08Dh<  Dh{7t tDh@@<@T 08Dh<  Dh{7t tDh@@<@TU Dht`ADhDhDh$h DhDhDhADhDhDh~A.DhDhDh`hpADhDhDhADhDhDhwADhDhDhADhDhDhADhDhDhADhDhDhmD@"DhDhDh (08@HPX`hpx$DhDhDh08@HPX`hpxN$>DhDhDhK$=DhDhDhM$XDhDhDh (08@HPXFADhDhDhCDhDhDhADhDhDhADhDhDh!DhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh!DhDhDh4!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh B!DhDhDh B!DhDhDh!DhDhDh"!DhDhDh"!DhDhDh"aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh!DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh?\!DhDhDh>\!DhDhDh=\!DhDhDh<\!DhDhDh;\!DhDhDh:\!DhDhDh9\!DhDhDh8\!DhDhDh?\!DhDhDh>\!DhDhDh=\!DhDhDh<\!DhDhDh;\!DhDhDh:\!DhDhDh9\!DhDhDh8\!DhDhDh:\!DhDhDh7\!DhDhDh6\!DhDhDh5\!DhDhDh4\!DhDhDh3\!DhDhDh2\!DhDhDh1\!DhDhDh0\!DhDhDh7\!DhDhDh6\!DhDhDh5\!DhDhDh4\!DhDhDh3\!DhDhDh2\!DhDhDh1\!DhDhDh0\!DhDhDh2\!DhDhDh/\!DhDhDh.\!DhDhDh-\!DhDhDh,\!DhDhDh+\!DhDhDh*\!DhDhDh)\!DhDhDh(\!DhDhDh/\!DhDhDh.\!DhDhDh-\!DhDhDh,\!DhDhDh+\!DhDhDh*\!DhDhDh)\!DhDhDh(\!DhDhDh*\!DhDhDh'\!DhDhDh&\!DhDhDh%\!DhDhDh$\!DhDhDh#\!DhDhDh"\!DhDhDh!\!DhDhDh \!DhDhDh'\!DhDhDh&\!DhDhDh%\!DhDhDh$\!DhDhDh#\!DhDhDh"\!DhDhDh!\!DhDhDh \!DhDhDh"\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh \!DhDhDh\!DhDhDh \!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh\!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh !DhDhDh!DhDhDh !DhDhDh!DhDhDh!DhDhDh$!DhDhDh4!DhDhDh!DhDhDh!DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh !DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDh!DhDhDhaDhDhDhaDhDhDh!DhDhDh!DhDhDh!DhDhDhaDhDhDh aDhDhDhaDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDh?\aDhDhDh>\aDhDhDh=\aDhDhDh<\aDhDhDh;\aDhDhDh:\aDhDhDh9\aDhDhDh8\aDhDhDh?\aDhDhDh>\aDhDhDh=\aDhDhDh<\aDhDhDh;\aDhDhDh:\aDhDhDh9\aDhDhDh8\aDhDhDh:\aDhDhDh7\aDhDhDh6\aDhDhDh5\aDhDhDh4\aDhDhDh3\aDhDhDh2\aDhDhDh1\aDhDhDh0\aDhDhDh7\aDhDhDh6\aDhDhDh5\aDhDhDh4\aDhDhDh3\aDhDhDh2\aDhDhDh1\aDhDhDh0\aDhDhDh2\aDhDhDh/\aDhDhDh.\aDhDhDh-\aDhDhDh,\aDhDhDh+\aDhDhDh*\aDhDhDh)\aDhDhDh(\aDhDhDh/\aDhDhDh.\aDhDhDh-\aDhDhDh,\aDhDhDh+\aDhDhDh*\aDhDhDh)\aDhDhDh(\aDhDhDh*\aDhDhDh'\aDhDhDh&\aDhDhDh%\aDhDhDh$\aDhDhDh#\aDhDhDh"\aDhDhDh!\aDhDhDh \aDhDhDh'\aDhDhDh&\aDhDhDh%\aDhDhDh$\aDhDhDh#\aDhDhDh"\aDhDhDh!\aDhDhDh \aDhDhDh"\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh \aDhDhDh\aDhDhDh \aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\aDhDhDh\ !DhDhDhi!DhDhDh!DhDhDh!DhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDh aDhDhDhaDhDhDh aDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh!DhDhDh!DhDhDhaDhDhDhaDhDhDh!DhDhDh!DhDhDh!DhDhDh B!DhDhDh B!DhDhDh!DhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDhaDhDhDh!DhDhDh!DhDhDhaDhDhDh aDhDhDhaDhDhDh aDhDhDhaDhDhDhaDhDhDhDhDhDhbpf!DhDhDh $DhDhDhx$DhDhDh^$>DhDhDh{$DhDhDh$sDhDhDh$DhDhDhADhDhDhm DhDhDh$DhDhDh $DhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhADhDhDhq߾h$gф/:D!bF(0?dCRڛGԋebs<{g=4e߼HRI8 Fcv_={~!]b<6Dz7fRŎ][!|vD`O;?.~%COx6P)'UZ>(JBa$pם0t5gk>ۿ1~c5v[Kyt `!sϬ27 )3)s;1~|8;s}*^B4{ (G ]hXM^610cqMnHFTq:}T9{\yey~1oZHn:(ulQjal_U!l /+PP DpZhr2,e6R{Q}uK7y-Zݿ$H^%QTFH)%-`R t^KfPN4UY .X]Vj[t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4p"4 (^#!^#!1!a%a% LL1!a%a%NetBSDAPaX NetBSDearmv6hf4p@-D0D 0@`Qp(@P`F`F&a03/T@pp$`$A-`0`` 0PpU(pGpG@Pq`P03/T@0US $\@-lPQMK \!\1 P`0 0R0819  0S  /S 0S10S8 0p ZpG2 pG0@3'q1*03/T@Y 6p20pWH2H0@3(1*03/X@ $d 0 P0 0Pc~$dp_$D_$.%(@-t ttPl@dphP Ll`POU P w@ꪇP*&TH/(T   P R)&2&P$2&SH0`  BR` pRp RaX Xp/)&)&@-pr0 `P*& 000/46&pC-؀-`P p0M @3,{ A (-, A{{z`P$0  ЍpY@46&%8P*&@- M @00@   P  Ѝ_A- l1X0Zp 03 @P 1r0S@ ((@0X;0% P-  U @0`V/PrX`! p r0-S k@|@PhP ULP@ U(p0SX %lvH6&O-6M@T  s@P Ѝ  'p` &@5Xp0S 5%0 0 |5X 0S_d50S&<0fpP(@0SN50S0Gp pPJ400<T$尠E00CS0 f+Pᐔ Pp  PYU 0 P00CS0 N+0 X80: S  + +pP p Qt  X0 0, 0X3($05x000 00 Q00SD 0 0 `{Wp8  p 0Y 1(#00 H A 0P c@P㴂~ tY0S@zcK"I 0R 0[0YY]820#0 p00 R0S -100S  0 7( Pʨ0S;$a@T c@P@0 ?oR20S 0  H1 0R0gP( @P @0S "P0S %P XTy P0Rt00!P X6&%$86&@6&D6&<6&T6&SP6&P*&)&L6&46&qF&d6&h6&0@-MM@P  p  ;0U$C dP TTۍЍ08 P ,(0P X%ΌٌL6&Q@-@ TP DDl,P $ 0P@%ΌL6&Q@-@ XP HHM0"P $ 0P@%ΌL6&@-o0 P*&0$/8G'0$/F'@-!%뀍@-%떍@-%뭍@-%Íj@-1   0Q 0 Ѝ؍0G'@-1   0B 0 ЍF'@-1   03 0 Ѝ8G'@-0   0$ 0 ЍxG'@-0   000 Ѝ䇳F'8G'<00/@-0   00 ЍF'F'<00/@-0   00 ЍF')8G'@-1  ,0  0cC Ѝ:G' 0@- 00 $0P@N.ЍF%,0C-`A!圁!ᘑMpW0 |! R0B=00 B  T埾0L 8 R<B 8!4100!0Ѝ@PP 8$=_P 0p00S  0 P)0P      0 3/R ! 7000@080L$D0F'F'8G'|f #=ێ G'Q~(0p@-|@PtP00 R 0p800 p0  B0Sqs G'8G'F'0 0 0 /8G'F'@- #g $@-@- #g $@-@-80M@0(@3/P $ #H08 : S( 0h 3/P   00 0Ѝ00 0 1/qpn0S 00$m8@@-@RPЍ@: fPЍp@-(`Vp80@  03/PP`#8003/(Ppo@-@P`P *80 (0(3/@m P mPЍpxF'O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A T 000+ xpt| f  ЍO0 P % pHp 81/qp4 " ?P p 4 "em0S4 tp0 0 0 0 "f0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0ʼ004 8pX  FЍxF'E xF'$ҏR/ R 0 0 /\\CC  B0R00!/0"SSS S S S S SSS SS SS SSAQA0/C-lBM0 0  P0 0  0 N $0 !(0Ÿ}?LB?@PN3c` D0S%H0}??@3c`_`RP0!!!! d 4 !`P4f4 " BXX P!d4|4f4 " B   !d4i4e4 # B  d4V4e4 ~/0e8p<@0! e` d @494e4 aЍ0G'MbF'`YG ϐU@-@RG-A `00P4 2#&P8P (01/qp $ b!㰀娐pUЍ0S0C080 $0(3/P 0 `V`PE@:!0  Z  $08G'$F'% @-TAM P04!2#!8 P0(5/qp$ !P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080 p0h( 3/pLp #U0* 0P/`RP `F'$m@-@L M 0Q   0    ЍG'F{O-鬗IM0@SpM. 8S+ #='0K0S( 000 T" ! @!x040# #|0 & %IލЍ&jV 0 W0 pS 0E0VS06  S  S $0S0 600000Sp60 0`60 00 L6RH~d 0Rr0C0C00Q0 0S- ,B< 3 5o40P` U(  , ( ,0S$0`"000,0040 0S $0S# h5h%hhKh(0SX%0 P%00   0 050,0S 5 %0 0[4$pWJ / W 805* d 80c 80Pc d 80$cp004 0\ 0000 0@"D#@ 0@ p ' d됕(0X%,0吃( d$0吳v'P00S0 ,0S#$PU $0 !40S `\ /\ * d0 $rc 0t d$0#6# ( 0d$p[XR3 0 !0( , !w0$  !p004 0P 0000@0 D"491,0S 0`QP K0O0W80= / W P&* .d 0 c 0<P c d 0 $c008000< 08 @ d5<0(0X%,0吃( c$03!PaP P 0倱SOt  h!S@@@@P4f8 40000CS010 S aPT 0@@00S _ Pg P @ P 0@0CS0`00@  dCI'lI'J')&2(I'I'P*&XI'ILp@-Pd`d@000 PPPP10P0CS0p(00 pI'(I'XI'G-@0` V V~Ѝp$PP 0崀 尐R`00@`0SuP 0S 0 i0  0?o2S @`tPI'`dI'pI'`I'P `00CS`0p S00 P0S X0X /X)&O-p`㴢B崲0S@ CpPG0`F [stlV000PXe4 09,00C0Cf 100CS010:uPU 0P1` 00CS00 P U Rp0V00Pd  00C0S"10 00CS000 U0P 0@ d_ | V 0 00 0 @00S 0S YIPL'DI'I'P*&XI'pI'zO-XRML`000002000 20S z@0r`0#0P 00%0J?oT20SS SR9 א0S 0E  0 LP000CS0l10 Ѝ XS R0P  BR   @0S 0 0 0S  R Z@T    0S Z dl傐T  Z    00 00S@@DI'pI'hI'PL'lI'I'P*&XI'A-0P!S`P@c 0?pP0!S P ch 0HHHR<00S ,$0@GP*&̖,L'lI'A-P@lp`V0S P c7, ($kɳ@PL'P*&O-`@ ؀P0S vp0 T T R R k0pPP Ѝ PP P   P Pp@PL'hI'pI'DI'A-p0`!SPP@"c 0A @UP PP0!S P c 0HH"H<00S ,UpGP4P*&,L'O-@P b 00CS0p0@h b  0`001 pUpP@0 儱p W1pQpTP0PP00QPbY8 , 00CS010 x 0P0CS000x0 S0 0 @ X 000 0 P0 `0U0 0T p 0 )&J',P*&7I'TL'I'XI'pI'LL'O-PpP0 SPEUP ЍE P 0C0 X1 Ub000P'b G 00C0S 20  60 0CS0L200 ` Z0 P CPE P 000S S  `V$ V000P ax tp 00C00 0CS0@100 0`X 0PFP 0Z0 CPF V&P嬀VP0PP00AP aIt pl} 00C0m0 P0CS0<00jl00`6I'DI'I'P*&XI'J'2O-P@`p P`T  0PS ؍P 0@^S00\P0S @\[ \QP X0 @P+0P00I%N)&& W@-T @000 <P 0S( 0C00S 0C0 ЍXI'ht@%L0 R QQP0R/@- XI'*[ G-QpP@ `V 0S0S  @Ѝ0S V 0S@@T0S VT@T0S @PP 0S 0 0 P 0SXI'`G-@P tp0S)`&PUP 0 @P @P*[ XI'X0000@-@a 40aA R    0/1&iXI'40000 01h@-B 1&XI'iG-R肟@p0 0S0 "3( 0`?VJV$ V00 0 0S0 =D *` \o1@s4 `0"S04 @pp FQvhPRRR0RRRRRRRhPRhP0RTRQQQQQQQQQQRRRRRTR^V ^V-Vi @ 0s000@^V-V00@R$_0 01@s@_0"SR 0.V@0 @R T /Fo@P0 R00R  G@PR 00;V0 00 W@| T0SwXI'1&I'*[ 0@-@00 005P 0S  S   0 0 0 ,Q;Q S  S   Pp000;SXI' p@-PD0QS@@R0p`VP 0CXI'p@-Pk@P 9_, (Y$ p 00P*&Q 0Q\S@-Ao/`@-0S*  0@000S! P{VpP XPP ,@P p0 S</R/     0 XI'4]( Q 0@30/@-XI'00@- R 0C30XI'A-ppA1SPS a00S S P4!`0`00`0S00 S@P0.S0 S 0P00`P 00CS0#0 m W  U0100CS00 pPXI')&G-AP pRpGWR0`0`0` 001S 0100CS0H89 _P00CS0' 0S  OP 0Sp`0 0`0R00 00C0p00  %`pXI'G-P4Ap  QR`X0A EP0A0S6PC000P 00CS0'0  W  pP 0圑0CS00PU`*?0`XI'G-A 0`0P0 P 00CS0-0 o& 0FSp 1S 0PEP0Cp00100CS0XI'O-LB`0pSP UA!0SR0XPPP00PD 0Q0CS00KM!1  P[00`F`0&P/  C P) 0100CS0G'(P; 0堑0 S, S  P\ 00CS00  0堑0CS00  [0P{XI'P*&A-A`qW ڬQ1ECe R0 0 C0|00NPP\V 00CS00 v 0q0CSQ00 \R `R `XI'P*&0O-D0!10Pp Ѝ0S/  $SPPPPPM\\ XmT400CS00   _0Q0CS00! P1̃أؓ 0 S)"Rʜc0U```00P 0b0CS00 [ 1Q !@o!S/ %S !`V U 00 0P 0帱0CS000!000\Q00`PR# !RU``0``00\Pc 0a0CS00jl0` 1 1S 0S11a0S S`l  /P6 0a0CS00=?10`! S:`Fp00  1S pTa0S `10 BRpE` S`l   P 0a0CS00   XI'P*& K'L( Q 0@30/@-GXI'`01S @-0@!S @&VP /VKP /XI'^7@-A00 S1 RUVʐ0\00PBZ  00CS00- 000 @ R, R xP Ѝ00!S HP v0 Sڰ 0R0CS0000 0 Q  tP   XI'1&P*&Ǘؗ?A-O0 R ,Sp WR ! GrYQYYRV4|}}}}}}}}}}}}}}}}}}}}}}}}}}}{}}}}}}}j}l n}}}}}}}lrr}}}}l(y}}}}}}}}} i}i(jj llmnoo ppq}qrdsltwxl(yz}zPP00 nR pR lR 00 S  PP1S )PPPP0 nR pR lR 00 S1S 1PP0PPPP0 nR pR lR 00 S1S P!S00P0PP!R "R  RP 000@8 `PP 0 nR* pR# lR$ 00 S~Pt "PPPು0S!S  D0S 1Sk aP0PPvPcO 010<+08+0[ R000@ ?PO 0!SP ;P00 nR pR lR 00 S+0S ~D a}t1PPQUt P#G@ouG`GooPbVWP101 P00 nR pR lR 00 S PP0SPNʈ0 nR pR lR 00 St)0S hh P0PP0SP.ʈ0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Sz1SrP ~P0PP  PP` 0 nR pR lR 00 SV_P0PPBP T0nQ pQ lQ 00 S 7PPB@ 0  !P4p PP/0S `Vn0VkV PPPVPUXp 0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SPʈ0 nR pR lR 00 S2S040S402P0PP0S 0l0Cs0S 030 S1S 2SqW P000@ 0S0 0m`PP| 0 nR- pR& lR' 00 S`1SX!0R!S B0S1S dc hPUU 0S0Q 1OP0PPP`s0 gRG  R7 0 B R)W `n@p?W0"S; b(pR1 rR1 U0 R 0 S\ 0U0b0 * `P'00CS0 0 P00 S2S 02P00PP2P02 P P U0b200CS00U.4VP!2R002 0nSS pSH lSL PP0 nRL pRE lRF 00 S1S"!2R000#2 0# 01&XI'% %.B\L'P*&*[ ^s@-`8L' K'4I'%;20 2 2020P0PPKP^p PPY0S) `V0V PpPӔʈ0 nR pR lR 00 S11S)67P0PP0SPӆʈ0 nR pR lR 00 S}P0PP QR000P0P00@j `P 00 00 P0 nR+ pR$ lR% 00 S!0R!S d1A0S1So bWW P0S0P0PP1S 2SqXP0S 0l0Cs0S 030 S8 P0010CS 0nQ( pQ! lQ" 00 S3 00SF{U` `S@poU0"SY`x 0  PP00 nR pR lR 00 SQ0pS ZPP0SPPN0 nR pR lR 00 S2P p2S7P0PPP&  \-@- 00 ЍЍ/'\L'-0^S0]S0]S S]S[S .0Ls0S^30   Q  ]Q RoG-鐁`P@0 SS&tPD(!,RF`a`qU`0``00eP,Tm( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a ~S L0 0@S G 0mI'\L'I'P*&XI'pI'p@- !0 P< P@01SE0p0S S u`Pp@0P 00SyP0P00 rP l0X 000Q[P0(T0 ,H(I'`\L'+DL'HL''P*&O-|b|B0 %Q + PXrX00 SM Y< U 000P "$S 00CS010  Q0R0 00CS0000 S0&0Q@0C0RapU`0``00NP 0A0CS000 0P \S0P 0 S 0t00S|hhP 000S Sq 0`00 PkI'M'I'XI'P*&J'J')&0A-P0 0p@ W 0 `BP! 0 R00R000 1BQES@ @P@p:S0"S,$@gR000I'M'O-@SMpcȳ00 0GS TcsT`0``00PS` \(X00C0+0&SK BR D R: Y J @p RPR 00C0S @Ѝh20    BR   0 \SH 1B\C00 BR?ˆr L\ DR-WppB@ \ p .P R4D @<h00C0 AQ 0 T0 Tpppp  Pu p BR   @W0 `0CS0(00oq 0 bM'I'XI'P*&O-M!@"0P 0k $40S 0 0 00 0(0>pPP `Cȳ0 S pSP(0Y01 Y  $ 嘿P$Q\ X T  B R+<30 #   BR 200S 0 0 P0 0(PP0 ߍ00Y0 Y L $ HP$  BR 200S 0  P P004 Q' 0 p1pG Y<||Z  PD1 bQ4 0,I00C0StX 000 "2 0 0(0vP< 00CS000\^W 004 00 |vP00S 0  P< 0 X capI'M'I'P*&XI'?O-pᬡA0M0CQ` 01 00C S00`NlЍ~  0P5 <P!` 00000`P00CS000  [  Q0S00CS0x00` P  P`I'lI'I'dI'`M'XI'O-RB0M00bsp 0sqЍؑ0ЁS 1    000P@ 0.#⩟ɐ Y Fp10S 0p0000000CS0C01; 0 \" \ 0 0#0L\ 0C000@00000000 0C LN 5hI' %lI'ZM'I'J'J'XI'A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT c@ 0M'lI' %hI'G-@p0 PR` 0 PY(S%T0  d P e0 ,(-M'P*&@-|O0 jP*&O-dGM0PS@pM$Q403/P 0: SwO00W +: P9:kO?0(P0: S 0SP0: S 0S 0S 0/S&P3P0SLJP( P 0p#8 PN+z:0P 0#P]']P  v/PP/PPppJP! 0S0S r@XG X00CS0kpl Pph pYWr TTd{\H Z0Sh0S0c ?o2500i?G YU.0.0 MG=0JjPT.0.0 MG=0INXP804@pl0l 0 0  L00S   $P*&O( @N'DN'N'$0\ 0S HN'O( $0L0S/0 0 0/@-00 SM 4 $;ppchdЍ\0\@ X0R@P0 B ?FB 0Ѝ@OM'M'M'F3CN''N'P `00CS`0p S00 P0S X0X /X)&: S@-  S  S/ I* S  S%|@=A-x1`@pTXPM !X@P10S D10S- 010'p  @0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?A 0T00S M'UM'M'F3@N'DN'P,pPX e) 04 Rl$ pH 0! 0 X 00CS0Rp YX 0 P  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (0S  tPP X0: S QP8P P X0: SPX pPᅱb0S 㝛 ᄲ l P= 7Pjw 8 R $[P T0 ¯S ,!0 0  A! A ({{ z0 bp.<00@0 mP <p ljP C0S  X0;X0X^P YP C0-S  PV<pPp0S  DPpY@lN'3P*&)&Fh' ?$8Üќs@-@ `PP'0P UЍpU \@0 P4ol@;(%J4Y7A-A~M0pSM P0` 0`P Cp! p~,`P C@!1P~܍Ѝ0 0`PB ~,CPPB ~,:P `0 0PBx W KQ \10 00PB0$ \1(%mhڝ300CS0 g0 /O- U`DMp 000D$000 0000SPPV"4`0p Q 30Sa4PZ|>PZeB0`$ 1000 0K4$PQB0$0V 0030p Q  #P0 02B0#0V0030d#PB0X#0L3000DЍp(0: S W0 S" P 000 S|2"00"00 0R  Rz2`2Vn `i S0% 00 0&8qpA0S 0㐐唠0 0p) W W)2`V%  ?%; 10 0R  S0R 0!CQ:++R:0'WW~Ta0@ 0 :T04[@T ;0W ` W00l W~,0 ~l0`Z BP* BP*Q*S  Q T0`(%N'`Q't%4%'N'`<%zE%Ǟm8@/( .(%N'@z'@-,BPU` V0bP$00 p?W0 pGWhPhm@0 SV.00P ЍP#ڀ;;S 00 060Q P?OPppD1$p0pQ Q(% 00$0SP ( ..@0S00(@0ES00!@0S @0ES $0Sh.@0S @0S @0SPU @(0( .(%N'ʟ 'L)t!0SX@-dQM0S T100CSD4.Ѝ0S0SS/ 0070S S00.S0S0@pT0pS 0L6Qo 09p T05Q00L 0wP000S$ʲ/N'(%t%mG-P`0 P ,p@P"ڴAQ"5Q 0Q P 05Qa?D .ЍP 0S(%N'G@-xaPMP d1@0S2 SU@D;00U0pp0 50Q+? -Ѝ P0S(0S 0g5Q?  Pڌ0U 0?n8  dQ-0 P 0P> 0, -(%N'wӡ@z'mO-rM,M R(`RX0E@FPG0 0S 0 00 S(0S `  P"L2p00 80,"JJ?00"Tn" ?܍,ЍT ܁0S =! !!0`#8 10St1pl1 0070,!J~J?04!00(q0(`01娀(0 C0Jh b00 $0 7 0 h O0| `G7 nTt%P*&N' 'Xz'>I`'H hU'`Q'?Hz'(%C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S R1 / 0S pP (0: S0 0 p10S10S P=JP 0 0 0S q4Jj 1 /00 0S000p000 S(00(000 P@0S 000S x08P 0+0t06P 0X/(%`Q'N'|''x'''ڢN't%'  'Xz'Hz'A-MM, Pf=# ,G PZ=",RB$0`SF 0`CĂ0S2o+pT8P} O8Px 0 u S( .p[+lY+h2Lr0`0CSXXP+M+HK+DI+@G+<U+P,(8P000 06+ 2 `ލЍ,+0S  R  sS SS YSRP+yS+$qx +l+<+P,7P 0S8 47P( c61P *0S(*PP 6P0000**'#=(%N'D''[<%4%t%F!l E ߤx'֣ *^ܥ Lk600@-@FpQp`x%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S *@DT  A"0d#0UPTP*PV0S pr*@X`ꓢ" @2/PL0 !ᓢ#, 08h%\%`O't%|aO'Q 'O-Q0@`p@F d[ PppWPH8* ЍPT10S  '*p@ 0 $03/P$ 0 R T @ A$"  80 3/PuP\\00Sd \) Q < 02/P " " '`O't%ǦhU'aO'6@-AMP/MU=@P+ p`pP/0P0 Uh0h *AލЍT0_"j6/0P0 0@0 `*lU'd`O'x00CS0 0 /0O-S$M00`Y P$ЍP0,03/P00嗨L30S, 0P! 0p 0P0U00pPF0P0 000/`F p 100`00Q Q P0 S  PF8z'T%' 'p@-0@0PpP E10Pp@|8z'T%A-`PlplU@0@DTj@P U@0 B100`PE8z'T%G-P`ကpU0@0@DTG@PğU 0@0 00@UP0 `8z'T%G-pM =@ P`1T10S һP1:8 ! U00 J(; 5! BR P#?U0 3P0PU0o0⢻PJ18h @D 0RP J(L J180 Z `ލ'8z'T%߫Ϋ Q/p@-JTUPP10P > PpCP14$ 2  0 40p,Op'0@-PM@ 9Ph00S Ѝ0 $ R\ 04 0R\ '`0@-MP @PЍ000S0: SxT,PNPU 610D P 0&#'10 'E 'O0@-M@, 0000S# Q0S 10S ȺP'0S% X0 "?A3c000S&!h0 "?A3c0  P 00NS 00X Ѝ000< 0S ḹpꈋ%%MbƬp@-@P`᣺P p aP $0"00 Yp'@-!@PP 0"00@ D'O-P0`/Sp/M/ @P7 EP. mp /00 ,P&  P!00S   P  P0 Dx Ѝ'G-@P 00/S (QP 00Q  G司ZZP&00 0`0S \`뤀夐p0  uP 00S@$<jP@D0! 40 @{Dp', ''A-M`P@p᤹P5(10S Ѝ 0RP  0RP 0: S*P θP/0 ]cPW KP / P W0 @?'E ҭ0@-:(4@: SM=0P - \ 00[ P0 6p 0: S ,Ѝ000  t:P/  0 fA-pQ?ZdV`PF/0H!@1@0S/0(DS7 (1!0 0 =  "4S p᷷P/p0 Ǹ嘝0 40Ѝ@$<@0(DS PL(DPL(DP 00 0,''%%,p'O-J#Q30` P (tJM Mp40CS񟗄 3)P x30S ₸P0: S* XP2,3,0(So0S| (4S~ 0S20S 4m0C?o2 000! "p"p.0 ",X.Z/ Z\20S0 0 D"J>0@Pz=0 Cz Jލ Ѝ  ܶ Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(404)Pz ķP#ٷP. 0 `0 + G`\ QX00O0S0(4 008 00''''%%C'lĮ/O-p@M W 0DQ 0S08 0<000SPP0C080pG0S 0`S : 08 0 x! x3  P< -@0  0R X2@ @?#Q*-@0 :0嘰 R ,P` dЍTT ꥙  ` `@ܮP'L'X'T'Rs@-Ѝp@ 0@`P#QR-08  兵PD-0 '0@-@MPP᭵00800S =J"Ѝ0'G-`QM MJP㠔@ Y #p nP 0p 0PP=! SR J(Pݍ Ѝ˶PJ,8 = $ HL0RP J(L0 00+#QJ,8 PT)>_G- QP 000aq@T+00CS0pT0 0S0T@ 0 S@ 0 P 0S@ 0S0 0 S P ''%)& 0 0 S00@-@R00000S0@000S `员P LP40P'''' y'p@-PP 0S|p `h@P` %@P0/S000000f PR @@@p訯ï'h0 RX R  H R/< R/ $R/Q/ ''''l0A-0S X0XP@0P`PpT R S: 0@''P*&C-b@ 0,MS0S.,Ѝ0 0P50C S="8##8#h"#8#8#,#,#t20S 0X0 00!P! " PPP  0!$7$!2 0!0 㓝 Iz X By*(4 : S>  S8  S%  S04 0L! 0 J $!1k&P6 S  S0  S04=! 0400S -ЁЂ ;Ѓ"040+04 ℳP(+0P 00   0 P''5Qm 'p@-8M@  D 0`P`tU`$ $ @ 08P8ЍpA-t1hM0@S T hЍA`Z(ę="(<p@1WpP0 0000p084 40CSH$0r"60"$۸0( ָ4 CR+x ͸hЍB>'PĸS+<  z|'FðP հΰA@-@XM="p:(c0 XЍݰ7@-@PppP Q Ѝ0 0 V Ѝ0@V0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qqp@-PP,0CQ@0#S : P$B0WN%R0CBSB 3b 30(PpA0NQC S*p P@-*0S ^*00 S R( \000Cs R@30 ? SR@*:@ 00 Cr@ T \A Cr@T2  0a0Cs R"  p@-0C@0 PR#S : $B \N%R02W" 0C@Q `@ 07(PpANQ0 C S*80P @-  //'A-@8q8`Q PC-PQPUPQ S AkAr:UP0 ddG? 0:S@ 0S000 @-'\#&!P*&8/$s@- `> 0P PQ10*@PЍp0S @mR! bR kR% + 0*S xS SwR! /QP0@P0$+* &!PP@P0PA- 0S`PpP Д0P# X p R 000R p0000S ,P0=0@PQ'es@-@`P0C30 0  R R00PᏔ@P0@( 0ЍpPE U'00'@-  TkP*&0 Rr @-/t%@-4@4T(T TTOP*&,ٲO-px B@ K\Pp`(0, [/00 `? qO-lM/P)oPtr@P p`0p/小0/ `0@ ?/@|p??A0s S  R`?`/0X CRSE <zP񟗳6 51 56 5 5 5 5 57 57667 5 5 5 5 7 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 566 5 566 566 5 5 5 5 5 5 5 5 515 5 5 5 555H6 5 5 5 5,7T6 5 515 5d6 5l6 56 5 5 5 5 5 5 5<4x4 544 54 54444 55@5t5|555|5555 55`N>4=P $,PMP>@J >0 -R,Q0 00 0;= =, 4<=????????????????8CLC?CC?CD???,D@D@DPD\D???lDDD?DDD??????>>?(?? 2@ 9`3@ <2 3 T2 @ .83" * 2@@ % 2@  2L 2LP 20A00㬁堑 RK aR eBp Q Pl@@@@@@@@@@@@ !00000 00K1]PJ `1J  P1I  0I Hꈁ 0 010L0q1Pd H'''D'\%\#&t%P*&')&_ VP:4 C/o"SQ  S 0 BP  0 C 0C0 0A0 B!"00@1&A-Q@pW :<00S {ۇه@ ''%%%7@-@@Q@A@P0!!\S  q  190@L Ѝ0 @G-鸑M@TY `P!ApT 0S @T @@PP 0P0 0ZQC ,P5]" 0`! A*00!C!QP  ލ P    P] $0 P  0D nH(   'G% +J1G- pWP `WY @ ̄@P P` PAt@T P`P P$ 'ld0A- @T`pH PATkP @ 'Qqp@-@@,0C\P \A@ \ @AAA A@AP:0Q00^A0@00BP0B 03b 30@pp0 S  0 - R 0R$R:/A-0A R0.p0X!MPPaM\ 0  C0/S' 0 !  P3ڍЍ *R.@ ?R 0pC @@\@0@C0@0 C0 0 Ȥ P 0` T⽤ P 04 $Ɽ 1& p@-`0Sp@e\ 1e #@ P000p 0@- 900S  /@'0-h0^0 SQ0Q00P@' Q#p@-0PSp  lCP`0 r   H @Tp /}%1A-`p娀u@PP%P@P 0 \YH0@ LT00CS0 $ 0 ht%r@'M-`PPЍ8":0J840K0CS 2  `70 01 .  dd (l] <tX @ |qp}  H=/ 0$  4 =C@2Q! 1Q) ($5Q/^)040)($84K ARKQ  $ q++  @ 04(4 :(40/S0004084(49)($ q++@k$L' T'C-j4@0CEMS*hxxxxxxxxx30SPP EߍJ(~J(J(J( J(S20d 0@00CS100 0=P  0 R ⨁0≎ᩑC  S@ 3. b 30w  J(L0Pu[[P001  Є=Ђ0(p ZP0<x SP0@ LP00  0 CPP t00 08P` &PJAPP P >@'Ba~'// Qp@-(0PS$ l` [@P|bt 0000X0 `%V0  @p}@'TO-P`P Ѝ#:0J84YqW V#j/00p0K0CSt3l IPk0<00H3  a  d ( |qp  }? $004000JH1P tp@0 B(1<+P lb<0 㓍 H K06S 0S 3 CRUpp,gSy K CRZ0 40r;;000(4 9 xS!04(4:(404(49(408400C /Q000Q($4S::  $ R(4 @0&"*4*0p000 02S($0 *4($040)($84  R KS 0 0 40r;;00 00KS8  0( $ L'T'~@'yO-z4@SM- S `cV:60VS0d`F`0PS/S`S 0EoᨂSXA 0CS4h'G'G -P7@- 000@ 0 0 0 P0S xa00l0l h^ X]TD 8R0 ya Ѝ0@Ѝ/''|'x')&'P*&-@- <6cP*&@-M@P@ލ0/S[Pp[P ᯚp P⪚p 0RP 0RP $tE 000/p'@- xP*&A-q`@ MT ttlAPD00CS0?@@P hDP0P 0@00aT8@pt(A-ppP`0006@ 60 06000@0CS000SA'|'p@-P`@T & PV 0@p@@-PG-Q=0@T: 0S V@0 Y =-P P0 V VuX00CS00 [V 0 0 0{@p`t(p%t%C-3sPc 0 p3@0! 0  0004 B @3 3 00`Dd5蒟 ~ 0@ Ѝ/R@R R@ k&@ B&Q؜ĝt̝T@0=S0  "?R 9R:BPꜛ< |R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R'0o  -R(0h )d%b#`0 ]1&\'m P'X'D'0@- @')0s@-0P`0Z0`0@S P 0R@P@   P@ 0S00S 0ST P000 R  Ѝp@'l (d%I2 m Z@-L ^꼠Ԡh<P,\ TL @@~$ \1#P?  B 0b0?  b0 0RQQQP0R0R0P0QPQP !~O-`pu딠P @%RB &R X*6! 2[00 @P@ P@ Ѝ@'@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F4P@$ P@ⱘ W@'q[p@-@P0)Sp@'O-@`p04MTV TY T( T) #T! @$TU "T 0@#SP  ! 4Ѝ'0DSYG x@W'0I @S 0 0@SP'Y00p0p!C mW! uz! o0  @@P! b0  @PYWO'T@@p@P, @  @'q[O-p`M8P谟蠟6!@ 20 R@ 0DS U# 0 ^ 00S^^ :U 00SY` p PU @ 0DS Ѝ@'60S >0S$0S 00D0$ 01C 0d>0S$0S ph@DnT@ xP H047S 7S) >0S*00S5 -0000,0(00 0p(0P =&0S(7S%00S 0 0Sd= 8  ,=, |p@ P 0 ,= M8 = <, R , ,( Z%P000<<0S @A @X$ 0 $ ` 0bh<<<91Gh@T: =p<P+`P H00CS00 eG 0PppH@T4`@T @ [00CS00 JG 0 H@`@T0Hk PU#00CS00 .G 0 :G00CS00 G 0  %BP @P07:0P xPP@HPP: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP0077S 0Cs0S0TT)SS B70s0SBP0 Q AqQ8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  p8 @  (00(00@070040 8<000L۔P7 7H 00R}0( ?$0SP007pGQhJ 0'000 000 7 0|'0x'00$(0h7  10103/$0 7 G474' 6,' EL0S L8 6 6 @ R] 4 0  X $E&@00CS0 +ns`60S JmP x60S%,0FS5T6$5D h0 L5,,0( F0000+,0( ?#0hE$0(0S,, $ \5 d50S $5,0S p埅t<%050S 0 @0 AP0ET>0 0<0$0 0C0 000|D000t4 8\XQ00CS0D40S P) `40So*T0SXQLK8 3 3 3 \ 4 03˓CU*00<p3 0 0S '|0R#C#0 0 3 Bxh L00S0\|P0"0C0000QK8 2C  |2  t2 \ 2 *00 0`2 T0S@"00CS0 2 R   01D0S$mߍ;10S ,0,!SS{1 08 L0H@*Kq10@0@0S P1 @0S1 41$ @0S  1@0sH1 R#0S01   B  @0S @0S7S@<; 0 00S R;X@,0S0  =,0Sh@P3 \F 0,0 0H 0 (p ('l (l (d%0DS'H A- @PM`Rk( 1000  8p!XZU hBB Q PBLBQ8B 00AS 00CS00 FB 0* 00CS00 6B 0 ЍQ PBB000uM h00CS0 TqBoBHD00S Y,y ($t%'|'p@-P@@Pp 0S%SppP @Ds p@-P8@Pp 0R_Pp@r - @0@ R0S P P\ 0%'G-`P@唀0吐00|Up00CS0h00SG0S0 S 0S00gPPp''%|'A-`pP0@00 Q Q:R@ @:QR@P0SwppR %Rw@%Ppp0V:SP0@w@ ('%A-`P倀000|Vp00CS0T00SA0Sp00M*g@T`''|'0A-pPS R+`a@T"W p000I 0 @0 0 f00CS0H00S F`uP `@''|'p@-P$@Pp0P0@r @-L@000@00 f00CS000S@''|'O-PM/`@ 0sP @@@ (؁P000 0S 0S 000Ѝ#   P@ |BP @bPR R R R 0S 0   " R0""  " /R0 dpP>Z0 R"00ㄲ0  pPZ m P2 @ 08@00Q  0S/R10SZ #P %pP A0000S R  pJt#Pw R s R o( P0 * R; R 60@@D: P R  ID T@0000S R    BR =D R9 7 a (%'p%'`%|'O-@`pM&PP'0S*[ 000`0p0Sw|2!| S6hBi?01 P?PЍbPEUXH(08@HP00p`@[ Q V  0P!0X ZWYV M1 00 _0S& 0s1TP P*X 00SW0 0 S0 P 0S(DYT 0s P kF@Tt('t%%H' (%p@-`P0000S S@00J 00CS0$00S Ѝ0@Ѝ0'd%|'@-gP 0SJO-@p`SM%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩00S"" 0RPW>= >0 @ TW 8Lq> P 4j>>0 R @ T ЍY>x>A00CS00 = 0 00  x100/PXP!  SZZW Y;>8>T~PW.>W~`FeWxWtWq ~W 0` @ p`=`'tt(xj FQt% (_-JO- MLBLRp 0@0`V' VV:V  VF /V   BR 7` F R8888888$@! R  |a[  0000SHA@P  ~p[/R 0/S k0f}YP ЍY @TW 0 BR r R  BR    BR  7 2 `%L'X(d%]o A-(A0S 0PS0 0aqP0S00 P000b00CS00S P 0SRh`hp0P RP000b000CS00S L''|'P's@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `b@0S00S=STL00 <0 R0AD1U0 S 0ST%\(|(A-dp`0PS@  R Rb00PH @L'O-rPԂ0M00B00 00$`0040CS ?4`PP00CS0E0S00CS020S - H{P+J0S 000P{P a P ,10S 0EC0P0CS0X10S Ѝ000 @H[ [` V (QP PAP 0 SR BR r R  B ~  ` B `FAQV  RP PL'`%'X(|''o 1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xqQBP  `V' Q`:00pQ@  @% Y0S" SP P@P P DoQP @@` L' (P'%A-XPX@X`P0p00`0p0CS00S L''|'p@-P@` 0@ pL'@-QP`p0G0S `*00E@P`P P `R@ Ѝ0P@@0`SP0S0O-@ Y X0 S@0 S@HY" \YX0 S@0 x0s0S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x r SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x~^\| ]\Q000``S XSQ0 0 @ 0000xqQuS^ P[Sc:Q! P-Qe]Qb  \QQ PP$"`( yP1 0$0 $`( yP%H0;PP0 QPQ P !$ P80QP*0$0U`P b``0]S0 S 0p@Y(\PP  8QP4\SSPP0 SP0S  @p4Wm O- P@M0?S*S3 [S;0^S!S00x|\/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xpPS@0/SR"@ R0A$x r RP R  \$$ЍzPX9$P| 0U0/Sd 00EpP $0S/00E0S``0` xqQP 0S -V/00D0x r RP0  Q: 0 R /00@>0P .Z. B/o" R  P V0 W^$L'E ? |'0 q Q0@-0 @\C\0CC/x~^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S+ P W$$$ ^0$000CS0H00S V 0S ~0PL''|'p@-@ PTp 0@ @@L'G-p 0s0 S QA0P 耟`V `R`F@ V @S`` S =QQ RU  0P   Pm 0G-p@ Mo oF0P ㇗8a000e U00SW-00E@`PIPE@T Ѝ00CS0@X(O- R@@0`-SPM S! C RL LLLLLLL|?So @Sy 00C Sh0 0 \`0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P@7@p<(W@A0S 0g0CS00  P6FBЍ666+0000Q00S h6h pR\&TV(0S 0 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 R I 0  U  R~ȣ0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   9 ~ 3   0S q QAQ$AQ!   Q R V  BR + `w~  0 BR儡  BR  ~ ~  `K E~paQ 00S T 0s0 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00|(\(o X(L'i i d%P('T% (%O-$M000 Z0 0H'0=,W0Jp00 0 7'0` 0`F#ZGF@Y0/ 0p@P`6 Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG (A;9 6`0P`F 0 0S Z?0Y : @5% @AQ TK[Y0I Y@i ZD5  A0B F0  %T5  0 Z@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R&$#X%X%$$$$# & & & &%3  AQ AQ~00AQ v~p K R  BR ~0 0  BR T~0 0N @0RP[ 22 0AT[ @T 000S[@Zp  Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0 0000P  00B 0C 0000000T0 00`P 000l0 GR00#S00 B00S0p0 G0 B0[m$Ѝ|0s0S[0000p0SQm L'X (`%d%ZX(\(o l (rO-0M P0 4ԄдД00C0~Q 0 `p0 @Q Q!:Q =Q Q QX   L  BR  V PR AA KA P񟗇*'***'(\)()W 0S@ЍQ Q@Q =Rp( `p(``# P  BR  wp  w     BR u   u   BR    ( R 0BQRQ B  W `   BR  v v 0ASq Q AQ~@P   Q @~  @    }@P f i  ~Rf=Q0Sa 00 P   @ (%L'`%l (X(G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S"000`0`0CS0!0 0@p  Y 0  i 0  R 000/ 0p d%L'`%X(X%l (h' @-0@`%O-XAX`0$M`F;oP(0: S$ 0  mP  XPmJ0 00 md%TmL600CS0,00S Ѝ'N\a~|'A-h@Q0P0`0 PHpP<0`00CS000SA'x'%|'p@-`P@00P0%P wS 0S00pS0X 0000CS0p$00Spp@(%'x'|'0/%p@-@,`,P0SpSTp%'p@-P@0Sp%'p@-@Pp P0Ppظ$0@p% 0 R/ % @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0 (5rO %A-R0S20SP`AT p a$lpp $G$eQP *- 1N PpWlp l 0P (((l qP mpT  Qp,T l P lpT  PpT #00(((`(T( %>>d%P(0S/p@-@PP1PL1DP0a 0(00R 0S"00D05#0s  0C?o2^0SP㌝pP BTP p0C Ao PQP0S*00CS0p,00Spp@I(A5rO'h|'p@-@\P0P00 Q@00CS0p00Spp@&'|'O-@`LM R0 LЍO=,ؐY) PPY   0SPs  0 S S S PQ 00SЀ0S@LЍ0S}22 F!0R+  p  !R -  x",p 0 0H"+ |p0 sT NQ0pp+ 00CS0Y+0p W +㴱p^ Z 00CS0B+0 00CS06+0 | 00CS0*+0  Ѐ YZ +000u + #40  + +P S#4s/S 0 0p@ gd _+pZ*0㓉#ЀC;( %5rO@- 0 S  .^\Q0  p@ S0C  C/o "P R pO-PP10 0%SW P Z0@S!!Q@ C$0S 0S  R-S %S +S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  C,P T"@` P*P \0@00SJ R Q !" R @ %( G-$a$40S Qq0m0@S| @ ~*Р㼐0Sʰ00CS00 ) 0 C+0 R  0 S !T*(Ft(5rO)Kt%A-p@`QP00Sxt10P 0S X$jPp pP@ gP`WP P11@*@V Q@ T0`p0S0 )@00CS0{)0S 0 0 00SJ 0 S 0 0SWt((5rO;[Lt%800S /@-P `(8 P  /Q 0SZ//(`060S/P00S/D0Q<0  40 A!0 S00)d%T(p%(5rOG-Q`0SS@00SjZqP000M:<@ 0@C$ Q 0000CS0L10S 34q000$100S010000<>00V00CS000S 0S @pWZ00萠@ 0 ZNꙂ! P00 R @('|'d%A-`!@SPp% L&WVV |1N0S9 U 0S0PiPhV81LpP!1@ ! "&0@$$060S& $$$V&&U 0S PP hXhP HHV WT  0 T(d% %t'L(( N08 N R S  0S  P d%O-pR0`BM0 pP i0S0S ЍP880@000$00 ##P%:T 0S0 10S 160SdTf P c100CS010S 0S 0 2"  \ Q R05S00|) \~ Lo ^ \ \ \@W~ Lo ^ \ 0S 00>TP 000('(T(d%p%|' G-pPE@P ?P1N0St `K@hT @hKpVO `㜠@0S0S 0S0S$`@Y 0 X 000 .d% %j(A-@PP PT0Q 0S wlP@ pP@ ZP@w|06 R0S@@d`Q 0p) 0 0 Skt($d%t%O-PPdPt,M @P Y8 U0!0S05 @nT pTU P300SU00S00 ,Ѝ 0C(P ,P p0S 0S@3 P#Zp `X*00SL T0 @@0 00 00QBZR00 RiUX )Y ^  pPX2 R  Y RQU@ )260S'  @ Y00P'  P0`0V 00& 0V0S(0S0S 0S06 P 0Q p$@J0S 0S @sԀ0U0X0S 0 S0C0 >j0SY UX ]) @0S 0S((t(d%OEp@-@e``Q000 R 0S <1Jp M!r0S 0 00D1  S @` 4s` V0P 4s0``0S`0S]00CS0X00S p800P0V0S ' %(5rO|'@1A-Q40@S%P`q0SP00CS00 % 0 f&0Ip u(M.o!w%PlP000T0@0CS0800S 1()$t% %'|'@- @ 00Ft(@-@ @Fp@-`@0 0 p 0Qp\ PU%00p(A- 0pTb0AU RAЍR R =RU "0Bh 'Rf 0 BRaPbcclbabba) 1PU ^ S \R0 R  p ` Q\1 0 0A Q "Q" .  Q1 01p0} 0$ S0." W p 0p: !0}RQ 0 0\ $ `0" X00{ Uy 0"  @PEs(u #&%)/A-@` tMTg 0SdPUd geeededdefhfpffggg0 000E000PS V 00CS0l00SG, E  P0(` C0`00'X%X(|'T 000@0A00CS0/00S/'X%|'p@-$@P0 0C0C0pX%X(p@-(P(`@0@D00C0pX%X(( A00C 00 0C0/X%X(-A-@P(MHp@`DpPVP u }T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@5E0 P Rp' T4O-` 0P  d8P TLSCP 000C SPppppP DQX0 0@- ^ @P U@R000/d%p@-`@`P6N0Spv@Tp\\\[@\ 0P p@d%@(i!SG-pP@R^Q6 @a0S 0  pW@A00CS00  0 @aq刁 Q 0S  @TPL$aDqD0 R R @TP@00CS00 K 0 Q P @1@UT@Q@`Q PGD`V0 8d%Wm obt%'hv 00\%P0@-od%0S/p@-@PPEPp@@@A-@1S`p@DPU 0@P00` P\(O-@P0q儑0`0S -R  RF -R0SF P +R: `cP Z TPoP0S TP T``T |0|0T0rP0S \HT PT<0@@T0SOz\(x(d%P0A-B00`0Q 0S 00S0S006X pW:P 6P6p60S0S60N0S60N0F0 0C?oR20S  0-S0F01P0CSQC0SQ0 0SwP   000S 0 0^0 PA! R   R0 0\(d%'P0 b@-\@000D00S 00CS000S '\(|'000C S/ @-e?P 0 \(G-0p RP 0S5Q 0S @0?` 0CC10@ !,a``@ `Y@j `` -R \ -Q0S 0`@T0:SF 0R@1T0:Y " @`'@ `0 T 0:S  @`@?:\00|@Y00  T@0 CB!0 4$@ ЍOE/x%FP@-HmD0P  Q 000CH Ѝ6\(l( $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ H#PP0@:T  ($\(lYG-tR@ 0S PP -R`@@$0P 0S 0S@0-S =@T 0T T@1@DSq0`000@@CA!0S:0\:0l0@#1 T030V:0 000CS0 10S 3  0 #@0S`p0C 0 XZ0Oa0C R 0 0CS0H00S U@0S =\('|'p@-H@HP080Sp0u`0CS0` 800C805H%X( 0R @-@T =0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @H% 0S/xqQS  0s0 S/00 0/0S/0/m 08 0/=P/P/0/m 0 0@-0H%{p@-`R`@P:P t0 0Ppd0 Pp0-S0S0 0pV ($00080@pH(D(H%O-RM0 p0pᔒb"%Q  X @  [c { R00CS0`S``@520`0@Ѝ X @ ,\[8R /y P0  BR (000lp 0 S B R { [000Yp X R  [R. @@  B@<0  0 Q P Pp P  Q  R P000@00 w 0 C%`%X(X%j H%0-0@ P RDM`t0 Ph h "  kU0L T<0< 1 0 01 0 H%j @-P@M0 D 0P0S=p`@T*vpPT @T:;PLP @0 PЍ@X%`%(l000S p@-XP@T T D0T@p8040@p 0 /H%'&F@ (% (@-0@?'p@-d@dPm\Ppj P 00008  P8 T Yp@U%H%UA-DR0@T @ B 0S 0 @ 0r8 0 00CS0!0`)V*V V v va A ` 0F S88 88$8lx V@0000 @\V. |V ;V&P @0 ;P @0 @0 Ppx&P@0 @0o|P@0 @0@0@0p P  00P000K 0 H%%x'|'q G-pc0@0 T T+P,0S)㰀" _PP @ @@`P  0RxP `FFa@@T 0 H%j p@-`0$P P g 0R$, (@R   RP3Pf    Q V 00000S@p 0 BRp@ Q080@ pH%>@-y0 000H%@-@oPp@-+ @fP P @0 000p` P @`@`H% O-С`P0 $ @CPp/0 CR00SY%3PB%V 0 H100SD (100S @ 0YP@0@Y PX @PW W! V! u000 @(pGWoVP0V      000H%j O-PKM 0 5@00 04 P00400D$0Xb`P  0S 9 40  |4 Fbt$0000 `SH4 ` 2,4$ ($00CS0c 0Sf@pW 0䃟RPp *p0PC0pC0 Sڈ#sV@0  0 0C0Ps000x90 000CS0030S0@2 0 2 0 02 P B1 2R z0u`B0PUZKߍ20S d2h@d2d0p@00 0S V 0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PR@0000 H@!00CS0 0000DP3: 2.3@@*pb0PC2P \00;0-,M00CS0`fR {00^H%t'`%'%X%X(|'r0O-鸯帿pM0ϟ  Q"/O/0 0202280 `00P/20S0S 2Y HܱP Զ/Q00S: P.Q00S1 0P0C0p0000PbP.00CS0)<.0p210SxPpNTP"Pg KPEpE U0@#S?ꐫhTLD<`Xp6p P00@ S0P@ A0@S7P@a0@SdWP@ W_ P H'P 0p@Wo00@S"dwWg'PG]p0000Pgw<0 0CS00C0~00P00C0l0P@F00@S0P@9u Y p0P0C0t0E5`0@?o? @2;R0S 6\P(\Pp ?PPpppWppUpW 6;E S8 5:0 S0 U0C *0?0%3?P00q Q~  B  PA0U!*00%60%3?00q Q~  B  ?PA00q QPA~P•3U5*00%90%6?00q Q~  B  A0%3?00q Q~A• ?P B 00 r R P B ~ P  B u300%<0%9?00q Q~  B  A0%6?00q Q~A•  B 0%3?00 r R~   B  U?p00%?0%WUT@>P0 |P0 &PU000@$P 0Ѝ H%%p X%n x'|'&AH(D(`%1&m (X(`%k X(k q o P#0 ,  0@ 0 0 S0Q >W @<P >P" &P0000000p0p0((0 P -P 0(0  pO0ZP0  0{P BP 10 }0 01{W00E000C00R#PpIN}PP 1 " )00 0: =}P,p @R<2 3 wp BR *p* p|2  BR P=  ŤM= P2 Y%W :W5 #Wg}x 0P 0 ym10G P wp BR pYpT3 0 @ R  B 0p3ppP3?  BR 4p02!R1S $HQ x0H@ 00 X"0`0001BP11=t=P|4  wp BR pPP4HW I/o}W" R #p BR p P 0X0 'P02`5Qw0  0y0"0 `! $0  0G-`̠̀0@T@@0PU @ 0S 40 0  B/o"`f0p 0S 0 S U0 0 0jH%p @-P0@-2aM0$ 0 10< 010@01|0000I[PI@1| 1Q @@00X d 0S $Q. 4QG Q ,4  8000<  ,000 0 0 ?0 0 0 S00aߍ0  p0 `0 &H0 D0 H00SZS,0㡽 0t'd%l'H%p `%x'FM G-Vp0 004 P" 000-P6X0$00pK@P 0 R |0f` p    Q0@0S 0 00}Wx P0, R_P}1 000@ 00 00 R, RNP4 00300 0000    BR   00` P 0000 CR Sm 0 tP P`  ``s 0 0008 @0C 0 00`0 SlP XC0 R   L000`0S.0 R Ӻ00 P 0 R000 0  P 0@S P 000 x`@`0P0|0` P/ 00000PU# T 0S U0@P0@00S0P0S0S 000@Ѝ0$00pH%eIL%d%A-Q@`Q` @ p0 P0 0X@p 0HP Q$@@`Q < W R    0 00 00 @ 0p0 `4 P /<`P l0 08 00C004`ЍRQH%%{ A-P0 5P@. 000`+P p@``@@P 0`0 U000 PPe``PP0S H%d%p@-@|PP ,0 @P P 00000Sp oppH% P/0S/80 P/0S Q/0(A-@Pp`00p` P@-` JP80@ pT@̺ PP  I Ѝ f@PI  d JT% 0P/(RQA-`Pp%6JpWpPpW@ U bI`0 R@'JP P1 0׺MI0 T%A-`P@xpT@Q00C0U U ?/@P0 P"I(p@-X@X`0P0000!/00CS0p00Spp@l'(|'p@-PX0@TpU@PU@TpPHP(|0p@- PR @RP H0 _P \`H 1 SpT%p@-@tP0 S000C T  DHP 0SH,03O@dA T @0@p@T%gfff(p@-`P0 Sڜ S  H@P t0 R@U Hp0S 0 S rH@0S (H(T%p@-P @0Pp @  0p(@0@-@ P  Q f.@TH0( 0 P/ R/(C-LsP0 U00000@0CMS񟗮T|4$$` H@P@2@姿  堹H@P2 R@Ux20S Tq G G`<"<G@P2V0S' `Gp@! DIpkPGgP 1 bŹ 0: SGT00`l!x`\!l `V'jPP / 0(7 V U0S000  (P @$/ 0G00CS000S Ѝ@pNT 0P/ DZgG'' T%d% / |'Rp@-@P PP Up / |Ը?Gp`U ˾4Gp0U s/ pDdpO-P `ppW@p  0Ù`ȐȠȰ0S UT  O   0@  U  }T 0S@@ `U t%dF?( k G+n< p@-P  @Fp R  Fp d0 Rp  Fp Fp Fp9(T%p@-@PpD0 0RPPp03/FPp(O-@$M0@000`p@A p2@ ̒V 0S"2 0S2" $Ѝ2@0Sڐ2 R@00CS 0SP P . 8ܷGFPzֽsPP jT AF0S_ ZPPZ*F봡P000P000 S`|1 0R  FpP\H B R% N. ( C EPP  R  EPP UP Ez R rP0 00CS0t00S @T0 00`Q RP(%t%p%H(D('T%|'O-`0Pd#dCM`s`` `00 '4p(V( PEWUCc 0 pW` y@p00S0SᳶP20SU0SRp0sS vS V`p0+S -S X @Ꮆ @Q0 @R: P     +PU 0 P0SA<0OЍVF p p0 %  " Q  %5S'  Ep"O- Q  0Dp0T ʅ00傼5- | X0 M IU00 DZ@-\#&@-G+D(H( k t%Y9xA-PQU 00CSQHq10SL R@ 0r`0CS00 `01L00<S0S  50qL0S 0CS>S0SSxh R 00CS00 -  k OE]p@-@0TP R R R& 1S# 0 PpR!Q QT " "D0600S0T0S 00S0('|'d%@-@1P @ +PmTP@ @-@P TP0  H OE(QA-@ 00CS00 P `tpt ?U UH?U!P0P0CS00 `$G-@Pp000 T` 0000CS0H00SG(0S 00S )@'(|'P P0  /\ Q0 S//(@-b@0pSM910S5 0SPPT,2C 02S p? 0Sl UX U` Pᐺp2 W`RUHT0@D>T000 0i00 ,C10S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ (T(d%p(`PO-`@TP P@yP ,tP0FpS`@ PCPBP_P34 QPP`tDa0S! 000(U 00CS0 PT40S 00CS0 40S P@U00P@`s䃟1 R 0PU TgO@`@VT @c儃Q0S 00S 3@@TP@P @޴PP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X P̱̑@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR 'pVP 00CS0\00S 0U00 PI' KQt%('|'S U p%~A-@P P0` pUTA0S 00S Do0@0@000CS0 00S P(('|'p@-H@P02`S@20CSpUV02p(40T0P?o20S 0S//(C-p@`1010r!Q0@S10C1 ЍqXPU X2ePᅵ 'P 0S ('@ 0P/!!R /(p@-8P\2Sp@?<9\Bp(0-MM01`"R !R X"R   1 1d"1!d2S ,AOPl1, ,8OP L!0,00/O@P$1, @T0dB`0P, U @T 0S P00CS0 ! @᏷00 0$0(00D>S 00 5@AS@"!031('t'' 0@-`"dy(p@-L@8'P0PPp0C/U00pk p@-T@TP0 0P0 ;&0 0000CS0p00Spp@胱'\%|'A-@R`P  ?0PPEU`pp WD艷0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000 0 000CS0h00S #sDP`000 0 0C0H ('|'p@-@P@0SH00Spp@00CS00  \%0\%0\%@-@9P%Ѝ-@-   Ѝ Ѝ/-@- 0  ЍЍ/\% -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`P$ 0S! l0S00CS0>0 "  u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' k \%0Q\%@-@@\%@-0rS0G-p0 P0R(0帐@0=00:=`6`F@VPpPER000 S=S B`` R`ĥ`PG苣@`%X(X%0@- 4@ 00C00 0 0BЍX ( 0P P PR00/0@-HP@^ ^ R0L00m A-鸀(  R i(p`@pW p0S 0QPU  0S 0S   3/P@P00t (0SfA-@ᄪPU p`pp0S'STP@DAM'ᅥPP(  EB0-$' A-P0`Sp@    3/@PP@X #W p0@=S0U0 0 00CS00  0 00CS00 x 0 T ꡑt%nO-@00Sp 00P㼀✠Z  0I@PU* Ѝ`V Y   [ Qʁ~aP`0pX (t (80@ R P=R/=R/A-`P0S=SPERPU@'㑯\0\p!0qV@pT 0S mPVpp@X (t (@-1`0@S @  PPV 0 `" Z h@  `R Ѝ@"Dq   R <0 2/0`" 0R , R  00 0000@!L@0P U U0 g00CS0`00S Ѝ@ҭY0#L 00P P Ѝd%7'X (|'-p0GM00`000JP  80  00 Gߍ0  0 gt'l'A-`p= P 崭@VPp IPuP0D @S= O 0V  @"`ЍA70CJ-GMP00 0JP00$0 0  Gߍt'p@-S=X@P0`!@0U<[ 0U`00 0p@X (bii!S!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    \$Ѝ\(pp('d%@(p@-@`TP000T 00CS0p,00Spp@ެ@'|'s@-P@T@ bPP0 P00Ѝp@n` PP 0 @?[00000 00PЍpl X (A-PpU`A0  =!08!@TP@ 0@00`t ( @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =ᩢ@@'C-pP@0聟rS``PW! 100S T! 0  ЍC^nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000  hG@0 L ?@   W P ث$t(s@- P`@@P 0 Q   00 00CS000S ЍpQ     R T0000     0  '|'i A-`pĀ@TP0U0  { >0S R   0 02/0 00 0000X (D%d%A-p`P@P 0`0PPEPvT` eTp` fTxTp`X %@V R@t(PP@-  VC-ܑp000P0`-S㴁@TQ @ 0@00`0CS0Uh10SQ ЍCȪ Z@P=+P 0 @0 0  0 00 00000  0  RP 00 00=S Vt0T 10=S010C0 0P00 Ѝ'X (D%d%|'  X (p@-@PTpu@p@-P@`P \偪NP@ xP@ IP@P(P0 P pVt(00@/ 0S0@/s@-@W0 0P`N0S J0"S U1r0!l%*0S`0T8000 @0C?o2R0SЍpi1&z@-M@ 9P ލ9P@D 0RQH0PP0@-M@ 9P ލ9P@D0 SPH0PP0@-M@ 9P ލ9P0RP 0RPA-@`9PI0 0SC P69UA 59PPPtp,9PJ! 0RA"@- 0-RS# 0S0 00t: Ѝ0SX0 0P0S00 040,兪P$l Xm m l 0@-0P!S@M0SPЍ0P{ 0SxPUo U U ΣPo U 8P? 8PPEUR(8HXh P  P  P  P  P  P  P P p0St00@8T @[80(S0)S0 0qop@-@`P(P} 0Sz00CSt ,<<<<@lᷩoopᯩPᩩᤩP0`@,TV%@`!VT`@V@`@ P`@P`@V@)Fc0S0!SPpp(S0)S0S pp@-@P6PPE0P.U)(<0op=Pp0 \0!S0P p(S0)S0S ps @-70Dp%@-$0$0 00 ߧ'p%@- @ R1P\ * ЍnO-@`@MT0pD P-R lRC 5R -R| `WF@P{2 000E @PppGWP 喨PW pGP〢倲PE0%S``PXŧpW ;sR R`6pTP`2崧PU W@1 000 PPP@U aDP@ 1 fFp |FP lah;?X<@P E@P0S0Sp@CFp0 0 O `X0 R P!q *S0 0R dS HU5pv   T&TTsF5oF1&I' ? t%2 P 0@-DMq0   0@@DPU#4@0 9   60P x, pp LdDЍ0=P ''-OES%wl/i!SXp@-鏧00S 0| 0x 0p0p p@0   PU P@P0P H0H P p Ppx'x''(H%(%t%\%p%x%p@-@?0@刳 0 0@0PU@0004A d0 R 00CS0H00S p@_@C0PC'T%(d%'(|'P/p@-@PTp000@p@-@P.PYot p@-0MP`0@-S00(00P0 0  P/P 0( RT  0 0 S40(P03/Ѝp<u A-@`PpQP-U@Q*P00  PP 0-U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Ppv w Dx Hy p@-$@P0S 000PpP (Q+  0 BR@- 0 M| 0- BSs^0@Q ^ 40 ? 0 C  / /OEX (P (p@-hP@`V P0p$`HV40,000P (H >$S C-MPp`V@AT `0V@P 0 @< 0$    0 S @     T    t h@9  Xv Lr@ @n 4j (f  b ^ Z0 SSO K G@>: 6$A 1|@  < S S  SP  L6 CVyP   $W        @u̅0ST  l/ /X@ |/@W h/t @ Lx@l 4`(TL@ 44,@   T4 @KV ` X@H~x<z 4hv `$r Pn Dj<<f0b(^Z3U@V LHD @>|<@l 0@4TY .Vt,<*8 $"H@V S  W  2VxApr`VЍ00 d. @V   Q  o.0넑0l  @c. T⫼l⩼@ p.dlrz )(09@GNU]crzt 5KXems{  18?OV\dlky@-鿠 /+P*&@-,0, P 0 0 .+` (>P*&Ws@-@`000 #S@]Pᶠ0S  0V00S 0  VЍp$0S/#Sp@-@,P$p;0P 00p` (圛@-PRP@ p`%p 0R" Ѝu0"S0SO 00SS  00@O1&@-TЗPL0 p@O0"SUЍp ('@-T嵗PL0 p@40"SUЍFp (Vp@-d@P0S 0S 0SS 888 U   S$Ppp (up@-Px@Q dcU P L0   P    pp@ @y p (0@-@PPM 0SLD00Ѝ000 0?P0 0  (O-Pp`PM 0S<f;$ ,l  P 0S  ߍPꃯ0Q 0S F@s?0P P@ P@0 ST WpU: 0S  H% 09/PV` 0`p (U2@-Y0S S S8 4 Ѝ S$ Ѝ$R0/7@-lP$ R\T;@ H $0S p (T T Ѝ0p ([h(p@-@P 0Sp@<0PS 0P0i00Sp@-ٞPD@D D`DpD0S*00- | P*&NC-P`PM 0S00(p/p0 @P" @/Q `0p0@0P T0p &PH$0@@ 00Ѝ  (p (G-@0X T, HRD2D1H#<,( 4 ,, (,0 ,8 ,4 ,#4R! ,!4S ,!4S ,!4S h,!4S L{,p!P0S t0t,T!T0S \m,p(HP8W ЍG60S. a`v`  0Q, 0 L,0US !S|  !3 \?,0US:3 0U #,  1, 0t,,pP)&y .@GNU\cFlu~BB& & (O-Qx ,@QdP0QL 4QP8PQ$80S,00 80<0S#<0P;pPP;iP1 QB"8_`㠱8X0apS wpR  N <0RTGP)0< S4>P0S9`(噘Q 1(咘Q *@P0S0 BS `a 0ph R  R* P*da (Z/op (,YBO-;$M p*bP 0$S   ߍS P@T[D@hP 늤40 婫X ZS$ "$0f0Qf/ j,2!S!R !SS0̡1,21S 1P P P@0 0ꈡ|1P#>00 P,2 S, P 0 <pr#>00?s0 R* 0S 0paj8 P 0S 0 pS1Sw j  @*1S j/ f/ j↛01P P%DT h(p (VEW}}WEVF%_< ()&A-P@p,P` %R 0R000005Sw D $0f0Q $Q  p (h( (p@-0@rP  P$p@`$0@-0S ,Pp (@-P   (O-@:P,kCM M00 8P( 8P008[80p0SP :3P  @00 CY x P 1(p X' p@ ږP$4 X p: 0 $0-P$0S  d$02P  P pGGqr尖P,圙圩$ pW 0S$00t v P$00 o P$00$0 f P$00   &@~P pWa 0SY] 0 0$0P  @; 8$ 1\ t$ #^P( $0S  S;Ƒ8@0;RZ(( DP  ( %:P 1 P0 0$0P$0S ++RP0 0  | P 0 0$0oP$0T0 < P 0 0$0^P$0`0  P 0 0$0MP$0X0  P 0 0$0<P$0\0 |ѕP l̕P 0 0$0%P$0d0 (底P  50$0P$07 娕 P  l50$0P$07 {嗕 P  (50$0P$07r jd冕 P  40$0P$07a Y$u P 0 0$0P$0x0P Hd P 0 0$0P$0|0? 780aJx0S0S  |P0X: `X0 H0I0@0t 0 ST 7 7 2Z/ \w0S 1 #0Գ000S05 0  3000"0$0 0 0 $0eP @$0!S D@0$0|2$ 2 ,@pCލ Ѝ0S 0c  QP0 vP0!A"AM0S 0崡0S 0Cs RS񟗚xk8axk8a8a^ p ( L>} H\gl6LV (n} ( ( +6Je (d} 1&s@-`0PU V  P!@@P hЍp`PD! 00s0@FVld} O$00S "@-ژ00č%p@-@5S4 0PSP p@@Pp0S 5S 1S N|Pp5S T \Pp< HPp#(( PpNp ( (`.edArdALs@- 1 AP(000(`;a5 S4 5S Ps0S o0S005S  Ptp0pP$"5S ЍpH DlP8 WEVp (fd]mdnč%p (gd@-@P f/6@ ( 0 Ič%d(md0S/!  -3@-PT P 0S S@@ ֙P@Ѝ0@ Ѝ/)&p@-4@4PQ9p@`b% _% @̍%@-t@t0MQh  `P0cS CS SS 4-sS00ۍ0h1(J,0@-MM@` PP 00YSP , ۍЍ0mPUew 0 x<()&@-@M0 vP ۍzp@-@$P 0p@ W)&< (<(d@-YMM@p p\YލЍ<0< S <fCPژ10YS<0<0$rdA@-*0gj zgzz'z'&z'z{zgzzz { K$Ѝ57@-P0@ 0$S0S> 0S6 TQ+BQQ+ QP10S+ 8@0  000!C0ASuuuuuuuuuuuuuuuutuc0As Rxa$t_$ Ѝ0zg{{' Q{ zg{{{ { { @h1( @-\@\0MQP  HP 0nS yS0 $00ۍh1( D\P `00CS`0p S00 P0S X0X /X`%)&G-P 0p`0=@P K#pGT@Y @ 0@H[Pp Ep〠 0  a U `V `` XЍds)&O-@M MhP`ᜱX%XTuTT0S0#!pD P >P  P'p0 p( P   nTt`(p P  XP `h#ZtP<08 Tt`( p P  XP D#0(0Ss`, p P  XP -#0,0xSXs`0 p P  XP 4#000$Sr`8 }p P  nXP "080Rr`4 fp P  WXP l"040xRDr`< Op~ P  @XP "0<0 Rq`$8pg P  )XP "04Qq`$!pP P  XP "04xQ`$ p: P  WP 8"04(Qp`P p# P  WP v"0P0P|p`T P  WP `"0T0ۍ Ѝ< ()&@ ff =XrCd)GfO-M@ M0(p PT `V:0S0`S`6P`P8apEbWWnF `F`0E8ġ0 0S0A"S0#1` lop P( AP●P@#" 44 |P0S  3/ PA RP ,ࠐ异Rx%.A 5p P" 4SA4`S>54`P92a0C" 20< S :A$!"YA!x5|%.A  pY P0 x5< A B0qpA|!A 0Q<0PADx[0x5< 0RA| pP 0 000S P0`p尀(V R s S 0 0)0`PX,!ލ Ѝ̍%@ f 4k|<()&h1( - BR0 R W"A-P@! R1!! 0!0 !X0 X0 pX0 \ ( H!, <!0 0|!8 $x!4 t!< p!$l!$h!$d!$`!P \!T X!巿0p 1R0S*0X`p\PQ E!Vl墿A*, 1;GT[fkt @h QO-pᔀ 2MSR R@`aW 8QT ,[Q 00   `0@"  8 ,   K`@0@"  0 0  !R21`   0S 0Cs RmSjTTT@TTTTTTT  1 0 02|0 8QK \  <0P+8咍Q* 8 0A0 @ 2<0P+8xQ *ЍOܾ0 0 020 020pi  dd 8 T ЍOЍt}, F$IA-@Pp(DC <墾`8SA 0` 0/p/0p@-  R( R((,,004488<<DDPPT@TXPl XRl@PUt @ 0T0p  Q CQCQ}C (@-@t40Pt08Vf/sWEV0H @-P \PY Q@1WEV (80@-0@S K08f/K4 ( 0\ P0//@-L0 DX<<巽8@8P(` RI 0ITP*&\%P7@-@ PT'P0 08P8 0p0 pF Ѝ0ep1(vdH 0@?o2P0S@- p`P@P P P P@V@lPH@T@T p0 43F@@ ЍG4p1(udH 0@-PM xdP@` p DF 0 400+ + Ѝ0p1(zd@s@-@ ep E0  0 0`P   0   0  h0  P0  8Ѝpp1(td@)FGn( p@-@PM`P p  ( V V dPЍp (y{H( p 0E 0p1(}d(@~d();0@-PM @ X{P 8_E4P 0p0 ZEЍ0Ip1({dЀH C-`0@Pp!匁匑,M00 p0SP@TTA  p  00EeP qP p` $0Q 00S*U@P EQVW V 0~ R00tP 0S,Ѝ00* *  `@@-\#&tp1(|dw,F@-P$M /@P <p pD P*&O-p0$M@QP`H0 00000X$Ѝ x  pB ZP p 0 S 0T@0SxtZV Xz`W 0  @D #  g' p@-@PP1P' 0P, 8>0P  ?B0P 0Pq 0Pp@"p@ 0x1@d+p@<U@@ Pptcidyara9 rbmngntsP $$2 0D S/ 3C5C$1 4! 8<0/x5(0@-4A QU0&Q  „?/.01 ^ L043c 0P0Q  „?/.3@01 24@5 ̎ @x5( 213/P/5(A-PT0p(,`>@:,0T@@DA??@x5(?0@-0@0 (20,20u0P!P30x5(> 0R//G-`0(,Bp  PX E@PPTW ,20CS(20CS GE0x5(  p@-@`42SM%^ 4 E 82<"@- 0(2,"&Ѝp@!