08POoj'&<  'OojkP''`'3. 3.Ooj'&P@@<@T 08POoj'&<  'OojkP''`'3. 3.Ooj'&P@@<@TU Ooj`'3.ppyAOojOojOojQ$f OojOojOojRAOojOojOojAOojOojOojAOojOojOojAOojOojOoj?AOojOojOojMAOojOojOojmAOojOojOojnAOojOojOojxmKb$OojOojOojX`hpx@$fOojOojOojU$ OojOojOoj (08Q$OojOojOoj@HPX`hpxR$OojOojOojKAOojOojOojoCOojOojOojzAOojOojOoj{AOojOojOojqmOojOojOoj (08\$OojOojOoj<$OojOojOoj$>OojOojOoj@$OojOojOojD$sOojOojOojH$OojOojOojFAOojOojOojOm OojOojOojPXN$OojOojOoj`h $OojOojOojpAOojOojOoj|AOojOojOoj}AOojOojOojNAOojOojOojO$haOojOojOoj$OojOojOoj@H$OojOojOojPX$OojOojOoj`h$OojOojOoj_$OojOojOojo$OojOojOoj~$OojOojOojAOojOojOojpAOojOojOojrAOojOojOojsAOojOojOojtAOojOojOojuAOojOojOojve?3h-8tTwC[[oRCu( F*[Rb5tH\9y5x_%S׬ #1gCX.r%aQMRS ݅IvvkKin#E>[_TA}3. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4_$4 (99P!!X6X6#118 TTT,,#11PtdX(QtdNetBSDAPaXU SR ffffUSWVP[/-t$$ujPjjjjx0F $uH& Q/tu)7\uk;,s,9rD$t P9P*;s9rLP$06v@ P;USWV [È.-A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]WrUSWV[û,-;$s'$~*u.UE9r^_[]rSWV[l,-(;s9r^_[f$SW&,-5u1ƃ54tЃ$t$k_[SW+-4uYƃ4(t|$<$kt8?t<$k(tЃ_[WVD$0tP>tKj/V[t@Ƹ!!P%PVtt&uVh!h!hdf2諨^_`SWVh!h!hdf2腨 1۸!!P%PpCPrFhdf2j wh$hdf2? uhdf2j jD$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5Dn2^ u$1^_[Vh!Vh!6 5@n2h!j蜌wVh!j\USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S%rtutD$D$$D$% D$t$@N D$l$hHn2h $D$ @l$0tD$Ph#ӝj D$  |$\$4t$,s$L$)L >QPh!蓝 D$  L$s()@L$L bQPh!eL$ D$  s D t 4Ȯ%h!9L$ D dtPh!D$(@9XUf\$D$T$T$9tt$N9BD$4Ȯ%5@n2h-!Ĝ 1h^_[]t$|h!y%WS$hA!h^!j襃U5@n2h|!j躃t$|h!5@n2hq!3$h !jhc 5Dn2PU u15@n2h0!jdSWVPD$Hw#t$>%Wit ub%$h%!Wit N1AQhc5Dn2T u 1^_[5@n2hE!jςUSWVP|$t$7{(hA!WV| fu <;@n2u _2)u @n2uhD!AL!t @n2hjQt Dn2u 5@n2hU!Ihku3$(\%SUht uUh~!jh^!j$NPVSd% PlVdf2PhY!VU Vjjh!#1`%\%h!hdf2  uj5Dn2tWVοV% htuVh!j%^_VPΉj PQ x $9u^Vh!jˀWVοV%gtuVh!j蝀t%^_USWV\$$1o2 n2o2 o2sV2j=P.x<$hjjh%U o2H F H o2VP3uo2t;#=t%{ o2##=uthU!Lo2tttjut!tcuo2H o2^_[] o2jVh!W Wh !4$h!4$h%!jho!h!D$L$01e1PjPjt$h#܊o2n2o2o21PjPjt$h!謊o2o2h!j~1hjPPt$h!xo2o21PjPPt$h!!T,1tVj o2u$1PjPjt$h,!o2o2ËD$o2h=!j}1hjPPt$hS!މo2o2h_!j}o2u$1PjPjt$hv!褉o2n2ËD$o2h!j}1hjPPt$h!fo2o21hjPPt$h!>n2n2fSWVo2t/ o2o2 t5xo2)փ>8F uxo2n2|o2 o2 n2n2;n2 o2r*jUn2xo2n2 n2 o2|o2^_[áo2 |o2 t n2n2h°%h $jg|h°%h $jV|h%h $jE|h%h $j4|USWVt$|$6"d"Sj SVW u=_2P]o2u,o2+/$o2o2ذ%Ah!j{o2ذ%1QQP!n o2y 5o2to2 to2 =,1ro2uhQ!롡o2u# o2o2!o2ذ%1o2Ho2ذ% hQPm o2yJ1o2H o2 hP5o2Q o2 o2y 5o2n2n2o2utS1V o2o2o29o2rZ to2t= o2 n2@ n2t# to2) o2I n2 to2ujgn2 xo2n2o2 o2t o2 o2t o2h`u;5o2 n2=o2 o25o2VP5 o2W o21Vhho2+hj]hj\5n25n25n2n2hԲ蟎-,1`o2t%0o2(o2 4o2 ,o2;o2 o2ss$xo2 o2tQj QjPK o25o25xo25o2P$ xd5o2-o21‰1 o2 o2=|o2 o2(o2,o2=|o2 o2o2 o2xPh $0,o2u6o2j5o25o25o2P  t5o2h $o2 o2o2 o2o2=|o2 o2(o2=|o2 o2,o2Co2s o2o2=|o2 o20o2=|o2 o24o2u@s)tPo2To2H xo2PQQJ o2xo2o2=n2 n2j1o2|o21o2o2h}!j胈Ph $jvWVo2=t=H=ju <o2n2 n2t;n29щ5o2s))Rj5n2H o2 n2n2 n2 u\5$o2= o2 tJ5n2j5n2RH o2 n2n2 n2n2ʉn2)Ɖ= o25$o2 t jY= o2uo2jPu =d8u*o25 o2Pt^_h"juh!USWVn2|$,tn2n2(p‰D$l$|$,u o2 xT$ $o2 o2 t!o2jQP5 o2R !ƒ~t$VShn2 $~ D$ `\c18D$ Z $o2 o2 ʋ-do2`o2t>5o25n2QPXo2\o28o2=o2u =M=o2ui $?$T$SWt$t$%?É>=o2u=o2vXIF0ƲPhX#hdf2_r h!' F0蝲PhX#hdf26r h!N^_[E0hPhX#hdf2r hh%hN q2uáq2u tjwGjFUSWVj譇Ƌ|$11K< @u=,p2819~vRO9G9~-81(p2~Z(p2΋Nu#81)Ou9~81RN981 Lp2u q2uu81^_É1jDjDVT$(p2t=(p21(p26(p2t@9uхt(p2uha!%hK1^SWV1q2Ds2j?eh]"7!tWM6t|8/uWh=!WhI!hPp2 Pp2tLP|t$hp!P4Hp21ۅu@WF5Pp2h $ys!jhV!PJVd^_[VHp2tAPc7xGHp2Pp2t!P3|5Pp22Pp21 q2uq2utj8}!j&7WV q25q219}'q2FىDuw9@u1=q2^_USWVD$L$9tVq2r=q2~=q29 t9|1Cq2Mu9|1Cq2=q2 9u^_[]fUSWVl$}!uEhM"P,UT1hM"PaÅt*t$Sǀ}!u?SE=50苡PUh(%hdf2#ah!=eSv*x(=q2uWh+!hdf2` 5s2+t$040PUh(%hdf2`h!=^_[]USWV |$$Wơq2$Ds2D$,s21-q2-Ds29-q2t\$=s2t$ gDž~w11q25q2Y6tss2PPjJ Å q2uq2t$ Dž|$$\$9t$utt !<$u=q2t!!9u Ds2 uhdf2P9¡Ds2Ƌ q2Ӏu1A9|$t $ q2 Ds2q2t )) q2u q2ut j4 ^_[]j3USWV1|$=q2t WrGHOHt uG `-q29}q2Vq29rFU5q2/-q2q2 q2u q20u Ds2F8W(<1ۍF-q29~Nq2 q29wUQ~t7-q2q2 q2uq2uhtkq20 FX10՝PhX#hdf2n] hh%9 q2q2j2G @utLq20 Fq2800YPhX#hdf2\ h!Y9-1q20=Ds2=q2  )Ɖ^_[]js1USWV|$?!uGh""P%t$WI,VP\Åt2l$t$ US NjD$8!u?S6=/0|PWh(%hdf2\h!{8mSg%x-=q2uWh+!hdf2[ t D$ )@ʼn3/0 Pt$h(%hdf2[h!8^_[]USWVPl$Uƃ=q2t1ۅtf;l$ `1V$th~;-,s2u=Ds2t =q2u8 GWPt$ F x4EEs @6;l$ |=q2tt$$$^_[]USWV|$\$l$19t[=q23t UPrUPOzFyb.0ߚPhX#hdf2xZ h,!61^_[]USWVP\$5(s2FEx @u}|~PVq6tjq29~lq2q29SPzgƉq2q2 q2u.q2_tO5(s2;^_[]Ë5q2W5(s2Vd . ,1xщǃ|$uEs2| /5q29$~Zq29V5q2zcÉ5q2q2 q2uq2t q2W5s2U ,$+HPS5q2D( |$tM1BDžhc!4H,0ŘPhX#hdf2^X hh%41 q2q25q29} q2|$Nq2q29͋|$|MVPxt05q2q2 q2u q2umua(/ +0PhX#hdf2W hh%4 q2t1q2uj-j/,SWV11e2H e27he2!u8e2@%fe29ue2H e2ÍF=s29~Yq29wW5s2w=s2s2 q2u q2t s20u Ds2F  s2C4*0豖Ph>!hdf2JV hI!2%e21t s20s2(s2^_[)0UPhX#hdf2U hh%U2 q2uq2u tj_+j*USWV\$ D$1tt$h[!SD$ l$1uHD5f2J f2;$f2у  f2Q f2;=D1|h f2h$g1GD5 | <\t<f2H f2;$f2h f2j\X f2H f2\\5tjj Sh`! tVG`!)Ȋi!f2J f2;$f2Vу J f2Q f2\$ !0f2H f2;$f2h f2P^W f2H f2D50 f2Qf2ɋ\$ ; $f2h f2PW f2Q f2D50 f2Qf2; $f2h f2PV f2Q f2Dh f2QV4 f2Qf2; $f2~;ȃ t3 f2Q f2D$F9h f2QQVh f2P똡f2H f2~ f2H f2 h f2j V1^_[]fWVD$L$L$$$0F| $ |r1q2hr!t$t$ ] ot9EtzSq2ǃxtostypf<;r2먡_2  $)D$|$ta$8-uWq2D$|<_2bq2S q2Dq25$L$jjthj^1FhVMVjBhj3hr26ƅux'q2|$t$8t$0|$t[hdf2hz!R$8u h!_-jAu$hdf2hy!h}!--y =q2ths2hX#hdf2P r2tPh $Nh f2Q xt` s2| s2x51gs2QPP M=s2=q2hdf2hz!#h!:,j%e2s2hc!,%e2΃t0hdf2hz!j515s2hdf2hz!}h!+VwQ=q2ths25 s2h!hdf2NjrjkPht%hdf2N jE=q2junhs25 s2h!hdf2Nf$j0yjt$8!$h0hq2 uhs2hX#hdf2N jL$ ɸ!q2Phht@j x#$r@1D$ rD1ËL$=q2t1@ q2Ql"L$=q2t1@ q2Q#WV1F=q2t9|$ ?!t!h"Wvtj/W'th!)1^_s2s2 s2$s2x>s2 s2 $s2 s2 (s2;t,uQ(s29;us2빋 s2| s2 s2t9t$s21Ƀ USWVPm2(s2DJ@t t@(s2@DJ@t uHH (s2~Ã=w$%=s2!hD!  !=s2" (s2A1Qptntl  Ӊ (s2A˃=s2FP”^ U (s2@߈\$ ̀1ۈL$QuH (s2H1KDB@,Aǡ,s2 s2  Pj  5,s2j$1  ˣ(s2@̃=s2t=q2y=s26DB@jLǡ(s2@1Hptntl   ˣ(s2@̃=s2DB@8!h0!=s21Hptntl  ˣ(s2@̋ s21PptntlN  ӣ(s2@̡s2HQPN"(s2@1Hptntl%  ˣ(s2@̍H (s2 s2 p1Pptntl   ӣ(s2@̡s2PPv (s2A1Qptntl  Љ (s2Aˡs2PPH-$s2 s2=s2= s2 9=,s2 -$s2 s29 9w hu! s2PP (s2A1Qptntl  Љ (s2Aˡs2PPl@ (s2A1Qptntl  Љ (s2ADB@;h! 1ЍrЃ sOj h(s25(s2 (s2x  1q1ۃ=q2Ƀ=s2 ˃ha!% (s2x  =s2u-5 s25$s2 5s2g (s2x ? =s2uL-5 s25$s2: s2@;,s2?7s2-(s2x =s2u , s2IQ T(s2x =s2u,$s2 s29QPn(s2x QVP (s2y F( (s2y 1 (s2y P5 s25$s2g (s2A1Qptnt lu  Љ (s2Aω (s2y  s2,s2=@19|PRQ 1=s2u ,s2 s2 ǡ(s2@1Hptntl  ˣ(s2@̉(s2z !s2SPhA(s2x  1@+q2q2uF%(s2x <;u<1=r2t1r2(s2x =s2hs2hX#hdf2> (s2x }*x1Hptntlu  ˣ(s2@У(s2x 'q2G1 s2$s2(s2@Hptnt lu  ˣ(s2У(s2x =q2q2u"|$Wt""5 s25$s2QP';,s2s2(s2x ==s2uJ)=q2q2u5 s2Q5;,s2)s2h`!h!h!EEp $A8GMi $s291 s2)@أs2=s2t W6Us21 q2u q2u u^_[]jjSWV=q2uj貽L$ɸ!q2,s2Pjh""h!Hy|h߫"tkPh=Yà P@tGWP |3/tf/V-ed.hDhup5,s2jh""Vj=q2ujL$ɸ!q2jhr2OUSWVPl$5$s2'Ƌ= s2$s2-s29ʼn) u)E1u1$q2E@q2V}tzP蘹t_s2PPj DžtOs2q2Hq2u q2u[uE6Ms2@Pi1,$l& q2u q2ut j1^_[]jUSWV$q2 q2th!ckjP~(s2L$F$ Ts29} Ps2Vq2Ps29|BVP]I5Ts2Ps2 q2u q2! (s2 u1C1E҃!