<"82E@d`,"(20@X"\4Ѝp@x5(,%      2    s@-P`  0SЍp00S@n0"S1Ds@-$MA@00  0 0ztFA P*&A-`P 0p @Tʬ@ /, s0d  ? qp  RЍAL`0S`@D@, Ѝ,%x5(A-0ppP@`phn!14P S H d" R S R 0 w$Ux5(%p@-4@P0Sg( ᔉ0B1px5(O-PTM0$ (00#,0x0@08030匠s0<080S8 (2,3`P(0,4 040$04 ?$0 0 $0  00 $0bd"MP ?$000 " 0 RL0 $R0 S p2000#1-R0" 4LL`P@0x0P00S P  P  P% L`ᦤ0L00 S> Ճ0g2< pmE%KUL1O?C$\"00㌃P@\2S@0x0@XRx0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (0 0,00 0hX! @$PTЍ P @Yx5(,%a7()&41&Y:-s@-@400CS0 CP` Pp pp?0 P00CS0C0 Y@oЍp@Ѝ/)&4O-a0 p>Pp/B$@0eO 0qp Ѝ  R ЍOt`0S 0 qp `BPE,Z 0S ,%x5(p@-|@P2S 0h`n/(2B!1!1U &"U 80U p@@PC @@Tpx5(>(7(G-b@p,>0PP > P UsW剔LI J$ oo,็U0U 1U01 ;I0s@s \ X"pG' '"q!'|"",q!#34#sO8#@<#$(,0#$1!#(#80Ԣ #ZYPPUJ0U @DQ ČUȌ̌X L X0PZ 80S 0sPU*‘ x5(EjO-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q 32 $450 (, T02Sx Y< ЍP P倰[R21 RS$ [0 0 2S Y  P$=Y 200p@`p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$m00C0@@PAy`d1S  14P8 <   00P2S. Y  a14a8a<0#d1a#h#0)S Z0)S R0 Q !P:00 0j0<   0S8$x5(L$ >F),%FUj^U6QTpyA-l4RUP@P@^Ѝp(0PPPB1P@$a$aTS  ЍAsq 1l1 0pd 1_1!1<0 V 1Q1 ?0K1!1<0d B 1P= 1@?0ЍA5x5(F&:M^pO--4M`@0P,0 q 0Sၴ0o_d\,P("/op" R 4 0 0  ( g 0U䢑 Zz @ pD H L( @` 0t0x0| 0XS T0@`t˟( PX=0 @`8 21S /0.30010204458<0 TTQ6 R:HL"T 1"R. 偟4Ѝ0(R0o_dP(0|D 0 P(u 0 P(l xVt  @D H L(@`0`XB(@ Yw  0 pt0x0|9pW2SjX 0h !? 09 ܂,i  R    0$  $  0 0@P`T 0 W0S `8p@W 0`S$0 @0u 000 V 0S<8Xr\" 0|SR p 00 RW0`@0 0 `p@,0S| 0 007P2S XU9 @`@ w 0@ ` R$'0Q0[002 @`S`Q $ 0 ^A$ D 0 H L@   @`021S  "/0.0010T0 320445 8<0 T @` @`2S 0 00P52S X?U @ `@ 0S3 :2S H"%>0 $00 0S, 1S) % X000P$  00SX0!14!8!<!14!8!<X $`LLD(`0 S( 21S$ / .0$40 81 <X S  PX 32 $45(, X\ 00$0p@`\3"Rr2S/ d70 00 P 00 00" PXT (00D#$0 #(#< 0'4 0'80'< p0 0pr0 @2S` BT0`lGPX 0 1<A 00@@',2`0C 00@@m(2? 00@@0`Fa ??`1`<A` 0@@,2`0C 00`@@(200@@@? `Fa?`?``0S 2S@ @TJ041S 0Sg 0s XPX2 0 RS  0dPTo_P(Lx5(F7(; mj$(L_nG-DBp42gS0ĜP(r(b42S 0P7U42S 0S 嫜PqЁ 42RSf P:圜42S]1!$1(1,ЍG0Sd S` d04兤Y2S t` ` 0PPw"PR Sm0SЍGPS@ D0ЍGSPV 0Ѝx5(d5(6Xq{@-0@M0@ pp`Ptp&ߍ\ 0  0]P \ dt02S 0S " `P D!SR ж0Px5(0@-Xa0 0LAP d2S8 V P(!p! 2SP0U0 $pt" Rp\EU$p0 00P d2SP  P@ Ѝ0P0!!1 ,%x5(mdt5(>( A-@T2 @P3{P .{P ){P@ `p@T 00S p`V@{PD00S @@{@P+^(H%A-Pp`O"@,")"000 0@@@A-@pT` jygyPPc"0@  @"@G-M d4 P@TPD zP @ 0zP(4 00(0 4QT(0 ,0"4@ 0# 0@,0S @@((@`@,0s0000CP倃0CP>PP0 !01P,30  ,3Q #   c0 T0< p@8 PA ,0S ,< 00S< 00@ $=`P&0FSʆ`!P0S -S@= doP00@@Px,0S ,^A0 TP z8800  e 0 R00S' 410XAXQXa400C0  C3~0S0S~0S0S C +0S C !CC$0#4 ܍p PS` PR^(F<  G++ +S &++L%O( ,5 H 0/_(0/_(0/_(-@-$@    P*&G-P`ph~@0S   0S X|  U T Y0S s 0S~@  Z _(O--]--@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  + C-@M Mq` @PPݍ Ѝl!rKp@P=0LLD@rOP,0: S0RP00 0%PP P81: S  S U r%PPd.a.P%PPPU r)PP @P_(? -_($----@-a>0P  0 00 $Ѝ  .c(.0@-4S 3/ T_(@-k}0 @( 0$|_}@8 _(@-Y}@c||O}@@-p PL`@@0 7/P0 S Ѝ ~c00|d(O- MM06@  @  @ 0p$000 (0 .P(DD@ ܍Ѝp 03/0P0   Pj @$0PS i (0SDUIJ-`P 0 W xU euX0YpY 0 `  W 6p[ 0S P%5  e@ u UT \ 0 @W0SU 000 !0I0S# 0S,aQ;m00CS0"*5@ T 00CS0! 5 P @YT Y@DOoB 0Q   @OoB\ 0 @0  0 0 SNTd(//)&)& D/0@-M 03s0c00@S] oFPP* R!>PP<A 00@ E  0PS P5 `Ѝ0S 0S 0S\0S\  0/@ \0Sp 0@0 @vp 0S0Sٕ w@g0SΕ  @"  @0St引 @D HP@ @0 @ `!0xP|"%#   T`    P @@``a ] x Zp h 0 @`d(d(d(/R////0?0d0p000,101G-0@  0P 0S< 0  Q*E  4PP>  8 0`P hJ ZpЍ!URQ 4& l zx0 pH00W0p P  0Q0  1!0 1!$0 0 0( 1 0, X0`P\  P@ 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0po00 QP    0P _VP xyYVpP1S1S1US1S 3S3S3US3S,  pP0p* p2 02 121300p0so00 QP  =  M 0Pp00S1<01@040  0Oo40  QP  M 0PA0O A0  UP 4A С 0R  8 eY[YWX`V P0EIs 06#++R`DX4 $0S,0,  RT0C,sD0"P#10P 0 # 0QL \0  0P 0PdPd@S1k111112#2(2-2! RRaArrAaUP2g222233333[3@-p@`P P00 P0n 00QP  Ѝ 0P< !@ !0 P0n 00QP 4 b0P2P2@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  V ,P00034G-X` p@PB Ѝ0PZ%V0 0nVU D1 AX0 X0 P404O-@,M0p@l@$0`P PprP$P @,Ѝ Cv0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0x!Sp sppP0 S 0 Q q     L 2Q0 2 q "  @ "  p@*"*  P0@ S  2"!"0  0@pC44c44440P s s// /44&eO-`@PpMP0S Ѝ X  H r0A D00 s/ r qh \7P0p@P q x0 ` !P 0 00 P 0 00 `  P s0 `P pP0 0 P`8P 4! 5M5_5r555596U6j6R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R064O- p`0P\PPX $P  qQ0 0\Q@T(2 R@0 P" R S C0BTX t0D s  $ 0 TX  R 0 0 p p+P YP  L BPTR2 Q PE6 7O776O-X`0pM@PP`Ѝ t0Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/QP (t  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 )"0# 02k0 QP M P47G-@P`p,P0S 00S <0s+@qa$0S  0S 0S,0 ( 0  `0S/P  S`pl S HDpP@ q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hPP0P Wp0RQ@07 88! "eA8@-?`XP\@#@3P@T@TpW @@T`Le(O-`@@M18 00TP0S<0T D0S Ѝ1@ 00 `P0DS%0 ᕈ0 0;jQP >P0 Y:0 0 0(jQP PLC 0 P<0T 0Bd(8l8O-M@L0Sp<`@DH S:P PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:888%9d( A-@/pp0%B?[`0S m0ES PC crp@@0T?  C0d(0 PK~ %/d(O-pcMW , 0 [P0 S~@0Pp(0@@D0 0$04@HD0' R$ X0`1#b3<0#000< 0,00li<00 QP cߍ0P@4p(0@pD0 0$0``0 K2#  ,VPV002800aL0`F08 0L0SD00S   80< 2800,000*i<00 QP (1 0H 0  RR R0(10D40L0 `0L0C >d \HP.  (10(11  , B 4 0B0 D0P D0[140S  QI@(1  0I0@;+ )p P(10(10@4 40 0S\ 0@ F /o@0(0"s R$ 00, P 0q0p(0@0$S@0! 0C@0 0@ 㓢#X0X 0 PP :X R: U$0p 00pP01So p U&0 pPf(@\Q UpW$ P   pPK/\p g0x!P0p00pq P$ b QQ#hQh  0 U P p$pu00000 ,p$@Pp0S*0  Q .b A0 b @ @ bρ LG?@@0Cs PQ*W q0L 1r|1 8 <|10W01t0U`0 0\|xQ1PP|!R \$P PPL0sPP|!B0I|1@|Qx1U0P U* SR   1S \\TP@ 0I 0000@1$hhlPP 1|!RI PP 1@c3s00 0Qs (0R U$0p 00pPz, u\000U\`0( 0$ (\T P000 0T 0P0 00 , Q@W $0[g1Sd Ia1 S0(0ZRhlP0S 0Sm \ppOR P0S02S 0S0SW 0\2SV \Q|!/xQP WPPy 00I@ s = |1P 3D=P PPPPPPL0Is0PP@1@S"U @[ShkP=PU p|1WS  P@ |qppL0Ispp@P !SP h0PP 0 1|10|1#40L0s_?00010PP. K/\BoPP05gP 5P0h00h0Md 0ES:\P P|!d1HrH"HP :0 @0|12PPpB18 ,<80P'I0 [P0 S0 U$0 P 0r00 0000 0, @ D00S< 0,00 f<00 QP80,R0 PI Pd01S\:0!XBP %4QIP0%8%\0 P@ld(l88,9S9Z9i d94e(9999:4E :^96: :%9S:u:: ;;;R;;;i;G- p@r W pP\aPP Pp $PK/nD08QP0Q:" 0PS00  Q pYxPh`P 80"8 R 00 05 !$xd(;;<4<<h<<<p@-@5%SQ%  5%QPR 5UU}QQp  0Q   0Q0  d(A-lP`5p@ @ 0% Ņz@ŕ\d(O-POMpLP* b5S 5唢@TE  iP@ ET XT 5d 50 ! S$5"R$%P0SOߍdP  RR @`0d B2" 0d JQP d d0P Eh0K/0h0 m0 @!`,qr0d  01(Em  j l  l,10,1#40L0sK?000/1001001#40>000310 00 000T0 Ckd(%,5QP Hd Ld0P <d(-=O=i(=<=f 6=@-@ P 0 5d(0/i(0/i(0/i(-@-$@   .P*&G-P`pm@0S > 0S X|5 U pT*Y0S 0Sm@ i(O--]--@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @#PPݍ Ѝl!rp@P=0LLD@rO P,0: S0RP00 0PP P81: S  S U rPPP%PPPU r PP @Pi(? -i($----@--0P  0 00$Ѝ  .m(.0@-4S 3/ i(@-l0 @( 0$`ll@{ i(@-l@ SSlPll@G-`MMP@p`rPR0 `: SW/wn0P  rR l00A 0C @H#@ V& 0S UP0P帐`07PPJ0: S,^0"9@PTP&P vgP  PP @u3M`@ S @ S@PPZ PPn UD e-@+S R UAPXp%t!0#%PU00`P00D!  n@P2  Pl0Sv`X bPPe0 PP iW80% ܍Ѝ`n^PUz fVUv TrU x`=h= Fv=F F@0/p/p@-P@1M $( $(0XRX0X00\00`0ddhhllppttpp@-@ P LLLDDL@@LHHLLLPPTTXX\~`\`0p Qp` 2jP0@ S p@-0@"!Rc0p@-@PLLLLpA-0@PJ04S->CL->C?XzL9>:>CuL?n:>CFpL 0? AC>gL}C>GbLmF^LEnFZLE~GVLX J.X R  $$((,S>,6L}S>G1LmF-LHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqxK1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,YP2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P> \`" :pJ"0S1 T L000 0(t HP( $0000S ~0  0X.P 3 p\tK.Px#0 0!0K 0 . @p x 0 0S r  P1 !.P Ѐᰢ L000T0 H d n 0P0X0x2 0J0  000r00S 2j0 0H 0Hh [ Z0# 030C  4 S 0040NP!}t1 0[ 0{[0  kN000C0 0 S 8   0 0001   !p'0000 0 F!0vs  0J 00S 2=>n($q('>pn(X%8c@>Pq(_>6>j>>>t>n(>^??G-P`E@pXpAZ x10S l10S 00 0R P4ЍG!@PEU< 1 RP0H 0  P `" H0S"00S U  0S |0S GppЍG]X,P H0 ЍUn(n(n(2?pn(X%2=8?F?]?s??P0'0S ^P X P& PlЍSv  qp@\t=`dn(\q(Tq(q(4o(U Bt$q(xo(xp(n(o(0o(O-Ph20Pp0@L"`V  00  Y0 Ѝ0k Ϡ?R g4G@ WULQ TUWV A0 %00100 @ R @TPTpE@TP T  @T  P T 0 00V02 0 %` 0 BQ0 9Q[@P 0 000\000 m%0`0S00000 n($q(;BO-Pܣ4MX3Xp0 ~aPp0 g3G0 GA3B3w T 3(IP 4Ѝh`+a43 0p R [A 4000?02@20000HT C^9 @ @TpT0x6@TpT 0 0 0 @T p & T 00  04G000XC_ 1 0a(P 10010SY 뉑  4000?0失 0  yP0  nPY@">  10@(Ps 00 p4000?000S* A0 0000 0 @0S$p0Ym0 `00P v$ 0 00000 a$hR$q(n(VBvB@-V BP*&s@-@P `0S 0S 0  Ѝp%CO-|EM` MP0S 0S L~p P 0Sލ Ѝ000S  iP J0S 0S 0S $0S\ 0S|z 0ShM0ST0S 0S4 0(d sS80!"70  0 " "t 0D@?!? 00? 0jO 0gOd!! 0`O0 lpP_0SS "04 0 R0  0"?  0,0S)(04,0AŸ$80/R%78 <0PP0R [0" |$0S lhbPUt @0S HDb@PUn , 0SP@PPDP~H0S  `Cn* l;xl$|0S lnl0p00S0P0$ 0,0UA:000S 0S P H1 H0S 0S,0S _P  *P   000(WP 0Sm P PP Pn( R. P!\!0  S P  P (  . 80< 0 @80< `P0' P 0 $0 S@ `00 R 0SQ Q\ 0Or(Fn(Fq(n(MGn(\ RP 10H0J00ALPa`ppPU0 \:85 @5D0LT 0 b32 R p'@ `글|$\5S0c%0# pD ? 0 OD40S<40W SW ,4,t`V0`@0x@S yd0, J 0 0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0X30qA101[S>  0(A  Ϡ5  0S  u0S\000 T@T`V T0?  @`@T` 1 0X20qA000P!0P0$G  !N0 00 pS ;*00p0 VTX0 @ QX`` @W0`3V5 R01<`7: R 0@ 00 00   0^0 TR 1VS0` 60P   W@*  A 02N 00\q(n(Tq(0}n(n( q(q(q(4o($q(p(HP*&n(n(U @o(@I'IVIr(zIO-` @ 0Mp̰̐ 0 0  BRЍ ;PP U QP ` {{@ pQ RP Q @p(r(n(M0/O-dMX M0PpP0P1P 0L1L H1 0,0SdЍ0S @d0,`}I0 `00@ట 0D RpT0 :u`P 0RA0 S0T TX0S @PSpt0ȓn(n(p((r(IP*&$q(4o( 0000@/00S/p/4o(00S/0/4o( 00S/%04o(O-@M`PV`@@M :0S 0P *S *`0080< 010S y0 IP0 X P )X P|9`0S 0S H)E8 P00 9 #R0p0,0S010009(0 01?10< 000800$p 0P @pfy a 0#cD0 @0C0S L100S 0y IP 0sI0 S$ 0S '00P|7}`{ 20,0S010040'9<'0 01?1$'p0pp00ppP*0S  KPc 0 1 4`[?PW @p` xp3 380< 0 80< 0@0C0Ɵ .0 00 0Q.*0S  P  0" RWލЍ0S 80< 080t5 0< S `h0 00$001 3`P 0S 80< 0804 0< S h`0 00$`S!  Br p 3x ⴑ}3P@280< 0 80< D00C080P<.\SP$ .P $PPP3P`080<9h3 Q0 *300rP2 0 0r$X!p0AS񟗴ܞППP0SS 3 00c20S40000?P t2 >#R0؀2 00 #R0tQ& l20S`20ST؀ 0 -P  : S000 -0 0 #R0 Q   0tFQF?d!d  @10 S& Lg#R0 š!ɡ0S  0R ؠP1  000p0P``0P00C0X?P8b  $q(,q(n((q(E .JLKF(q(Dq(Tq(xp(n(q(KLLLP*&$q(q(?Ln(_SLs?4o(?n(yL^L00S/0/4o(O-В"0`1CĢMa2@Tߍ0S Pdp@FDAG@D0 ddp00@00C0 00 R2PU 2PU0p 0S0S)EP@R1PPUPRPU P0:0000S 00" P D100C,(P X PG0P0!!0` 00p0SL" gTdXJ{!Pe 0 09 J000pDTtDq(Tq(p(LP*&n(n(p(n(pn(L6>b$q(LcO-쳟p3张P M`@?RB \P  ? 儣 ? V0 G\30ST30T ST D0 S 3 S ( @ 00000CSFTYr P 80R000303L32   ?B` a2! Q,S Q0lB*.\2<20S nP PB PЍS   XPh?00 1>!  R1Z 10SI0T!  0 S<1`0 ? A00 20!谟00S0H0S 0 04040c/0 $ 80QT $0 0$0404 L3 2   ^[0{ {<0 倶PpAn(\q(Tq(q(4o(U Mo(0o(q(n(n(00S/0/4o(O-plMX F2唒唢00,0SlЍ0S @d0,PJB0 @@P000P㸀$@1 0 0D RpT0;:<`1 AQ \`X00X00@SSꈳHH0Tp\t`d`V %P 10S  0 @P5P 00S  0 0S  Q\ {{00ӵ O0Q  000 P  H 08Htn(p(AMP*&@o($q(n(iMMn(2?MMMO-oMM@PX00 E0|2X?0SX0S $5S40SX(PYX0S $XmX S R잟f>`0Vd2 P\20+! `" d" BE00!X d"B1h21$\Pl2\Ο\0C00p21`t2QB1l2>V 2l20CL0=SLq Q\20B  0S 0 ,$54> *->>0S 20 0`S0 $5B111`R B- 100 S  $|Ќ0S%  0帀- 00$%BR0Ө`S<B11@%L0PP X ZT PN 0S  <P| *堀,p<d<0S 0 00\0 bA?L0D<5A?X0 =<0T0.H0D; 0VHRQX0h0@ @0D8 84<ϠQ b${ S W,0 Sa?^ @"PC (;0S @ A>+@B@  C@P:"  @0\ 0 0009tJ*,h:\:0S G0 0؍ߍ0<00<`/  `!.0|i0S pd, @ 0 HH 00 4y+1#\Q  0 Xi ?蘟 _D0pS90n Sn 80S 0)S 3S 0S d0 080S 8 0S@8`0`480`N (8D8/˃2#\%R  `  0 ?d h pB2 `b7"<68+?P囓)<D TP 0RT%ͱ7DpP0W`C ?Q `,00C[nqS  S +1#\Q  0将h ?O0$S 6!0S dP#50x( 0R #0", 2R #,2$24"00 (2S W08" x S0! 2B 2$S\2/< B 2$Sd2/?L BW=SL5sp45 p`? ?`00SE[ 20$Sd2?/0?  (2$0C(2 2Sd2?/0?  (20C(2`D0P ST00$3^0 `0 D0d]"{ "{ `,00C[B @d>p ?! |"l 0AS`(( 20 2(2"0C(2 2Sd2`0/0!!!`pV0: 0H`P  D Phdqzq08PP$20$2<0S4 d> 2!S\2/0?! ! 2!S?ԀP5/`20PZd~>pz>0 0 t>=000$5S `0t63 03080D ` D ß=n(\q(`o(n(M>$q(Po(N NM$N0^00/\,$5St2 ` 0h pp WS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0P3 !D0 R  "0 0000 0 0P1  "(b2*( 2,20S x%0 0T20S _H ~P 2p"S\?"0STT< mP VVP2 H (0"bST 2"TS\?< (i0 0<30S 2@#S?d?0`#S\L 8P  !P 0#S\ 2#Sd2/?L c(90 0 ppS $S00 S0`@$Sd2?/0?`$0S0\0000p`X 2R`嵟\ 0V $S`0?0$ 2Sh2/0^>00p`Y7 0%S0\000S7呫!"TpW`l嵏X7 0%S 0\000S7呫!pWO-P`@DDT(p  W @qPvPA-Q0 % C@*r`! 10" q0SU 10aQ0  a*'1t10S H0 0T 0@# 03A0S4 \@ 5*< 5'000S  0 0@TP<UA7t0Tp Pd0 0S L P<0 0S n(n(%Po(0o(4o(P{PPS>h p@0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//$q(O-x4MP U dDddtd`@qvL:8D80ŏ 0 P\kP SЍ ?u70 Pz P\PP0S 30S30S tOl3l#0Sd `#SX{ P L0S @;0bS  s*1$0S @"\5S 2 2\5\5" 0C?o"20Qh [řT24 ᕁ(Ud $2 ?7:010S?, A!(Ÿ0#\ P  0B ? 0Sf0S c0āh #0S W|!\5St1\5P l10S(` XA! L!0 0@! 0 *# 0S +0 0 00PX@hPİPPHT* 0R A To( 8q(o(q(nRQq(n(/Qdo(NQLo(mQQ4o(Qn(8  q(T$q(Qq(`q(n(Q0o(Xo(\o(q(Q)R?R 9O- 0*MM08PpP<唭 M80S 5 :P<偭 p0: S X ]PލЍ48H0,hSO 0)00S 00 78 7 $9   ̭` ǭ8 8 㻭[V``Z`P`L7VD 77P Q P ˩H8P0 086 R>0 0p 0<&0&0P7p0p(60pw>0 P0p(2S# *37P *.7P *.pVXZ hY 4[ 0SY?관X V. 0:  t6 <0\:P$V, Q3C ?C5rPPe 2S|3%8 S20#"20$#20PC 2SB4$040404 `02P&V20A2\02@2 060C`6 `Fb 6 0| 4H  ?`0PtT#0`P\`Q=S/0P 5` ( 2RV0 S0S9c 5*< 5!3 30S .0 0`20S 0#0 0R V 10S `2R\\0SDz2= C ,0"00 00t 2A(07# l0`0S10S!0 R=S0S lC $0007 p 0L%000P%X30,~9q *'! 10S T0 0q(Do(RHo(R9do(8r(RRo(pn(`q(RNR4q(8q(R< *S3S^SSSSST*TTnTTTTTITUT1UYUn(URUU!VUjVAVV8W[WPo(~Wn(WWWXL`o(Xn(q(Y@o(-Yn(Pq(Lq(Dq(Hq(Tq(Xq(TYX,q($q(To(^XzX0q(n(o(0o(q(Xq(q(q(4o(XF=SZ0SR  0\p<<00P%X30* 0 |00S 0 00S5 0 >0S sPq 5*N> 0:#: 5q (1g 10S 0 000S(OP0q0*Q 1G 10S }0 00<cQ/,pP 0r<0*1 (2' 20S ]0 0倂0 RL%r0L%r0H00q" T 000cH00SP<Pr*220S ~+0$# 0 00L40q"  400cL00SPs*330S V0# 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*d4\40S !0$ 0 04t R,5S0%45S R! t004e0SP*r$5h50S 0X% 0 00刅(0S xQ$ U0S< x 0(%0S8Pȅ*E5;50S q0 & 0 08%<5HSR$ ' H00850<S_TP*6 60S C0& 0 0܆@%D5LSR$  L00@50DS6%P<*L7D70S g0' 0 0 7 70S ,帇 0R" 0Rz7 0SQ `@ᎩPLX p 7@ Tʰ8 @/  @!. A@O@@lP 5  6,@u$)P0 ( 8  Q DI ϠR 5l)p) x)V)pPWP)pp [ 9 z1 P, P'Qڨ0Q, C 0 0S sPz*6:, :0S b0H* 0 00S S0S0QQ 0 0S APz*::0S 00+ 0 0P R0Sh R0S R0SQ^  "Q  R0S&! R0SQL<Qk R0Svq R0S0 R0SH0085L0<0@5h<D ,5S0SP ,000<0,5<0(5H04e0/85L0l0<%/@5D%0*<{<0S 0 - 0 08=0S 4=L=0SHm*fT=\L=0S 0Mh U=j P%L5s0SB A-000=0L50P5?T5V>X50$E- 0 0B0T ӣ1`R.B!!@tN00 00L 00*> >0S @0. 0 06P0 @DT@8 HLd Lc B 0b03"4@ `P Z( \?0S  G8 H4L0d @ B b"30D?0S  ,0p00Px6h@ |\6PPE ^0D& 5000460S 1S >1P  6 6 @Q yU @ 0`P @@  04 8 E5P l50S pVlP 0 0  `` 0  0 0 4 8 P 씟 <0S_oP`0 4?s0 S +0Sc^Pd0 4?s0S `p0SfDMPg 04?s0V:PP/PQ 0Sd2Pe000 4000 Py c0ScPd0 0 0ipP0S 00 0 0 00  P0S 0 0 00p0  0P0S 0  0000 W0  0lP0S ``v0`#40  A0  0`qsP0S 0@00.0  0 1 1Q1Q,+ 0S kA 5< 0!00|!0x!0(pCSq #0p R0 !80Bs00WP CP0S0@PT0 Ql \  E/ !0!X< H!Uq(@q(n(# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT\n(\q(4o(0 \P/Q/ Lœ0|   ,PŒPŃ ,TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*3`30S '0P 0U`dSTS嬞Ps妞PUU00Q A'P 0S ??@t)凞ᅞP`"hR0"00S8 lr003Pb0S* xO0S* 0R0E>0*X4A 2p610S l0 00SK\P10S K 1TQ `1*X1` H10S ?0 0H10S <J (1P 0*0`00S p0t 000S d0P` 0ټ 0ڷG׷,q(q(n(x(^n( Wq(o(0o(G-`pM0/10SPvP@p1@61001000/0 0  0    0P@4P@ 00 ?U05:00 0000P00S AЍ00 ?5"0pp%&` ' Xd00 0a'%v 0S    $q(e_ 410S tB$ 0R00 00?000P+ 0(P0$00 00{ $0 0{000 0 R  000`@`00S 7n(QP>q(_n(A_A`C``_>`4o(^FF^i`$q(x(&` W`LO-1APQ P1a`3$MS0_ 1P11r00`[00 0p|000P0@T <ױPXpXT 000/ 0cP'0Ġ[@  0S A  NP PD0$Ѝn(7QP>q(n(@q(` *`n(-a a0 @0SpP pn(^Fn(3aFOadaR/G-P `$ 0px@V` 0q@`` V`@&!D( `G-@P4S `$pY00qzuPt t 0 0! ##P @?Ѝ_ uP :^F: F^p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@40P/ Q\/O-P5>UM 1 !  #0@`Spp `J 0 U 0 0n7Π ^ÌVQ 0V>  0P" G`p P b72 R0V1Q0V"0   P 0 P$ ` U P ``Ѝza J a0A-1àQ`P |0| ||"0@Sp࠱ P$` p@QL ࠁ PQ zaċ } ap@-@PaSl0l ll"0C800S   0[0080P4 PR*Sp0 a׋ , aa2 ,0S/`0@-0@  L@,90,0080S 0  M"0@)x(ba a,0@-S ,0, ,,;"@TP @b  aO--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D5@D0  0 00Pұ U0#03?\[[UXㄐ `0P$0<5Q 4己O0$0 ǒ=D 0XR @"!L0<p(08p$0 0H(0 0 `,0`4  0 4$!HP $0 PT40  (00 0LPv,05S00SUSP3S` 4 $ `UQ!V  0" 00`F<040 C@004`300DHpL`<0@ RS80 0 ,H0PpT`_@P,Ph3Q 0Q+ 0CQ 0SP THpPL`P@ ;T@P" P0ۏT`@V !")P` T@!"00P0 p0,03(0?D00T P rHL PT0RP H>t`0, S24040S@p( D0 0 P  X Z 1!< (H >`400 0Q 80080p0?(00T` 0RZ@p (0 0 P 80S0 0C800S   0啑`|O@  D e$@$\Ѝ0$0x(8bLBAWrbb abb! NBAW#cb4 aF  cG-0,0S0  P@`00qW40S*OЍ!  0P@P   k@Pp bX F aA-`0@c,0Sh0h hH Pp Q H0< D 0P@DT@ bk aCca C-`0(Pc,0S0  p@Q |0l x@PEU  0P !  0 P P Ѝ b q aCcs X0sC-Ђ0@ P@` 0 00 0ᮯP 0Ѝpx(q(YcX0sC-Ђ0@ P@` 0 00 0ᓯP 0Ѝpx(q(cA-0PQ s@`p0P R   T0! o@P 8P4P,do(x(cx(dcF@-,@P,0S <00x(@-,P ,\  D Ѝx(p@-P@Uh0h 0 SX0d0R 3?p@006.4 Q#3SRpp$q(4o(n(27@-0S S+,Ü2 R0 ELi `Q |x*PC㪬aQ* Q( PDP <4B 5*< 50d30a3 220S V0 00@ @7.Bp#x3 Ŝ ' 0P `XA 5*< 50d381,10S ! @0 d3S, CQ,aQ$ 0AS#uP z0@a3d3*t0jt00S  D0@ S Ѝ04n(x(n(pJhU^iziiiiiiG-`p@MP\@P l@TC^t# E@0$4$ 0840 ;p+Cp YcⰣpx H4$$: S! R B.T ⤣pD $4S8 (4,$0.B.  ┣p 0 0"dR04<,$$4(4$t0K>Ѐ 0   E  00`d$t؀E0  P0`P 084S   0p 0ep 0p pp{ p 0pps P P 0" RPp5:Ѝ Z0pY"jjj"jd@.jEjd@\jrjjjj@-@P 4B BRP p 8O4  YЍ@艡Ѝd@ k(k@-@Pp P P#4PS 4 nkkkA- @P0TP p` X` p0 pkk$$ QEAS 0Ŷ r0"(Ѹ0 / 0T 02 /$4 0T1 / $4 0T1 /O-`P@p M6h`#P̀PP `00000ᘦ따 V:Ѝ 1 00 0P0ᇦ`P1 0 0}P UP1 lFlP*&'lݰC$$0A@-P@- x`R@dfЍpP <P 4Y R 0 @-=lYlilO-P_o!R0`@tMR(0S00S "R0oU tЍP PU 0SEpWB (0WS>!RSR6"RSR.pG/0[ P# 9/p " 9/p 40 P m0 $8  P P  P ylA-@pP`P 5/p 4 5/p 4 lC-(00pS4P Ѝ$d@ 0   0d` 00  0 `WP lllO-0 0Pp@ጀ儠T Ѝ` =P `V DHp 0 @@-G+ mA-P@$`$p0 @wT 0mO-Pp$M `@ȀP뼰0     Q   x0 p `p X0 X p`00P0  $ЍF bx >mO-PQ@04p 00` ЍP P0S* E l`P0       04 p p#p p04pp  EmTmsmm0s@-SX`@ Pe0 ?o2R0S  Ѝp@-Yl@- iR sR aR p` 9imp@-P@P (`VPp Jp@-mp@-@T 40`PPBpp@-miR@-- 0 aR bR LR( .sR% tR@P 0P0S`00p`(j0 n@-np@-@ M\P`NP0 0͵0,*0S $ ЍpF0n-G-Q@PM Q  ЍA~␀ p$`P phB~0 00 ` 0PP 8nSnrnO-$M@`H%P 0`$ЍPP 0 0 !0 $0Y!<#P0*\Q P0 0?Y S0SXP pY0 P pE04 PU 0pop $ fP 000 00 pP ቃ4   \ $  0V,S( 0 `$4 80p{ $Ĕ{%!#,[PP { T P R*L0Sg 0p^ L004 0 000 0/PL 4$$   $ 0$$?Kp6 nnnno5oUo00S 0@-@C^M E$E$$0  0//P/Ѝ0 @tq !ס"`#XT 80 : @ɡP8ơ\#&x |pppppppqOEq-q0$ 8O-`DMPp4 2<0  p 0S8 ! R4!DЍLRd a0BS)S&hh<hPhhD10S  0P 2@P   "[q@ Pట c T 0 k0@  T n@0  @ P@pJqnq\#&4@-G/ )&mXqA-p`(P@P0 p!`P @00 0$0@-@P$0S @ O-sisP/0S//P/0P/A-P`P P@ pRQ  P`X R T@-@,MP@p`WP8+,Ѝ $ p`P r4n@-X@ P HHH0H@@b=@8P8`@AT1 TtqttP*&tđ >R R R @-@R R/////t Rp@-0@P! R!갏0DDDDDD RꨏD(DDDDDDDD pp B R"Sh 1@\ \剝T0 L pppppppp$ ux(uO- 0`<@PP Ѝ0!S R m~0Pp0(P\4S 0<t0$$ 0P8 S ~ R RP304S ڠ0"S1@ 0 J  403/p 8 H0 0($z P  P 0$ 0 0S (0, PpWuWEVkuu$ ux(uO-0P`p,M$0  ῆp@20S$`{}P 0 0!  pT AT fT h@,ЍsT00$3p0 0 00@! qp 4 `0 0p04S 0Q41!0  R? 2R502F. Yp p 0oo`@ !Vp@| R@ R0R R 0S\0S0  00` 0` 8 H00 pppW$00(p,0`u\#&u Ē $ uX8 vu$y(u,A-@ĔQP MP  An``llph`piP LЍp ( 0 9vTvpvG-@P#p% U4 d! A~Ⱀ尀 p $$ 0 P ! `" $`p  H00`$B~ 0 vvQ O-M@AP`BPl<8 40$R 4S Ѝ4SP 4SpP  0 0"VU / s $ RQP  U05p 4S 4S  0; 4S5 P; 0  0pP ,  ?o  0M0 00 pzp d+ 0p80Pl vvwHwggUg{w@-20SK@0SD00O@ DP 0SD0SA \^<40$ 400#qpp, 804<0ZP$ 0I,0  dP ~bU@qU PH04 8pPTЍ0$$ `VlU0Y `0 XW0 0 0S" [ P70W0 000$0 0(000qpp 0 QP Р 0Z)p , A#p p  $ w\#&| sm Axx!xO-@PDMCnp F#d ᳃pL50S <'DЍqP sP 80^p#  0&qp PPp0#F0$$`P P  0@l<0P0  0 <0 0$0+P $P 4  0 (0$0,0  4 PSs 4,  (WUXdcP 0T 1"H0 0 S :0 U 00[ 0 40)P40 (, [0V [(Q,UX? U0U0Xd;P p (V,#X0. 0:p8 0  U  0 0LP\ Q QXXx!!  p4\ P 4 "$p0 0S 004  $ 0$ R40H Lp $01S0S p0`v0&h$ r/0$0s?`}ph7 4$$  o x\#& xxynky;yRy| wyyyzy4zRzC-P0 @p`$M!!ᜑ P 9p*0S00 P 0SP0SM \^H 0T' 10S#!Q` [.NP. a@ P P ,\444444t44TppT T  ,$ЍP`pz\#& >p@-P M(@,`6#"X0^P0 0͵0,:0S 4 ЍpFz-@-WM M`pz@T 4G0S @^< P 0$$ 0$$0 xn0 ixP x xx 0Wlm0 $8PޗLܗ#<%Wލ Ѝzz{p$OE>zH|||zP `00CS`0p S00 P0S X0X /X)&@-MP@a qPx꘨@(08̩0Ѝ@蚗`喗 000 010 0!pp↗Ѝt傗`h~ 80TPL0 0 $n0lP 0  @TR Q2P  Ѝ@QO $m0 8 00  T ppx61S1SDPЍ@){gOE({{.{={L{Z{h{r{ {F^ {){{g{G-PMM`"  "  $X2㬂@r夒TݍЍ    % #`Vj L  .  `0"E0 B@BpP Ɩ0S8 1B,B⻖B Ḗ嶖 $ !P0#ŨP%$ !0#X堖 m0 $8g4喖0唖#$ bv$@B凖 0B~ {   0S 0CS 080  d 0aaa11b?; {mj{{{OE'|{$>{dy({R|F4nz||zG-0p P`@M!ဂ P pd20S$yPD$@6 lP`Pa@ P$ 4uP xP @ЍPP pFPPP0S00= P 0S0S \^ 0 Q  Ε ʕ#0p帠W ṕ ᵕ Q ᬕ   p ᜕|\#&|И ; {mj{{{}A-HM@Pp4  `41 0S1D0 ~p T  P 00S0 iR TR a0BLR NlR s0BST pL]HЍTp| %}2}\#&X >0 Q /0@-$M` 0 0@P!!dq ~p$0S00b P 0SC0S@ \^; 0T 00S!  0*a@ P ꌳԳTt"pT T   D$Ѝ}\#& >000000000   S /-0,M$00 0 00 00 00 00 0 00000000 2,Ѝ}C-` M @ P   000sS 0lSp` P$0㓆( Qp lp P 0㓗) ;p ЍpW`Vp C-`Pe$9C,ś ; ] <)&O--@P`؊zM zp :0S ЍO 0FS iS:C>`C$TSP YL ЍEP@P Y7P9P`0P0 4_P000$$ TPi_P p_P (0&TPLn ki 80 DP $0  O Q4 FP 4PW0P 4 KPq pP00000W000000S 000$0^P X^0P(0 gPP <<<Mj`P Mj$CpPP0  4 BFP 4`P `P @ DPn H yDPh @0 SD00H0 RL0$ 0`` 0 qp<  R$4 "#qp 0`~ ݊$4P `$$Ҋ$4P`VU^`P Q^P a|&lG^P SgP'8,0 i`P i4&? ` 0qptp DP4p o  DP   DP  DP   DP   DP  P CP q8 CP    CP q/  CP r CP 01S 0r/Sp, s? Ѱ  CP s/ CPz$$*$4P(fP೟{ 5i`P  5i$$`0 )qpS, p0p< !EPj <pP < 4 < EPZ <P  CPO  CPI D CPC 0< DP $ <!8 JCP3 8 Z* 0d$ Bp $ ้P$4 "`#qpp$ उY$ 08"\T8008$00(0 0 00$0 p40P0,` 0$00 P00 T0nXj`0$$qp$$g$4P000pH00L0`L$4'`q#dqpg$$G$4P `c\#&Л @-gvX}IՁ$>eۂC9L| ; ]AgYgUy}AU`m|ǁ <҃0@-@M P y ֢ 0 0S`p< < 4偊p$0Ѝ0 A'iM@-SM@P, D0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`p  D Sߍi@]ii!iu@-@   Q0Ѝ10S/p@-!MPM@P% PA. (01+P A!A垍P8 0`0?oS c`2 06P. 0I0凍0 0A. 00P0P A [Ao0 000ZdލЍp`]0 0A. 00PH0P A4 41A@Ev`y(8(Fلw s@-6PP )iP " 0`@TЍpP  00SQV   ƌ@ 0 R !O-M@ Pxp1p"`P"    4[P- ^-[P:([pP ^px![P ^ \@P 0"h 0R00  p!  @Pr 0SohQl @ pal ^! R R RZ  0PW l Z XqX (s<hW 0j0S, @ hΈP@ `Ȉpd HQ L 40R !01Sp0S 3/p\ U 8 X婈p \ [ 5@ `圈p Ѝ AYE$N2dA-pY@P@=ZPPY[Z PdeZP e`Pe@- AP ЍA-MP p[@@P00#p`ЍpP  z0 7p !0  A i@-@p @A-P`ZpPA00]P@8?0] 2 FA-P`YpP#00]P@:?0]  F@-( ?P00 Ѝp@-8M@ P?P 1 ! YP c]0 Q0s0S00\PP  Y@cDp g  \< PY`cV8Ѝpk  ti0@-@BM M Y ?p 0S 7  /  0( P(@0S700$0/ 0h (dP(@0S Bލ Ѝ0@@i 0@-MP*Y@P \P Vl0l l\ 0 0S ,p宲Ѝ0赅 ti<@-@M   pЍi@-M @>PC0 x p  1Q0r R0s04 1p`Ѝk ؜ riis@-`Pp@ @@>P0 J@PhK[ P@ LB@XP 4 QkЍp趆 r҆7@- P@8pT T"L{X P@00 <<Q0400X@ Ѝ0 r7@- P@p\ \0H@NX P40 00$X@ Ѝ0 rp@-M`5XPh0P0Ѝp[P@Uxh@Pdı0 D&p<峱8 P@ PP jD-Fi]@-$MpWP200$Ѝ[`Xh@Pp 0 XpL僱P@ P`@ p$}jꤌji@-Bm ЍF0@-M00 0  PÅp `h@PM ` @岅pp P0 `pR00bS NjU 1Pxi ʇ$s@-@`)PP  ,p m0Æ p@-` MP@cWP [ Ѝp P*    Z  PW@aD꺋vi 0@-,M@ P=P0   p,Ѝ0 0R0s0S 0 $0aZPP  (lW@faD  frp@-P(p@`@@VPH0H HHZQ P 劰ipY r@-T @<P 00Ѝ  p  ch$ $@-Q(@-M T@<PD0D DD08 0 p$BhЍQ  2 ri_@-M T@q<PD0D DDk08 0_ p$!hЍS  > rim0-M $00I P  Ѝi]@-@0eV P$0$ $$;V@G r00@ P/a CRWC/A CR=C/@-y00@- M@ %0( 0 pѯ Ѝi@-PM `@@5r{G 8 8 ⺇Ѝ$$; ?Fxb@-@JUPP 坯mtpPL``mP00 00Bt0@`Vm`]` PT0d0X @ @@@@.,`&03/`T p%FP*&X////0 L0L0/p%0 T0T0/p%0 \0\0/p%0 D0D0/p%0 d00d0/p%p@-@pP 00p00D S 0A0CS0$PC>P 0@pp%@-p0y( 0`P/ R/p%0 O-4M@@!2T0.  DPpďů 0$ (`pVD@PT P p1cehT6l PP@ p 00JP`p R  P Q R/6 0TS $ P\(P  1/P ⋁@0S  Ⳃp "SR(0S`{\ 2/P W0 [  #y(Њɚ;ފO-MMPp  X p`%S pP$ 100$0 :-C  ⢂p+f ؚt ╂p Q X' 8 p$0Q $_ X@T ⱚX00@0 0jP@S 0 0噚 ,0@4@Sp 0d0Pl0q 0X 40,@DpDg 4<ׅf0H0S $P31ȅH0S=I0S:Z`@T 0 3/@: " ⴜ렒M0S:00 % p"姜pM0S  ᗅ@ Ꮕ@03/@r J&I0J/pNI 1Rla`"%J` 1 0 d1 T|p 1 d\!1 HJ`@#%Jr!1 @ t1 x!|1  P@Tf 03/@ 03/ݍЍZ Ai~ip%ifizy(؜ eGYihW ʌӌb݌ O-@PpP  p T R@RPT!ͬR`P \ʬPPU D1O0S いu]s]gkW VP.Z  OP' :P! K0S 0 L0S 0M0S 0 N0SO0`S PPV < # p y()&@-,MP@qpP RP`(  p0S hQ H>8P00< <E0 $7,Ѝ2<(8i(<Ц If@-P@D0 P#xG-@RPP0 U`@ Y㔀VpVܞPP  ḕpp H H@@@e@萐"S 2<(#xs@-@{DR@Pw00ЍpUPU᨞@P <` 帕Pdu ې<(s@-@QR@P|0| |UPU@P T` 叕Pdu( iЍp"S <(A-@"QPP0 `@UUNPPp Dp< >FJN@\"S <(@-@ \7PP0P PPL 0 S@@00 >00Ѝ  <(T"P*&0@-M@QPQP QPpQP d0P P P P` 4PEp  Ѝ0\ې<(7iAs@-@/h UP LHPH`b P! ,Ѝp@$N< G+WG-M`@PK ZppP"˪(    m *p% (( px" <@T t8P寂l2P\娂 UR TЍ0 PDpb@P㉪ $@~p 哓倂t 0R wk)0 .` `pjtQp R%P\` mKP;ЍGjcQ\ 0Q    1 0PAP0 RSD 1/ # 0` R P U 0pD` P\\\ A8i(idt ~<h' `* >Fb< \ đPp@-P`@OP V  P`P Z`Zx 00pOTpZA-@T e00`Pp-U0 p `@@-MPPI00Ѝ`0 00p0@ 0 P LS0P1 0 p 0 `P0G-@(P00`( V P1r0Pp*0X!U0"R0 "00"SЍA0P 0 , [p 0 @0@-@P Z@ O-`@pP,(0V0S 8_P$P$P 40S 04S 0S(0p(`8P0S$0(P%bO-M00 X$000Ѝ 0Q`?  0Q> 00 $5PP; X/ߛpP ,,pAA,4@[T /7@P00 D0800X5Tj (ea( R R[^"00aUx 000 Po0"CQj BQf Qb?5^ Xp_PPV  Ჰ$pP ^Q_aXD 0  Bp= 0STz 1PP]0!/8!10#R0 0k8Z7aP Z@  0YPH@T 0CS 0 0r xC0X0^ :T 0CS wR0xL  @0aD\W@DAD\ 7@Dt@S 2s0@0t@0@Dt@ T130~Q@`Tl p˧ NP{X< DwX0 0 0`0G+2 (h 0҆A-X Pp@`P300d<0P* 0 p 0 `P0O-P`$M@ HpX8 P W0  rPp` 0p0  0P W:h W`%*0@D@PW@DB0LWLt@| @t@@P1&1&.aEQA-@P00S 00QQ0s0S Att*|p0 000xSX!|`PpV|`   @01&r1&p@-P M@ FU U( 00P Ѝp 0TPTT@ !*!0P!!`ZPP  @e 0A-p`Pp@ @P(㻣 b AxEp@-@P`M   `ЍpG-SMMPPx!x㖣ppX!\  p@!H F/ m$@T) SލЍ`P 0S0 S 09(00 1 ,0wpS[@(0#70St0 00#00`X0`M/P41S 80X4M/,?{0 Ai8(yp@-`M@jp 0+SЍpP  a  ᾏ R # <uwp 01S 0/S Z3 i 00S/@-@zy(A-P@`TpP @ 0SP P*&ǓA-P@p `PW\嶢 TSPH0 000  (p`1&:i@- M @pd d喢 X.P!00 Ѝ0, 1p~H 9i"@-(M @p m S0P00(Ѝ I00S H .P02 , pGP AL9i"@- np 0QSЍS   1z.5/0\ S $S DDD S/8 S 00,/(/$/PPafPPgn\s0p S $S $S LLL S/@ S 884/0/,/(/\fg|ansO-X`@p1!0R  P A^QT XPPD@YZX80PE00O D [JP]@- M @pl嚡d v-PT0T TT0H 0p@@,|Y Ѝi  i@-@(M!  0P p< <^4 p[(Ѝ E  i@- M t@-Pq`0` `\ upL 0@ 0lp,4 Ѝ ! iiA-M< Pp!0@P "` # 0(0xp0@`@$`<0[PT100 0(000804 1p' R !P@0 @   :R@p00CȀ0 0p0 8Ph00ݍ@ T0S l@ 0@!P0  S  0/5 #6i8g>1&G+G0@-0Mx @ pd d㘠]q0PP  041p 匠0Ѝ@ wiP*&A-@BM`(  XpP 0 P P PP  8 ! ll pz l RFOxlm U#0P 6sp 6S30S |8x0`P 6ap 6SP@30S <&x 0P 6Op 3Q? xI0P 6Ap 2Q8 x8 K 1p 0S0 w8 &pu p p p 0@ TyPpD2Q <wBߍ10S w10S ww0  `0000pwPU0``0` Rڬx1000 0:S R HP8w`p$PQ wV pWP ,Aw=}wH0S Lww 3w~rwpiw`0Q cw w8i(i]iy() Ėi8iiiK ͖Ԗk]1&6ܖ'h0@-@Pv$O-PMM@ 40L004 T4P妞4'S$0P0@ 0 0 @PE( 0RtP 0S0'U 0ʘ9 0909 09帰0|90x90t9v(@!!0 P o0 /C BRZ      -B 9$ B2"! 0P PE ^r PE0x800IppcppCppPpp Spp@BppA`\8 0PP08` 2v!0(X@"0(0(0S@ u0$ 0B'S$0؍Ѝ 0 0'S   BS>C0C''S Q:ǟ"!! CR   ##9C0C<"!% \'S>C4'>C2"" N=C0C Q 0*S ;S. RU 0C'S񟗥586@65586868686868686868658686868686868686868686868686865556666 6(606S01/1///12S# St 0S R SG %SB 0R  t t0u0( 0 B( @U0S 0S| `ppvullllpW>+u 0R 0du`00S  [u0S `p000 Nu4H3ट娀XP0  @ pЍM  ә 0 /4%/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0g-@-  GVCV ЍЍ/@-@0VOoJ 0S/@-(-@-  'V#V ЍЍ/-@-  VV ЍЍ/@-\00S 0  0000 0 8UpЍ([@-@mHmmp0npꈯ p@-pMPP2 P0S 0@P 0 0 00 0XTp DlP@@ ((@,P0P4P8PS800!031 0@-Mt 0+T@P \㏙ NPLPP @ (@@ 0TP 020Ѝ08%#(@-@0P ,&r  roP*&P@-d0 !X|!T@0 6p0\ (0000/ ¯ Ph0h@-` |!TD0 6p0\ ,00 00/ ¯ P-4s00#q^0<\ 0000/ᘯ ¯ P 4qs00#\,s0Q00/00꘯ ¯ PL- 0:# ^4 0Q$0000/ ¯ PL- 09# ^4 0Q$0000/ ¯ P 4 <# \,4Q00/00꘯ ¯ P@- 0:# ^ 0Q0P@d|0:0# TDD#^<s0\ ,00$00 ¯ @- 0 00WnP Ѝ|A@%A-Pؐp`@WЍ P 3MP@ p7@-P@U0  (◅?Q Ѝ0A-0@nS0oSp@ pP``QP"Q0nS0oSRPPzRPP'G+@-e0 pm P*&O-MM`<(0p0 0D@00 l0 gp0S SH N 00,00 Bh  gxp@-@PP (80/Spz-p@v-.@- khBP*&O-p0000@P`ᜐ (,唰00 Tp0@DTq oP0 P}P<}9 O4\#&@-@-| `@-M@A>0 0D@00 l0fph0S SH aN 00,00 庒sh< gxp@-@P{P (尒0/Sp,p@,.@-  QhP*&٤O-`0@P(,p娐娠娰0 Tp00@DT oP0 #}PPx}  %hA+XO@-\ \#&`@-MM0An H 0P0 $@ep Lgu p@-@P P (>0/Sp,p@|,.@- jgP*&O-P@M P0c`r"Sp)20 R. +x   &  x `!p 0 *00)0`Vp4fpz uPfPMP9 9P$ GP g@P@`____`T`_|`___``,`UP|0 0|00|0|00|00|00pt`x0 B|P嗑3|~Pyep Z,0p0Y00t0V0;;0x0U~Id$00|00|000ЍY00t0@-\#&Sl `-MMJNP0 @P300 |0dp0 `M0 0N/0 4 8000 0@(fp@IȀ(O-@H pH 8 444f Qp60pGWQq 2@FPffdededededededededededededefde,g8gdedededegdede4edededeTjdeljdej kdede kdedededededededef g gTgdede`gdegdedegdedeg`jfjjjkdejj40S = 4 40S 4 0<007aE08:h$0000000D30@90;g)P04P 0I 0(80@008 0szPPȏ0       +  @   ' B ,# R#  # R" , @ ( "  )            y20  xy0$000 Ty0 000 0y0$800  y0<:00 y08:00 y0@900 y0,000 |y000000y0909Rf01r`0$000 0 0tS0,0wL0 0xE00007000+040 E Ѝ̙%-%@-\#&((( `'(5  %%A-RMMI>0PC@P@(0L AH`q刁( `L0ibpM0KSh0  R < (Lh0('Yd0 堎( h0N/@  0PP ` p,P.`0TP P T0f0\ $00X 00@00\0|00x00t0 0p00l00d0jfRݍЍ(tz Up@-@PP (P0/Sp(p@(. R R @-3/n0@-@MP`p 05a000 bbPPЍ0P0 0 03b0 a0P 6s@-`/P0@00 `P0 jTЍp0/s@-`P@|00!  P0d RPPP @_@] 0e0ЍpH(z (002P0/@-@BMP' 41010 0000000 0P -H< 8e&H00BߍBߍ@o꠆ H G-0@`p8Pp3 pϿ| D0Dv4<40 8p0m,j<0(000pE040p<0< Dp PH00ЍpPPL PG Cõ->C?XᲵ9>:>C᭵?n:>CFᨵ 0? AC>៵}C>GᚵmFᖵEnFᒵE~GX J.X R  $$((,S>,n}S>GimFeHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqx1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,⑹2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P#‚ 0Px 0c`0報 C cà00d0 PS C cQ0@D@ @00C030S300C00  0#0030 3#00020SNd 0@ `?50 ST0T00  B 0Pe SX00԰V,ڨ0d0? 0 0@ `5? 0Ϡ!Ϡ<,2  0! ?00C000 \aS T10S   dϠ 0@ `Ì0 1+0! 20Zb\V40A8 0 B0 080$ 0C $ @$  $ 40040 08 R R` /  1> ( d( (U uP*& %p@-Pl`0@S     @00Sp0?00Sp0?0p % (t0p@-0`S[\@ L00S000000B0E0pT( %O-MM┵p,@e p51n_R0`PCSyqD51~WW@ ?F 0SB/~F? 0?F4Pp؍ߍ B@DŒ@0L 0@?DKd04 0BP0 0 SE0KSyq441:WV@/0p22220B'oF0f? 0 040hl @@D@ 0L0@?DdK40 0@ `4 0@<0#p R0Cs000 2s00Vp`20S7w 2袟 0 000p0u  `  Z XZ0 ``a , 2\0Q0@/,040<090(08? $0KP `@.  0@őD L 00 /4;0V%V 0d0@ 0o} 01r 0`W Vp`| 0 /\0X0`0d09{0?{{{{(,0 ` 0@Dő L0 0/4;$0 AVU 0l dh 0@ `Ì0 1 %(d(Ap%%D( (TO--)MM,0=0?0(8$0UD0D`0S> 80pW:,0 0  0 FW(((H(\(P@P`P @4v P@  4lpU 3E_p@ d3T@  *=SPp * =P tC(0S0,5 Sx0<0(5002 0,%S0022Q042Y] 0Q*YUxx" 0 04 0A XYG 040A 8Y> 0 4Q Y5 00 Q*Y, 00Q(X# 004 QX1 p00W/0G,\3Sr1\sƐXX\1X0SHX X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001X p4凐P 0d0 a 2! Q$ \(T($%(%'$(0(Zݷ3(((nH(T8(Dd( %ǸT4(,% (,(@( S,QdS18$Q<4R:t^X  @0p\5?>C00#!3x000844$0<0t D0p@p/0|00pXsL5P5 P4H   ?*8@`D ?# p?`1st00F,o! L ϧ !>   0%8$4<4RW#22 p84<00x 0 08SoPM @P@0 ? @P0PP* ?@PP(5#R0:P@0$- 00Z00 1`%"0 ?001>0Z`0 c2# S,[ Q [3?001> !00   BB`Q0oP`0/2#$ 0  ?\V`1V`#T0`10F 0WI ?Q B@TP 0ἐ<됈  00B1  BZ1 ` Y"B !!0 R0C!I0B ?'0 `됈 0  B!ZӠ!` S1B0 S W9u @P`x1 F084<ĔCP`0S84<Ą-0$5BPS,`QɑRB@L0 0 0000x60S|0` ?HL404P@0 @6ᱯp;'!RLp00R  Q@~L7\5?>C00!#4t x0Zp70(1#T a2!, A3 31 0  @P0 04 `  0H$4  E$ ( B, @%LV.  R*h ,(b < 8( X @( \ H( ?.@Xd@+@B@A.@B,-8 He `墚 @40K `+0 ,p B8d A YZQ !0 XZ R Ŷ{A/  <pW $?.t{ 4Ą ß Rï80\@$D04 0H4( 0ĀpL2 R 5#< 5023pr0S+됺 z'z'{z {' 000d0 CSQ c6Rc(+S`PU @ z犸 z'(Ȋ0 (08娍+S,tU 0  R0:1P000\tP2#00@Q@0 0厮p00 R00{&$0 0Sb@ RU QP0 뀠@t9 j0JF 0{pK 0`0S>D(^Fb׹H(` P( z)&ht@)&6T(T(U Fh' T\((d( %ĺ ((8 ( `00S` 0 #$1 $0+V. |00S  b 0=S,V0S 0S0$0" , 0 B2\,(^   00/d A! a,3 1 !0T$1H ppDQPP04SP0 0R0 S00C0 S 0,00P0B 0,0STG p开8ȿ 0ᘥ+" < Q \%p#R!0@ (0 0 @DU`@4A20 @R40 `0```0T00m(s 0 ` pL3$,X0`0 I9pQ80< 帐 P0x0 0 Sx0x0t B\0X1`01Q0C00h0`0lR#00B1 d0R*4*%kU0   (0 0C0L(0( 0 R R` `  0$5S  l01` p0000S3d0%ST0T00! !0<%SP5X0`0`P5S00d0 0    0000080@ n`Q 㵋+H0H (DP+H 奋H000-ᴰR㰱 ,  BU 00n0000T0 10X0岑0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4400CS ~T00C@ 0`w`d4  80Q~T:  $5SʨG $`$`(0wV0S ,4 t d,04  0,4 $| 00`  Vj0S   0帀0 X#` x0x 0X\%Ϡ  R     dp 0G g!<n L9\%R Xi0SP.pi\`/ `ƌ$  $ m0`S` 0$5S  l01` 0000S1dѿ04*ST0T00! !0X*SP5X  ``S 0dM먐 I   C 0৿00080@&0C 400400T%*$ Q`?0@$00$0l0`0@hppT:S $S0ppS $S00S0`@Rl倐H)ꛖP00@&8p`0x1E@pY70IX!@@l00@0T: @5A$\Q 0@08(0  (0d0O@ 0NN nC 01kp0SH=0S0 000S.Q08C|M = R0/5,\%R    0 d0/ @ `.3,00 $ Q0000S0S 0,00C0S0 \>0S pQ0S bQ>0S 0ᅉ UQ00|:x*,8bP>0ScN C>`>0S303040404 0#pCVW*DbyV.P\oV.GV0S  ?0 PS?\5=S,??^ E?D0 0S 04 l dLĒH 0@ `Ì014 ,$0S0S 04 T d ,04 0aM 04\M)ݍЍSngG-`RM@Xr ByPP XxP`H `P P7   UMp y0S 0ߍ<08 H(00,0 000040!04 04$0D0(0P )WZ  -MpT h'Mp* \xX` 8  4 (     0,00   Lp 0`?`a8SkPb 0  0**0P0[f W 0* ]d@edA^zd@^+^~^<^N^b^u^^A-PMPp`;@ ip@P  P06PGKU 0 2 "0 ݍp@-@PP ('x0/Spip@e.R/4G-P `$ 0p@V` 0@`` V`@&!D( `G-@P4S `0pY00qzuPt t 0 0! ##P @?Ѝ_ uP :^F: F^p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@O-4MX0p0\00``P0 0,, 0S% P 0 KwmS;aSMSASB0C0b0C SSSU0@0 0DT dS$ 09R "P T 0U8$UQUDT P 0 sS @ @ @U00@@@ X 00 l Pv0S00 0 000 00P4ЍSr@-P,@ (OLP*&ܺt 0@- @   X O-@0p Pp`G0 00000ZI00SB_: W `B?F ᴐȊ((P0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@pȊ(0P  C @- Nv co`/, rs@-PL@` 008,V @ 9vЍp蠊(Ȋ(2 s@-PX00S@H0`ă5#040<t,V @ vЍp蜊((Ȋ(7 \10 PS/C-HQ@@MPM`6`@fa 1p P06 0 T:@6S-O@ ᒻ DD6ۍЍC+ 0 Q 0ˍ14 ^ 3?\ P;0Tֺ 0+ۍЍ蜊(Ȋ((((< G-lB` pm,PPH"Hu 0F0( 40 㓹06# R 0 !u0 :0C 0 !wu0006&0A06 0  B 00C0( 6V0:`8!D`Vp 0Q$&0? I0(0 6 C c0 0 &$&?20`L0V&S %Ǿ0: S((0` 0d  &ЍG9. R0Ȋ( ̻7%A-Ta00S FT:p+PP  0 0A1S0S. P @D A01 S  t0S @2106&0-06   B ! ! 00C 00Ȋ( [O-@PGM@XH? R`$\>t h2 XSQ 0@H0M$~H 0 R (cR 5-0$080ᐩ (030UC (0 , P(0,   @R 0 0 $0F 0༟0 0 60 6< 0(,(@2200UD ,0 00 Pg@ X% 0$|儌0@d0c<@LP6HG 0T00<0Lh5)L0S0c, h`)$<PU ٷP W  吩0L VR0400 & \`#  @ \ 110B0|F0D0$APpepeC0CP!P`\` :@/*P0  `p㬼 0 0d00,0\0000<402802$0 0Cs0<000C(00SE,Z`j p0S04#*&D:C7@ @< 4K) 0 ( "**K 6 !0H 0 09PpD IH&Y0SIp9 R050r0S ,0S fPI@ 00S40  (0Sm0C$0pXp<01 0`@Y80R\(0 x0S6 0Sڐ0S00 0  C02#`(0PJL8LP ppGPPXP 0R SHR SP᩷`@pb Spv0 0Y 0:Y:V3006弗  04(01 0媻0 JऻT  060 D7&0唻$(6Y:0TSL0S d0 P VX60S_pW}@0S H帮5L R d0 P# 0PDT%_oRU+XE᤻&0#H6 C 0 ᓔ)6  50 씟 <6U0CT 00C0CSX: B'p5Y1 21[0!!!0 Sq`$ ᓢ"!" 0d0$&S: 060& 0h0.pIxG{ 0W4#000848 0IpXl0SMf`F`VI 30SA IW LI3PU CL0S \0:`0 e PP1 P# z⸺p37E6|0X0000wE096 30JPp`DUIGq:` Ip` z≺27EX0000KEf &! 02/!"6 QP *dh"P P 0 |0cPPP$"u v'`Pw!k 'P  6!b!PU:< U*!:0U:*0 )0 xp*L0S\^U@!%8%E*0QQ:BS! 0  6PsȊ((s((ƼG%%((%QSN0((@((>{׹( ɾz)&ht@)&h' F\AKQvܿ t%%A% (Ȋ((d  0P0 Sp %p%* 向  0p1Pm 0 !GP `U&`060U/0 x x₹L0S `0  P1#'$/%\17DlgX0|0005D090& 2|0P U :0 `p 2& 0x@0Df?o2U+Du~&0#x6` c|2H H0 HDDGߍWAG-`RM@Xr pPP XoP`H ``P P7   Dp =0S 'ߍ<08 H(00,0 000040!04 04$0D0(0P D WZ  CpT hCp* \zoX` 8 Ỹ 4 (    0,00  ᘸ Cp 0`?`a8SaPb 0  0**0P0]  0* ]d@edA^zd@^+^~^<^N^b^u^^A-PMPp`;@ `p@P  P06P BU 0 2 "0 ݍ@-`pჹ   @P{00S0?0\$ 0S 0 nS\F\GL \ D$T4TgL|0 SDKT ЍE%KUJ%FZO%A_0 @-P LWGDDP<@i/0?p  @\0@ SL00ޭ  ?P $w 0 @ЭatePP#h#?p  fCAP 4$[H0aS 1L\ : SRQt9   W@P@0j V@r@DOoB@b } BP pY00S  CPL  p8P 3m`PUb@0D 0 t0 0$f@0D QP  D0@ ⼵80S}0x S10S10S00S11011|0 0180SK0 RS00 R0 R0S= /婸P; 0@S 00 T^wX0Si 1Sf 1Sc 0 %1C0S [  [ *0SR3#:\00<0S @!0S ۦP@ T <0 0P U8 PDJp8珱P@@11 1 1e000X0`S`Sx0S4\0L 0H?0 0Jp+ p`PpC0S)2p3 p1S?V?`#)&p' a1Sl)p Q1SAf1S Y #?p$ m 2"OKK@0DP?`|KL0OK\0K@L0 0Z0T0Q0S<K[# [ [ |A [l0S d/80S l0Sd0h 000@0D0 %h0S  d0S  T*,800S0 [0S0S"  0C0T }0#Stw#0S0`0S S 8g,0S , 0C,00`00l0S1|0 0S010S 1h0S(1d0S,140S /㱥40P(0&qB]0P(0 (=pp(f(?0P!* Rb R ᲮV000S(dR0(0S00[X1`$00PV`5U0000A࡯00Y ,`'H뀵U p⍯ $0 pSf:Yf 00|p` uU ?r$0`SM:(!@R&0S ,1 S&40(00p000 [ 0R5 R4*P (!RP5P"S4U  R,1SPP,Q,1p SR U ~DSRQ SP" 01S<1 P3P%P5 1CP0Y [  0D0P000pP1+!`GT0b#02b#b&$0X $0S [ & Y$: [׮00"P!,"T0 S :0㈀$0[î00,"P!彮00"P!? 00Y`T00 !000 30q W5j:0+a& G$  +! 0  r [\Q [PQRU10A+!0 Y0 0@c&0 t0 0 +!T$0@G0o0S1!YV*8 )$0p,4V1&iyBSyL#|/?&QsF0jxf &P*&)gfffX U8RRaArrAa [0 [00S$0, S00R 0, t  [0 [00 &cU*3!A$$1QR0X@@101S0S0010 [0]S 03 $!q515@000$ T0@P0S @1S,0 @1\0@ C?0X0 @>0!0E?0040@1SL0 P@X$! d|@hz@Dr(tbtRQr@p@,Qk@ '@H0S yލ ЍS03150q5 [ 1 1S|0_ ?H0#2;`PP ;hHo<?C#;X 0 T02#H0M$ [00H <080$4s0`0P0#4s0d0,0#4s0h0@0$0Q l #   Xt  0|04Q0X080 S ,40S d8 80 0d 0h@0p$040S& [",q4 0W0W03 W00S pZ$pp帨 0S  p:p T  ( ) p Z [,1< C/oS" R `0 [ 0$0 @ 000000P00d00,00h00\0001010100L0 0  1$00(0$1,0J?03K?03)001x 01100 0$<2?@1c4 04v 08#$0 #(#<l 0 0&>t ?Q X0Q40S00|00o0 00 R  ST (X˰0'?   :pT TS `(!R R S 0 S7071011H0T RZ*JຬQ\0 [0 0+ S  R   0S* 0H0< 0J?oR20S R(0 00 25 010 0P B24 0180S   k B*{@- S-k A 8 / eA@00@- 44@4P\P 0B"" )-@=B'@)0/p/@-  L?F<uP*&G-`@ P pί!>0P U0 0   P@ GY 0P\04, 0LZf R 0Sf U   )@-3s@-pP@ 0  y9X 0TT=LЍp  P `i90 =)$()M@-03S   > ЍU$@-@p$M0 0S ` P1 00P 0! 0=))=1 l=9\=9L=@DpQUVPE:$Ѝ=]0@-4M@ 0P0S ,Q 0  R0  7  0$4Ѝ0@=R  (  0$R 0S 0S 0  ( 4Ѝ0@w=4Ѝ0)2 @-@8pbe@)CD@-0 L@ R0* 0s# p8)P `00CS`0p S00 P0S X0X /X>)&p@-`į@P8!R#<10 <10 .810CS81V <1S 0 <1l0 h墡d堡`0蝯Pp <10C <1$0 810S81)Х%)&P*&X)0@--@4MT <A`<d<hQ <`"R d2RK< <d2SA |= hk0:{PPS['ΞkHk>[E{781 < =2 * + (+S  PPP< 0 @@@ zj{ k{[+S[<4Ѝ00B:k{{'*k{d+S<?@@-C6?Y@x)])zХ%))(p@-ㆮj0d2S:)@0@-0S0@d2Sp`2"R2Х%)h@-@ 081D 09t,  t  t  X0S (8xS`S)?S DS . x000@Sz*P0C 7K+ C (K0C+ 00CS00$Sa0CSH'@&'T((@&@&)@&@&@&)@&@&@&$/l/@&0@&@&/<0/   PK 0@P* 0@0 9 90Sx9 00K  K A  8 YPK 0 Q PK. i8K  ֣  <PpK P 0K. 80  ⼣ p "@PV P80S 7  ⤣  P>8(<08808407007,07(07$07 0707070707 070707078 t  ڤPK PP ,70St'0 0C!0R3z T70S0Ss K - @P PQKh >GPK Ct0@PpS K> 0 p7t`@@hP0V#T00  HT\HX0Qt0pW p`R000QSL00D0QDD0@n0 `X\0X0S 0PV)PP PP K 0P@0 K. l7K>x%x 0 O6 `@씟D@pP @ VG|  0S$0 0C!0R3 0S0S 0`0%P `0P c=0,C 0  R+ .t  7 0  d0d0`@ 4jLR p 1  1 S 01 \Q \HHB/p@!bK L0 S1P00P0P D0S( X3 R  h6  X   `0H0 S   \0T0 S `,@0SJ @DUY<  "  ∣P0S|& x 1  ` vPcݍЍ 4    cPPA0S, P    OP ܡ  BPv С x 6PPj@d0SXT000+ vO,S0!? lSأ*ȡ*h*L*P*&` 8O( 6 H*%3EHe%5*m]v'Fl +MmA{d*0*gfff" E ^$!& %@-<00iS03S !>FP2 *ȡ*^l0@-h@+   Lv @0q 0l g*|*@-`0@Px0 B0PU1 S2P T0p0S @0R<< 0,$p5 Ѝ%d*0*)&C-PD1`0B8! Y!R!tM@p  10S w5 tЍ000iS00S 00S d `P J4W @ 0  P ! <P000 p 0p_ W@000%d**)& *0*%`0@-@X0 B0@T1 S2@ 0P   0S %d*O-tQ0S hhqM @P 0S <@faP*&A-@0`0/0000 SPڤ/0>+b T0 P<P0? 4 00?**%0@-@0 0Ƙ0@0Ѝs@-@P`P @TZ TT0?0 00?᫘+"+R  + *ЍpP*&$0L<S/ @-鶒P*%@-<*p @,dP*0@0% O- 2@`pVCMz Qp@0DWCߍ`TV B/ ɠ 0R ?s0 0⡛ U@`1P0 S8Q 0S?(h X:0000[4*0S d0 0S [0 000R*Q /0S |`WQ0/3?0 S 00000S  `**)&p*0*O-X3p0]MS DD@c@C 800#0.00RS #0.np"& ZRPP "V/W 0"p.00RS[ 0"e.xnph"lLYPP"L  PpDDB@@r0PSY : SVH`P؀/0 ጚ10L<aS$ 8 <8  @ ( D `  P  `\  T  ؂X  HvP ,? 9/8!88hM/0>+b  P<^P P d0?0H @P ZPPD ֠ .L P sZP3P|]ߍ0*)&)P** *H%U4*%i? p**|hHH* P*&%@-$@0 00: Sp*G-@ q `0S+(P 00S  P0 S00P R HRڄ00S t. Y `tP 0 Y00:$00S $w.X**P*&:S? wO-AMM`P@mpP8 0 840 AލЍO/0 009/P7 0p!p 5- ⿙`Q D D @P <)PD z@P@ 1. ,. '.PD b@D z`Ġ崰TAލЍ0A. 4B   R ; 0 0 .D E@D ]`0  0 D ]" *E P*&^A-MM300 /R @`㨀pPP 0S P@ۍЍ0 D ,5`D @P 0V ┚P`? *p@-0@ @P ?P @ p@-@'@ O-3tM0 S ppl00RS\3 P3P#0Lh,HC4#S<88tЍO, -$PL  E  e-+a-p0@`00(آزL<` ,L\0@  WI < h`VV#W  A @Pp L<0@'pk0PxSiSbP 0'0@$ 000 ,L<0@ O mjf `C `aT|^L {XtЍ0 0C0\10S 0`S$0` S\'X'h0SS   6860S d00X00%90P!Td0 <,d['0*)& *P**%%.P*&DG*ny$*(*H* !B[A-MpM`@PP 0ppd!d&@P TT{,LQR< 0r,ۍЍ aD D< 'pPU&& U`k &p0P K,$ xD,>)0S S&p T0TP 8 2, 8 [EpP*&|*$*p*@-$P@-L@4#S 0  '0#S 0 @'%0A-@P` 0 P0: 0tpp ?)0@$aH00S$` D@~*8*G-頁`6pSP @Ptk0&(0C0T%Q&F( $06U00vPPEPP J$ @$  (@/J 00 @ pP`$0P `0@0 P $ 꼼*8*@-@00$D 輼*0@-S@ a0S 0S X 0S R0 PIF T` R 7eD0&F$ ЀP 0S00 :Vg*p@-@`PP0S @ 0P0 @/ᶝPyQ0P 0 0s00pvO-2lM0pS ||Mx2YGh)PP n P L)Do0`000@(Q /*` R 0?*A0 Sg @018 $1 %1 00`080<0@ 7  p)8 UlЍ 0`0V@ 0 0/Ջ 0` @T`$ ⻁000 0 0($00S0,00S0(0 0S000$0S0400ᨋ@0 1S0 00ᜋ0*)&$*4nP*&X**@*P**C-20MS Yr 0jTP0 00:000Ѝ R#PP  d ` ) X8$P ޚ 4 $( $@0@D `P $#P Śx  ( y1#1RQ rQS $0!SP P0h/%0 "P X1 D1H1D10S0"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t R" 0*)& X**#E oP*&>`j *@*p*P* * @-@MQ 0 3/00؍/,)0*"i(G("L-0@-P I(C%p*0P*&0@-Q 0@T0 R ||.%0AS@ ЍH0 D#P ( (%h**P*&W%mp/0/@-x 0 RS T0R H0P88'Ѝ Q *Ip*P*&A-D@p 0 0SP(r ` ` `*L0@-  Q0 0P ,0'$ Ѝ]*p*P*&@-0xP 00S@%*S`  P@` 40P , $  0'Ѝp*p*P*&0@-0@S 0$P B5/x00SP`P 奏qpH0P@`L  0((@i'c$ Ѝ**$*p*HP*&p@-hPh@4S 0SP LL&H0H P0000$R0p4@0*p*|X*T*0s@-0@SP  40B3/p00S\0 ! \*C-paM! 2Y\ X& 0 00@! %Y 0A0 r&08 !Q 讟 0"Qd&/`&X. , Y U& 0 00`  X G&8#`Rp000F"<&t F8&d00@ LvMЍ*K)&5p*\@mP*&(*|J[*lO-鼣@0EMSP8a   &0 @ሳ00T*0 ?o2Q03S P30S D3 T@#@ $%0S Eߍ0S 00p0"$0S 0"p! 0%V- V V:   B B B 0 0 l"p0S0S P 0坒P 0- 8嗒PZ 0SF B  B B B 0 0 !  B B B 0 0 !V! V V     \!q20n000%60"|2-02R0L "S " 0x30=00 2R 00# |# #X0/80\ /`0d 0 %0L0<040h00S!!#3 | !t 3h1S 0SP! Da! AQ@$ȆІ4 N 9-0CS    R0 R R 0N\ \0|Tt0=0- 9!m*lT*0*)&Ck*^( ~P*&%Z 1C- 2 B P000000 MQaM0S q쑟=聟0=P  RP 0AS^PH,<=0p、0W\hq P  RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ2 0=ۍЍt0 h0P0`0\0S H,@{p*p*T**P**P*&X*Xl}O-AM0J(0 "S $[+p0(C0AУ͡ 5/0(0#R00 #0Q0h2P00 (0S $7(C#5/0(0,0S3,0P0?0!#0,0@ i(P Aۍ<ЍP(0S  +p0(C0AУ͡5/0(0+p0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  B;0S 8#R00SR 00S \0l 9P tl"x3  P8P0Sp*T**%p*o* )&; 0 p*|h@-@0SSp*0O-wM< 00 0 80 4 @؂  P  0 @0 0H0@0LP0D`PP:P S  S  S;  S 0 ``p SK  S"  S<60S  ,,(60S 66v0S -Pv) 050S  Ѝ50S P 0 L50S  <<s 0,000%p,,[0S40S  Y40S  P 0 0 8'' V0 00`40S 0 H 30S  30S30S  ?P 0> V 0 0 80'-'P30S` P [L 0 &0#p0 0020S  20S620S L4PF 0 QQV 0 0 8&&20S 0 $m"p0 00m ,10S 403/   !PdV00 0IX10S00S 0 0 800S 0 4\  03/`V 4   00/` p*P*&0*)&,*$**x%hHjj*(* "G bO|hFWs**kl5 A-1( 0  S !@ 1 1R 4S8 !4|q04@0t\a00S/ P0S  R+* RS-MP- !0 010000 QP 0PT 0$M %P ЍPB*0P;C0P|80S050 000 0 @ 00 0p*p*T*X*@-|cM0S llںhChS0S Y]PD0#0,,c] R0 2r  0500K Pr5"0C590C990C9000Ph|n x呺0S \2d"`2Q090 9 e00@ <|?Ѝ(*FG+@-a?A-@P`App` KP LP?0 S000ЍU00*-p@-BM @P`0E CR V  i뽉P>0FS \0 BލpAS IP0P S00@ N?"H *BA-P@`/<0 p'W >A*@-1 BP>  0SZP  HP>01PP `@yPP 001F0S8 0 00T1T00O `V!010a0,Q5 S:; S0,PP!00P  0 0 P 0 Ѝp r _S-S x(`0 00P0;C*P\Pw1&**0@-CM@P0,  0  ?Cߍ0*@- @ R300*d@-$M0h `  P!@PPDp$ЍPU D 0P >|*p@- M0P@H   54`   Ѝp*6 -\M0 P  \ЍQ -CM0( ~ Cߍ/0/p@-`P0 R  @  0!S \X= !.0T  d Dop*p@-P@U U  0< $p@z  )&P 7P P / //-M M? c.⃴ۍ Ѝ)&4`00CS`0 XX0 X /)&O-pQDMDЍOy@xM`lP !W200 u00020PS00C00@@ Rp@T3 W+X( U U G   ]  ᤆB0.    M  ᔆ.0X   p8D p W)& *S $*3<0S/@-@QPM PЍ@ p31Q``X00CSHxxx"1PЍ@L !0S SL   d0AS&(0@P8hXH 0S0PЍ@d$ r l h d01hS fS501 0400030020Pj0CS PЍ@=01 (0<00$0;0d 0:0090080070060 050040030020-1jS$ $%!Q Q ! ( xVPЍ*+ V\Fe y! N k " O-@`pR  ЍO8YIp/00UP1MIp!P POP0 00 j8P @& PWI E%P WL0S Ip5Ip 9*̯%p@-P(@P RPp@$%0S $  R R/  0@- 2*@- (0 0 0 0 0Ѝ\P P Pq@-(M0@ #\S@3@#:@ [(Ѝ l 7@-P|  @P .tPP @~PQe ,o Ѝ0**0@-QPM @4OT 5_0d@Oo@! "U  R P Q T%< @5_U@,nЍ0%(Tr h \%Tq @ 0u  @z* Q@-.@h0 \!@@QR  0*l *0s@- @R`  +P.wsP ,n0S ,|n|Ѝp l0!PU U 0< 4Ѝp@'Ѝp@د%**@-@T T 0( ( ЍЍ@2Ѝ@'*"!Q p@-@P T p@<H  p@?0 p@9$ZO-@"PTMA@ p` @@0@$(@P PTЍPP 8 @@0Pt@lT:TЍO0 EW y R@x   ;y0P gyR  ,\100 0 S00C00  Q,4P `0 m0 0`g S` `X`00CS`0 X0@X0 X 1@د%X)&@-00C Ѝ@-0  ; ЍO-@p P4 aTAD -QP  P PPP@D`FRPP00SP Ѝa@-@0 0 0 Ѝ@?@-麁  hP*&@-@-QAM`@0Vp M0d}*aXQX!0TL0P 00 ,Aލ ЍP0001!! ?t0oB !R  0Gr@P;: X 7:<T0 <F<@D@ \0D0X @ DD*4F*;_@-x*0@-6S l *@- Ԁр΀xˀm/l` @P" Xn TB h  <d 4z, ^ @ *Q*@- 60 P*&0@-h@  0@ 0\0CS @C1&00S/p@-8P@U``p840#U:c0X 00rX0X40P80 X0X0p`P -7@- 0@P0 0P R*0 B Ѝ0@Ѝ/O-PdMpP a@蠟谟 T0D 0 S  dЍ` | J ]  ^` !0  0 `00$C0  .0`  V0BΛP %1&#C-@`Pp㬀嬐@"!0# U 0 ⟛pp p5 ╛P@T0S0(P    Ѝ0 7F<-,M  808"40!00!,0 (0 $0$E? aAP*&-7@-`P @XT@1 R 0@*  (!000 Ѝ0@Ѝ/%*p@-PP@ 0S 0CS 23 0 0pp@ hh 0 00Sp  0 0p~ Up**A- `(p 0pЍ P 5@P  PP 0pЍAt01Sh0 `  0X2TpT 0` 0S ` F P `*%< F0bA-Q@1(pS1S` W 1SQU(W1S WЍWx1x QU u ЍA <1ЍAoW( QU0S) S S '~U    ~U  ~ WЍAx    ~ U Pk  DDf  ЍA *%< )&f OE=Dz4 0Q 000/ *%MA-|AJM1MSh =`p o0 `Pr} c40`0 ip0S JލЍ;X P0T}A7J.H0 0A1$HpL  $`0P0p0 Pp~8 Li0S8b1!0  *tG-xAp1 `S1SP V1S \$V1S VG 1nV 0 \ l GV \\0  嘠EPe0SVGx 1S  Q 1S  0~  G8 *)&%< A-a0 MSP@\ SQR$SQ SA 0lS 0 1S b A{Sp RU@E@PPVT < A G  `*O )&%< y 0@-P@0$M00PP0 p$Ѝ0 R  hW1d0 0 1S0R 0 000 0I  * O-pq 0M08@ D @CT Ѝ0VЍO@R`" 1!0  @@0p Y PP  @@ 0 p R Z ttx00CSHX888d8p4g( **  6 `  0@-P@0,M 08PP 0 dpf,Ѝ0 P  0!! 0Q P0P< 08Q(  *%$ p@-`@0M 0(`` 0 p"Ѝp R  u0|P10 01SL0 Dn1S*OP O!a *%< O-DMhZ2 0S 0 000 (iP (P(0U%`(` P@PDЍ`(Ppv (   pp$0 $PpDЍO5(P 0u$  (0CS-   0SP`p㨡娱唑( r00R0S W 0G0 0,,`1!0< 0( (0(Ps p( ,y (U((0$ 00 0 00 0 000  00 0$P 0 0$ 1SD"!!!! *   %| C-M⬀p`` (&yW0P0 0000 hPPQ ЍP=@P PP  PP 0pЍC~ 0R  ,W/0W400(00 P(t 0SQP o0 Pp0!00(YP0Sxpx1Sd,0`DS PpP "0PS   * %| b0@-P@0,M08PP0 p,Ѝ0 R  .0 01SL zZ{e[jKZfke[KK{K+S * O-bp0MSP@M ET S !P4"4.J@ w X:0@8 0 2p2o3ٍЍ$y p y "R x{. X R TX PR*1 21 0T 1S1!T0 0*T 1!0 0*topsr0 < eS _@cr 0 < TB* $G+# 4 O-{JM M`@PGr3 @jP00 S5VPo0 xxCpn0 `X;p* $bU E!P 2?rP*&O-pMM`;p.p P@@ p p p0Wp㼱0Z:_0S KލЍ0 0Wq@P\ @PLqLL?HiP  1pZV㟉 1Z SP nZ.pZP {nZ.20Sa00 0Z0V9 Z-P an\Z.@)0T:Z^P RnZ. |d< edAp,*Z'@-0`0 06]PP 0@PT )]P Ѝp@0)(PP D!Ѝp h' O--tM< 8@40PP凉tЍBS0P(0  ( pP#U  ǽT T T;P0t4tT$0gT6P0X4XT$01P0H4HT$00SZPT(4TP$004 0S0R0S00 0 0 (0@` 0 0@TF*3#03  0303P0T0=@؋P(0@`,@pW6*40S 0dS0ktDᅄ p 0`9 pu  ;X0 pl X `( m0P02R$0,g 0BnS01 0<0S 08 S@ ?@0?D000S, 竸0相S0P ?f T0 4 JP 0L f?L 0Hf {{'0{H 0,0 0,0@0P00D0@ Bn| 001 00X p` d?4 $;` p J? !4 ;$h p X0 0T0 {{'0{0h `Pʟ 0ifP 0cf $0pdT Y@B]h-/;Q4[Yp3 F7d0SQ0勤d4 00kS& Lp0p$XJ p p$;`A p} 0@U 04p$;h4 pp h0` XPɏ 0f p0e$0@U00`  0e$000$ T,0S0gd0kSㅤ8 q 0pX p2 4``p$; p' 0U 04h$; p p  & A& A{ {'{X0@0 T0  % A% A{ {'0PUPp Ǐ 0{e 0e 0 eT0 Y@F@-k *$P*&A-@`4Sp  PWT0DPEE$UX fP00fP 0-80 V P $8!3MDPE@D*) $p@-P@Q0  0 pfP @0S \e$Pp HV0@ 0< 0p R$S$ꈰ%+?`+,+++7@-3400S (0 0 pp ~0++*O-\M0 MS1 HpW-Q`@`((Q(0 X]+ 0=P 0 0 qۍ Ѝ0 000nS ?S aS ppS qS x0  T0 d0M0L0婗0 8AT+8+R+)&`L5+q1&)BA-X`0S L00S 08P8@p0Pp00L5+0+T+8+@-@L0@S3@00S\',0, 0S00T'@++4+x+*C-RP`tM  ,,E P RQ ğE R`S Jd0t`FQ ğR   TDR 7 4* CR ` 0S $ L?i ,4\ P20@04ßQ [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+EU`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0,00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊ1&1&<+M+<+<++PA-@@P@T (.@ P`p0Sl d0 @ P ,0< 8v(0@Aꈰ%h' +< SY`++A-@P@pP0`S00|0 R d R 0L 0S @!P@`T !+h++%+,7P@-- 0 D`+P@-- 0 8`+Q P@-- 0 ,`+P@- - 0 0 `+++P@- - 0 0 `++н+P@- - 0 0 `++++P0p@-AM 00@0 0@Sb- P1 PS" 0S00!C4;P 0S0l>PP 0T00aS0` 00S0``0 C;PaS` 0` 0R`0 0@0S0@T@ @0 Q000S0m'Aލp`+k[t+VQ`h+d+G-1MMP, 84 1ݍЍP0$C:P @4@0 (PZ30S Scs 5@PQ 0 3@cs0S0S PU~\30S5 0P/ P30 043 0 $3$ 3Q0RQ300?o2&Q20S  2 0[P0002@0 0R R00 R ?P 02D"000 H 2 2QT100?o2& Qy10Su 1@P0001@h, 8f 0PQ0S0T',PU Q 0S 0S0 0P+ 0! 0 00} 00QQ000?o2]&Q|00S  d0 0P000<0P`+wL5+ # *+4+h+P+d+t+QVT+0+l+PC-p0JM M 00@0 0@S+ 1 @Jލ ЍS2 0S! 9P 0S0<PP T0  t1t p1 R0 0S0QY`% 41 0S (1(V! e9PzY#P0͡ f0S @$00 R   R 0 (l00Qc5qp P0ST00@`+`l+d+h+d++k+- 0 0 0 0[+ 0 0 0 0P+4C-KM MP+ |2 Kލ ЍP0`"C8P @@2@<2000,YaP 2 0S@ 2 Ò. 6P0 aQq0S 0S 00 3@P .d1@0S t5PL1 `00P <1P ,0 $ 5P`++G-@`pFoᨂ@t]P 10S 1ЍGݎY(' 1 ЍYPq YP4Y! YUQR 8@P dPPPA @1 ЍG0:],1PP(qPp$6U@0 000y#T6U@ pV(PPP 0RP[`5|0@0 LM000 L0O# 80H#>'d++`+`4ΈA- MP& 2 ЍPO0S![4P 0 1C\P 00|S 7P /P 0t\@h1d@* PP!@4QPP)@K)t$5`+++$+4  00@-MP 0w% d1 Ѝ0P L!L300CS00gP P5 1(0S0@m@P @RP,Z C_U U0S0 @ʤV@P @;PZ ,_U h0 -0S0D @%Z _`+? H +P _ j r | 4+0p@-p@P0 p@ %\0\`0XPS 0S/0S0p@Č $^00p`+T+X++  0p@-`@P0 p@$L`LP0S/0S,p@袌 <00p`+X++Y P00P0@-S $ 0 ЍP | 2P 0hPL00}SH00S <0<l00P 0`+ !h++ !+P00P0@-S $ 0 ЍP | Y2P 0hvPL00}SH00S <0<100dP 0`+ A!h++!@!+A-MP`+ J@lpET \GP+ JW+ J@ 0 ۍh' $+@-P%$ <0 ЍP $ 1P  `+H!F@-P $ <0 ЍP $ 1P  `+]!w!@-P# p0 ЍP 0S L 1P 0S0,  1P`+k}!#xp@-L@PP# 80 p0P0 Pph+`+!!p@-0@L@SP# 80 p0P0 Pph+`+!!p@-L@PP# 80 p0P0 Pph+`+!!oQP@- u# $0 00Sn@+`+4+!oQP@- ^# D0 <@0S 0S `+4+@-0@-P000P0S 7# L0 ЍP@ 4F @P@$+X ]`+!| p@- M P# 1 ЍpP! 0P 0#p`1`̊0S@1D0 0S 1(4P&P0 0S 0@T 0奊&`BS@P W d@ qD0@ ]I0 @ 0@3/H0T 00S00lj&`+o!+!!"*% 4+"Pu+x+0@- 0*"l+`+0@- 07"+`+PA-PPPPU㈀ "00P@lph0hPA00`0 @00IT,0P AH`+h++Q"M+<+7@-PA 0P0000 Ѝ0PF"0P%0S0P 00M0@0S 0 S  @M@00+TH0 S +<H 0 /P`+d+^"+$++<+<+i"P@- !0S000 005 0P !0 0@"P  0 0 00Ml00hPL0H0D0HP0 0 00 \+`++'h`+p" 000 0@-S$00 00 h++"`++000 0@-S$00 00 h++"`++p@-@Pp@0@- 0"t+`+0@- z 0"p+`+PG-R@Pp Pq!ЍP`P? P< P`TP5 A-PT. ;-@PP%%`. U(1$1@W 10SV U00@ $ $``PK0 0  S  |V Up0l0@W T00S H0H 0 @@ S8  4b '++h++++'h"# @-j0`+P@- x0 pP \00}ST00S H0H嗈@P 00 0( 0$ 0`+X#h++]##+X+T+P00P0Ss@- 0 Ѝp0` 0S P@P z0Q R   L 0Ѝp@P$Ѝp@`+d+++###p@-4@PPr 0 p00mPph+`+#A-P_ 0$"0Ѝr0S 2 P80S10S 1@a0 ` F0崁S Cb"c! !    c#A P0U0CtQ00CS0<Y P?00CS0@P P7 (!-PS0Bp00 p P 0c" R  c&0P UR PE 00P0 0 Sp(0L0 0 S`+ ++#T+5$ 4+ 4+ $+)&*$q$$P00P00@-SM  0 0Ѝ0Pl  -P 0f)qpP@ 0 $0$U@00`+k+$P00P00@-SM 0 0Ѝ0P | \-P 0)qp L0@0P* 0,0S 0000`+k+$P@-W 0 PRO`+$$@- (0@kP0 @4+$P00P0A-S쀟 ,00ЍP  -P 0=0`P ?+H:?H` +@d?=0 00P$` Q(0 A `00+SP?=0  0`0@@DcT@@0P/UP0,00(S  T]@pM(+(? P+(((((+(4+X+f)E+`+P*&-)|+T+'x+O-iM Mh8dLlOpt͍40,xHD@|0 0PL0.600K/p% ,A~'@0{'4QDw'8aO?ⰐV=HLa少'TU01p 0S `IPP d0sh0sl0sp0s0St0s tU 0S V|V?0S 3'?0S0 /TP$'!'`?0S 00SV4  0_ 0 .=0S ~P' Vi<, )0S  ~Oe)P$.p>pN0 0 U)00 (IQT /=0S-p= PPk/@ꐗ < <00S Xk?/@80S00?o 2F$PP0 GP60S P 0SX%P 0SP%6Fp嘆VTLP@3x)t<rl60d6sP 00@T J OP 00@T J OP 00PO _M`~ElP<ht' )_P<[060S(`x@T*4!@&K,& &5uPU<LV0 0( (FW} & @5 d5@T O?00$ 0@4!&p40SdPH PP4P$P& &Px (4R$&&p0STP/X3Uc \40SI 4  t&TXPpk&&p8|ȽXP 30S 84L|XU4cb30S 3 h B&U@b 8&UT  /&`R0H0`0 $ @0HBP= \@P? W0 R (2000@/ $`pPTpP 6d R060&00tK 6R P KT60F! $6@6`l0Əs l+0l08@T? V  %PXJM0 0  2 @R M0"0C?o2? M"0 "0A@-000 R ;R HHP |000 R RT 0S>0S00?'"0 40#.0S ?0.T0.͡@!͡!..R0l0"R0.͡0 $PP#PP0S0S80S#PP 吺B(L000.R0@D0$.0 pww0PppP0 PXGpX \M\P #P U d VpW|90S p90St9lyP $>0S @DT90S pYFy1!0S   PZ0S= S Ed#4: 4:` T00R0SE tPsJ  $P  GP Ud f:0Sf: P a** ϠP 0; T# {> 8;R.sr ZO.!0Q3/PPp;@7 ; R0 ;Q;HP+0 0 S dh lp"0S,h< 0R.Ks q0.0S 垺000S 嗺000S 吺000S 剺00|iލ Ѝ0S 03/0S w00s@- P@AP  AP0P $ЍpX`P  AP 0 F/UpP Ѝp@2 0S S0S  }A0PP(T(X(M(0e&0@-Mh 00P P10S 0S00 0 Ѝ qQa @T0 S 00S 0s 0 :;P 0 S000Bp@ T dkFP 0|S ׹00 0S00 0000+4+  *+x+@-`$MpP 600000001@D0P/S:S y@P@tQV塹P $ЍUDPᓹ@ `6  ,6 W60/0LPP":LpP多@P/000 09@P00$`0@@DcT@@00@0CcS1S@'`+? '(PP00/@-J (0@  000J@@+*@-J p0@ `00S T0 0Lpp<0000S J@@+0++*@-{J@\00S P0 0Hpp8 10 10S haJ@0++* d0@- T00S H0 0@pp00 101000E@+0++*L5+ -X0lM@ d @580 00ssb %@+0+*@-0lM@}0 0 00 0rS sS lld d[5d X'5P0 00ss2,d $@+L5+*+00 1+*0@-PP`@ @0@ss00V 0ss0000@? P UV 0A0T0Ѝp00CS0 Sp0 S 0 /oO-pTM|0x0?X0 "?0p 08I0P`0V0X B@)0 @040SD H 8PZ0S= S DV0  @P*fI0S bI0#S ^I|0pS l1 R XaR 0# E;FItp uTЍ  ?$0000  jPP)I0S %I0#S@DT|0S ph@"\ ;$0 V `|#M"0 0 "@B++O-@BMMV@ Aile?0a>0 @@0P`46 pP,6P<B6  BR  P5(50S5V % 0U :0WU S00G00S(+  4 0S+ 0 S( Z000[9  BR $5PP00CS00 : @P00CS0 j0㠴0 0 {P8$ ap0,TS (400  00BލЍ@3@30S VW@@c3!]3:3 0p330S' U U# dT$30 CRKH3000+ [)[00E@ 0A>V0 `W4$2 2#2 >U[2000 p"00KT1#0V CR@U-[ 0S ,2  00 020 CRUT<10S@d@60 @S405  [ [P [ 10Sʶ50F?oU20S d10SX1p10S} U T U00T0SyT} dT([@ 0S10S 3/1V 0   0ZR\@\ 0YS P 9/ 10 XS P 8/0F* T `++ +h+++ + ++ ;1x+1&`+.+-A-` @T  0 ЍAЍ/0p0$ P Lxs9 h0h +Bo0@S RP 5/ +[1`+* +!O-@sFM M`  @E E 0E0$0`30(0$ 0,@V0P SF厷0 劖 3 Fލ Ѝ?U0 @,Q(22@@Ȳ@aGT  l 2 0U 0 PD0P|2d JP `"`d1 L10S 00S , 0(d  5PP d@0S00?o2 SP qE0@6T6 D01@p  dó 01 D0(66S0d00 0d0A0`PS P P 00S t0 |0K'P@ 0 @00,`@0?*+}1`+`+h+",f+++*1G +4 +110O-VJMMsn0pFXv600S00p W 9P>X p6  h60 9uP@,JލЍ,60 0 00D97S 60Sa54r!005إ0S# ̵0S5 Q S 5R "P 0S x500CSD5dr00T;0S P97S, 5,4 % 0S 400CSX0$000(00000 0PI |40000Sp40܀C XSX (4h00$ 0C h00d00`0<, CP 3$x!>\ 0h0$<` ((0d $r 0( 3?$r / &<7R d3Z0 R0S R3(0s0?008'P 2X_00 97S0000 0f0S  x 0\p28'PP420 00 0E 0 iC DpH 087jP(  97R_ S㴁 0S [10S. 0S* ,0< 1, rHP8!81 R  p 0 / 1Z&P 0S 0097S;7$0:70?70>7='<0S P0s00[X0 j0S{ [X  U*\+t++*1+`++I2+4+++h+2`+2D2`2 +3*'32222*53_3~3333@-2Bp`WLM LЍ@ rpPk  kpe 00011 0S<0 ?!tq((00 Q 00SZ=9Q ='/?@#b!"/p8C0S C0#S 0(60 8;pp C0S C0#S ( pp 90S0 00 0 0+7LЍP4K 00\+t++Mb34*430A-H`D0 82Vp  R`RBR RB`2b  Q  ,.00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 0SR 9>0 SN $ 嚫); (1RS ,1S $00-S0S : C:$ =<0S $ Eߍ0S x: 40st80su\JPq0000So,0Ss9 9 9T$ 9R P90S =0 S $P$00$0T $m/00=0 S$P$T H90S<<9Q0SPPP=<0S!0S' Z+80S Q(P  H8(|80sS|>8  t8Pq00S  L-Pf@U,,0SfP 7 7 R0S\P,1SC$c8P!7,!(0L7 L7 (0xp(0p 0: S 0'0'0l7 R,`7`'``:$00|S 8$8((0S$|6,! x6 600$ H((0S6$6R P 6F~60SP 50S 50S5P60S~ 0CS0<0S 5  (p(!3Q$1,0%p,0(0q(05P001! PL<0 SE4500S 00(3/0(0,H,D0S4 S<Q  p40S 0 4RR qp} X%%&0$Xp0bpq,4P@$PH  0eЩP$lʩ<0S t0 0 @ 0(@咙P` T0 0 0(0ㅙPwdsl( 00CS0(/pk P @`( 0@#n%.0 ? 0!$0 S0  , 000CS0 ,@ T @0S  @(H!, 0@(00@ U>,00@ ;0 SG1(00@8 ~ ('T!000t, 00CS0,p@ TD0#/+"+ 0"%+?;#;0@#5;DE !WX@\ `U0XUڴ1QQ!0 P IP A Ak{H{7{Z~(0`4!d'YP (e 0 P<g(0@<e0   0 @0S  P0S S (0dx @(0l dX  .Ah+l+++F+;<QN<X<]< h<++|<<<+00pp(KߍP@%U[0DE;@-7T0@ R0 @00S 40 0,ppݿ7@+0++-$M ?0 0 $Ѝ0-4M 00 000a7P4ЍO--pMM,E, "  4 Ѐ0 P0p PUp0( RPUp4d"R 0*Pğ^p0S 0sd0S "P @0⣥840S` $$13`$S 07 l{ A0 ( A{{:?dSd0 0#f3` 3R - BP  0 BRڛ h3h図"B \#0 fH#2` 00ß R#3SPS0 1"000f0`  $P(0 0SZP=9 =:k{uL2 AP09 A { Q  5 P;!%#3\QP  d 0 00 f!1@P0G10 R`dP 1*!3^1?^00L60l!P0w`1 000ss(\0S"%+0!gUp; M@0S00d D@0 00ppiMߍY@.A++++l++ +$+<+QF < <<=<++=@~X<=f' P P!0  A A k{I{7{Z\0UzK0P  `h@<=00P<p^f0 @  @-5@Q5@p@-Bd00` pd00CS01p ,P P00 @R0S"P8d`Qd00CS0+p "P \Pd00CS0p000S 8A0QPA p0 0 `V,p0 c`Pd00CS0Yp 0@S P,P \Pd00CS0Hp `V0 0 U0Pp@+Է%C=+A-pp@` P@ .t%PP @P PE *P@OoB@+O-$U0mMS pGDPd 50S gmߍ0P.0͵1;%4PPd'0P0S SUpF P`4P PP P0CS p, P P P0 PsdJ/P P /P d0ppyP 0? dR`Pd?p P 0Sd0ppZP0? 3p P 0Sv0S dh0 P P d00CS0Op\2\` P Q4280 0 dAQ 00p0 1@S P0S!   Cb"c!   c# 0\S81Pd00CS0p0 dL\0p 0 p P`, ^0#S^0C0 d凃PXX +G+\=F 4+`+;l===+=#>1& $+ 4+c>G>+ +@-0 @0S噣P  q)P  0 00@ x0 l偣P T0 LxP 00 ,oP 0 1&>&d+>> - BR0 R  P R $1A-0aS0P0P3U |(P 00.S Ppd1le `L)X1P@  H,(P10T0!0!00 (1( U 0 ! D0Aq000 00000P0 0 0pS000P0T h0h0 @U t0-P$0`u_+h+#> + ++>>+X+\+++d++t %>>p@-@P v0x 00p @0h hP0d Q0 P0P H0@D0@ <80@0S, 0p +4+\+X+P++t++++ + H0@- 800S ,0 0$ppк@+0+++A-@2Qp0S `0S pp00`P00000S p`0S pp000080xT  G2p4+ +t+x+?O-P"2 AM MR0xB p" R S4 P 04 S` 4S4P  $Aލ Ѝ4Sg1+h;004P/S +-+)dP_mpUp儑0倁 00g000000000S L1oV81<$1 R100CcSppW100S 0o9 000000h4SU00b$@hPPJTy !P00L5+P+0+4++? 9?G?h+|+l++4`+ +Gl?A-Q0qS0`00@S Q`Ѝ0])P !P 0 R 0000@ Pl00}S0s00T 0S$@,] +h+d++?? +1&`+O-쁟a0AS000qSP4M Q 1]4ЍPF X!P0.0lR!P00X*P" H@,P$,!020$A$000 0@, /*P 0 @ P 0$0寺qp00P0}S0s00U 0S(@<B] A+h+d+`++?? +?? +.@A@Y@@-,@02 ߩP8+f@@A-`Pi`pe L@P  8@P $@QU@@@@-@nPX+ 0A- 0@0PS0p`0P㬀"  P 0S 0"S0x R S  p`"R"^ 0 00T++h+`+$X+ +0@-M M P | @0+Pۍ Ѝ0FPhu4/S) @ +P;0@TP/PE @O-@P`pW 1@@Pp3:f*pFa*`ܰ0X1 0l)T@1`0 10S 0 SY E0=\ Q0K)0S*00 000 Ѝ++@-/L0@0 <ppnpP0 0SP0 0/@Ѝ+ht@+P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C++A++@-0 000$ ▝0S" R 0S0000S b0Cs R S             Ѝ 1&1&@-(A`0S0 0 0 0!0ᠸp 0S:S50P0S0 0 000 券pa0S:S5000h `0PqpTF00, 0 ep(:Ѝp+HA+hAAAC-@\ᄐpA`\P ^T1:00"\ \ L|9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR%0R0PMU20S2 2"0S0 C0GQ .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10Ns[00N B B ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0SP ^*0SPZ*@P0LG RX QP 0TJ*/0SE*<0 RS=*9 0S  7*+0S2*> @ S,*0 0 0GS$0P(0&4+`+P+FT+X+/A-p`P @a}P0  T  `00T  )'0@ R   `FVp`00CS0 Xo PpTD000`000 T00AA)&AC-pP`&@0尐TY t 00@)ax0@P`0 \ctL00D P 0 ЍPu+?+AB)&B%B,+(+G-M@ ` 04P0 43`PT 1P #Tf b30S+ ` Q `V` 偶p,0@00E.002 0P El"l;,E@XBލ Bp`0(T $3 5p T(0q10@S  [ 0$ 0/ 0$ pO,0$S*F>C0S  @X4 `$Q(00SZ=9Q =(/?@#b!"/0 0p4,0S ~,0#S Zw,0AS  T0 0000 0p 0S ^,0[, 0 ôpw0LT PK,<00f+6BIBvB+Mb",p@-@Pp@践ꑴp@-@PP`>'P 89'Pp0Sp僙pwl2 B@-@BP {B@-xPsB@-@xp iCP@-[\P\@CfC0@-PlMQ@00 00 T  40S P X00 P O0 0 0 PACcpW' 30S M%@J%@@`  L P `UPJ P F{0 S8 容0P 00P02 堹 2 PP 00 @T % * P 0 0@T $ *P ڙlЍuP 0S @P@E $ )  P@$ )T T0S @P@&$ )0S @P@$ )Tw 11@T  0P 0p`V&PP)H&000'r0 0 0PhQ XP@+;\&++p+yH CC)&%B`+C_ j r | P++4+ 4+ +`,Pu+(+,+X+T+7@-Pm 1 Ѝ0Q0S 1 1ȸP !70 CRhA R S0T!L1P 0S0,!S }P 0S 10S 0 0唸@ @0 @0@0 @0 @0 @ 0 00S 0U`+4+`+C+p+L++CD+h+DQ +++'Dн+̽+1D++5 ++IY++X+00S#@-@0M, ( 0AP0S8y@0Ѝ0@P+-A-@<1<1s0S M P0\! 1  ]$@AލЍP0S S  S00<1s0S !p 0圠0CZ Z <? 0 @,+(+W+++++t+`6 RE%aE++NE0@-EM,P ˭P @P?Eߍ0 ,PP   Ҭ߬ #x0 <  #⽻TP嗭ɬ ?lxEEEE`6 %EO-`h3MP@ pPPuL`#<# 03 ,公UPE 㖑`S00CS0% p00 R0ScP1s0S7 `$jP22l1s0S  Ta9 0 0 Pp`1 Ps0S 0 ` 0 D PVS,1s0S 8 ` 0 S 1s0S <1s0S 3l1s0S 0|0md1  RGL1P) _ V 11s0S WpG'P`?'#<1s0S0 ɫ dЍS R   R-WP0 Uq0QLLD>+,+W 6 +++%,+NE$++++EaEEp@-BM,\@P3L1 D儫""$!1 哫PP>`0<1s0S 㜐 P00 _ ""Bߍp ᄐ@`pUPp0Ir""J<kxE+W+++E%F++,+Fp@-BM5,hN@P3X1 Pk"h"0!(1 $)kPP$>`1<1s0S 2 P0A0  B"?"Bߍp @`UP|@߫ܫ&"#"<ᬭxE+W+++E%F++,+F0@-@pP4M\0PP <<0000<<0 @ <4Ѝ0,++0@-@DP4M0c 0P88 0$4Ѝ0,+@-M, ,PF A f 0 001 l1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍!F%+'h$+@-(@ $徫( @巫,+{t zt @-@>T:@1p@-@PPpP p0@-AM MPAލ Ѝ0P0!⻮PPl1LAd1T@_0!P0owu+ݩ@ ޸U 0S S 000 MTҎ   T l凯t  10D0 S B/o" R  0C(Fh3F%4u+P*&;F|JFZFt+@-MP Pppp p唩l@PL\܍@蛮, HP Ԫ܍,0 < +zF0+FE%0@-MP MuP%@e0@SۍЍ0@W<P551d dUPPTۍЍ0@]@ 5 , ۍЍ0+Ft+FFFFp@-"P dd;@PpPPPp@4<68P L|l1s0Sp0p@#+zFGF%,+p@-P MP(P @R0ۍp@;Sp`Ү@P\ۍp@P l! r R< < 5啭 ,=ۍp+Ft+FGF%G G'G@-  L㑫P*&mHO-P4M$`5~`=@Pu`0 `4$$匔p0Z$ dQ Y  Q$0 PP0$404th 0X$X3P0PH} p@z <)U, U$$t @DOo0B$10<13 B0lS010S 0P  [ RvL tS)`S FSI (9S /S 00C6&`a0CS,S HR @S HR T LT HR S HR HR HR \S HR 8R T ,S HR HR S (T hES 0ScTPS2PPy Pc PPO 2?PBd2 @dPV  LPR @P/ ,2!00(1 1 0 0!0S1/ P @:,00!0 0 x0,P p嬶 01 U PUP0 0  0@@@P 0 T0@0?o2VP0SVP%4Ѝh+|+++$%K\#&+L L++0+^ +L+0L?L)&b }%$+ILP*&H@-bK/KWQKuK. KK_L@-+@-@M h| \0P0 0D0@10S l 10S0S@Ѝ۵P  00S%0@sP 0 00S*0S 00LP0P@0 S090v ,n$pU ++0+,+$ t A-U0S7P@@P0Px% /Q4 } \`PPeDpMHu0S+ 85  05@,5 $5 5 R- + 5 400000@T ,P004@Ѝ0400/S@ۧP v v vldmFXm 0S&Qd0S րp=0c ΀p;0cs0S000S _: }0P0 0R P T3Q |30S p : hr}PX30S 2Q P o2: @W}P 2 : O}P 2l!: G}P 2 : ?}P 2 : 7}P t2!: /}P T2h,!: '}P 42L<r> 0u4Ѝ0+%@-`0S@ ʣP0S 0000q20\ @+M6 7@-0Pl000p@h R R  l R  R4ɨ03/ Ѝ0Q P%L%+$p@-$A`1QS 0SP AFP00p00<0P 5P0 .P0 t'P  dd4\ 0H@H  "  \ p%+}b MP*&Թ%1+,0@-1s0S 0P %8+@-(0(@ 0@ 2+++p@-`BM P'@0 S0`01s0ST01y0 0Pn00x0 BߍpB/ BR 000P Cy0001+%8++ 0?o2 0/%@-AMR  0b0000@000  ̢Pڶ0 q 忢P 0SS WS BSs0 +⬢P  VtF0S 1@0S0 pW m1s0S ؀0S R      |P W 0@^S00CS00  S00 P0S+e ,+++%8+p@-PH@P@pP P P @% 0/@-鲢o/A-@PP" p00CS"lj j j j j j j k `V PP1P0 P00TA4 0S P0000 !0S0R 00 NNA-AP00C!SaXp `0000CSPXl k l l l l l l `00CS`0p S X0 X 0 "S  0S`00CS`0p SX0 X ! 峦X!嫦0 0P0 P000 `嗦0"S0L0Ay40匦0 0P0 p <+)&$N@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 NG-@P2 pqp =`P` PP2 00PF 0P 7: V @P @0S@0S300@PP?P PPP P 0!SP N<+%A-@MPP\1 l 啦@P `p崀  hPu00u0ۍ0 P 0@ 0000S ᦥ  P00 Z%NG+Np@-`@.PP 0 9Hp$%PI@ps@-@P` >C ӡ R ̡ ȡ@T|]Ѝp(R( d?0P'P O<"P K(P ,+f@Oxt yt O@+0@-@M@T0(@,0 0 Ȯ@P HЍ00,ex0 ^PPP@P0S .p00@SP s @+%,+@- (,⫮O@+@-@ X R庄lP 岄 娟0P3P xդtӤh 4 X啟善 'ßЍ,+xt yt P"P%PJ?@d Ҡ00 S @. @ C< ܡ0ЍC#0(%RS1S@SGS)&U p@-MwP* 0: S0 0 S P@` 000uЍp p P @TPH0 0000Tl+MSUSfSO-0]M-SP M0S @p܄P8 00S0W0S' O0S" 디` spPxh4P ]ލ ЍOv/L]ލ Ѝ 1 -@plW ]ލ ЍO褁0: S  SQ oPPOu {לP ttA0v: S+J $ 0P@` PW  8P p  0 0,0 00  0S0S`-P`y`+vH 0S 0` &P V  P z{ R;^R\pPS NPx!1Z[ d 0ߚ?[šp`4 0S!P0!0v0` P: v?b H 0S -v⡚pPvP-Hᦚ 0Sᡚp<ml+(%SST2SSQS SS T"TGTlT< T)&0 R R /0@-@P0R0  APCU 0APLU aC\ACP 0^0\0R0 0 0@-@P@@ L!P VIP00S D00S  40 /I #O4[ߜ+,+,%@-J@-Pp@-PF @p 000/+p@-@P0-S@@p IP0Tpp0p@-0@S`@MP0@ 刞  P@ЍpPU P  !0P0X%+U) @-@P @200S@R+p@-@PPp00Spp@+A- `pP@P000 PP0 0F@-@P P0P00S@+@-`dM qPU= 0S: u[P1 @@?T.   `00@ C @ H00 *S ?0`?ZP10HG> P dЍU 0@-OV5DRVUVFTG XV,+ 7-]FDv[V^VVjV+V,+tV4zEDQOM+wV ec eY:_ }zVJ E +s0  +0  |+@-@(=St00S h00S\00S L00S  b400S  [0(=+|,+,8,<,0P/0( P/++0 C+0 $ >+0 9+0 4+p@-D0@0S 00S 00S  !<0S <0S 8S0,=t00S  \00S PH0(]0Sp@ jDP 0Sp|,++<,8,,,/@-0  @+$00S/0 R/ ,+00S?D,0  +0+@-0P4 P1 +P00p@0-0Cs0LS ``PMP"0-0Cs0LS rvp` 0  0.S00 U`T  Ѝ0  @-@P P  P P ЍQQl0l0ѳQQH0H0 Ѝ@Q$Q~V VVV/p@-P4@Pp@A0S +S90+Sp@p@@-@@@    0 0+ 00@`/%p@-@lP     <00S   4u @p  +,D0@-0S 00 @T@JF@,+@-@0 0 0@+@- Bo 00S dC0 X%V+A-PRp@ FqpADFqp MP GPp P`UX@DTUtl@8/pXVt @W@T*U A (VVVVĪ V$0 0) 0 00S/+pp@-@ P 0s  SD@pd%WO-`0S@p 崠)0   ?990 VY†T00S[  RP _@  D@%+(WP 0S  R 9  (0///+ O-䤟M`V 0IS(,  RQ0 R005r: 4) "P  2"RfpV  rq$ <$Q  $Q Q 0 x#P 0 {   {`  @`   0 PP 0 @@0bvyf`p{VX!SR@ 0?  0qp1tCЍ QP$0 0@R*20 R    @ @  " @@900 SP05:Pk09a 2 q4   10SO  09ϬRXV a0SG\C002LAP10SI `10SEPB  D1 09 0$ 00*b$@p 09c|p  RB 0P   l00St0PRc0SL00S\ O +,\,d% HW+$,+ SW@%D$,800S 900//+@-`@0Sp <)00S000(0,0(0,0+p@-@0Sp Q 00h@w00p098@00sp000B(Pp 0 @%++^WD$,G- q`V= P@;U000P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@+D$,@-P \00S @ T S 9(,0 +p0@-@TI0 qp0@ @}00p+D$,p0@-^ 9 @ 0@&)60 P@ ^@T+0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/+P00010 0/d%7@-P R I0 0#0 Ѝ00R% 0@!"0@@qp Ѝ0@GA+pW0@- 00 Ѝ80098<@ q|/ 00\ /+A-p`!PP"@h9  @0@  P09   t!09 r`A++@@A-p`VY@  @ @ 0 gvP0 0p0 KT 0 0Rv0@A>!++0P /+\ -P0S0@  P2:1S0BS /O-@bS7 .S6 00C S 0  ?QP p@cS@U:e@0@0CS000000C/  0?QP @@+WW+p@-@P 0S`PpPQ HP@dPQVL)@F7P0S  p Pl%ľ%WA-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0S"P@u0C?o2+@-dMvX@PpPLnPHlPDjPT 8S8c(s0S3(3(!4!!!8!! 0 -R  UR +R  >Q @`?}0:S X?u0cS .S bS S@ @0,S@pS wS ,>P ( 6P 3vPx@Pt@Pp@P0 0  SxPPPP PPPP hP ^FW+$+0+<+WW+WXHXSX%h+\XjXl+X$X-X1&2X8X>XCX 0p/+@-p  01SP R t0 T!WP R HH0t@08 ,’@"P0 +tXp+ xX 0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aqR R S R0/0 R /!0 R0S //@- @PT l ȼ  0#-?003&?=r 0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P pq!l? pPpĕ ?`llp@@`@@+0p@-P@P QT4@pTT@DQ0`VC@S@ T0CQ @6@+@-l@PXPHP <00S,P`+X+Ŀ%,̿%@-l@PXPHP <00S,P`+P+Կ%,̿% Q p0/+P@-rЍP@EP @ $@P r0 &0tT! _P P0X!P80T@ 00 0 tX+xX+@-,@1P,PH+ܿ%00PbA@0CQP//DA-RPp `e@X@@Ѝ`>P@\@P, PP@@+A-P` @P lpP ` L@P  A< $@ rT ]\]]]\p@-Pl@P TPpD|Ppp@U p@Pp#] O-MM`p 0@P P0: SX}qX  RP  9@P> ռލЍ R R R00 2P P@ +P @P $PP 0"SU T 0S0C0 6/ RP 0mS PG0]%S]D]%L]P P / f+s@-P@`o "0 00 BЍpA-@Pp4` R 0S ېp@Y]@-P`( @p0` G Ѝ+@-`@ (8R808Ѝ 8 0 CS  8 0C 8++p@-`Q@PRpP0S  嚐$0Sp 吐p@0S S D0V@ ` 0V, xU  p@q%D]L]Y] $0 (((( 80( /+% 0( (( 0( /+%C-@㼀`p0S Ѝ @oP0S 0S 0 ( ((08v9P 0 PP 0++7@-D@P@@00S Ѝ0 7P+@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08a9 80 8 00S08S9+@+0@-AM0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS ڧ 0`+@+@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00+@+s@-@8 R 0R0` (0 RP08 80 8880S Ѝp0CR80S 00Sʨ808+@+p@-p@XU N8PE`V` D0(  p8Soppp+%(080S @-/+p@-D@0S PX* 8P 0( pp+%p@-|P`@Sl0 R(0p0CR0R: $0( ip00+%7@-@1@P@P  AP Ѝ00P$ /+0S/0G-0PS`p@U @0 pP0@@@ X lP00nn @ ]P00,P R/z-@-4@$P(0,0P  $8 +%7O-0PSGp` 8(hS?Pp $8SDG(R008(h8! 0S0S ^ Ѝ0S08R00(hkP080h88S 08 ЍO`0F?oP20S `&0 S PpP0@S  4 X t D @ @ @ eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)0$h48VK"3P( 圓R( B( ( W(PV  PPl>@mH80S 48PS8P m08880X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 0P0J``` P Q`*ZXP@$ 0P+++%+^]? 0 pC-@P M!00 0 B R   0.S q3 `! P` HP T 7 Ѝp0 P`000C/0 !GP00+l]0(8R/+0$P00 /+00S/ +8 O-鬡MX[$ 00! 0S R`PO eP:l]@0HQSQ0Z00@P7 ppP0: Sppb P)dp0 R'0 Y& 庋@Y  K0H2  x*(llЍpP00+%P,4]0]< S]800S ,00S 00Co//+++p@-|PPF@T p@``kT0S S VS 7Sg@ @+p@-@0S00S 00SM7P p@0qp  y00S Rpll0P@ QP0PL0@p88 SP@ P`%|,+++, +@-'=@24G-@ eT00P  00`p|| 00ST V0 000S T28 + +D$,A-pP1 @`0000  (P0;0 A' 2 mA0PP     P  5X A*+]p@-}@Pp$R0%S!S0C Sp S}T x T 0C Sn 7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP j0S0ptp 0p@^ 000Sp p@B0!S $P j$t00Sp$dP`p@&L00Sp7D00`Vp(O'p@4p+++]F]]p@-`@P 0p@M+A-`P0@@@p0P/00,0S W HT T A,0+ +Q ]+?(p@-AM0 70000]0  c0  ^0  Y0 T0  O0  JP`0S1 0 |<PU0 D<<1 40 Ѝp+]]]]]]]]? f+@-@0%0PiP/+< S /@-0 044 Ѝ%]@-@x0@ +p@-x0@M@T 0S P0`P V@Ѝp`F0PS +@-@J0$ 00@S 0+@-@@P@-@0G--e`㉋(B(r0$2$0@M0?000S0S  @10S y0S 0S45?0P P (2pP`0S P 1`P 0SW80S! t*2S80SeV|Z0PS0S[ /S TS S S U U"8=P d2Z 0S F:1% "1+++D$,+|,+ ^H4++^C^,%`%+Y^>L,,0,$, +RU,,%m^w^+^^%+^^^^F__H,_/_+7S< iS0S P0 P P P 00K`P iV 0FcS񟗘8 L l 8 T H P  < < 4 ( L   @ L <  d l | P \ t , 00E.U S``ydP ePeP= R0S`Fc 0SP0@_U0b ,0Sl U U000#=U00S `J V P+U@  U !UQ0-UQ00  {@0#0P NP 0 a0CS00 0`.P  ` 00P 0Sa0@S @P000S AV"P 2,00 @0S 0$ o-P 0S.P +Ta0ES000+P +0 /UPnUU0ESf 8 L ` *U( @U6 !U[ Pq 0S US'T60S# PP pf0SLH960S 60S0 97R0<  K60S07S ;07S 00#0'ⅅD/K10@S0 @007S9 :<#0CSdP .=P 0 j0S e`q0 S (0!R0*?0I$80S p o0 S h(0!R0*?0/ !R00 !ı#80S!R0F !R0 0!ı 9 49!R00 !ı\90S!R0!R0 0!ı !R0t*?090S 90S `0 S 08:0S y0 S 0  &a 98L!LjR00 !00<0S0 !0<00 eSd0C0<0S 0d !0<0~<$yP0rP0qi0S 0!ıT; [4 /U;0S0SVp @ $< D ,< H 4< P Bl<000!R0 0!ı<00<0 00!R0 0!ıR 0< `0000!R0 0!ı= ` `<02.!W?PD!R0 0!ıPH ,P P !R0>>0i?Pd!R0 0!ıP& !R0>>0Q!R0 0!ıt?`P0E kP ?qp X? !R0 0!ıv?`P+!R0 0!ıP l?`PM P 0`0,`IP2)P 00,00  &20S?V" 80 PP U U ?V "R0> 8P|P U U "B0 PlP U U ="10S %PXPs U U.P!0Plh!% T(P0` !R0L1 0S<10գ?0/0 $!0 S00C0 0 C!R00 0S00գ?0/0 00 0 00iS $0 `;P00S0802?(+!%<_G_T_`_h_,,@+++h' x,00S/+p@-@P/!pO-S`PpM``@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0d80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 )0P R* 0.P0   80 cP wd [0J0C+0   /G-pȀWY+p S@00PPP @ 8ZPPE0S`0S P B0@ 0R R@0`s_p@-`R P@ a0P @@@ 0ppM-@p M@9p00PCu RT0Ѝ` `?Z>P ?0 `P?>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#+  0 ,++A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ# 0 DPzdP fPP Q gR 0S 0R   R E0 i,++@- @ @D+ @-P@|,D+u_ @-P@o,H+_G-(2pW pЍ{PP( P0`{p`@P 0pqpa {{? SZ a0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Ul 5 P @U(X0jP ++L+_p@-p@`PP<J,<0SV@` `<D IP +pD+_ 0 D+ 0 D+7@-dP@ PP 0S  P Ѝ0D+Po/@- + Ѝ$A-`QpP P P@P%U0P 0 P l @`T @P 6/P`_]`@-~|0p p0h hhP 0X X@0L L8P0@4 4 %%` !`1` B`O`^`g`q`w`C-L1M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@+++G-@`M0PSS003 @ R S0\R% :R R DZ 1Pp P0H3/0S@@ R0Ѝ| P/@-Hp H( l*_Ѝ00S @  d[*\0PT T D( 88qp `$,```G-@P`&pppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(Vp0  S P 0F@@%%p@-@QP 0S R SppQ0 QA QR P/@ PRP/p@-`: PPp@p>p@- 0@-M + srp@  * PP  000Ѝ0++400S/@-$@P P@,+@-@P  +P/ @-p@''0@-M@'xPx00S@)PaP DP OP AP )dP oPi?|0t00SЍ0 x0LP 00|qpx00@)+`5a@%yaO-(M0S 0S F0@S R v P 4X ЍM D@k Pp 00o pPPP`TP DP  PPpP0S P``30STPQKPN ((@(!P3`00P0`0 pP0`0 3P T ( ^0 bwP`& 20SP `JP   @( YP wY |2 pd T2 )D2p@20WF0b,2P 0S RP (xP11P =)v&0S )/ 1X 2P D-P Pd1 ]L10S D] 010 (0 yqp 000Sp 0 o9P  0 R  [ R 0 0P: l X ++RUaP,a+$a++,,++++%,D$,%aP@- 0@+00@-3P '@+aA-P`XpVWPU@JTXlP0D$, 0 +@-zP@ @0 + 0 + 0 +p@-P@@P Pp@7pp@-@`P*PpVU p@Z Pp PpA-@Q`Pp f\\U7G-@@` PР @PUЍp pPw\7CP l\8p0SkЍG+@-W0@0S @y+0 R/%R %R0 sR0/@-(@0SP00+FbTbG-`dd@p00CS0 ቧp PP 000 P U 0D IS  [[p@P@- 0PpbUA-@0 0pR`@0S00 R0S@00`P0S U  CP@00%%O-M@`DPp!Q Zl`@pW*p%pP` P` X TP UpV`PI`00@0H0L 0`zЍ84P ^[@00%%b@-@+pFPPP Ѝ@變i@f@@`H0H 0P0yA[ ᗊ@;[ ЍG4U A-PPЍ0S `p=@:@@YPP D00< 0`yW tP [t? @-@@ ]A-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0Z@++C-EMPPEߍ@ 0@rqp `,ttPڬ嬐P ` P:T0S E~P @  N0pS<`P  z P@+T,A-kX1@0SGk @1RpP? ,%@ 1Pk`h`e``P0p000 0`00x;Z밀P@LpW pZp*ZW Pq0SZЍ YZZ@+bb%%bb0A-0S@`@P0L x@p`PY@YY+b@-@@nP ,iP doRUa@-M@P sPۍ@ ۍ1O-0S# 10SPpuP 0 `|R@0 -R` d*P JP @ $@ ЍP PP I 0 x {Y P vYU @T ` vv`AsP ᵉT@@P@T 000d0&@qP<`$@ᛉ0SHY$,+^ba0A-`V8@PSpP0 PЍA#nPk`:@74@@@0 `wYY@ YT ЍAQЍ+bb-M *tP  @oЍ0@-@P0MSP @XY tP&!@Ѝ0@T@0: S *@XP,%%@-M@tP͡0 00yЍ0@-Mo0P@w sPh0 R\P0 R\ tu p0St00Ѝ0+++/4@-@P P0@/R@-@ (0@0T8$@,@- 40 R\00S@@+,h00S /pp@-qp $qpP@ QPpp +@-P#P3#0 R/  +O-q$M0S|10S%@=P`\\100CS0S#P`vu @@$P`0S00S$$ЍxP`@n 0 R  0吠00刐 00 000 0 000000  0P0000`0E ,,@++l++O-M ЍOv *O-P@4M(0X0 ,0ut@ P4Ѝ40SW400 ?Q)(@PPp@d00$0Jp P9P  ` V0. 8@p` P P@00Pᰳ尃0v V `V@P,0S3 l3X3 A5B)P30pW0 0 `P20S Y Y` P P `V@Y*$P `@T_A0S t20S  P0 (0 S 4  3&PK20S 0  @ 1 0R00S: P Pc p 4ЍO V000 P0d 0P@ R LA0 Pp``@P,1` !X$0u$0@P_ V Vm@P{ P P Pu Pa@Put$0X$0@P_|$ 0S V V0$0$0S E@P R`0 ,t+ +D$,@,+(,0,t,|,7@-P@sP ,0 R  000 Ѝ0+O-`dFdO-`PAM@ M]`p㼕Up!`|*(px*0,p<00s*pQp `TPLuK DnpPF!0 0$0P0  P  P ,00 Y0P;Aލ Ѝ Pg tP \0`=V* !V' <V 0F^S0`͕0͕0$xmL>V =R+` =R-`8 t Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =]PV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` P `` e0Sv} p0Ps {L^`p%+%)&G:dNdSdYddbdFddEddd$0 RP  /+0 14/+0 Q/P/(%@-04 ,    00++++G-P㌐剀jL@fLPT`ppP MT M  !  M M @`匀+A-8p@0PS` 0P0aP +@-@$ 0 @z+P 0 R   /,p00S/p@-`@mPPPpP 0S8@pPp  T,+~Vg@-@P00Pl0 0  ;D0'(<%(8#(4!(0(00g+gg+++++P/0/+0p@-@00P0 0R 0.PPPPPPPPPQQPQ'H'D'@'<'Pp P0 Q00++++++C-阁P0@SpM`Ip`ll!0 0!0S~0@ 0  @Pa00CS7 `PU7 0 Ѝ P -0!0S @P 0R 0rq0 U h Q H S  {PwP`,(,,,+,P%H%,0P$0 00S000/(,,`,,p@-L@P`0S0000p01S 0n'P+Pp@-`0 p@&X10S P@@p(1@0PSP5pP/}`P0@@S  1CP0 1C%@<P 0S5000|  0p  0d  0@@PW 1CcP ++++++O-|C0M0dwvP1Sy0\P1 0S b 0 S1C10q&QF 000 00PP20SI 1SF P2!0sr R0l2ap01UPL20SDXO 1R.sr0nS`J j`0F[J 1RKЍ1S 5 0A# R Y1S1S  ` 0kP  00KU1 0[0 `0S/& UzD& 0R 0èQ0pP 0C001萄 S rI  0+,+T,@++ ,A-pP`p00S HP `P 80@0@D@ 0@0TЍT,+@+p@-P@A 02PpA-`p@@PGE$1S 0P $@@+7@-Y 0 0R  x00S U d00SX00S D00SX   +@+, ,,l+p+T,<-0 R!  ^ !0+04/+0 R 00S P@0~0/0P 0/\!4 0 / B  0/+4, 0 /+qp/G-p`@PpP 儐u U 0 0W 00V@00CS7P P 0P@P+D$,PG-P0P`PpЀ@ 0@D P V 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB+D$,G-p`P@0@@0W  S #R0C00C0Ѝ ;,P  j eF 0 CpGA-0PP@q1k`EP q 0P 10+G-1@`p`P0 LL0 rS00TD`0PT@@+++p@-@PPp. P0S0Ep P(%@-0P (%80P/ R/0 0S 0 /0+00 0S/$0$ R U0+`,h+A-X@ 0S0dS 0p(0,`P` pU` s00++hX0QH0H 0.4 00/ 0 0p+0+p,A-@PU  ^"04P4p 04 R0PU R4`40 0 P ^PQ p0࠱`  00+O-1P0sUPP@PP0⸡p`@` V R0 SRA 0 V 0  W0PR 0*JPA `Y0 0 y W`@TP0 00  0` qp +@P PAp ` W0 0O0  0`qp @TP`,0+D$,P0G-cpPU !R00 RS@ U W0S P*P @P P`@V0 0 0 0 00r  0@P`Pl`@W 00 0 00r  0@P`V@0+D$,G-`AP@pl0Vs 0SP@`.P@tu TUP+G-g@P0p`Pxx80@ p 00  0`P 080qpc0+D$,800S/,00/PP//,,00CS0 Sp0 S=d0 p/O-0P-SP u   E f^p]P^@P0S,@ 0R S%@T EC]]];X   m  0 ЍO`P @@ W@ 0A $ bC Dh+U G-@P $`P( rpP ` } { [" d b@yz  0Z P"p@ ;p Tt p@s CT6k.sq 00P6 A06PU p7nAP0PPЁ  G;P p,+H,@-P ,0 0R C +hl0@-0`  ^ @^TSa04S '0s05S #+p,0@- @P0 QA6R 00p,G-ipP@P P`PA`Ap6W @p,00S/G- M`pa@吠吐qpp6W @ Ѝ 0 PU/P P P 0 `,p,h@-000mS Ѝ 0 Q0 >@P 0 S#  PPP0`0 S  Q0 R pV`PPp Ap00+17@-PU0P( P@ P0 Ѝ000SK@PP @jP@ Ѝ0@H00S< Ѝ0@? 0 0$09 +h+h@%hii 0 +<07@- R P(0(@?@ 0 Ѝ0%+@BH,@-P M# @0.S ]00S Ѝ 00S 00 00S000 l ^xP0@  0R 000@0,0*i%,iBiH,Vixii<07@- R P(0(@?@0 Ѝ0%@+@B,,@-P M# @0.S 00S Ѝ 0S 00 00S000z l ^P0@  0R 000@0,0!%ii,,ixii@-@PP  @M Ѝj@-@PfP  @> Ѝ0j0Sp@- Sp00S p@t, }l0p`xP p@qpP@ 0p@ v+TjT,H,P07@- S STl0 Ѝ0XP@T0PP {? @ Ѝ0@r?0 00 %%rjP/L0@-0@S *00 $0$ @,+,? P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P)? Ѝ04@P,0  0 10 %%#,%,$0/0X,P/OP @P/A@-@| pl@0TxSPLHD@<8@t%j`*jjjk%kYkkkl@-V0dSK@S!1 CRJT" R&0CO  R꜒ D D D D D D  D @P3 @.A C#R$ D D D l D D D D ԑ T D D <  D D D $ D D D D D D D D D D D D k Cr \ ,0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~,sl/lLlO--@PDM`00PP*0 S 000C S ?  0p00C/  0?>pU:Y U :TЍ D0!R1@0P S 0,ST40, @0D@D1!0C 0 +X%\%C-PMP M 0-@ݍ ЍC` @=0Sڐp吀吐 =0PU`=P0P = @@ݍ Ѝ =X%l+OEG+l\%l$P@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000%%ll@-PM 0  0 x0  @ld P 0S>000D ;0Ѝ,0P x, ,lP @P/ 0 /l+P/00S,0/@-@0S,0/@-,@0S0 0q00Ѝ, m0/@-,@0S0 0_00Ѝ,7m0/400S/(00S/@-8qp@,+P@- 00@ ^S00S00 Ѝ0\ /%fmp@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0SX 0Ѝp40@0000$ [ @,,wmm3mP@-P A7 ЍRS+DSSS 0e C R Ț \ \ \ \ К \ \ ؚ \ \ \ E C CS -S 1 CR 0CrS dSWS ^S0Sj0wS     0  E000 0 FK N R WR Q S-00 0  m,m800S ,00S 0P//D,,,$0P/0 0 0C/L,+,@-PU  @B Ѝp`@PppQ 00S0\Q0S 0S@V kP 00$Q00m,@-0 S 0*( (Z Ѝ * ZnX,n@-'@ ;,nP/0S/P 0  //foP@-/h 0LP/X, 0@-L   ЍX,m@-`MP@ᱺ0-S0p00Cp S T 00ЍU TP PTU $PT00W`(nDnO-P$M cLP 00S S03/0L0$ЍeL0 @PpXX 0 R @@-PD &$PP 0@s093@!+P0P0U0 P @0+S3P :╺:9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P# aK[  0 p0 @ =RP   R R tq000SPP000p00CS ( \ 0U?o 200@S 3/TWU 0 [ 0S00S0000SL@40 S 0_P&00S X,,+]nnn@-@PM @PU@`p0@ mPPU   c(A R  { 000CSc @ P @ @ @ ,  RyV)00SS# P|U  U Uc0?o20RP 2/ 0RP0 VW 0 {Ѝ 0?o2RP0U U U6W0 0S00S00W 0 0S00S000ESX RU U U , 0 S0R  c R U2/U~00SS 00S000 S000;S U000 0 nno5oaoo+s@-P`@ᓸ000C S0 ` 0 Br ^ ST00T00VЍp $`~S 00(n 000S/P/,,@-XP H0H@ 0S0S  0  03/$@o,`% 80S/S/ 0CS/$`%O-@pM8Q 0S [= 0S0 0 Ѝ`V/$P  0P ! AAQ-P $ SQ@ S0 0@@Oop B0 R ` 0 0S Wp0p`%@-,P^P0с%/-4M @20S4P 2     R2 0S 104Ѝ0! R0< "$01 S 10S 10S1 `11S(  Q2 T!2 R (10P!000 0 o R  RQ0 000S P 10S 1v\ 1P P0S~ L0#Sz ,0 0S P  0!,,T$,D$,h+,% +%,@-v,@- 6 Ѝ@-P$9`@@@dp0 `!V ЍH @-@9P  7,G- @$pP` 0[ )!0 P@@ό@0p\p3#@- d 0 Ѝ(7@-P@2"@? Ѝ0@B@-<03?B3c/ $ 0 0 QЍMb@B40@-0@@T PP  0 %,+@-@0@%0$R/ $堼,p@-04S S S צ0S  0 [Q0Ŧ0S 0  C  Q? 0   ^R000 Q\ S$R 0C 0N0P0000\\   0C R 0 C%GH$,O-pQpPpMW My@xcPJTpd3dC  \\Ls 8PZ PUA (3T AWۍ ЍpPS@DT2%P@  @@ 0  'X &| V@ &T@"0S000ʱP ;04P ST@ 2 Pp 0Q 1T VP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S ? P;? T0p0000,H$,%)&D$,1&8 !G0@-@ᬲP奲P |堲P l囲P \喲P ?P?%Ƃ@-@P @P P P(@ẐقO-|1M0S" @`0 ЍOdPp400 0 Ppxy&@`00S 000S  0P Ѝ P0 000 { {% y% 0S @`H$,D$,`,T,0@- LLPR^0S @T 0 BH$,%0@- LLPR^0S @T 0L BH$,%0/H$,0/H$,00S /H$,@-NP >P>P>@-0T$,//@-L@ p0 P㘤S0PЍT$,\ QR0* /QS QQ*/0000/@-@P $000000/0S0C 0//@- 0#3P Ѝ@- 0@SPR? P W[`Q  $` PЍpA-`pP@T@  A-P`"F$@p DQP ,0 0(000dPЍFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0P00`a0C@S  PЍp  000@@0 0 0 0 0 0\/\\A-1!0 j \[Pa@1!0 j[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CqQV 0p@]^S @p^404 0 4?jp\006,6,oByp@-0Pt @R RP D D <h@D@ p@ @1&6,6,C-1`pMQp@P0᠁ `0Y 0 .PR l1@d1`0 Li\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . Cr R 8" [T \[R@]S  000TT[T@  \T  \R(0 R Ѝh6,6,6,>,00@-00M/SP M $S+ +S00+ 0 0 9S#\S @P0 0 fi0IS@P R00ۍ Ѝ00@00 S00@6,6,΃O-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S 0QU t0t Pp0 `ib`0V 尮P0 0"PX$, ?,6,6,O-`M@@_.0 0\0.> 0h S \|.t>0 xh Q8  T   (   t   0S 00@0000 0S 00@`0`S 0S @p#S ;S 0 p00@\ MP  P 0S| @,Sv p0S 00@P 0S  00@[VX,>,>,p@-P @"000P @pd%@-@ 0  @0d%0p@-P`PUp,=@P 00CS0hp yhp0 h`6,GA-p`hB R4 RR R P$0SV0(  R R <P$0, dP000 P0!;PQ$00P0PT0, VPP (00S(0 #R nR0V ,0020#00$0,0$0!h( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0S $v (0V0(0 00  T0(0V0(0`6,G$d6,@-@X0  0S 0S00CS0hp X孌0 o`6,O-DMX0`SpM00S 0S `c3#X0X0\030 `00d0尓XSXP 00CS0gp XtX 'pP0 `Bc0 X PލЍP2 kgp0S r70`6P 0O6P p4S a780p0p4S \PP IgP 00\006Plp0`0d 0R00d000S 00Sd C7P00 2 01b00S +ǘ+哘 P0 b+0⹘+0Jⵘe67Je 0h!]: P*6\PP f8};P\e ( p$p5\0pp!5 0`PS(00c;PX70000t0\`0P l000S S P@ /o"0 l 8(00(08`6,)&PS:,6,$6, ׊/4G@-@P Vb;P@-@@P GbGp@-@P$Pp0 ;bT@-T`@PP J 0(p0 ( Ѝ>,@-`MQqM0S000@03 0@墬0S P 0a 0 0S S ` 0l:@P *0 : Pf 000ڍЍ>,6,6,H G@-@P  0Sxa `p\0 `  {60P S w aЍЀ>,eG-pA唁!0`PU , R:(,>0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0   = 0 >,1&A-@P p0R`*W00  0P P 0O-鰿MO00PЍ080?PU 0PH0 \ R0S40 P0\0 P R 0SQ0A 0QES0=0C>S3 L# L# L# L# L# L# 4' L# L# ' ' L# L# L# L# L# + L# , L# L# L# L# L# L# L# L# L# L# L# L# L# L# L# L# @& 1 & h' L# L# ' ' ' L# L# ( L# 4+ L# + , , <- 0 L# L# 1 1 1 L# 1 SS4 0 PS0@o0P0  Q Q* S  H S 0Q sh0 R 0R0 0R0S0H0[0S 4 0 k0 P^S0@oPL0 R: L `0pI00)0S;';8 00 [04 0<0S H0SWP80S4PU 0`  E➜P0800A E4 א0T P 0  004 0 0 || 0:00z040 0D:DR <00s( 嵡0P 0S 0S 0( 4P2S 0 Hܨ` 0S0`V: $g d00@ p9@ 0S  0Dh_ H0$P x0 0H$0娨$0 S8`0V:m$2 /`000 00C 00P0 b\8 0R:LN`8 01 `S p 7 P0   R:1 ` 7B7` 7'1 01S:` 007 x70 S0`$78 00 pg04 0<0S cP40800 SP80Sf04 0ƙ<0S  80S0p4  Hh`P <000F400<0\04 姙<0S V 0400<058 00 U04 0叙<0S gbL0 R: L # `0pQ00pY R  Q 5 0V^4000  P 04`Z Z 0Z 000 G 00 00 Vt4Z  0Q\ 00 0 v  PQ8 p0V `XDcH0p0<Hp<(0000S s04 0<0S p PB"000Q0 0  0p V0`0  `0P   P\   p V0S` 0  PX80S0s  " 0p0 ]04 0\040P0 xT0P 0S 00Po80S0sl!ld0p 4 07040P 00Pp P R0 0`pL<0p<S80SP4XM  0`Rl0%#0VB*0006,>,?,X&,x6,$?,)&l%Uht@& 6,H H !6,>, $F.&,6,0pW(p0 1(W0 P0H  !  R 0剄P 0 pW* 0$ (1 0X`pH0`0h<Hh`<x0h041 8x5<0 0R0((xQ 0{Q  X&,F$?,p@-@P`Tp0wS {S sS 0p /P 0 D\0`@p /P `$G-`vOP9PU00p\p01@ R  pPVCGrXpp0!S < CrQR25 (6 6 6 (6 0  7\0 0 00 00 00:S 0S0S W00 000 0V 0S`: P 000BS !T?,p@-P0@T P ១P1 0S-l7 7 L7 x7 7 7 7 0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@T?,7- 0@-MMP.@P  P[ .p4[+ . P.ۍЍ0$؊H0  BR Rp R4 p/)&P*&@00CS0 S0 / 4)&@-,A᫚0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@f\@,1@-01\ @T P#OoB\@T P P P QQ Rr P\ p\ P P Q qR  =-\@,0@-  `Ğ\ @ T\    %R    \@,=-A-pA0 5S$\! R  (P 8!10  ,P !(0  4PP6 Ac<0S 00 <P`p夀0U00S 000\P ɪP D 000 PwS=-@,8 P*&@,p@-@0` ,/T  2tЖd lP`PT p  P000STA @)&P*&\?,s@-@P "P<@P @0?SP@P` p Ѝp/_P@OP 0S S 4@v0Sr00Y8 >* @-F 2/FP*&@-0@<TQ T00 u20001S R0Slp@TX` T@0$ @H4Y2T(8  @,P2\@,L$P*&=-ŋϋ@- ?29/~P*&7@-@P  ڒ0S 0@T 00 Ѝ00"S p`@-@P  p IYЍŌ<0p@-XPP%0ATp0 "R   DS " @D.Ap% 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,؝0P01pd,,01//00/00/00/00/00/ 0  /,@ 0  /,< 00/00/,00/500/ˏ00/>00/M@-@,00/@-@D, 0  /, 0  /,, 0  /,5/00/00/00/P00/X00/`00/i00/v00/ဍ00/ኍ00/ᜍ00/ᩍ00/ᴍ00/᳍00/ᾍ00/00/00/t00/1 00/< 00/ȍsO /gb@-0  0Ѝ@-@ +@-  谩,r 5@-0S04c  +@-  谩,k @- 0A,D, @-D,( 5@-0S04cD,  @-э @- 0,, M@-, @-  , ( 5@-0S04cy, < @-  p,< @-  g, < C@-^,< @-  V,  @-  M,  q@-D$, e@-<蠛, e@-4n, e@-,P, @-  $,  @-  B,  @-  , @- 0轞,, @-  , @-  ,  C@-, @-  辝, $0Qa @-, @-@DIP d 0  F 0@-0 |1d, p@-ЍOʊ G  p0S 0V01`Foa 20S2 0 0` p@-@` P  0p@E5@-@Q7[ [ [ [ [ \ $\ H\ 0\ 50S04c @ M |lP X03S h `\ X X P0; , , ,, 7,6,э@-@Q:\ \ \ \ 8] D] P] l] 50S04c @ $P t03S |I tp l lh hd00S  0 D, D,A, _,^,,,@-@ Q?] $^ 0^ <^ H^ T^ `^ ^ ^ ^ 0 R $b @< C   ʗP \03S | tp l lh hd00S  , , ,, ,, ۞,ڟ,,,p@-PQ-P_ x_ _ _ _ 50S04c p@| | t/ @dzP 3S/ <8 (A. p ,r Q8` H` T` `` l` < <4 4C, ( ($ $/B, , ,, ,Q` ` ` ` D D<0 0 0,00S  /P,,,,QP' dP% <P  SuP5P 0CP  @@PV 400C`F V$P P P0S p400C`^Y|m1ST !0C B/!?1C_xP00 S11X@zP`PxP@a@1S50200D(PZ) @@Pq ,u t 0@S,u Pp u Pp P P10!1 NSPNQ0^ B жr0s0Ɣ P P?@ "0C S񟗊p q 0 b02P 00P000`czf@,=P*&7-RS1&7-]1& 001/@,P0 R0//@,O-p`*@PP [ ! 0P @ Ѝ000 1\$<0qP0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @@,P/D0 R/0@-A1 P e@< 㛔@,O-Bp0 "W Qh0p 000 Ѝ`((0S 0S nP CX000 @  S! S0 30S nP (X %X 0 0 0 R @ S 0 nP  X0S X0 00` S P0PS PH0SPPn0 00n0S nt0#?C S WPU  j0X!0Cs0S;3PP0 PEW@,1& @VUUUO-$MHZS  R0P 0L`YDp9? =0Y0 0S 0g mg᪎P9n:nGn@`0l@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C 0DS0  0gnX 2 g0  BWU P0{ P>  PN P P!VUA`E D{@DP`0(g %g"g@`"PD P AP;  JR !   ` D0z0@0!P`1 V0p00@  \`ZGy`F`FV0p00@  DPEz@DU`E¨` Y @ @T`— R    BV0S 000 0 0$ЍO0Y S @,m ?(r 1&P*&A-lP`Pp `Vm@Om@0T 9`P@ P P@,@-P@p 00T0* Mp@Ѝp0 002 0l` 0@ :zI@t 0ߎP I 4%@,uh0p@-P@XP0Ps H` R :2P 0S@@Q@pu4%@,@-@@@,0j@,0j@,-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@$@-@$@-pP@`M,0 0(| 0 00`Ѝ@- ЍFO-M P`@pml@flUjT0 0aPV 0 D0PSY 0SV L00SRD婌PPL00PTP]y@DO@W ;p @PQWpV`KЦo`0 S`K0 _q@PC@0 <;PT0 0P00L00$T L?Z  r xbvsbqbЍ00D R00S 0S IL0X#3pxwqP 0 q똰:FE_dbd ?0 EGpcP`!FE`EdHd@,}7-@-,, ($ +ЍF@-P@`$0 0  0 00`Ѝp@- ЍF@-pP@`M,0 0z(o 0 00`Ѝ@- ЍF-@-00c X 9Ѝ Ѝ/Fp@-P@k@Ekp@,@-+7@- x@yH+B$h~XPU }%  K00h@PU m%T  K00000S$$` Ѝ0,]* H,< @,P*&S O-DAM@ PP4q@ &@ ? @Pࠟ   jPLKAߍ`V 9 n`PX Y   =R@@0密 `|GP*& P !j 1@-r0O-MM 0p@`P2 PP* P _nP 0S0 0    JPPRP 0 Q0 0PG~ۍЍ0P 0 90  09 o ? ,00S/ 0P K@-,L,,@-T{P HP <D'Ae(^"Pq@]? A-@M @圏0S0|Q%P,  ⏏w0S#|P  a0Sl Y0] )PeQB@PaD'D*JB^&(ЍP@R=}P(P'20S IAP'.Ap 0$!P<} X $P 0)AT RPP AP p`PP 0q+Q Sp 06&V`T(p`AT-@p0T-:W?Q  R@4Q p0Q  R@5AP`003/P 00  h0S  R l 10!@APꜛ,d,<,$@-MM+@(C{+({B+(:{B+{(X@PލЍBO@P 0 T @@@@@ @@@@0&'B(,? ( -MM+ {+L z+ z+0z @P  ?ۍЍ ( 0@-@M D1@@$#P @! qP A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*@P3FP/[P+W@P'@P# 0PZ| Ɔ;R|  0S 0_ Z(P @P4o0m)&)y*00ꜛ,d,b  7-7-@-@M 0@@1?v#P* ?@  qP 00*!R00$Q /*@P  {0S 0` 'P%(2*Ѝ蜛,d,O-`M!  0X#*0S ` 0 SS 0Rp0 S00C `@C0 S:ᧉPP@ B pQ %S0S iSc %S, dS *0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 Gy1&7@-@ XPU e! G00 Ѝ0ll P X M!L  t( 0$[*H,< 4    < Qp@-P @<00S   0 p@5 0@H,H ,7@-@ PU ! ,G00 Ѝ0PP | od00S kL 0H[b0 ,|,*  % D,i< 9 P*&s@-8Q`@9^jWz _Bd{_]dw _7dz5Rd_+6~zTf 0 Ak@Pxx塹925)P @h@^^ ᏄzЍp7-$QP*&^ O--{MpP`ᘁ 0'p F 0S  P R  0S  됵P ~뀥P ~Pqp@T Pe"  D!S0B? 0mM*P "-F@P "$F00勇P冇P; P  l}; B;0S >;'P :; 4?00y4"0{ߍ4`3 ,0z"!`׋؋ 031,0l0,0L,0   L 0qP600Pz?"!!0 # g PV m YP*U l @2 0S h2P OA0S hHPU ݋L P0  T 0  SR =;1P } 1 T 0I2 _z?0YC0P0SP @ 0V0 R0SQ }0S/ P ]xk  PS 2  L, &ptbt f@,H,  E ,    ,|   0@-0,MP0 00 0\PPP@P DD屷@0Q ,嫷C,Ѝ0@!ꄚ &P*& , -O-piMs?!0 WP 00iߍOЍ/lx5@PX1P L!L00(@P jZ` PPW0FSV030#Z0S S00W"nD!` jP P{p0W0XDU80P , 00x)Pu)G,!8 O i-O-p0MT@X   p$p徥 `V X @M'U` zPPP@P ?H E0ᲥPU 0'SP0U*S/ (P y [ 0@ 0 0H0 ~P11Z Tw0堤p`PUQ;S ( 2S022SP0220C2   S`` ᣁ1w$00 00( 0p|^W  @0   (PU )c*c(c0U 1 \W 0X0C?o20S O\`$L\aoc1w@0UkB\?\&w00CS0000CR0U sY$0S  r96-Tf wi 0%S @SJ B* B^D0 0 y/00L 0.RP 0 0囄PH00Zp1@P 0A0 0XȤ3 4Q5fSv00X (Sb@Ȁ0U bvz  0UX ~Y`[t`voiR PPW  ]WK0ЍO Ѝ/b ~  h' ht@7-)& 0@-CMl1PP 0S .Qby@P 4ntCߍ0 Pgt @,A,G-p@ 堀堐PB`AT:00Z W ,/Z 000 .yP EQ 0 @ 1&A-`Pp yp@ ~ ,pt P2@B,A-PO@Lopl t0S DQ0Q.SP @$ $s s@,E A,@-M 00PDP # s 0PDP  s p@ (  s 5PUx@&  s```p @)'PPЍ ls hs`!iD,%iE,B,8i(,E,đG+O-8MXd0 @!sT400\0 ,‚P40,   -8 4d0 w=C$ C.,Tr P, 0.