%=q2hq2PƉ$ Ts29Vq29V5Ps2H5Ts2Ps2 q2" q27 09L$]9q29|WP+H=Ts2Ps2 q2]9~[q29V5Ps2G/5Ts2Ps2 q2u q2yt vPs2 (s2 (E (s2Q(s29\u=Q(s2I ( Ps2G (E,$s (s2L$A (s2 @s2y Xs2)9~_q29VPFI5Ts2Ps2 q2u q2 Xs2Ps2| @s2A(EA@s2Xs29r (s2L$A (s27 q23/ (s2Q(s2 ( (s2݀ (5\s29}@s2Rq2@s29|KVPFt]5\s2@s2 q2u q2S5Ps2P @s2Xs2D$1!P0ePhX#hdf2$ hh% q2 q2u!u#^_[]h!qh}!gj'jVj/:tL$Qq p PIH10ndPhX#hdf2$ hh%n1^Vs2t.L$19 hs2uhs2Hs2t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'hs2XWV (s2 td< uhI!1 Q(s2I t;8t7P1ǡ u2t?=0s2u6P0H u295 u2h!R5 u2j8 u2tV0s25q2WPe u2t.h'hs2QP;5 u2H u23/20bPhX#hdf2H" hh%^_USWV=(s2 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-u29}=u2Mq2u29|KUP{BtYlj-u2u2 q2uq2uyS5(s2W; 5(s2=Ds2tsj jSWme0aPhX#hdf2&! hh%1 q2u*q2u(tjh.6$h![1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u(s2 uu2E#t(s2 uE1^_[]8uP(s2HЉʀπwRj h(s25(s2 1w8"uh!1gu@(s2ErUSWV(s2H (s2H%u,8Xu'(s2u2h!t18u= u29 u2L1}5 u29~[q29V5u2?#5 u2u2 q2u q2\t Yu2 (s2Q(s2 u (\t u^(s28uT(s2H (s2 u21< u0=s2u't s2| t %e2ى(s28q2u29|NWP>t8= u2u2 q2u q2uuuw5u20u2M1I0]PhX#hdf2 hh%1 q2u q2uu^_[]H(s2,j'jUSWVPL$s2$s219 s2}%s2ȃ Eh!Kl$ s2PUVPt$$KǸ1$s2PP$u2q21S̪ás2tP芬EPPjM Ņtl9u q2l$ uq2ue$s2 s2+$s29}yFs2@s2P%Ut$ Pt$$hDž+9 q2u1q2uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=Ds2tj jvS肮vލD$jPjSut1t$ED$$D$1E $A9T$ 4(u29Ɖ $T$~cq2t$ 9V5$u2;\5(u2$u2 q2t$ T$uq2=Ds2tjj RS藭T$=$u2RSW/ 4$D$D$ (u2 $9~bt$ q2$9V5$u2:5(u2$u2 q2t$ uq2=Ds2tjj t$(S=$u2t$SW~ Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu&D$)D$(u29~Vq2 $u29SQ9(u2$u2 q2uq2|$~#D$$ D$ ud$th!$=Ds2\$tjj SV賫$u2SVPN $u2f |$%C<'0XPhX#hdf2= hh% q2t e^_[]Ë q2u tjjUSWVPt$ =u2T$-u2E<\<&I,$D$h)(u29~Yq29W5$u2[8=(u2$u2 q2T$uq2%$9C $u21F9uEEπ;D$$,$L$l)(u29~Yq29W5$u27>=(u2$u2 q2T$uq2ml9}C $u21F9u,$y^=(u29}$u2_q29|W5$u27=(u2$u2 q2tT$ q2T$M 0E+u2;u25(u29}$u2Jq2$u29|KVP6t)5(u2$u2 q2u q2u^u`IO0UPhX#hdf2e hh% q2u q2uu؃^_[]jjfWV4u2 0u29|ld 0u2j Qh,u2  tJP@UPhX#hdf2 hh%@5,u2&;1,u20u2k4u2L$t$T$ =,u2@Q葤 ,u24u2RDVu,u254u2@LF54u2,u2^_SWV4u24u2r9 ,u2@<u|L19tWWg:9u4u2s2H1,s2L1^_[USWV=H1=L1=4u2t s2s2$,s2D$j荣q24u2 ,u2ÍS4R4nr@44v\1L1 [ ,u2\1l1sRt6,lmL)1 ,u2t)|?wt)LI1 ,u2t~l)}L1 ,u2,u44vL1Y ,u2l1}w4R4Ӆ HA9~R,u24@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=s2t׫H1s2$H1L1,s2D$L11 q2u) q2u&tj\h9!$^_[]jlUSWVL\$d3覜hI!9N!tNjt$`hY!SV fttu=<;߃u _2r|$L$ D$1%!D$PƋO9rPSt$ K tu;_Յuͅu t$h!-|$dD$ Du$$1Fl$?uSt$ h^!jL$j QP蜒 $;Fl$|1ƋD$8u&1zPUny!Uh $jD$ th!jVNjC=m@!sHQPWc xs{QPWB x4$Uh!  =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@W y?60Ph!ӍL$fqQhmW 3Uh^"D$ukD$Ph "hv!  T$D"h!T$!h!f2H f2~ f2H f2 PhY!kh f2j t$8t$8t$8t$8t$4h!x t$Ht$Ht$Ht$Ht$8h!W t$h!F t$ h!5 j6Ph3!hdf2 jSWV֋|$t '!?t-!VQP  JB8f2H f2;$f2h f2j< f2H f2 f2H f2>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hZ!thl!P0u8u2hp!踰thl!Pu hz!)jhl!hp!) PM u h!j0觉D$ u h!jt$,)݉\$D$$D$11D$$h!SUt c7~+Hr߃8tlH w&$8%<;$뼃4t6맃dtket/1@D$=<;umWt$Xh!5<;KD$71@D$$+L$ _2 _2T$uA_2$T$uȋ$D$,jj@Rl$L$ $tL$ $L$,1ۋD$P~CEu S)St$PʼnD$$ U8l$$T$DtIL$ىL$$U$E L$)QPR 4$EuED$ush!h$xOu]h!bh!XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh8t$>Nf|$Dt1BuNfD$Dh|$u%j t$h=!jt$j hS#yh!PhB!hdf2jPD$L$jQ51A8Љ4DAtt;L5rSh!j? 10h~!WV|$x$t,WDWHDWDW4Dx uW趠jtw\wX`=19}5PBt851WVh!#|^_USWVT (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP J̀ uCt1t RPIL$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PU]D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RPH$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph!,h!3*|$PQt$t$RhU!j-C$t&8$\T$XT$H|$RQt$t$Vh!je-$L$l$8h!h !hh!uUSWV u|$Wm1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h!j,NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWPֱl1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hSj,PSD$HPhȷ% |$0hSj,6StND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWh!j*^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh8! 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ Xu2Xu2`u2`u2pu25tu2D$!z _2)hdf2jjjh>!L$$zL$$=u2x =u2tD$l)&1PPD$Vm D$TH Qq T$T$ t$t$QShe!j$ 11KL$0t.sbSPh!j#V5u2[Su24u2t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1h]mjP88H H;1D$8<9u28D$D$ tD$tD$Lu2ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP!PD$tD$t$t$8WSP!Pj tD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPh\!D$8Phu2Vt$,V'~GD$D$8D$HD$L$PD$LPhu2VD$HD$8L$ $\$(\$(u@,(L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L hu2lu2tt94 S.8Lu2T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Ph!"¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVh!D$8Phu2St$,V~D$@s,D$¹tt;<FG;D$ L$?-Vh! Qh!j $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QPP@;D$DT$@D$(4t$8t$t$t$0|$(WVh! HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhz!je1gD$4$DŽ$߬$D$D$D$@$߬$ ܷ%a111CƋD$|$8D$|$H|$LjD$LPhu2VL$HL$8t/u2ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh!b11ҋt$  t<=pu2tu2$T$p$1߬$$$߬$Xu2Xu2`u2`u2DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QPJ=31A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=u2$t1J8D$<D$ۋL$؋u2k,L$1T$9|L$$)щL$ Ɖ$D$HPWh!W $PhD$(ȷ% yNxL$ L$tL$L$8]:u*t$ tD$Phh!j  ,uh,!j  uhI!j  M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$PwlD$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP 3D$ t(Gdt;<r61@ht 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWB NJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP4$]0hVP~ ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$Vh[!jT$$BRt RP RPVWjt$$Vh,!t$$vk,PD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph!j D$,|$D$T|$XD$TPhȷ% t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =@u2yh!je11t$ t$$k,t$(D(D$L(L$(}tTt  t1L$(VWt$Q](Է%[$t$ D$L$9Éʋ|$S=@u2tQPjWhY!j"]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh ȷ% 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$QD$XD$TPh]ȷ% |$t$t$kL$,9 $ ?t$0kPVh6!jD$,]|$t$t$t$L$$QKtXt$|9|$11k,D(t P;|$}L$֋L$]t$Qt$D$,TD$, m4$yD$,`14tPP1h %j,u׋$e^_[]USWVu2tWjjP= u29u u24t0jQʔx!=@u2h!jNt$) u2xi8t:PWh!QV`tPSh!Wj7t8Vh!j 1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 1I 11u2Iu顀1Puu2 1~ t1@u2@9uUSWVD$911A9|G1SƉ<$~ SjVNr 1D$~Q1ɡu2t<1*tBEB(B$B4!؉B8<:tWBuA;L$u5u25u2$1^_[]V$u2 u2D$D$ %T$ t$ 15u2t$T$L$D$\$ $r!$^Vt$FtN H N tNHNfr v &V u2^VD$`sH) u2u2 u2HtP4BPQ@@1ҋu2v9tu2u2rh!jktp4F@u2^USWVD$T$#15u2tC=u211-u29| n-u29t%9P4uH$3L$X(3\$ t Fu1^_[]h !h!hh!USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>u2 u2 19|[5u2tFNu u25u2t5FNHNFy F4VPVu2@u21@j@P U1@PF ~4D$F(^$F0^,n#1^8u2 u2t q4u2^G FtH 7~ F^_[]É u2=h#!h!hh;!h!hh!Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP u2Hu2N^,H u2u2u2H@u2P u2 u2Hu2H4Iu2H89t;tprpu240u2t4F u2H^h\!hU!h4h!JUSWV}]uuu W@t u21@u21HCSuu WW KN0F,xNF4VPe^_[]vjv \l fUSWVP|$gط%sԷ%G4$O,51w0VPww D$0^_[]USWVPt$ffط%sԷ%F4$N,=1~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p v2HtƒQ v2@ v2^_WVt$ v2F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjvj vn^_dUSWVPT$|$:%4v2\$ v2$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^421ہ=v2| t Pt 2v21t 98t@^_[]Ã^_[]`V15v252hVhv2mi 5v2^ft$ t$ SjɨSWVt$frLN4F,=1~0WPvv 1ط%t\fv4V1AN4F,=1~0WPvv 1Է%1;NuN^_[h!1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR ׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS3$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h!h!h h!USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP-3T$3D$M u1^_[]USWV(t$1hPWa jt$ ;|$D$@G(D$DG,o0uFhtȋ1FVt RP>OdQ AuFV FVt RP OdQD$xd11 |$D$$D$ D$D$D$D$ $uD(tȉDpTtt RPs tuGW l$ $BGWl$$tRP,݃1ۋ4$FÊM t19su)Gu7|$ \$'ŋl$FFF }F F$|$0tfhjDljPLtLXt uB\I\$$|$ C$|$4Nh!.<1ɺPt`tLtt l$,\$(|$0uejttPttPijA 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=1lj1l$1 UPQSWVhjKË}Pw S\ P G1PWH¹tTt 1߀<$u1 t1 L$QWURPVhj蚲Njl$hu P[ P E1PUtA|$4t h!SNW61^_[]u C4CHKL1}Mt|$4t7hm!Kt$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPh!:$  $ V 19tQRh !Ϡ 1@^USWV |$,\$$t$ tCPPt Ttt4RQhu!N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth!豟h f2t;D$(u KHKpStURQPt$DljT$t h ! u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh!b 2VRh!K T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhx! D$L$9tQP$$h!t$Ht$nL$tI9ȋt$ tPQ$$h!襋1t$脵\^_[]h1!h#!hh>!ѡh1!h#!hPD$L$ $QPj1 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$!D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|ttE|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP$ D$TBL$?ttXLT$BtJ J T$$T$ QPL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv 4 t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h! D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h!hO!h h!h!h h!h^!h"h!舌USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p 蛇A L$H SjQQ0 ^_[]USWVL$T$ B2ulF1Gl%Uh3"v,$f2H f2~ f2H f2 h f2j }{u q1^_[]V3df2PPh!VxVjjh! !@T%Phɢ"hdf2w`%ujnUSWV׉΋*h!UC%tCt[PUCjhh2s 52膕2t222WVS52O^_[]Uh~!jW\52h $ju\USWV$:$D$VuP30 9$j uP0 J1ɉ\$QSu Ƌ8\J8"u11F9Ή$<$J1ɉQSu b ËD$8ՉI8"u !t$$Vhyd52- tbVh!s^_[]jh!7jh!.uh!$h4!hN!$p hh!h!jZ$052h^"jZUSWV}E ph_$VRAFh!V$jvW* s'Wh{dЀ52I( t^_jh!j%V652h^"jAVVPPhtd@52' $t%t52h!n$,!u!52Qn2$$q!q!sd"QPhJ!in 2$$ q!sd"QPhv!Dn 2$$q!sd"QPh!n 2$$q!sd"QPh!m 2$$sd"VPh!m^52h!jUWV$u^Vhzd@52& tH$D$PWVh0!~m$PwwwwVh>!\m^_%52h!jTUSWV}D$Phd@521& tzD$Phd@52& u52hr!2$|$\$ t$jVSW5VRPSWt$h!le^_[]f52ha!jSSWVP|$uX|$_h"Sp:ƅth{!S\:u+1Qhwd52I% t ^_[752h^"jQSUSWV|$0t$,1@4;_2$1ۉ؉D$h!WVx qt\$te+$95_21|$7wWh|d52$ D$ ;D$t-i9l$sUt$ƉD$l$묅hhPV2L$ d"t@#RQPh!j|$ t\ư1P`VvvvvQPh!!j G;|$ ru52h!j$t1^_[]W52h!jQ52h!j|QjEcP|$u1Phd@52Z# 2tQhH!!jXD$ 0Qh^"jTQSWVP|$t$^hx"S7tDhM"S7t@h""S7tH$!=@/<;1-11<;l2$2<;j/SF02 2Sh\2hX2hT2hH!5<;ԇ<;L$<=T2T2x@2m5<;1=UUUU)ʉѾ3333!!ʉсi <;1B|h2<21;tٍT$d3LD$dD$j/VtC1ۀ>tT$da3 D$dD$ tTj/S{tF1;tٍT$d#3D$dD$,t>\$:t$1\$(X%%h"!;c u1\^_[]hz!hS!z_2=,2uj=42<202(2$2 $2Yh+!5<;h!Ph!jI(2=82u th!0"02 $2t uh!t=1uh!)ǃ|u D1j=H2|$\G1PPL$lQPjW萡t2t$dyt"1PPD$lPVjWdt51=H2u4$P51Ju#$=uH282 42 <2 02=l2 ɡ1=H2t&jQP: 1u[51hq'#jhh|2QP1y"68h|2h"谀1|2=H2u'L$dQP]51h?"hx2hrdAP 51h|"hx2hedA51} 51h"h|2h,"b$$t(hQP51hI"$$ƒ 2>s1@![Vs ) ȣ2222? 2 Ь2Ԭ22p22t25251=2=x2?w4282=<2L[V<2?82) 42>r$r$42 p2t2l2u 11]u1hQP@8 1u25l2h $5181jQW51|V'vp2u Vh%"8 11ht2t1A1A1ۉL$@1ht2Ԭ2 Ь2hج2= 2u#T242X282\2<2 t$\F|$LSSWSjV5t$L[ul2n 1QQWPjVy5l2讅l251j/VWt@2uM `29w>UUUU)ʹ3333!!сisd2162t!tt22r2cԋ:2 D2H21>2‰ L2P2X21 T21AhQh@2w i-@2=T2 / D2ًH2P+==w !r%1H$D$ ʀŸw1D$ $}ȹ:2yt,2t  uT21I $L$9 @211O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj 21҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$42-82=<2H2D$D2t T$$T$02=D2uu 1; T27=(2l 2_hQ""El281uh!"蕲l2L8L$(L8L$$L8L$ L8L$48\$81=1Ɖڋ\$4PVQRPSt$@t$,t$4t$ 21K1Kޅ`1PPPPPP =18h5"1228LFu=(2uRh"%tajh"FR1"WjWWWP+h"t҉r2u 22=82u02u <21g=82l2D$tD$|D$h""P21N=t 蹵@ 1o"WhVVWP+9tigfff։f52T2L$ȃjPrD$ u h!jG8h""譭1HL$ Ajh"P1۾2D$v2tB?t=kWUh!P z2L$ DD 3$ D$tD$D$ u2 T21@2|(.tq<(tk{PWh!#P H2D2@2t (BD$,T(2D$ TL 3$3L$ щtT$ T2T$D$,F9u߃|$~O1l$GVWh"O T$ L D3$3L$ tT$FЉT$9uT$1۹"VWSSSP)T$ ‰ $DD$R~w02=ue2$@D$ $#D$u D$ %1$L$19;ta $Ȣ2=02u42u<2u 82=(2t8t2~ h"2nج2~lh"n]h "=02u1I2 2t h!"ͪh"tt2oج2e$jFt1 2:2t ,2t3$ D$ 2 u=T25@2H2D21|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 2|$E9u KD 42D82D<2DL /p2 t2WQD$lP~ D-d21ۉl$(-D$D$D$2$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$H2 D25T2d2D$t$2xt,p9߃| 1019޾|ω t rr ؋ $1ۉ1ɉ62t;:21ҋ>29߃91Ouω‰ӍQ|;-Ь2Ԭ2|7P2L$ T$t$u.h!"h!"՟\$ L$ T$t$=(2tt$1|$4uʉ"PhPPPV @2D$ \$1 P2L2Ԭ25Ь2$L$$L$|$ u4$T$T$4ȍDD$u~t:t  Iu82 щ $ <2t&=u2օ4$u 2G(2tih2Ȩuh@"hm$O4h2tj$2=u2Ѕ$tNd2=(2u"Phu"S0h@"SPh"t h2 =h2uQ#$tr$t`$1h2ti2х $t4$P5d2h"QS=(2u5d2hR"1t"102=u 22^_[]VPD$ L$ $QPEh"3e2H e2~e2H e20he2aƉ t9tDe2H e2~e2H e2he2!ƒ1Y^h5"jUSWV1=L2˃y CS t Ԭ25Ь211 uY1ɉNVt11@5C C!t "Ph "  h "Q1He^_[]SWVP$1;1u+H2u"QhmdP y h`J#謴11ht2<=h2u;5h2|- h21Puh"V=T2~e1@2111 D2H2Pt,@28C;T2|hv"Sh"$1;1u+H2u"QhmdP y h`J#衳^_[USWVP։1ɉQPU[ 1O}t#Ë$8u8"u r1^_[]USWVP։ϋl$=,2T+@2 t2túd"t;$76PSRh"T$/7St$h"/D$7UPS\$ Sh"s/7PUSh"[/77PUSh"5/7PUSh"/7?PUSh!"/77PUSh2".7PUShC".7?PUShU".'1PPPUt$(SRh".^_[]USWVˉ1u=@2h""T$$8$43|$͉)uhd"Wh."y) |$Z)uhd"WhQ"_) D$|$:2:9282 72l$M?>:2>2KL$ u}tGE)9H9^_[]USWV,։L$D$DD$^"tD$y"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h"% <282D$HL$LVSQPD$T$D$PVSUPD$|$ D$@VSPWljӸ1=1ƉT$ L$@PVt$QRPSW|$LWVUl$lt$,t$,t$(t$@h"$,he2jdh 2D |h5"h 28~ 2\$ $t < uC{ - m2DAu<-j D$$Ph 2@ D$$\$ hT%SaK|$(@D$Ph9"S $ϋT$ t։t=t$h"S t't$h<"S ct$ |$@D$1=1ы5`2jVWR D$ՋD$D$D$D$D$$t$t$D$$  T$d2u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th5"Sp|< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhf"" 2V<ƀ 2t$Vh@"" 5`2D$,$t$P։ω,^_[]h5"jo USWV΃ twttu"^T$(|$$+d2уD$ ;D2"L$ H2|.|$,T$0 P2|$9=L2|=(2u|$4u 1^_[]Ë-T2~} ʉ$9tw@2|(tk D2t( T( (t1+d29\$ \$$}2;T$}#=(2u6|$4ttD(OG1nF"t(n9Չػ}n9l$\$QAuƉ62tt  $tt ^:2 D211 H2t$ -T2t$|$$|$}@2] ʀ|(tP D2t( ;L$T$|L( (9Ή} =(2{|$(t ;@2KC H2D24"1$t=t D2 H2S"=(2|$(5X25@2}G1\2X2T2P2L2H2D2Ɔ62t$ |$(P629X2u85@2G1\2X2T2P2L2H2D2@21Ƀ|$(T$3\$1 5T2n @2|+D$Nu @2[\$j5d2D2)؋ @2P|$(t$ hhjw?@2VfǀUX2L$ H2D$D2ƋD$$ȉ5L2P2T211T2u@2=(2h""u "w"=(21|$(9 X2u85@2]E1\2X2T2P2L2H2D2@2Ju UPQ$ T21|$(tD$D2D$H25L2=P2^_[]h!jWV@2t^ tڋt֋|҉tΡ@24 T2 QPV耉 T2ƀ^_USWV T$L$T2@hPh@2  T2@2~CH2D2$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRRˈ @2;UjP fDŽ;UtZF , M ;M;MU;; D2 d2T$)ʉUL$  d21 EE=<2 82ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! MT2 ^_[]h4"jDWV1=@2Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5m2<tD~t@ uB 1u€πr<r1@^_USWV 1D$Ӌ51݉t$މ$!!jVWt$!1Kl$ 11uhUPzQ5p2P ;1u[jVW51!1Kt?D$H5p2#$SUP 51V51[ ;1tÉ؃ ^_[]h"j8USWV$0$,1@D$l$D$D$ $1h""WV$ suMj U5<;1 á<;8=L$90J8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-_2)1<$L$jhQP47h2hedAP =2A=9l$| 4=@f2UjDž\$ t|f2H f2~ f2H f2 h f2j jh2h f2 f2H f2~ f2H f2 h f2j K<$ D$ttd"tW#"Ph7#"D$f 22Waf 2gdWPV xnu)D$PhwdV h%"h%"8rV1^_[]Ph""25<;h#"j`4 h#"h%"Sj+Phd#"hdf2 j USWV\T$2< $S,D$9d$ՉjRPt$ V11 Sl$UV 9 1U\$tL$j@PQ 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4%h$"T$l$ 21ɺ$21MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$2t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf 2ŅtMaQ4%h$"T$ t tuf f1112|$ 2 2T$$2%2f&2l$E<$g\$ttXaQ4%h1$"O ;B Q4%h_$"2 <$\$t4%h$"<$l$!F1D4 !Ph%"V GPSh&"VGPSh&"VVjjh׊%fGXtVjj h&"MGXtVjjh*&"4GXtVjjh/&"Vj 1w(h8&"V w,hJ&"V w0h]&"V w8hr&"V w4h&"V w=2L$s("0AJPWt$h("j2{<|$\$W4$0Wh)"h)"S&d4$u h!jF j/PUt|4$4$/jMUSWV\$ l$|$t$1E2 %2 2h)"WV; h~n3itVn2Ѓa~.btCd$2봃otBs,2띃NuS<;2(21= 2 2mjShl%5<; tHP EuA_2)ރu4t$$V41ut$(t^_[]hh("jv,Ph)"hdf2 j$)"= 2uD$ D$@)"2t ~#P=,2u :%=$2u )"=(2u +#@P0h)"h~%jWVPhM"Qt1ƉPjPWG% Wzt jPVP^_ÐWVt$|$ VWBt$?