̟ Q(<P 00 ( 0 0uPPPPP8@<,`0tD0D, Dq,v `<I /  0p>0a Xvr  \PP\  VPP;U 1sS 1lS;"000 \P p@ v ! HhH Qp0TKT[T{1D+0~, ,P 'P "P P P P P0:4: @p A*0p 0HAup H0St:t*10ll MDP 0H0 H0Aup 0 AP1PH , H$U x P\PPP@;ÁP@- ,r)0xV)0wQ⭁P\8 0\8UXLy0 y?T. 0)0z8 ;━@PEPS%PN X0 "\6SE p0 6@P: ;5 |t h[7S'  PH@?07@ P 0(A=AP\XP@Ps:4S 0 zP 0'APxnP 6P'`0b@Pal\80<'8\8P,W 8Eq8o .vP0&08P 83q8] vP0060&S\880\8P 8 q8E0S d&8P 8 q86 uP000S\80\8_.P0S\80\8P@sT %0}C\8%0|;5T$A Q0:$R$ Q9ğP \8şWt^ H4   3ݦ4SP  0@?S @P p4{ 0Q0:$R##\ğR#$R#W%HR($ 3 ( Ts0S1 T`P 2@T PᖱLHwH#00S "0S <#|v>3S3 TE 8"DC?00N?C0C ,>$MP0  0@F0@P]iiP$A?;p@Px080Ca@,0,P pX0S ,I~ !X >0S@0 < X+4AS< ". 0 0S D'~Dm!W5S !"o0 0S $~M!XbvXz@, , P*& U/ ! 1&0& uB,,  ? i6E, \ e .h' @ !B,< -R # A,D,5F,W XG,C p  l "  LF,v , SF,E,  E,4@ Q n \I,  I d  / P 01/!FC-鿏P@,MpP3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ߍ   @-p`CM|@~PlP#d0RXPP @ W<0080 `0(PCߍF ,,  D,@-@ @,@-0  0 P @0@ =28 0/P $  gЍ,X ,H,O( 0@-0@XMP0  0@ P x x0 t0Ep@2P0/Q   LL <2 0/R@, ,@2Ѝ0@,h ,,,,O( <,-MMXP~P  `n \n0 00SލЍ\0\ \TP L0 (0< 0, ,,,<,,B, , @-RCMX6S 6P \8lP XT20S H&2\6S 8!2020"(Y2`Pr\8. q^|10 ^[:4S !TQ\@f10 H:4!SO *00 0 B=p:tt!2@P) M1d 0T-L*<'0S ,!, $!$0S   ; cP\6S V ;2tCߍ 0 B@,D  ,@ C B, 4B,  - Y6E,M E,? f q A, D,  SF,   W @-@T^ S C @TR00S\0\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-p@PhM 0S'phЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/ 0\ P0//!01000/ 00#0//O-`$MPA@T z pd|P00 0S 0S0S$ЍP P00 S P|S, R ,0S R : 8 80R:P#3///@-@MP M p! *0 `p  Wd5\\ SS=S 8 d3R 0 ,c0 ^ڍ ЍTT  @-`QM p@ 2P  PP ePЍ{PTP0 p1P@$U@@KT @ @0 @(P <  OEO-Pp0@0Mw'PP `ĐĠ0 R  PЍ 0L03/P 0 y놁0 y  @?$0S P @k @k`, p@-P`o0@0S 0p@(H @-0MQ!p0`L0 3/P< 0t@T 4/@0p0 y 0y 0@= $0S @Pk$0 @KkT `@Ek @Ak@y0S0C@ ,$@ f(Ѝ蘛,  h' m ]$0S/p@-P@J 0000p@O-p@P|M Y60P,0+`f,dP|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U/0 0L1<00 00OpP ,0<<0@D'@0S .P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0 H @-Z P 0P 0Pp PQ` QTyPQH "P <080P/,/(//!p@-8@Q0@P@DPp 1PpX&p@-P@P  Zj &j00pp@-  pl&@- | px&G-@PMP N/} 1j0 0 s0S1 0S XP a-P ލ~0S ~0S1S P yP @l0 1h0$1d0(1`0,1>1S nP >,%0`> @`pԠ( p$   $0៿Y 4 P 3SG y`t } }00? (Ԁp䐍0<P 0S0)#0C?o27 #3RR  0R6p7P 'SH0pA(\ C~ QJ N`P PP @YP  ,0!4!Pß0#pw2P  @000@0" 0N?P0'SpH0AR 0 B Q  > 0 0B,0!4!PŸ吀0#90!pJ V|KR O|00K?(0811~$10 100 d@0Eo`YG_FPEwP 0000!/9PP 00S 3/pO003/No,P4wP (S("+"g b+bg`uP@``VBaV>+"vg+bqg3\QQ0QUh $P 00S 3/p $QUY ` p0 `` pxb.;8/ 0 ``px`;".6/0S3   2g ^g0 0~`PxqxxU" b +`P  P]^P"\+" gbU+ "`P vP# vP vP vP vP vP VxT f  f` (}P ? h!,d,* p,Z G++$ #^ 00A-p$0p@` PAP0 @ p> C 01/@P00pЍpP@00003/003/$Amc O-PUMM.hh,@4Pz.zzQ_(x(EhT`V`(0$S^ 0(0(UݍЍT  n? 0.07 00P00@P#Ppύd40z(Y^ 4S =(7h400C2 7\4=1 V =V?h400C26\4=1 0 000000000 00pp`` , :0440\40s -1yv0 00 00000 0zap` 0440:40s -1ଔV3 `v00. nhE "eX5@0Y^ =2XL=1pP0Nόeph \  kv00$? 000*0(0S00Ӧ?"N?@/&#`@XT,0(04@S0S N?/$$,4pW 4 0}10  A e "e ~e4!0p  1$,01(L!!,H48> C6$1^(1)0!4 $,10 (q,1 48qH!L$Q p{ \x^v #Ÿ@p#j0Ÿ$1H0 0$4;[p2P p>ؠCT $100$10 0: z0G80<@80Sp Pq $003/$`tPM `qS!> ,! 26$H,@IS  GPp<PJ ;HSF 0.$10B04!8C0(1}1S0}1$1S `4@@ꜛ,7-)& Z$&d,,,,F, _PP$030/0@o//BO-@P MMA E0*!Rp0)Q`U0 $0   P q Pp ,\*'0$0 |$(pP d4\,G ܍Ѝp 84Zg0Spp0 @0 4p0SW00_ , R\  000x;8,9/PI 0  x8;,;/ 0 x8;,9/T08SS0CS񟗕0 p p p  p p p p p p p H Sn "Se S P0~  R{ <pWv  &P d0S P"8hH8 ➓8Rd0S $"8Z\0S  "S8`0S !I8X0S! S! 80tL0@ \Q\0S ` R !8)x8 _lQlhY`Q`\STQTPMHQHX @1R<C0Q0}vP00P0)0YP0 U @& 'pPv 0Q  cd,T < f^ ? .  , P w }     wl    , F  2 @ :   D    K  ,O-UM0M*a8V"e&E'@r& pepT pW i&0 T0T  Q ,ލЍ7 )qWd ^P FP' P ! @{P @p`H吴 XBT0SWd \ T 0S 0$< 0P00,0P F fP14s10#5:# ,&*&(&0S #&!& 0i  rP0~Z@DPA@ pe `V  H `p80  P 0 0 ,0ST0 S00 P0p800SS 04  0x; 8:/P00400ST0(ll S S L Sc  SV 0 <0qP<0PL!@  PP ,0$  40x( P0 { ,1PP xqP 0005S0+4^a 14  u0 S r0 jJ%а 0İ 0d,S 4.,X q   F Z'n,    + !8 e k q z    mj?    ' 0 7 C K  F <  & i @   @O-@AMT MXp P`L @P`T $P```7PP@Aލ ЍԃE̓C̳ @;3 (4@$803DP@<@T@X P \~430$3 00 q2 $02(408@Y ^~P V딢娂  It208@d2@DDAT P2P"PPs#P <2 8%PI,2 $ *20)ATp !0` YP&!0%0 Z@0S o#P 0St H0@4 000@0x;8 8/P6  %P !b%@P 0  zp @$$0 +@pW:zvp@p!  p, < %9     m۶ !# Ќ,S d,$. FFb.0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  PB\J,\L, $0@-@"!P(@\J,@-$@2S |02\J,O- q@P@B`P@   dPP@  n@p0Ec#రPU* ЍI eQP  _QP @BI    R0S 0p1&p,@-@00 TP Q P 0bЍ C-`PJMM⼂```p 8r@4PT_H(PeZP8_ Yo`GFWI oP 0 000!00P < 8<1P#<@XNo<0S0 0< 8`PV 40,0'1@ 01A010000 l@@@@x,W@D0S7 0S(8<JݍЍATP0 8`$!QQ@0RT<0P 0 003/@#S0 S(0S 0S8(0S003/@#S@, D & 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> foW 0@o/b0 !!/`P,10/mp@-@4P0 `4^1111p`P,O-P@p`ԐԠ԰0/ C !  !0  Prq00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ`P,  T D 0@-P@M/.?q1, 00 0d0@00 0T0@@@@1 0 000@"P,mߍ0@ `P,O-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+ { 0 Q{ 0S  |]0 0P  P 0 0H  R,  4@T  8X $ T\ ( p` , d A- 0R 0  DQHa@1QRpB   !LAPAP&0 \A=0Q     TTAU @@`P,> O-`BpX1MSL2X\1S,2\X1S \QUЍ0C`10`1S#a`>k1PS \1 XX1! 0`1V$ 1x C H0C 0*fP 0 S 0.S  \-p `Z!XP ^0X`0 0_X"p\P \!p000: SX1x 2 \1` 0 0 X1 ` SX10 2 $ eZ\`P,8&p _Q, !  ? p@-MMPhPoۍЍp~P@`+e\ P*+p/\ P*+)\ P*P|¾Ps? p@-&Mtp@k(NJ`P6 Zh<0 0s_j P (ZO6(^O Ah] <@P ލpQa bD,!j  @-X@01SP@0S01S0  `P,  O-p@MSP! c0  2 0.`尢Y p` 0 0.P0SߍP X%]P0JkP0 a0CS0S  PU`08Sڠ0S( R% S]0  0 a00 wp 0d1劅00 0s0Z+ 8p tP` L0P!h!R( 00@(O  00O0 0S* ?0!C P 0 00t00 00S 0wUa0 40 . d@edAQ, `P,+% MC-L1 @1 R0   A h9'Q   R 0<1LPDTPapHiLP iU `1DP1 iU `1TP1 iUP1 `1iUp!00, pl@ ЍC !!`P,!F @-M@ P @oЍ@-| 0S lP \0 T0T 0PP0=L004 80<6( Ѝ Ѝn, ,,O( ,  ,<,@-p@Mp9t)0 0 0T00.00 0p $0t !Ѝ`P,!p@-L:@0P F%p@bQr -?@-P @  R ,7$0$@)HЍ0@ Ѝ/ 3 @-0  0M P L0L L@ 0< <@0 $@Ѝ,$ ,O( ,<,-3M M T+DP0  4iP io3ݍ Ѝ? [-3M M  DP3ݍ Ѝ? 00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PD[@00( (0P,Sꠛ,$,S ,,,t  ,,<,@-0  0 P <08 04407000 0 0Ѝ,v ,,,<,0$ 0!S/ /lQ,0$ 0 S/ /lQ, 0( 0S0 10 1/mQ,`P,11<0@ Q !@-0 " !/`P,0 10 1/`P,@-Mj/.l, 0l0d 060 P000@ 0e@,Cߍ<&@ `P,0D D /Q/QQ Q/`P,<&@-@0@ 0 0^\PЍ} @- @0S00 , 0@-pAMohPN @X  P<04Px9ܷ/]0Aߍ0 `P,  ,@-P@ p0P  iЍH,-@-   Ѝ Ѝ/-@-\0X0@P D  &Ѝ@Ѝ/  -@-\0X0@P D  &Ѝ@Ѝ/    @-4P P PA J T @-@vfP@ Io0@-4@gP 0 P ,,D,@-4@gP 0 P ,<,H,QA-@@1@#PP1P#Ttpt` _P t uKa_>\>66YAY7-D,7@-@L-P @tl' 0 Ѝ0w P*&^ 0@-EM5P@ W \P0000U ($$0x:@Eߍ0謩,f`P,@-pM<hA WeH1^ P0x ,!5 -k<$0P H ` p 0000`0 0PP`P$kߍpb02$kx:X JP (?W((Jl `P,,< M"  8&  @-@P !0`RxzfP .PP GxZP`h 1  T y-01I@0PU@T 6X Ѝ`P, M8&@-@<K$0@- 0& Ѝ0@- 0 Ѝ@-0@M00  0Ѝp@-P<@0/SpQ rfPp@<&@- 0P,,O-$M@p`P 0 P( 0 PP0P00P p @0}PP0PySa00ͅ0݅ 000͕0ͅ$Ѝ F,< P, ,, :O--,M`d$:[@pq[pPd $-[P@cdT00S@ NqdPPEUM T1T!TTsh$00  @Z$0VSS00Y00S Sd 0 C H C$Z0 0$0  0 9$ VRR   P # 2R @D i0@Q&d `P$ Z@,Ѝ = ! T A-`pP@P!ki fPP 6/ApO-@ M$Z`P Ѝp0P 0`0 VSSTP$~Z-@- 00Ѝ Ѝ/ἃ -@- 00Ѝ Ѝ/ A-p`PMMP\' pQp@u@ FV ,(($$cpt&  0Su 0CS2PJ{S0)  0x 0S8 0S r0S 0S QN@|EP$ 0 \0 L@nD2P 00b0C?o270 姏0<(G?0SލЍ!7SdP1Q! F?p@Foh!H1PH0  0M('  0S q0Sv 0Sr 0So QN@P  00 @PYF? Q. QSFHn q   ,o  ,$,  O( 7 TG,8&mQ F B,, G -MM P  P  tۍЍQ -MM P  P  _ۍЍ^ s@-dP' P`P L%P0S ,. - - - Pu @D`FP Ov@TT/ЍpE v x0|+R/ @-d|+\0XT0PL0HD0@<08~40`P, , , ,,1 ,/,P@-@ -%@0UD,p@-@M L(@H@6g0 #,0H ,0@@0y8h'Pp0: S HncP S S܍p, g 8 gQ @P@Pڨa <PT81!e|8<DQi T1 08808PP oQ P00S ny < R t00 00000 00l0p@ m(t(0S!,e,,<,[,  !'T d n, ,[, O- 0CMSP0q ` @h0!`30`SPW!000 @ &$@3/@P CߍW! 000Z 0SX 0 @T W  00 0  0S l00S \  P0W0 ! !  000,, ,  $ ,3 `P,7@-PQ@0 SS 8A0 000] Ѝ02S  9 C ? O-(UMp !4Q 壓 e#ß0/SCP3c0ЃC0P/UEA# 0SPZ0S 7Z0Sk0Z0SG)Z0SH"Z0SIZ0SJZ0S| Z0SaZ0SHY0S000$ R(000 "0A W(40S  0$S $SS $S)400 0$4 0Y0D( mY0SL4 LQQ004Q00S $4Q $4 lЍCmW2W/,Q pQ Q DP P Q Q=0 L3003 0ZY0 ElЍX300P3 0JY0 0HS(0p`@ 0 &SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@0 8", P0  R>0 H0L0 H0L0 H0L0 H0L0 H0L0 hH0L0  PH0L0@ 8H0L0U lЍC!SH000050PpG0  d 9/ 000(0[0 c,U 8Z  @,,FC I R DC ,C XC e ` e X f i p w       V C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``S0 0pp07/@-M0@ 03/P 0 004000 4003/ލ@-`,MHP I@0 0 0PP@00 RS THP pW YP00P00P0,Ѝ @T@0/W/0  0IH P00P01&0@-$M@D0X W 0P 00 00,0P H0Dd$Ѝ0f G-%p(M{@PV gXa `Pb`D^P08 ,`SS0 Q "S `P  P !X$U06$U ` 0 [0 00 00 0% 0MPPmX(ЍD ! ! C C-40PS,M80S,ЍS S S !S S @P `p䐟`S`X 0 e000 00t 000 0 00 0 0M*`Pt!:x  Q * Bq Bq BQ B` B  0Y 0@ X@@p0 0,(0 @@@@@ p@@0`PUߍ 06'0 pD`∀B 00*8b0A-0<0@SH04 `pPMUV09EU?V090VP:0A!r0S/A-@P0\03/0 0    `0V R!  B B" @10C)Rp0!*P! 0 ` PPp !@` B"@00080000$0 01P0100ATXn qO-P@OM H(Ya1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,pP5Oߍş[@P TşT0@0C0p0NC2 VH0 0$ 0 R̴ V 80L0TX 3/P1d0 00H03/ 0T 0000 3/P#%#& 00t80x 3/0lPp X̍X 0 0|30t3700F00, C@! 01 SH0 V p .4tM` PP00P00X00 3/088q0X 0L03/l 0 , t T x X h H !0T`X 006/P `0d Q 10  0!s"D  V p0 B?D!2 B"?1ᴡ0C100C0 X `V`s`V T00 03/P0 0D 2#4`0Z5 P0a 0` 0d0  p D00CK?D!2 B"A?10C10 0?o2100C0= !V ,!!U !LN DH A-Pp`@f!\0P  p0Q p ?p VWB`P !@ B"> AWT0 01`0(`10q0000v g 0S/ LP0 05/0P0 8p<  @  L 0P4 P p $ Q:  BS:Aߍ L`0 (06/P(0d 8< ` @]0`4 V  V  R U  U  RC $A0  ( Q( P0 zQp ,( ( ,0P 0 pP` p0  aQ 0P@ZQp`P\ p `P@0` O-0@AMꘛ,@,W O-@`4M0P\03/0 X ĀX p ppP(V 0 Y2 2 Z "00 " 0  C" 1 " X "0  !" " 0 " 0 "  C" 0CCW 2" U0E0 0h20`2J00T 00DP<1,pp@12((4Ѝ嗓)08q P ,0[RP,0ZH D00z0v 0P P`%0,00弽0P8 @ 0S[00S[ ZP P00S`(0,(00V,00602 0i3/`g d,qXn hV ^ uG j !l 4J [ r$c,? @-@P0QP/XP0S0? O-pMCO TUtd4{ 00 rs= 8b0  * 0c P  0@0 B )R R3PQ0R r Q0CFS0TR000US00Ѝ@0  ||{3PT00U00X@0 \%D1R4 !8R0 !R, R-RH T00U0(O@ PK3P 0R 0R [X T00U00} [XxT00U 000/SS<!Xd,/d, [d,FT8 TЌ,,e, 8THh,? O-0MS@pأЍ`  W0 @00PS8 cSG MS  0 mS  sS. gSR  0DO 0S cS !MS @MSCS GS +0C?oW20S 000 00SSSR mS @ R O-OM M P#0 P0P<0@0@00P(0` 0H03/40080 00!6 0R 0  0(3/ 0Ps`` r S00 D&008&XqU\a`v0$0000s0,00$0%ap`0(`HpD0WX0h05R0lp0h > `pV Svh 5`U Tnh -PUhh 'VU 00 0$PTbp씟0P`040dPS800O>0=C0D0 0jN$x U 0S  T0P9p0 000D0P0 F0uPT0S dxOP 0S00Q00`Q0S 0L0 aA3/P 0Ȁ`0` 0&003/`Pdp0E0  7#`@0o?NX` X 0 [0R0 `<0@ 000< R@  0S8X( a`v0"$0$0,0-0,0$0&$0x D9 0M 0xd00  0M 00# 0MȐ 0 x0h00l010h Ht0pH+Dk?+ g?L L0` S*pV 0 TvoU 00 0\Tko0 4TeoT0P0'$0, Q030#Q0S $0( A(02`Fup 0 `&?00`P3/0A` ``Q/V*P[0H X 0A48`Td(bOލ Ѝ蘛,   @, z H'   @-@! 0$   0 P 0"ġ0S 0$ O-Mp @$ P(`|1/0@T 0P5P[0ZP0   0L @p0L@Tp UZ@p 0 L X00,8000P<00ͱT0,%000008@ C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$ad,$0pQ@-s㐻㈵ #"T R0//s@-(@T@ЍpH0P0 w003/@Pd\/@-tM`P @P0 p@@#P  30@Tp@tЍT0 @T|0t dl0l p o`P L @, ? l, Ќ, ! /@-r 2@/4!  ///@-0@Q s@o?0 \ 0P000@-P4M0 LT0@T H 0 !  @!4Ѝ0H@0l,//G-pP@`ㄐVT0S0S IP$1H0PUH0 X {H0 `p@ l,0SR00/p@-@PRG<0P4`" 6D0# A@$!p蘛,@,A-<`P@HPp(  9 Ap,@->勽@-p@-@M @dL0 hk0S Y `L0LP03V 44 0 ܍pc5,>! e! ! 1G-1`PM@1P1!!  xxaxavt@Pl7ToPkMP0 [Թߍ BgB?F YHpP0=SBF?q@ B?`R@P ^ BPt@t P 0 TI?D C?:9 G< ! ,$! ! ! 1A-1P@,dp1P1X X T`T`  P  @> 00c,:9! ! ! ! " @-0M02000`00Pp0d@P @T 1\ 1TO/11 'PO/11 Ѝ'" R; 0@- wP TG,C-`CM P@ `RKeP pܐ܀0 `0`#0SO/11 Cߍ5S  xxl lPX \\T0S  <41, 1,E" ,,m" ~" " " " M;Jp@-P@ 1 1  p謩,1p@-P`|@Px0 p@" p@-P@ȸP PN/1 1 p" Vp@-P@1⪲1(1 rP1 1 p # V@-㝸@b" C-@aM.pJT[BP`᠂rU U.v20P$0 gaPZ `"0(@80WPW @",PU , fE 0,P@]EPKC1PL0P P110PU)!,`pApP0S7 S1  @SJ 0` 0P@P`1\Ϸ0P~P aߍ@]0!fVPT0 ,\N?P0@8 Bz8 0 0 0F& 000 p @Mt&,,,'# e# # =9:,,,,5# # 7-7-@ K A-P$p-e@P a-@T " B~P( 0 P  0+= P F@ၹoЍW\\zw P< 0 Ϳ# 4,# $ $ $ I$ r$ $ h//O-c@T Ѝ@T@T( ^& L U[Z [Сԑ YZ PUPE P P$P@ P$@0"/Ἧ,O-4Mp(tfZ,@P @ P$ %R!0ͱV0 0C  0V @P 0C@TPT0@P0 0 00000 0 T0$000R0#02S4Ѝ; 0 0 0S  R# S   @ 0  00PV@00V @P 0C@TPT0@P RK RH RE (  , ZQ R Z5 TT  Z! 0 S0 0@PV00V @P 0DC@TPT0@P 0T00@PT Q Q0   .0@-4MP!! 0  P P"P@4Ѝ0@/@-@ @"$ p@-P@/fKP `@ HD0P P `Ra BQQ pQQ 0@S:p @-Hj0RH #@-40@-P@04MS !1PP Q*   P +U 0@S Q 0S4Ѝ0į,0p@-@ ^T00PUPU' \$ST Tp 2@Q.^U@P@ @$ $ 0 00C 0p0 $ ~p@-,@PG0P ;pA-@p```P匀0ST 0@P"Rp@P!, 00S@- /᠈,,C-麋X@(p,P0`$ 0АYĐY T  T: X0WaU|U VP P 0U Ѝ 3V0  &% +%   @-@P 0  F@C !0% p@-P@0S|T0p 0 Tsp0"S @0<00Rp( T4p0 ꠈ,,,G-lP0`Sp@;S S 2@1+1:X bp  QBp\T.@T&RQ0000(Q $Bp Q 0S T vJ3 0@1 00 0TRT0T"1į,{p@-P@q@op1O-0@Sp`P 0 PQQQS SK0UȰС0r 0 $^0 0"90(Q $Bp0, 1QX#  E vQ 020  R [ R pR H0H HE R# Ѝ 0W1Q:P ꠈ,h% !0% p@-P@P0St!U 0E p(0"PE0U055403 0(2#p蠈,,,40@-0@SZDP0@0ӕꠈ,!A-AP0`SH!U 0E p0耟@SV Ѝ 4 U(@0ⷴ`P `4p00 0@0EPp0P  H p7 `00 P0'p(0,0`ꠈ,,,f s% 1A-0PSp@` 0 PQQL SD0 ~E 2r 0 !Rv?000  (0V$0X3,0R 1RP0 0000 1Q\00R00S 0W1S` ꠈ,E@- @00S T ]㬲Ѝ2O-X0MSM2"D\0@S2"`0Sb2|"d0S2d"|h0Sl2H"hH 10S@娴80S 8( SRM80S , 70pHPASTPPDP @״@I`P- @ \00`0d .0xh X hd;S XH!H@0GP@_oRݍЍ 0:S 000a 1 0 0 0 0C0 x;0CS||qPp% !0% % % &  & :& 1&&C& 4U& d& & & & ! & & & & & p@-XP@0S9!R+)r00 S @ 0N Dpį,O--BM MpX\干@P 0`^ ;`( DpݳBލ ЍH0 (Pѳ  Q 0 0 d!`ppu0 $0!`4X00 (00Cv$0;S P 傺PW +RQ 0P \P SD0Rpʩ0S S 00S 00 0`S0S00000000 0 P 0S  10 0 R$ ?! 0$ S0S 0$ j edA' O-DMhPl`PDЍ@P >$6#Sp 0 >P` ;#S0=p0 d00\ `0h0x00X P$`P`t0 (04Hl000 00 00p;!:& @-`X0Sg0 A\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP S &0[ Ѝ% !0% % % & & O-0TM00 0$ 400 ,00(0 0800P! 0` @@{P$0SUppФ Q 0U U H0!<01PRPpU=PUp<0L @P PUDp p0S H0L HLPp00D S400@00P4p S 0  S PS p0Sn ;S S 21+1:$0S L$0,  QB\X<X4RQ2ȠP,$0)$0(Q $ >p(0 S ! 0S H (v.80ƀ1 0$ 0 0 0S0 0S 0$ TЍXRX0H"1į,{O-P0M@DTЍp`ȠȰ@D0S W0@  0 0 `P1/Y  S      Q R  0@0Q0 0`Pp1/P ̯,!A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A- @P`p1S 3/P @`VTd0@@T0P0S@000S4000S(0000A5!ȯ,̯,!!!p@-@4`4P0Sp@%10S 3/@̯,ȯ,0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp `^$ 4R R0 0`40$ Rp `083/< 0 2 P   ` 000 0S0\000  00//00/00/00/10/Q@-@@L 0A0003/P@(A @Y $C-B`0SPEM;0);0pS!{;0 S| s;0S l;0SH e;0S0^;0SkW;0S00$ R!000V F 3 x? &>0!C> f`,0 010@0`F{8,,' $O-PM0@߬0` P(" ج `b0  Y00 09p!0@0 09!0g0p@尬 o@Qttݮl:@d塬 0 L!jH嘬 @p0 $!`$厬!p 0W`쀟P0 R e+ Pa+Ѝ 0p!m0i `7 `M+OT 0-00@p NR S3#:@`0F@,,X +' Y,L' S' ,{e' QA-@0`\03/ pPW@@P@?P< 0쀟DW  \-W0 U  0  !   0 00$ 1     t   Ch  0SJCT T0T TT\=0B@@L rY,q  u j' !y' s@-P,`@01Ѝp8,p@-0(M0P,03/`Ԭ0@ S:0 00 0 0 0 #p` 0A0j(Ѝp0l  O--PM4,@*PЍ pP 0p @r @< = PZ0H03/0S@`G@`@0 0m`P p" 0 Q!d2A 2I0C 00000008"  0$0㷨啥ိ0S("0 L0P 3/P X0P@T`@\0`0 S8,PZ 80S ,1 0, S001{40P ∡0L0 3/00 P0uF 00% % d 00qp`弩@r0,n0kph` ㈤80|$4@`!0 `40 000 f0,0p媧0$10?0\$109`\0@ pd0900S< p0 PÁt ,l3 000000 000 0 080pzp` j3d,0Rῤl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV 0P2Q fЍ4P00SZ 3/@@OoBS l@0&0010@!Rx!@!x@|@pPpt@ߠt0S|0X*@JP PQ 0!@x 0T:x0S@ #塨t@OoB@|0xT:@d,' 2!' ,8, R F08Q  ȯ, uxh ,' >O-S[?UM< 00@48@`D 1P ,pP^ Uߍ!0P40 P,QO3, 080S 0R@ <0S6(1SL0L ,H!0L\." C 4<#H@; $+ۥإ 0@PYP @T "2B 40P 0S 3/P,00,02, 0SU@`PD`D@t w T2R壥 Y0N 噥 ,H!!LPH@0#`P`T@入P D` 2@ 2,2,00 0000a @ᦧ 2   , 囧 2, ⒧៧200P1:1!6M @0 000000 0000 00㲢p` D⎟D0U4 Q[T Y mki4gv `^ȯ,̯,F(( no3( C!' O-/0@JM M`0"PP+$P) 0S% 0l"`!`\r\/u:0P T  0CT *0C/Q 00P8@m+# P:8?0  @P+0: S `Vu8>00ꨰ  PJ>0@0/S> 0m+ # S P+ # P*GP 0/S`0oo`bS 1p10&000 SV+tU# P*+O# P*P8@8@]Jލ ЍE O( < ? @-r)*@-M @P(0  [@P P P gЍcP:00p R O-M` Y'PPp X`p㴠崰u,P$Ѝ0S @ 2P0  SpLP Xp0  @-( O( F( G-|M `P`P PP<+"H@P@ 0 @ 90&@PP+J"IJ.0ĬA+J":J.0T㵬T2X 㮬PP~D)4 ᥬPPu$>+J"0J.ᕬPPe.+J"  J?` ~PPN+Jk"tpll40 0J>P 0 ._P UT [ލP@Y+J<"JPPp0J.:@+(" /P h lJ>(PR U( ^( i( o( y( ( V( ( ( ( ( T ( ( ( |&O( +d( ( (  ( /00/00/00/00/0@-0@4M#|0$P 0/P\ P0T0670 P庢 y@P !4Ѝ0蘛,z@,P,O-AMAd2,00 (0B0P0, (00 000> 80s$0(0, `pX05 0/%500%`G0$0 0$0S000]d5\` @@`彜@0S 80< 03/P0p80<P Ѝpv'80s Ф 0Q:8`0S0L0` 3/P  &[Z T0 SW`vp 0 D 0$`0$00  0 0 0#3P00 0`0000 0刢$0Sr D⾧#D Ra @Z%R[eP*%0B?o 2 0; H 2/$0`SpHL I 2# V 0  0 .Y0 ; 0 P pX00 0  , (0  P   0S {(0, ;DQ0v1;0 H0$0L010,!<1H0$00, `E0P Q    R P50P0 Z{[ 8 40&0P40 Yp 0pY 8pB YP  P 0 0 ; ,(0\j Q r,00aꘛ,?(F) @,< 1&d,C ? C-pQ|MW0PSSp`0 00 P  "  ." 0@T0 S>T2x@&L"@(@@,0S:(Ҡ(0"P@P  00+0@080s=0 0( T W|Ѝ#㬠!@&(u00T1 0-X!00  C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1\!S<1@100> C @ @lPp( ,L"#0(@0 '8 0' 0 W &%, –0徖80000, 0 >0尖0嬖80000  0'8T0圖0H嘖LH0P (P0)W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000˓pp 85P,0ᣐXpW) 0GSC0.(>P C$ 00S H @3/Wv@DpH L0] YZX03/ 0! 05@0L0 3/P 00S 0SpW+ WP0pH03/ 0! P7/P%$%$)@0 Q1XYK @1003/Q  01/ 0S 2"!'$Є  0;P  0+ Hp0  @D@0 ᄀX80X> Pnm,0S V$pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P~ 000#d,,Fp408Q ȯ, uxh ? [* X! * 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-Yp@P` 0< # 80s#   002'  0 S R( 0S%   吁( R Q0 2'T 0 < {+800 s"000S   l 1 SR0r01/᠌,!0 /᠌,$1p@-S@ x1SP $003/p@蘖x1畖P$1 0SO-@0`PKMM0((0DpH0S >I @&0 0<0o- %#{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,⃑ppK܍Ѝ([ȑ(0S*< o #8 ;c&@@ u-O-`0@PMM,0d1d0p 0S (0 S> 9 HQ& 00 0 <0.%#@~40kP`0V,p0U 0000000 0 0000000 00*p`ލЍ,o,0S*< #, 00A"X R00C0C0000S0 0,0A$Pꠌ, u@-@-%0  !<$10(10,1P001.@-@%0 0! 0O-,MTTpPP`0 Rヾ,Ѝ "P9 @@5/ZP`K %` V`G2 % 0" ( 00 0噐`wb0,ЍO/@[;p@-@Q-(6D6\6666P 0 P40 Pl <0`p@PP80 P<,0 P00 p'p* )z* *+p@-PBMH`@Ғ  VP7t777788T8p8889(9P廒 0P岒 Bߍp`姒P00S0`園40Pl`喒80PS<80  0X0S,!U@ 傒 0Pz\0 `0S ? @`id0Ph0S /@l0S %@|p0SD @P`Et0P^9* :* ;=Op>?* * AOEBCE@-PAMH`@*  @V(9@:h:::0D`qK0 @0S    8`V@ 0 #P 0Aߍ(0S l @d,0S D 已@@00S ( 孲@ ^h' /* OE12* 30@-AMP@0Q*L;;X<|<<<<<<㽑   q0`N 0S (0S    ,`V DAߍ4噑   {q0`N 0S (0S  n  j,`VPy $0Pp 0 Pj0 Ppd0 P\^0 PHX0 PR 0 m h' $*    60S O-@MV M=Pn 00x R# R0`^嬵嬅adDp80  @Q D0 P8  3PD  H  `V8p00(0S%ı$B00,0S$ⷱ$B0000S$⪱$B0+ 0 p0B/Ppὠ C"U0S1 `F` r됣0p⇞ 0S    `,pYV o$ <Y4`Ύ ⍷0`0"  !ߍ@廎 0  0S  3 `pV 妎 0  1 PS0N  T唎 0  0S @0S@兎 ߍG<0040!00F@0Fo$ 0DL03/00 Gppqr0S !0,PD` 0S ;  7 p8` V0(a x Q0W 8 < RFO    0@ /-@" 0  e R0Wx 0  + + `*u, h' f + &$+ + w+ .' @-x @h +0 @0p0啕d- @k+ @-D @U 000(0,0000倕d @Vꐯ+ p@-XQ`0@sJM@!   0,1S:KKKLLXLdLJߍp0 00@ @@0P(@0 (b0 0(0000 0َ(BP(B4P,@,P0@00&u5OE670p@-QPM,0$0`s@|!   0(ˊ$1 SI0MTM`M|MMMN NN$N 1$ 嗇PЍp 0 ,⎇,0S$0YP@0 00 000000 0o0_BP0[B!^@HP@@P@8P @00&u, OEO-P`0I1P/S X(⫉0(0 00_e0SvU (p m0S `Pp (00!15:% p P q Q 0, ($!p p $ P^ 00 8a4Q101T/ᴭ,,,O( FF=- ? ( , - 0S@0@-S@00 0S/,l0O-P̲EM 02@T PP0 2P |1S$ $P| 003/P `2P X o@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 ~pPP2@0S- $P* 0 x0D 0Sꌩ,l\,Z. ,,A ,T8,g. A-$A0MT@ QP` 0p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T  @TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 ꌩ,\,,8,,,\0p@-T00P SDPPp0AS@  1SAD,d,,0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^@ ^T 0S"Я,l0\ Q0/\P ^U Q0000@-Я,0O-`GMM40X2@TL2V 00 0 0000000@@@@ 0h➀p@c<   G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  KB,0h 0 x0@W 47 `4}Ⴠ4 VL0 <0G, ,,L,u ,0@-PDM@S P08 @\ 0@  Dd  0 0DЍ00Sꠌ,0@-@DMP. P0, P\ 0P  0T   R X  z0S0000000 0DЍ000Sꠌ,p@-@Q`P@M<5@P   T0 0SP@Ѝp@t0 @00 D0@U@Ѝp蠌,17@-@SWyzzz{{0{ Ѝ0!b|P4PP<<0P0<0P0<0P0<04PP<0 S, 0<0P<0 S@  0",|080#&|0,0$ |00000PXi`@-@PD -x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍp芍Pv@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P 0 $<  <Uú l0$壼P 0|! w|Ѝ0d,a@-80@SP`4Mc00 0 P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0:  ~. W 0p@-PQ0M0@$ 0x`0 6/8 `Px17x1a1S0C€10Ѝp. p@-@P 0P  Pp0S@}p P Pp0S 4! B! P  ؉Pp0S hpP R 0L ĉ 4忉Pppl. . T. . . O-uM Mp, Z-H0cS_ Cx0SSozB0S PBԒ0SrzIJB0Sbz2 P     P x2@    PP2 HD     P0x0001 @@K @P @ PHPP< ,h@ ,D@/1K 01R010|100P P 0u}p@  P$Kz} 0S10$1S 10 0Suݍ ЍPaHPk߀Pj1S |!R P  &,,8,,,,\,,,,,,Ŀ,<,0D0d,,@-@ឪ00S @P很긭,. @-@PЍp$QU0 Y`P PP> C  01/P ,00 H$L Q>d,80S @-0 /!m / G-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  T P $QM7$00S U 0 |1 08Ѝp_P ֭P P Q ᅭ  P ­  ቭP ꠌ,A-M|P8 ]U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `p0XEH2 08 8/PD? 0!! `b7#`00  3/P"#"#00 03/p p0` L03/᱾ o⏭` 0SWp`?`B414!440<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv XB 0 |1 0?l!! / ,G-`RM@Xr PP X4P`H `RP P7   喛p 0S ߍ<08 H(00,0 000040!04 04$0D0(0P wWZ  npT hhp* \XPm` 8 8 4#S (US QS MS IS 0,0CS0 ?S  p 0`?`a8SXPb 0  0**0P0圴  0* ]d@edA^zd@^+^~^<^N^b^u^^A-PMPp`;@ p@P  P06PሙU 0 2 "0 ݍ /O-yPXvx0L @8⼗8 P 0  FЍsM!S/ @-Gv0SЍ@-@M uT0  CR$00S ЍwA-pP@0ST 0S` @sP2 !2 @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0pČ,p,08S^-/p,h, p@-@ 0(  P0R0PS 00SYj oppC-@`PNMM< Ѐu0 ` P `P000 ;ؤ@PD ćp^NލЍY 8/ ydG-xM` @pᜐ堠ZP! |!0@P 0S PU 0 R<D1D!DD_00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZL   YZ( ( |X2 ! 2 . * Z O-`p@BMMP/0 ;@ 80P0p X@;$  i P) 居z BލЍaiP (0  h   h0/SX k0H, k!14"So[ 1 SR 1S  RS1S1Sr`2pB@?↯0Q 0 STS "0SO[@(jpPI P 04 8 < QR@ Q  A R !Q Q Q "r " 0ϥ00 " "ko@ KU01U01VMKURXA- 0MHd t1t!tt$Pi@PP0ЍT00ؤ 0R`0 !?020 2002p104 pj" 0PS" $0Q00 L03/P Q P0Q    R D0QR003/1 !2 >p,P/A-uo\vwR2UR@C0B0Eҁ@0$H#8@ 0A- @P^U PP0 8^ @T 'hP ` ` `b` ` p Sp` 2 q!aPaa Gj00`U08RP08}/ ^Q 0Sp`82S011111111108 r2aq40S0Sp  P P2S222J040UP 2SX<2 O-bM M 00 QP $00/;@0P0`bލ Ѝ$ &p y?`x00@ ,(?Z 2S 1S,2,",,0@0 Ḁἰ        0S@!? U㪋p ኤ< (fP^bV}T&PRQ 0 0 p  W p!p'q ?p? @p  W p!p'q??p0g@P%  09eJ  pf?WU E ,( ptf6i?W U `d@ !2 Us@-RU0 A@`d0T `Š"; P0H0`04 oЍp%3 ! 2 93 @-@ ^ @ T@@@ Pp` TPPVPU Sx   D L"4 0"8 0.4 0@.800 0",<< . 0p,,O-P@dM0p4005Q 0 }Q Xg QP08B^  RW* 40'D0Q   R0RS 0}υ^ @^TX 0SQQY WpdЍb004@F@  0D@TT0@ 0@4P SD 0`P P\ X 0`VBT`@00T04R21 SR8080<0 0Q<0$02ơ 028 02S01  (, ,(0 PH W2r`!R   R 2S SX 2Ƒ1 0 Y  ZW1Kt "QR 0S1!02#38P0WZ eV,0$ S 802o(0 0<pPD @0 Ă2Z02HY PY g ႡL0S 1P0S`10T08<  01Z o 0  RP   0SH0\ \2 P Hp,@3 3  !T2 < !lO-@|MHX0(S S|ЍS S7 x( [d8d(ddSD S0@ }(00$0,,QT@0S4000(S$0000Q 00S 0[SX770QP"4!( $ (00) 0P00U00( 000$00 00 U00040 080408 0,000, S 0 08B4X6~u? v?( $R BT@2r/00q?`0sh00`0 ( R   T R,0S0u0<0\epP<0=X50B\0o_P0"H``V PV xfY0( 8 @0o/O @0S U SQ0-  T 000 0/ !o/ S㴲< $ 0 ' ,0S00@P0PT000S@ P0❂ P0;c 0@SP0 0HL R   ?  ?/Z[d0P `@10d ἐ 09/0P@\ЍOEd,G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/d,>0@-@0M 410810!|a0 P0u0L a0 I0PU ! 5/္Ѝ0d,i @- xH~@ H}@-@x 0  F4 P*&@-<@0sz}(00ppa0Co&--$M ?0 0 }$Ѝ0-4M 00 000P4ЍO--pKMDU5~ " ,~x4 0`p0 `V0 R`V"R0*`ğ p$ T0S 0s 0SKߍ0S P (b30SP #)VP#S 07Ꮽ{ A0 ( A{{:?dSd( 0(#e73P 3R - BP   BRڛ 2図"B "( e"2P 0Ÿ R#3SPjS0l 10h"0(0e0P P 0 0SZP=9 =:qk{1 AP09 A { Q 5 P;!%#3\Q0  d 0 (0 eP!廀$1@P0& d( SP P* 0"%+0!V5 Ꮐ@0S(0d 冀@0 0(pp{Y@.A----x-$p-<-QF@!!<<<==--@~X<=f' 0P 0 A  A k{I{7{z\0Wᓸ0P  @`ᰛ@<ᅸ(0P<pছf0 +@  %@-@s@SRG-@  700pP ąP:<`X:00X 0PlD @-P@`pP0S -S :S S  000`  0 0P0 ЍU0S T  aP1&p@-@P{p  `{@{U700@pp@-P 4`zp@  zP{@p@-M@ :|p$ ЍG-`p@T2 P  P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝ? p@-P R`@0 @ {0 00S o UP3PE Ѝpp@-P@ @{pPppA-@Pp p` j 0W0 |0WxX Uh0X`0 P  0h0H ~ЍU0 P 0 XF:,6 46 <6 E @-`0tM0F?oP2p @Npb{ 5{pzX{@kzp h2S{p L0V#4 - tЍi{h"Lzpp@-@0  y0 S " 0PUPUp@_0S   0 0S __0S   0 0S __A-p@PMU `0S@PE7  ]0P6004ۍX,700S @ Q@BPE@C0 00 pL 0S 0#S @UX D"!Y6 k6 }6 @-M@ H Oyp8lۍP  U"!p@-\1@0S`M @@>  <P  0 !   xp0 S 09S 0Ѝp0 S   000 00P0 PS @ d0  pDL  Ѝp@ p6 i"!}"!6 6 p@-@$`P\Pp0 @ `P0 002 0pp@-SP@`xM  _j0 0xp@) xp'  xp! xp  xp  P  L0  p,4#xЍp x"!6 6 0 0 s@->@P`Mp @ p0 p`` P0:p @ 40 pЍp"!6 p@-@PqP  Px01pP`qpJ =x0#1pp@-pM0 p @N "xp!x@pЍG-QMڡ700ۍ 5  Y  @`V w@pP`@-`R00 Ѝ@PTp \@P  Q*@ 0S0S0 S   0 0S0 S*\P ` ]]0ST  C 00000`0 @@P0   @-@+@ "!L1p@-S@T1S#d1S.RU9lRUppbV:l]lbp1C]L10CL1L1PSʆ]0P11C]T10CT1T1XSx]0X11Cr]d10Cd1d1hSj]0h12,P0C2bV\]bp2,P0Cp27@-@0 PP" H10 D1 <80@8@- CB Ѝ0@0 Ѝ0Q@-@    bvP p 00` Ѝ@ Q @ 00b pЍ@l Ѝ6 "!6 Q@-@  i  vP p ]00Q Ѝ@ 1SP70|\yZP| 01@ 40& pЍ@0 Ѝ6 "!|6 @-t0M0@Q0$*p Ѝ  "!6 081/@-@d'P0S  P 0800L0S S@ r'6 6 P@-p!@RM Qt0 p ЍAp1S6 0@-800@@@ P@-@p t10cSt14 Ѝ@- @d 0 Ѝ6 Q7@-@  ,, _ Bvp  P,v Ѝ0@ P 11P,|1@ R  |&AQP |`00CS`0 X<|@ T0Wp 0< Ѝ0@a X0 X Ѝ06 "!)&)&6 p@-PDup44p@2 @vp* p@u T7 p@-P@ ` 08 l, H>U\& 0m 0 008 , 81pp@ %7 7 p@-`<1P:<1x1S0p0@Tp 0S    0@-@T 0S @G-`P-H0$:0@0   10 &000 0sH0 D"4S4$ 0>0S0&0 XPp0P W  gd080jP0403?@- @T08 00  CHP $  :8HP%p@-8Q ,PAtp0 ,tt0,1 Ѝ@Z7 "!<7 @7 !p#!p@-@l <=  x1P`PUp@P 0SR%P%p@ ފ7 @-t0@SPLM 0$Q0@(p 00 p0 `P s LЍU @ x \| 2`H1 0D1xP"`#!q7 7 O-@PP 0p4` R ' 0 08   ~0 0 XU @N 8s< 0S 08   Ѝ7 7 7@-@P@0H!D Ѝ0A-鸀@x0P P ЍA E 0 ` 1 0  0x1PU 0" 0SHP ЍAET 0S 800 P P Ѝ7 7 7 A- M@` P,L`p$ PO 0S PuPU{ 0 P8`Vx,P  Ef ЍA:$ 4$;080SV $0| pO0SK D ЍA 0S $  + e p A ЍA! U0 0S V ] P0S t`QP  +,t R |P 0S ;P; 0S 08# ЍA Ѝ8 58 G8 6 7 #!X8 y8 P 0@-@x P $ LV@ L0p@-S@P` 08PU $00P   81 08006? $0080S  p, A p p@#!@-@@O--pP`G M8@T1 Ѝ P 0S,W' 08،`#0   S0800  0?X 0U0X0S @ GX   -8 C-MH@  ЍPPf q`0 P  , qpP1 P P2 P7 PP@ P8!88W@p$r! LQ0S000 0N00 4 .p x'D!\10B0H1x>l l<xG APʌ#!6 9 8 8 8 9 8 8 -8 8 8 X 8 8 8 @-@ ! ,vqp  P<1  ,;,zq0,1ЍP0@D<1 P$66 #!?9 Y9 9 Q/@-@  0S@C-q`@ xh @P00@ 0S  z0 Sx   0 @ Ѝ 0 pPt> @P 0@0PEW  x+ PP 0S  I$0$0> R>  **X 7 0S /@0 S   000x1  @  0SP P 090 S   09 9 #!9 9 0C-MM000@"0qp,002P؁+ pP`>pQ v07S 0 S W h0 0\!`1  `Px1 (ލЍ PpP  R쀟쐟PU qVxx x 0 S   x0 ppP 0 Px1p  P  0S 0r0 P#!9 9 /: )(Q@-@  ll(+p07S@Y0 S 0VS0S@6 $!A-`R@p@M PP U70l0h @ЍAp"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *]P 0S( <0 *?  <05 | 0S 0d  r 0S>0 P 0SV>P  *@ЍA$!$!H t: : D: O-p@`,$MP&P   P 00A $ЍO|Py  P000 pp XSP  x   10pG 0pG0 ZppIKU3#pp pp Zp#3s 8118100x1Z* nPx1C 81181kP NP  6Pp4PpUPpP xP nP p 0S 00 P  YY p 000 0SZ81181$Ѝ eP  YY ep 00`` ;00T0 :0G [W 000x1 Z R& ` @+P `[` @H0` 0 00  WB W W 0S 0`0 7 0S [ xx{0P 0S [{0 xr: : : : : : \#&T%!: p@-@>Pp0?R02P?00"S,003?00> *> 0Cp耼p@-p1PSM"`!  %@P T 0p1!V T 0S X\zQP Ds@tAtЍpp>0S \0x1@T l1S R  @>0S@ E`l1S   0 @ =P 0  @  B.(0$p ,)l1S B B $$!B B C C 0 R/ 1/-/A-@P 1 !  SXpR0 qP 0`0S000S \ \QP0 S   00S000@00P10 paU0EC $!GSC C 0P@-p0p pphq 00P R0 U  EC $!SC p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@P n p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@:P@P0S 0S0 @@EC $!SC C ʚ;C @-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p, 0B0 0p"#l ЍMb@Bp@-P(0 XPUPUR PU PTP,PP@PP4PP4\pQ@ EC $!SC P)@-0 .0PT0/EC $!SC P@-0 0T0/EC $!SC //P@-$0$ $$ #08D0EC $!SC @-,MP`  1U0@0$00 0p@000 0<0S kp,Ѝ8010C>S/00@( ( 03(00@000 0<0S80 p @<EC %!YSC @-XWP@P lpQ@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0XQPU `0 P  S   p0 6k00C0H?Q0HPLPU0 P(P0P0V00 S   0'Q0 S ,  0Q0 S 4  0Q@-@@ QC-@PM pbĂT0SY 00C01@0S D3/2"(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0SH- L0 S* mP% HLH R 0|S0       @@U 0 HM0SPp0S} `Ѝ\r P RUk Yh T0e0S 0S   PE  \P 03/-EC %!SC @-8 0(@ 2p@ t@ЍP*&A-`M4PspM k0 np@ i@ۍЍ4F P ڣ# "P  RP@@#C 0 ,$@4   IR&P*&-@-   Ѝ Ѝ/@-MMP`@fp0  _nR 0XpۍЍH -@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/& 0p/Q&p@-MM p =ip P@;00 dSV 00@ۍЍp P0 4Od&$0/&@-$@@Q4 @~Q&p@-dP@Ii; P嚣4 P P   iQT V00pp&P*&^Q@-@PP:?@ O@-q@ h01p h01@!Gjp@-PM@`   0 T5jp 1@ R! 0 p`Ѝpii$0 /L0s P/0 #:60#//A->PXMU,V0P0XЍU#700p@ `R0 PU B0>000 <0  ,> >!PP> *C @-@T>@Q/@-@T?@0P/ R R /0G-`P M0(0S @ P P P:`P 0!00 0   08S0 00 Ѝ080 00S # `pP `P0P 0iS.S  `P04S 040:S1&0@-@PDM QP@T Y00p@DЍ0U  [P @0S@-`Pp@MTЍ 0S P 0S Q 0  p=@P @-000Q/Px1P/$0/@-@M    P0 hpЍ~iO-YM `F/@H9X0 KpP pYߍ0pQM 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 ]PAT1S@\1S`1 OP5\1 S S R@L1SP1 >P&L1PC_oSRPU@+ P0HS 0s0nP 0*81 T48#88 S R p S 0 S T X @@?@0?H0[p 0P0H0}>H0 @/000L0PPP(%!C D iqD KD A-p X`0P M0 @R  RT T 1 # x0@ @ QPUx!@Te00 Ѝ S @g@-@4p !p !p`3fȀ %0R% -@ r % A  !@   + "*  ) Q%£ £    + "*  ) Q%£ £ /A-`Pa@P─@Ѝ !P\jKhKP0 q*P ?pP b4%!A-PRp@ M 0S0T00 Ѝ/P yP&`0 00 0  0S TT 7PUP/00T 7}D D O-P@0"S0Z"SJP Y ppP wi70p0 ЍT WuYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8aaaa aaaaaaaT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: J U*`XJ:0\S 0}   0P0N[ SP0Sl  IPTPp@]p1&P /0 S S /S/P0/S 0 S S/0/O-PՃ@P ЍO^=`P hha ЍOI U qWIᴃ@P  |P 1 A Ѝ=0@S- 8P'[ ᓃ`PI ``HP 0 0   0 0;%!D p@-@P I` 0SP}I$` PP(0S $uI0(0$0p,e P,e PO-4M10C`p@XPSL|`|x|Xqpqqrrrhs|sssstth,thtuhhh,{{|hhiihhiTjjjjTkhklhm0mmPnnXphp(qh}P}~~~h|(@L||}`hn@@P|d||~\l܇m0h|@}LnnpHU- `Pp $uP@ tP7 7  '$ !P`0@T\0S @U0 @5 0H050U+ H0?0P H0 @PA t01p4Ѝ,FP 0 pp 0S (PpH01#@%U  ChUH070 0 JpP! .R 0R77@0U ` 0/pPD H RU H0@1S @H000{U P0H0q ,0 00 0 L,0S ` {U ,0!00 0 ,0 S4 K Ux <1E80w40b儒000 0 PPP00 0 P  p@0  @P | UJ <180w40b儒0p00 0 PP00 0 P  0@H0:0H >P 0<0UH& 0S# /EPp؀  &P00<0/3`P 00 /0P0 000H060U ,0 00 0 ]K,0HS  >h 0A  a/p`  P 4p@AK0  U ( U ,P 0S U 0 p H0 50d h050,0 % 00 0 ,00,pYL 4$ U&PPeU]700 5$)0 5(@pp 0 *  0 p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 J,0HS ;U H0P SPH0;00H090U ` dk`,/pP D`P 0$'d CaYFH0Q7;0UlQ P0l1 P0l1 P0l1 P pTE0P p1tH000~U10H 2xP0H 2p P 0H 2h P PH Z H000TH020OU  0pPl_ H0 S;70<H0207H0602H0;0-H080(UV <1#8b0w4儒00 0 P000 0 P0P0P@U2 <18∂04gr000 0 P00 0 PP00 0 Pp@0  @U =4P fp PWH0p000 SP0<00 P WH p P  PWHp   P  P  xP  dP=WH  BlP R  ($p 00v ,p 00cpPj $ ( H,8  P> B9 \[PWH B( $tp? 4pP; ((X (U H$8Q  P  BD &G%! D D E %E DE `E sE E E E JE  F I 'F J 5F 9F =F BF JF aF jF F F F F F F F F F F F F G G ;G WG G G G G G H H -H M-FH Q ^H gH }H H nQ yQ Q H @H H I Q CQ JQ PQ XQ _Q gQ AQ Q %Q Q P``X@ D3&7 D0 + 0+0 0P70P7} G000 0:00 30000% _p /Y +8 0 D 0p0 D+ 0 P#Z 1H0E,=P0047(8P,:؍<Ѝ80Ԕ$080,CP(/p,078247024<7囗 SJp,8>@D7囗 SD@>0H'87l"L'<7@7D7p"H7L7808 p,20!C ((P ((pW 400000(0 00Q@(0S 0 S S0P\S @pp8000SS ,38 P,,00  CP 0y?o20804P0P$0pB((P v((0S0' &  PN(PI Z$d hPP78=0u0@(0S 0 S S0P\S 00@ :0P  ᄂpPpP80,C9P(0)S YL ;00(hQdq xPpdq P DP0S (P  P 0S (P pPP| 0)R00S P W400000(0 0  00S D:$ D000X4,!-!-@ C,!C.!I H ] E J 0Q//Q *///G-p0@0P `'P Y 0 0 `R:S@C@3@D"X HGU( HGA-TpW0 T`@V0 L0LS @sP X X| |00 S HH0P 0RS L P,!L L p@-P @PpB=@-000N -!N O p@-@PQp2W-!(O C-`TM@ P `fp) 0 f ````f1pWp0`V& f @ 0 nR@ fT  @TЍ00C>S00`"P!@03@000C>Sp00p"P!@03@0$!`$!|$!$!-3@- P jp@Ѝ0@ Ѝ/@pA-@RP0p`@0S p0O A-0Pp`@S:0SS 0  RS* R0 `V1S* DP a 0@DpR: Q yO -!6O JO O-ATP` M zynA@PAD@T081 Z  wp 00PȀ P P P P P P pPpZ l Dp \61@ R H:p 081#?Q0800 00 & &(p L0S% S% p H p P p $  p d pw P0S t0$0Q0p P pe x0SA08!K0x1[:`Vp M  P> {p@ h9PH 00 \d\$k呿P|$| p* Qd p-"p]@x p 0S (P Q [ T  Vp  #VpPO PJ PE P@ P P9 X00S 2"Q`` Mp  Gp %P %P0 x1`$@ 2p X00S!XppW" a a!4p%P `V%R  p0S0S"0h 1SPq2YDp@0Lj   npb 0!`pZp  < \pP 08!pGpPA 1 RZ  P4 ЍZ p pk-!O O 6 P6 58 O 9 7 O -!O O P >v8 0O P P "P -P 6P ,!KP O O O @P $h' \P eP P pP P ( Z p@-P@pp p@\RRA-P`@@pL0s  S  U@ p@@@dW0S R H R U p6 O PQ p@-P0U@Sd` 00p P@/@T:勸p/P )&@-P`1pSMAT  p@lkЍ TsPЍ@!R 0$ 0 0 p@ I@aV 0 !p@8`P ?p50S lt'00#40  LL&D SP 6 0 (-!P P .!H P ".!P P p@-PP 0S @0`0S @@p00p SU   \@ .S0.S0_S-S.00  @R"0T0 0D0p1& @- @0P PT00Q  DP `00CS`0p S00 P0S X0X /XFT)&p@-h1@SP4nPPE @p ǰ0.SSPP XwP HrP 4`P 0  .ᙵPP2c*0Q p@-@P'Uc 0 R0 tR0 dR0  TR0H/@,8)0& (#@        mR0  hR0  cR0 ^R0 YR Np@t IP;Q G }BQ IQ OQ WQ ^Q fQ mQ xQ @Q $Q Q Q Q Q Q Q L-Q )& 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pP\p000 QQލЍA. !. d0h Qp`0SPE@Ep 0S:0@0D: @ Q Q O--,Md`pP. l}`  .@P2 0S  XP@ RfP@,P$ X^P$0X22900,Ѝ P,P, R ;P,PE0S h R* 020 6$ R, R P 6$ R R ,Ph!@P !!! bQ Q P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  Pa70 ^.0 I@0 0IU:D XO0 0 `TT  DSPO-`@P0p 00900W*0S T [&700 Ѝ!0 *00@KP  00T [ 00 P     @ \Jo"p  & Z/Z#T [\*00 0000K@P\ZT [T [ KP|1&#.!G-QMMP<p`8p; @#=pE dPp V=p <4 $PpTG    0 Ep P; EcP E/    QލЍ   x20UV00\2 0@E p , @pP0P@T*p0S4 zp`@ᴑ崡T*T 0  >Pp @ ap    /r (Pps @ /r   2/Ppa @@ 2/ J   .0E/PI \E/OpC 0S @00S@%<Op300/$[   wlf OEA- PpU@M ЍR` R 00P0S 0 -0 0t0#0Q0 NV 0 00 0NP0S 0 R Q O-4MX@p 0S\`d` (0S:0 `p20"4ЍOS 0  ,   pp0,0 ,0SPC<= ,4xp 0!004,/4ЍP V0 000!0  + 0,pcp000H!\ `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  0<,P4.! R *R 0O 2R ^R R p@-P@`P 0S P$`(0Sp,e P,e P  0=J0@-MMP+ p P0@ۍЍ0;0 C@P ,P @- PΠ R`00\L  ^@-QI00P`PV0 V=`V xЍp@@T   20x@ `DPЍp`Vx1@P 0>0S *P PU@P PP`/0P@-000 00坽Q$0  @R 7!R R @-` ,M00<0@SP  '0x Bfp ၾ0pt0 0 01 0 0S0S|0@0|0 0  X00Qx0 xPT ,Ѝ0 8 0@0S 0xPT A-`@VPPFP|P2Xpx`E-P x倂|"x20 dV0  |20|2@-`@MpP!  ( (⛪X( 8pIPU@ T4700@Ѝ ,i///0@-$!M@ 0  E+PPЍ0 3"Qp 000)00Hp0000@ 0Hplp 00 " 0tHp< p S 7!R R S p@-QUp@p >GK-0x1p@F-p@->`FMV 0P0Fߍp@PF/ e9  0t01 0 `塽0 HF?qHP 0> *0 F?cH ii@-@MP4@ $⍹P P@Ѝ7!Q@-<0< <<0SSP`///S 8!R $0 /Lp/@-Q @ p000t0@0Q00@-P@,M(    Ꭹ P Hp 0 00S p,Ѝ08i(p@-@MP ˼ ` Ƽ e  (PGPЍp:iC-PQSM M3#坻T0S2"`V2"@p@"ᙼ0B01801T0t0 H00C@L0@T0H @0H0L00L0 P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0 L00$L0T@L120@ 2ᎼT@@D@@0@L0 X9   @L0  sXH@L0   @L0  XP [UPPEPP@ D$r Ep`Sލ Ѝ D @XH@M 8!R M 'N  C-`p"0M` 0$`  0-pP @T+Ѝ`*PPA   0-p0 S +@ ``T*x0V*00p+T00V:0 (P|P@ (һ 2Y 0@P 8!@-`@DM pP@  p  !> U 134  R2$ $@0 2DЍUi@i@-|@QM  G00 p |2 0"x2FЍp@-]MP#Dp PP -R m000S0S S SS wR0S HjpOVPS CQRS@ 0`  x@P -$0 Bp 0S$ Hݺ H|hH Ep 5 $ L #80St S S00,0S  R000@0S  R00@ H @ 0嬺 HK!>50H \0Ep[0S 01S dd0Sc0 0 000 0 0`gTRY>S SM  ]ލpRIx@P= @= 3P0 0- H)}EP[%0S" H◺M P N000Sii@*8!/S @-40 000 0y+Ѝ48!2S/2S00/@-@@aV002@-S0@0 @@SV0002S N/<8!G-PM`p (PP(@P0 0TT`0Cp<00 3H CpP0S p Dp PU0S  p {C)@! (V( Dp | PDp 7/PP Dp 'P Ѝ@_S hS qB@sS lBpBfB@O-@p`0M00P U C0S9P 0 0 P  R P崡 R V 1!N P    ᗹP0 PPP0PU:000y Ѝ@-  UD ЍgBp@-0M2S`P@x (iVP@0 \(-DR00ލp@ D8!B-$M^ * ! ^B$Ѝ@-@B (@(@-@pp Cp`~B p@-A^ T00p``0@D^"000œ\p@Tp0,p/0/R0@-0 \  0s# R0p0QRO-M@@00`1Q V00ЍP0p Q :8Q@SH ᓸ딂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 'P 0 B0 W 0 S2XH00cSc@-@ 000P 0S00 Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S:Ѝ@-@\0S 6\0\0@-@`q0)`hA0`0@-@08$@0p@-800@P >0S0&0T0T0x1 RpR 0S TT0Q  0800 >0S  p@S p@-`PK@%Pp00,000S00 /0KpcScO-@GM`ḐȰp0 Gߍ0RS*R? w 000K C%PP d R FQV (P Q Ph  0 " > BQ *M 2& t QqR  o TgK$x0$ C\  D^V Vd^ h  \ (/$  H\@ǟ`$\ D\V R < R @HT6    < @ V6 HR 8   h'R @ (!R p H R=  (  ׶(100@R^A F"P%*pp Fr 7rpVa %Rp  HR+  %A C⩶ %V @= W_V G %R3V0p p 0 RN  HRl3   0 HRa7   @ ," R20' , 4 QmJp    HR>2   W @(!RoVp 000DKP*0W(!R_0(, "r  P V: ART  , ,R\ Q:(,q P V:@QT  ,    D B W   HR9  0 Cp@D $R Y  HRM  $A ֵ $ @(!RWEVwW08 2Sk ?( 2S PHt [:Q0 0 2 0000 00 @V5 VpWJ h 6SF 0HSr^00 &A ⌵ 60@6W08 2S'V0081 0 Z00 HRO P0@W00  ^00HS>t000@0D0D0 HS3<0 0 " M 2V0@ WV}[Q0000 00@0 0P0"9 ʯ0HQ 0   # @~0, $S S cSc25S T 7@-P\ R&@P\0S x0x08  Ѝ0PP @ 40p &,T 9!H 56 @-PR1!z`0@ 0p\ 0C R1 0R00  06 30 0 0P0 0:0 00P00;0 00P0060 00cP00 ЍP 0000000 00Hp0 00<p0 009T 9!GT C-P@UM"P, 0P`00P 01iH00P0 0븀x0`  (#0(10: cV ``!P (8"@  ' 0taO!P( ``(1 (1  0(t!p0 +"70 (P 0 >``v`&!P( `"(1* (> >Qߍ 0*  6 #9!tT T 0@-p0i0 MSP`$M 1!pp =p@0S i p ۍ$Ѝi@ p0 Pp 81Q50 00QpP P( ⋳T )&$H T -9!T @- 0080PP `V@Ѝp0S  @P  k00O-IM PppPHLL `PR { @P0>IߍO"0,0"600 0400` 0 p00,0 PS2 V30a2@0 0 ,0T<`0 P <o\@PIߍO@<0 Px }VT` 0X`0T<0 4`j<PT 89!&@T T d U O-@pP`QP,b尠,`2S$P㘀U`,@ ,,AkP%A, Q 0S ,9 A VP,`0D9!U U RO-00!`p@PT:p T  X ⢱00U *x"0 p Ѝ0R0  h @<0 Ap ;  {ApM S @-RM MJ00@P0BP Pp` 900 pۍ Ѝ` p rp @; ?Ap 0FSa$@- 81SsQ S0 00 0@PЍ 0SDPD3pO-04MS@ h@@ `_0P o0 00 00P # 00 y0 0P#  R @ ^00T0 @P0g 00 0`P^ 0 $ ( XXVpP 0$,0(,8 5P@ R  !Q*"0 0pP 0[ $0*(00 0, $0(,8 P@0 Rh0` 0h0  0304Ѝ $ E 0 0 b f(!p,  t  00 !0spPt @ p[o0p$00S,0 IP@,0$S  S S0t020P !R "R h!p( $( ,8  P@(U F,U O-P0M040@p0` `2''pp'ppW9 pW6l0S~,0Sp,0儂0噇 2Sp,0800噇 847Sp,0l0噇 p"R000, 20wS4~47S .: 0T &pߍ00 `2(Ip (  0 p 00 `2,7p( : 0 p (9 0 p,9 0` p'0}0,804l0 40po'0n@0!04,0 40p`np`kpghpn,0 !P ,; 0,00lS  R0 `"CpP 004100,0H0 p 0 pY00, }R0SP 0I p p  00V,0 !P !0 `" P 00 0H0p0  09,pPU aU U sU U U @U @p@-PUp@0L0pp@- P# M;p 0` 0 ` 0@:p8@ Ѝp ` 0 :p )X` 0:p  '00; U1009p@-p@`PQ81.(080000&0S  0R  Fdp`H1 Ѝ@$@ ,0p Ѝ@! Ѝ\9!886 O-`@p 0帀SP$H` 000 0 0 `00`0! Р+0 `  $8 00003H081v Hd ЍOW<0 $8 000x3@0Sl3H000s$8040q8 DS ,00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!D8 00^*S:kG{{'{*zd}8 S zkg{{'{* z0o$!8 00QH0S0ST h Q 0R<0S 0S11H000s8040 P14 }P18 wPp10 q#\0@ 0R0i ,0.0 0p &0h` E P0 20S00H Z P 0dh0 ЍO Ѝ??U U O U V V %V @V V `V V H] V ('W ?W UW Z7 W W A-@PT` R0A h0`  | R 0i0=P 0S <0S $`7   .p0  p0 pp,0 00 0ppH0  00 0$0 F#5 FAd0h0hW O-0R\M@`pP 0$4P X0 #3P 0 RT0(00 p` hPP. cL0S0 0@S@0#/L0}?H00P X0 "2P 0 Rzgjzzz{T0d0S  $n P $[ <X x& L" D"p  $P(P Q6,  0  <  @ , D  0H  <48`LPPPTPE6p[ pT  ;PPK  0v` 0p10 p E008@0`0v P10 0\ 0~`?v 볭04S"1S0810  \ЍO#p   0S @\Ѝ7S zDW h9!W W CDCW W X W  P@-`@pP`0 h0X $7S R @`00  `, 5 0( Ѝ@4   X W Z R*P 0S 07S Ǜ ǛY  S2  !  Q 0 S:500 0p00 0 ( ЍO Y 0 0Cs0Qo0S0 S0L0  p    0P 0 0 X0SY0A060@ 600 0Jp0 0  `P  R0 S 081ni@x6P uP0S0 0<S<0P0Ѝ 0    0~P 06SY700S00YV0S9 0Ul00 0P0 RS0KSK?3050X%60 Y ,im0 84 @0S0 | ] P   \Z0S Y Y 0  Br.  Br*0 8- $P0 0 0 CY ' 0  3@ $ 0P 0  S 0S0@00Y$00D0<0<081(?00; P0 P4 000а 00 0 0P00 S*P *   pP @ 0ЍO600 0< P0 0S * [P  p!`81 000H 0 000 `0`0v\0S   0L!?YP 0 8 R @ 1ЍO5Y Y) Rr   0 P0Pd0 Yk 0 6g0 t ЍO[ @Z jZ Z Z Z Z Z T Z Z `Z 7 [ #[ :[ K[ [ [ 9!O PDx[ f[ [ A-h0PR@=0 0 DA0BS`pbp C0 Af$[ O-` Pp 0䐠x1@T ЍT 0S R T0S> R *hP  0 6@\ O-4M@PP Q0 4ЍODPE ऍUPp @RL RIYUD:paV@ U=:$ GP3U0:" R-   >P% 1S 0Q00R0<2  $  P /  44Ѝ0 C 0 B:9!3\ R\ @-` MQP\@M  0p000 p 0S TH  ۍЍ 0]`V \@T6 9!$H A- p`@PpAPU9/ 0 HA0S 0A\0S 0A9!o\ A-0 ;M0M`pp@P @ p0'0<000C$00(00$0C,00@pV004p8  XX^U0`$0 0.p Fݍ0Ѝ:!6   p@-@PT  (@x1S0pSq W.02p .02022p R Rp07@-PX0E @P 0S10>0P 7P7;020C0s0S027000000 3  Ѝ0@#}x zgjzzP+S, @ 0 Ѝ0zD\ "p@-@P0( Uph0Spp@E"O-P`@T Q Pd0S  0 tj0`d0P0BQ 0S 0P .  60800 |#  帀81- 8 0 $ 0R0hd`h08 R0 , 00C0 l#0800<0  P`00 0 0w0S $0 pWp1s00 2   0P C @R 00pwpWL0H0Hxt0p\ 7 \ U 0/@-0P s0 @Rp@-00p0`PQPE@ `㈣ @d@$,b p0P @-P01S 0 P04/P/P/Q 0\R/ 0\/0S 0< S8/@-P 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ oSQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScG-`x1@PMT. 0S pW$ P  ɞPP@0Sh0S d0S4$儡d0 0S PPPЍ|0d 0|0 00d0 00090` ⎞P] ↞ PU9$0 00 PP 00d8dX1{ ^PP ||0d 0|0XxٝU" 8mP^P f y | 0Pep|0S HP 8 C P  JU` P < 0$Q S "  Q  Pp h  5< 0 i  h=pP; t0<0t0(0 0#0 80dxQY X ʝP   U ⹝pP םȐY $0% h  5< 0   $0<0|,!N] :!*Z] ] ] p@-PP1!U jp`01S 0S 0S 0S  0 @T 0Q0 PSP 0U d0S0h0d0p@O #:!Z] ] H p@-@T PP@0Np0:!G-Pp`PA@Ѝ0E @P00 4d@P 0P000000 000*10  ,/$00 pPP*0 Gp0S p0 CP  0@R 0 0000@@>:!M {] ^ @-@0T PQ 8 00*:SR h0S dP cH9` ЍY$`  Pdp (0Q,0Q  g `P 800000( ,0?P0S  0h dW $0Q 0h0d`0SH"^ @^ 0S/0S/   O-MH08PR 0` xPT00ЍpP PI0 X@ XP R R R0 00Cs @ЍOP 0S3Y0000000Cs ЍOd47 @PЍO p    @@0 0)0 - SK:!M 0S/G-P@M T 0p `x*00 0@0 0 @_@ЍP/@-@TP@90S   02p@-@PPP (000p8 P 00p0000 S0 @00:S 0S @\S000@:S @-1&0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO4E`VK `0P0E@ 1 PP 00pCލ Ѝ@@k;04pW p40(0= zP  0 `R0 :R`00Fd4@0  0(880P4 PF0 {0S :(G p PP ;000P6p 0S#0 0 0p8`@[ +  '0P R 0(0SJ @뉟@ '0P 0S00 `0 SWG p@DW :Sp:SY @\Sp S Spp p00T:C P@D 0SJ 'G0P0@ 0 Y@S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 P0@DJ`F  0S l'y  00,  @ ` P D,0J  F,0@PE_ P0S I'$ D0A00T*q PPJ 0P-&U @-0  0 Ѝ@-(@ P UX0 0-0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ }0Pv Ps @  X Q0,P ލЍ }0P P 0@PX0 PP U L,P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  -1&Hp@-@PDp@NA-`= @P@ d PPd f 00@^S0S:S_ p0 R0S@Ad{ PJU \Sp0S:SH 0C^ 0@0LT1 0L\s0TSpASBC\ Z [Y[[YYYYYYY[YYY[Y([0bC|^ 0 0 00:0 0Pd @0:SS0AR0@A  P A-p= `P@ d PPd0`Fa 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P |A+P-G[^ G-Q0S `pʯ PV00Ѝ  -P00CS0V Pp0  W00S(@ ٗP   , P ]P00SW  X  R00S 047σ,P R   S@T PR   R -W 8--@0@-0S yP `P-8 -@-@WP08G-p@-P@PPpVPp-@-@AP M 0@87ST -8 -p@-@ PS P@p p@-@P & 0@87ST -8 -O-pWP`@P @ ЍZ K P PT  RT@ Z //////O-Dr@00S `P$  4PV00 Ѝ  P00CS0U Pp0 0 e |U00 S ᶖP o kP :P00SU00 Y00S TP #P00S  EP ?P x9P \3P D-P ,'P$~ :嘋PyP -W 0@-4@0P x)PP -Gf^ X0@-0S ;@@0@00DFP0DЍPP - -@-@`0P0`Sp 0`+P PP ЍP -@-@P08DP -p@-P@PPpTPpP -A- P@`pPЍ0 `(0P84SUP @P -@-$ 000B;P Ѝ -A- P@`pkPЍ0 `(0P84SUP @P -@-$ 000B;P Ѝ -@    /0A-P<<`0@ C0p0D0& SQK 0@/0PA/A/O-@PDpDpG``b0Y:0z  Z# 0@@Dɔ 0DA\0:Z: [=0 S: p `$ Ѝ `p-A-@`Ppồ Y"ᵓ S"ᯓ M"ᩓA F"00@-A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @P2p TT0 ~#p™@ K<0@嚙404 4/,00S 0TЍ&y^ -A-`@ 0s P0"0p0pGWp0P"P @P @pT 0@@PP @-p@-@P?