/tWhc)"$Vh|)"$^_WhN)"j#fWVt$ |$7ϑWVUSWV $$l$WVSU$ $ hU3WhX!uWVh4*"jGD$@tF$j$h%hV $V$$$h=*" jUSWV$$$$D$1 h)*"SU $D$D$1G$D$ȃ 1$%N|w5<;Ft|$`N|Z5<;Fx|$Cj$h%5<;x P' 5<;UFp<$h)*"SU V_2H9$|U4n$W^.l$\$t <$tu;D$ PW,HtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]hh("jWhh1$jGs.Pha*"hdf2 j@WVPt$jWV 9u9t x^_Vt$h*"jVt$VSt@^hu"V^Vt$VOt@^hw$V|^WVPt$jWVy 9t9u x^_Vh*"jdWVt$|$ VWC>t$?/tWhc)" Vh|)" ^_WhN)"jKfL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QfD$ T$M⿪t׋E4D$T9\$E0D$Ds h*"i-1VWt$ t$fP:1@PPVVu4u0u)OËPhh%P苹 }D@u hh% hh%Sf }D@PE,CEh-$V\$th-$Vh*", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5Ph+"+%t9\$t h.+"+\$pD$p\$D$D$ 9\$~\$~tSha+"+\$9|1} t h+"k+hW5\2h+"}4xME0;E4ru0h+" +},u,D$D E4t h ,"D$T 1u D$D5 t$ D$$$$L$$$E@$D$,D$(A$AD$|AD$0A $CD$4D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$,"(D$ D$L$41۾ËT$||$|tL3L$4 3tD D$ WA(\$tt$1F9tWh^," (D$ 1tt$ tЉ|$TB7D7R'tt htD$pt\$1t$T$2:|$D$xtIt$)Wh,"df2P |$)Wh,"df2P D$ $L$t$}D@tCW&1@9tWh},"&L$G$D$$|$tD$|D$P$\$hT$,T$ T$uttPFx@HIt$81VRtRRP*t$ tPh!9QL$xtL$tD$8@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

ST$utfuff u t r D$$% u$<L$uKL$U K K\$t L$Y L$) ) |$Qt$8S衜 VjWC t$ uT$B|$tfD$T$|$tfL$$+|$‰T$D$1C D$8H4PQ|$HIht|t<7t1ۃË|$71ҍt$8VRtRSP"tPjhj $PVxT D$8$8D$!u Q<;o1"WP1HPWWaP2'<;`2<;#WP1HPWj'H‰D$5<;hw1"<;Y1"WP1HPWWH2<;+"WP1HPWhD$8o<;d1"WP1HPWWL2E1@D$491@D$ -82"<;$WP1HPWW2D$PT$L<;#WP1HPWh@2Vh1"h3"&u=_2؃rKVh1"hY4"j臵D$t t @@u|$$h1"Ћ45h2j/Vcuml2Vh(2"h"2"hS$DPSu"5h2h(2"h7$hhl2sh2l2 Ph1"Ku =82hjS: |$4tg$y\hh5h2 D$xD=d2~1hSPnD$ F;5d2|1QQQPsD$ u D$y05h2֢0SPVu h^"E 1HD$j5h2脦Åy'5h2萢0 PVu h^" $DPSFqy'5h2T0PVu h^" $L%=ta= uD`2u D`2L$t$QRPS5h2ul5h2h%5h2h.2"NDŽ$$lfsD$tjV$$;$ $L$ Z$ $ u4hh2"L$ u.$$lfst!$$Ph-$4hz2"L$|$u$=1|$Ttd21d2ɉ\$Hu0d2tL;$$ s5$$ %DŽ$$lfsd2t$$ $$ 1Ҿ9É|$u|$ |$|$ t+|$ u$1Ҿ9s h2" h2">L$8J#$L= j|$W$($(0D$8T$ t$VxMN|$(O11VSh$Pt$X苨xHW>MD$(+D$L$,L$ ʃ|*5h2h 3"v1D$(+D$L$,L$QPVSD$DT$XD$PLD$L$L$,D$(D$8L$  L$lD$h1l$h\$8$螿D$\D$8L$\ %|$D$ fD$Bl$B|$`l$D$`L$d QPhSt$X}x>W0LFD$(+D$L$,L$ ʃ{1QPWV3/th?3"jܯ1F\$D1VPShE3"oD$XWVPS%|$$u1Ʌ|$t1ɉAw1@|$Phs3"D$tt$5T25H25D2t$\t$dt$<5P25L2Q5<25@251PWt$L@ƃ|$4tVUSWVӉ $\|$j W\$ S Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph3"1L$8ɉ׉u L$8t 1@׉׉|$l$ 8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h3"3QPWUt$t$h3" QPWUt$t$h&4" t$t$h3"jNUSWVdf21F/WVUhr4"\WVjh4"\WVj!h4"\WVjh4"\ WVSh4"\WVj+h5"\WVj;h.5"v\WVj$hj5"e\WVUh5"U\WVjh5"D\WVjh5"3\h5"WEWVj h 6"\WVSh,6"\VfD$t1B9| 1I 112Iu顴1P2 1~ t1@2@9uUSWVD$911A9|G1SƉ<$~ SjV} 1D$~Q1ɡ2t<1*tBEB(B$B4!؉B8<:tWBuA;L$u52K52$1^_[]V$|2 2D$D$ %T$ t$ 152t$T$L$D$\$ $r!$^Vt$FtN H N tNHNfr v V x2^VD$`sH) 22 2HtP4BPQ@@1ҋ2v9t22rh!jtp4F@2^USWVD$T$#152tC=x211-29| n-29t%9P4uH$3L$X(3\$ t Fu1^_[]h !h!hh!USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv kF V>x2 2 19|[52tFNu 252t5FNHNFy F4VPVx2@x21@j@PU1@PwF ~4D$F(^$F0^,n#1^82 2t q42^G FtH 7~ F^_[]É 2=h#!h!hh;!h!hh!KVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 2H2N^,H 222H@2P 2 2H2H4I2H89t;tprp2402t4F 2H^h\!hU!h4h!USWV}]uuu W@t |21@21HCSuu WW KN0F,xNF4VPe^_[]vjv w fUSWVP|$g%s%G4$O,51w0VPww D$0^_[]USWVPt$ff%s%F4$N,=1~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 2HtƒQ 2@ 2^_WVt$ 2F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjvv v^_USWVPT$|$:%42\$ 2$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^421ہ=2| t Pt221t 98t@^_[]Ã^_[]`V15252hVh2t 52^ft$ t$ jESWVt$frLN4F,=1~0WPvv 1%t\fv4V1AN4F,=1~0WPvv 1%1;NuN^_[h!1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h!h!h h!%USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$F@}F}F ~F F$|$0tfhjljPLtLXt uB\I\$$|$ C$|$4Nh! <1ɺPt`tLtt l$,\$(|$0uej蒿ttPjttP@A 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=1lj1l$1 UPQSWVhjǾË}Pw S h P G1PWH¹tTt 1߀<$u1 t1 L$QWURPVhjNjl$hu Pog P E1PUtA|$4t h!6 SW1^_[]u C4CHKL1}Mt|$4t7hm! t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPh!:$  $ Vx19tQRh !K 1@^USWV |$,\$$t$ tCPPt Ttt4RQhu!N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth!-h f2FD$(u KHKpStURQPt$DljT$t h !u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh! 2VRh! T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhx!D$L$9tQP$$h!t$Ht$L$tI9ȋt$ tPQ$$h!V1t$\^_[]h1!h#!hh>!Mh1!h#!hPD$L$ $QPj1 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$!D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPh!TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPh!D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh! D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPst$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP5|$FV D$t RP|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPz$ D$TBL$?ttXLT$BtJ J T$$T$ QP L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPuي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV]D$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv f@ t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h! D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h!hO!h h!h!h h!h^!h"h!USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQ; ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QP 1 ^Vt$ V(1y?1I+F$ыT$ptj42QP轅1 ^Vt$ V(1y?1I+F$ыT$ptj42QPn1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jD_Ɖ t,U5Ftf^81FFH1|$<΋t$ 2uN 2NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPt$$K\$tSD$ hD$@p$Fx~"1ɋ@ L;H|PHsu"l$ \$ 2{2 2\$L,D(Pl$ tttt$T 1¹pt Ѝ t$@F01FHD$Pt$.KCLLtPQ4$gXtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(2y 22Py`P迬D$@2 2C9݋|$"Shj=" Sh="_h="_t$<L$D$D$L$ oP\WtXljo 1tX L@uH~vCtTjhhx>"_ V $^_[]V}  )UjSq D$ D$ CD$CD$C D$C$Cl$Uhf"VU u D$CV )1$<;obD$D$PSh>"H^ =USWV$0xjW_ƅ~F$0h$1jU_~4$hPu C9uЋ$4hM"SK@Ǎ$ىh\?"$0SAt| uƄ$ $0ph?"QU<D$$0qh?"QP;ىD$PUPUS  u׋$0EED$1ɍ$D$ $PhS\ D$PD$PD$PD$Ph$S_D$L$ T$ ыD$E L$ T$ D $A9L$D$uPh ?"h>"蕿}Sh ?"h?" Sh ?"hj 5<;PG Cr2밋<;$PCrj h"V< ىVtSf1P/uE$ ~S4V $Ph@jSPt$VXuVh~A" *Wh3A"jÍD$LPSu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA hG"Qhr$PPrr @r ,r .%r0B$PPh%r0BVn  8YShB"A*r'r)rzD$(hA"Ph)r])r9r rBD$>PD,r<r<|$$$PWS?$XAQj2$TPQ $PhxH"Phr<rr hA"jhr +rryt$$$PVWS>ލ$P|$xh>F"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP $PhH"Phr "tWD"PSh)E"1 .1$P;$hB"Shrt$VUH"9;$PVhH"p1|$$VhH"W1hA"jhr t$j=2:$hI"Whrt$*I"?c.\$j^hI"WhrS$d|1$XAA$Pj2PQ  $Ph`H"Phr9rhM":$`>ߋN8%wL%PVhbB"N/ `Ouet$$P\$ ZShC"/hB"$P\$;$PPh_E". V.hOB"Sh*rt$  09rhL"hhM"[$\>$Th#$. V-hM"*$X~:$\1j h#V ;"tQC`;$X|j <-~-hV車`Ouj -$X1~$1:t @`9u9u$\Ph}E"-1@\D$,\$H|$PS$hjV L$,9F VhE"VhrW h#M"F0PhE"+-F0Pv,v(v$hF"-j $,h0M"跉$ThF",PhC"hA"Fh$VlD$0L$4$PND$8Fh[D"Vh(r WM  FtsShzD"u,$PtPh$\,hD"O,$Tt*Mbi)QRhD", j 0+$XqPShD"+ ]hTM"螈$X~n$1Wȃw,\)"$%L$7B"!B"B"% BM"B"PRhlB"s+ F`;$X|ۋt$~G$`>G8tu #P%w d%QWhlB"+ `Kut$hB"VhrP>_M"ttM"P襇t$1 E$`$d $jj h#QPjVayjh/#V V$`t$VhC"s*$XMbi)QR$\VhNC":*$|$|$|$|$|$|VhC"* $\uM@#1whM"衆L$!r*I"$PPV)t$hD"!11҉4hӀB9ud"t@#QPt$hC"d)=2~S$h1h'y"E)1PQhC"() C uߍ_ j 5( rt$hC"Vh&r@t$";$PtPD" "tWD"RPt$hD"(t$ USWV`p׉͋$tphI"S,$tÃr t1C1|L$PVQ Ou vu hu Z$1hoVWs owt1$0 j2t W# F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh::"WV Ƈ$L$h;B"Qh+rU9uhA"jhr U`p^_[]WV1VFF FFFFF hG"VhrQFĘ^SWV։ϋ\$1D$$jh$S tVjhG"S tBjh"S t.jhH"S jh"S u$D$D$hH"PhrWh H"PhrW=2t?|$F"tF"PVh3H"% |$u$4<%VhNH"x% ^_[$oWVkƿdf2PhI"W8' Vh)J"W)' VhaJ"W' VhJ"W ' VhJ"W& VhJ"W& VhJ"W& VhK"W& Vh!K"W& Vh8K"W& VhYK"W& Vh~K"W& VhK"W& VhK"Wu& VhK"Wf& VhK"WW& Vh L"WH& Vh*L"W9& VhKL"W*& VhbL"W& VhyL"W & VhL"W% VhL"W% jVRhQ, t^Vh $j WVPΉ1WPhPPj PQ u^_VhL"Qj USWV։ωl$PU\$hjS E9C ShE"ShrW VhRF"8#ssss hkF"#ss3hF" #{F"F"tF"t$(PhF"" t$4t$4t$4hF""$t$Ht$Ht$Hh%G""D$8PhXG""$tF"VhkG"z"$4<%h~G"\"$hG"H"Ę^_[]t$ t$ t$ L tt$hA"jc USWVӉύD$(jPd1t$`FFF FFD$hd"V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVPD$HD$PD$P %5%|$D$ fD$ l$ \$Tl$+D$Ty1%Ph $j($PT$D$ +T$(+D$0хyL$XD$\D$\5%D$XuT$hL$l+D$$D$ $߬$@%ݜ$ܼ$D$pt$t$$߬$@%ݜ$݄$T$xL$|l$x@%ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|RhI"j$P DŽ$ <\$D9r<s5= 2 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h %St jh#S t ;/u f. Gf./W S9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PS tH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 51 2H $s-t$$tHfHxt P2)1^USWV= 2th f2jjhU"jj9#tvƃ= 2th f2jjhU"踕21GNIIˋ^s 2 tVfV(2ޅu2=21WS"ơ2Krk=2tV$PhU"h f2 ~uV7dV'%V`v v"2F$52vu;22K^_[]USWVPl$2M1t$"Džt.w w!ƅu hU"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=2tW"PhV"h f2 W_1l$$ttF9u t G9t$x%Qt$h2hV"hdf2i<$WbWE&F~X|$<thV"V_VCbV&vfFt$ t$ t$ hV"hdf2EuFufFFV!|$WP`WV&N=21ۈ22|NIL2h22ǀ2|NAMǀ2EFNDt$h2hV"h f2$1N1@=21ۈ22|NIL22Wǀ2FNDǀ2|INOWd2ǀ2|NAMǀ2EFNDVdPt$h2h,V"h f2C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=2#~VPt$h9V"hdf21t$h2h W"]a >W\Ut$$t$$|$$WX ƃ*VhqV"V%]1@KGufGfG1@=2$ WbPt$h2h,V"h f2.Ut$$t$$|$$WƀH1@=2ىV_bPWh2h_V" |$u V[v vY2F$52Ut$$t$$WDUt$$t$$W.PZN1@=2t-ى,VaPWh2h,V"h f2=؃^_[]S122|NIL2t!h2ǀ2APEǀ2|ONTt!h2ǀ2FNDǀ2|INOt(h2\ǀ2|NAMǀ2EFNDƀ2t(h2/ǀ2|MODǀ2ECHGƀ2[SWV= 2th f2jjh%W"02=21VWftmxtg 2W sJX tCf{u7=2tSPh?W"h f2 S\S [빃;=22k52tc~ tWuLfth]W"W Z=2tWRPh?W"h f2N Wy\W9 륋v$^_[SWV= 2th f2jj huW"2tS21{ t$C$Su[SFuՅu52thW"VKYv$^_[USWV=2R 2utDh f2jj"hW"_,th f2jjhW"C5 2t$G!jj#^ơP2;2T22,׋- 2WV]Ɖ׋ T2P29sAWV2ÅuWVhW"p\ SPhW"hdf2 c렉1‰1 u`WVÅu h/X"%\CuhEX"SXCt SZcSSPCcQPWVhX"hdf2=:K 29tPt$ ZU- 2P2;2T22^_[]USWV= 2th f2jjh]X"谊fH2jY9T jj\ʼnT$2 2PQ\D$5T25P2J\Ɖt$U9\ʼn$St$p\Él$9$\$T2 P29ˉs6fH2j8DTk D$;P2T2rM\$ - 29sIT295P2s9- 2tS  2E9uT2 P29\$ T2 P29ΉsZWVÅu hU"YSCPhW"hdf2? cWV[ƉסT2 P2911 uU9t$D$ rIWV<Åu hU"|YSPKAc9- 2u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5T25P2fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ= 2th f2jjhvX"FtVPXfvu݃= 2th f2jj hX"2=21ҹ$RL$QtMƋhtDEt9VP|$ W1ۀ~UiCSPW+W em븋L$$; 22r^_[]SWV= 2th f2jjhX"2=2rc11CWS5t:FfN~u %fFfthX"VYSvuȃ;22r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWhX"V ~u,|$ t%hX"VRWhX"hdf2  1^_[]fUSWV`= 2th f2jjhY"Ņ52525,2h8Y"hh1l2 t=2uFFF%)Fu9rV9= 2tJh f2jjh\"mF 2t(t$h f2jjh\"EF 21V9vtRPh\"h f2+ 2th f2j $ 9̓>t9߁^_[]á82tPjt$t$uù1WVIAfF=D2|CH2)fP2542jQhL2Bu5D2F1L2PVQU =H2FD2^_ù1Qh9]"Pkؽ8u"h]"h|]"5,2h]]"hdf2jWVjh1|1t)h t 8@ W,^_VP2 T2t7#L2=@u%o>P2 T2tL2!=@t^USWV$$$ $jhWV,L2tE1M1 tmjWVS$8jWVS$8t$Sh3$hVlVS$ @2U Rh5@2DžtGh %P虴tSh Z"hdf2b 5@2DžtGh"P[tSh3Z"hdf2$ 5@2[Nj5@21jPP6L+^^$DOGrhPD$Ph\Z"hdf2:hPt$V1c $(j7V@ @2u D5@2Nj5@2j1PP6褞+^^X^_[]SWV׉1jPP1r+FF9tX\$)yWh\"hdf2 %؉jQP61~tF hP63 F^_[USWV|$_ OtGhS7 GO9}vDty)9|n4 ȉG.uFh$Pm;-22rv=2tUhZ"hdf2 \GP1=2t:PhZ"hdf2 %1=2thdf2jjhyZ"z1^_[]USWVD$$PD$x/@th$Q81ƀ81Mbi)L2H1ًP1 t @2P RV説5@2At\G9uGSVP> t5@2Džu*h$D$Pptƀ8MbE^_[]USWVt$!M1 tFjhRW,L2t(E1M1 tm`ƋU R^_[]ËD$0証} USWVX= 2th f2jj&hZ"x2  82@ @t$'PWjt$ >82@ @-t$ t$ à2^"O?SwSLFv1V^_[]USWVj/Q1t.VE/tÀxtVh`">߉^_[]USWV|$u h_">W2u`Ɖˋ-82UDžuh _"z>-82)ً29w؉9vlj<2|$2WS^_[]USWV։ϋ\$ t;=22rVWh`"= -22QPVW{s LK$\=2t%[$tC1K 1 uh`"S9^_[]SWVt$f~th^"V9~u(~th^"Vg9~ th^"VS9FN tkQPDžuh^"V)99tt79uNH4~^ SW FtPh^"V8.>WӞ222F$52^_[ËAP 9ttЋR9uIHËIH ha"Qt8Vt$Vn22^SWV|$t$Åuh^"V,8;^ty^C Fs j/WGS2 2W WߝFV86PH1ɅF fN^_[USWVd= 2th f2jjh%_"j=2td|$xh""W4ƅu0膩0Ph?["hdf2 Wh@_";t$ f 221؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6jvuݡ2$2؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W0i[u2$52L$T$9΋$D 1$T$|2~L1\$2 tAD$t$ jjShG29|͋ 2 $52T$|L$<q$Q Ai@2D2QA 22QA02A$t$ Vjj(QKhF @t3-0Phm_"hdf2C t$xhy_"8V虜h^_[]USWV$= 2th f2jjh_"ge1PPU菪 Džy0衦0Ph@["hdf2 Uh_"88D$,PWKuy0_0Ph_"hdf2u Uh`"7$jSƅu h*`"7SVW褩 xD$j(PW萩 y00aPh\"hdf2 UhR`"{7Ws2RrD$l$D2=@2,$1Չ1 9$hdf2jjht`"jj525262jP2u h_"6PjPh %HĨ^_[]fH2D$L$ D2@2D$L$ 22=2u t$(6t$pPh`"S6D$ L$$ 22L$T$ 2<)2؅~ڋt= 2tPWhGj"h f24 =2 22hQV 2 2^_[]t02 PUhGj"k s-2hh2U> 脆0Phj"hdf2蚲 j萩USWVE2fH2l2 h2D$i"Vh i"hdf2_^_USWV 1D$ 22$L$D$ 2D$=2u hg"=2Tt hg" 2ȅwEA 2 $ L$u |$~D$$D$D$E Ɖ=<2r11F؉Ét$@2D$tkHL$ D$ 1 9D$ tP$ PUD$ $L$=1~bD$ tP$ PUD$ ;$D$D$ u $T$P$ PӃD$;$L$|$L$D$ +D$ $T$P$ PӃD$|$ߋ$t$9ø$L$$L$=t$|$|J|$~CD$ tP$ PUD$ D$ L$$P$ PӃD$|$~=D$$D$D$] t$|$؉AF; <2^<2)|#=2t)Phg"h f2` <29})A2tL$a<2FƉ9|׉޹2 uC$L$|4=2R=2t5252hg"h f2ڦ|$~52hh"O =2u7f=2y-=<2~1t$ljG;=<2|친2~#2h2B)te^_[]á2fD$ T2L$ T2}PhP2҉QPhP252hi"hdf2jSWV|$t$28;2vhUi"b 282WVP: 2^_[52hj"hdf2蘥 j莜USWV$$= 2t$hf"h f2^ Z$ $(މ4$9{CKQPh:"hl$U赡= 2t CU341hf"h f2ܤtUCKQB+{))σf"WRL$ QP$(CKQB3{))σ4$g"WRL$ QP$,蟝BCKQB;k))΃ g"Vt$RL$ QP$,;t%=2$(tqUh+g"h f2ӣ \{$(u0jh;g"D$ P@ tFjhvg"D$ P( tk= 2th f2jjhg"U89(jtzwC@Ng"P$Ό6C@Ng"P$荌C@ig"Pj$$d!C@Yg"Pj$$ u_{C@ig"Pj$$ !C@Yg"Pj$$f =2J=2t&d";$ tf"Phf"h f2 = 2th f2j ^_[]iSWV|$t$=2t\2WVh`2P =2uWV5X2w t^_[Ë5P2=T22Au0PSWVhoi"hdf2TjJSWVt$=2t\2Vt$h`2P =2ujjV5X2\X!ƒt^_[Ë5P2=T22t04PSWVhi"hdf2ʠjV2tufH2VVVC ^PD$L$ $QPhdf2苤 X2m > YV=2t114Bu11Bu=Iu1@'525T25P2Phk"hdf21^SWV\$j/S3tMƊ?SDžu#Sjj0SDPO/F^_[WV|$ thm"WWNƃ=2uhVDx= 2t.u Ft#q"jwhq"jwSWV$$$Vhp"hW3S ^_[USWVӉ΋|$-3RYPSURh SY9u ^_[]j\=3u"p"j3SWV t$t$4hp"jVlS#jfƅ~'|$01ۍ)QP53h ~9߉ ^_[jUSWV t$4|$8\$Whq"jS-3SXPSU`g WV53Pg 1B$ ^_[]SWV Ӊύt$sKt$ tVWh^"0 |$W|d01HFu3h8#WYYt9h$WGYt'\$j SW3 $ 9uy6hr"U$~h8#WYt@h$WXt.\$j SW D$ 9uyvh#r"jqD$PhU53C u ^_[2h3r"jqSWV |$t$ >h8#WaXt9h$WOXt'\$j SW; $ 9uy6hr"U$~h8#W Xt@h$WWt.