@0 ?@0R:@@pP p-p@-QM$0Sp A1` 6/`1!6/&%!Q10P! \`6/*)x!(Qp'l10Pdd! \\\^`P 6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/Ѝp-&F^ (^ )V*ii^ ^ }@^  ^ ^ ^ ^ ^ _ _ $I,_ 1_ O-Q<08@0(00IpPR @pĒh`,@480T:(t(@#0T(:(t(#0@ (0T: 壒030H,@`(4 啒8 00 D3#00 `@4 兒#00c4 0300 `@80@J000 4/0SD0p -`:!p:!&FP_ p@-@0`,0DPSp1S@-0D0P/-O-EAMHP MU=;`0, 00PP3p0,0}0@00`o`L+w pp A>0t@lTllH0SpW W D~P !P 00PpXA C9R񟗈`rsssssstrsrrssssrrs$ssLs`sstsssssssssTrsssssshrs|rrssssrrs ss@sTsshss|s0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0H 0  ;/Qc$0`S #0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 0 00(~ `| j,`PPDAލ Ѝ, !ổ4P 0H0-u_ & _ _ k:!--0H0S/-0Pi /-A-HAP|0`S@M*0S'3 0S S f+ 0P 0P@ @Ѝ ; pW*P 0 0000pb p@ /`0p~X0 T7/0S 0SP 0 P0@ЍA--&y^ G-\qPL @0P12C001b5R 0 0&0S  h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0RA00奐0S0PS 2&0S,P N,@GH--!\  0L0#0-@-p0M  L0@31 ^AP 0C! 0Ѝl- @-L 0 0@11D ^Q       -A-@b@0Mu L0 @2# p PW%cP_  Bc p\  Zj$0 HD@,X#10000 2R01   0 0S0" V00 S ≐ ЍA X 1(4/00~X0威0 SV Q`ЍQ0S ȏЍA`\c  Z  l^@lG%0S Z b0@0-`:!C-Q`0MS 00S` R@P: 0s%@Ѝ pᄐW   @ 0p0|0S0S +@Ppap00FV@@XP 00T p@p\`W 0S:S* ᷏ ֏0p0pp--O-`HqL1P0SU#,@T,P@P5 &0B1 `P 1h L0C R P!050%Pd @T: ᓏ 0 p[L0CY1T*Q@@-G-QT0Si:\0`S& 2 c@Oop @d(0d$00@X1 0S. S0 P B H %Q * RA  0<408@S1:X 0p@D7C 0p03 c0?o< @@D@  P  "OP ` @!В0 a`2!! !00p30P-&A-p0@@ `P PP0`0P P@lN%Q *0S  ᕒ-$00S:@-@@X-@-PP` U(0SP@P )@T \0@噓T0T 4/봓 00'0S 0 (( @+Ѝp-&F_ O-$M@PpD00T0SdS )@TPY P3@gH3H 4/Y(0S p0dpY`WT0W$@p pp0Yk0 # 30f*[`C`fQl: L@P7W KL ) D2 10Z 0F30 %0S6*0S  0@P1'0S 0 0@$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@ϒ0 f`[x [`K``fpP @P0p0 KF K0`F@  L @&%Q *0S  @-&F_ 1` -@-M@pP,aD(0SWTP )@T: 0@w0 4/0#880 P0U: @P  5'0S 0 |( @Ѝm@P %Q|0S0S P_ 00-&Ff` O-@QpL$M(0S@ P x`(W .0PT\\0T**P* 0`0  `?oo 0c `S, `P T 1q*#M'0S l p@`$Ѝ4 T$P030#P0S X 200301S%T#2QZ E*0T00S  D࣐`P 00P`P0 0#  0|0S0S @ @pڋ,Ì`0<0 0 ;p`  `P% 0   %T#2QZ J*0T00S  DOVvꔑ 00FP )0S 00@g,0, 4/`P-&-F` @-L0@'0S 0 00 0T Ѝ@Ѝ-J////,&/,&0p00/1&0p00/1&0p00 /1&0p00/1&0p00/1&0p00/1&0p00/1&0p00 /1&0p00 /1&0p00@/1&0p00/1&0p00 /1&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/.&p p0 0CSp0 S Pf0 /p@-P@,`禋Pp@ Tp3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00{ Ѝ0S/1>3 !/0S 000/$-0S*p@- @PKP P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B! t0`0sA-0p0@P`M̂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ00 |R 0S |0 3/000Q R R0SQ|P.00 R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍ$-A-PRp `@P 0!Ӌ000A-@Pp`0 SW' WV00S񟗋LtV VjpGPX`ч1 X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0PS Hp  B0s  B`NpGP`Fe`AA-`@0PS0<R"*1 21<0S 0R0PP0S*! !x000S(!!!,p (*N0PA , (0 ,P.&1&1&A-Pp0 R*S\ ]\ t`@BX T ņPVP`& R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00$- 8 0 s000/`Q'Q!//1&p@-P@,`sP@tp TpP!Q 010//P!$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0P`.&1&1&O-P 0R@M  P&   P 000Ѝ 0@  MPP ЍO 0 PS@ ၉ 0 00<00S*^Q000800R ]R00-R f0S* ]R -RQ\S0]Sg-Rm0 Su:0S0086000S8\ 00000 5^p0a SaR ,0Sf40Sc$0S`<0S](0xY d 0(`c0@`F p@ Uj 00C0e-R [RQ :R =R 0pS:   0Q00`S0`000-S]S0`S0`0p4 R*000pBW R:0`S0`00 S=*R: :R7 ]R400C  0p pB{P⌳ 0w S0<R$  LP    uP  p$0  0$ 峠0S00`` 0Q00`S0`000-S]S0`S0`0= r R:0`S0`00 S*R =R ]R 0S0 -RC Q@]Q= -Z00  W2 0S- W0`S 0`00S ,Z00W0S Z4 0KP  pwp400!0pᲠ40 P0S 00000 P  P{  [n 0]S S `Q\ r  0  EB#ЍOa a .&$-1&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@1&1&1&C-@PPp\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  vHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB Rt r I 0D OX &(  RPSxPA4#X z 0   000`020+U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP"  B   B0  B0V0\S0{SPP0PS<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S b^0<0S 00$000*Xe .X< 0e$-)>{^ ]1&@-0@``P?Q $0As R S$$$X(($$0^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )y V 1L   0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   000p030` 0V:0S003000 <Q >Q q`x!P  &  R  #+S  *Sg 0S8* *B?RP {R1 Q. 2000' E#,Pt 0S 00h2Q 0   0R  0 `S|* ,Ry  2000< V0 R  !   h0 S*}Q00 0RX}QR  Q +S ( 0  BN  B   B0B  B~?S {Sz   B00  B 0  B%  B  B " A 0000S 00000$-1&^ ]0S C- `M pQpG OpL@P 6W:0 ЍPPP P $PPxP @GP0 uPP 6   00 0  $ ( , 0P4 8 < @ D tg000G R:0S005000 S3:  P 0A0GP  %00Q p0 P>3S! 1St Sq S <0RpQ00< 0o (  {SW S<0RuQp< 000p000Q S S SS8 S S4 +So >SQP>3S S' "S 0SU\ S: ? <0Sg 2H 0@0 @010 0  P0S HPR, 0E10S*P 08 BB0SE0 1AS*, ^ R0C*@ Q U B!U \1LX0R#3S#^S!7l80SD 0>Q Q QS 00 0R 10C/TUU(ܙ$-Ee$1p@-0@S0<QP: 0,0R04S `$0V':8p1P8 S50#p(00<^ 00^ 0S8op 0! R R0 0^P`.&1&1&0p@-0PS0<Q@*@80P p<0S P pH0@0@P(00Ppp@.&1&1&O--P@pMLPئH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T *P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0l30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  _P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 CP0 0 N1& d O-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0\0( 0(0 000p 002   0 X @ Q  0 R)  R # `Z X!,    R  $  S  R  V  PP$ X$@1`v X PP@(@ xPPP @(q P  @@ $ X0  QvW PYst va  r _V R  !    _X RG v@(@X 0x  v% YPt P vI_Vxtt xLt v _`V `R`V t@@ v(  P Px Ptv x N_XN 7@Y (@X fY0txPt, xt v  t v  r   _X_V Q ( X 10 _X @jth v xx ,    R (ZS $X $ 0` (ZS  P 00004Ѝ0S0 0x~ @P 1&O-P`M80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R >sp0 c800@ 0 ZZR  D>sp 0 L800@ 0 CZH  D>3 1> Q p0p0800@ 0 p'ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPئH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0l30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  oZP?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 CP0 0 N1& d O-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  9P ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E 0000S0R0SpG pGPx0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPئH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T =P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0l30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  ,SP?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 CP0 0 N1& d O--lM%PQ0x @%Qs ppp        Q 0#RS. 0 YS,Q 4^ 80S 0~ <``F`Z01S` 0s vQR\R 0C1!S` `0o0 Q[0 000,@4H80<@ PP 0 TX\ L0` t Vd 00 S`FY1`0 0 0`,P XD0S 0 0D0,`PD00D0 0R < 0JS : 'RP Z Z `p5`XD0S[ 40S,0@4440S pj, 0@ R0%00D ;0$0 0D0,,P5DQ/*0 F00,`P& 0 0D0,TP HP 0000 0D0,AH0SPHDgX 8 D0`F0C0X?4@` 0 ,0@` V 2 1(1( XP4P HP PR [S3 0 Y,,Q~ 4^e 80S 0a <``F`Z#01S` 0s vQR\R 0C1!S` `0eE.&m0 Q/0 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S8 0 0D0,`PD00D0 Z ` 0R< 0JS: QP Z`XD0Sf 40S,0@440S  p4P hHP dlЍ, 0@ R0%00D ;0$0 0D0,P5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0SPHD^X 8 D0`F0C0X?4@` 0 ,0@` V 2 1(1( XPpS5 0 Y,Q 40S 0s 80S$0o <``F`Z$0 1S`0s vQBo \R $0C1 !S` `0 l0Q0 000,@4H80<@NPP 0T X \ L0`qV 00S`FY10`0 0 0`,P XD0Sb 0 0D0,`PD00D0 0 S` 0P< JP:$0 OP $0Z`XD0SY 40S,0@440S , 0@ R0%00D ;0$0 0D0,DP5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0SPHrDiX 8 D0`F0C0X?4@` 0 ,0@` V 2 1(1( XPppn plpj-Ѝ///@-a // //0p@-8P00@S Pp,gP p0-7@-4P@0S TP Ѝ0P 0-@-@P 0S k@P/QbP0 0 0/ /0 0 0 0 0/////0P P@-  /d 0-d P P/ /O-Mc`pPR0@1~*@00 0_  R03#$[Q0^0A02 T03*@P  #0 0 0T 0C2@TPT  # 3S R0 YS#* X* 0H0X0% 0L?o@ 2R0S  0\ @P# 0T  # 3S R 0 YS# X00 Ѝ 0S"X 00HSX0 0 0Ѝ 0j@0   PAXHn0 Q00@-M@ $0  P#SA\ (GU-00ĵЍ0~ r0\0G-M@0p`W PV P%Y P.X PmZ PNx P4 P  \Wf  \ [V+  [ [Y  [t [X5Z! L [< [ЍYXZ-  [ [  [ [Ѝ [ [ZVY  PЍG | t L L $ | D L G-PQ00R0p`ᤔ00M 0 @P @0S nS a0CSsNU2  0oSm 2kPN Ѝ)kPZ V000U000kP[Z V070U070PkPZ V000U000jPZV000U000jPZU000V000zjPZO V080U080i0@q@jPZ: jP jP jP`ZL V080U080?jPo jP jPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000lCjP TSHPPP PPP8`"`!P03 pP0  :p, 0 np@ np@  'p@@@dn0 PnnPn0 PnP`Ѝn00@O-1MM @PDL 8 "( p C. `pX@D;@8 (Z0Sl pp  ` ᰑ 00㨱$ %0!`p@ t0!0] BP@P 0S Rjn001ݍЍcn0S 0K0S R Pp 08D<4! @ P0 00Z  0/0h,R <1ݍЍ p FtH    gt0@-P@M 0  POp Rp@ P m Ѝ00 0vЍ0@Ѝ0A-@@0s/ PP0P  0&p` ``V0`0m0ppJX`p m``>0`0m 008p@-@PCM1 /]P3 ,pPB ` @m000t2 06{C.@ F {P4D@ @Fb0S VS00 SCލp@@0S^m@h0h 0P@0  P@1:qm?00@km00 @D p@-QMP4@SMY TE /]PB QP0s+ YhP "QaP 0`9&pG @ 0@cqp> D p7 ۍЍp)0si/}1p0 +jXl@0 P@0  P@1:m?00 p 04l0#S @l@l@+p@ l00X`$44 %@T \ @-qP`O-$p(W,P0-S`@/U'Y1 ? fZ0 0fP :[#J P?5#I x@t4 2px 2BzPYh@rUZ0J[% 0@-DM@ hP, P8  > =` @ =`==< (<A-P@U 0U0PUP!A`F>PFq ``5P 0!Eq1pP 02P''O-@ML008 p L@0 0@8@4@<@@@ @@@pi P0@T0\0P`00ᐋ君 SD[1S l+ 0S1=S L+ 0S1,! R Zt[' 1S + 0S!,!A R%R:}p) T  0VZPT ` <` SJ t*a !_0CU ` e‚!  3Sz5,t%d^jiq>nm~^gkH,T lT0XYP` 0`0?d0t00P0?T0l0@0?D0p080?<0h0H0?L0d0/X00\ 0 00#$0S`@PH" R"  " R,"2!x"~$0S"x`@s0`@0m `@20 P $:($^0<P0 0=R( ( @%0h00D0c 0.a 0$p!#:6 00 0.$0Ϡ.>H!! 0!!!^0C 1(02 >0. 0,S$/2"́ ?0 0 #1?B!   0 $0S(, 0Q 004 0`@0`)\)q(4('&%E`E$%l""""'.%Q(\)\²(0`@S  R $ R `\ :6$4&60 Ϡ!$0! !>0!!!0C 0P ,"΃0/($0?,0S00#0S<,000, ,00Ϭ<(800$ 0 #1?B #: 6 4$&60|!$,$0!,>Â!!!0C 0R!,"΃0, #1 (, ͌ , ( 00SP0$ 0 0T 0D"0?`R0`@00N `@l2t0 P :P0 0<R$0h000 $`@  0 P0*^*{ r0s{P T80<`@ 0dR0  \u Q $ Qf$ &PT8<`@  \0X000 Q00SLPT8< 0`@D0`@0  0C0;000 @ 0S2 0 h00$%`@0 @0D 0 0h$% 0S 000000$0`@2p rp t t `@  P00  0# D%`@D000 P 0S %z`@D000 P 0S!D% &j`@000 P 0S D%\`@D !V 0`@ D!O 0`@ !H0S(0S `@60P : c 0 $_ $&,:6 00 0.$0Ϡ.>'! 0!!!0C  0  " R Ό " !( X'\$?h#" ?00 #1?B!  ,,  0\$(  R0# 0 RO#PKOI RF  \Q:%8< &0dP(003( :60 0!$Ϡ0! !>(0!!!0C P/8!#? /" R  " R $ $0  0#1A0H h0 0%L 0C00000S P0 0   0@0\$   C00 00S ^ 0 0  0dL  X* R" O-Mp`$d0LL0d0W@0 V. 0 2c1 00 80PP/ 0v> 0`0?d000P0?T0 0#?<0 00$$%"`˟$` 0000  000V ;0d0PX 0TPK dPI$`P0Sʼ Rʨ R ʰ R  0 0` 0S0`@d?O$@Tȏ(ET0}N0`@d001d v^D@pD 0G080HXP0 00 PESQpSp pPQI| 40 dhlptxPV@pS[R  R00df@x0Ut0Yp0 Rl0Wh0 Rd0Zxt [$[8P0>C 0C 0p00@t0` VP x0S c0ppt0 00@ d0 0Pd x4( "ό R t0"! R RWv 1p?'/!! #./ B pW ?,?.P P00#1 ?<v.C BL\Sx  Ptp Pp`c 0 qpp 0qpNc0S@T` VP|0 ?oR20S@30@9pb 00P `p@ d0@RP ? /' Rß&0Q| 0Y/0 #10">/ 0C!a 0C0 0"#0R"P#. W#0,jpW10' #ΌQà3\!=30S 0>! B^ ? 00 0qp8 @(pkCa#00a0S>@㴰0d0Y@괰[0"c01 2c1@TÏ!a!Q  s!P aT00a0S10'` #ΌQa00@taT00[aT00 BlX/)\P(\ ףvɻ %I$@-@ LjpTat X00 R 0 R 0Q/  /  d  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/ H  Q j.0 0#  Q/D00Ɠ\ 0@-pPo> 0@" \ 0 /A-@P `p@P@0% P PPA-\@`@P pjNP@0& P PPA-\@`@DP pH@P@0& P PPO-P M  pP9 谟P n{`P P @@ % xP P0S  Ѝz T W Z  F0p0S A-pPQ `@Q BP 0@DDB(000S  lh@- M`pPPp) 6` 0 z0@0S *`0"S" 0p000S0 7/ Ѝ`0"S1Ds\0pT000S @ Ѝ1Ds$ b(0 lp @-@v t@qO-P`U M PP2S pPK @P@N  P K <10`0@P6 0nS# =PPP00Q Q P R  \0  KB" 0 0Q@00oS@d000S p Ѝ4 l tO-BMM@pr_@0  07UP:OPP  +UPn00XP PC @@`K'0 PPKp q0P0 0 PP=p \@P! H 0dSPkPU0 P p` p}  0(ZP @PP0 PpS {Q qP} {^ 00BލЍP/U ` P Cp@^0SQ  1JPBލЍ 'J0H0PP0 p=  I^00 P 0 Jd! 0 0 0^0<0  0I^!0 W`00'^00 P 0I}v^00  P 0Iqj^0\0 P 0Ifd `   zd@4 ̲ | d X x -{M 0 { EPЍ -{M 0 { /PЍ >-{M 0 { PЍ ?0-,M 0 LPЍL --0$ S   0/ 00 p@-P>IU@p]?( ( 0P 5/p p@-PHU@p]?( ( 0P 5/pX @-@P 0003/l @-@P 0003/, p@-P?oU20S@ 0 0 03/px p@-P`UV00P00S@p$ P05/p p@-P?oU20S@ 0 0 03/pd p@-P`h@PpE](@0 p@/\$ p@-Po@P p 0 0 03/p -@- M  Mxp@(0(003/ Ѝ@ Ѝ/ĭ @-:xp@0003/dx O-`$M ؤP @0R0Sp$Ѝ\0,P@@  4/$Ѝ O-`$M ؤP @Y0Sp$Ѝ\0,P@@  4/$Ѝ !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////0  ج d T @ (   4 ī t ` L 8 (   ̪ X $0(- C^ 0CQ$ :$0S3 57 $05, 0$0(00 # 0 $0 0@-@$ MP#055050%A0!0%P$00$0Ѝ0 $0R  S,3 5,07$050$0/S<3 57 $050 0$0/0S/, p@-R@pP$(ASp0$ R>3057$ 5 $ !PpO-`@VPpDM@P؆, -Zp0@ U p 0@P UK UK h[,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R#00C R00CT,@DЍF, 0R3057, 5 05 R, S# 0C 0S 0C 0S 0C5$0P$p 0@V@B 0S1 `@@0 SS( S R 0C#@ =0 00 P, Q0Ç0,  0, 0 P<@0S80S ,0 S>3 57,050,0@q`V  FV")VX*0FSTRQPONMLKJIHGFEDBA?>=<;:98bV1 ?R20S/ 032 b0 B12 00@s 0 00Q,  P0Ç0,  0, 0Q @YfV ?R0@SQ  b9@S B88 C c3<21FV 0, 00 R Q05 705,5 0,0 5RQ= 305 7,5 0,Sf @ 2$01$0@@@0TS`VI2=0F?ofR20S00:FoFRQP Q P=V, Q05`7,505,Q,0 P,00,0Q  1@ Rf 0Sc @[ @ 0PW  @ ?RM0@SJ b9 B88R00F @00R%#jo%#jx%ju-M{0{0 Ѝp@-P`M0@ 0 4/ЍpG-PRM[  `TpPC/a@IP @1000< pp. Ѝ80S&  1 000< ppNY0S0000< @ pp=Y0Sx 5Y0S X 0 < @%Y00!Y00ꔤ $ $ D 4 ܟ @-$$@M ЍO-EM M`X@P+p `ERD Z0P@'T 0 Z0P@T| 0 0EAP D CUEލ ЍX00X000 @-@` pMPSP& /Z 0RP$  rR$   P @0C rR  Ph 0 @Ѝ0 Ѝ@}0rS X 0 ̝  A-`@ p 0P/S /9ZP @0 Sp 0 S > XWp@-IMM@`PP p 0: S X0 0up IލЍp0XO00@IލЍp(X008 p@-IMM@`PP p 0: S X0 0Jp IލЍpXO00@IލЍpW00p -{M 0 { PЍ 0P 8 Q  8 //p@-@P PP` @ PP u IP  p@*=PPp--00 M (0  ЍЍ/ 0P --M  Ѝ Ѝ// -- MN<P 00  0 ЍЍ/x 00-@- M@OP  Ѝ@Ѝ/O- q`Pp,M< PR% Ppp0 0CS% P[ P@ 0 @[P N!,Ѝ000:Q!0P00,Ѝ <p@-(M `@P& (Ѝp0 00  0p@-`@PNpp p@p@-(M @P,0, 0 `|& (Ѝp 0p@-@@ @  `  @PfNpp p@i 0p@-(M@PXNp `Q&8 X(Ѝp@-@PT T  ,M` @=Np p6& =,Ѝ0 0C-PP,M/ p@``FV`R V @`0 @_T N\ ,Ѝ00 0:2 0,Ѝ <p@-(M `@P% (Ѝp0 00 0p@-`@PMpp p@p@-(M @P,0, 0 `% (Ѝp<0p@-@@ @  `  @PMpp p@v0p@-(M@PMp `%8 e(Ѝp@-@PT T  ,M` @Mp p}% J,ЍL0 P $ Q80 @-880@M08 Ѝ880/LL0000 0<Q 80880Ѝ/lP/0@-@0@0 M0S 0000 X04 x0PP | d00B/P00 Ѝ0@MP,J0 O-3M0PP 0 @AL0 `D0Fp@ P P00U tpp0 0Cf Y 2ATT00  RF LD@D T\:[ 2 0000~`K L0 V0 W7 X2ATT 0`Fs 0Ry L 0  0 B0SH L0Ѝ V0  0 y L 0 o0pHX<0S3 0b qLw 0 BW@ 0 BP  B^L`FtZ  0 B@  BNL 0 6z CL 0 )0S 0 B  0 b008 00 0p@-@PLppp@ 0RS00 /p@-@<0<00P  @Kppp@ 0808 00 Q0R00 /0p@-@`PKpT T   p@pp@-@P\ \  ` @KpTT  p@p 0O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDA Œ Č Ȍ A`| Ap2  W R ? \ QQ Wt ,0 000IC1100Q0 0, Ѝ0000 00w0@-@0@ 000 @T "AP80@080@-@P AP80@0800-M  nЍ0-M  ЍO-ϟiM P̑Ёq QP@ P? `K͌U PD? K͌T P? F͌(1S P> F͌(Y Pl> C͌ X P$> JB͌8W rP= ̌1S _P= ^B͌``=@ 0S078D H0P `P P  P P Pp PP P, PP( QP PP (P PD PxP'( lQ780H0x100C40S000C,0h0LP 0P( (0Q0Pd  , P `P X hU1q @a0T0 @T, 0X  p @dQYh`@0`@ P`'  V U `0P1A1S  ,000@!1S 0D 0| 0?piߍ00NP,,0`L0!!\\, @  B  $8 P<`@ Y& 00A00@S= 00 1 `V P`V ,PY 000 `,0匰 0[p$0p1`㐀0@@p`㓽Pp  W 0@0@S  P8<`@P(04 0R(0LPP1@00S@@X!(@L 0S00!$0P [T0S0 0 , 8P 0BX00P0 P< BY 00 O0 T ,q` 0q @PV f`Xp0@  P  U  PuU,0V00@ Pܰ封[ P@0 PP  U `X0pP @Y 0@X RY0,0P0  0, H V 少[0D|A>`Fp1``  0[`0Lꈰ  0PUMP  0@TPOQ @ 0PUQ @ 0YSJ @ 0XU @ 0pWWQ^ @ 0PUY,  `6,  B 08P< T$,  p , 0 H T0封1D|a >p@(8P 0<04 ! , B BP   $@ 0[X T[0,p`p0q0 0q08@<X\PV f`Xp1@  P  U  P-U,0 V00@ P封Y P@0PP  U `X0p8@ 0<X\P@U.[P,0 CT', 40p! < ,0 H0X 0q1D|af=p@P 00 0R1 (0SE ,00p W 0g1(0pS3 1@ a! @0T0P0 @堽T,00 ` @!(0R1@pPB30P@> T  0Pp 0,0 SR,0, 0B ` p0 W" 0 0B00`S9 0P 0Q!1 @TQ @LT,000 @,0,0Q@@ఱ>P`pۺ PP U  p ` $0S; ,04 1Y 0i1$0 S- L 1Q!qD0 @00T00 @T,0 0P @Ta$0V1@V T  0 ㏺0P@,0 SX,0 00C @,p0 [# 0 0 B0!0@SC 0T 0a!H 1 P U a P巼U,000 P,0|!0RP 0P1` @G0P`R T  0 @  h50 0R80000S 8O-pYM|Cq0cS@` Q 00L3?K͌ 0 0v0S?H`3K͌ 0H0w0S?pp2F͌( 0p0u0S|?Pl2F͌( 00x0Sp? 2C͌  00z0Sd萍 1?B͌8 00{0SX 1?̌ 011s0SLN 1?41@BM@0810 PYߍ 00v0Sk H`w0Sv ppu0S Px0S z0S 萍 {0S  1s0S N <0@-P@L0MH( 00 ,0 40Ѝ0p00@-P@L0MH( 00 ,0 40Ѝ00\0\ 0 R/D@Q 0Q(00?H/0|$P0P0/ D <  R ,  R$ 00?H/4|$0P07 A- D   R'P?UH@0aaS,p10 0D C  (  \@Ud@U(  R 00/|$0 000l P  `0H?30\ -@@  D\,00D//|$O-PP 4M 0pS4Ѝ弻PH D0 0 0L|!03:|@婻P` `0D0ZP`@0PZ0 T/P V@``@|K:L ?3Q 4Q<  H0 00DpL |"(099`P0S R@,PR @0P  : R0`S4ЍT `@004  0Է`Pu @|`|$0 00]0p@-\0\ 00PU 0@S PHkpp0p@-@P 0PS P1Tpp0P0% H -? \0| DR0  0R0 S000 0\$( /|$0 000 00 /qO-tRt2P0M`@V0u T":L"@"4"("2 2 $ 2 T 0 01X 0 01\ 1 ` 0 01l  1pmp0p0npp@z20吲0唢園 $TX\0` 0lm0n \1Q0'0 0 0 0 tЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000 h( d0C-餂pP@M 嵷PP @@{ d"j =@-ÆBBB {`@C{@@@@pPV CO pQ 1pL 0p R] @B0 @@@(P: 0 @@@(P/ Dp+ #p' p0 @@p(P  'h,000S :3S ЍP ZB2T @T][PЍh0S,@ApP_ 4nb A-Z`pPp oZBe2S @TP,*000 R A" A (@-lQ+ P@E0`XM_  S- <1^p0!!!!v : !' !_ !| !o !* <#>4{!*prQ>{ R 81 R 0SЍQ L0 0 0Dl0T0Ѝ!fklTkj@0l 0̃ S/jO-C@p`ᜣM[ +6(p($W 0CS0SL߸38P $3$0/# {% 08:x{rH̲ pŸ夒堂8ırxrhÃqpr(rhrq`r`PrXr弁qPrxrHrÃq@rr8rq0rr,rqps rqrqrqrqrq rrrqrsrq}@s: R 0S 18p10S pWЍQ 1 0 0Dh' Jl`p  \p  00(@T(0Ѝ `ak\ t_ pp<^ v 8#:0'#z #H#p--`_|opry޶z۶{ض@|նh}Ҷ6A-``'^` p @ 0^ 0(`V(P fO-`ܶ6 6M000ƟJҭp6 0000SVF . p =p PP[ S p?P4S S S|V0S'pPn 0@l   $ `00 4S 0 0 40 s 00bR$ 4S4 0P%00Ѝp PP 0 04P40 s 00bR4 440P ?21 R R0 ;0 $Q B q 0 ;0 pP.4 S S040S$ 004 0r0  cR$`S 404 ` pse0  ;0 յp PP4P0u0PPcRT T4S{0z$0P s 00bRS40 00V0SkpP 0@  ^ $@ `00 4S  20 zS 202 `7 pa p 0$ $P0 s 00bR40 ; 0pp@ P< pg 40 s 00bR4 4$R2P00$0C?o$ r  aR$2&100#?c p p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100#?c0`00$P r  aR$ $ Q 0000 4 00 40 s 00bR 440`00\0\0! 0S6Pydy`y4xQutADsR 0(  0 + 004 00/trO-T4P@P0DM+ 8 `$Qi w :Q|#R3Z 300S 8 ⯰pP 0@T $T` @@TP  Ѝ<V>04P0@P@P@X@-@l?P @f?P =P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o"M L O-08vSp@`M$f`ZP T0 ʍr `r 0I"R 3S(0$00 0R;PK  TH;P  0XSd%$ X% 0"L5`0T <504S0300SL p0SI 4SC 4S 0t24W】匡Tp2 >PN 4p2[  LAT `P P  @  oX4Ztx2 PX 04x204Y|2 Pl 4|2hЍH5S4S~ 4S0?o20 D p$h l $ <%$(lY Z>P Z S>P [ L>Pp2?;~0p220P_0 rr 0I"R8YD  ,>P[2[x2Y  #>Px2?;~0x2W  >Px278x2Z  >PL2|2[  >P|2?;~0|2W  =P|278|2w1S06 4S2{L%R/q[W]  =PXx2!78x2|"[Z[(`1M80<4 |2O[W,  =P'x278x21|29p2[\>ht@ 0D@-,@@0S700,<@-$@@0S700;@-X@M@ 0S Ѝ< 000 0070 0Ѝ;$@-h@M@ 0SЍ 7 0R  (00 Ѝ 7 H;;@-@B@2@P$MQ :cVT0r3ppp\,0Saqp 0SO1p0S@ 0  B0A*1`00|PM 1@ 300 R 8 C 30 0Xz30{)0 i :3,pp4 HP`$Ѝ0`00|P @ ?7 0R` 00 `600T @8 <300 "7d:l:l8pC- M0 P `  iU L@_}<0@00:3S U O Ѝp  0 000:3S/BHT0T 00:3S 03@-pp+P`/@-<0< 00 03, ppP`谊@-808 00034ppe+P``0@-PPP M* 0Q0@00xP 00 02000*C( Ѝ0|P H00 020000*( Ѝ0l/0@- 0 @P0:R M P% P P Ѝ0P 000 U20V( Ѝ0PtP 4000 P,l0 000:0!-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0\@Tp#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@TЍA-PPM Q@`Q00?`FV`V` ,p(L 0@nTЍP/\ 0,  B0/\//A-`MVP@,p(L 0@BTЍA-`MVP@,p(L 0@(TЍ@-PP M Q@6`pV00Ӣ?/`FV`V` W  L0p@T Ѝ(1@ RR( RR T 0 p@-`V,@@Da QP(0 ^0C0 S0Vp(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0>-Pp4S-`0@PP3@ 0 00p) ,ޣ4, [ 0  - 0 ( lЍB0  9lЍO/O-:$M$pdZ0  r$ -@T] P 0p p 啣 VH&:0PSE  0 @Pp$Ѝ @ P0S S6 SpUV&0004S$ЍODp @0S F0V  B2Rp  `Fp|2U `F 2Vp  pl2@p FPPQO-PM 4 3`S,[*Y= @00! 0@ @00@ %-TP/ { @p ` ^PPE @0S  0 z`PЍ` D  P 4A " 2:Ѝ @0 }X P0  0 /404 000S :P /H|<0<0 0 0S :P /|404 000S :P /{<0<0 0 0S :P /t{404 000S :P /({-DD 0\ ʌP 0 ~z@-|0| 00@T 0J#4R B0pQ }8@.P P @z808 000S :P [/yD0D 000SP:P4@//y000 000S :P r/`yL0L 000S :P @-ap @@/ yA-0 00pW* Z3$SP! #R`@4Sp`3@Tv AUB0tQ 7A-x-0    pw000 000S :P /wO-00 0 MX% p `P 0 4p @!P  0 P(p@ 0 5@ f Ѝ@hwP  P /p@-JP }3S P`4`G30PVA  0s3 S 0P 2 $R 0X0S 0D3 20X #$04p03ppDp@-jP 93S @P4P30@Sp@A-`PY JSU#X p @R 3S$ S(XڒL0AQ0, X0p ,01B0010χL10|10\ b0 0XP 3PSSpP4Spp3PUpp@-@P PX0:"C0T0XppG- ؀\/P@p  `ᒠP LTL VW PT WV  P000S<080 }0 0 p0 H @ L Q Dm1S J0 (00P0 080 f h10 0S0J0 80 W B000 p@``(00P02  (C\00C00 T0,R001 @0$80 00 0 S 0C`C 00080   K dbdO-P,0M 1H`  0N)U1 0p @T% PE$ `p0(@ U 0zP0 0@  0@)0 Ѝ-,0 (0 M0 ЍX0- M0 ЍC-@P M(p, P00S 0G`SLhPJ0 O@0H"Hb ``8 ᴙ 0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ000 Ѝ0`00SZ00%0   0T S00% , W10X0pXPH T0`ER VڜpPpV 0  pP Ѝ80  080 000 S0C`CHp@-`@P!pp 0p@- M Ѝp@-@T T  M` @P p 0 Ѝp U0l l0 00S X  8Q Q @ ,@ /&R//T0H H0 00S 4  !R@ ,@ //0 S;,0 0D | 0 00P0qjpI PX 00C K0HSP 1TX[00CS``[TY0IS`YPY0 0CP!YN|0 00xK0p@-@PpP`0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/$!O-PP + С1D0, 0 S 1H`?c`` AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0C}QJ0 00H0T0 ?o2R0S P (1  //\,-(^,0R0^Q!R@O-A1@ 0QM4 P`p, @p 0S" Ï#SÏH000C  ```P  (0R0 (00000C00T0 03/p 0PS@  ЍHX (0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P$ (0@SpP0@-0^ @ 0 Q@R0dO-`P M@ VU``D0S  00C(00P00 T0P 0 S `&, 0 SPp0SᴀJ`Dpv0 `| 0npP Ѝ 0 S RQ Ѝ,P e,0ݒ0P 00X p  ``F , B,(`aaA0  U p0E`4᳒P  Fp`,004@ 0U` p0EuPT   PB  0SQ 0 0PC 0$ 0\R =PT 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000U1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP ,B0 PQ8 0 /$ $\/ P/?PQA-a@`ؠ1Pp0$ TZ 10 0 QT$ D 0R U ETpM D10 0 QT$ D 0R U EBp; 0D00  Q P@$ R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0QD?0 PQA-`0`p0*Â@$ PP q@D00T 0Q\=P- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@ 0T `ApB 0S%0^! 0S0X K"@ 0 0 09@U/0P 8 Q@ @ 8 //A-P  0 BS0@( p`0,,0A0C1!0 0L0`S@( X0@-8  PE? J0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M4|ڌ`ᣎ@Pu z{툰 {ᜎPp,n ᶏPP0a Y4% 80!S0` ``pX08 0 T``0a$$ <@0H0|08 ( P0@0, 0!0 s0PT( H00#E @ t@T,0Q0@t@T4000SH00SX   R ,  H DS400,01$00Q$0 0P 0qQ 0%, S00,0,1$0000 S 40p0L|@0H00D00fp 0SL01H@400 0,0000,00 0Yl0Y 00S 0` S0F 0R_4000,00 1 1 01IY0CRڸ/o<"L\ Rn Y@L0l00P6P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Xp! 0 AS 0 V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s D  RD   00SB 80 S8( 0`V 00P0 0CS 80 @@ NN Œ Č Ȍ N LL\80ɟ`Vpl$8( 00S>0X *1h"0( 80 0 @ `40 , 0W Pp$t00Sz000 @0p` 1`11qW878'880 <00 00S 0X *1h"0`40V @ 60S G6( 0p|Q:0A0 0C0/l 10 0 S' PP 1 11RY@ RRQ 0   S %( R R !%`FPA p0p`P@ !?3 pGWaFaP `/0 < p  L  `P 0P0P00 PP0ᱠP0D0T H00S y080  400 e H(40 . p`\Ѝ8 L0h `T<00D RW 0 R PP! [R  f[ $R[  0E0 p0S  0E  <000$R ( 3 H000S2( 0<000h0S0B  0 0|P@t 4000Vg0 0C B!H00 R d1S\Ѝ4080 @0 800P00C\H00^B0SC V\1( 0, QA@`3`4! ,\@XP ppX@P GP0@, Q J   4p@,@ APWp@PT ``HL |T0 8 rt\l`TPp P @0`, AVXDP q@DH P! X @   \`Q  ABQ`P P4 BQO p @ p   ,@ 0$8 R p P p , [!, !`w @@[`o P p0 WPn $ Q  $P p,@08 P LPA\H0000`, Iy$ @A`0,  \0 `@00400   0}8 0'00@ 0C40c0 pWPx p p  P  , BQ 0` R G 4 DP @P | 40@ PL0Y0I D| p~0TpP:W W@ P q@DT GpGGD@c0 0: 40Rpp0,@0C 0B0W,0P 0p p000E,0E PU U R0a R  W R R"R10 S0@a 0 RAA LD8$ `P@@ ,@D@T \E$ P0B `0 B8 B!!x 00Cz 0U40P0 P,0a0 0R0h400,@P d1S ( 87 I <0@00!R 4Q R dP  .@ ``B 0E0p0~ 0E  <000P( D8(  <0@ @0,0 0000Sp 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  \9( @` 0 ``( <@0 0L0 00 -<000N( x>@ x0 `C0`  <000tW 5 b0 U<`? 0 0LRP6Pj <00 pCU YʕbH5Sp@TL 0$`P@@U= 8P8P `$=`T @pp  ! !@-@P@(T R/A-p0,SP` @T @T0`SP R0Q/ C0A "" Q/p@-`Q(P@0N "" S0 "" S \ 0L "" Q\PV@pp@-@@@0S  P$00C$0>`O-x:xz0t*Mp$P( ,pP @*00\` S@@s  aRXAkHQ00) 4 @Y @B@0@T ROoB@TP `NNQS0)\ 0  |  bR\ L)` R&<) R! CP'I@, 4R S[80S 0P0$  B$ X@0C, 4R CPf S ^\ \( 00Q <80, 004(0RJ0H 0@0( v $P)0S700S00l0S# 0 S , 40R#0l P, 0S (P$0CP$D70 RЍ (70( M$(00 SBFf@`- & (00 S4$&P0C (00xP0S  P$00C$0@d&  X&0 ,@(@ R 50 60, 40Rp F f@` 0 0, $P, 40BR0S(0g 0KQcڤ%%  p p d% 0(@`VAq@nR @D%@ T ,00P0S x0P0$  B$ X``Q 0[^[ $ 0|$0C ,00(@0 K[V p<$ , 4,! ! x D @  ^$ $@$#0 P(0i0 Rv ,,Xqa00P* x# ; l# (0$0@ ?3S0V{( , 3\0$7 (000P )(0$0S p 0P0  G@$(0lP " 20,  , n40 S ^ ) D20$ ,B@0S 0P0$  B$ $ 00P0 ! 00(@T7ڬa` ! (@00T0!0@Dx P(@0S  0P0$  B$ 0, )a`0S l0P0$  B$ 0,  tdhTpht@<$(P4 |(Ḍ\l 0xdO-hsh3pdC@00 S M ̶400040(c`(,P Zm34@ 3`0T&"0C S402PK䢟  50@DS(00S00lP 0S 20 0 204@,P0T0hP XRP0 @P 0( 0CS P 20 0 P1040 ,( Ѝ00S00h0S00~0T100 *@P,P  K<1(`0 R*T$!P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( l0  04@SSCPE@D4@P,L 00SL004P h,hltĜT@- ,(4 00@-  ,(4 00輛O-p1p!0 h *⨒YP!P H!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU,@0@DaQaS@00 0 Q  ST 0Ut0 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/LO- MtuPp) h5` 80s,  S̠DD Pr 0R!1S5@50  50 `\Pᴖ 40 0~0P 40 0s40 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0 $,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q _S~VZ]9 Q gSf2 Q 4SSVi^* Q j^S! Q k^S Q gSf Q[-S 0Y[=20  0S0*Spt !-=000 0R$"R 2U8Ÿ= @0A004 1aA`PU+ 0S 100S H0 0YH0,N  Z000 0 0 00RYPU Ѝ0  00!R 0ʀl2 00 !R 0ʀl2 %R t5S 0ʀl2Sw Su Ss Sq So Sm S\jld1P0TX POP# @ QH\F( 00ʃlœ\ 1:t“ @-'@T! tƒ'> 'tƒ /A\  B\  ^tƒ    /T1P0A 00` P;ʀ :l“3\0 /@P%0000CS 00000000000000000/@-@P@M&\\ Y #3t P P 00 C000 0mЍl`P -P\P Y͌# /@-00  |00S d d0 8=0!D00 R 0hz\@-4!41 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ !A\  `0y0 000:h/Xp@-@0@`P0M*l"R R`   P H00 040@ 0 @ &Ѝp,lX02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R. R !p@ '( V@ Ѝ1=00QM0SJ\1p20P10 0H0剑Q:20t1=00Q!0S0p20l00 0(0剑Q:20h00 00`0pY0!Q 00pM0!Q Ԍtl0 000/,p@-x0x 000@00CS0 S p0 S P00p᜗Pp00p@-0CS@0 S p0 S P00p~Pp0p@-,0, 000Pw@pp@-Pw@p0 000S  @-@J Q P\,Q    @/00P JP\@-\,AP / P/0S/p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0P`Pp@ W wP 0 0C S0+,+00FT0 S80  F2 0@t0 @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p sPP+  U  P `X(0 SCJPC0 0(0C\00CsG`$ЍQz TP P  D0|0ip H0@D002 T `V `uV `` P|Զ0 00 0p@-@Pppp@p@-@80800P  @ppp@0O-<6dM0@P$0 ^ Q| 0pv`PyU P&s0P0O W 040P0[000P0@SE:I.A@`0XP0P00PEPUO000 00PS0408 00 0`P0p @R@+40T R80 ) 4000C?001vP`F,vPH` %v$ \400Pp  pG`0 0p`0 PP Y 00 00 E 0 4,QpQpP Qձ,pp( X4 R!p! Bp G" RU     HU pG4 S0 0 P` 4,8p 04,0@,@ 0<8>PU 0 4Q00C  00 Sb 0( 0C0, Q0 00PSl 0002 u$ 10 P 00  0h 0 K00000p0[000C?00euP pGR0H`FKZuP 0I pA! Ww 0H 00 0ᰡpG W!D0|0p*tdЍ004 p` 040T pR0`40 00 0P} 0GP tedЍ`td0 00 b0p@-`@Ppp p@T R00 J0p@-@Pppp@ =p@-@@ @  `  @Ppp p@'P0p@-@<0<00P  @ppp@ 0p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``O-葟MS D@HP 0X 0p`@ 0 0[  E4/ 0 R < $R0<SP10000#10#.Q00S0> P 0 0@0 0x00 P00 Hr R0S0 0?P4/[WЍZ00 Hr R0S@0刀0pP4/pWQ" @-@ RM !R "R pPĜ\  00@]Ѝ/0Q " @-  MS S PpP$R (@4Ѝ/-4M0 Ѝv@-@000M, @ ЍLvp@- 0B\\@S ^\1  @ % e ,\'\ { d"LA!!A0 4"!! L}0 p%   @ '  pPU< 0 ER3\!@`P    ^0 B! { c\  "0  {  \ @ o% d  + {o\\:\ { cꜾQO-M  FoPP 0  %  0  S  h `\ @u,S 0   @0S *  QS%S +0B GSSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8 0 Sq 00PЍ%0iR@ 0 `fv`  00#1.R0*R0 S l@0 S[0@@00dR% d 00 @0@00 S0[  00 @@"0 C0 0 S[ 00000 K0`"@ @ 0 @00 S020 0r 0  0@ 00 Ssؑ00s00 00 00 000@ 0TX 0@d0 0 r 00 C C00 0 <0  0 @D@0 @0T0 S\R Z I00 S0   ot  000S0\S 0 S0 00 ꘻%p%c%+%c,$</>p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0\llTlplA-@0MS0D0@!0@p0S? ` 0!1!1P!1"b2cP@AL0L  00210B*P0 pW$P@WP 0fSPЍЍP 0Ѝ\NԛgA-@0MS0D0@!0@p0S> `z 0!1 ‚P P@0!0A1 0120BP0 pW$P@TP 0nSPЍЍP"0ЍkLh>C-@0MS00! 0p0S2 P 0%!`1H $@0 x 0X1@ $A0!b4!b @1c1c0A 0 00ࣀȈ(!h!bC P㈁ 0tS0cS0S㤠 0 @0Pb00< X 00u Am, NgDkLؓ>d-?L*S( A-@`p0\ %\0PpS sS lS@ 0\TTW 000P1CP0@CV` 1D!y00O-霮pQ qM PP- 00S0406 `$  0l@H 0 0S1  RS G@T l P p 4 @@T %T@%T400 R,:PkP 400P,%0p,00=0,P0 - ͟00:T T) `DV%?#"< / XT c`Dv`Vfz t``` 0`D@lQ 0>T-0p0  Tg@W -@@@C?T@^ >Tp A0Ds =R=S2t 0BXaevV.`^`0^@ C @00! Dr 2\* R:0Z'TOP ͍R'R ͍T0   R'R'Rp@@pI@[eiP 00040\iP, 000p^ Q1`!RX 0BS11`U PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#y1S 0C-11@ Q 34 00`Q,\*P 0 ᯉp 40P040`OU; 01 1`0@1O1S  0C-11@ST #Q,%*P  4 @@9AT @D=AA0@a DrQA DR3@D1@ؕ& R ?R ;RL  pR 0%R 0@a0Ds RA0DS 13 DOS ͍!!010@Sl00l0 0St00t0QU PE@=1QP OU5 =1 =10@1@10Ds R-1!TORP=1=1 @T!p1S 0C110 S@Rb  ?R ;R QeR  pRT 0%R 0 00000 0 B10 OQj }RR0  R}R}R@@ps!R =1X@ BT! :4 Q`!`10` Q,0*S 0 ᜈp 40040@M, 40,qߍ! 1Jx00@QU PE=1@Q@1OU =0@01P@ Q$-1 1OSU00PhP 400P,V 2hP 4 `V ả``&``VP``P``Ì`@oobP``V o`{`@xu`rQ AQ A QU PE=1!T@QOo1BV 2h0PQ 4 0,0S@p00@ 0 n00 @00 ' V8[`000&@DQ0VT&$#"y p ]K5#a0@0C!@DZOo0B00S0@00-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/ :A-pQ@PM 0S! XB cgP $`V! 0v0* V Uz ``ЍnpP0U0b ``U N4 0 0 R Ut @U\:]P0S U( + 噃p 0S R s0r (0 000SU00P g0 p0(0P g0 p00TU@4<# $ $ $ $ ht@88\$ 4$ # # # 0R @-MI0@S  ЍA-pPpP U) @`TV 0PS |@P0DV  CP ;oA-PR pQ $00@ `P % P P #0 ES  fP  0 000Q  0 R0 R   ^ Np0 PQVP PU`̇Q 0S  0 S o W  _0Cs0S0S  0 S Q V0Cs0S PUE 0$XPGPG "J X= $0 Ž20nP< sPJ fPZ PR00V0S 0 0qQ :%eP NC!ePJ<ePL5$ PP f$Pf eP$$ W   PP?V00S    0S V P(C-P|a@x!`pM0 + P 000S< PЍ`P  P 0 Gp R 0S 0PP  PP004PЍ 0 P @``+) P *`PDGD TFFO-M M:S&0:SSP 0`S:Spp@F T R!*  @ 0  tDmP 0P:S ۍ ЍPۍ ЍC-pP,Ÿ,M M@`tP) 0/SI ٟP5P 0 ۍЍC0P p! eP20 ۍЍCl0P 0S/S pP $eX 0eX P 0 ۍЍC0 PۍЍ p 0eYW L0L 0 $ۍЍ404 0 $D   x h  B B G-p`@P  X0@^eT  NP @\PPP P @T  @0Gwv-@-@ M00 Ѝ@ Ѝ/F Ѝ@ Ѝ/ 0p@-S@ 0  p0000  P 0 p@-@eed@dd d0d@d 0p@-PS@:pS dP!pb @-Q @fRQ ^nR sRQ? 0  \ A- @X p`fS@X P70P@ @ 0nS sS@X@@0 0 0S00@PA-P# P 00`pp0,SS00 0\,\@CbP   p`p@X b G-pL@`PP 9epWS*nUJ sUA fUH0D Y#R< @]cPF H0D@pH0@0 H0H0nUp@0 H P4 sUC fU; L00L0@P @XP00W 00 ,00 a 0S0000  0@ SH0 $H00H0H0@ HH0@, H0@0H0(PH0, 0H0($PH00H0 | H O-P M @Z p pY ` `(080H0IaP- 0@  Z0p@   @`Y@  00@X U0R@O0@ Ѝ@-0 000 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\ԂA-`p PPU@R ?bP !0峀0 V00pp   0  0 0P`O-`0@ $M 0fP pbPpUP5  VP a0P  0Rb pP|@P ;P@@aPb $Ѝ 2bb0,P pU 0$0(0,0 @ X  @@R 0 S00lPJ PUb0LP@UD0@0H0L07 pfS,  0p 0 @P PU  @0nS sSpX@@ppp Ob $Ѝ )a%a@ A-Pp ``V@R SaP A0峀0 00P00 0  0 P_0A-P pW@`R %aP 0` 00P 00 0P_0O-LM< <t+, 0 $0ppP |%@P0|0`P9 00 [PT P8:PP`PP  (P< V $0:T $0-, 9P`/ `$010#0(00S% ( .S  ROS= =Q@P 00p{< <00Q4 Q 0/ R, PraLЍ#.pP= @p@t ,0 S Q0S Q0TS$0 0000[0 P40,0-Z80 ,Z`80 R&`0a'P@@0@Sr 9p@tp00$0 0f0 PV ,`p@W 0 WP`h *\WQZZ % R ^W Rj p@W0P 0 t'0FSY{  0P ,`Z0GqPE G/R񏐀~}|{zyxwvutsrqponmlkjihgfeda`]\[ZYzWxUTSpW@ W<00p@ p00@%00  <   p`00 D2`D0 0S"P  Pd$0 ` 0SO t0 a$000  00 n0Pp p`]8004 $p 0R  S 0Q p`        04 $  #t 0 S00P{?W u 0p@P80  0B\| 00  4 0$ Z80! S0pB PWppp`+ 0$000 0s0ZP ,`9pp@ttp@t: ,0 Sc Q0S \ Q@RPaT` P00 $LV0$ E,`]P00A Pp@t0G <00QG Q 0B R0 `$0 07P$0$ 00 0S00 P $0`@0 $$< 00 00P p  P7| 0   l     $ P/$P00//Ἆ@-M@0 0!1l!1"b2cNL 0@@0#@B!A@C0OPЍ赁NLg P0`0K?//ԍ@-M@0 0 LlB N0"0L 2<@0#AB@C1dKPЍkLl>$0P00?//@-M@0 0L@N $@L0B!b!bN?AA4 1c1cL0P0@$C!d!b8A@C1PЍ-?L`*S p@-0P0M`2O@P 0Ѝpz], 0 0S Q20ЍpG-1!0  aP P@4 04 S0p0p2,0PP0  |Qp`  WPeȄpEQ  W| 0 ȇ0H00(xmp(@-@P ]]] ]$],]],00!R  !' 001/P'001P//8'G @--@ X@X0@0@0s H QPJI HH @kPp@--(M G7@` @@PR~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " k{UF{{!00 (ЍpP P # 0U 0f {kUka!00 P ~P T# 0U 0 0"{P  0cP0J30{kUk 0 iP  0cP0G20U 05{kF{{TPn  0cP0t20U 0x 0"BP;  0cP0x0 0U"  0P;  0cP0|10mU ! 0a"1"UJP.  p0cP0%ʘ 0U"  R b0cP0$d10U 0"P1"P  P0cP0$10U 0"1"P  >0cP0@00U 01"0"P>  ,0cP0@ʜ00U 0 0"P  G??kP  d  t G Lj 4  0cP000{kF{U{ 0# P  0cP0uʠ30{kUk 0 Pb  0cP0\30{kUk 03 mP  0cP0n30U 0_"3"[PF  0cP0L20U 0="2"IPO  0cP0ʔ20U 0"t2"7P  0cP0EP20U 06"\2"%P5  |0cP0 20x{U{ 0 P  k0cP010g{U{ 0 PD  Z0cP0ʌ10U 0"\1"P  H0cP0H10uU 0 P<  70cP0k10U 0\"1"P_  %0cP0&00U 0"0"P  0cP0ʀ00U 0"p0"P   l  L d | x T GH 0cP0(,00U 0"@0"~P  0cP0l00 00U"- lP  0cP0ʰ00 00U" ZP  0cP000*{kRF{U{ 0 EPn  0cP0`30U 0q"3"3Pd  0cP030U 0"83"!P  x0cP020U 0"2"P  f0cP0Wʔ20U 0H"2"P0  T0cP0HT20 00U" P  B0cP020 00U" P  00cP010fk{U{ 0y P  0cP0ʈ10U 0"`1"PN  0cP 0<10@U 0% Pc  0cP0Z00U 0K"0"P  0cP0ʸ 0U" 5 ~P  0cP0qt00 00U" lP  D GL $ h ǐ 0cP0_(00U 0P"<0"DP  0cP0h00 00U" 2P  ,P  00{kF{U{v"00 t3030vx30 3U"c"00 aH30@30 3U"S"00 Q30 X3U"F"00 D20{kUk9!00 72020 2U"$)"00 'x20p20c 2U"!00 @20} p2U" "00 2020 H2U"!00 1010$ 2U"p!00 10b1010 1U"G!00 `109X10k d1U"!00 (10 01U""00 0000 1U"B!00 00400g 0U""00 00 L X   < D ,   d 8  T H T 00U"Td!00 bP00FX00`00.htp00N |0U"K!00 I00{kUk;!00 930 3U"."00 ,30{kUk!!00 X30vP T3"ZI aI  3"U"00 20{kUk!00 20{kUk!00 20S"00 "00 l" d" A  PI : S@ "00 "00 !00 !00 kk!00 "00 "00 !00 "00 "00 "00 !00 kk!00 "00 0Si !00 }0S2 w!00 u0S o!00 m0S g!00 eP  _0S Y!00 W0S Q!00 O -DT! @D  4 0S 9"00 70S 1!00 /0SO )"00 '0S/ !!00 0S "00 0S !00 0S !00 0S !00 0S !00 0S !00 0S) !00 0S  !00 0S !00 0S !00 0S !00 0S !00 0S !00 0S~ "00 0S "00 0S !00 0S !00 0S !00 0S "00 0S !00  3H "~P !H H  3"0SIg!00 e0S _!00 ]x# cp# vT"00 RO"00 MJ"00 HE"00 C@"00 >;"00 96"00 41"00 /,"00 *'"00 %""00 I mI "x2"2l0 02L0 0w 2,0 0n@2 0 0e\20 0\820 0S20 0J10 0A1l0 08"1L0 0/K1,0 0&!00 P10 0S,10 0j10 090 @@0 L0l0 0? ǀ T X x 0 p ` P X x @ d  H  X 0P0 040p0 02X00 0|00 0`0 @@0 s0 @@0 100 0u,1P0 0z,P1 @@0 mo!00 10 0_!10 0V10 0MG2 @@\(0 @82 @@OX0 3l2t0 0*20 0!+0Op\>0U) 0PEt@T7p0pp@$>00Ss o=0000CS 0S =007s@ Q=0 C0 0,0`S P?N?P?<<5? M? Q?H?A?L? J? h C? | iB 9?:?;?0@\,( @Dʈ+7~N82q@D0 D0B$0Sp0  0p2@0W'8<#0#w[ 202HL0  200@S2D0u po 0S3q0P0;T02@D0 C<3q@D07s0D@C s P5l0{1r0ರ^l[PEt@[UxR!B"0$ 8 S0l00X0S>0p0P0?0X00 p0tP \40t (CQ @m 40e@ 0p040I 00p`40T4l 0Z[pPEt@[jU" 0C00Sp 0 000(1 T*U $((U^ PEt1岐@^ Ԃ 7sQ0D7{D @C7s0D@CqD<6L0$ R'400  0q@x6p0@ 0sxp0@+MP7s@DZ 0ಷ@D'q@p6l000` 0 0P00p0P0 Xtp0(0$P$(0/ 70( 'r0R0S(07@D0SR: @3 0@|008@0I80y 0s  \ p T d \ h tP |80G pC=0S804p@-@ZPP80S ($03/$0(3/00pPA-@`BPP@p0 QR 408 B4 08@V000PA-@`#PpP 0R| S  +P00S  : 70S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000P@P`P-@ R2Q <001 0 0S!B<@0 RD R  0cPࠓ^ S R5 0 1 Ra @ <00 R1@ 0 <l0P\p\ G R R0c BP  R S R 00S  0S  pl0Sp0p0Cpp0+x0 00 0RP,040p0 x0 0 0 30 Ѝ0l0S  pl0@@@ ꫄#S???!P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-PXPx@ 0!(`3/PPu 8pWG  ( 0(3/pP00@c  Q 0  \!#P S>0R:oRS B P T  B T p W0Bp3  (08#8pPp  BS>00p000@ Q 0  \ P S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰX 0C0 0$SQ $Cp0`0 sRpW-0 p  p0 Ѝ0` R`V40sCJB 0|<J^S20 b6 0s0^0X 0 C∀0S 0SCXP! P( 0 ! 1T2 0! T 0SЍ0W0T0S Ѝ0D?o 240%R00S020,0@0000,004@0D?o280(000 0 0 0C$0PU?PU@PUAP0UAPR@oPP 0C R R0 PR \:0S@\!v!w|U!1^  RX  `\h$X  `\h, Rl R O- M`0P 0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPH/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S>00000 S *S0SWq00Q 0SD0@S>P0 W0Ss S00W0 00#400 03 0  0#400  0 `0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000. R0f9S ?0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E000S ! P B R  PE[ 0 X0 * PH h0 ,0 SR0 B00 0 0 0 0 0 S0 S00ӈ R01q 00 D R}0ES IS= [S8 gS8 40S0CkWi D8 RC0SS@ S   00#  #800#"0    ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S,  Rg00 0 B000,0g  S  0Q0u0S 000#40}0q00]0SZt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SWc :W㴖K 6SV \0l S 8 B0 l0\000SDI\ R8 C0 l0\000S7 xZt0(l 8`R B  ^C 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l S/t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [ KoP᫲[@ `P``0P0@&ƅ&s0(!ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0<00S=p#  #800#"0 00]$B 0.0c*W6F &R< \ R80l0 C;0,0|K 0 00 0000 B 0L0DC0C yt0S*l0\06\0l S 8 B0y l0\000SD10,\ R80l0 C97531/-A-`pPTq@PG Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0 `\p# 0S%t l00\ R6S S L D0 BC 060@! Rppp@-@.PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ 2)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOzv `fp00$0`(0 } Ѝ8 80  000&$-M 0 BЍA-P?PUPr0 `0@ 0S  00 0t!(3/@PU \!@ 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/O-Q$M R0  x 0S!q"$!@P`p,ß 0+0* @$)z0(!y0qx0a{0t0@A P1:SuPQ "9SuPQp'8SuPQP`&P5S>3s0uP1+@$ "@QP0 Ÿ " rP"$!!! q !P!"  " " rP"$! ++{ !Q+" @$ $ rQ"$ S4T@QPQ@$t@a@Q"$&P%uPQL"T% $r A Q%D$ "r Q Q$T% "r A Q%D$ "r a Q$d& "r Q@Q&T%@$t@!\%$"C0S 0!q^"$!$ЍP!AQ1C1@`puHh C-PRp ` P  0!\0 0#@B .P@18R0  C @$' C-PRp ` P  0!\0 0#@B .P@18R0  C @$' @-@Plp`hPp@` 0!đQ0 0#B  0 @-@Plp`hPp@` 0!đQ0 0#B   p@-P04`^00# @L P%!p G-pR'wph Q RO SRCW-o`VA0A0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcV V-2Q0 pGN0 Q"R 0pP1W1|G.7&c2pG0N 1pW|GpG1^NNQV=F10C>@AP  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0A0C 00 pP80'7b"c2pGNq%R&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /qR&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /q/Pd U/0S0`0//ᔻ 3566@-S k>@@0 #400k.06S0k. ς 1O- p:PTU0!`Q`+ṐY* V@ : U @0ς!\KU V*  p0Q=0^QQ [ 0O-DM PX%@QX 0F  u pGjP0P4 \AB\S 1vσ p P Q-0[P4尐&G B&Sp  @  ipWPQ=00ද0 K`{P0: `;VT`+0I AX{T4T+ pQ}Qp0W20|q~6x `00[0` IT$P0>0 0@00 0p^0 S[0 ⵟ0  !  W X SA ׾ᨦ [㑢* & "& R\+ ೞLY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00U0 0S@\ R @02^02N00 R0@\DЍW@  yP 01LX 1R 6 G2#6pP^p N j p=A-`@PT1R`QPE0+~PT S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O-` MVPPR@ʀk` W !.⾐ἠ i5Rs0( P000P#406IP0cZ3s0V⾐5s0iS0P⸠P0%TPVIPeQq BYr 漖P9s0000P#406cR!0C 6Vj VPT@Q p` 0F?oR20S RV0XW R+}~ʲᰐpj5WPs0pPJs000p0#40vPpgYww0 UVA5Pps0k.00P0p#406VPcQ 0C6PT@ Ѝ Br 9 kV0& PPQ^`徠἖0`j9Ys0`J 0 00#4 0编0iQq0  R0἖`g)0 6b궐pi5Zs0P000P#406I0cW3s0 Y㼖P Ap9s0k.00P0p#406VPcQ 0C6PP) P V# Br 5 yO-ʀ6knS㼖0M #P  #  # #  #  ! A@b9 Ts0@p000@p#406 B0c^~00἖&R @ P$ pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಐApi>Xs0000#406I0cWsw0 0@弖^ `D Br @n9 Ts0=@p000@p#406N0cR#r0&0R἖f b9 ^s0 @Pk`0`00@#4PP0 B0`Qq0 k0&Ѝ0἖=0἖9 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I( , &&蔩A-@ k΀`P s0! Qr p p "$  aS2s Ak> ,u 0  u0#Ġ  <##4U0 0 000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ M, R 0p&]P+&(+#0N  q/ ! R7@P j   Q&Q3 "[q6k S ;p3 s0000 #406 cPp 0Ck N.V6 0G. 0R0 0xS0   0LSZ=00IX  &&0 Ѝ  \ R+R +R ,RE R  Q ,_ R3 "&][Pj 0w ЍO R \3 "[k. Z0q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦|qk>0#40缦0j\3s0 J Z㼦syzk>0#40缦0j\3s0 J Z㼦T@|qk>0#40缦0j\3s JpM⼦k> / ! Zq ! 缦jR!r JPἦ L I  Q3 "[F@q:sy:s0:s0 r :s0]q#r 0  t:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  p0S A-P p@0 C`0@JTUT @-'P s&/@- MP`p*@P @۹ P Jp . @P  Ѝ) 0@0 Ѝ"@ Ѝ0@.T  Ѝp@-P{*@P @婹@p 00p@-@j*0P 0嘹000 00p@-MP`V*@P @ @價00 0Ip b.@Ѝp׿0@Y.T п@Ѝp0p@-S P@0 C`P0@tIT 0 p&0P@p%yara0p@-S P@0 C`+0@OIT 0 ph&0P@p%tcid0S p@-`@0 CP0@*IT @mpp/0S p@-P@0 C`0@ITp,&(0P@Kp/k%yara0S p@-P@0 C`0@HTp&(0P@'p/G%tcid0@- M P@ Hp  @P Ѝ0 @ Ѝ0@ Ѝ00@- M P@ Hp < @P Ѝ0@ Ѝ0@ Ѝ0yara0@- M P@ Hp < n@P Ѝ0־@ Ѝ0Ѿ@ Ѝ0tcid- M} Ѝ- Mv Ѝtcidp@-@P%0PPptcidp@-@xP%$0P p00ploobp@-P`m@P  0@$p@-@V@ @-@P@% @-@J@< @-@D@X @-@>@t @-@8@ @-@2@ @-@,@ @-@&@ @-@ @ @-@@ @-@@@-@@@-@@)@-@@>@-@@N@-@@c@-@@q@-@@@-@@p@-P` @P  40@-$pp@-P` @P  "0@$pp@-P` @P  0@ $pp@-P` @P  0@#pp@-P0`P @P  0@#pp@-P` @P  0@#pp@-P`n @P  0@#pp@-P`\ @P  0@#pp@-P`J @P  0@#pp@-P0`P6 @P  0@#pp@-P`< @P  |0@u#pp@-P`* @P  j0@c#pp@-P` @P  X0@Q#pp@-P` @P  F0@?#pp@-P0`P @P  20@+#pp@-P` @P   0@#pp@-P` @P  0@#pp@-P` @P  0@"pp@-P` @P  0@"pp@-P0`P @P  0@"pp@-Pn@~#(0P p<0P 0pgntsp@-P`@P  0@"pp@-P`@P  0@"pp@-`P9@I#<P pP U patadp@-P`m@P  x0@q"pp@-P`}@P  f0@_"pA-P@#X0P pW(`P  P `*gntsp@-P@"(0P p0P 0pgntsp@-P`9@P  %0@"pp@-P`-@P  0@ "p@-@R 0@"p@-@ P"$0P p00ploobp@-P`@P   0@!pp@-P@P "!0@!p@-@ @) @-@ @@ @-@ @W @-@ @s @-@ @ @-@ @ @-@ @ @-@z @ @-@t @ @-@n @ @-@h @ @-@b @! @-@\ @/ @-@V @D @-@P @Y @-@J @i @-@D @~ @-@> @ @-@8 @ @-@2 @ p@-P`@P  M 0@H!pp@-P@P  0@8!pp@-P`@P  + 0@&!pp@-P@P f 0@!pp@-P`@P   0@!pp@-P@P D 0@ pp@-P`@P  0@ pp@-P@P " 0@ pp@-P0`Pm@P  0@ pp@-P0PZ@P 0@ pp@-P`I@P  0@ pp@-P8@P 0@ pp@-P`'@P  }0@x pp@-P@P 0@h pp@-P`@P  [0@V pp@-P@P 0@F pp@-P`@P  90@4 pp@-P@P t0@$ pp@-P0`P@P  0@ pp@-P0P@P N0@pp@-P`@P  0@p p@-P@P +0@pp@-P`@P  0@p p@-P~@P 0@pp@-P`m@P  0@p p@-P[@P 0@pp@-P`J@P  0@p p@-P8@P 0@rpp@-P0`P%@P  c0@^pp@-P0P@P 0@Lpp@-P`@P  ?0@:p p@-P@P y0@)pp@-P`@P  0@p p@-P@P V0@pp@-P`@P  0@p p@-P@P 30@pp@-P`@P  0@p p@-P@P 0@pp@-P0`Ps@P  0@pp@-P0P`@P 0@pp@-Pl@I(0P p0P 0pgntsp@-P`@P  |0@wpp@-P@P 0@hpp@-P`w@P  \0@Wpp@-Pg@P 0@Hpp@-`P@<P pP U zpatadp@-P`@P  #0@pp@-P`*@P  0@ pp@-P@P L0@pp@-P @P <0@pA-P@X0P Np#`P  eP `/&gntsp@-P@}(0P p;0P 0pgntsp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@|p@-@Q 0@r@-@R m0@hp@-@0 P %%p@PP#0S  #p#0|H@-$@@"(HdyP 0R @-P Q o// g g P 0 t@-0 h! D ! @-P Q @@ @0@ f0 w( (0( g0 n h! 8! l! ! 