\$j SW  D$ 9uyvh#r"jpD$PhU53B u ^_[:h?r"jpUSWVhA$(1hWD$ PB |$ |$ D$~P1ۈD$$,,jUh!`V tjUhQs"LV tG99ufD$u\$ tR$,4jVh %V EjVhWs"U 4jVh\s"U 5\$ D$7f@jh0uht$Vj P53D$^ރ9tD$j@hes"PA ߉tD$PQDaryDpriml$t?tD$PfQD andfD D$PJQDgrowfDnt$V,QD defDectsDuV Qjhs"P$A V53535353hs">Et2tR}jhs"V@ uH}j1hMt"V@ #}jIht"Vz@ t6WhG"裆Sh $蕆UփOut$׮ hx".^_[]1h2s"j`mUSWV}\$j S53O D$t"NuD$Hj@PjSPht"jl$j$Vjj53rF=tPht"覅D$D$ D$$fD$t$j VE 0k 9 1L$81qAQQ a A j QV53-D$t$ *jht"E pRR  D$ @L$jhtjPjQ53ht"Ƅh f2 D$t$H1D$`D$L'Ƅ$0VhQ`53= $j D$tPS> |$'y9D$(ȋL$;%|"@D$PhWu"h f2j uD$$<JD$ D$ L$jhtjPjQ53~e^_[]ÄtH<t<u'53hu" 53h#u"hdf2聅 P53h6u"hdf2fh_u"iht"jjE 0ht"`USWV $ ~($ 1j4hnu"gP ?C9u1CCJt$LUPV[< CJjh'UVjS53~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P53535353hru"Y vL$D$$jh'hVjS53Ffȁw$VhU VhU ƅtL$D$jh'h$PjS53]$f1Ɂw$PUhWhx"'WhX#YvL$D$jh'h$PjS53$f1Ɂwhx"t$ t$ 1؃;D$ D$4ƜF>|$Ń %hM%h7$菀 ~y)L$z"xQRPhz"WVqhWVt$D$ 8%u8%t#u@u+t'Qhw{"VPq)V%P . RQh{"VPTq^_SWV|$t$t$hz"r~t1DPhz"zrCF9rj qFY(WPV ^_[fUSWV`$l$xT$1\$|rSUR+ _w$G $G$GX0WhQ`t$|* t-D$[u`^_[]<t$<t-<uCjW53.ht"jX53h" 53h"hdf2gs P53h͑"hdf2LsjBjUSWV\$$|$(t$,1EEVPW* E \$ ]Ejh'VWjUt$4$^_[]SVL$T$D$ \$F^Fjh'PRjVQt$^[USWVt$|$ \$$1EESPW* E]jh'SWjUV,$^_[]USWVt$ l$tIl$L$߉<r uBGu".Ko13Ār< uF9ul$E^_[])1l$: rx\u@tfE\\7tE\: 0E:$ 0E:$ 0EIt]EG9ufUSWV } 7x]h"WS| Hw$%<;3փDu34333(3 3$3,30383v<3j1FV Ph"VUuO5_29}E$3 03=3uuu 03=3u,3th"L Ȩt&j%= 3u!Ph/" sD$Ph;"S}1L 3H 3D$L$P 3 T 3D*hr=#P;|=3< 3< 3)he2PW跍 G?t ; 3rx9u; 3 < 3\$)<+m2T$JDHUBRk<H 3D$ L 3L$D$1ɸ=3T$ωD$ \$S6ƋD$)D$tGD$ D$H 1ۋL$|$=3VQP( 33=3ۉu\$ m2DQu+<:wS6eKC CCCCuh?"TD$PT)D$\$S5 $%D$KL$  S J#GBD$ @h=3S5@ 3H 3 L 3uh"dhP 3腈PhO"k7X 3ucP/#t X 31jPPd =3u'tu/hc"jdIdj jh#!臭 MPhr"jjcKAkdT*T$JKL$KL$ KL$L$ \$ KD(B\$ TH\$ KSAL$AKSAL$A KSAL$AKAL$AQ6*T 3P 3!уu+D$T$H 3L 3hB"jPPhk"hdf2k jbUSWVP=L 35H 31,9|1C=L 35H 39}`s %H-%E9ƉMm|)t6jju uL$1L$9ȃ}  $Q1F,MUۉu1;}E|uHE EmubWV"VysWjh3Wj]3WjR3WjG3hhVB x`j"h"P~@ hP 3A jPVb@ jh~]$VR@ =3W1PWV9@ VB^_SWV։ϡ\ 3H \ 3uhh` 3 ` 3h"h"hS[fh""S=tZÉ "td"h` 35X 3Ph"SmiY|@hP 3S Ph"SAi yWh"Phʒ"j蹩<|.i< d"t@#QPh7"Sh t Sjj!h[" Sjjh}"@ 3tSPjh=3hd 3u;hVX1jn[Su1WZ[WV01^_[WVP"=03u%$3<u" 3uƓ"u#!h=35X 3Wh"j藨jyh"=(3uhݔ"=3u6hhh"a? xjh"P= V"@ 3Wh"jQV,d 3h"8j~^VNjh#" 03u$3ujj?"uƓ""u"$=43u D$@˓"D$=83u Γ"=<3u ѓ"=3u )"=,3u ~#= 3u }#v# 3uH18h"tWPV> :8Vhԓ"jЦ :8Vh"gj=(3u h"jtj]jhd 3hW"ʃfUSWVكှ=L%] yBD$t$34$D$4$D$"=L%sBD$t$34$D$4$D$ "=L% sBD$t$34$D$4$D$"h=L% sBD$t$34$9D$4$D$" =L% sBD$t$34$D$4$D$&"=L% sBD$t$34$D$4$D$0"=L% sBD$t$34$aD$4$D$^"H=L%sBD$t$34$D$4$D$4"=L%fyBD$t$34$D$4$D$>"=L%sBD$t$34$D$4$D$%q=L%}tQL$ D$h$D$"D$ ]X|$t$34$#|$D$hD$}4$ D$0D$D$3$\"pYGHtD$$m"YYG(D$$w"FY$ ZX|$,u=31t| 3uteXu<$L$$T$  3u t GX@r9=$3uD$D3$T"XGXHw $C"$d.Gt u UtVtR|$,ދxT$$\$ ,H L$t$D$,D$\$T$ D$D$\3$D3ƋG@T$$\$ tnuj1D$D$L$(L$ D$\$$舗D$(u; 3 43Y= 3LD$D3$"W3D$(M I"$%|$D$ D$D$$$`_83ZG4D$hL$$T$ JL$0$ oLưD$81D$D$D$hD$ t$D$0D$D$$$薖"4$BD$8,8 D$h$n1uG0D$$5"VD$,-1D$D$D$(D$ t$ht$D$ D$D$$$14$D$D$et$h\$(1D$D$\$ t$D$ D$D$$$貕D$(D$4$D$D3D$(1ɉL$L$D$ t$ht$D$ D$D$$$Q{4$D$D$$bm`1D$D$D$(D$ t$D$ D$D$$$D$($D$D3S1D$D$D$(D$ t$ht$D$ D$D$$$蝔4$D$D$D3c[iF D$|$D$ D$D$$D$ D$D$D$\3$D3V9*8 D$($>lt31D$D$\$ t$D$ D$D$$$ؓ&A1Ah1$D$D3D$Ö"UD$ @D$0t$h1AtD$h9k4$-|^G4D$TD$hD$PЉD$8D$4|$,T$<|$PO8D$4@L$DD$@D;tNI΃ ;t$8r\D$DL$@D(;FuK~1Ht0<$ kT$<1Ht |$t$ $ T$a΀-% plj\$ Cut$BT$ҋ $)|$4!1ɉQD$PSf D$ D$ 938*!8\$ L$ D$D$W|$h n"SDh7%S;h#S7h9#Sl3hO"SV'hT"S@D$t$ |$@ 1ɉQD$PSd D$D$ 9؋t$8 8|$q 1ɉQD$PSf L$ 99։D$> L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,ShD34t1hR"v 1<==3 ڍt$81 D$ \$phjShD3PVT$R裹$1BD$L4JD4`L$p$QRSRPV(3 $3u1$P/#w %QhD3h"H 831<=4 j=V9=3 j=VbT$81 D$ t$ hjVhD3PRW耸\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP蔇$hD3h9"D$49t 8Vhy"S1JD$ $$Qh&",=(3D$t$=3$D$D$,D$\$(VGC@D$p9Vh"0TPt$hơ"|$oQhB"=(3D$WSt$h."VD$ 81ҸD$ |$\$ Cj"$PG^ÍD$pWVPSt$ $P\$ E $D3jt$tS7 $D3jWV# -0?PhD3h" B(3 $3$PhD3h(%ED$ $u1@t$2|$ Qh"(11G|$1\$ tpupth#QD$ t$D$t1@L$ ɉ$%t"PQ^Q|$t 8t1j t$ .m4$`St$hy"FQt$h"7.l1m1L$ L$ ف$K{8P|$W>D$ t@j QS D$ ;$|$8tQtUL$4 T$hjRhD3QWt$> l1T$ gL$4D$ D31ɍAD$4tT8`T$ Q$QRQPWLc(3 $3T$J/#w%Pt$h"t$L$ $d$ r $3 $tu¸9#tT"PQh"|$D$u |$u |$TF1@]$%t"Pt$h"$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qh["0uPt$hv"|$L$lj% L$St$h"{D$$%1ɉQD$PS] L$ 9t 9St$h#",D$ D$ D$D$0L$0RPQt$,t$$PtBD$tUtsD$ |$D3jVPM D$h|$t811FD$&|$D3VVP  D$'$D$8|$D3jVP D$pD3jVP UD$1=(3D$44$Vt$hٟ" Ph"=3he^_[]4$h"ًt$D$t$$t$S @9s Vt$hb" Su @D$t$|1ɉQD$PSx+ T$tD$pD$ 9t8u[8 St$h"Qh "31ɉQD$PS[ ƋD$ 9t8t}St$hD"St$h["D$t$։D$L$8`OGL$0d$ rxL$D$nT$L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h" j6j-PhD3h" hў"h"h"hD3hÖ"SWVPD$t$|$L$ $QP67;9w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS|1Ht$L$ltT$d;WuT$h;W(u QT ŃtD$ppPUe D$DGXHr PdoXd^_[]USWV$l138D3t 3/3ShD3tWD3މ)ˉESQ|$ W DW3V!Vfǀ3/SUuD3Uh3u!,^_[]USWVhT$D$e"0%1Ch31D$ CL$;rjt$V脀 ufD$jD$Pjh3Vt%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPxUWt$hE"|$$j@WVP[UWt$hU"j!WVPt$=h1ջPhT"W< 3t5<3Ph֝"5h1<D$$PV5h1@ @3^_V΅tO$Hw;s1 3 43te0{|PhD3hߝ"M Atʡ 3 43t"0E|PhD3h(% u =3t^j2USWV=(3ˋ}$3 ,3 t u tth f2jVuQ}ti=03|}t j }8MO؃thD$VuP t$UtuRhT"8{5p1Rh7$8 bD$VuP tMD$PVh"8 D$VuPV t+t$ t$ Vh "z8]D$ s*P? D$L$ r!QPh΢# rD$rIPhf"QPh6#xt$hݬ#8}u h"8j 7e^_[]Phׇ%USWVP=(3u(ˋl$ D$$|$5$3 ,3 t u^_[]Åtth f2jt$Wd܅03| t j 6$^_[]uCuWt$h:"D7 K4$~DN1ۅtPhz""7t#=03uPh+"79t03C뿃u,h"6't+ORhT"61PPUVSWe=$3ut$ hT"&>rt51t ttt ttth"% 9uЋkT ;$tl  1L$D$Sjh:"}% {t+1:LtPh"W% G,;{r܃TD$@TL$9uj O$VM1A ^_[]hD3h"+USWV }=3t D$ toh"Wtcv1ɉt$QVWf T$$9t8uL8,Wuh" =3jN11CL$ t$PSQVuuctWt =(31=,3u?=03u6L$1J1ыT$1 u#MUPj h"1ɅRaMUPjV tK=,3u-=03u$1H3$3|$ uMUjj h"MUjjP e^_[]ÉSWVtm2q~FDx@uAFX@ut9vm20Dr@tH^_[USWVPω11s6tUVh`"SPUhV#S? t9VK4$Euuhd"蔢Ɖ$t^_[]hl"hg"j hl"hz"USWV\։ύD$ jPj P 1u0D$F|fD$Y|Uh"j D$ P $L$D$ L$/Phz"j D$ P [ $fL m2/LA .sD$ L<u\$ So~jPj S E9[|$ t D$ PE~Vh"w!d^_[]WVth΋u\~8tU~4~`N4F8 I9rPI1F0F4F8FXHr PhIFX^_fUSWV\$33hT"sP\su 3ʡh!Pu 3j3Jmx &蹶'?c.53芓h!PYu \M3=\M3_"t"l$PKrt Pu|Qߋ<-t<+u{uNhk%StGSM16khd"q3t8u)hk"q3Pqt 3aT#hr"}q3Pqt 3{"1= 3tjh"~FP7֛j觛N=3u0j_`ujjB=03t!=xM3u=3ujh" C1FVV7=M3uhr=#501fu\~jhˣ"B jM5M3f:0BuK@33!Ѓt4M33Bzu=M3t0譚|M3jS=M3u T3=R3~jh"u j j 6GWVt$ y5 35 3$3ut[<|=,N3t=83t|1'V1Wu=WSBVWV|$ Wl@jPg>tWP^_t$t$=>tjh "jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@9<3<@3U50[3=p3u D3p3U=v====,=XAf2 D3it3x3|3F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff fܩ;D$t3D$L$d$ x3 |3D$D$fD$ D$50[3Pj50[36 <3,^_[]VPhht@j t1h%"ktP辎$t$uչr$~3h "rkt(P耎# 3 31 3 3u.h0"!kt P/FM#Tƅ~53h+"jtP# 3 3 3 3P^V[tP踍=3t1H V^PL$$31Qw$%8"M(uMf3 x;"4>"+A""D"G"J"M"=YÉP"/uf3S"uf33WV׉vu1=3u WVG^_SWVPhV"iPi1Ʌ 1h$ui%t3Qh3t3i"t3Vy C"3l"3o"3%3 u"3r"|3!y33333333~ LN33$3tީ;#d"d"t 3"gtlj=3u"O43x">"t 3"!"t 3=|M3t8=3u/湰" 3% 3= 3u  31 3d"u  3d"# 3t8u03 3d"%q 3=3tt8u03 3d"#": 3t8u03 3~]$湳"  3t 8t1@  3d"1 3d""s$VWWh 3h 3qq"z%V5 35 3h( 3h$ 3H"$V5 35 3h0 3h, 3"$V5 35 3h8 3h4 34#;tlj=< 3GF#m@ 3_%⹹F#d"d"tơ 38t,<$1QQP؇ PW <$W@$h"D 3X%=1d"ud"ud" 38t2<$ 3IQjP\ PW <$Wv@$۔"