0S p@-\@`@@ PPpP p@ 3 wwA-P`p^# "@P  `P `ppk"P` b" $Z" `$$+\wEp@-P @`iPpP p@@- "@P $ \0 0 0 @vA-pP l"@P"  I0 0 0 ̯P["`P  )` P0 000 ,0< >@u$  ` /@-@P @ e 0 0X ⦳ t  }-A-M `V $P0 PB@P"pP  0PB ;ЍAЍ/ЍAЍ/ 0 0t s  ( U @-@P [@  0 0X X <  }p@-@P x0 0 0R0 P!0P Q $ p@ppsha p@-@P `0 0 0R P!0P Q # p@ps` P/0 0 0R /rP/<0 0 0R0/P///trt` 0P @-od  QP  QQ #/r_ P/ 0 0 0R/q@-@P \0 0 0R  =!0P Q ~#00`q8_ P/00 0 0RP///p^ A-PPM /o00 0"P R Ѝ R0 p 0 p `P 0 S  R H  A pP` =#  00p4 ^ ] A-@PM 0 0 0R ЍQP 0 2 0p `P 0S d P A pP` #000( (0( $0 o3 ,] h  ; P -/o<0"0 0^ R  R/nP/D0 0 0R /@-P XoLn<\ P/D0 0 0R /@-P Aom[ P /ol00 0"\ R RP Q # Q /ml[ `[ fP 40 0 0RP /m [ fA-(0`SM.P@U Ѝ P0zP  pP 00  0lP* S'P0S0"Q00 @P X 0 0 0 @Ѝ( TP $"kd P 00#0 0 P 0S S R/P/ R0/@-9 @ Uht9O9p@-0(MS- @{ S  P{ f@` `YP rP (ЍpX  (ЍpD P { G@(0( (0 հ j  |   $@-@!x8@-(@@H8i@- M`p@P0 P0P!s*0 00 Ѝ0"S@- M@pP`0 `$qp 0 00 Ѝϲ0"S 00 S 0 P :\03#/S 0 P \0///A-Pa`a~ᥬ@P vr(pP  eጬ@P ] ֬W@Q, ,0, (0 d6 lg   M 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ xЍ00@- @PM  @ jЍ00@- @PM  @ \Ѝ0@-@P ,0 0 0R 8e /P/0 0 0R / 00 !S R!* R0:/-  ^0 : 0P0*  R*/@@/ / dP $0 0 0R //dP $0 0 0R //cP $0 0 0R //cP $0 0 0R //\cP/`0 0 0R / 0  \*s00/S:$cP/`0 0 0R / 0 ɓ\*s00/ S:bP/t0 0 0R / 00  \ */- ^ :S  0/S[ p,p0 S S0` ` S S/S >S S 0 S S0FU0 R߉P0/S^ 0(00>Sa S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p0 0 9 S =S`B`0"S0S   0"R R  "RC$ >R0 W0(00>S` 0  $ 0Կ G-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R"@ tR Ѝ mR8 pR oR sR ;R'@ ;R<@ tR ;R>@P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮otfe"R /R@S00S@Ѝ!1 0 L   0OPp 0 +r  RA*0 Rf \Rc  uR_ 9PZ +r PU6I %"". 0)p" " <,  0   ,0     SPY& Yy  ͕)   0)#<  Y,!*-"-    )&  w, 4G-@`pp W W00 GR0SWL 0F<0W0PPF <W0@@j\r\\p 00 S S   CQ R<S+  P)   P#  P-0@S@S -S 0@@-S0>S @ 0R@0S>S 0 @>SSS @@ @dP (0SP  R @+W' W0S@@m@PV` :P @P D /P0S $+ BG--`M@PX ,2ppO .4pO 0PH h``S`Gp0!  ᩐPP2u3    p `3Ѝ&  퇐PP2u  00 L0up3`{2 Ao/A-PP AP`p @@Pm@@@P p4.0,p0P4080<0EP@-@  $@-(@@ ⽣hD⽤@-@ @O-4@T p`, ⪤P @@D¤@`T P礀Qㅑ@0@ @@0 (PZ PZ P8ȳ L @-R 0P< P 4Q ,  D D0D )0 , ,0, (0  0S 40 00$ $0$ @-0 ⠥= 0 4 @-R 0, B4 P @ @ @0@ <0 Ⅵ, ,0, (0 |H H$ O-80M@ Ѝ@p`# PP @ ` @ЍȒ j ⯡PP0 004QY  4 R] ,剱1Qw  ᚢ P 0YIW  B B!,0 P 04 `<0 04 <0 PP,UN<U8U+Y& 嘡 @i P 4 [PP) _ ,0,S<SS> dP\ @ ,0P`<04 0<0x<X !⋍,0P ႡYP {,Dx x0x t0F/Ɽd d0d W0,⨤L L0L 0 ⟤ X:p  \t2ԩ (P ,p@-@PPH0S L  Q <0 0 p@9 0  0K/r9 xp@-@P 0`0V PP l l0 0  0@S0<  pPp( (0( $0K/D8 ,D O-0@SP MR z`40SM x `P@ ЍmP pP 00S 0q 2 00PX 0S. @0R* P# [` 3P 0P 0S 8P' X D` ЍOQP 0  03/P  40R 1#PP 0 0U/Ⱓ^ 00C 0P `N@zh h0h d0U/◣T T0T 0]/⎣7 ,7,`6 p5  l d@-@ˠ0,S<SSL 0  0 b` 8PG-U p`0VRV@P7 404 S `  S` D000,0 100,0$ 100, ,0P ?o  @ 2\0S0S P`P :  404 SS`  `D D0D @0c/0 000 ,0c/3 ! p7G-PS @- Y`' T 1p 0R  R P 004 00R% OP ? 0S 0 GUd d0d `0i/⫢0,S0 000 ,0F/⚢X2 \1  G-PP' 0 0R"A4P 40S @,0aᄑ1p  ,0`p40@T:8 408 # 10P 4  Q@-P80080/\0p@-@P80080p@p@-@P 80 0R@ pP4@p/p@-@P \0 0R@ pP`00S@#:p@/p@-@P@pA-PP 0 0R4p`40S @40S ,0 P@b `.A-@P 0`0VpP0S ~P @T @ @0@ 0]/⻡@@sL. A-PP /o0`0"Q@@T @0R pX K@P @T M@ 0  0]/⁡-8 0P \@- ^ 400\@/ 0  0F/b, 8 0P o@-x@ T\ @\400\@/ 0  0F/9L, 8 @-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0Rp@ S*,P$0 B!ʼn400C40<00<0{ y h h0h d0s/T T0T P0s/@ @0@ <0s/ޠ+ puК Lv (w P/?o0 2 R0S/0@ S/ *0P -?o82 ^0S 0 SV /)P/0 0@0R/)P/0 0@0R/X) P -/o<0"0@0^ R  R) / ) A-`P @PpP (0Sp0P  pA``( `=D(O-0S@9 0@S7  ` P. X8qPp u P o P @i P HXP0UU@U !#10< ,$V P?@O 0 s0 X% XP0@#r 1 PP l l0 0 0@S0<  pPp( (0( $0 w<@ԃ w0G-S@PK Tp# 40SF   P@ P P 00S 0>P7 0 03/P0  40R 1#P' `P 00C 0dP  @ꀐ pG \ \0\ 0 8 808 0 P\( P4 40S 0C40/ 0  @-0 댁 0p@-S `  Q P@0@p 0  0 Ù< мip@-@P 0`0VPo0S R <0 0 p@bD D0D @0 ⛙0 000 ,0 ⒙d 0x@ TwG-S *X@` V 0P 0R `00p *V` $V 0S  Gr@ @0@ <0F/QA0,S < tPA-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p @-P80080p@-@P 80 0R@ pP0@p p@-@P 80 0R@ pP4@p p@-@P \0 0R@ pP`00S@#:p@d p@-@P%@pp@-@Pz80080p@sp@-@Pn8@@@ipp@-@P 0 0RP`[40S ,0AT Rp@p@ 0  0O/℘` | aA-@P 0P 0R@ p`-8040S ,0X <0, 0Q<0@@>@D D0D @0S/F0 000 ,0S/= { \$z Lp@-@P H0 0R@ pP`@pA-@P1 0RP`4P%80,0!qW&  P  1P ,0P < 0@ 40< AiAD D0D 0W/ޗ, ,0, (0W/՗,py Ly 8`0P -?o82 ^0S 0 Sd/p@-`P pP@eP (0S p@ L C 00 //@-TP0 p0 |hy O-IMP @ @T p `0 R 2/0S\ P Y  9/0  paPV @T!1 0 N003/Y@ 9/T ST T @T@" 000Q 1/0S' P70S+ 03/P. Y 9/S@T 0 0(  0 0 Iߍ 0 0(  0 0( Y 9/Z 0 03/X X0X 0( ܖx w سtw Hw X$w t4v 4P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0BP 0 $ \00 Mߍ0 000 ,0H ^ R00t D# 0/0/@-@@'A-PPp`M2 0S/ 3@0U  UU 0/P B 0CU/PU  U0 0 B/Q h!0C@T@!  o;@04D.0 0  R0* 0 0ep@  V K0P !@CPۍ>?00@ۍS0 p !`!H p  p !0P@  p@-R 0@S PR :   Pp0P  , 0`0` `90 L0L L:0 808 8;0 ph,r x r Xq 8p@-@Q PPpQp@-0 MSP@`PA Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPU pp 0 G$QQ Px, ,0, 0 ɔpn L8 0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@ W,m p#0p@-S+@PPU Q PpQp<{Pp/tP PQ lP Qp@>c 0 Q0` 8l |0p@-SG@`PU Q Q DP<?Pp PU Q 3P QPU Q &P QpPQ P Q/P p@>  0 0| “j 0cA-PP4 Qpp0` XpW*7@P&  3P <V`p p0 8/PyPv`<``Q# PeP P 0S #P P PP@ @ P P 0 j 0p@-P@PP B P᠕0@"뛕@p {z011/A-\@`pP \1S 0 €  P 1P1 `p P 0808 8A0 $0$ $B0 ؤi h Ф@-@^ P ^%QRS  T00NQRS"  TŒ 00 0 Z0 h 8ԣG-@R00QP(M P 0 ` p Pl `B0T?o20S00(Ѝp`0 ̣0     Q /0     P /0 2/ / /    Q /0 2/ / /    P /p@-@PP`(M/ 0S, R00&$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0GW P0V00(Ѝp@ R 0S V00̡0Q000 00/@-@p00T0005@-@T @-@T000 000S/@-t000 000S/@-t000 000S/@-דdt000 000S/@-Ǔ$t000 000S/@-㷓t000 000S/@-㧓t000 000S/@-㗓dt000 000S/@-㇓$t000 000S/@-wt000 000S/@-gt @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#x 0 01/ᘹ001/x0 01/X0S@-@1/00/p@-P0P0 0@0PS` fPppt/@--@-,000 000S/@-גdtAo//0@-p@P M 4 P Ѝ0 0 ;0 ൐vtܛ4_ @-p@M L P pЍ(0( (;0 wt@h^ 0@-pP@ M T T T  0 Ѝ04 @| Ѝ0 0 :0 otĚ4^ p@-@ @ $d 0 80 Y^t l] p@-@PP $P(Pp0 70 Dꌤ] p@-@PP (Pp0 70 1@`] p@-@PP $Pp0 70 $] l@-@P  Y.<+ < 00 ;0 |\ @-@P ( 0 70 (8\ @-@P $ 0 70 ݏ$L\ R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@K P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pϊ80 0 @  0""048# /UUUU3333  гp@-PQ@ : Sv P Sd0 V Sb0?0 r-w - 0!= S [ 7SJ @Sx00 r-w-0  R< R7 Rx 0 r-w-8!@ T. T( T0 T x  00pRs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- A0a0-0$0$ $90 bulpV O-8AP@:  ᳈pPA ىPA  pP% 00絈` 0@T' gP0=S AP` AT BX ! 뷉ᑈD0D D>0  900PП@U C-@``"`2`M 0P$DT@Pg p`XP \@`@d@h@l@Xpk p p` o{{o{$P  {Gp[ p0 0S08@R0<@@@@40040,43-5-0-5L1L0 00D000C,X  #Џ0S pp@ 㩏 㥏  Ѝ[oЍ @꬏0 0 ㋏ ㅏ く ВВВ O-PMp 0GW"S00`0v@AP-TPg +T@`0@ ?  0ˈ0 Ĉ P p ! @00Ds \a0DSW0DA0DS"70DURX : QP   S  R 4 "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`00 R0  Ѝ p p᠀堐 XR A B0A PR W @ 0`H0H H?0 ୌOW p pmꙙO 00 0M0Ѝ2\/O-PMp 0GW"S00`0v@qP-TPg +T@`0@ ?  00  P p ! @00Ds \a0DSW0DA0DS"70DURX : QP   S  R d "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`600 R0  Ѝ p p᠀堐 XR A B0A PR W @ 0`H0H H?0 ݋OW p pmꙙlL t00 0M0Ѝ2/O-M8@ @> }}_4> T}}= X}}= }|a8`= Lzx|< ; p; ; z: yyxyw: xO-pQ ` V 20 R" P@T60帢 R01-[@P-T@PA T"lRPP %yP? -@y0P  :R7 $20 0S" 000PP@:T0S! 000100S 0:S  0?@0S|1 0 0@`P 0:S  X 7 0100:R@ 0S ^ 0P00P0 0 0 R0 5VW0 S0 +NQ0 0 ptvu8u0uttvdt8tT`v0ss0u7 uu6 puTst@-@P @ p0 /0 (u6 ,u@-@P @(0( (/0 @~u5 u@-@-Q Q Q  Q010! 0 0 0 0 S r0! S L^ 0r0!# ^Ƈ00404 40 `븇T00t,5 ts4 sG-P @p0#03w0q0W`@DT@!   0R ! 0 4P   G;0@ pQP@-pp M P@P `P# +{0 @p{0 PP  ЍT00PO0`PG`D0P`>P|t0 0 XW(-0   Xc(p@-@PP` /o"0p@ J0 40 ބpq1 tq@-@P 0@ I 0  A0 Ȅ1 q qp@-@PP /o"p@; I0 60 ఄp,1 p@-@PM 0 0NTPЍ0 00 p0 p0 p@-@PP U {00QUPQ{p z00QUPz00Q0 /0 fo0 p1R ! /A-pR P@a@T T 1 !03/pWG /p@-@PT 0p@/pA-`Qp@P RwP 0开D00p 00$`,@(P0RD00A-P`ph@PB 0U0" V W- p`Pp`PFP, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`P00z|dXp@-@PPM& U 0`1S ,0S ք$0S τ pЍp@0@ @<0 (0( (;0 m, ll, l@-@P 0S$ y0 P @0P 0 0001 1 00y404 4<0 W 0 Tk+ $lp@-@PP% U 0`1S ,0S h$0S aIpp@0@ @90 $(0( (80 Tk$+ |kdj+ Xkp@-@P y00CS00 Pyp?P0 70 il* j--M  GЍ Ѝ/ -- M0 0[G ЍЍ/0@-0P$M R~ P0@S&  S$~0  B!  0 $Ѝ00x~ L000 W0 PS@$  e\jiLeP 4000S$/00//eidPiC-PRSQU x0 00!0 0$0(00 00 OPLQ PA,@K@kj@0 @免 !0 0 L0 306TЍ 0 P 0|V 0 P 0|W 0 P 0|X 0 P 0|@@ X~@&hT !6*wTt t0t 0 3wUT T0T 0 (wPy 0 X hD D, _C DCO-0"02 0TMP0L00`w Vk 0  00 0 0 !8 2XPPP @p1000 p@P< 0+S+0S((P,00$00 0(P 0$U,$u,0Sp2 0 0 L0 30*TЍ0 :P UPs2x00h h0h Y0@ vL L0L X0@ v} <lCJdCTCؒ <]dA A >@-!1 0FM M@P0d40p/ `Ր /PPd@"+ P w0@1w @Rh \0 0 d4 30Fލ Ѝ4 404 N0 qu뼎 ==@-0 0dM@P0\00p` Pᆐ ᠐TX P0 0 \0 30 dЍ0 000 h0( =u뀍( =<88@-<@<M@ b0 FЍDS<0P1Spp//0@- 0 0M@P000P( U!  @0@  "" 0S0(0p d0 0 0 30Ѝ0)<PP000 0F0 t14 0;H ;G- M砐 p@ U$eFP'0G W09pPUo0 ;u0+ ,@P   U0 U v0P5vTP v0@*v@  nx p0 0 4 30܍ 0lQlp xP|` 0- M Ѝ@-0 0dM@P0\00p` P .X P0 0 \0 30 dЍ0 000 0 0tL 88O-/? 0M@Q000 L 0ST T@@P 0\@ ?P `@ %   " H l%T!;d Xp\<@lA @87lA$` @b 9 @nM aDP,dPlb!5_L`h`:b.͌6o+(d! P% PPbQ pP5_l & d!, p' )``d!" t` 6o* dx@n,4O-p'`pp%nQ (pPp pnQ%P|p !7( b n ]>a,$bA!,@bA$͌e!@M l8+,`&'pbq p)7 +0.).4o&e)`` `e.d)` !6o) *", $*" *(((e8P*+/+ ( ,"* " 4 0/"*p'*''`(pdq p dq' p0 o& o&o&( `n da(@} (a (,nA!@o͌`nA$g!@ oMnal ga,`ga&$`_?`/%/",`!g1)p`_%!`_%_%0`/"!! d, !:`PodQ `P%P`) n o],daa@n!o`,o po&po&   (M `$oe!na `4.+`+,͌.. `dA.( pea$ `& `l$me.`_l P!_O%f _%)_%(O$_%0P_lQ_%$,,_%O$_%%Pnf._P*ᝉaQ.魊i P%쟃4f Poa ` )` o.o&.o&,`$`4p..0pp]j oaa.o&p!!(o&o&,坉o&eQ`ja%p `&`i%j篃m _n/%i./"! " p _%_%p/% _ f!.iQ " _p%(4p0_%_%(`%fQ 쏃P%-a P]$pb./f!`(a!( "?a1/,"''p!+p/"+0p/"p!/"  m!!8e( &f1e1fq p?0nfpn10}eP`1n1`?f1?O#O$$,@`?#?#]?#$04g1`1ga`?n1`0. 0,?,.,..eg (eςm` ae a捈ςg 0pfa fςe Ϡ8pO,O$O$p @,,(@ ,Phf hA@ςa @!$P,,!!!`h`M fnQ`Qn_͌hQ`dQpnQdq p_`Q,` *`8*$  `plQ dQl_nQ.`)o)`(`.P}..aQlQaa `_dQgAaA`gQPOmlA P`AgA` OaAO!O$O$,!]!!f` f͌菂gp''((e '',peqfq`qlqeqlፈ$fqaalaaqpoea`(p_/l!'%0))0+ 0'+0,_%_%_%(Ÿ''韌$< h1 a10h 0m`0韌h! a " =f 韌h! -c1f#韌( 蟠 )(((돌 )))p菌pfqob1#0#0&a''ppꯌo&bqb!! "= `!-!c1``#O @ b1# 韌0#abb!!,p뿌0 "= `!-!o&c1`q `#$ b1# 0#abA_0b!! ꀈyZnܼbTwt'0 t'' H'=P "`!p !-c1(@``# όo&b1#@ 0#a0pbb!! "0= `!-!oc1`a`# @ ͌DP nHbb!# "`L m0!01 `0 0 30ЍH1H!H0 o 0Sh1h!h0 o@-@P 0LL LHH  004 404 0 o#EgܺvT2è 0'&A-PPp`8 W, 100.!0% "0 ?0%0?S@@h pR0hS@H"#p ` *H0V@@p`F ApH H0H 0 \o, ,0, 0 Ro |%%h %%p@-!1 0MPP0 00@A TJ R00 113R0 0~? S ``4` 0~? S |U PE0"0 1<3R0 |0 0 0 30Ѝpd d0d `0( nTH H0H D0( nB u`% t $($ L$#0@- 0 0M@P000P( U!  @0@  "" 0S0(0p d0 0 0 30Ѝ0)PP000 0F0 nHsT rD" 4#G- MM砐 p@(U,e P'0H W0:APUo0 ;u0+ @P   U0 U p0PpTP {p0@vp@  m x0 0 5 30܍Ѝ 0fQP.p pP|`,rq 0- M Ѝ@-0 0lM@P0d00p` P" +X P0 0 d0 30 lЍ0 000 0 mKTpo   0{,!0 { / #EgܺvT2O-tM0@ @P 0\@ 0 H @&0 40 h& 0,80lɉf+ 0 " (<0h+`,h;!@DPafl;"f0#R0XD=\`;@` Pb! P@$.@n dH@la[#l˄h{P% PL\b[b+c.,P ˠaˌan+% "T cf c;e+, "0X 9n;nl+! " \b)e+e[a#.P`kKXl[lˎc". dnaahpŒȌ̌ p' pb%,h̠cˌc;L{    (he . 00@28<0h; @$g@Jf;l@ b b+@ j $!n;,0#0@/`cpmvmzNS3hˌe;# 0͠T0+>C3C7Cg; )0隠c{n 0  k{Pct0fˌa" a(f `hHekb,b(e P]@a[l&al( h4bf%bf! L+I pᕓI嫗Ik <ll`` +LLd e+(Ldˌ p'e+" p g|nˇ\pb)f+ *h! ph,f{`8+LLLnˌ ꩠkˊ i p`Kfileka" a,eP @0e]h[ $bK&@hˌbK$ @dIDaKf%aˌf. n`be$be(p苠8fd.  f+d,dlʠeˌgn{( pe+n{'XPp"` k+`fjkkf{d{g,Th+, dh+" hP+AAAkP%P4]+AAA`[`Lb*n+lK')@n lK$ik@*XMhKg"hg.h 0ll;Xd.dˌ@e nb$ b,l̠gˌ,04p (llphbb+Dpl0h{,p+>Cn{,p'3Cp7Ca;}d{0lK(0@$@dJL0nKd;0h;'0# 0;l;ࠤ< ak g$.ꩠk n8hnˌP+LLLkˌ ` f "( P`+(  ,`+ j+gd#, ͠gˌ\p +~GsGwGf{`k芠c{.e p' phhgyd{g H "+@@@e b,a+P``&dnK,`@$mjk @Hj )dMcKl 'c; ` <0n P`g;$0#09ll˃T00l[d; 0#a\0gda{`;,0# 0=d;$@ cKhK@(@clK!@$ @H`K d b a+# " )l+c;$0#0:a;dK"b+  @$@0䊈i= 0tЍG-`p 1?P10@@e00T0U?W@@0@W@0W*TP(@T(pG  GKh  Gh >0eW*0@-P@  M  1?0 @ cR c B T 0 E,̠P,ĠD 80 0 0 30` Ѝ0@g1(Td |SQ1. 00 R<. xB@-d 4@4  R  *4 8/3 x0 S\ R `0S Р@- d@ 4 *8/0xB /*(0"8 /:$& /--M  HЍ Ѝ/0  0c x 8q8pPb  b` 0` (`b0PPP#Paa` 0`(`a0P PP 0daalЍlЍ'H(0( (H0 el<@B,< @- M`]tqt1pP@P`@@T 0Q P Ѝ$ \P @ Ѝ@ \P"0S- -S?@0 0000 P F U RP +R@@D!0DSX \P0S +S!@?@!@L9KX ?P L0P00 1 R/@P/!R/J(0 @>R0 00//J@-M Pp @f`P`W0D>S 0!3100 0rfЍ>SD 0!3100{f00wf00I/-p@-MLfP@U@0 ` ` pPx0x 08 R;0Ѝp@Ѝ/0 a0H( ( RH,hA-@PP`pU =UB 8X ERR14/.-,+*)('&%$#" Vp&2!0` 0`00+XPp -X% =X00+0E0VpPpp-0V0\0+00+0`0p@00,0, ,]0 c00  p@-PP@`  0RuSpWSRX0CSG5 +p à 0R ^ PSPQP^  0    T0 0+S -Sp0$ $0$ b0 5cI@ d<O-0xSpLM 08@ (`(0,0004020 0 0=e @ X 6e@T8 P0p000003  0a0GS] SJ$00+W@ 0-SR=W000 0` @X B R j b\S  "=W  R"   P:0$Pd @  d R $ "@P0 偡   n Y# @ T:$Pdp@  d0S$0 @"@DP@ @T X 00X  0  0pW ,Wsp`TS `! Z0$Prd ` $ jd R$ `"`FP`0 `偡   ` =W +0G?oY20S# Z$PHd` $b @d0S$0 `""`FP` `傡V X 00 00X00` `Z$P$d` > d0Sk$0 `""`FP` `傡 0T0 00  HR;I?I00 HR0 V^B0P R@\x dO-P4M@P\py WmX0S0 `00 S 5/000 00!S5+0 0 00!WeW0a Y_ X00Ut5Sp50 0 0 0 0@0` P(0`0s5`0$0XY 0S70`kW ,A0` {YW00V0S@P ,(05#K 0P` X $ 2@0 8$*&  # #. B@T$0#"A $1?Ϡ "!,:#  `V4Ѝ3+00 00!l3/0 00!el30$0H\.d0La#0L0|2pST0, P `@!XP 0`V ^ @P,y ^~[d"$:600%$0H"%>!!!0C0"0T(P%"1 #1O"QX00 0 " 0$0 0?S%D P@ ]`1T101! T$?01>! R01"_0`A(0|10X00`d(00@t`dP(0 X  R21@$Q5 0A`X0 0A$0PE `0P 0  `3`3 0 9@ 0\ 0 8@ 0\{` GzG Q(\)\x X SQP tH(  O-PP@`Mq Ty V 0 @@T:R P* $Ÿ P0 P R# 0Qz SQЍR P P PP\@Q @ P @0 @0 X^ @ 4^ p0^p 1^ @0T^Pp# W @ 00 0 \T0 0 \V}0 0 \t(@^*?[!]- Б  p@-@PP U p@KX X0X 0 [U8 808 40 [p@K L Đ Ep@-`P@P T U pPpPUpH H0H D0 [0 000 G0 [, $q @-1 0M M`P040p@' T P+P( 0@ $03/ 0 0 4 30ۍ ЍX` `0` \0 b[H H0H D0 X[<&% dE 0CG-P@K TT P` ``a V00"5SP0 pPO 0SR 0p R 0C à zPP0 TP8 0 Q 0  ! 0`V#*_oReZpP U ![x x0x t0 ZT\ \0\ X0 Z ]00PD < lO-Ɵ MMMčƟP pTDe0< XE 0SN UW V) 㰰\U00U@@ R R00C?o2$00⃰0S U0 S0E0@0Sy00 000SgV ̠+ G 0 @s 03/0Sr 0@ 850000,00G(003/P   0S00 *  0.S  Z0S0 W: 0S $0S  ,P80: S P (0JQ/03 10J10 00@"P00$ 00S  0{P80: S5 0# $2 MލЍK0S0S + .P @\0 4/P 0 000z0   `0NVD 00SS ̠+ PR  v 0.Ss0S^ 0.SmZ0Ss  @p 03/0  00.SG V P 0 @JP6 @n  2/0!1 4 0Y!1 , 0}Y!1 , 0sYX!1 0, hY0Sl!l1l h, 0\YUP!P1P L, 0QYV Pw[00PS P$P-H 0@ 03/e[0S* 0vH][0/ 0 0@  03/0tgHeH0o|$  #"*<   /| tT L(   |̆ LO-PPß KMMPčP`pؔܤ9 UB WK YT \[ /\@ @ 0\/\0   T:"2 0 4 30KލЍR_/\8T*P/00p/\V4"424 @ 0XU"2 @ 0XW!1 @ 0XY!1 @ 0X@Pp PP 0   R  F 0T/S 0: S* S 0 0 0 0 pX P+P 0@ (03/0S0: STm*/000 0 H 02XYZ/0 0V,8 0 |m dn oP HSO-XşX5M$M 0PQ000` 2 @~\< 0  pH 0S/S;R/ 0B0 4ZS 0H*0; !P4S 0 0CPR IR*0S0;R X @H p0\  0  *\2 |@\ ?\" [\!PI 0^N \@000XS 0H 0< S ?@ 0< 0@Ⲑ 0R  R QR Რ@  P+j@PU "2 0 0 30ۍ$Ѝ0@S D0\P ]\!PLm @Ÿ]P 0 p-P]^ ~0]P @ 0< 010t  0BW 0R S0BW 0R S@c 0Q 0{  00P1A0 GY0 [0!P0@ E0 0 p3P0P0H*0 ;MP 0Sꀀ@p@p0P hV0\X V@S@Q$?**[-]Xp!| A-`QPM+ 0  0 S -0{S @ p0Q @{Q0 #P Ѝ0}S0S ЍAc8 808 0d nVX 0 @{ 8O-@PM`pM R T  D ~W^ @P}\ @\ [\ {\PU PE0]\\ \8(PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S00 8(G 0}^S0CV  F B   W  @ ]RR ]RR zpPpp0PpP  \0UWgL0 D0U`8 808 $p 0UTx  Hx @A-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ \R@ @R@ )\ L 0 RKލЍ$ $0$ | 0SU\@v X̿p@-`P Pp@0T1@D 0CP@DP t000p 0  0 *U0v ,0 S. *S8 ?0Cs\#S 0 P/0S /Q 0S 0 0/p@-@PPV 0S] "S "$ R6  CQ   0S- @ 00 CR S 00p\S 000#  00p0"S0@000 00 T\0pp t $ p@-((1$a0QM`M0500 S  0 0 5 30/QލЍp, P00 @ 0 up x PE_0 v\PD04 P 0 dp Ps <`5C-0$eP`M 500S E@ p#S"1V0 P$ 0S %P @ 0SV0SЍt `p  0@S 00 40  0Sx t刄刔p 0fS0fS 000#3R0 <$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 PP 000#3R0 x# 000 PP 000#3R0 (# 000 PP( 000#3R05 " 000 0#S 20@ R@@EP00Ѝ0 S Sd hPP 000#3R0 (" 0@00q RPP  KPP4 000#3R0+ ! 0 00T 000#3R0 ! 000EtP ` 0@S0 @  PP =QIE 0P0 0 OP=Q 0 @00 *E 0P0 0 T8hPT,m Ķm @|p@-PP xOP c@PLPPP M00p( (0( I0 oR|k @-,@@P-004O-ȟ MȟP P`@ pUpVpWT 4  Ip00: [Y  SU 8(,8 0 0 30Ѝ `s?0l0` Ⱘp X M gUV 000 2c110 0 0p0S( A0  $0mp PpT<000S[ S000p@S@Z 0@ S00p DPZpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #Sy R BqQ #R I BqQ #S H BqQ #S G BqQ #S1 L BqQ #SL M BqQ #SB N BqQ #S8 O BqQ #S1 D BqQ #S E BqQ #S F BqQ #S 0S:U 00S! R B  P `0000  00 F  RS0,Z *p0S ?S00 06SW 0 Z[ -S000@&S@p, 0Q @v  D# 00 ( G#   20000"   2000000sEp00,(@ ((@(@00,0o\  Pk0Sk[y+wQDh2"_0 PDR00[ Ra  [ R0`00{0`0 0SpCt X  pGw0080 }R0SpY005[ r0S0 R  p`00C0C   pp p }[S IkF8L$@`d ԤĬ0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF3pP >P ЍpPA-P`? A@0S( A@Q0+pPpPP s@P  ?p0 @BAQA3M@ *p0 "p0 ,0, ,<0 O4 X|` `p@-p`pP`P@T T0T0 R@@pP00xܘA-P@P`@pj0S |@@K R"@`\tP@P00hQ0@I|dD4@-a 00 C-`4MPH@P 0S|0V ! NUpЍ ~0P;  =R6 0Q*G B&R&>$#"M = -ఠଠਠRp㴀Y WꘀqvK SБp0X{FH  0XXDx<Ԧ p@-P@\ Pp0Sp0O-# BMM $ #S  #P 000 0000+ 01Pm 40 4m<P# ` @FP 0#S 0000P Z20 $b@`P 0#S 00P 0xS0xS0S 20 0sS(0wS%0S"10qap`0kP q00cP q!h1 0 4 30QBލЍt10000IP q00AP {q 0`F +J; 1 0 0`p -@P IP`[[ JP000xS0xS0S: t00P^ dJPY.[ Z Tz@Z 4$gzp@-d@@0S P Hp@P@P 4P ptxwp@-@P$ 0PP 4P PPJP Pph`h`PLǼp4 404 0 *MpTģvW (p@-@P$ 0PP 4P PPMJP Pph`h`iPLp4 404 0 LꈿlؠܢvV @0p@-\PP 4P zp<`<`<P@_p訾$(Hu@-@@P000O-v,M@Pp0S 0SG 0SM L60` 0P U 0D   6000s0?SN Sl *S00 *Q @R50*QLU 00  *QA[SU \S0  0 @ 4Q8 ,Ѝ?[ [2 *[ @[[+ \[0S @@0S /Sw .Swu 0X p 0X/Sm.Z\ Q /Q >P ~ /P P,ЍQ /QS 300 000  ^[![00 $0 00 @   /S \S> S -RE S0 U@ ∀Ḱ0]S^$0 S x ti - 0Xn  0X/Shf @`U/200 0 /ZU0@  0U ∀Ḱ]^^ \^  @S ^U@  ᲀ^& @@  "0\ @ x!  [Q  @D1D!D|0 aK,1,!,{0 XK P0 @0`pC p 0U0   Z  0 uP/ZY  /=Q /Q[ 000 0 $ȚO pO |@0PP@-@ P 1M 0 Q 4Q?o2c@,p@-@lP&HP X HP T00pT 00pL 0 pO-0p M @p` P ec10230Y ߍPT 0 pI  P: [ ; 0` 0P [P) @@ 0  p@ 0 P0P S P K ">0 "C 0 p@L -RO-0p M @p` P ޺10230Y ߍzPT 0 upI  nP: [ ; 0` 0P ֹP) @@ 0  _p@ 0 DP0P S P K ">0 "C 0 ?p@K -R%O-0p M @ p` P [Y10230Y ߍPT 0 pI  P: [ ; 0` 0P QP) @@ 0  p@ 0 P0P S P J ">0 "C 0 p@zK -Rp@-T@0`P@ e0P0S S5P pTG p@-T@0`P@ 0P0S SP pF p@-T@0`P@ =0P0S SP pF 0 00 -H- M 0 S 0  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/-H- M 0 S 0  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/ -- M0 0u+--M  --M  A-pPPp` Q @Q hPD@L0 0000Ak$0$ $0 8H`\dC <0P R   0//{O-0'07 0 0S0 A0@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!T0h0p\@@PT G08@@0/S(@@ @@tWPWW(IA-M`PATA0P@D H!0C p0 00   ! 0b0C S1</.-,1*)(1&-pG0 \0@S` 0S 0SG0"S D6!@Ѝ T1r0:G00Ѝ$ @-@P1 0S* $A@T. 0T)  /Q0C T !@# *0P@/S x0 B@T@!h0 0gF  T <@0@0@/SЩ UUF0{-DM  {000Dp 800S DЍp@-`P+p' P@ p V U phaUX vp` ROLV|@EQ?o?o 0C-@c^?c%^& ^ `pCc&Pc2680E270G2&1H01./ "0;:(0C0 /0 @- / ,00-+C@ P@ 7KE0 0/0E0E0C 400-+C@{$PG{6KE0{7 Q/ 0E0E0C /0P!Qoo G-@`^?`'^( ^ @p@`&``4 3V4X4G1Y010? 1?1>4!50;:(@000 /0 @- /k{  0 +C 0/A0C0C [k{ 0{+C{7 Q/A0C0C JL@ @-Ip A JA@ @->p J @ @-p J@ @-pPP `j@-F00p@-@PP  p@$U 0 10 CPm1 x~?0/R//R/?0S/R/P/R/p@-PMP`V @T 00DЍp{ : { ,p@`($  `,|0 00 R IꜦ,@-E00 0S@5`0 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PBPX `>@ :PPY  @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍPP @@ @Q0(@$0\O-\ϟC 0C,0  !/"b!!A0,0 W0 0000 0YWP 0  R0( SP 0 00HWz 0AP(0PW%S(Pk6 ,0 6,0,0 v>C 0CWP0(Z 000"0W0QD6 0 0P( 0, ,04#/A!b!b0C P0( 4 0 Br0 S8P(P1W*p 50 ,P(W0 00W =0 P( WTWp ;0 P 0 0p S0 (0W(Ph 0 P(]c0 , 0PS( 0$0?2c1, 11,0 020 0000 0 ,, ,0 0CP0(J 00000 3 ,, p,0 0CWP0(000c c0 ,_P([(P000yW0T 00. 0 GP(1 u  RO 0s! `p0@@v0 @`   ` @aKal B  0 B0 V PKUS ZSP  @ 0,"P ( 0$0 R0Y R0P ,P\ !/#b!!0"A `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0,40 00N(0~0 S!0 @pA_Q"pG@D  W@ 0 40N~ Q @(0P 0(P00$)\P(\ ף) ) ) Ql'$IpoonmW QԠ(PP @ ACLC|q \^JS S 00#3P0z z H/o"(PzXn|TQ(P7 pp@*CP(!B0pu10 B0,Pp> ( ' Pp#/"b!C;R, a2ba126MP P(P @ @0C2c2c2P$00( (0 00 @ 0 @Q ,0@0S} 00@y0S 0@r r,p0 0P P(00, 0C$0(^3000c^\0M0cP$`jP$`   0P  P(00 , 0Cq$00(06  p  0P( ,  #P ( (0 b$ 00 0M0ЍPA-1@0QHPP P MK Q$`10 P1#L@p P@@ (. R! v P`U Ѝ0 P0  P La@` ~Uk?T 0 Ѝd   0!X?0040  *ehe\eTegfffte(et@-0M@ 0P 00Ѝ@-0M@"0P s00Ѝ@-P@gp@-LL1 00Mp0,00`@P= U2    P00Q Q Q > 0 0 0 ,0 30"0Ѝp  t d\0\ \;0 <D0D D:0 < t,t,t,0V4 I9 q@0,  (@P ^/ P 0 0 5 30ݍ Ѝh0h hD0 ;F=00@A=00n ̥E  ]0   M Ѝx--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-鐒@P p`M X X00?R1.00P @ P v00 P! !  F1XPH  \/VP WU V[XPVppPpW` D 0`f`0`pPI PLLL1 0 0:W`!00!1 001 Ѝ"0XP C0PP00 0 Ѝ0 X:`᭨pP V ᦨpP `@0@ @?0 ?:cl\ [[F Z@-@ M0(0S2 .0 `0( `1/qpPp0)  0 0 PUR <0PU0 ЍPPTp 0S  0CP0<00Ppw0@-P Mg0(0S: -0 "p0( p1/qp@`0/  0 0 @ToR <0@ToM01`V ЍP@T` 0S  0C@o;T0000;00)0p@-PPE 4A0S5 @Tp1 Rp00P0 7 P 0S P0- 0c0(( 0P0 #0 S,P 4P 8P p@T0T T0M W90Sp000 0K0 K9eE`W 0WV Wp@-@$PPKWp@D8@,~@- @@=W@7@}p@-,PP0 X@)p?}@-a@P`Mc P10`00S p  0 XRp p 0@@SE @ W8 CR67,0L0 S0\^,*N^(^& N0 s0QW   "\ ^ #R.S @A a  00C ƒ@0@Ѝ "^ #R$0$ $F0 88TX T4  R  *4 8/L{ 0X\S 040:8 R РS /jxB@-@`Pv:LpL0ppD尀 T   Ԋ똙J@-P`@z:0 QA-hx`Pp@P1 T&  p0 SSS7 S300x S(-#g\*7'0 87'0 8|70000F00P00 00#R00 00;R c\&V Psd\ 1P01 0S1000S0d\ Q 60100 R =R R 0 0460000  m 7 Br 000" q00BQ00100C0g R R 00\ 50000  N70Bs0 0 Kd00  00Bs0@% 0W0Cs0 209 0?X000 000000*-X00 ^XT0000 I 00Bs0$ 0W0Cs0 0 00BSD0100C0%50#\X00S00%0H?o2300&0H?o24 00=Hoᨂ%  00 3010";R |30000 00C 1 0HnSrXGFEDCBA@:gSJIC:-$ 00 B 0J00G 0 0H00? 0 0@ 0 0; 0 06 0 01 0 0, 0 0' 0 0" 0 0\ 0 0 0 0 c\^d\w=0 Br 00Bs00<00I00R R3ho814o10Nn@00=A-R@P 0`So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@L"00@10 03/P(!p0 $@ 0V0 p00 R (P00 0P3/P" Up   R  SVp 0SP00 0U pmm.l.h.K0l--G-@P P.0`P (rp^u  0F0\c<!"#b!0CaqV; Y 1PpY` $00100S p !`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(XP`0003/P 0 p 0000SX_P00}00k/>3hj,j+ii+D+00 @4?00 @ 400 @400400p@-@P Q WPp`\Pᗡ0@P HP`V 30"S fp300p@p@-La P`M=  k-00QP0P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P  800  3 0 @~,`D_,_p@-@P`P3 V( 0Pp:P @P0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 1(0( (0 1t=x L=4/T (=00/p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 0U8 808 0 0pp D.8<D * <O-ȟ M MDčpĝP 0o 0Sx 0S t4!S S,XPP `P  pP 00S `D R!' ῿0 00 N Pi 00P0s` @ `PV 0 S( [T :SZ \S S S 0U:H$PPE VpP+ ̺P @0` S[1ZP#QQ ,Ph600`SP0@VE0AX0 0p$&6 0 D4 30dݍ Ѝ:SZ PPEV  00 0S m᩠00@ LpP< 吠l5@00PS0 00@5p0040$0(`,= Pv :SL 0@S t40@0 0$<PK0C 04 8 0S:S XE H R0 0  Q!000M P@04@@0k+ ִ0:S `, 00UOPK0 E0 %*10 S:S008$ 0S:S00n< cl?$$pb#h" "0 00 _-H-M0 S0 00 0 0 0@  00^100M 0 @R0    R L00 e@ 00 0 0 30KH Ѝ/__ _4@-K0 @ @0% x@ O-@`$MllP႘X20PY 00 0@`QKP p W  P G  pGpPH0 S#: *% U10 r 1$4S1$ !t@00H 券H0S "<100S (!0 0 0 306 $Ѝ U r _pP Р ~P 5SX0(, VT00#    A&PH H0S Zl^|@H?84>\O ˠ@-(@M@@0BPЍp=  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A A{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T *P0 0# 00Ѝ {*0Ѝ0-$M  00 0ͲP$Ѝ0-$M  00 0彲P$Ѝ0 -M 00 0 嬲Ѝ ѳ س0г/C-LL sMPP`0 V8 @X0^00pAtA0OW0PP P1{0p0>TA{# 0 $@9 0 0 1 30sߍd0d dG0 'VH0H HH0 '< XDW H  0   M Ѝ,WO-ϟ MpPÍP0^ Yf 00!R !Z P   "P0%%Z * 0S0 R 8/0? 0 3 30[ ߍP0 u"P 0C PS !000C 0 `0zS|NQ~|{pyxwvus1jhc_^\ `ZEU000 `0CP07PE 0SF0 0C0000 000S0  IY r<P0 !P 0P0CS0000 @ 0D SU*{r? (0R0 (0 , 0C$00 40A@Qnt#zx 0 S0 00 1YK @@0 h!P 0C0@0@ @T  0SP 00 0@0 @0 0CP2 0S0 000$0 $0S0D =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SzP P000, 0@C0 H9T@!r?(0@0@ + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0r000@T@0TS XRm    0 (0     7 5  0 00 0@0( 0CP000&     ( S@ @& YʱY  P6P&P0 Q%Y464&40 G%Pp _P @0cP " P  0 S0 0C0 S V P @00CS0K 0 S0  @$ 00S HP40SZu 40AQ0Q 0 Sk $ @00ESZ  P 0@0CS0W 0Y0 O @0ES$ PSZ R0 0@0CS0  0 S000S @+ D  @AQ X2 @ P 0@0CS0Z000 0XW $+D @@P 0 R0 @NTA 0Ti@@P[ 0 R0 $ @XQ[@@P  R @0 00K%? 0r?(00Y D  8?o 2R0SY 00 00C@0@00<000WS0,` `01D00(0H@V< ᎕ P 0  B0=>J(  r4%0  ?p P p =p 8=>3PSx $0S0000PS`F4P Z,`X@ $0S0 00 0000V0V@V 0 < tx L$ @4 '8 ! 0 P 0 0C P0 SP 0^Z``,40u$Z`Iy @0&0,(0( =>0#C0,`-Ql ]QP @0c Q: ,`0;00<0000000900000 000:0090 00|0:0000s09000l 0  H  0 PB P>  +P6  P1000;000;0A00=jIT  , BR@ 0Z0 @$P 0 R0l @X<0#  R @#  R2XX  P BR@ $.P$M 0 SJ 0iT nT  , BR@ 0Z0K @ R񏐷D" AR>  @ BR  0X0@ NR-  @ BR  0X0] $@(T  @ BR  0 R0 @)T  @ BR  0 R0 $J$0Y$@Y,Y0$ 0(0@T 0<050 (@* o00 500S @0SI 00 0!Z] P 0@0CS0| 0 S0  @]0SH}P 0Z 0atP 0Z 0 p00 00= 0#aP 0X 0@^@ =. #RRc @R  B   @ 00. @0=>03SS' 0@T0C0000@000 0S*P @X A 00 000P@ 0 S= 0@@Q# P2 0 S/ 0@ PG 0 SD 0 0 ( T?o_T20S 00CS@0 0 S000@00CS0400 0S0  @0 PW 0 40H0 B=>  @J"r0 喒p= P p ݒP 0Y0C P 00S"0,p `0#  , BR@ t 0 R0l00 (@m00 qP Z 0@003,  ]R$ ZzPp80$0 0P80,  4`, rO<`T xP$0 0P(0080<$V/PR 0 SO 0M&P 0X 0$@3P= 0X: 0@PD 0 S@$P P; 9P 0 S1$1I/P 0 S 0$ @0P. 0S+ 0 @0$P P P 0Y 0@/X,` @ t,TP 0 ST @tZ( S C@ S  &P 0 S 0 @0002P $P @-  , BR@  0 R0"  ,$P&, WiP 0 S 0$@ ]P 0 S |lR 0S@!0@3ZS 0䱯P P 00 0Z  ` `d0$0H00 M PK A=>0 $ C  0rp5 P&ZP@DD 0S#T `Z 0 @+ @D00P0T0SJ0000rp0SP Y ` 0@00X_<0< <08 {00CZP@D`\ A-@P`p0 0@@-@`P MDp@0p0 000@ Ѝ45A-,R@QP`r v 200S5 0P1S010n C000Pv`! pW@0PA PPZ 0 9 00  C `C0000  Q  Q*RQ0 <00@8 B`0nP$00P0s0 ,P B/0T0T T`0  B0 D@`4\ p@-@P* ᶀ0@+p@-0P$L`T M 0S pW  07/@P  Ѝ808 808 }0p @ Ѝ\ 0 00M 0Ѝ1A-0P$L`TpM 0S $X 0 8/@P Ѝ< <0< 0p C0$i @ Ѝ耡 ,00 0M0Ѝ0A-0P$L`TpM 0S (X 0 8/@P Ѝ< <0< 0y, 0(0 @ Ѝ蜠 00 0M0Ѝ/A-0P$L`TpM 0S 4X 0 8/@P Ѝ< <0< 0D 04@ Ѝ踟 000 0M0Ѝ.O-MD@`Zp@P] U? 0ST$ZE 0SB [? 0 ;/0S) $\U 0S H[ 0 ;/@PЍ 0 0 w0H@Ѝ0$\ 0 0[ a0h h0h 0Jh V0D D0D }\ 0JP $ L̝ TD @-$$@M vЍ,@-0P$L`T M 0S 8pW  07/@P Ѝ< <0< 0 08p4@ Ѝ謜 $0 00M 0Ѝ+@-@`pPtt0l尀 8T  5@0 xṏ$ %+D'07O-şM `@0  0P0 pP0ʿ00! B b09<Bp  UQPE @ 04BL3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b 3P  00Ds0S0S0 S  \00t0!#300@ 00@00 @0`PUb*Ѝ@\ M00 P-  R^^? @ 0 `0  P 0J ZS0 0 0J ZS,1 0000 Ѝ0S0 P1 00000\  s  `\00 00 00Cs0S ``0\  a  `0\  b  `0\  t  `0\  n  `0\  v  `}0\  f  `v0\  r  `o0\  @`i+qA- Q@Pp`! ᒌP=0D?o! D2]R0S =h0$"0@ !1 0 V V 0' P0 A d A-P@`Pp .T Tp!0D1(0D,TS0 pAd_T %(0$"0@ !1 I6 O-ǟ UMLǟ@P `|  ?o2V0S Z Y y Pw0P0 rpo0P0 [00 x190 H@ U1 p00PU`p! X U0 1 #P00? PP P@6@&@0 PU`p0pGGq WP1 P! Dr`"pPI Ƞ  0S V D0 G0CSax1  * 50 0  Rx1  ' X50 0  Rx1 00x1 00x1 00x1 "00x1@\00x100kx1 eД U $`xPUk 0p 9/Px00`\$84 0 L1 30Uߍ 0S IP/4$0 㞉P 13#z0 3#0 3#0 Z3#0 ꈓ ꀓ 0 DDpO ᖋaV$00友 0S 0S 0 Y `0$0C0@4@0S P ,0 p( 505@@!0(@@ 0%$0 0%$0s dq U$,Pp@-@P T UUpd 0 pH H0H "0p ,, ,0, (0p "Tn ,,n A-PP`F L'p<@,0 $5 S9 S@T @峁T V,0`<,0L0`S00/S , @ f00 npp@ S00tPt, ,0, (0| el 1p@-P@PP 0P0S 0`0}0SZp@H(~(~(~(N$0$ $B0 t(xl 0A- 1 0 0PS`@(M @Ppp 00 @0ܼ P& 00CS'  p0 0 0 4 5;1:(Ѝ 0<080v"0 0(Ѝ0 l k 0 00M 0Ѝ@-@P P PP 0 *0 0Xj tp@-@PP U p@K P0P PB0 U404 4C0 p@5 аpj <԰Dj p@-@PP U p@% P0P PB0 U404 4C0 p@ 8i <i O-PMp 0GW"S00`0v@ P-TPg +T@`0@ ?  04 0 -  P p ! @00Ds \a0DSW0DA0DS"70DURX : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`o00 R0  Ѝ p p᠀堐 XR A B0A PR W @ 0`H0H H?0 OW p pmꙙPf X00 0M0Ѝ2/@-@0LM`Pp@0 P LЍ`0 LЍC-1 0MM`00<0pP,}x@P V h1 0S }P(1 |  [P( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nSP0S  97@PPP(|(*ӸPh0tnfsuniop@-`HPp  @Pp0@@p`@-@P @(0( (F0 H@꜠c |@-M @<p 0: S  ʘp  IЍS00ЍO--3$M0`@0 ;#;$SP00T00S00 e00 P@Pp U * }@P 0G Pp@ 0f ሙp P PE U@*0S` PU|0 H Y*P 0    U1 T 0Ḱ @[Ui |PPu Y#: 10 001[ 00 @b0 P @ 0 S0S[ 8~ @W; 0p@D@@0 `$0@$Ѝ0 !~00 000S0d0{P 0!ޗp`z w L0L L0 A  f @lH_ xp@-P } @T @}T0 0pp@-@PP U   p@S D0D D:0  U(0( (;0  Բ^ زܲ^ /O-pP M@`0& X. @T Pf[ P@ P  P  8/P  00[W@D:P PU ЍD0D DD0 X,0, ,,0 ] r] ȱsO-PLM`@< Z TV, <000$0@ z0P 0 Za <0Sh V0P@000p000F

p<  䀟0 00S (wP   ) ( w$ 0S p qP     0S P(v 0S Pp (t0@-@PPM  0 P!  P 0zp@ @Ѝ0 0 S P0 <0 (M p@-T!T1 @0(MT0$00: 0PS` RT= 0ST@ 0 0 $0 303(Ѝp ^ (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@ꩲxL L `X0P @-DQ4  Q ,h0P@-X  S H@ @0( (@ 0 D4A-p`PpP@ U! T 0 F0PU 000\ LL0L L?0 U000 0@0 $8pJ @HJ О000S 0 00 9/`-  0  ^^$  00zh{mNA<{{ A- p`W'0 FP@Ï@hC12c` P@ R0d0d 00 1HP@@T0`10 P$zz_ Ny8zp@-HP@P ju0S,000@ p@ ^u yyxA-1@Q`pP`FS  Lu R&100 UOUd10 0P!p <0 /u?UU'U9? 00A0A100 0p0Pp0 0PV  B0B10< l0l ll0 X` t| hyx4y yLx4xxwPxTF `Y0wA-01@PppG> `1&P #Qt PFR'000  0 0!܀,UPP@P@ 06&```00A @tl00A0A100H H0H 0 }pw̬v,wE lvvvvvE @-(@@ @xt0@st\up@-@P PP P @p@p0 A0 BꈀHD A-PPp` @P# P# tP  P@3*L"00@G004 404 V0 900@C HQ:// BQ://G-88!000s0S03 0p0Q= `AQ@PP 0 `Q ̀@P   0PR@ pvTl@0@S gv000  B BG!`tsPp@-@P P8PpU0 =Sp=SppVp@-@P PPP@Ppp@+v 0 0 sr A p@-Ps@P 0 P0@prp@-@PP LPp P3#p$ $0$ 0 Eqt@ DLO-10  MZp @To p `P \P0=S] @PT[^ A@ZP1Z04 S@@@S*Z3 u 81 0  0 `K)0S:a # D!0 0 @ Ѝ0Z   RS@ `0S a1S  Ѝ PP8ȱp@- @t,PpP 000ppA-l`PP` p\@P 0=S SP(00@0xS,@-s@P0@ln,@-s@P0@4n,@-r@P0@m!00-!0!Q00 000000 0#0, 0# 00!R0Q0  0R000p@-P@1`%S 0p 1# R  " R     Qp@PP@1`%S 1 S  \  1  p@ Q Q      p000 0/A- Up `QU @ @E 7/P@G-Tp `AT P PD 7/PX PPHPG-Tp `AT P PD 7/PX PPHPO-P@U`pX 1S P@@E  7/P/@P@@ @@ģXC 1Q0000/ @0  0000Y @0S0@0 PT1S1 S Do  00000@ @@@@0@@ 00Q0 -"P 0 PC R00 SAP 0@/ p@-`P@T0^ \ > R>  "   T0"] \haa0 00000 0#0 0#0000``0000T ^pp@fR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@7Q `T ` R\ ! O-p`pP& 0Q@@PppW@Q0Jh `X  H0PX@aap(OPp(0pG.wZ_TaB3 ,000 D.@-,@@0@P0S@iM-`@P@_}P(p0@aao0O p00ZO.TTaXPB(0( $0 0 pH0p@-05S P9pP0SZ sX@ 0CR\(pp@T P UP@pHchcb/p@-@P $P*rP &r$$rP rp@r0 0 eh1 Mp@-PP@ T $0p@! 0/L L0L 0 IT, ,0, 0 >1 0 `p@-@PM$ P$`0.UP  P pp(R00S 3/Ѝp003/( (0( Z0( H0 / tA-$P0@MSp p0(`0 0@0p$p^Pp0(0V,00S 3/@Ѝ ᢌ00,0(p03/?pP A-PP@M) T2 0S Ѝ $`0P Zq00 @pP fЍ00pL L0L H0< T0 000 ,0< ~. - `O-d`yM(p`o,PP } o@Po 2 en20 RF ^n0!$@ !  00 0 4L  00 0. $(p,`X PP 80 03/``oP"  F !0 0 1 302yߍ         PopP ppP||Puop``Plo4D2묹p<D<+ h+ `D+ <P00/$a@- 0UM 0H`0L10㙪p! 0H1帋@WpPW0P`p  S 0$< ,0 0 L1 30Uߍ1ض`Lp@-`PP`@M& T. bPЍp fP aP  aP |0 0  PL0L LG0 RT000 0H0 H(}) (~X) ~O-@P(p,aP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV nP``n@P V@0SZ V@o00X( |G-`R p@P8/PP @VG-!1 0M@Q000`PQ UI U .00P!1 0 0 30ZЍ0) p00P 00 S00 0\PP  0QPP H0PSUp!0T  EPp0 pPp P4p 0 @P0 00P꺨D/ B/0  Q B  /0 R % B   %3 %//Q0 / 0R  B 1 // 0R  B  2/ // 0R  B 1  // 0R  B  2/ //0S :p@-@P0C0 00 0p/0p@-S@ :P0C0 o 00 0pp0 $000  / 00$0ꠢp@-PP@ T" 6cP 0S S pp@)c6aP p@0aD0D D0 T(0( (0 w" ww" \wp@-PP@ T bPp >p@cH H0H X0 t, ,0, W0 j4" wv " S" UV J=00 s J=00Xb O<  XP S0Su  0SD0S  0S0s S0S UVJ= 0 03?"R #< {<0J8 0<J=00 0 P J- 0S.J=  0S) S HJ͍0 E:01 00000G0 ,0pTP @-+ 00SdLP# P P J=00X0  XPmJ͍aPd Dأt mNj O-xxğ M@pQ4@0P0C`S,H6)('&%$#"! D QWX00 R04 0S SYex#p3 0 0 30ЍP#D3 0 0 300 HD@pЍOQWX00RT]WX) 0 "? s0椈pPJTH0S0S ? /r x"s0 DPTVT008" 0 } X: P00Sj!0 gT@@O 00!0 XpiT 1i #pYp \1\\ P0 pY 0@D    4T00? YRp0쐟젟PP0 ppW 0@Df    T00? D  P|TypdX  d\0gxg8gffxPfHwèPeeG-p 0 FM& P@`p &P  RW  P Wr`ov` G0@Sp0 0 0 1 302Fߍ000 00?1 00  0P Y: /r RX 0S wP 0 F꘢뜚̙A-@P`p 0 | 0P ]p@-MP`P@@P@T 0S  R0S PH+@PЍpP@#PЍpp@-@P qpPpPtp0 @0 p= a0. AASq0C .S .R Q P-S.S S /Q P_S /0@-S GRC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ R 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0S00@-d!$M""0 0 AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S0S'  R  R R R/S /0S S/@-/ 0  00S S/ /0S//0@-@P M 0S PP0 PuG@0S0S 0S  Ѝ0$0$ $n0 $u \@-PP@p`M* T Q Q Ѝ0SS ЍS PPpW0S# S!  0p 0  0O00S SH0 P 00꜕ [[[H>p@-PP`@ V T! 0p᳠Ppx x0x t0 V\ \0\ X0 T@ @0@ <0  ZZl Z|Z@ H5PZO-Ÿ2MC `<0 0\P0  03/P 0`&<00&,SS00 80R0SW  RD(ՓuPUPEA [?:$00@4,$0 C 0\@P0  03/P @J] 0P0E]`B]Vx80Sg U  &<00Sj&<00SD嚀!P` E/o0"SQ[Eo᪢R,0S10DZ@0P@C<0D\; Z^7 @0C 00P3 0P00,00,0%SA @ %4 0, 0 30ݍ4Ѝ\00&<00Se &<00Sg  E'UR!`Y [I_40@Z,PE [p H0L0P0 p 0 c@P30* 00S  Pj X0 SR ]P 0 =@P 0 00S @P _@@ |@P t0ht>O--ϟ MSp 0E 08 x0嘀m  i e0 0` W( 0S0S  ` 0 . "2 Bߍ0S0S;0S^>3> `p.p>p l.0E `P 0 0Q P 0. ^ 0S 0A?o@2T0P00S0S  p Y @`P 0S   0?ST CC" 0c6#PY$@ ;0 RS S0 00W`P  `<00@(0PP`$pY i792 I120Y0 0 S   S  R  R Q ^  ^ \QRSQ PRV  0PsQp X+0 0Si QRe 0S %0P,0 P , 0 B  ` 0"P0Y ,00 X,8`0S  YYB@pTP0S~ 0``,p@b S R \  PW \D @T( T d642 D52 0S0 S P  ^&S㜐Q^.\+@`T,p7 W 000`P 0 `pVPUT \0P$0N ȇXP 0 ``P`T^PXP=$7]0S5 0S /] 0`@/oQ" SCR㜐  `>xPQw 0PM RJ 00SC RQ? 00  P 0P1 P㜐  00SS㜐RpmRo \;R P @ 0XP 00[0 0[*0e/0 5%0 @Y XE`0@S 56p$`(PX0000XP X@T0 4p0$`(PpP` 000 JP@T 0S S00S0000 0  `}P `@2 T; W8 $ 4  0. 00?oR20S u 4@,8`⪺ 6vP1x00x0 Z`PPP@ `0V 00`ZT0`ZO-PLM` Zi  @㰱q p  kPP0 0 0PF ``0S S S T@P `0S `(0 ( (`+P00 U `V Y 00  Y``VU$@LЍTT T0T P0/Z8 808 40/ (*(h ((i G-XM`@yP pP @Y00  70 yP 40S0- XЍ PP Z 0 ryP Y8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 0D DD@  00,0, ,0 ꉫ#EgܺvT2 A-PPp`6 W* 0!ᣁ000?0"@@h>V0: ?0hS@H"#p ` *50S@@:p`F AH H0H 0 x, ,0, 0 n h `p@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@` `0` 0 )T@ @0@ 0 w|I HT \( |G-H"H2 0M000020"00P003  `p0\ @ 0 XS@@|Q0 C" T. .0N|Q0.\'^V*00QP0@^*0^0 8< 4^*0 8<؍(HH G- MaP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp  (0!@$R0@0T$0B0S \@0S ( !0$ R0DvEE A- rM`PpP: UB @X0^00pAtAP0O9Q01 000TAΌ LIQP5  0 ypP& 0@RP 0 0 1 30 rߍ0 <0 Uh0h h=0 P fS00 0P0 8DBHCl$ X 00   M ЍlB -- M0 0x ЍЍ/--0 M0( 0 hЍ Ѝ/Bp@- M@; Pt00h` 0`0 `P@@X@-0@T  ЍpBA@-TT1 0M` !000np @P   6np l@ 0 0 0 30*ЍlPpW @@T PU 0SIP@MT.00@D'00T$Ai@ 0p@-P@0 0p0R(0PR(P,PR 0\0PP 0P 00,,6rP 00p   0@-@ 0 0 0 0 0 傝 0 00@- 0 MP @0RR 00P 0 B?o20c Ѝ0+4 00 0p@-@P 0U0 0pp@-@P)R0PP%R(0P"R(P,PpG-P0Pk `|Pd 0@00 S S0 S S lkpPS 00pXp p8 (X@P 0q0p0S S S@ 0A S  A@@P0 ! 0S 0000PP   PP.0@)@T O-@ 0`p M,0(S{: (T_ TppW 00SS 0 RM@D@T0PH 00SD000@D@D0P0S- T0Y  0!0J@0PI 00S$0AS000  0S000   ԉ0S& 0p@-Q0pp)Q(0p&Q(p,p@ Ѝ?PP  (,@(|0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ0=p 0$  $ 0 . Ѝ0O-PLMS `E$P@ @0 ``DRPR$jNpPN 0 ``7RPC$PPU 0`@Q QD QR Q1 0U00Sz ;NPb  `000 @p R  R/ RY R 0 @Up kP 0J[0H 0 LЍ   @QA@ 0U`   (⼐up 0  ,  p0p 4`0W G`@ @U 0P00P `^ \LQ  QA@ \Y ^ Q\ @  p, 0S QAR`  R  P@T( Q  A X # X/ X5 p X@ P  @U)<X X X 0` `p  `   Q@` ``  `p`<0< <]0 pO )댰 4 @-@P @cO( (0( 0$ @WOԪ pT/j'QO-^p P`ƽPU<L ( [@$0`  $ X(0,2(``-P p`[ # 3X(0, 0!(`` -0P p`QJ`a!Q0#03U0S` Q:PQ Y5XX030#1!o 0 N@f000X; S`3 `#61S41`F2s2`Fs1`FPS0`Fh 0`Fv`4:0;`0Y S`3 `#61S41`F2s2`Fs1`FPS0`Fi 0`Fv`0809```ꬪ p@-`M{hp& @ip) P0u0'{0 {@j0@xht h0 0-P Ѝpich00]h / p@-\ ,@\ \ Q :\ :Ap00p00C-P$0@SMJ 0( U4p :`H;$963>0HG81GpB70B- 0R  R 000<890L>1 0 00LЍ 00!00c 0 0@-S@ 3/@Mp@-W Q4S @A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U  B N B ^ '" ^ q N $P@@DF$EA! BB  D B &"AA!@@  B B!"AA!@@ pQ Q@#`  P`PE@F$NN. B B&"@D@D"F$NN. B B""@D@DA$NNU. B L B \'"\  \ \ , ($P@\ \. \* \, P@^ ^ N@N P@\ \ \ \ @wPU  0R40008 h`1S   ;`1S0 0  0PJ0  0P7P  PP$0  0P0  0P0  0P0  0P0 0P`1SxYz < P0ppW  0R 01hvpW 0pW  0Rx 0hcpWf 0pWa  0R0 ,0 hPpWGpWD 0 PS00 g`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0J001p 0?001p 04001p 0)xt1p 0[lJL gtЍ tЍ 0 10 0  0 0  00 x0 HX8 dL \|\<@-@`00AMM0 400p00 ?PP0S wD 80 0 4 30AލЍ.2`0,@-@ M pp P?`PeP 0S <0000 Ѝ00S.S 0S Ѝ輚p@-|0|AMPt 0 ` $ 0 @P %8 00 0 4 30Aލpp@-P@Q`  @Q lcPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝp@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00ЍpL0@- MP0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0$hplp@-Q`M x00<@MP 0PU  0VЍp_40P 0`|Ѝp @@L0@- MP*0@0@=@T  0U Ѝ0p0 0PWU:L@@ Ѝ0<00@00 0PF Ѝ08@d0@-@ M T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP`d4 0@- MPI@O@ }P Ѝ0 0( 0P{ Ѝ00@- MP.h0h@0@B>@T  0U Ѝ0O,0@ 0PZ Ѝ0 8HMp@-@ML 0 Q0P0<00P@ ` 0. 0;T @D D000T H0 0 <0 30 @Ѝp@Ѝ/.0 Tg2~ @ O-PM@PP pi`e0 裟Q  ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0`g 0 T @ P  S#3@ P 0RQ  S # 3!# 0T: 0 T @  P  S#3@  P 0R \  S # 3 # 0T 0 0N 0L0 000J 00  0;O-`Q0 dM R 22/18R{20\0QS0N0@0l2a!##\B2b1!AP2aL5BX2dD@AEW0E0<02h8's2Q>?2crlqqHL01NਂhL΅ReXT P0HP QNi} e} a}[P0 T XF Z H Y J (0L0$0\04 0<0,0H0 0@0p 0D P40C[ UCZ QCY MCdЍ00N\0`R`(`j  0 0dЍXZ HY  80igMbQ<t@-@(P 0D .R\0@*S0T .S@@T QA.@S@@$ $0$ 0( :ly @-$MP`@P`v]0pv> 00pp< pp_p  MaPc$ЍhC-@P@ `p MPOP @U _P@Wt Ѝ @Pt0 0000 0 P"@0S0Toᨂ#  C-@P@ `p MPx@P @U ^P@Wt Ѝ @Pt0 0000 0 Pc"@0S0Toᨂ#t  p@-@P00CS0 S u P `0 PpUb`u0 0CS0pSr P 0 /=b@-M@0  0000 !R !0@Ѝ@-0 S 0@Q0 R  004S 0@l@Q0R Q    R Q  Lp@-DPD0P`@0pp 00p@,X0! Lp@-@ @ `@0Ppp0p@, D LA-DD p@0P`p0 A LC-P0 `0pMpp@ H 0D @ <8 @Ѝ;: LC-tPp0 `0p MFp@ ( 0  @ Ѝ: L0 00/l L0 00/L L 0 00M0ЍA, LA-TT p@P`Mp 0 Ѝ L0 00M0Ѝ- LC-tPp0 `0p Mp@ ( 0  @ Ѝ9` LC-|Px0 `0pMp@ 4 00  @Ѝ9 L0@-P@000 00M 0 0Ѝ0< Lp@-D0D 0@0pP p@h9p L((  M  0 Ѝ# LD R) p@-P`@V ?P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` 0T  0C0 ЍH0H0 p<0<07/0p 0 XLO-Mp`@PP*W3*00V.:Y `8 @1@0 p pZ, `P 0 P0 P 0*`000000Ѝ0 P`Ѝ ` ph0 qP0V0`FV0S000 000 긔xk tO-M 0?͍0,0= 0080=͍000\ @p@LH$0 dPG 0@S P =4 0H P0 M1P000 0Hk=P0= <<0d@PU *0,/ 0|> 0;/ 0`Hk=0PE(P0P D0}4>xd P0 FP` 0 P0 0`PyYY 0IS  'B)?mZq=m#"pCXd~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! 3Pr R 0S .S 0S 0S00S.S=0@\90- RD) <9d 0 @! PE 0D$0 SaD0C8.800440PJ0000$0@ 0CS(00x0p` <Y@`p @D0  P(0ST0 P 0 0`P8000#808, 000.0 r  .00Q! AWP0$0Z 0D: 0@H+B 0?R0S \' 7 0  0 30  ݍЍ$7Y =00SF=0@60\=0@60V=00P040H00!P@00 0?0P00|& @t6000#80\P =4 0H 0 P5P5@5 0PD;5@@2 0&!Pd00004 0 BtPY 0H@ 0R0JZ0Szl%l5l h0T 'p=00S"4 @0D;,5d 0 P`0 P+4 0P` B=P"H40P`<8p@C 0P`+P0 zP 0 P`P(=00S-4000Xd 0 0D3 0! TP=00P@C 3 `PP VZ ʜsVp# @Pq0 5P0T00 E,P00d0V0@DV!P3d 0 a! PEp`$P0 :@P 0D 0PYX+ !$%P$=00@CD20L C +A0W&1 000&;A>A C6;w  4 0 B6P 0DK$0SPvp\1 `(P倐P 0V$  R @0 Y$ 0d  0 ^P@T0- \7!?C0 S!HP|P`o1 0(@DK1#0Yp!00Pd=00S= 0@h80W 0   4  BP 0Dk$0PCUQFڸ@p@U<1 W2 z0d  F 0 P=00S= 0@L9040P`<8p@C 0P`Pg 0 P_ 0 P`qPV 0 PN 0DK$00CS @ :0p4 0p BTP9@ 0 P1 `jDK`0PD[ 0d  0 P0PD[ 0d  0 {P 0` 0P 0;@d `0DK P 0 aPH=@ 0 !PP=00S 0d 0;0 ! <P`V D 4 $ 1RP@p` PPPP=H 0 0$ OY@ *, < 0PP< 05/=0I 0VHD6 $0S @P 0 P@P(0d 0=0 2 ! Po=00S0@0 l=D @@2 0 `p0 PP$0 @PHW ]0P @DK P<0 P5\ @0 DK P+0 0PP# l0D;  0P4 0Pp B*P/@/0P0 0( D[@>4@0 p`0 dP- 0?@B!?C0 SL0 QP=00SY=0@?0x=00S0SK==00S< O0@d 0 0t `P0 !P0 p0d 0D a 0 P 0 d S 0 P0PD[S3jC"!$&P%=0@t;0=00S/ p0D;D;d 0 $ P`0 P_40<8@C 0 P`lPQ 0 PI 0 P`[P@H=00S=b@0 0H[0 2#T` *0,,+,  p0: 07/=@D@P0 `0H[09d 0 ! zP$0YD2*`@y堉p0p DPY V 0  ZP `0d  @ 0 LP`F@P 0$ Y!;Po@P4 0@P BP0 'P PDKO. 0@K.HH.T  w5 J=00@P , 80P 8 05/6@>=00S=0'@7 0(=00S. 0D7d 0 & ! PHc 0   4  BsPX 0D[$0S'C1#00 S!PC=@0 0H[0 <"޿T` *0,T' p06 @07/ 0P-@DH[P D[@=@0 0H[0 "ḿT` *0,& p05 07/ 0P-@DH[P D[@!bP=0@50%5 0T (P$0 PU 0D[:{0@@50u=0@,50o=0@50i=0%@5 0h=0@40[=0@40U4d 0 `e ! PU d `P0d 0 0Q  0PUDKD!P PDK 0 ~P]!Pu 0@cDK40`PC@p0 Pd 0@pwP\ 0DK$0S|!POP L`P0VV 4sp@P0 P50T00 EP,00d0V0@DV!P=0@20P @PyT;T Xrp`P᩾0 mP0V00 EdP00f0T0`FT!VP=0@10P0 0H0 yU@>*, 1l0P`1 05/0H!,PP0 0H0 UU@*, 0100P0 05/ hX@ԧd4pHh@ТOآ? 8EdL4` Ȣ 04HL0$ |(P,T0T0ܗ܊dl848p\(@(ܔԓԇtxD8P8/ +a `P0 pD{ P@1d P0 P0 ~P  0 P0 nP+0P D bP=H{` 0PPV *0,!  002 09/ =p`F`H{ `p00 `lP0 0P^+P0  D #P=H{` 0[PPV *0,"  03 09/ =p`F`H{ `p00 `-Pp0 P+P0 D Pr=H{` 0PPhV *0,# 04 09/=`F` `pPH{ 0 0PPH\0 P@*@0 DK @P2=HkP 0@P(U *0,$ p04 07/ p=`PEPHkP` 0 0zP0 PP`0 jP!bP=00%@C5 0=0@50=00%@C5 0$0%@C5 0|!;Pvpk vp@Pf 0 (P0T0 0 EP00d0V0@DVL!PE! Pvp=0@603@$0@X 0D:+ 7 '0 ,$0'@C 7 0%,!PrDwpP @l`P^VRV xwp@P 0 PU0T0 0 EPL00d0V0@DV!P==0@80 !P08xp=00L(@CP8 0=0d(@h8 0$0@C|8080Oj!~P xp8(0 $0(@C8 0=0(@8 0+I W0W! ##9 0  +I W-- +I WW" !"  +I WW  #  +I W,- +I WW! "  +I W 00;I!/PPUD{ p@- R  MAL  ,@0@(@@; Ĝ0 Ѝ>MM$000 1 2Ѝ/0`A-PS`-p@ @W0 V :0?s00@PU c(Pw(0P0TPD0?T0S,0, ,l0 7PP- G-0pW:P 0?W0: 0/W : ` SS/  0W*:(00@0S X0T0 "$ P0@A-QMyp$0PS@` 0! $, (0v(`Vh0Sd(0S0! , $P, (0V-ʀ100'PT, 0 ^,0O /  , U/ ,(0T0PT(0 S0P$00Q (0, Ѝ0F 0P',  (`, \ :0,0?0s0\, :$( ,00(0 SPU$P 0"00(00A-QM}`$0PS@p 0! $, (0w(pWl0Sh(0S0! , $P, (0W0<0000*PV, 0\,0Q U/r ! , /r !,(0 Q0QQ(0 S0P$00Q (0, Ѝ0G P(,  (p, Q!:0 ,0?s010Q, :!( ,00(0 SPU$P 0"00 (00A-P@P`v Uk T{200p,2 < V'Ì@D.?pN p2 00< V'Ì@D.