S>H 3FG# tÉL 3%#d"tƹ!=3ud"t‰hd"Ɖ5P 3>u +3^_[É0=$@ 3z8{lV t<0 1=3u V聂^USWV׋t$$\$l$;Et*+u($d"t D$ L$M^_[]USWVր9tMτtC1` 383U53WĀ ` 31` 3U53V觀 ;` 3|ut$03^_[]Ë 33USWVL $։ύl$ D$?hҤ"W)?SWUx D h! VU $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$xt$4h! VWr L^_[]Ë 33V=M3t =3=M3uF 33 38t! 38t=3u H 31B83=M3u 33b=M3t 33HT 3=lM3t!=3|1Fj 2F;53|^Ë L 31B^ H 31B L 31B=T 3ug=M3t =3uN=M3t 33=M3u 33=M3u  33T 3Ã=3"T 3Ë D 31BY P 33Ht$j5 3襂 1B)=dM3tË < 39t3 =`M3jË  33  31BV=M3L 3tH 31B5X 3t-F=3 3t 31BV^Ã=3 3t 31B^_B$X 3t 31B>X 3t 8 31B'X 3t 0 31BX 3t ( 31BX 3WVD$ #=$1 lj Ƌ $ 3j" , 3j 4 3j=N3ttV$  3j5X 3^_WV|$ 1Ʌ<+u OL$ GW-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$|%1@ÃQ*A wO$L% ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$1 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅thB$VXtrL$PQV t4uRL$x٤" $x2P ٤"T$x ߤ"$x "w^1Jդ"^aD$# $1  X 39uVD$ T$5$1! щ щ! ‰ 19^Ã=1th"Ë @ 31BSWV@΃=1tt\ 3tVstx1Cj S*VGVVSP_GVh*$Pt \ 3=\ 3!Vh¤"j@W"WZ@^_[ËD$` 3WV91t#֍|$RQjW1B$51^_Ãw%ÉfUSWVPt$ P!уtRPtt jh"jh "l$$\$|$Q t^tY9uE}95u =Ճt(ˉ $19u tC ;$u~2KՃujhQ"t jh "jh7"D ^_[]1ۅs IQRP踒fVt$t=1tjhe"51^á1xy=d 3uE h 30@#4@u.d 3jhz"?t  [3t1P 153.3V1N=h 3t9t/ h 3,@wB$@(@1҉,@Ɖ^USWV=1h 3@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh"1@$qQ51 9D$}h 3럃^_[]USWV-h 31|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5 [3(h 3@9@S h 31JЅt8=l 3u/@u1u0@4@ "&[WVh 31t[@t @4v h 34@0@{!уt RPF1G)t  [3t^_USWVh 3t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHh 39t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë h 3t$@(@ ,@1HUSWV5h 31H(@$@9t#H1ًP1 u,@;Hs DN3%D$z9tG1؋O1 D$ ~9 $tG#G=M3t @t1x9 @}lh jB#tH @1HGG7FGF8~FNOG Fx ~,@;GsN+M3~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@!ƒ5h 3@@1tOD1Q@u;G  )RQ@w u&h 30@4@X%OD1@l$1tʼn$yjhǥ"1=3u 1x~OUQP 5h 3@@o<$t0@D$4@=l 3tU=N3u#L$ Qh $ N3j2=l 3t=M3u q= [35h 39>tOOHOh 35h 3wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jh" 0+31H^_[]USWVh 3ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H1áh 3@u1I4@0@Ë9t1JQQ 9u@o h 34@0@1@@(@$@,@PPP@臶!ƒtjh"81PPjt$]!1WVh 30@4@!΃t@@9} 0@4@^_SV\$t$ 53({h 3h8@jh 3@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjVl!ƒth 3 h 3@P53vzh 3@u@^[SV5h 3@  ˀuH9tPQP P$dž @vv Hu5h 3@uE u@5h 3dž@tV#1h 3P53y^[áh 3t@1fWV|$t$ t=p 3ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnV腐tD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV hd"j`9h"lLh!3h!3h!3h"3\$ -uF :tjh"]jNbt'.t5!3bt0:wtptcu+!3F&jSh!3 "3jSQ ,uF!3!3!3!3!3!3!3!3!3!3!3!3"3!3"3!3h"J1tPhk"J1F$1Vhv"Wht 3P(h"dJVh"Whx 3P ^_[h">JPJj3(71B th"Jƅu&h"Iƅuhê"Iƅt]h"Vu6h"Vqu$h"V_uh"VMt1B"w1 m2TA ruƀ| 3ƀ| 3ƀ| 3@=u=p 3D$| 3SVt$ !3M1ۅuD!3;1Cu11(u!=tM3u1 1ۅÉ^[D$| 3ËL$=r!=p 3tP5t 3j h|!3'| 3u |!3}!3u|!3ESC|!3Ãw@| 3uQh"VPt$ u !3ESCuw | 3u;Vt V5x 3B$!3xPV@,@| 3uPh"V5t 3j h!3!3^WVD$L$ =p 3=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$%F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=p 3t'~3P19wKS>~-19s2C,9r9v)CK$SU褸uF8AUVo ɋl$u9tSv ft1|$jjSOF ~.EFE0uE^_[]V$*3t";T1t1FVh "3P/ $*3p^USWV\$,=p 3tV*3tgفuH4*3J 4*3,*319*Qh,*3~-*35,*31E4*3J4*3,*31E*3=*3u *3 $*31҅; <1t҉օt1PS;H*$%=8*3+"@*3Шu*%=tS *31*3]^_[]Ét$8*35$*3 1y *3 "3)É 1n1|$ l9} SWh "3X uԉnd"t*3 "3VW= *3= "35* *38u!e08*3<*3tP<*3%MD$P- *3E˨ - *3E8*3 8*3? ǃ,*3^_[]8*3] v8*3e8*3 *3= "3v!x ux ;| *3= "3w%8*3 *3< t *38 t8*38*3 8*3*3B5 *3a8*3 *38r 8*3 *3= "3wx u *3= "3\x tQ *3= "3.uD$ L$PjQ课 $T$e^_]Ë 4*31; *3| "3á$*3t @@@ 11i\1PPUSWV=3׉΋$$L$ D$1AyōD$PU&#D$=xhM"UU W$ShU 0jhm"U& ShUa D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(1D$ $X1D$D$ $Uj $Pt$Wփ ShU` S诪1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=3o=81u=h1u =G3P1TAPS@PjVPW2|8QZtQL8h""WÉ4$pu1ND$PVx#D$ =uhV虻h`"a0tPoSƅdո(1Ex uָX1Fx uhm"hX#S T$Z^VUh"S:S 4$VWWVĀ^_[]SWVh"/P/tt;^_[&hr=#VU1ۅt+h$VAtV<1AÅt^_[SWV|$\$t$t.9tFtVaF(1tX1u%"+"QhX#P tWh"v Y=81t"h"hX#vj V(1=h1t%h"hX#v? VX1^_[^_[USWVPӋl$D$ $uSP蠥SS1tD$ t}t8^_[]StV믉h "3jPN SPuSqWV *38L$ Ƌ*3 39}I9u *3xtWD$ *3$*3V *38t,t$<$PD$ *38uڃ^_SWV "3*3$ 3+ *3|51ۉ|$8tZO\$3+ *3$9|Ӏ8t-t$|$D$|$D$$8u$ "3)ȣ*35 *3^V^_[V5 *3 "3tR *3)Ɗ 0@u 15 *3A= *3 "3"(*3= "3 1@^À= "3t8*3 *3 15 *3(*31@á *38t AUSWVPQ$1;t.߉WjU $)ډfu $;uƉ^_[]USWVh߫"O+h"@+Vh"P@ Åt^_[]jhɫ"Wz@ t Vh"Pe@ Uuh֫"*Vh"P:@ ÅuVh"W%@ WV9G t'փtPh"VV G?G uG^_ÐX*3i ËD$u5Ã<1Ph"USWVD-43ÅE\$9uz$1ۀ|tisljDDs9u>rjjx \*3\*3$t,tV#hj:} = [3TeuYÃ= [3e4΃eX*3~o6/=p*3u #=*3 t t =^=p*3;*3Ct}.CЃ jS&ed~h*3 l*3h*3=X*3t X*35=X*3u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=X*3iX*3ih $jjS\Fc`$%=3 ]%t53#-l15X*3=ES[jUY  xSX*3H݃t = N3-`*3>!(Ƌ 1ķ>tjVUP t j=1u J[\ 1jry C$P% 5X*3 h"9t39@39x3=p*3Sp*3C1Ƀ *3*3ῃ5p*35p*3X*3/U]VsWWr!2@*=3%a*3X*370N3X*3hhS#jj*3*3n=3 5T1X*3 }h"X*3 _gh]%y1PPv0N31; h*3`*3 l*3Hl*3h*3/=3 X*3%h"1PP9t39@39x3؉ك u. u.S莍i*35l1X*3%aih]%{jVy*3*3 PZw `*3 **3уBЃ@*? !1҃ ƒ!D$Z=p*3,9t3t 9@3h 9x3W jhK"j#t$(VOVrlp1BsRtM&=3=X*373`*3Щu`*3Mj5<1ùe= [3Iv_*-t%+q1҃¹) *3*3S\B D$t1< *3D$ D$ PD$PD$ P萪 p*3tjD$D$-<{|Q<`ʃ=*3tR D$HL$@븃@*3|$ ^s 8eBX*3emhȬ"1PPL!ùe9t3e9@3e9x3e e 1?PS1FP@/*3Phd"5*35p*3虤 1;5h*3l*3|l*3h*3n蔰VVA 1;h*3l*3  l*3h*3|,3'M1PP5,3 =M3 *3 t|7ػT 1;h*3l*3|l*3h*3蛻=M3h*3u' l*3|5|*35x*3Ph*31QQm1;h*3l*3 l*3h*3|,3|C=M3u5|*35x*3P1PP5,3A l*3h*31҉3P5M31;h*3 l*3|l*3h*3M3聺觮5l*35h*3DT5M3JX*3NVh"h1PP5 ùe9t3e9@3e9x3e e /йSE*re|褹ʭ.3*31.3 tM3 *3tM3 @N3 *3@N3h"CjjhW"l*3݋5h*31ɸd9 jh{"=3t>t5*3.3*3tM3*3@N3j)eD$t Pj{@eJr蘬 L$Qh $1;h*3l*3|l*3h*3)O=M3h*3u' l*3|5|*35x*3zMh*3jjP1;h*3l*3|l*3h*3跷ݫjj蟷ūD$<1D$Ph"=3jh"VR l*3h*3M3 l*3h*3M3h*31ɉ l*3|l*3h*31@Pe(ejh"e1;h*3l*3|Yh*3l*3 諶Ѫ=M3u5|*35x*3Ljj- l*3h*3ʃEݣM3c l*3h*3M3*3  *31; h*3`*3 l*3|l*3h*3q j5<1?h*315*3"5*31;h*3 `*3l*3|l*3h*3 j5<1RCih*31D5*3=M3t5|*35x*3J1=W l*3ih*3me53V?P/V$h*31ɉ l*3|l*3h*31@PuGjh"h*31ɉ l*3|l*3h*31@Pk 2V_e!ֹe5M3RPyJ1A诳է l*3h*31҉AQPcM.3Nn.3X*3>X`hӬ"r1PP?ùe9t3e9@3e9x3e e S賁+̲1PP5M3n豲צ1PP5M3jP#'h*3l*3ؽy蟦=M3t5|*35x*3Gjj5h*3d:0ؔh*3l*3艽*Pjj5h*39; eS贔D$D$Ph5"{豱ӡh*31ɉ l*3|l*3h*31@P"etbt3tFu j11A; h*3l*3d"|d"L$Qhl"11%h*31ɉ l*3|l*3h*31@P'"e11A; h*3l*3d"|d"L$Qh"je53<hr=#P袌531=tjh,"o5l1X*3nvh]%1SVUh蠻Ag53rSPx]M3 3݉h*3 l*3.39‰}h*35l*3)‰.30+3eM3 3h*3 l*3.30+3i1l*3h*315M3QPHFjh"H3D$Ph"d ։u=*3th*3 l*3*3e,5*35h*3tI~V8Jjh"bUSWVP趮ܢGVD$1Ƀɉlj щ .3.3l 3= [3uH9ljD$u21xUUjn6 9- [3u;=.3.3D$tl 3 [32t8teue^_[]USWVPӉơ`*3u`*31 r4$0utV4$#`*3`*31ESWPO á`*3 `*3 *3tu1Fx` sKu j]j%u0SW5`*3 á`*3 `*3 *3ujh"t 4$4$^_[]WV=1u=M3t =3u袬׮t 33!ʃt]53QY0+3u =1uP5lM3=l 3lM3l 3u _BLE5lM3=l 31jPPB ^_SWV*3߾%tr=#X*3/ V+=*3u V@t h̭"t u]%]%P1,+3PP^_[V蛫ơX*3"~S.#V$^%=3*3VPujhk"  tY>!t *3t P4 V!