(2?p::0 0 p 4 8<T0 T! T00p#2<0W0!T 0 000=   = R*0@R0@x0x x0 k`0` `0 bH0H H0 Y $( P' H& & g& ȊO-cP`PpM U Q@< 2ܒ`2 0 002 @0 00 0 02 0᠂ @=QR ፯PS Z 񏐑,4U WH0 @ QZ;@YbЍU W1 0 @  Y 7:P$U W @ U W0 @  Y 7:P Z3 @ZQ 0@ QU W R 0 P 0ৼe 0 P 0Y 0 0P ⓼QQ 00@=Q % % % % % # $# d؇|# ZP 00/TlP 0/(/ ///H4@,@-`M@lTpP@TL0 @ P@LZ / ĆxA-Q`PP@pR TG 00S@00XS< 0ST.C+SQ1- ~``p 0000  0C ^7ࠃ0ࠓ`0CVs 00000  0C Q700C20L0L L?0 ͻ404 4>0 Ļx l @L A-Pp@KU`, T @ W0``W0 .pPE^p P0070 2000 S037#Q00 ^00$ $0$ g 0|0x| $/ሮo/p/// @-` @0 0DM0<000p2 0*0 RP+ 0 0C 0< 00 0 <0 30DЍed  O-H2HrP0੒ 0 M #r $rgqC2(0B刀B# C@$AQ i!dP`3 @@CB*TJXRW/Y  @0 SP7[0S  `  0T0000000S @B0?R0S2  Ѝ @0 MgP Y W 0 \P@D 0 RPX  @0 HFPWY @0@ @e0  Ѝ: %I$0 $ ԀA-`pPP0S-@ ⮻T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@ꂼ( 0 p@-M P@ ȍP k`\ PPGo4 (0 0 8 30ލpd(  0-@- M0@R0  CIPP * Ѝ@Ѝ/ * Ѝ@Ѝ/jdPRp@- `@'PPVP0 ?p@ED00pPRp@- `@P_P4P0 ?p@E"00pp@-@Q `P?PP0 ?p@tEԻ00pp@-P@dEP p@ p@ p@-@P 0PS <0S P 00p註00pQP@- 0R R  蕻00p@-PP Q@ @Q Q QT0 D32}00pP T0DS@pP p@-PP @P  T 000ZiP IP NP<4@MoP 400(S x  201 0ZnP q V PlЍ 00XS 40Y Y00] V4000S @ lЍ zgk\ 0R0D Rk0 ڐLg{R[{{0S, 0yS0%bQ, 0BSPQk S0 0 {k{'{jP0 00{nP 0 S B ? @ 0,`v@?A `s  Nlv?L\ @, $ [  ``Q0QJ`FKSFZT0StVj[ (q@PN 8xqPI 0 ` 0[q 0Sd P ^n J @U D 10jS*k&0B: @QV  L1D R@0s {{7{8ropono loopP   ! } TLqP8 o@P LTQ0 0`B A0,`AR Q6`v $  z 0BSPQ S0 0U(3 Pe [k{{ER' U'p{jp8k{'PP{WP D$ kPaU U94UP@PP7KaDjP{@{0 $Q0@0 "00 X8 @ 0SAXK @4@\  0@@ T  4T440@@ T(00040Yi 000P  4 0P @d1 @R`4 00@ 00100s^{0 S4@B0G{1kV40 0=0@@400@ SHA4@0@D00@ SIY\E;$0S@dp4@[mP go@P 8 oP( 8an(Z8 8oP8,` 0S  55X$[ 8KnInGnEn CnPopPp,`4opPP  l RVD ۟4ğ [ 0U0j[0S {۴ {:S03:g۸VM{M{ Qk6 C A@{{ {*30 SU{{@0$&00G={۴|Z8,`mmmm m#  B"$ 귻N{@{7{c۟ VM{M{D  Qkf{G = 0V:0:G{G5  0$00tŸ0 T00 0T80` 4< j0@ SV OO@0S46Sl{ q۟] ^q{MM{^m۟MMQ|Q!&P{pkP{'QpU{D倁5AD{k{' DTQQ{ZVEQ85́Dh A5&B@D .{{ *00S{*0R:s 0$0 0 0Co0 0 ꔀT@{0 Sx0G{0V1 400 ' ?A5???H ||N @ p {۴J{۴SR 0,`$8@p8 LPR 5k8l0< @`k0S3 b0A!Fk{1V 40{'05&D [  $J(R  ⋐RЁR ($ 0X 0 0R4040C40kP40~ 040a@,`G 0Co0 0 0S,`0S 0SA [8llll ~lU  V{ *p1 0S3LT gP %46$ $D0[ $,` w R ^@0 @#{{78{[@0"SZD 46SU00jS  U R*k&0B:@{{8{5?55?P9h$ @0,`0D 46S400kS0S0S| mPW mPsD0 U8 9 kR77RXkkkk kkqU D 10jSR-@ R ^% M @{@{7@{83 {B@@U@<q0 ^  l36B#: :@ D0-b)&^@0 ,` 08$V  mP [mP&ݱ 0$H 08$Cx S   0&D @0L  jRq8S" k`Q ?0 00M 0ЍP\ MA-PU@`0pS  qP 0S UDp@-P@}PyP0 S :pSSp 0R:pp808 8e0 $0$ $f0 ڲbX bc8 bA-P`H@ET*AP/ =P4 pPW 0P P B $$P W 0 P l l0l C0 ◲T T0T D0 ⎲< <0< E0 ⅲ8 ba ba ba0 0R@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-r-w0-x0; 006000S wS -S rS  0S /xS  /  p@-^ PB2 p 0 pP P//0S/ S S/0S/0S/@-@ቭ0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 f/] ] ??SQ $0$ $p@-0 R/t]D ]P P P`/AQ/Q/Q Q/?0 H0H Hp@-0 ,Q/?S0?/0?/\ \QP0 ?0/@-l 0  A-P 0`00`@pZ PuZS0SM0@!H@pp@-@P`M P0ES  aЍp 1 0PKZ)0S 0 0 Z0 l[ p[p@-@PpP Q 0S P!0PS!p@!A-PPp X P@PEX `P@`( (0( 0 ௰` xZ|ZO-` MV " p@IV PԭP @0SV F!0 `F`1 Ѝ Ѝ )!` \    t 010/C. *     A-RP`p(M @x 0 @0@0 P0 P0\ P@ 0 (ЍP  X00 5CS  A/0cS#:3 3Q31:0CS! 2#0p@-PP@ T Pp S 0\\0 0NpD0D DL0 T(0( (M0 گ0 tW0 LWO-PM`p 0FV"S00 0\ Pᰪ@P-UN +UP0+ _p"@; P00Es Qa0ESW0EA0ES70EVTPSQ @0U0 V)  `0q 0T00S0 S` 0J0 ЍS T 0P 0ꏱ0 0R0  Ѝr `00XS 0A0C0A PSVr `Pr ` 0 ?0 5gꙙT 00 0M0ЍTt QO-PMp 0GW"S`@P-TP0{ +T S 0T W  p Su?0 0㌪ 0  優 P @p P 6 Q P  S  R- !" P 00Bs ^a0BSW0BA0BS(70BS%| Y[  Q P  S  R!" Ӱ"00̰"00 0S \0F0 ЍS@ `" ?0 0j  0 ꤰ00 R0  ЍS@`` j0T0^ XR" A B0A PR W  pQ ppM @p` F404 4?0 A!W7pp7 Q00 0M0Ѝ p  | 0 Q?0S @-X-- Mw ЍЍ/G-PP`Q VY ጤ00 !PER !U6@  IPG0 PU pWU@9jPp X5 00g  @@pG  p00W  0@00KT0T TB0 ൭V808 8C0 ૭3!t ,OL OA-P@᥯H`H0``@p =T  P ATn p@-@P00CS0 S u P `0 PpW>`u@-@P ߣ 0`00@ޣ0 60 J  M- M ? Ѝp@-PP@ T 0 0 00 pD0D DD0 'T,0, ,,0 'L 8MM'$ MNA-pP@`% V. 0S 0S 0P Q 00 00 R` FQ`00L L0L 60 V, ,0, (0 լ< HLL (LKbO-ß OM4`|@P `pPdh V V 00ܮ/00 Z.` P 30 00 [ !!.PQP\.Q O :!!PH [ 00:[.[<##=[0Q.S7 Y_0IS00X00 I Z  0O * P00 0J ` `0 0C S:: m0  `  ":[ 000(0,$P0 1 !01 `0 $` P00 0 0 41 30)Oߍ Z]00100<4 ~P@Ux x0x t( 07 T.R  :[P u?Vk j hc 4g \IDh DdHBO-ʟ UMMLōj|ŝpP`xU刕 0 0S 0  R0 R R 0p*0`: 0 L5 30UލЍ@:0$0(0P00 0 ?s0ZS#``Po 0@5 0 0@P0 $03/P Z: 0B?o2\0R0S80s 4P0`PLP00 v`V T00 Z@05`F00 0@P0R?D H<0p4X`P0 C 0A`P!0 $03/P @ ` Vf00p0 S(,0XW ,@x TH:0040D000@Q 0 d0H P0S\ Q  RM pp TP@ `BZO[P0 0 0S ! R soQ \ V\pp0XP  70$00W @0ST0 B@Gq 0P^!P" SPSP@Tp`0S 0 0`@D @PC0@P0CS`@:Dp` @ȫJH0T C0 0CS`:庫080S0 S R:  C'SR]0@ 0P}0%L P~J RSNT5 0 <0c@PC0  ,0@S<Y 00`S4 <`Η`` P'0[7P0( 0S 0S @0S0PP( 0@T` *X0H0Q*pK@0`@0,@Hp@0 R R ~$4 0@ 0SG#3 @ 0= 0L0?R0 0 @P0 > ,0@SP D001Q>*0P䣥P P`P圥0` CR00SYD0004D04002<`PeLpქ0`P@ CR00S!@4P`@$03/P `00D(`C 0P0m0P}  0 D00000A뺫 0 0% L`  0 Nύ00>@1s;S00pP`pK 6P 0 c@PC0 , ,0`S@0S00PD000@T Hp@0,`%0%L LP4$P D001Q *0D0P00^P00D(@C 0P00P  0 D0vSD0400 0P9 80 0PݸP  0 0P&U 00S S 0pq8 808 40| നa 0 ;l;G-30BMPP040@ 0 00S0. S @ᬒA~ ` p0v #0G7P @T *X` \"̕T2P 0 <"$2 0 4 30Bލ 0    ! 7@PI `PD 8 0 0@圶PK` 0 00 00000 0d0@TA 0 p pIP  R00S 0  0pW0   0 0g 0  0 0 0 _N 0 G 00S Sy w=ARZ D;:Y X: 88O-PPM@ 0X0 X0 @ߍ0( 0P 4000 00 ` @ p ȕP 0 "00{P ? R R R#[ 0 R@ 0PUI:PE0S[PEi p @ ᥨ p[PEW R 0 0 呩00 R R0 S S poPP  Jo P ᆤP !Tk*0@ZU  0쁟pP`P R R R RZ T4*9P  R`~pp آ U:  PE6XA Hq + PE  W  Ợ U*(P@D `( p@ 0  0ަ 00 ( P@D pa `@0P`p+v `R`P 6 4 $4^@-pp10LM`P0D00@G Lp0PS- @.0 P( U( qp0 0[0  6P 6  0 0 0 D0 30LЍy6Ptpp  @ T@ @0@ <0 [PR a3`Q 2( \22A-PP@M7 q`p@T) X pp00 0 V6P   0 Ѝpp E@T Ѝ6P @, ,0, (0 |_H 10 G-M0`p9@P0P0 V 0   0 pP8Ѝ 0  PP 0   0Υ /A-M`pP@P , 0 (   P0@Ѝ0, 0ЍA-@P M`P@pQ UV'0S9 0S0S9 P`4418(!<P P0 0pP 00 ЍU U, / 0 0 Ѝ0S  0 00S000s S 04 P` @8 808 4 0F0I T/PM -O-DDğ DM<h@P 0 (0P P`sp0 `+PP ,P ,0  0P0ß RR RR 0 Q Q 0 R R 8 $0$0@P`  s p0S S S@ 1Y g*@@P 000S 0 R0 ?@B 0I  R06@DQ1   @Ds T!:  @Dpѥ0 Sq CF P`0  å@D q [p>`SPT* P`64뭦 0  0d!P1 0 <0 30HDЍ(API `  8P@ڢ P1 0 0 0嫦0 J P`00 0 0 000\00 `N`PL @PI p@-M`P@ ),0,0   0cЍpVV@-M@ $$ 9 ЍhVxV@-M`P @1pP0P0 ɠ@0@ 0   @0P0ЍVV0@-P MP@T 0t  P00 000q P 9 @ Ѝ0@T_ 00UU|UC-a@P`PMD UL 1 0`    p 0\# 00 0 L RW0100 L.\3W 00 @Ѝ R0 XS 00 9\0 @ 0 m0 YU0 n0 O\ @ pG W QU $ (,03?00F  & &O-ß3 0,MPQ0$00@`O R Pl PZ0@:T000 0o Tq 04#P P` `@0 nP ` Z[ @ `V pW` @$pTM氐0S T0DE S0 s\b 0DDrD p 0I4 âVA T T\ /00!1 0 $0 30m ,Ѝ!1 0 $0 30a,ЍO@:TP pP :V>Z' 0S 0$ S氐Pq1pJ04 uT TU 0 0@ fL0S k 0@ [A00@ T@$pi@.T`@$pTP\ʧLThD  t$B B <#\D $"@-1 0,M@P0$00`P& V.  0 0 0 p M1P* ᑏ 0 0 $0 30,Ѝ* 0 X0X Xh0 V<0< <i0 BL@ !@ L H!0 !O-ğ lMQd@p0 R P P% / 0 p$h4 0 d0 30lЍHHTHdP`0H ⭡W T~ T0 ⢡ 040 $(,00h1T@ RT@P  0 q0S P q u \P 0SP qI u00 \0S PZAU00@P40@ 0b0T0` VN*:0TU0O "K 0 v0YP?@T$ 0U00S 0S "2 0 d0 30x lЍOu0P040@` 0bu PU 0 S *  0CR00:ႎ80 S8:" 0 /Z Z9 Z@P(1( R0  KP ᤜPP`0P`I0 ѠT T0S 0 0 : 0 0ච00@SPl :0U0@tKT? > D @ < @  PO-ХM@P pP) 500SL ([P U U U  0 Ѝ0` R 0 ? 0[' + PP%P 0;/qp 00P @ P 00 0 00 ˖ЍXp p4,P0  * R + L UY pp 0,P 00 0 SM  00 0;/qp 00`PßQ <`V;0 P0 ;/qp`0 z 00 0`VßR <0`VßpX0P[ Rh0ה0cX0`[MS  00Qe <`800C`V0Z & "  RY`L0i?  `;/qp@ 00 `P  @ P F00 0 `Z 00 [P)0S&: I y Z1!0 y00C02P`T 0S  0C`ß$1$!$G0 \A`V0 Z 0CJ `J`P @0P 0000 00Õ῕[ 0 巕H0H H0 "08:  h d 8p@-PP@` R 0AU0D qV p<0< <H0 Vp0Pp\ O-P$M`@ T\0000 0 00#ppY0 0`' 0`B0S0 Q; `V00S  F 0S` 0 0PP0  0ݟ0  T? X0 00P6 0SW @@RY00S@ 0`V00S`V[* P`Q @ PR  _PV 0Q @`H04 QY0 ϐP, 0 S# H @ P00S T0S S/ S4 T: P@000S 0 0V $Ѝ  P `BV@` 0r ^` D0@@ yW TT SSD D0D h 0@$倔  p@-@PP` U 00F Gp 00p0 60 ҝUd0d d70 ȝ0 0@p0TS00@x txP L -M0 3/Ѝ/0@-@PP M U( 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0D0D D0 yU(0( (0 ox DX 0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 9U, ,0, 0 ., xD `p@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0 , ,0, 0 L d$ p<p@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0$ ʜ, ,0, 0$ p  H ` 0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H00 U0 000 ,00 p  D \ 0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0@ GU0 000 ,0@ <d | %8 P &0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0P U0 000 ,0P X p E, \D F0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L Y0\ U, ,0, (0\ ඛL d  8 e0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L a0l U, ,0, (0l tD \ 00@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0| =U0 000 i0| 2< T (0@-PP@ M T 00vP00 Ѝ0L L0L H0 T0 000 q0 ꄠ X ,p0@-PP@ M T 00P00 Ѝ0L L0L H0 T0 000 ,0 ̟֚  t0@-@PP M$ U- 0S S S Ѝ0003/P 00S00 Ѝ00 0S0 02/ Ѝ0L L0L H0 U0 000 ,0 갞  t0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 WU, ,0, (0 Lꤝ x  A-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP P0P L0 8 808 #0 М n@ X* 0A-PPp@`M3 W< T% rP RP P P ЍPX v 00R X# ЍAt 0 & 0ఙ 0  0ঙW 0  0  P@ J0SP9 @@    (^ _D p@-@PP U  ;p@|L L0L H0 ^U0 000 ,0 S  A-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0 0  0 Xl l0l h 0WP P0P  0ꜘ t H D` (40A-@PMP` 0A UJ 0pS SW ᗔ  dP R`V V V Ѝl 00p0SP Ѝ W`# `0SPVM 0 /0 Uh h0h d0  Pp 00 ꐖ d <| p@-@PP U p@T }P P0P L0 ZU4 404 0 O(# ? \0@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0C/U0 000 0C/d |W8 dP0@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0G/ൗU0 000 0G/ગ h4{ (p@-@PP U p@QX X0X 0K/U8 808 40K/℗p@9ꄒ X xp@-@PP U p@zX X0X T0N/fU< <0< 80N/[p@b , p@-@PP U p@X X0X 0R/<U8 808 40R/1p@8 P 4,p@-@PP U p@'X X0X T0V/U< <0< 80V/p@ꔐ h @-M@/P0.S00ЍR@-M@p  B0?R0S Ѝ$0$ $0 Ӗ0C  R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 /0 L0 00/ 8p/0/ 40/0/O-0 MS P`ȣȓ Rl Q Xg@.P` @Pc X[@RAS0SI <  cSB!  S   XG` #SpP@@P   pGW`W0P@W `0FS0S0S V*0 00R0`FV0SP"P2P 0 ⾕ ЍT S (00`AQQ!X@R P\! C]R% X!q#c!! Cr   "!!1Cs0#"1 0@0Ls 0;S!S" Cr 9" T*00Ls`@S \S X 0@@DQ P`S pg' 0`A0j pg'!"p0`40]j000X.0`0bL L Q O-Pğ@ $MQ `0Xt P`p)[V> ~P @Qa sP @Q`P hP @`VT*` P`Vy [\Vr .V DAv Xt0S Q.Sm @]?Pj `0PCU`PxQM  D P XS  ``/Qj ]QOP R02   0 ]R) PR  "  XSnP   R0 F b"r R` V` v`A ` @R^ .R @㜖@  0D0C  X1(00$Ѝ艖00P  ` < V   \  PS X R0Q  S0 T 4*@DT[@ XS(@ X000… Q ` T`4*@DT[@S X00`t  0G-XAQ@L*p0S% RC @R`P000 0X: 0s00ܠ   \ 0 Sp00 @NT00Y0Sx x0x t0G/⸓AS 0SPQP!00P0Xӕ(0@0 $ RO-P3P#RP3 M0U 0p`\ @X @RI R R5 (00 ЍQ*@ Ġ[? A @ GRPR@\ 40S4  0@0[0Q0A[0S 0 0K/J  Y*@T*0Ph 0A\ R!ɑ" 40S 04 0 L$- M{ ЍO-S@4M p0S0h 0S 0S0^P @^Z \S 0( X S B `$ ,PU P0S @Sf   [@U `PU00 S 0W*0 B>^A ZP `00  K Z0T?\P0` RP SAS^01"0!0\VP`Ṕ(00X0S $0 Q*0F S(0S 0 `(  0AU0S"  !  [)@Z0 p w(  ABQ APAU QpF  p  r  0B>SE0A S0AP`0S 00f(00@4Ѝ R p0S   P\`B0[,? 0,$ @C /Q R!1 0R/ p100 0 0R5 P`%00j,@J0? Q0S 0 |0R/ sX \Q\ @ @0@ <-0ӑD} ,J`} j} Dp@- M P0 `00p @ !yp < 40 0 1 30ލp@; A-P 0 0M `0 10@0 (q]p 0 ph0 (0 0 1 30ލ;@ Q:/R/0S/S:00/@-\@3#* 0^ @R R R {(000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?RE00C>(00/C/A-@P`TP% UVT P @TP 0?Sp 00 (00QSp@-`P@ ˆPP@`V  0R p/pA-PAUQ?UU@A`pP W ځ1APɒ(00Ē00?00Q @-A?SSRB 0@S A襒00蠒(00/-- M/ ЍЍ/@-M@ ,p TЍR/0S0 \ S 0S0000/O-P M@P 0DT"S ` P-Ya +Y Q0Yc T@ @Q :pW`Ppg:pW`P" [-SQ& K0Iq P0aIQW0IAIQ70IS| V[SQ;+ 0S \0J0 Ѝ`Q0YXP A@0L ^P @Ց0 0R0   ЍQz T@@z0 ?0 Y4Lu X00 0M0ЍG DA-00 rMPPp`, V4 @X0^00pAtAg0O `p00TA΀`L PP"&0 @t0 0 1 30rߍX0X XF0 =V<0< <G0 39 $ Lt ds <0   M Ѝx  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ O-@SM ] YXc 0pS000!R !01 /PP E`#3`7P*Q30A 0#1#2#4#8 P 9    U 0C  pSKP0 0@pQ 0S  ЍɐT 0 @00Ѝ808 8@0 귐 0 04hq A-@`Pp0 z0@$0$ 0 M Ѝ T0@p@-0 000St@@@pdPddP=+@P@P 0000 0h t??( p@-P@] p@A-@`P2ppp0php oT  l1<0 ீ  A[ ԡ @-@P0S 3/000S@Dt A-pP@`  F qv000@P p@-@P Ppp@@-@!1BMM 0`PF040@@@ @@F8xqPpU h10S \!p0@  P8A0@ P< 1 0@~!0 0 4 300BލЍ׏P Տ@P  4/P Q Q 0 0~p0 00P 0 0 崏 @W7 @=,$ \D O-qQpMPP Ap@f a@0` RD 00]1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W 0@@00YHQx00p@@gЍPЍ<0 0w}h  ;|:D:: 0@-@PP$M U" 0 P' 00 0 8P $Ѝ0`0` ``0 UH0H HH0 D9Di H~\i G-@PS  RL `10\ 0SA HaHHqP`p #)/0PS-00兑 000S 0 000 00 0 00 0 00 h GP00H H0H D0  <0 pg \dA-pP8 0S@P$0S!0`PP @0S PU @@P 0U00 nt\@ 0@ P 0 000 ,0 ŋ66Xf O-XğdMR  0 S X (4`000SYD@0S00 +0#003 0  0 0(0P YP3s003@0p0VQ QN  QI P0S_ 3/0 0P U@p@ SP00SJ" 00C0T@dЍ`B,@@@U20\ 0,0Sq  R20$   @$(0<0 L00LP 0S 0 <00@00<00P 0 S@$0S(  ( @0PN 1S@iPQ 00C0 d!d1d 0&( 0S X @0!010 ,0( ՊX!1 0( ʊ00$   @$(0sP @$0S(  ( @0@J$  $(0 t85̓ L44Ȓ 3x 3x3 h b Lb Talb (b1d 8  C-@@Ÿ 8MpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W?!1 0 0 30[ЍU00ì?dPER ?\00S T=*0!0 V5 @0S00L0  0sT*0 V @0S00U0Pep 0P[T*0@0S00 V@@W <0Pe 0PAL4 Q@ `O-ϟ M|ϟp `0S㨐嬀m  Yt 00 0S` %SP %0BUSU7(! @jJ.'1  {xYE>]-= 0 |0 30Ѝ POd @040 $ (P,9T-T##P-cR:H-c2S<=  PP 0 0C@aa0C0C Cr  \\x=N>?#c!!"N ,  "bQ-5:bQ , !-#c!!2N 0  T\0 S 0!Y&0`0S00 Y `0  p`0 S00CL  B2;Q/0A!b0dP  Y0`0S00 S 0  B20;Q/0A!b0dP  Y0`0S00 Y0 p`0Q0: 00dP Y0`0S00 YD0 p` 0Q09 00dP Y0`0S00 Sa /1 b !Q 9Q00dP  Yj0`0S00c SB0Q0(9 00dP oYR0`0S00K S*0 p`8`p0 w`-p8 Q0 0dP  ;Y0`0S00 SQ!/ b !Q  '0 dP0  Y0`0S00 S Q '0 dP0  Y0`0S00 Y Q $'(0 dP0  Y0`0S00 YU&P#U"P Q &0 dP0  Y0`0S00 Y 0Q0D6 00dP Y0`0S00 Yj0 <008@0 0D00dPH00L0080 0X0% vYm0 `0S00e YD 0E0 S0ڜ YU0`0S00N S-YH0$ `0S00? Y00 %1?2c 1 R11Aãd0Sâd0CS0c0`4dP 05Y0`0S00 Y 08  8  p80 S0R`050dP03 0 Y0`0S00 Yp0 p`0dPS0003 0Y0`0S00 SY0" `0S00 S0 p` 0S 8 @ 'qp  Xqp @Q 0! S! -Rk Si! 1Q0!Z0S,)@Ϡl  ^Z R SH+ȟY`` ؈ظ v@@PPȟ%ȟ娨 ,H)q Z.xx pȟ5:llX@ $ ^, TΌ3# `_ 0RS@xWCYPP  @E`E`ǟ'ǟG ,D|h(ao[.hgt 11 :Pg,@Dg$ ^, 4Ό3# ` S 0@WP f崆`D0"ʠƌ唖 !@ Ό@|L @R.H pp'q@N @ ᄲ᤭ @ @ , @R Х ) ,  Όܕ Z 3#pP Q 0C   SUD05H 00cP0SL \8;Q00i`@Qq d(8NPn (0, UTA WVH V07(0P@`,0Pp? 00?0S  S   (, 0  9/P(0, SRS@PV0BR00u TKT00ЍWV `Vpb .ER 80Ŏ;0R000;0800S< 8 0S Q{@#Q!Sz RW0ST 0S ``VJFm F|$ 1 S `hp  Z:1 S@PTJ#M @A(0, 0/0S/0 0 6/P  P0 Sj u@Dk 0PE S 0N izßSD >BW@122e3cdPL@. c 09z4#(: 600+$0+>! 0#Â!!!0C0(AX Oÿ2+" ?00 #2>[?W'`FPG`D2#2:#0H"H @r,W"!0 / 15: "  0"#2>"Q0 3 #101`0U15? B4sppp0/S[0 p c 0y!(: 600+$0+>! 0(ad! o`!!!0C0Xÿ81+" ?00 #2>`T[i@t c 0y $: 600*$0*.0$1110B@T0 I:#$B0Nn :E.€Q_uk9"mn1 Sc$IųQ\(\ףp= ף(, + Q(\)\* s c 0^y8 (: 600+$0+.X0(a1110BXt0 o☉;#(0```0 0 cQ @R0!T BqgqgYpC(1 ? c 00"y0,!(: 600)$0!)>X! 0Â!!!0C0x!Xß)" ?00 #2>r/E B 2?A1c1c0R0B 0 2P!502c4"2c2A" "b1C S/  `008P2P":#"0 όB! TY: 0"#2>"Q0030#0000U  PE0 S0  P P$ 0Ѝ@t)1?c 0 0x0t#):60 0($0#(>!!!0C#0Y("1 #2>t<0P0@<`pa0@<0P0@~T 0 @-M0@P T 00t0(0Ѝ 00p0* p* O-`@PM 0S6  V 01? [P+x01#^ 0 01>! 02P"> 0R \ 00!1 R j~00Ѝ0 S, 01P0% V 0"> VPw Ÿ0 1#̀P0PQ V0" RR!Y0h&P l6m&N Q Q@Q@QDQQ@^)OAN h(0$ z$ (0N h  P$j0p 4 h`@(P,0(0^S0 ) P4P"<$1PP TZW [[$p W  @`  0^ ^4$0^$!? K[ (P,004`$ V F̋ nP R S  0A0B 0(1 0S(p=0o R !0S P t 1PpN h &z0 P@PA-RL pBU, "P/ ppcW   $ 5# @ 0hhNO-0@<SP|MJ0@S|Ѝ0S >S`@0FSH{pP [ 0S10ƒ!0 hh "0yY OX10\1001Y <Y30 S0S >S@p1S*S0S -S0 C R`@0F0H0N<)`h0hlpt y|Ѝ*YY -Y00I S@0IS0  S ,S;SQHAL f ;S,Se SlH^(- Q 019mPhj`@019mo\@ `Ko`h6Pc^`@L 9 bp&kg.htlw@ 0 0N\hPy00 @y @ P 1 00@1 00|P00P 0,Sd0(0P 0S  H LɅ bh& `p&g.tl6w6`,p0 `p̴̄$$cR0#03 1`002c2c# b?0cYZ  [  R `pK 444$ cR*($L4P 0 S /G,p`0` 380b 04cP0#031`002c2c3`?0cPpcs V P  P083$;#cP*(3$3401cb008[0 00",` 4p<@ @`pD 08@Z"28#!BcRd:t"cR0#03D 1`002c2c3YTX @R  *PŸ Zcc, Q  \Gce Q!Q*R/ ! !c 0p?0  c@R`(0X$ $ ( 1 0 Y Y Z,`04p8<@@ f>0gΌ t 0HSl0Ű1`,p0 }L}H  ף)\(\{ 3P A-PQ@D 0S! pN,00 01h6l6h`v`P 0:S fP `VpFPW N hq0PPT`V_pHPNLg@P`hPpVE`P  vA-A`P@pP qPPPW7sPqpATW  P>UH QP |1|!0 t0000`0V m``@ v P =D0C0CS\@0d/@D  y@D0P0T0S00#  1PWPࣶ N0I0Uh,ohP@P0P P0p0 000h@ `= ju@S < 0@-@ 0 0!R !; x; @-\F0 QoDv 40]8]@-@P e0#3@e0 ;0 0oP\p@-P`@j R T0U:T0T:p@AptRW@-op@-@QP> 00!R ! 00! \ uP 0B RQ`0 Q0AP R 0 U00Sp8cP#bP `bP0 \0\ \<0 nD0D D0 Wn 00Bp 00H[P[$[A- R` P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ 110L00^ 0A pW \00W00S PA0 SP0Ã@80p@,1! L0  A 0A軠p@-PP@ P a0000p0 0 7n\YC-p@0T@1WP` M Op jHp0S* D!n00@ Ѝ006p Q/p0S 0   p0@p@O-P4M@p `n0  00ShSf  %R0 0BZSZXWUTSQPM'J?>=<;:97310/.,,+)('%#" vrqp! $9 roR V@7VK 0V & 0 aQ S  T 4ЍPP؀PP؀010 00C0B Q$ROLoP00 x3 0S 0V`1!'  x 0SM 0V`1!  x 0S6 0V`1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p V`1 0! xO 0S  0V`1!xX 0S 0V`1!0 *RS 0B Q@ 00B S@@@ x: 0S 0V`1! x  0S 0V`1!    x 0S pD 0V`1!dx$ 0S 0V`1!W V  x 0S] 0V`1!F +  x 0S p (  xz 0S px) 0S 0V`1!x+ 0S 0V`1! x 0S 0V`1!xn 0S px 0S p  0V`1! py xp qp jp& cp \p Up"s R 0Hp0y  V@ `1 | x 0S 0V`1! | xm 0S "pT  0V`1!t ; x 0S4 0V`1!e ; xX 0S p/ T- * p# p$ p7 p#l x 0S 0V`1!'P x 0S p[ x 0S 0V`1!  xi 0S p 0V`1!$R 0@C p7 x 0S p  0V`1!x 0S 0V`1!x 0S bpx! 0S Vp@ x 0S Hpz  0V`1!  x  0S 3pe  0V`1! PZ X PU S PP N pG PD B P? = P: 8 0B Q@ 0 B  0B Q$Rh x R 0p0 V`1@b P  p  P  p pO p P  P  P  P  P  P  P } P x P s P n0s 0 S ~p  0V`1@! P S$Ry@00 P H P C P > P 9 P 4 P /~ P{ *y Pv %t Pq o Pl j Pg e Pb ` P] [x 0S pP  0V`1!p PE C P@ > P; 9 P6 4 P1 /O-@Ο oM M0Pƍ0L@ H@h @0S[ 0L00!R !0w00 ` 0S   R  @, 0 䰍D I/@$吰\ 00000d0X00PU @%U PU `DV0pJ00S00`00pU 0Pv0%10`(P 0 0FZSe= 5^<*2w>rAB~ &P\P    R\00sX @0S Pb?`1RRP`O`.>TQC&iˠNP`G0L,@ \DLt/0@8D@P@N\P@@0@ 0@00e@00F p`A@00F S$V (@D T V4 $P|:,0   S !0S0q-0v0 0SM P 0@TS@@ 0R00S@v0bo,dp @_TP<4P$0000S 0t0儀0@0S0000XX f)8 0 6 30 oލ ЍV_ PP0abv0@T0P0<040%!(R PQ  R8  儠`AVvS 0000S0v00%1S \0000$10000S0Z @DT0 $00Sp0>0 (0PCU80P00P$U0X0Sz v040 0S@@0S , 1 0,040S|00 x0 6 pR10P | 0BD00?R0S 00S 0P00 x0S-0v00s<0 ` `pfL0 p 00 ,@p0\ V '(\;:DP,l  H L  x @ Td)$)^() L H 00d , 0p *B S> !  0vSb0\J 0,0  0R00SK 0 , Xbo wd @kpHXGdXe XPPv0T @P < 4 .00 , 08 * S ! ,0RH0H0x0%1 :0ʌ 0 S0v0\ w0^400<,0 R boRdp 00!.0g0d @H,!000  0g0SQ 00 Bd0G @pH,` P00,0`@4/ eVH0,0boH0 L0p[ ,@_J@@P`Z@P`P`P`[ `*Vt 00F S0 0 `! 00F S PP[$,, 0m *a ST !P 000S%a<0dꌄ 0`w0X0q40S0S00D <0@JT@T ڔ00Sp@0x<`T`FV<0pX0Sv0 00  0`0Sbo `0 0JZZ ڔ0 0Sp0 `Z `FVV0Bup$p@`FV8 0Sp 0P  0(0CZdZ ,t6F0`0 @ p$P`pGWQ\PpGW F p $7 0 R00 (?P$ T0$ڐ` ᄧ   `$@K[0S`0 PK[0 @0S0800@0P$P } 0 S 0bo`R@)D @R0p 0~ D `@Vd RJ? 0PK$V$P9 0F @$Pp`FVQpP)`FV pF 90Q`0v0SP$YP$bd0Wv0 XPPT @P < 4 U0ڔjp$`@PEU 0S` 0WPPEU00S0;0P0BBP;0H0R)p]1P)$U0000S0;000D0 00 `000000S03`V 0D 0 000KS,   H0H0 0 S  ࠡv0,0Sj R@D @@MV[ ,<  , 0)bB000NSn `Vv0r|p @P@ T@P@<@;V}p$p@`FV 0Rp)P1)`FV ʈ  0R`)fd@( ` S , P` 0P0  @   } SH0,   H0p{ Q @   K SH0,   H0phaP)$uYP)$xP TQRӻ PwhP4P $`Y @ @LTT0ᐐ @HX \ P~HX@ P0\@PdP\/? 0, a|00CD0\P@PB$v0~V0t@ 4P$P`@K[0S`0P0(1<0 S+0S cB-0C R)1ھύL1BcR0 0a0  AC LQ@*JopL0 a0d.d>d , 0`H.H>H D, 0`0S0$>00`0FMPSH , 01H S-0`v0͵ 0SB PJS , P  0H000 H0,00,0>SH0,   H0 `4P0S0=00`09P$1X 0p@T P 4 _oPz$J0w<,04 04bo,Xd ~,pHPY$ @ @  S8 , ?  ` S, H10  H   K S, H10  H  S^ ,P  S ,SH , 01H 0z,@pX R <A R R R <PXT@0p_4@`V\zp0v0LzpYP$~w0^40<,0 ^0bo{X `p^L 0 1pP' 0@00S ,hS ,S ,P!SXL"L2L , 0@]| @B0?W0D@H PH ;_ 0 0 0@ 0px_ 0 0 H0PpH0P$` l!l1l D 0]]0@ 0np 0SH0 ( H0n@d SH0,H00, 0LH P0H H0PpH0Q 0@00`H%$x ̈0X#`0#3t \ hX@\D TD>$0S~ `,@4`00F SG@A@00A S$Q0S+ 1 0`0, T P (  SH0,H00, 0_ 0 0 S,H01  0,, H00@ 0p> 0SH0  H0 @ @-@`P MDp&S@0p0 00k0@"S Ѝx* A-@P`p S0 U0@ SO--@/ pj0Pfn_ X  O{(j43):P:00XS Q0p O)AoR^" 0[0 k12000 QS0T0l1 c, 0# Q:|00Q )Q  0 O-M<0 TXHX8@`p00S 0 0Pu0@0P0  DB0SG^P0D= PPb P0 Q DS ZH P 0S S SD `Pb@00@0 00Vp@ !LT 0 PeS5q0 0@00S Z 0 P\Pc R  BPPb SP0E0CSڣ0SPX 0Sa F0 0UX 0p 0 Q U P  U UE^ PLU 0CC10BfP0DSy`0 S0 S C U 0S S S LP@"00ЍRq  BPP+\~ -\  L^ ?L NZ @\ #L@NT @Pl '@Ѝ \ 0P@0Q 0S00 LS S80S #000 0 b@0L"00@C |`P `D21 2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf w0 S_ 0L@"00Ѝ@P0M@E PL `K"V`pKW  ` 21p 7 ` PEF@QP!80Sj80S 000i U U EP 80S800c8080S `T0)  RP!@L#80ST80S P 0 0  B P\ \vj 0`e  BR "@` P3 `2 c 1P5  /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPU 0 BP @` pV  0 BPp0U`980@-- M@ Pc@_ 0 B00C2S*ސ*KU Q6cZ AKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ I0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/`-4-|-A-^0000PbA1 !0T2, l!p(  T2,0N10C#10R! T TNNN1^0R @-P@M: Q @ 0 R Q ~@ЍA-$a$1`pP0MS3 U10AT !0S 0003 y@T 0 0S0 00Ѝ@0!0D1S<000 S 000 tH,H@ 0p@-@P0p R pPQ`00App@艸D `80 0QApp@ص t+H*0  0#10/sP30s R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P;pP   ! H`~P03#01S412s2sS/1J //@-@P0@0O-0Z  @ SMpPA PaU* F B  H  ^'* 0H0C X000300 ZP@T   `d` X`Z P` @T@T 06S @ЍG-0@pR$A0 QPiV'10SP`P\ 00001010i0S l1ٴ zPP4 @p PU `@00SaPP# 000S 0⯴0⪴PU 0C  pPph0☴iV0S <0⍴ ,0R0i 'tq&HUh%G-P0R@T`塢ڃ0TP$ Zp  !p5G0   a!  \2)0L0C\0003R @@HpG \ -0P!1^$23\ *G-0@P@DTpD !1PD*32\ ::P @ P@a0 0S 0S Q 0@A@DpQ$A3 ! V @00S 3 #V0`F`F` 02NS @0@PpP 0!Q@3A! p@-@ AP`DD 0` P0R @ *\ l10D R56 501 P56 +Cp0R `5<#511<?@--` M@P=@P : #z:S 0W0 0 C.G B 50c0 Ѝ 0P c2# R   W C>C0C012`0S0/0 R /@-`ap`@PMA H1P4PP2 pP,0S  Q5 p 0: S.[CP 0uPP0@ 0$  0,  0( 0 0Ѝ"G00Ѝ\PT0T TE0 DG00 GO00 4lPp@-@P O;00CS00 PM;pP0 =0 Dp8O@-@P 00CS00 @ 0  I0 DNPp|A-@PpS 0rSL wS aS_` F 0 \`0S! e C+Sr ^R)# `0S``0[S0\S0TS0USP`0 >0 2DLMp@-@P7 0S= : P00P! !& 0S 3/PP೼000P @ P 00 `嶴00aa:d0`` 0p娴7P404 480 CF 0P0mH{>O-,M0 0 S ! rp2/0, (Q0 Pu @`P@P\%$P 0  CZB 0@PUpWW 0 `PM 0@SP㲀1UJ[K ,Ѝ 0 oPPu/  $`\oPB 0 $ `P# 0@SP㲀@1  P\ \4 \  ᰠZ"[ L`PP  gP 0 $jP@00,Ѝ$`p  0p0oP   fP(q@GT 1S(Q0 @-@ ! \ @,A 0 ,1A0S@-@0@ A00,1R@-@1  @0zA ,!sA0 0O-`̙0S ]MG pPwᱮ@P Uq  @| VAP 0 Sp <* 0ɟ0 00 84  D?@ ?PXP V P0 S40R !Q!3^ pdȟ ^ ^@4; P3lp D H 0$p gP7ɠ3 LJ<,0(E MpQPVNP P  0p pt 0} Vo 0Sl A/ 1 *4+ )4p+́* (4) (<' 0<' .4 .<0 4< <0 4< 0#<  <$ 0 4< $( 4< (, 4< 00,#<0 <400 44< <840 4< 8<0#<< < <08 8 8Ġ  4   4| pp $ <  x0$0 (p , ( 4$,0p ,(048 < 4x0080 < |@ <4, 8p | < , <00@)Ġ| )  p' pJ0  | S!tpH (( x 岠*LL,| , S[,CC r A[W 3pWSA^O  8/@ PG( PC 1DpN8ɠ0  !NV Q5U0 aPP$4Q$媫Px 2R Ÿr@ B 0! ` `]ߍOPZ?P| 0R?p 0 pOpF?PC?Qj>?pW/ <*  8004 D=@ =?pX ??@P ?P?P0a|>> XaܘLL< O-(P`P10p5fS@(Pp5 Rؑ'P- (2 ,0[ D D S 1"1 O+hꂡ P ر % Jd= 1ؑ@-@ 13/, (Q0@-@Q .00 2> 0 O-鸶MS `p & 0Z0 P!U E QX X R Y <<YYY  X>00 Ѝ P 5%0 ܕ !ᓫ@P 0 10$!12fP- 0@S0 200x5V00l500d50 0\50 0T500L500D5000 S S >00P p |ቬ 20 2 80p 0 0aUP U\3UX# 2Z 00 20120QSE  000 1S 0V8pER8`@V*v`V`3w`0 ,P0 "  @-P 1S0S1S -0 29 20 29 20S 28 2CR2S # -  P}P s R < "4 " 8(P0<S 0%4,<%<00.4$`<.,,4<&,| 4& 80<$0480 < (0480<,0 4480 <*$,00 4*,80 < 40P$0SM(PP :A75$P`ppR[9@-@-@ / ?!BC5 @P/P/0 00P /Q0*   BR1$%&'()   " "        "P0/  O-RPMc @T Rp ?o2` qAWsp 0R0Su \023q0W0C 01S 00 10 1pW ` `  0 1 01 p S p pz Vw0S0`S 0U`P @0!13ppGZpb 1 0a`oobS @S 0 =0A0@Ѝ@P  P] WpGq0X  0 @0 A@`0._PЍ001 A0@0@_P0 01\ \Sk W p>`|0| |0 E7_P00@ @0@  027?ݧp글htA 1Q=00/C-A MT' }TP# `P  7嶧 0 屧AT R0 X 0V@T Ѝ0~_P 0 00 0 1 01 0/p@-PXp U@ p p80@]8@@@-!1 0CMM0,40@PP: T10P!,` @ PB*F{0p C{{$p@ kp#   p U p  0 0 ,4 30CލЍt 00P80 P8P@8?00 l~h~Б }O-h@dƟ` TMQLpP w(00 2mU  [800%5 0 L0 30rTЍ0w 0St1S7 'P䁄0  0少0 0!00 BR{?Ⱐ0张:1S ZY0 0P 0尐00o(0S !(( 0P0 0(00U P0尡 1 0C SY*0 00 P U 20 2(0} 0{w R!/*R$: pl 0800 @000S$04p<0<040 pW 0000 H000S$0,`D0D0,0UZ %'P@ 0010EJZ㪠*z0Q* C00C 1! 0Cs0 ! 11 0 0(0  0RG 1S RN  RQB  e'm 2 T  0zpM V'PF O' 0 QIY㩐J*yI Z0 0P000s000 0 1 S0"1! ! {0!10CS`* v00CS010{/10 b0 4`600\0\ \b0 4D0D Db0 4  vvXvhv4vDvO-(0pM D @a0cPX0P P FP1uP0y1JZap@0 R 0 1S@10CS㣰M* 0Ks0S0Cs00 VqS10C1(0 . Ѝ@ Q! R b0 `(0p. 0  jPL p P p 0 0R1 S0C1ȁ2"b0 4Ta Y 0I 1pP(00(0M QPEUP*0EY!:YQTQPEUPi*u00CY Vp崑 (00(0N1!0b 3u00CY*0 p1vPQ Y Q %PP @ PAbPA(00 (0%0!0!0```@0 `p崑P j V%PPe 1P0CS㣠 *0J 14P(00  %|0| |b0 3(00(0 %@0@ @b0 r3s\ sr sxq q0q @qp@-@PQQp %P 0 0%Q $P 0 0%ppO-P,a V0Fh  1$@P `Vp0ഀ0 0 po 10CS0*S0ST P@ P 1!b0 3  H 1zp0FV㴠p1p 0 R 0 1Qp10CS㣰4*0Ks0S Cr   0Z0s00R10C1  % R bP  0! 0 P$ $(0( (b0 2|o onnO-Pp@Q$M $00 2T T 400@$Ѝ(  @i @$Ѝ007ķħ0 0 `Ph  R ft@Y* P 0PbA 2@D @aT㴐: 0 bt@H2Y:@I0Y0*0S0C0x  Pr 0pp 0BRs00010CS0O*SUP@0 #pP 10CS0*SP 1 ]1@0CS0*S#P 1$l ,$fT*TP]@ 20 2$Ѝh5h%hb0 1T  $858%8b0 1 $Y긐Ioᩒ #.`0 @0# OP 0 RH @`|t S9 `V #q,Z@ t@@DXA #q Wt 0G 1(#P AᴀW@DT@:b0 h13#b0 _1 #s # #pPH Pd D3D#D0b B10@W1 @t@ @01p 1 0@1@p01f# "P@ Iy 0  T# "P 0wd2d"db0 1@Tx 9#T z#300m ` +# P_ ,p 0R X #aV@D #a0W! @0F 1|"P> VR  B1r T 崠0@D1 %!0Ist0`崠1 加1 0` " U"P@D 10CS㣐:0 b0 0  " <"PHm,mjTjjji\ihththhgge@e@-@PM 0 0P Ѝ0 50 W0`LeO-Ÿ JM M@Pč`pPg VW00?2$0S 0SNIPIT/ "P U200P"D2 0 4 30Jލ Ѝ$ > 0X0 0UXS 00; Iw0. T:+[) P0K/S  0һ0P00: S 2000S0I S 2?00(1(!(C0 /QP PV# 4- Tp!10S X  \0 RK [ ""P100W ዻp x⊻P 1@om,y Gx p`dcLR Q0P:Q0Q:0@-@-@@ᇝ $ @0$ p@-@)P&#,` P$ p@>g# 0@-@T M 000 @sP 0S  ЍG,# 0O-TM Pp`0H0 @8  8$(4PD 0,0`< @@pLp PP 䢟䒟䂟`p  @$ "dXb`%0# `!,l(a `& `zcna'b(*abf ` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah `猈b,) &`dL(bdl+`|.`lXpp<%cjgpl&`` `ga*aldH(d` &b() `b`j+g .pl\c:%pWpl̠UЍqappePU3 ᓛ @@P tЍf0S 0p-#*'0p 00  \0p@  Cp +T$ /.@ l O-PAPPEY0!Ÿ\M `T B000 0"3*S*s@? N: R\:Y#Y*W6 @s@ T0@P00W@@PZ%YQT!L1 0 T0 30J\Ѝ,!,1, ($ 0,@ 0 0.WZ @   .@ A 0 $ 0, T:YY p p0p l$ 0,YYW@l l LX ` mV @PIya @`FV`: 0 b# @괒 @,  1M @P 0VSRa V0F <2"b0 "괢 @, 1* @P 1ᴠV0CSz`!*v0Za V0F ``f1崠አ!0 @ 1 u@PU1!b0 "0Cs 0 B 0Fs=0!1 `0崠C 1 K@P- 10CS`:p0p pb0 "X0X Xb0 " 84L4433D/DT/@.@P.--h-hx-p@-@`PP 0 00(0`00Q(0pO-@`ൟM, 弡 pPJ 1p0C0SsP7*U/ PrU @t@ @ 0Es0P P 0%0!01@0 @V 0Z @Jt@ m0@$ 0b "0p 0Ѝ 2 @ TQ\10CSP*u0TQ0 0@p P P ἐs P 0㼑 Z0  u00CR 뼑 Z 0I 1epP Q0YPEU0P:434#4b0 ! " @QP@ EPr 10CS@t*0D@ 0" PP` 0㼑 Z0Y 뼑0 Z* P0I 1pP @YT 1 @Dt@ @U0PE1:1!b0 L!1@Dt@U @PE!' @10 v pPP 10CS@:`1`!`b0 &!7 ]8 X@' R11!b0 !0PK{0 1 0p1pP013 P0  &p0Y!0s00 !,+))((( (''R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P L  0 0@ (c! 0"O-@T2M0\0(P 00$` p @ ` pP03?0% 0g#"," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00ЍTdA-pP@ $Q`?PU(7 ) 0(0 0`0$0d0H  03?\0h   08R(@R )P@ b )8  )P8 b} 0A-1?`@Pp @f(X6 @ 0刁0 0$0@pG0($0p. ?W?@`G?`@`(`0@ @T 0 0$ < T 0$ ?pW ( 0$ q0 0$ ?W@`G?`@`` 0$ <@@ T 0$ `R @-/ N@-@P P Ό 0 0@ ( 0"$R @-u/ )p@-@P X00m]\`  0 P 0$$p茺O-B(6TM0^~?D00p$0 0 00(00400000(00,0000,0400080 0<080H00P0H`L<,A0$ @($` P p`p4<&c0<0$)$7'90#%ɠ%'nj) "ˠČ 0#ˠČ@0 ",0  .Ϡ' )00 *$(0 (0'& ( 0@0 0  0 08$  ( 4 , +  ! 0D Q, 083`0~?00L`AHpD`    $   @0 !1P"0?0#`%o#,.0#.,',YW) " g Y i WP&@0D 0 #@0D  H00H0L00L0pGPpP 3WR`G```@0D ;  SP@0D *H0L 0 H0L UpW P@0D q0 #@0D H0L 0 H0L W`G``P` @0D ;  SP@0D *H0L 0 H0L U`R @-|/A-@P` 7PF8pEU@ hp@-@P X00k]\`  0 PP 0$$pxR @-B/qA-@P` PF(p U@ -03?0/00@-<PM0AP@;P񏐽lcl;73/OKGC?;73{wsokg{wso;73IH}zP;DPnE@5Py|{xsrqponmlkjih{xizQPedMl]\[ZYXWVUTSRQPONMLKJIHGFEl[p5P d5P 0P9@0Ġ@ 0P%0H ͍p Hߍ0?CP 0P 0!@ 0ߍ00= @2S, DPh00  p $0Ϡ{000H {働p h0@ P000H Arp DB ? 0 0!@0H Yp HP ߍ0 0d 0 F0z@0Ġ 0P@0ĠT@0Ġ 0e 0b 0_ 0\ 0 0 0 0P 0M 0J 0G 0D E0 D0 C0H⼦P+ FHⶦP% @ 0, G0@0Ġ 0 0y 0v 0s 0p 0m +0j *0g )0d (0a &0 %0[-{ {@ V 0P 0@0Ġ@0Ġc@0Ġh@0Ġ B0. R Hi,h<,~}XL 0$0P@ P0H Ah`0pH0 <0 ,0@0Ġy@0Ġr{G-P8M(p` {{ (@U@W@V@Tn 0S?!Q 0S !Q0Sz Q 0{ 02{r"P 0 ! r R  #|:W UQ VPw  ` 0 " Q!W Up& V P`0P( U    V x! 00@`ࡇ ㉈8ЍV0 `,0S0 0 V0`W Up V P0`000 ␋P0SQ q0Sj Y @d0`0  V }|| d 8 L p@-A0@T 03/@TQPP 00@T 03/@T\%pމH00@T 03/@T$p T   @-@M@P Ѝ{  0{ p P000 0A0  |yx 4 O-p@R M ഁУP `A80 S! 0SJ: K 0 Z 0!80S7  0Q?0 6 0 0 Ѝ 2  Z  0  00 0 P 00  }P00 2  @P   9P  000@-0 P R@MPQ ! 0 013/Ѝ0s?0r? <P100@-@P0U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpG-`P @P0Sp:ؑI Y `1`! { ! PU p @PᦇpP pPO-Mq0 P0 pG 0  PU @P U`1`!   8[ 0PU0  ЍЍ0A- P@@ P 0 a`F 4 P@D pV: gP/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:ֆ080pO-Ÿ2 0|M@R0t00P`Z 00S80S `h"`2 0 t0 30|Ѝ4P  TP8~ 0{1\  {`0$  8 0 0 p`W: P8#[> 1` 71!004 4PU 08  R88P@PX`0(A@ f0 801248 Q!:0 S p808POP8pP 8 ` 0彇`P p80008P0P8m00`hѿl  <н O-ɟ M@pD,\($ 0 PU 0H"4S2S0\90U 4000Dh00Z P.00e d0R 0h@00S d0P00 0CX 0 ?01HI000 p@0 pS000S0!Q0:X Y 0c/d0O0c/J  00S 0 Yp 0 SRPU 00$ R 00"00'p7 0 2 30ߍH2SL708 R4003 4P0P\ R400P4`400刀@ 0  ׆p 0`U:` 66(0I_Vࠓࠃ6048 X00Sr  0\ Y``VP `PP$XY0”2  \8Q(( Q &P`00S 0 SRPU 00$0Sz00t8Qr 4Zx ` Z``q XPF 0SU 0 RpP ZaY0MX  R,c/w0 0) Y2 0 SRd@T 00$0S ,0S  !4$0(0S (0@TP $ | P 0 SR@T 00$0S?00 ZY0 0c/d0,0 p 8Q 0 SRPU 00$0S00c/dp y@ 3X P2 `0 R(SYPR`WY`P2 08@04>tRP@9P0 S (0( PC_oXRPU``  0S0S \40 40 8 \R8 \P0` @ v` 0 SR@T` h00[@ @ hM`㏁(0P`2 ` Z8@P@,@ bY$0SH00B 0X0 0 SRPU 00$0S/@ @ T $ H@  `@ 4  A-`PpX@M@`@000,0 0(000j0@Ѝ脲 @- A0@ @ €1p@-P@Q l0P ! "0 2pp@Fp@-@P` VP$p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/R00; B-ptx` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/@-4!41 0MQ020' 0S0. /!PR*/ "RR /@ 1@Dr0Q R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@  /O-?o2P00#R00,MSPP "[ 0#!    c 0pR UU 0E`U㒦&0@ (UP (  ;/P ;/PbW0 0P``V0c   F BR R  L B@ER !R6 0T0TG SX:P 0C 0 0 0Pp0pSpU0@哥(T **p@Pc`Z* p  Wp ;/P T T  0 X0 W p0p0W:,Ѝ  `;/ 0P 0D  P@V. ;/PW W  00R0 0 R0T 0f:W  000@D`W 0XW   S W 0 0 00   R0 0 S*T % PW  RW 0 P  WF  P  B B@ER !R AH;/P  ;/PM `Q0  0;/P  ;/P0F $0;/P ;/Pڅ00DP 0;/P d;/P ;/PPWAD S  ;/P`  R0 RP 0 C 0D[P 0 9 "! R  B B@ER !R A"! Rw 00ST;/P?P ;/P8;/P~ $;/P$`v ;/Pa ;/P Y ;/P0 0P $;/P`X 0 R0`P@0@ @m0 `(0( (l0 Wꈼ\8-0 M0 ЍR Q0P:Q0Q:`@-闹C- 4PS@ M  $3/`t  0  QP` }4P4S  $3/000 Ѝ300A- 4dpV:@T@T 0P0S  00 S  0Z~@P0`0dp@ B ! A-`M pŚ@P0: St6~PP ˅P@ P 0 B tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0@@  0SL@-  00AS 0~O-4MS{@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0    Ѝ P@ $ 0  QP 1{$R P0)00@000dS0  pq0Vp 0  $6/Ѝ 0000O000Q 0A00/0@-S@  R   0 ^~0SY~p@-@PT @T 0 `pp@T&P`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 0 3??oP//@-P0Sp@M:Q !SV@Ѝ0A 0` P F @Ѝ`T 0 @00O-PP X 0S & % 0S" p@p" a,0T T 1 ! 3/PS00CS@D0 T,0@pVP ?0T` BB \|  i V`!  0 0C00`@000CS0 0T` @pQQ    D R ! ,03/`PIʼ0@00 "R( Y `1`! 00PVQgRJ ,03/`PY M 00CS@D0 T@0Tp   P @0S*V*  000P@DS*`A 0`V:4|0P 00``F0 ``i ~ 0Y0C00 00oP  l 00C000Z` b 000YP sd0d dG0 & XH0H HH0  D00_@ 00[ꐎ|s<@Tsp@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 V0 d\r@0p@-@P0 R0 PSp 0P0, @Kz PEzp< tR0 q R/ S/p@-Q@PP8 100S 0  R 0   p0 0c0'   0R0 0 P @P !|0 0 $0s0 ,0, ,<0 ^ pp ptpp@-4aPP`p@M* W2 T: p pDP0:*C/o" R  S L 0( 0R Ѝ ; 0 Ѝ;0t0t t0  WX0X X0  T<0< <0  8 dtoLo`t$o8@-p#p3 lS0lM@PP0d00B 0 C 00  $#3 0 d0 30lЍ ~0p0S, `$y0P " V000`S0 rrhP0 L"L2L |0 0S$"$`@ ҙ6Pk 2 0FB0/Q/S-,+*)I'&%$#"! 83 )`00 5{ {4{ 00{ 0SP pv 0W 00 ` `` `| |0| 0 ) g`P|  t mkXp@-@0MPx00TayV( y0T1S Ofx0T1Sy0`y 00UTX!\!R Ѝp@w\!x00Ѝp@w00UX\! X\!0 000S/ tp@-0 00PUp@0w00TQxU0` TQUP wpX1P0X1x0T0`X1 th0h 000S/@-@0w0X10CSX1 @wT1Ow0@wP t0 000S/g t0 000S/p@-P@0uwU0 \AQ\ X10CSX1 p@ew`sx0T1Ow0p@Zw t-X X0 04M 0,008 00 0 ,0 304Ѝ䋳 p@-@QP  p@$' 0 90  t,@gO-M8@: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M00 0000@>S@P  !0#00  :P0ЍM00p0 @-0M00 000@>S@ "0!,03,0  P0Ѝ)00@-@ @ 0 00/Ἧ -$0$0 0M 0Ѝ䘯 -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/8 t@-@p@-0@ ,p:pP\g0Pp  //////_ //1O-0pPW`,M 0200000"00 ( 05/,Ѝu@PK 0S PPP S0S3*0! 00S S( #S1 0 0S  0S S * Rp C 0QW001 00 S0000t0t t0 *0X0X X0 @ \ X 8     @AاA///O-44͟ M00P0Q0S$ X Z1 < 0 0 0< 00$0 0%SS  IS} 0p  0GZSZXWUTSRQPMJ5~}|?>=<;:987643210/.-,+J)('&%&#" ZU  {ErW  ` P0,p` ,@     P  *  Q [: R  R0 Z ˄S0CV Z0Ԅ0˄PU*a 0 `CV`F[ 0 [04`V*U 00Gp! 00G S[      0 /Q-0s .0 R0 bp<p*WI 00G S4p00G S-p)p&P @T `v  ?0P 0CV  P b0`PBvp  xp $000qd QP\`P@ 0S  0 S00CN  P ' " [R*  RP  BR BJ0 [4 R*DL m 0 0 000plWp p`  P0`,@, p倐p@  0 00 0p QP`P@0 ,  q QPv @.10d0Q00 S 0 0T0`LV0 S B PF`5 0 @W  0000 +0p 03p0 0pS 0 0*@5 00 < 0   pQ @#2>""d h< 0p k S @#%:PTa`*aA0S`8$0&"j >0dU00`0d? *000D@Dv0 Q 000  0M000D0@@ 0c [  04   BR B  [4 R* R [#*  [* 0Zp˅  W  000 0h0 [0K0"2 0 0 30Ѝ0 0 / D   0 1 0 P I2 000.  @ 0 0  0 :@8 ) s0 0 0e @00r  0@  s0 A@ P0 00 0~0@  s0/ 0  0 0  00p0T0 0 ] @@pD9P 5|l4a D4̚A-@P@ `t0pP@PU J0PES 8/`uX@pW$0$ $:0 p x$P30 0SS S 0R / 0R0@o/ @-oO-((@ CM Mp4čP`v0@ o 0 @0 44 30+Cލ Ѝ 0p `0pKP lt 0h pnL+  =i  08i/iH  Ș,PG-0pS+ S'QU$ X!`@0`S  0P 0#S@0S 0S0S0S%   P V Q@0 R!R  "R0 R R \O-  紀BM⸏xMXčH1 0!p P` X' 0  paP@P UJbGb0 ZP/>PH <0 0 4 30BލЍˢ븚  O-PP AM @ MT0č?2 Y.: px (R`5 P_0#s0S"uPU/ 0 0@T aa0  P PU t   0.aPP D0 0 4 30Aލ Ѝ x (Rp됙  O-M Mϟt p / 0  @T 1S 6 S `1  0 ?l@X@0 0 p t% @0H0 ^0S3 S90PpP@u` R IP' p 0 ] 0P R!R㇓ 3P PpU`@P0ST `u岀0S`V@ 9 S 0S< d - L - @ T p P  Tc0 <0040v?D0\@4 0` S1S < 300S S00X01< 021帑Y[0H0tSp080400SAT <0CP D0PpPPw 0;O8@  P T@R0P MP * 4 <0 @4 D 0 T<0D \@0S  H0SQ -<002p0^ S00H00SS *pt`P|@600P @9/P"8`0 @OPF 0  Pt |*: 0 6 30bݍ ЍpW 4@P{D0Ppw} !ㅂD0Pp0 e  0 : X0L 9D0pd4000S70X08<0PS\0S  P@|U  0`F0P?$P0,0 蘰 P(00E0, ׀P [0.(  QO `1  0 P90 X0L@0 Y  @0}0@0+$0 0 0 SO@0b0!0Tp?A9c!ࡀP >0S :@80P h0P(0@' N  ,@0P@01 Q!  (8 0 zP0`1  0 70TX0 @00 00r  1 01 0@0`1  0 $70X0 @0r0 M 00 X6PW0&0< h XLP 00 @q @1W㲐@D0 `TPv? 0WP G  0‹2 0U 000W    ‹0v@1粐0 0 l5H@X0 0@0! P0D p`@^0P  h0$0@$ t ) (0d00@0g0$0@D$D ^0 AQR `1S9 0   0@ H0@@`Tiʋ |@ A`!!! Q=   30 @| X0Q 0H RC A aV *Pv|@0p t@p6/P񏐠0+S .0CS@0PPPU a0 2|@X0 50`!02 @@X܄i S0\01S< 3`0`00S S8P16 v`0 <P00 `~P101@PDy^hP p ` ~0PW`0P 0D TP Br R D0DI ~PS0d0PPN0@I@ &d06SH[F   ̏C$<̇t\ĂD(ԁ؁ <D$~,~4~ 0]6pSX06H`s DP TP Br R D0D P~P0d0@0P f0 0@! VW0 0R 0`1 g 0 @1l0XP0 6&0R  Uof0!0@! փ 0 P 0 1 X@0&0 R  h uH0S[=00bAf0H"0l"l ⨃6   & Gr R P T Br R D  R,#}Pʎg 0 c0@ 0ZP`P 21011S1G00 !0 x30 X00<0d03d000 3@X@0" &0 R  ;*0 3 X000m0d0 @ 0P e0l$0@t$t 0d0  `0 e0+S .0CSB@0P e0$0@ %  W 0|p0 (0d0wP0 @ @r0|5 @XԂ`e0%0% ǂP0 @ Je0&0& ⱂ꺜/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@}P$Ѝ0 }P͡0ıġ0"c110$Ѝ00@-$MP@}P$Ѝ0 }P͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM {0/1A#b{ Ѝ/MbO-@ßBM M 1Pd$č$p000 S00- 0p } P@QP0l T0h PN0@0A !< S 0 T40 ; P0 0000 ; PPT P00 Z hP10$430KBލ ЍS" Z 0?s0S0Q. Q( Q" Z     gϿ| 0/?r s0撀ZZZC~ $@ @8H{| zzzC-LLP AMM č@`p04" R3 a 0@`  P,8ĝ0  0 0 4 30!AލЍRj PP 0@ .R` @@H D D +?ZX{ y<.z E@yyO-嬡 AMM  čRG|pPLpPG `ȀPPB t @+0,BP7 0S4 `  0S+ 00@ p5P00@S 0S0S 00@ @K @ K` @ D ,0 0 4 30AލЍjy y xX0Tx O-ß CMM`,č@pPX\ @Y0S  .S@0SV:T d10S#0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $^Y000$0D DR @@ 0S+ .S& 0Pʹ0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@1( P/d!  0Sx0h 0@$0000\0@P@Tk0!0$  00$0s}0S 0S XV0 kO0  Xjx w O-p0Ÿ\M P@`$T V  Ÿ!3 0p!100UϿ@ 0V 0 P\Ѝ420;  0 f~VX0 0 0 FWP0swpzXwX0SUPPW   B RX00 0 BWP` ]XZX[X `PFRX0?T0$0 `F 0S0 s BXw?X @X0s8X0S 0   PB0?T0S\0\ \0 Y{P<0\ЍPH0?T0t H T T0T P 0< <0< 80 `n|n n=mmAO-0P䡐 M0S5 @@d@t@`p S S0  P&  P0 PI  P00^  0  SR 0  SRS ЍPd1 00d1 H|P0 |  cP  \P060 P0 | DP  =P090\ |000<|i0:0  !P  P090090|  P010r  P020h  0P0Z^ d@ ?R? # \ 0 2M$ 0P0ZC @ ?R? # \ 0 (32 P+ @ P010  P010n0nHn>n mmLm=l\=lXlk\lPl<h<klkH kjj@-@HMxxbx% |Ô0{ D   0  x{ 0sxxHЍ @-AMT  x0000 006xЍ@@\0@- 0 A0tMT0l00  w 0P0#0> X@ 80 0 l0 30tЍ0@@Txh h A-@Pv 1!01n0SPpuOPp vp0Sp@-Q@U x3s|p {\01P u\01000p_vcwVxXvP //GP //|gG-P`@>V%0VQ\@ 0\!R p Âp p "p O-PL+L; 0MM0500;@00U0XT 0 0Y01'0`,4( 05@ d!A  d!. 0`11110ZP  PJ0@ʏ@z$ p d10 d1r P$ `@ 5[`0D@SH _\ S\  S S00 Q@0S SP C0SQ0 0CQS00000,9,B{`P < 0 @00 P+0<P 1#S;S 0 S# 0(Sz 0(S> 0(S 0(S 8 R 00sS2 S S 0\( H8 R2 S S0S 00 S S SS@@ P `0Z_AP@ 0Q"0A'A+S? 7R2 S S00$R00S 0@0 S S00 HPP0S S 50P PPPPP00H00@06w_ 00 0IPe  PH1H0?:Q@ Q$10 p?  960@`@0O-PA lT,؞|` ܝt̜$`D,>lD>Ě0Ԙ4t99D99@-@P00Q  P    $00<0 0@ ($ $Ĕp@-l@@`VpPPp"0U1pPE1PSp ( 0$ 0p耔QA-pA@PT`QV0HM@P  0P"P` pp``@p7A-p`@*MPP T  000P   li07P7@-@{@0/ 00(/Ȓ000/ᴒ004/᠒00/ጒ00/ 00(/d000/P008/<008/(A-``PU 0AP ppT0APO404 0 ,(0 L'NO/-< <0  M00( $ SQ ЍPP 5@-@P 0`00@0 50 &H5@-@Q V00 2 < 0 G-xsPp@M 02pE T 0S0{00 0  0 0$ -0{폡PP 0` 2* "Z &= " 2? 0  0 Jqp X X 000@ ]h@PЍ <R 2"00@X 2: 2 (iP0 0Z 2< 210 010010 010 0100|100t1003P 0 R00   0T 0 2 13/pTc0-00PP 0`2 2t}00z@Zv@s0S{X} 2: 2l Pv 2 @0 2@0014000 8<,C-@`pQP M Q000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH xP (0$( p 2P ;00 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p  ЍR @-@`pQP M 00U,0`V( 2S * 2 P13/PPF `P 0 p 2P 00 Ѝ  Ѝ|00PO-1PSM0:00 X1*q`I`[ `p@ p W  0 : P tZ 2< 2ЍЍKP O-MXr=*`00A̱P'pP W [K DK@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 Pu 0SЍЍC-"1`S M2:rWB R"*T$* RU  R00U00SR ~0  PpX U"B Ѝ 2< 2 ЍTKP"! ЍG-pZ RbM'*Q* U@0U @ RD0 m P X U 2< 2Ѝ@EЍЍG-P഑p 0@F `` I`!v` 0 !`!0 0CS @Qà>z0S0Cs 0 R 0 1P@10CS㣐3*y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2Xpl0l l0 T0T T0 < <0< b 0h(|(D(hX(LX(p@- @RP ` xPP  pPp@-P`@Q 00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M 00 Vu 2+ RI 13/p)  0! 2$  00 3 p`0 9/P 0 9/P  d0P 4Ѝp$  0qp 0 HP 2: 24Ѝ?p`(0 0,9/P 0 *Yv`G V 1 !0p pGwpIͺ0`v`0s0抠G0Zp01`*0ಠ0`0p00xPP} Y```0S0`0F2"0y 02"0 Y0v`0``FVl*Xv`V \\\2 00 00000``FVK*Xv`> X 1 !r0XAq 0H0ppGwp ]`0`v`s0扐G0Yp01` *0ಐ0X0p0`0 00PP @ 00S;0`0FNЍЍ0 00 0 0 0 0 0e | 00 0k q0$`t0t tb0 fLXĠ|P\$0G-p`P@0R"  0S00 0U@ T9 P0X BPR RQ00S0Ӳ00ô00A0 0qS CY01*s0  0000aUU800C80h0剐CY01*P0L< <0<  00 0 S ಐ\O- @T @P@D(0t@S(,W 0PPI# ᑘP @T @(0@Dt@T `pV T`  0 ʯP``p@-P@ 0^\ ^ P0QS Pp\ p pG-@` 0PS 0S  0Q2@PS"  00S p\: 0 BS P= 0 \P   00(!S$! 10$1P0 P @0弐p 08p 0 S ࢸ10 B\r ἐP  $1 0$1(!"00 O-\0`0CS0P@Lp M P @ U?P& 0 0  eP 0z S0 V Ѝ0 0S0㗗P 0 0P000@- M@ P p10 Ѝ0O-@PM 0 0P`Hpa  PM P0SSD0Z0 0 @ @ 0 pWN0@r s pGW0K*0@p 0@000S p0Cps0W㲀Ḱ0>*0p00ᴀPP D0ZPPЍ0 P P 0  0 0  00 ph h0h d 0P P0P 0H 0XfD}G-Ÿw?`0 (MR$@py2S:0JS _P P崐2S p 6 HP ZP崐7 Z1! BR9:0CS㣠S*z0Y(:101@0p扐0p! 20  2!0 0 $0 305(Ѝy C00C 0 p匦P202 ⋶p 000 p  ` 0u,0, ,b0 Fx Г0A-@pPQ`M n00 2   Q `:1Q崶0" B1"000 VI VFEXBAF?0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* "  Ѝ00Ѝ0PU Q:(0 $P0PU`P<P   q=P 21 sF>@--M0  @ Wh hP 0PSP000S 3/x. WozYK 8 80 $0Q/ $0S/Ğ x L<<0 0R/$ 0S/t ( T4A-@T 0S[p`/+XP0P@Q0@ @@u]_P 0A/P4d P*&O-@$M`h ?T !Fpܴ4$$0Rab    WpV冄BP b0@SFSC|ĕԕ 4@=3 3$$ 3$ $ 3  3$$ 3$ 3($ 3$,$G `3$d `\$Ѝ $  ( ,  C # PU! Pp "P\@P< ` R=PxB `  p  BR wpPG Q]($R0 U tWS UX,$R$ ^[p4 I[p0 W$RD $pR $R !|\&@ $R $[p P$R& U Q R  T$`\&@ @ $;  ` &@ T `   ɇp Up$R UMi[p -e[p P  ^[[p U?@ PzZ^FJ2&\#&S@-)&P*&)&P1&Gw$[VO-@`MpPgg=뤳3#@ @Bp#x3B RP!GP P( .[f@(hPF  H@ Pl<<<<<<<`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X @ނ` `Z`r`T hPP   g`Pd 0)ȱ0V!Xq``pWpP @ 㰂% B RꈜT44 0S ᷹U X Tg0S X  R 7/ P  R v:$ =  $ =  +P0S P`X XFĂ%Ή@-\#&߉x?H .$HO-PyM`ef <0pI00 00 Cp8 PEU( 0R` S 0 0 vPePRP&GP\f0@Sꔟğ̟H0@ SL`t|aP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0Sp 0pSpp1U0;U PE46U& ⟷ P Q6P/[  00010SU0Sppp C C0S S/R 4Up0SBUa(0S0S 0 0 Up !h 0: S UH/[0%T U0: S0( 0 000JPU   0P0 0P 0)f0P @/P050CS"ꤢ$ `c< ` \ `00жPP0S P0Sp 00   B R(\ L` V `,Q$ /0 N!P@`0 !P` J/R  S/R/   C  R: x ` 8 3 0S S/R$ 0 SR& U0sX/ HL!R\0X\!R\ X00: S 巷h C C `T0: S P1: S ,T : S!  Sn  Sf *Y S_ S L0S !ZPN,0SM _XH0(尥 0Z Z80 S80p1p!ppzQ TP!P1: S 00Z0S 80 0CS!800 mXPR X0|rS Y0S !Z0S !ZnUF46&Q\#&^%׊%($H H^>_?p6&ًlf 6tf ? O-@PcTB:@&WAp8464f@(FS[P60` V  \0S0  `RP 9<\4P0805H`40[P0%.(0@\P7P0X T5T%H`}RP8P H04 0, %43/00P08004 r[4a 0V0![P ([P 0 00000 ]@0D 0 ^P0; S @ ,0D(0#!H0`86/,dP0`$mSWT2`` `0NVs0 CS 01#SM[P0 0( ,S* BY"!0 0 [8PH0U 03/p0SDfH0803/p(^P`؂G0 `0d P 0 S * X  %0 $03/0  0-Q3  R H6\0  0 -1/ 6P0 0 0 0 `0d 0 `0d P0$ ,!\[ 0,ؠܐPYZ0     00h0 l 0 h0l   000 R[0 0013/t SZ S>ZXP\`0O ( (0, PU`00 XP\`> ;SF\#&g xF'P%8G' SF'$xG'5G'  LG'(Md O-M Mp=b8844H4 ?p 0 Q 0  s0(0G@-P񟗙\\\\@\\t\\\\\\\\\\\\\\\̯\\د\$4Lh\\\\0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S 4}PU RnR oR0P<0,[`P  ]5P8t}`P,GPPPP VSR8S;d5PuPLa4 1S}H @0R. PV`@0S0H0S 0  ^P P 4R㓥' FM P3mY`, 0 ,0S| 8 RS P0SPuP4PD0S  $QMpP0: S(! خ P` !x0P 0Y/S / J>00$C`İPE@D0p/SP/)P0 S: p  ᬩr~PPUF lN'\#&`A-`P@M\ D 4 0& LP  L LP  L LP  L LP  KPlsh3P0`3P P$PD3( 0P+( P3( P7( P;( P?P ( PP( P EP8$@Ѝ(P (PT"[(0S (P(0S (P(0S (|P(0S (rPq0S JP}!0S0S 2p X`PPa D1R`PU 0E /R .P(嫰PU  Q00,0/00/00CSXl̈P0$0u00S pwA0s00Ί;x'P*&P',Wt%E Zɕ;PO'N'fA-@P[1`p 8p 00S VPcwLP PP Ӱ``ذP D$ 0@MF!\#&)&)&SO-MPa[1p`薟F 8p 6@X/ʼ60S ЍfP WP! PP ` pRP dP ѰvP iP0`0 prPxP ``0`0`$`a  [1ES WBu弅PU :KP$0 S0St. @[*0/S //P0.S0S .S0SZ 4 0 R  @  0P0SP$0pS 0S@ 4`P T\RPP0S <8v50C SV\\(\d\\0$S P P1 00$ @1 0Xv0S $ ?RR00R0SW3 $ 1  @0SX  P ] 0!0 0C0 IP 0S' #.0S 5S 0S 0S\JP0 0~ zX ˯Pt!I0Sm-P h0S 0Sa 0?S] 0SVKy0S u0?S q0SS 1 d000: S0S<0S 0: SHP1 0S!  S/o" R jP SGI 0SI ǯP &0S "0?S 0S0S qFp'\#&ȍ$ H H,<G-P@YD/p8a 6p 1 R1 `0C@P  KpP vP0pꗰHP ?-`0S -WP /P 0S 0S0`HP0-00S  F\#&'$p@-PM6 7 $ 0GyHPyH@wIUITD GP00CW/P3 xVP 30S S! S  3FI \3! d3 00L30S  R ,#6 R #!SR3m 3 2 20S ( 2 20S 0S'002@T$ P0"1@x<xB00CS00  0 < 0S60016 R0S 10S<'U 0PR<V0 01 10SO 10SK("p1\1PML10S H10S d1 X1 0S 160S 0@@1 H01(_ 0S0F0S 00s0S/ 0S 003@`|P@mToኻ@(Fd%x''p(''|']i p%x% l (%t'Di G-@MP WE.2br@@0 S X "H5pC 0 L1 0P|7x HPd+`x HPL+H8 HP4+T; 0DS 00S8 @0xL0QD0@0 0Q)@0SZ L ~PUsa0@S񟗷0l8d@|bFP \gs@@L P zP P 0@0 00 ]@Lj+Lz+0@0 00 0 ϸPL|u D0S hx GPT+HF`#&\#&Bt @ht@ t@1&)@-$#gt3@-'WEHO-M pWtf-l@0o0C?o`DT20<$<4@@@ 1p$4 4 00S ST [@ Y`> Z``: rRPGPP! H@ P$x`hP dP fPvP$@``j1 00T 00; R4 : aP @sA0S #S!Fd2 00 0 `PXL 0pL#>. ɾ P (Zp Rp C Fp Ir0S<0 0@0050C SR@XXXX$XX$XHX[ J@P0S? 0r$ pc- ` p0 R qX  Pp P    3/P00 S )$ p;- t8 pZh000S GF` (%\#&@-7?ll (.HH $O-M MP9^Jp^n^5 00 5D^5005]<:p0 00嶳P 6 屳pP pVFPQ qA@6P񟗹X4@L@0WS }055050p 2pQ Q 0X(tȟS SSy `,q050505484 ʶP ĶP 7ط E p0"S qꐷ 3 p ꈻ0"S hL " py0"S P 06 qpj0z0500~00v01w 00 0s0g0e0c ^ ^  ^ QS00 00055e46V0 "oNFWPE2%R U%RpUQp0%0;aP%5S 0DP80: S0550GSpU%R 2' WUz05Ur"M4P$040G3p`-(`^sPP yC\$iB''%`(ZtTD00000 0BFPP#2 BC0C|CCPc`0 0S #Pqop@B*Sꀺ0#S  B'(D㷠 Q0E?o2?  B `V4HPP'f/ E`sV !`PChGB00CS0 1tP Pp PNU0 P00CS0t0 UH!0S:00S:0J%2U516!1S)1S ePd`d!iBi&%l'Ux-HP 0TP! Y!`0U0w0 PEo0PEUiP@~oP  f/ɸ0 yT  'xPp (v} 1O@-č%\#&< (ZO( ɕ$4 ()&P 4G)&mdn  (PC-O( 0P !@㐐`p@XPF P+`00CS`0 4H@T ЍX0 X @+p1()& O-`@pP0dMԄԔԤ$`(`,`0`4` ` 060p0$@DTlUU!Z  +tPcPSPPPPd @"nP tP0 aP` rUdU 0qAp0#undU4 RU SU" QU040  _npUY [/lUT  +  $A@ $ Bp0 dЍ $3 $ Bp>n 8& 8 Bp( 8w 8V  HT@D$PP`p p -`TEP 8 yBp@P`("(!  "0`V!  P Q !m;0P0mTH 0@SxEpE&xX8 Z. P P% PP%&`V08`8 p@0PZS  ?+ & JF 0`||K Q@-\#&W T ~Dc Dp {D~  |D(     }D    = $? Z P*&yaratcid0O-O-222422223220PaMⴟ 0$00..pa>4 Q2xoPE 0000U1dR0 U% PPL0'p L#pP  PPL0'ppd2SP^APX0: S0d2232d2oPPS|}0 t=s^Pp0SP HL 5dzPGRP 3P@/PA1@P>S@'P6xxxxxxxxxxxxxxx x(xx8xxxxx4xp|@xxPP 8xxxxx,A@P+00I0000k ,2,00SP lp</0d2,042)02&02#02 02@`[`k @nDTaߍ02 20202;/`0pP 0S \+p< 00  R N+p. 00/ `P   R <+p 0$0/ P000S ,+p 0 0 R !+p0$0l0)2i000 0B BnyP 000S 3 S;3ŝ|)00Ti 0l WyP 000SX"\2R4RX2h/pᮦP P@PX0 : Sx9 q `P $/ᘦP D)0 Pk^>`Ph# @p Xq:w\108  W($* |>W #>9A!14'Spp>r03 8  T703D77 P 0@ hQ ST2S S 2S 2S$ 0s  8>p d2SL ?pV X!\1 r\1X! 0 \)02T7,2P7(UJ|T7(1<(rdAedA"5((>(^7(>qL7(,%1 SR Q  RQ!R!RS !14!8!(8 "Z)&7(43-0O-xUM M@ 00@00`p@@H@ 08%z)p0C000005 `V1 0CpP jRP/ ;PZ4$q?ZcPb?oY20S b PZ  jRPP4j/gyScS PS4 TS9 4 Z@T=d CR``````8 ` `  `` `\ `h  000   t 0 )     r Rn : AP[g  [ 1\ P 2S0S R) QnQoQ0 )p"pBp$0P@1  100,"($2$"{4ލ Ѝ ṬP' 崬P" 寬P  fT.@; uXp@. A![;P9pAp300 1X`V  D;p. 9>04P)`CQښ. .a0C 2 0f^(@-_,\#&edAp,< $̆ ?,P*&_(),_(͓H%G+F^(d+v,,_(zd@_(,,,-O-`@ṕ̑Q (p%W㬑 0S 0S p10`VA ㌰P `凰0S H偰@`V-Z ЍyPmPPP fP l5n0@ S  8       L  0 0000000000pBW 0CP 5P5P 9XX/@-d(a/\#&z/O-4$M` Y:P! 9P80pD刔刴00PPPl$k'p3W00S 0S 0S 4!Pp(4 a X' 0S00P 0S PY30S ЍzPOPBP4 FPo YP@*PXXXXXXXXXXXXXX`X$XXXXXX0pXXXXXXX00 P2 P20{00b 0 WYpa=o0` 0P00e @P00^ 0 c  =Op@UP(%p@-D@D)P.@(& %7p@=l( %A-|@|p `(P, 0`8P@@@4,A(%%X$G-`M4PF}ZP@~5P0 rp) P5T5@P Dm5@2@P0"0 0200@ 5 H⼌p HQ S5P   @  p1a 00 @ p0 @ t080<0@0D00P0 0 080$@P  83 HL@P@T@X@\@HPF HB333 0400,0@@,0( 00PNpFPPUPh0PP 0/`ЍH# `r1`;w {=4%;|;::(O-p0P`M(006唖Fp0 "pt6Z0PE `V0SPvPP`@@0V|P 0SЍuPfPFP RPg g@P &%%%%%&%%%%H'%%&0P0 3`0#S lP00 $$00S $ $$00S MEpP `0#S (tP $$0(0Sy  $$0(0Sl00i0P ፥P7q 7q 7 7` @fE[w aL3J30C @RI0cS pS< bSBJJPEU ]P0 0U8U U,P 88 0,3/8 RP cW _D@3Zg 2P"0 0C?oR20S^ qXUJ "r_ 00 0$,0$00S XU 0H '0S 0P0 00010S1 0S 0P0 0  Q00s  1000,0 028y3P7Z @0 $  `3H2&SR @0 #  R3 02  @0 R T X2Pq(00s  K2pp0 @0 *3Z A@-\#&($ȝߝ%E{1&hO-P@`p'M M $PP A p*6춟p0@DT00SfT T!qI@P Xk P㈦e1p`R)0S*  XAP? a@PP񟗦-x/x/8-x/D-x/x/x/x/x/x/x/x/L-x/x/l-x/t----5pP50S $2PX W^눥,PX%000P00 0C 0Tp P  ߣP ڣP*P%  P p ʣP P( ^}p q,IPpq/^00 000#0 00$00 0P @(VPPd] (P(Y@X s2 PP(!|}P( (Y@P `Hf0P 0(`p` qHP 00 00$0 00@PX@P X@PX@P X@P h6P T1P H,P!Pf@ $P Z 'P( (p` P( +P /éPm``ሡ 0V@ Hr0 0<0p` P!P1PF00S4ؠ00 000$00 0 ( 1p-0+0N0Pa0SJ+S'- 29S!S@ 1Z)Y x\W`P'ݍ Ѝ \#&(x,@-٠+$ )- V(zd@(edA p@-P@Ap@-P@@gp@-P@@@-kp@-P@@ap@-P@@p@p@-P@@p@0O-nMM000p4PP 0n0 P BPG  >Rn`> 0 p@7|>?q0SL>D$RX$r R  $t  n⸥t00<4A @0<4x00<$ 0 0p N <4 L!H Y42pPEB@D4TG6666<66<666670766677676666666666(8`86889@99:666@:x::;D;6;6<T<00<@ᴡP t< $y嫡Pt   @< l 0<$$r $dT4S`&P T3 2"`Fx2S H$L4\* _Y``0 L4H$Ϡ2#!0\pH2 C  NY0, typĮp:  0P 0P* dL$H?)"f4 S 0(1?V 6`04$$ST RQ  V  0+p0 `VR00R104Qf ;R040 Q$ Qq*46m(\#&`@-P*& 2dijn1&X i0%`NNP 7ЭP(4Ů{H (ۮ%p, ( 4H_*SL < ,uİ %%M@X? &_mHL4 Q} QQ040S[R0[ 4S$hhP 44崐S04144 0S @4S 0 0@4,4S $4R#1ѣ1,40 0 0Uu V+t R+0S rp@) P+ 0d!t/>0]gKXxP=.X R04ʃ1$4Q :$4#+ `T4S c ,d0<"t/+++ +`+\4$H1H4L1x0<$0@ 0+pt⏝P Z > |P⃝P  4qp   T4 v .0< H'O-0pIM M∹i4, 4pP_`9`4pGs04WZ h  Ya' 4S<44S $$4R0(|*p  h+p  4 SP,0S x0$o $tZ0 0o 0$c P$@ 1Sf  $$4P_*`GWZUCUgDPEUJI(MII0MIIIIK,KIIIdKIIKIIIHJvbPEUUKIIILII@LIIIpLLIIIILIIM6 (&p00( R0C0s0SJ p V044s04?0 00 d0 xp610(00 ,V0,Lj0@" 40 00  0 X0*00 +0L 0*00 +0@0!00  040c 00 h0 (050!00 8 0,00 1 1 40(40SoV00; T$G0P0<$dVh*p 4S M)PP#\$N`P#D  8(@P,4(0(00`V Z 00mp"#8$p = 0țP0 r0 4̛P ǛP#0V3}p$p4S80S4\ 1S 1!0"< 0S,⥛P 3"b~11   $$!0#zYpT2   U$ vpܑ   P le $ t$4嗂s'4S 0<-?X   $tR $4&S 4%X0; 4 44 X  0k(p0UX㤚X0:S Q 4 $S  0 z ~(0S Z v(+!fyX0⫱rX+ꘆ(U@-\#&Ů({% 2n3ۮ%p,( 4H_  4 ,uG-GMM@ph n p40@D@DTQp@@5PSRSSRRSRRSRRTRS,TRRR0!.0u 028PZP ̌p ZPUpȌ 刀ppPt + 8QUpeA\#&F))E1&@)))!`)Bx)Х%%`h)) 0@ @ |0 0PUfPh 0C Se0400000,00(00$00 0000000000 0000000 0^0p 4RC PPH)@PWC >)m8;p 00 HL0%pd 8; 00 L0%pV 8; 00 L0r%p H 8; 00 L0d%p@: 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;P+2(bⱚP L06%PW;"0#10@00 0`K`QH `    ` 0%Pt3K0S PP K0%P& 0  00 3$Pd $0 (Ss``0 $P`4$$ޚ!2P(104d 0`[[[[,Q0Q4QPPPPŚ3d<;SʔT$>@ Tz{ A k::˟c$@ 3TVz{ A k9I:`"2RgdD' { @`30S 0 C' @MHIN2 X0弅)#pU00 ֌@+@0W0 00D8(PT2 wppW O P $2@$PG`AQKY8$Ppjc1{{7 (H{CAZAG.@8HINT{({*X"@T7 }0S3 <'0xPT0T00P0p+t"P h0S ]#t;<000[ Y0 0 |"  'd2"SS% 0 " $@-C6?8~A@@)h)))&]@)`)gH)P*&)Х%< pI1 @S3 2R`P@pUTT0dR?L0 0 0 d20 !  6  `00hl0?ph{{7{{{3{{ {  M@  X 3PŠU h2Y0Ph2d@ f P 0h 0S hj 0Y 3! |N"y<0 0H 00l2 0BS+ (S3; - 0H;'U@P-PZ2!0@0Css0S  0I s0r & 0 1帑;    0; & 0@0 0U |!#<0 0H 0@0P0W 0 0D0 1 J 0 AvP<0[XU QD0 00R ZU |!<0 0H 0@0l  0 I0D T&PPL0ZP )Х%)Cn@))&)>vP7Xu^&D0 Z&0CSn$oHoqqop,pPppppq,qPqtq0 KP Q;lnxnnnnnnnnnnnno oo'&  | &E0募P@0h|xtplhd`0 P; @0 P2 Qoooo%%0 P (% %0 P %0 P` 0 P Q Q ($w u0 P w0 P 0 P 0 P 0 P 0 wP` 0 nP <0 eP T% 08 140Si CS S U |q <0 0H 0@0P2%H &6G`z<%Ql+?QfyԜ))SIZ0KUI7P$DDD0J0ZD0  I)0K9+ 0K:  QJY0KUD03 +Y `tP UD0 $D0J C 4 ḛ GUy\$PDDD0I0YD0 0J#1 K#+ $ IU$IO-M`P@0L-S@&P. @,4 t  p+40SP a`F0pP[P#PijQNpGK PN  ILP@ \3pC d0@SXv|v|v|v|v|v|v|vv|v`v|vlvv|v|v|v|vv|vv|vvL@20SK@HGG 0> 0pe bY /\KZ'D`PjP`0b 2 R J c0 S > 9U+ 0 O!0!00Xߕܕ ٕp4 ,p70Sv|Xeq|` p%0SP0pp@@ 0sK VpJ|`* \#&h' $j"4F:VXGe{< O-PAM M@`WxP lQPd70`W00-S% @P gP2K@ p0K0\Z ;`F0S0`@DDA@Dv  p .6p0StbLpPt63 Q XE 'P -00 `@Z-00  D0B5S񟗊|yyyyyyyy\}P}yyy }yyyyyyyyyyyyyyy\|||y}y} }yyy@}yyyy }} }}}y }} ~00S JP}J0 0w꤄:4P J00i00f`400b `4 ^0S HkJ V 04 R00O3#P H ܃ 6300S P60$010(0.0,0+t0C?o 2R0S0$0]PX\UPP@ Kv00J!@DT3a00@`FrS; RS iS/ tS xSC똒弢+0p 0@00@00S l  08@Th 0S HW#R0B(0/S Gl(0S  0@ ,0S (0S p|1 0h0PhS 4L(0S ( 0@IzyP+Gw 0 P@T[rZɕ*}\#&@-H*% 2@Z 2P*&Y%3,7)&E 8DE2O-PLM)@pPph/ p\?,#@DRQ0I 4$@@0SR)IvP cP SP- TP0(3 LP >d0@S 8DP0D003030800H00 30$30,3C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0qp,4y 0P 0PQT)CJZp3V t`(os`F P% 0SU030#:U 5%P|噩 P l2- TP&T6K/r0 03PvTS0 0S0# G@ctSPEK X: PYt 0 0<6SR46SR 0&2RRPh2 01?tT6S |O P W0`W  0RP  #t!EK/r0 ,6S m/2`P  @0PQ!Vs<6S:46S: d1Q0@6D&S|1 0 00Rl!  H&`R\! $&RP! 8&RD! 0&@R4! 0!Q   @= 녍 @h@|0P*\#&@- )V )I0***ej1&MP)&y:  #8*CejQKQA-Pp`IHM &p10PEU*  HP h0@ S S4 HHIIl1呮d1T1 P1 `q 4P p 1!qTPP ZB Lp$@@Ѐ@(@ @sa MP PҌ0S PxV EP X+B0 0000 \#&@-%p,< *$)yt Ct  0G-`HMp0,&,S,C, p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 > a0@S(8`p@ 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTFPAV ДY 000 0MHЍP 7PPp  aA0S  [q0 `PEPV qh V B`F *@-\#&%)&nG*$C-Mp`ᡋ҆PPF! VF pSPU 6 `V V 60S aP& tP8p6 R h&   p<6U@,V`F V"@T 噆P 唆PPV 0S A@D P`V  tP9@PA@3P񟗹ԤТТТТТТТТТТТТТТТТТТТТТТТТТТТТТТ(<ТP\hТТt|̥ТzP0S<0S{00\0Su00Sp00Sk00Sf00Sa 000@00=00:00SQ@0000.00+0 03e $0S=<0S800S3<3PP0$0:(U 0S# 0S 0S`V Q PF @0S 0S 0S`V UUl宅P \婅P X夅PPEU 8ܨ U3 UUU  U4 @U U0`0 0 . UQa:PJ0000 0 P   3$0S   ,p qp厥*_@T ᄥ 0r"600"$0$P @%P  P`z$^*\#&@-b?+P*&H $ tG-@PpMaM p10S QġPE R ލЍRP fP74pJ*P` ,?WOJTP1 JhP/0: S2  S)J P0 JN@n` 04S00`f]둉0S p J zPJ s@PJ0$@*\#&$!C-PGMM 00M"= <8=8X@8DX€Pp=0D80l8"=`{C0D `XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxx8囀PP   xtP:? 0|>]L  冀P< <@P |P @0P XP0Pl Sh=0 loP4:T{ |hP :h(s\_P 9T(X(i8 e,vP 9h(g40GDS4xp@,$4|`4D4@L 8(VS h8X(T(N T8,J8 J8P 00S= 8 Z=8, ,, ,0 7,, 7H(([$8p[7, | 7L(w+(s P:?@~ 0 D7P(74w[p͂P78x7 7<( 6T( X(L7 6P 00S 70  6t(6 x6P 00S 6 6@p r68p~[p0⤖80 AP 0SL6t pW 8*p(=L+ 5,0 0l5L(5N[` L5`(d( 85uW$5P հ@ y5?Q4LGލЍx5| p,ꔕ0D\<<~0P 0S [ `5Pyp@PxdD8SQ[@4 ZP Ur !rk~t Kd~Ct K\~t KU~|t KN~ K\H~X$TKPB~L$HKD<~ 8K46~ (K$D?W-OD)O&O#O O 0S0SA  ^;@288S2@P R<S P 0S Z ZH2 uN @+q P: B?\, )081<Skf+q P*N90:vP 0XP :@PO|N pNLTD@PHN@ N0@`,r{vPP0@P` p@+q0(@0@000,`40U0 (P<P8_[,8U0C?o20SP ,R  \0,0S Z,8S= ;l,8S F+9!999Zɕ90': ::8 W:)&)&5;\#&\;HL  9N:\:@-ȷ%:+H P*&::][G+::@-:;;]? ;y;e&\&o&z&&;Έ;86t;&;&| 0  z;r;+  ;G-P`0$E!|h|x媀P03"ep2S l P:Uڞh zPH t各9PB/PE0@ *  \pX40pEWQU <4 000`~P L,pPE0S#3 4# 3UPӄЄ̈́ʄEfP :vP303 `pd \1X|PP304lDi4S 4SGiP  r:7] P 4SqR5iPl l f PnRy,p`bG1/΅<01 1> 110101$13h([#2R4`ip`d Pa Q1s0S j^`qЁБgp00l V B/o" R -ipP  \Xh=`S 0 0000 lh1s0S*v`#RS S=?o20 S S lh1s0S 0 S ş` S S Sgix+N N1NN\#&1&=N+dN^ 0L?L)&jN%%qNN++86 MM$1&FE@-@`PDP 1 q pt10SAPX1PH tpD1C@(P 0#P 1 nPbP9P0P 00@0c0@ S VP    h0  X0  H0 T TT ncp0SLjl+U\#&ˆ(% P*&TA-`p1F0[X18X1`0  F1|!1hQda0  ᫫@Pw\1j >0[ >+00. X18X1=0YSpVPMP 6PR ?PI 4Pp㤍N@P񟗯$<HTfP j@PP񟗞@=0P1`<$`F@pԌ}\1F3\1Kw0000q0\1lH 咗@fppcph`0 P sP \1P y0#P\ r0[ ⠪0  @P 0 P O8 Y84'0 "00X1 pxx  1S sP 5c a ⾭] P ⯌:0P S\1@ @ Lp  p 崚( \ X1 Q 0P819:\!p*X1 d pDT 嗚뒘P)(< $X11Z +uPPY* 9Y) 9+ 0)\1 ՖPv{ P jS { 0 09zpHx  W 0S L + PQ N{0S(  X!\10\1808"/0  xX!2sP8"/0 j2X!s"/ `p= X1`  lP%DЙX!\1 0\1 00 8(p 137 ͙ #ziPtwht 00 7ȕpz0S $ϙX1pGWz0ST͙z0S z0 S X1\!8 0\!'zspz0S &|奙fpz0S &H嘙 = P q  厙w喙tg2X1 I S0CpT9 !_p5 P < \1A>\10L1 00 6LUpwlas0L1 00 5LDp(POp ^p P \10\1Q|@)Ӗ#d\1 @0\1 pP  < X1 X40  p` X!\1 $  $$ 43 ⺜p   Kcp 00 4p@|!RX14X11  P+p0v!炚P0!  R!ݘ00|!R00SR\1P xX1 0㌃匓 Q01X: m  ⼙X1  X1PU3X1\!( ; W A? = = 1R@T 0S 0 @堕@ 0S   0S M PpP P ( RW  R   001p0 S   0存PUQR\1@0@k墖뜘`\*k\1$ c; j; : 5$!.? @? [? & : : T%!\#&F? 8 @-8 8 8 l? ? Y$!RB 6 @? ? ? X:E `$!t*? ? @ 6@ O@ ? BB >@ c@ t@ @ @ @ @ @ @ A AA ,6 A A LA `A K; U; \; rA A |2A A A A A %B 8(!cB )&  Q/0p@-x@0Ppp@ P T0*3p@ 0 0$010 Yx`X/O-1!bM0 Mb  [ !1 b0 0 30Zbݍ Ѝ  0 "m !l\ $1w`  $; 0 0 +Hp0Gp( 80G( Gmp` x8_S0؀00 00 P00 @G0 csP x8##[`@*XsP0 l8 40GP>U P0 l8_ rđq@Hq*/ 4T*/@-@v@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.0_BETAxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressnot ACK or OFFERdeclined duplicate addressignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d ÈPНl?Q $ {\ `xx&( l #)/\ 5X, ; 7 1 (F(`!O$ +U\3b|3R 3o3|334,4,4 G HRM Wttyyԁ:H, H5 hhLjhsPΈPӈ؈t; ߈@  pushdnepopdne_`BK?@@G40Kx@@Q$Wd[ @ ^Pd@@߈@@j$unblock and -DNO_CONV?(LD100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink- 9 Oakww@EZ,#6 6_H^HFH<H>]?pPATH= NXV t5 YfndsYcmlr .@ pnv b    EOF reading here (<<) documentzS~ "&*/4fq8=DKRW_gmry}cpg $b}-+?= @ @7UC:=@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.' (0, (1 (1 (8  (0H (0I (0Pp (0WX (0`(P8U Npd@ M%9PEPU)V 2    G Bc g 4& !Em FUn                  gH s E $cػ@ @p, x8 o!HEDKE{O|| $l $`L` 5  5XL$W|K$(-&||v/ sP L`68~={CЗ+XK34< BF#KQ U; o = N,.: <#>* =i =/<Z<6=L=A=4>Z Hx?L?Q ?O,=C<mj>>C&D\LHl.VemZ' >}!&1'+4?DHL.VZbflp{08>CJQX_hox}!(16>DJ>&D\LHl.VemZ' >}!&1'+4?DHL.VZbflp{>&D\LHl.VemZ' >}!&1'+4?DHL.VZbflp{{i 0     "9Nm  6 R  n !#$~ &12 345 68 9 9 : ; < !=#!@2!AF!B!C!D!E!F"G"H"J"L3"MD"NK"O["Pk"Q}"R"S"T"U"V"W"\"a#c#dY#e{#f#g#h#i#p#qstu#vw#x##$0$O$\$q$$$$$$%'%D%\%v%%%%%%&&:&T&Z&s&s&s&&&&L&&&& ' '+'5'M'_'x'k)''''''(((((((A(`(w)(((((()6)>)p)))))*;*o*t*4 *****+(+;+N+Z+}++[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] < @F  < mZ' >}!&1'+4?DHL.VZbflp{returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblockl l l l         @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read6 M%@`gjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-`gwooooooop!p Ppwȏ%H̏%@mtssssstt Ԍ x l Л И  mZ' >}!&1'+4?DHL.VZbflp{vԑԏ%@i 0     "9Nm  6 R  n !#$~ &12 345 68 9 9 : ; < !=#!@2!AF!B!C!D!E!F"G"H"J"L3"MD"NK"O["Pk"Q}"R"S"T"U"V"W"\"a#c#dY#e{#f#g#h#i#p#qstu#vw#x##$0$O$\$q$$$$$$%'%D%\%v%%%%%%&&:&T&Z&s&s&s&&&&L&&&& ' '+'5'M'_'x'k)''''''(((((((A(`(w)(((((()6)>)p)))))*;*o*t*4 *****+(+;+N+Z+}++3y؏%@Й܏%@qx%@ez%@% }%L԰%@8p%SFH0eC쬥~+'SFU0eC쬫~LHah!IdontNeedEFI~~(s*K>; ~|nQn- q+~~|nQn- q+~~|nQn- q+ |nQn- q+&|nQn- q+4=rGy=iG}8C;Mt?NYmWC 3KOOdoyD<#*=(z3Dh&ǎ\ M}-@Mjy֬-чHD-чHlZIчH< IчHF /IчHT:2IчHZ'UL6 %?aafS'@ )Ѹsz*1@ )Ѹ1x )Ѹ%@%backupstore_gptstore_tblH %@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsJXgsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus>0v8 printallmaindo_setifpreferencedo_setifcaps.zi%hyiEEE%̔%HeEE%Q %S x%%Y%H%1h%%:t%D%K%C%J%it @Ǐӏߏ 0@ sJ >  & ,@0v8 init_current_mediasetmediamodesetmediaoptsetmediasetmediainstGHL >0HL HL `@HL media_statusmedia_constructorޑ\X%\X%\\%ޑ %ې\<%#x#x%paddr_matchH<( settunnel!%'Ж%print_link_addressessetvlansetvlanifh%LL%KLFsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrts%x*%$ؘ%#$*%ϖx%Ζϖ9* %%)X%/ %.*%M %M D:* % E X%(%EX9GG7H8l invalid major numberinvalid minor numbertoo many fields for formatffs@{ 48 ( 1 @8 D L á̡ ޡ| -ObK q@}@Ԣ < @F [  <  4 i cN  ޡ " @£ǣΣ bnorripbgensbextattbnojolietbnocasetransbrrcaseins i cN  ޡ  @ " ʤe@: @ơá i cN  ޡ   @ " ʤơ: @eѤ8 @4 i cN  ޡ @ i cN  ޡ  @ " @bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror i cN  ޡ e" @$)# L 3 9@BIQW\W ` '@5 f  @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv"  i cN  ޡ @ơáױGڲ:W~Ck>^%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@BCFILN'OSSadbtcefhikmn#o2rAsRuc@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:H@@R@h VpZp ^pbp P` fk@ p $1м|^t0 Non-system disk Press any key to reboot <hhh@hhhEhhhDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY 7d|7W%O}UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_print  ,:Rak~HHT.:GYay191a1|1LL2=DIbitmask_scanP8 (/4;hw.disknamesfetch_url666sendrequestrecvrequestF+=/=3=7=;=?=***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]a&b *b : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataFG\ ^ _ >h,i r , F, F<,  ,]  ,  ,  ,  ,, ,5 F۞,> Fڟ,H FB,Q Y ,f n,m t P,~ F, < $, ^ ,  Ќ, , ,  ,  ,  ,  ,. ,7 F7,@ F6,J  D,V  C,g FB,r  D, A, F_, F^,collect K  w !E mZ' >}!&1'+4?DHL.VZbflp{NAME=  F @ mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdsmZ' >}!&1'+4?DHL.VZbflp{ edit_fs_type_ext8Z  DC ,C XC V X e e 1LpC eC uC edit_and_check_label mZ' >}!&1'+4?DHL.VZbflp{disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijz г 8 X ر d < l \ X  X  t X ܪ l disklabel_change_geom!!!outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default,,<,,pm_from_pepm_whole_diskgpt_freegpt_create_newP!Xp \ܕx,H@ \tL8L̒< Z'  ~F 8~DlTs 4!12 `gooop  mZ'"l1 2 2 < @F 2 2 [}!2   'D2 *S. l 2 )2 4gpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC쬥~+'SFU0eC쬫~LHah!IdontNeedEFI~~(s*K>; ~|nQn- q+~~|nQn- q+~~|nQn- q+ |nQn- q+&|nQn- q+4=rGy=iG}8C;Mt?NYmWC 3KOOdoyD<#*=(z3Dh&ǎ\ M}-@Mjy֬-чHD-чHlZIчH< IчHF /IчHT:2IчHZ'UL6 %?aafS'@ )Ѹsz*1@ )Ѹ1x )Ѹ& ,4 ?4 W4 &O$of4 ?Av4 G$(4 4 4 4 4 mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new!0!!$!!Td\tпHh 8 T\$(<( mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************F+=/=3=7=;=?=control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2J""dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option9 bkOc>dOdeDD fJ gD hE ihWj^ k$J lQ m.J no5J p׀qM-r@J sGJ OtE uOJ TJ JvZJ w@ xaJ zyqJ AwJ BJ CC DJ EJ FJ GJ HaF IJJ KJ L)MJ NJ OJ PJ QSTJ UJ VJ WK X K Zi7 1K 4"K 6;+K J |{~?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~` $1&` l@!tH!` lD!|H!` 8` ` L` ` +D` N@` ` @"<"8 "cs_path Xa  bc_base_maxF bc_dim_maxF bc_scale_maxF bc_string_maxF coll_weights_maxF expr_nest_max F line_maxF  re_dup_maxF  posix2_version F  posix2_c_bindF  posix2_c_devF  posix2_char_termF posix2_fort_devF posix2_fort_runF posix2_localedefF posix2_sw_devF posix2_upeF stream_maxF tzname_maxF atexit_maxF` 48` H` ԰L`` ` x+D` N` ` 4 !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareg_Ctocg_lstatglobextendglob3g_opendirglob2g_statglob0globtildeglobexp1globexp2_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'@Bʚ;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internalgetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddr_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseekoisescaped_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf__sprint0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_getpagesizeqsort_r__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEXT T  ! $N0`'p8<@HL T 4@`LTX `h p S x |                            t <A x5 p w , hW #  < X4  ,$,( h,h0 48 <@ DH XLXP XT X \ d h l t|    L .  S   \                    0 0$0, 0Xdltx      $,48D             ~! !9!!4! !UP{{ {Pv PvPv Pv Pv Pv\\(!!!!!|   gntsHD rbmn`tcidL,x16l:***** X  yekd91\)l04H]datadHFHloobS`TS!!!!yaraY`$^\XtWHqH]L() ),)H)X)t))))))))** 8*D* X*d* ** *pI ****++4+@+d+p+\+ 7777777777 77(7707D $ 7778|  66666666 66 6777 7(7 0747$ @7D7L7P7D X7d7t7778888!8888!0;<;@;D;L;P;X;`;d;h;p;t;|;;; ;;;;;;;;;;;;;,;;<<< <<<<< <$<(<,<4<<<D<L<T<\<d<l<t<|<<<<<<<<<<<0;<<<<== =,=H=P=\=p========== >$>4>L>h>>>>>>>??,?@?T?h?|???????@@0@D@X@l@@@@@@@@ A A4AHA\A(!<8H48H|4!!(!$!.JLLLLM~ bjj.c5 fh"k1lAmSo_okp|p pqr" utvNwwxx5 zLjzBECJиOڸPSTV VX ZZ)0E QZ b ؈o( t0-us0- xxss t}({{|s{Ȁxss F QE 0yo/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin'}-+?=###%%%}`(d(aEVeFINiLl mCD nf"(p/b6u>ZGRqPs_khvVVtx(@=x%\%d f\qpsU v:$sU0(x8U srrYqW |A He D  G & DV  $= & ] & @] & ] @ V & l & : BJ -  l&  ?  t7  ,A  = m  & pU }  - & C s |h & Xg & P { G & b & 0E  I ' 7  Q   I >' G '  m #x - ' e Έ |h ' 00  7 ' 00 ' g  G $' Z )'  Z j l& & |h 0' \ 8' G  G =' G  TA ߈ D? 6t ? + W ' t. & O  V C' S O ` TL i I' t7  H7 N' m V' F ]' T c' da k' U  Q q' f y'  ^ 0 t. ' ?  Tk ' S mj  e % i o ; o  ,. ' ]  Xb  l- ' ` u t= L t+ = U 8 l '  7 8N  > % i f  @$!r^ &> &DDt 4s @v <<@)G0G!P7 <5GHL >SGM tlGM pGN |G? $GC CGE +GE cG\9 .H0: H0: HI +HI sDHX8X|XQ XQ XXXXXXXXXXXXXXXXXXXXYX YYY(Y.Y6Y@YKYRYXYYXdYXkYXwYX~YXYXYXYXYXYYU&YYYYYYYYY ZZLZ%Z,Z9ZZ@ZGZQ TZ8X+dZXzZXZYZ(YZ6Y[KY&[YH[Y[`[Y[ Z[[[L[\,Z\Z4\GZU\U&w\Y\%b%\% %z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ%%%%%%%%""%%%% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<3b9b>bBb is a directory is not a regular file (use -f to see it)0%0% (de$qe{eekee"e>>Lee]e;e t7e e e f#f2$f86f @fPf \f(dnfzf!ff9ffmf&ff)ff5fef:fh%fg6 g4fg 'g+5g,Gg-Vg.ig*vgg?PgEog/g/g'gFZdg d%He0] uOee ef"e4Te,e^ev8 4e Ce OeYeWmkRkRkYcWbkCkc kG ky wb YMYrWca%,ooob%@X, p4pB%\,Spxpc%,pppd%x,pq%A,&qBqD%($ Wqe%,dq~qqfx%P,qqFp%|,qrgh%,4rSr~rh`%l,rriX%d,4 r s$sjP% LsZsJH%!(,gssk@%H 8%H K0% ,ssL(%$,ssm %,t#t1tn%"`,=tTteto%` tO% tp%H P%, q%,tttr%"T,u$uZus%!t,uuS%!D,uut%\ uT% uu%,v+vGvV%@ w%"0,]vvvx%($ vvX%A<,v$wy%h,BwYwz%L,zww"%< w~x%!4,ww?p%̖ #h% w x`%A8,x(xX%,>x`xP%,xxH%,xx@%( *y8%,>y_y0%, yyy(%,( yy %,z;z%$,T Vzjz%$, zz%,zz%!,z{%!, {'{%!,={p{%( {%!,{{%,{{%,|>|% _|%,p||%,||%,| }%0 0}%!@,F}b}%,w}}%,}~)~%,@~k~~%,~~~  /C#L&}Ujyw '5AImSYe`p]xZdXŀ׀%݀6t;(4AO[gwe{W:C], (press RETURN) ! !' !%%%tags643{}abcdDgGhHilnNpPqrs tw xy !:#=6,`6,-e^H-i^C-k^UK%T%R %De % %F%|C Fd%f F T%C (%C }% D  D% %G FF D%0P ] FF%O `  % t%T%FF%G ` FF%XP a FF4%O a FF%O 0b  %# d%i 4%FF %LG T[ FF %NxG \ $ %; %d%4i F2$%8N F2$%F2$T%F %F %F %F T%F %[%Zct%uFF4%jb FF%f(_ FF%jlG b dg g g uPc H G G XL S u8e g g PH u\W ee dd ?d E ,E 5E H H tH tU T f f \E Shd I lI LI I U T H lO $E TLE D D E D ,D 5D яd (d 8d CHd !Xd 0J J I I  d J xJ TJ i}!,B[v 5p,05;?biv $9H[hmv| %@KVcrSx]$9ZxJ ?e 1<f{pYpjBhK%9 (U|Z'ZH#(8U] L; mj]n1=[|)4 {p G#00U&$h!Ue{4  (Dp6#dX]cm!HL F^4dg 6m +Kh~*:Kh+3;EPbsp "4G\gy!':Nbpq|!$2;Pbk%Fg&5K} ! :               T{ / l u \ 9 i p T  t z +  ~  T0     10 &0' ( ) *>+ , .1/ftp @S .    @r & 1 @ L  6> #ܠ ? 7@ Q A# ( B# ( C# ( D ˏ E # ( F l( G ( H '( It FYd FH F D @ 1uT 1e uT ( ) ) #) 1) ?) M) \) i) w) ) ) ) ]w\$1]Lx\2qB S h E FFFFFFFFFCa a a a a a R a a %a  ^ ~ a a a a g a a &!a a a a Z a a a ?`a tXb _b  b Qb b YN b !"b "1b #=b $Ib %Vb &`b 'kb (|b )b *b +b ,b -b -b .b .</`c /01b 2b 3b 4b 5\6b 7b 8b 9b :b ;b < c =c >(c ?6c @Dc [8\Xc \hc ]}c ^c ^c _c _c `c {c {c |c }c }S~d   -dd-ddTdd:dd:dd ` l@t@`p|#####$$$$$%%%L%%&&&'$'0'8(D(P(X)d)p)x***+++,,,,----...$/0/</D6P;`;l0x0011<<==>>?222 33$3,987D8T:h4t4455 ! " # $ % & ' (  ) * $. 0+ <, H- P/ \0 l1 x2 3 4 5 6 7 8 9 : ; < =  > ? $ @0!@<"@H#@T$@`%@l&@x'@)@*@+@&`'`,@-@.@/@0@(` 1@,2@<3@L)`\4@h5@x6@7@8@9@:@*`;@<@=@>@?@( `8!`H+`X,`h"`x#`-`$`.`/`%`CCDDEEF$F0c8cDdHdTeeX#`#l&|&0$0<LX\p|lx | @@tN   @@@@@@$`,`8<DLT\ d@h  33333333\\((,(H(`(333355555 6UTC33q%r%Pef_`$f_|e_33-339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž|$&$&|$&$& s% 33UU33UU33UU)&h%&)&&& P*&8(&*&)&f-H[[[[[4[66 [[[[x   @ h333333333333333333333333333333333333 33 33T.& "" 0000000000000000 -33333333(33t/&|/&/& (root)`33@%C " " " " " " "lXχOr_"-gw>/;A>q8.ϳJw"_:[y㵌|kyV^}Tp)k*bL ׽3z;o.\4}iqa~ć| c(Sk\#Z??ۼfsmG"ȯEzډ|Z?ݮF>GiREQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+4.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BlHpp)Pa%1!Va%1!$bb%2!g b% 2!tt%P!,y%R!1&"1&"0-"p"1""MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5771 5805 6488 6776 7484 7540 7614 7710 7885 7908 7931 7937 7946 7968 7972 7976 7979 7982 8087 8290 8529 8970 9408 9443 9458 9470 9476 9488 9537 9557 9597 9614 9631 9646 9693 9731 9779 9861 9985 10121 10162 10200 10237 10272 10282 10331 10481 10487 10492 10496 10516 10626 10646 10652 10666 10678 10689 10726 10760 10784 10886 10923 10945 11044 11099 11157 11168 11184 11236 11404 11611 11782 11846 11898 12171 12722 13252 13685 14023 14356 14469 14484 14493 14653 14824 14974 15138 15161 15185 15200 15275 15415 15592 15747 15759 15839 15940 15986 16012 16082 16093 16102 16115 16141 16156 16172 16185 16240 16251 16266 16470 16703 16732 16747 16816 16890 16963 16993 17031 17085 17539 17565 17594 17698 17804 17989 18101 18216 18320 19007 19266 19406 19442 19612 19653 19789 19812 19849 19894 20145 20241 20295 20394 20405 20442 20479 20506 20515 20549 20556 20581 20608 20643 20657 20671 20700 20714 20731 20740 20762 20780 20797 20808 20827 20853 20871 20894 20911 20926 20941 20959 20986 21013 21035 21074 21092 21124 21352 21426 21469 21515 21662 21818 21862 22141 22168 22527 22711 22863 23044 23191 23349 23370 23418 23428 23436 23447 23458 23468 23475 23490 23502 23541 23571 23610 23663 23721 23742 23749 23768 23789 23796 23820 23842 23862 23884 23915 23952 23974 23988 24034 24063 24097 24137 24172 24200 24248 24257 24266 24271 24280 24289 24306 24310 24315 24321 24325 24363 24372 24399 24419 24442 24461 24488 24510 24542 24558 24563 24573 24596 24618 24635 24652 24665 24674 24683 24689 24716 24723 24747 24768 24792 24805 24824 24849 24872 24888 24894 24906 24936 24944 24984 24995 25006 25017 25034 25051 25065 25082 25298 25602 26050 26266 26530 26802 26854 26890 26926 26977 26994 27032 27046 27053 27070 27073 27078 27087 27099 27110 27119 27140 27182 27220 27236 27267 27292 27327 27383 27423 27444 27464 27505 27534 27582 27815 27850 28057 28076 28113 28174 28212 28251 28407 28422 28468 28516 28539 28575 28585 28595 28606 28611 28674 28722 28766 28827 28860 28961 28979 29118 29140 29263 29277 29287 29310 29415 29471 29587 29618 29623 29649 29688 29698 29741 29751 29767 29782 29800 29823 29853 29874 29900 30097 30140 30144 30150 30156 30161 30172 30186 30215 30247 30259 30306 30356 30396 30423 30439 30448 30491 30497 30505 30509 30529 30546 30558 30589 30845 30894 31470 31497 31529 31557 31609 31615 31621 31626 31647 31663 31685 31714 31855 31989 32002 32138 32140 32142 32144 32161 32174 32192 32219 32223 32229 32234 32242 32248 32288 32290 32300 32315 32332 32366 32398 32436 32465 32494 32516 32559 32585 32629 32765 32767 32847 32893 32941 33046 33148 33187 33254 33261 33322 33386 33390 33397 33519 33588 33876 34014 34155 34236 34283 34289 34312 34358 34361 34387 34430 34495 34557 34627 34695 34788 35007 35032 35036 35072 35090 35118 35160 35204 35268 35318 35394 35416 35468 35512 35551 35585 35615 35646 35671 35680 35692 35700 35711 35723 35742 35766 35815 35832 35856 35899 36221 36224 36238 36251 36263 36270 36281 36288 36295 36304 36314 36331 36347 36397 36405 36413 36423 36434 36452 36469 36490 36512 36521 36531 36558 36564 36574 36593 36609 36627 36647 36656 36667 36674 36691 36710 36731 36741 36758 36764 36780 36795 36810 36831 36853 36872 36882 36887 36892 36910 36929 36948 36954 36973 36993 37013 37031 37036 37042 37059 37075 37096 37109 37117 37137 37161 37178 37186 37197 37218 37224 37236 37258 37272 37281 37302 37320 37329 37363 37386 37413 37445 37468 37488 37499 37531 37547 37558 37571 37594 37616 38124 38154 38185 38213 38227 38428 38650 38817 38904 38921 38939 38956 38985 39032 39043 39062 39084 39163 39355 39383 39501 39523 39664 39683 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_BETA. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_BETA ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_BETA ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_BETA InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_BETA ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5768 5795 6361 6661 7302 7349 7462 7555 7589 7608 7626 7634 7643 7668 7672 7676 7679 7682 7804 7989 8217 8737 9088 9117 9130 9143 9148 9168 9187 9208 9267 9284 9298 9320 9365 9391 9432 9510 9628 9742 9796 9825 9857 9896 9902 9935 10058 10065 10069 10077 10101 10183 10189 10196 10208 10222 10231 10264 10283 10295 10405 10467 10486 10605 10656 10708 10720 10739 10791 10995 11203 11394 11454 11503 11771 12231 12898 13322 13644 14069 14201 14233 14245 14423 14620 14781 14915 14935 14968 14982 15051 15164 15336 15471 15491 15603 15695 15718 15741 15800 15815 15836 15851 15872 15892 15917 15931 15955 15967 15985 16195 16445 16466 16482 16535 16603 16676 16713 16739 16815 17310 17336 17358 17465 17572 17773 17846 17930 18030 18525 18763 18914 18948 19083 19127 19266 19307 19352 19399 19643 19776 19838 19932 19937 19971 20005 20020 20048 20081 20088 20113 20131 20157 20164 20179 20194 20214 20254 20271 20291 20312 20334 20349 20369 20391 20406 20419 20433 20445 20457 20471 20494 20517 20535 20578 20629 20666 20851 20914 20950 20999 21090 21220 21273 21533 21580 21941 22091 22260 22400 22520 22652 22692 22739 22749 22757 22767 22775 22786 22797 22811 22836 22879 22912 22945 22980 23034 23059 23078 23100 23105 23111 23142 23159 23186 23204 23225 23247 23266 23276 23306 23332 23359 23408 23436 23463 23516 23526 23536 23542 23552 23561 23581 23585 23590 23596 23600 23635 23644 23675 23692 23719 23740 23760 23779 23805 23818 23826 23842 23873 23904 23925 23951 23964 23972 23983 23989 24013 24023 24035 24053 24064 24084 24100 24126 24148 24164 24176 24196 24222 24228 24258 24272 24286 24309 24328 24347 24365 24383 24606 24912 25330 25531 25771 25955 26033 26088 26155 26195 26218 26252 26263 26271 26294 26297 26300 26306 26317 26329 26342 26372 26416 26429 26442 26479 26493 26504 26515 26526 26543 26554 26601 26624 26673 26914 26947 27202 27223 27256 27309 27335 27362 27518 27524 27567 27587 27606 27635 27642 27649 27656 27661 27710 27748 27782 27839 27867 27912 27929 28030 28035 28112 28126 28136 28160 28283 28364 28474 28502 28507 28523 28552 28560 28601 28608 28622 28635 28643 28662 28695 28715 28735 28951 28982 28987 28994 29001 29005 29019 29031 29046 29079 29092 29147 29205 29241 29259 29277 29295 29332 29338 29346 29350 29371 29388 29399 29421 29599 29643 30345 30369 30403 30422 30467 30474 30481 30485 30509 30520 30525 30588 30709 30832 30845 30979 30981 30983 30985 30995 31004 31017 31044 31048 31054 31059 31068 31073 31100 31102 31115 31127 31142 31170 31214 31261 31277 31299 31310 31343 31363 31412 31512 31514 31579 31628 31677 31781 31879 31920 32011 32018 32079 32143 32148 32154 32263 32322 32573 32714 32841 32909 32946 32953 32980 33026 33029 33050 33095 33146 33205 33274 33321 33426 33569 33594 33598 33632 33649 33673 33725 33776 33848 33914 34012 34029 34060 34096 34130 34154 34178 34211 34231 34241 34249 34257 34267 34278 34292 34318 34366 34389 34409 34450 34749 34752 34766 34778 34785 34804 34818 34825 34832 34841 34851 34868 34884 34932 34940 34948 34958 34969 34987 35004 35023 35043 35050 35067 35084 35091 35104 35139 35156 35175 35195 35205 35221 35234 35252 35272 35293 35303 35323 35343 35356 35375 35388 35412 35435 35448 35459 35464 35471 35489 35508 35527 35535 35554 35574 35599 35617 35624 35631 35644 35653 35674 35687 35695 35715 35743 35760 35766 35777 35808 35816 35829 35851 35873 35882 35903 35921 35928 35951 35970 35997 36015 36035 36048 36063 36084 36098 36105 36119 36134 36153 36698 36731 36759 36788 36796 36833 37145 37322 37399 37416 37434 37449 37471 37521 37531 37548 37570 37629 37787 37811 37941 37966 38092 38110 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_BETA. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_BETA ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_BETA ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_BETA completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_BETA. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_BETASalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_BETAEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.diterGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5656 5683 6259 6619 7304 7365 7443 7538 7578 7600 7618 7624 7633 7659 7663 7667 7670 7673 7795 7980 8208 8737 9155 9184 9197 9210 9217 9237 9256 9279 9322 9342 9361 9384 9428 9457 9498 9564 9676 9790 9844 9873 9905 9944 9950 9983 10061 10067 10071 10076 10117 10254 10264 10272 10291 10305 10314 10346 10387 10400 10525 10583 10602 10721 10777 10829 10840 10856 10895 11145 11317 11489 11544 11579 11830 12235 12535 12804 13165 13345 13664 13684 13697 13886 14030 14226 14360 14380 14413 14432 14533 14688 14876 15063 15083 15162 15260 15298 15321 15411 15432 15455 15474 15498 15528 15572 15605 15628 15640 15658 15926 16245 16276 16311 16375 16450 16520 16551 16581 16673 17164 17194 17211 17351 17492 17689 17808 17955 18122 18680 18976 19157 19202 19365 19419 19554 19590 19650 19700 19991 20100 20157 20254 20259 20294 20329 20344 20368 20401 20406 20431 20447 20470 20477 20494 20509 20528 20560 20564 20584 20602 20614 20627 20645 20669 20687 20706 20733 20760 20772 20793 20823 20853 20878 20911 20946 20984 21237 21306 21361 21422 21540 21699 21753 22014 22065 22441 22596 22740 22880 22988 23173 23203 23246 23256 23264 23274 23286 23307 23316 23322 23354 23396 23432 23470 23507 23555 23579 23591 23605 23613 23621 23650 23667 23696 23717 23740 23749 23768 23780 23824 23862 23889 23933 23961 23988 24041 24052 24063 24070 24080 24089 24123 24127 24132 24138 24142 24177 24187 24217 24240 24269 24291 24313 24335 24362 24374 24386 24405 24439 24472 24493 24517 24530 24542 24555 24561 24587 24597 24608 24632 24642 24662 24682 24699 24725 24749 24762 24782 24816 24823 24852 24875 24898 24914 24929 24944 24959 24973 25161 25466 25897 26088 26323 26511 26553 26603 26657 26705 26727 26768 26779 26787 26811 26815 26819 26828 26839 26850 26865 26896 26942 26955 26968 26998 27012 27024 27036 27048 27066 27089 27134 27157 27217 27469 27496 27758 27776 27803 27852 27882 27913 28045 28052 28101 28124 28148 28177 28185 28195 28203 28208 28261 28310 28350 28416 28449 28493 28516 28617 28622 28699 28713 28723 28747 28870 28951 29061 29089 29094 29110 29139 29147 29188 29196 29210 29223 29231 29250 29283 29303 29323 29539 29570 29590 29596 29603 29607 29622 29641 29667 29676 29688 29742 29800 29835 29854 29871 29883 29918 29924 29932 29936 29957 29974 29985 30010 30188 30242 30933 30952 30987 31017 31063 31069 31076 31080 31104 31120 31126 31201 31351 31470 31483 31551 31553 31555 31557 31567 31580 31597 31624 31628 31634 31639 31648 31653 31680 31682 31695 31707 31722 31750 31794 31841 31857 31879 31890 31923 31943 31992 32092 32094 32170 32225 32275 32374 32469 32517 32607 32614 32675 32739 32744 32750 32853 32905 33151 33312 33467 33538 33591 33598 33625 33675 33678 33699 33745 33800 33859 33928 33975 34080 34223 34248 34252 34286 34303 34341 34394 34434 34510 34575 34669 34690 34728 34768 34804 34828 34851 34890 34920 34927 34936 34944 34952 34966 34982 35010 35062 35079 35100 35144 35486 35490 35505 35516 35524 35543 35555 35562 35569 35578 35588 35605 35621 35675 35683 35691 35701 35712 35730 35747 35763 35781 35788 35806 35823 35830 35840 35871 35890 35909 35929 35939 35958 35971 35991 36011 36032 36042 36061 36080 36090 36107 36121 36144 36168 36181 36191 36196 36200 36218 36237 36256 36261 36280 36300 36325 36340 36344 36351 36361 36370 36391 36405 36413 36433 36459 36476 36484 36495 36526 36531 36544 36566 36581 36590 36611 36629 36638 36682 36706 36733 36748 36765 36779 36810 36834 36865 36872 36886 36901 36920 37465 37498 37526 37555 37563 37600 37912 38089 38166 38183 38201 38216 38238 38288 38298 38315 38337 38396 38554 38578 38708 38733 38859 38877 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_BETA. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_BETA est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_BETA est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_BETA Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_BETAExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5750 5782 6274 6563 7108 7154 7258 7344 7380 7395 7413 7421 7429 7456 7460 7464 7467 7470 7581 7766 7994 8470 8804 8833 8848 8863 8871 8885 8903 8924 8975 8991 9001 9021 9067 9097 9150 9207 9318 9439 9483 9516 9555 9589 9596 9629 9706 9712 9719 9726 9755 9867 9873 9884 9901 9918 9927 9956 9968 9978 10079 10141 10161 10281 10318 10374 10388 10409 10446 10656 10831 10980 11015 11067 11285 11600 12125 12488 12778 13171 13306 13319 13330 13476 13655 13786 13920 13940 13973 13992 14075 14190 14331 14456 14470 14578 14671 14700 14720 14796 14813 14831 14847 14866 14886 14903 14915 14941 14953 14971 15172 15411 15438 15455 15511 15573 15633 15664 15688 15747 16123 16153 16170 16278 16388 16528 16602 16678 16756 17248 17468 17579 17610 17737 17773 17901 17928 17968 18014 18230 18354 18422 18522 18527 18563 18599 18613 18636 18669 18673 18698 18717 18743 18748 18763 18778 18797 18822 18834 18856 18873 18886 18898 18916 18940 18955 18972 18985 18996 19007 19027 19056 19085 19109 19144 19179 19206 19393 19442 19474 19522 19619 19752 19798 19990 20020 20342 20471 20611 20751 20868 21003 21047 21090 21098 21108 21120 21132 21140 21151 21178 21212 21249 21280 21315 21351 21398 21418 21435 21453 21458 21465 21492 21508 21529 21546 21563 21581 21598 21611 21642 21667 21698 21729 21764 21791 21844 21854 21864 21870 21879 21887 21902 21906 21911 21917 21921 21956 21966 21995 22011 22037 22054 22073 22094 22110 22123 22128 22136 22151 22177 22196 22224 22242 22253 22259 22265 22286 22296 22307 22325 22347 22364 22377 22398 22418 22438 22449 22462 22484 22491 22516 22531 22551 22563 22580 22597 22617 22636 22813 23097 23407 23587 23798 23986 24052 24099 24154 24198 24218 24247 24259 24265 24281 24285 24289 24297 24307 24319 24334 24353 24389 24400 24411 24450 24462 24472 24482 24492 24508 24526 24575 24596 24641 24885 24911 25165 25180 25206 25263 25297 25332 25474 25491 25540 25561 25577 25606 25611 25616 25622 25627 25666 25701 25731 25786 25819 25865 25879 25958 25963 26017 26031 26041 26065 26151 26199 26305 26339 26346 26361 26388 26397 26436 26443 26465 26484 26500 26518 26550 26569 26586 26743 26774 26781 26790 26798 26805 26819 26837 26856 26866 26878 26919 26964 26993 27014 27037 27056 27094 27100 27108 27112 27133 27150 27159 27178 27324 27366 27876 27884 27908 27926 27970 27975 27980 27984 28015 28028 28037 28083 28209 28300 28312 28376 28378 28380 28382 28392 28406 28421 28448 28452 28458 28463 28472 28477 28504 28506 28521 28532 28547 28575 28619 28666 28682 28704 28715 28748 28768 28817 28917 28919 28987 29027 29072 29147 29213 29248 29329 29336 29397 29461 29468 29474 29573 29629 29905 30029 30140 30202 30240 30248 30270 30319 30322 30343 30388 30443 30502 30571 30618 30723 30866 30891 30895 30929 30945 30970 31018 31054 31115 31169 31250 31272 31311 31348 31380 31404 31431 31457 31471 31479 31489 31497 31511 31524 31536 31560 31601 31627 31644 31673 31997 32000 32014 32026 32032 32048 32060 32067 32074 32083 32093 32110 32126 32169 32177 32185 32195 32206 32224 32241 32254 32280 32287 32295 32312 32320 32337 32361 32380 32399 32418 32428 32439 32453 32471 32491 32511 32520 32543 32563 32574 32589 32601 32620 32639 32650 32660 32665 32671 32689 32708 32727 32734 32753 32773 32798 32815 32821 32829 32839 32851 32872 32888 32896 32916 32936 32958 32966 32977 33000 33007 33021 33043 33060 33069 33090 33108 33117 33148 33164 33191 33210 33230 33248 33269 33283 33303 33310 33329 33344 33363 33908 33941 33969 33998 34006 34043 34355 34532 34609 34626 34644 34659 34681 34731 34741 34758 34780 34839 34997 35021 35151 35176 35302 35320 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_BETA. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_BETA zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_BETA zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_BETA zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_BETA zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_BETAWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_BETAUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..