*3=3M*3.h_"qF<+t< t 3t Q V菛3/7E=3V蜭he"Pt% =3V^Xh*3^(N5h*3jF5h*3jQP軯^5*3V5*35p*3p*373`*3`*3PV3h_"hd"r^SV `*3t s7X*3Zb`*3shq"i`*3 sh|"Q`*3 sh"9`*3th"#`*3 sh" `*3fyh"`*31Ct$‰sSh"jV#V`*3CuϹI"t$ s"Q,+3^[fD$=p 3t@WV|$ Wjeƅ~WhVpo ^_USWVt$0l$(|$$t Ug,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD p 3H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tWd t W WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f *3 *3 *3 *3USWVi $AD$)< u?FP貛^tP|}9~"ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp1hhh1hЭ"htjPV jh"h"hQtjh"h"h>jh)"h"hQtjh:"h2"h>^Vt$ t:j jJ tL$HΉp *3*3jh@"荞^Vt$ t:j j tL$HΉp *3*3jh`"H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃVN 1H^_[]h" t8tMjQP[ ƅuh߫"t98t4jh"P/ ǍEjPW W iUUUSWVP1F=3jt$P#19jV n1PPPS7j!ƒJVWSA <$SS11 ?$:81xM'x+xG1O|E(|n|dȃ|$*3t*3Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW S1N^_[]4$ |t|uVP11xtɉSWVh*3t$b<ƅui\$h*3e5*3PSh*3I5*3P|*3t*3h*35*3p^_[ËT$ *3t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=M3ÃB1ۃ=M3ÃCɍH9 3~Pj#|k0+3SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=M3ÃB61ۃ=M3ÃC%|$mu93~HPj#j0+3؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PNsV0ʼnP6sD$X9vpG$11Ʌu2~>9sWt$Vv t't1:%11F9r':$1u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWrV19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQOGt1=,$jUuWPtW診 U[ڃ,$C^_[]SVt$ hr=#V!`1Ct'h"V `thܮ"V_1ۅÉ^[WV$ VtVWVtWt^_USWV 1=M3]=3Pj\hN"1Ƌ|$ 11@L|uM@-u)Fhr=#W;_)1%tuQ%t s@AAۃ\$WVcZWXZ؃D$jPtWVt$PCW "S 1tXt^~u1O\$$D$jPWi uQD$P4D$(0r=#^jh"4|1 ^_[]ÉOV.;t;V.1|$rɅuŋD$(ܮ"1O;PrS" USWV=3t^_[]j荈h"t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh'"U{PljD$UVXWXS\$X,8jUHrS\$SVUP舍4$: S1 \W V- V|V$F#N@ |^WV|$=M3taPW1=M3#D$=WW*jP`qWP'hP1LPWx#D$=@{WcWjPqWPمh@1VKs WoƉ|^_V|$PV2x D$XT$\1jPPVF|^UWV蒊lj53# QPt1GL$ T$3+33 +31@ u,L$3 +3$3+3 u!tL$\9|$X}e^_]øZ"Vt$VRV9vHx/uAΉ^fVn $+31ы5 +31 u^ã +3$+3=`M3t^6~^P~SWV1ۃ=l 3t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=(+3t(+3USWV-N3~ON}=N3~Q111SWuljӉ:}qF;5N3|؃= N3' = N31= N3|=3111;5N3| V|ljՉ!<$= N3FD$1;N3á3D$ 3D$.3D$$313.3PPSUt$ ljՋD$ 3D$3D$.39pt$j pF1M3H91Z{1@^_[]Vh 2F;5N3uj{ t j2^USWV\$,=(+3t(+3&|$$t$ l$3t  $9~ M3$x 9} H9$!tT=LN3t M3tCP+31҃=l 3TRQPWV脘WV Ɖ1ND$(D$<$=lM3t73H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=lM3tzmz1@D$/1@D$=|1uu=1t h"\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|1 3t)!u =lM3u=M3u(+3=M3t Xm,+39l$"3HPj-|1Ot1E1=N3~1VV|{~ VVVD5 -l 3t <$tw y|1j@ ^_[]USWV=(+3t(+341=+3u!M3y=lM3t 3'|$t$;D$||$$t D$93~ =N3É!tF=LN3t M3t0P+3,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=+3táM3y=lM3t 3ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]Åt3HPjytm=l 3tPay1u11FUvUVRPVjv!уu [3tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V 3~&111RP!уtF 39| 1 319^fVt$tsVGF953u#1=1tu1Ɂ1tщ 3AF=1tH 4+3v  v ^ ^ËD$1tQ11tЅtË 11tËD$1t 11tËD$1tI11tá4+3USWV\$S@Nj511tv WQ6WG |$j4j'fSeFSF 1HF$F F1FFF0F,1tFq0@@F=1t@4+3VEESKËnUK9Ë\$sU虪 SKeFW脪 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P诩 w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=.3jjPWV^_USWV,T$Dl$@ظBӃ=LN3t  M3t0P+3 @1)ʉ|ЉjSUQP虊كQP4v=M3tK uu|| t u+| t u [3tt [3}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+t [3ǃ݃ tkwRPW v=M3t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N .3 CfN =.3=M3ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1M3l$t$1E1!1M,^_[]Ã=M3t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy51=1H~y@wr 1N51=1^_[ÐSWVstjh"c^_[uƉס3HPLi11 u^_[8iWV!Ӌ 3It*QRP4 3HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhD"bKy1V[hVjRPUo=M3jusj'hD$ jhD$T$l$ !Ѓtd9}\3H94$SW!уRPvlj9Љ $A3H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$31VVjt$t$PY95M3^_[]1K16-(+3-0+33H $)QUjSWP(1K[6=lM3tf"g150+3SW=g3HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9D+3">$4,$tt=t|<9D+3|wC^w \$D$Shŵ"jWn$4,$d"f9D+3u+9D+3}9D+3t9D+3hu_G t t1"~#ut|\tt t tL@?3~|$j=W9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEu "d"6$4t$ t t_G̵"d"$40tUPg;tu"dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQV7<+3^_[]SWV׉Ή5@+358+3h"hSj=w )WVRQj<+3S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl1 t^H+3H+3I+3JtGtO GO H+3I+3l1 tH+3uH+3^_[]ÍZ w6$ "&tEGЃTZ$H"&btPeu>fH+3랄tGOm>"놃>۔"w>M%h>_%YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]H+3I+3d   >H+3 H+3 I+3J+3N+3Rhŵ"jhH+3h"H+3_t>d"vVh0"T-3P+t T-3!hA"蹻X-3Pt X-3R"jVL\-3jVL`-35P+3h-3h-31-3PҎ $u.3^1|$á .3$.3Sd-31-3h-3 \-3`-3 h-3h-3@h-3;d-3|1ۉ(.3,.30.34.38.3<.3@.3D.3H.3L.3P.3T.3X.31H$.3 .3h-3#h-3-3P $u.3[USWV\$0l$,1=M3uSUƉסM3 N3SU\*@u6 11!ʃt'9݋T$0|1@9-1T$0| X.3=M3tU tX.3-3Z-3l-3-3N3 -39}Q-3Ɓl-3 -3ك=M3WV^! tt$j VRP)NVr01 N3)~$-3r5-3Ƃl-3 -3Iu܅~+1ɊT 5-3~=-3l-3-3A9uס-3H -3ƀl-3 -3-3(.3^_[]Ë M3t N3=M3t1N3@V5d-3h-39}9 `-3<u"\-30Ph-3 `-3h-3F9|Ӌ5d-35h-3-3(.3^SWVt$\$u$D$0j?oP-//=p 3t&v!Ss1҅ SVqt1҃Pn1҅t$Sth-3~- `-3Vt[u`-3 h-3LV3Zt h-3t> `-3VtV[t'i=p 3tVs1҅ƒK1JFVY# 3#3#53#3‰^_[QY# 3#3ʉ# 3#3áh-3\.3(.3`.3á\.3h-3`.3(.3ËL$1wQ5T-31SVt$ 1ۃw)V5T-3uV5X-3s1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJk"9u!B1@uDA;1A+u%uVt1@^ÃwV5T-3u߸ع#L$1uj jE1ɉHHߊ SWV=H.3 u|$t$\$t-1 |15l.35h.3tm1@Z ugHN3t tM3uU=@.3~+t.3 p.3\@x.3@.3H.35h.3=l.31H.3=p 3 @.3%=uax.3Px.3|.319Rh|.3bmh|.3m|.35t.35p.3t.3 p.3H x.3@.3u"x.3|.3x,1WV=p 3t x.31At^_[ÉШu-%=tS0l@.3=t.35p.3뢋t.3 p.3x.3@.3USWVӋl$,|$(8.3=M3.3uBu>%j jzC1҉PP.3P.38.38.3twQPl'UWS .3xtT.3Ph-3蔅1.38.3u+@N3ttM3A\$l$͉=p 31؋5h-3\-38.3Rk5h-3UWS% 65.3; .3-3PV軄.3@-3VP诅V荄 .3AVUUUЍ@@.34.3 .39}oh-3藅ơ4.3 .3Y$gQVlu&\-3h-3PjVPm<.3$#5\-3-39|h-3l$ EVjUek L$ )v %uh-3蚃5.3 .3 h-3; d-3 5\-3|tq=`-30jf j`-39u"_l$\$u4Шx$_l$\$u$5\-3 _ ‰$ u*DN3t =tM3uKuG ڃ^_[]p 3m_uiud1UWj(.3+-3 t1P+391J$;T+3} qɉы4X+3)t _\-3\$ PjSi 1EL$\-3) h-3PjS`i ǡ`-3 h-3tW4V)(.3~Z<.3t\ [5x1)Й)֋$F UWh $ N18.3E1-8.3$_PdtUW ]p 3t6=M3t-QdtQd UWl $UWS t1@1^_[]SWV=x.3~4։1|.3Pd VW u C;x.3|1x.3)^_[Ã=@.3~t.3 p.3@.31WV=@.3~t.3 p.3m@.3|$t$ =H.3uu 15l.35h.3itb=M3tY4.339(.3|0.3(.3,.3h-3A3 4.3H9(.3}M3 j M3M3jf=N3(.3tLX.3tBx 4.3 39}; j,(.3P 4.3 39}X.3ы 4.3 39|L=3tC3„u0=M3t't4|$t- 1j1j 1j5h-395P+3 u\-30`-3^_V=M3uajm5T-3tMȺj9٤"Fu=T.3u"Ⱥjx"Fu^SWV։ˋ=h-3Gh-39=P+3 u\-38`-34D$ (.3; 0.3~~ 0.3h-3,.3 (.3^_[SWVd-3 h-39}1T$5`-3ׁtu Ӊ h-3@9|^_[ËD$L$ l-3-3VD$ L$=D.3u=M3ttNI1҉ tK1G-39~-3l-3+5d-3)΋ `-3 \-30 ~^D.34.3USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8 [3u/P+3H9| Qu@\-38GO1H^_[]cS \-39t \-3Mtۉ>?SUSWV-P+3\-jSmw jS`w DžtVtRU5\-3Vo `-3UPWZ U} 5\-3} 5\-3=`-3P+31t W} 1Gt V} ^_[]USWVL$D$ʃQPO1H…t$=P+3\-3D8OlV tn [3uc~\-3>-P+3u@\-3 (I=P+39rHŠIJ\-39s=P+3)\8OVà uQL$ t \-3t=P+391H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= V%| 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15.31K.3|EtESSP t衄.3@ԋ=h-39=P+3 uS1Hte1ɺ|1:tWAuN1|11I:t?@u21|11I:t%@u1|11I:t @u^ËL$H1Ʌx 1USWV։Q@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=M3u1@$5(.3+54.3~1; 3^USWV։L$|$0\$,Ѓt<.3!t6tC؃T$RjQPWSQ=N3=P.31ۀ=L.3tw4$L.3 .3ىȺVUUUЍ@)I-3~4,I-31E 8Vt$0j* G;}|Cu4$SG X.3tf .3.3!Ƴttt$,9} 5.3=.3L.31ۃtQ\-3 h-3T$ 1ۅ~&L$ PjQ\ h-3~`-3\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E4.3;.3uX .3#$.3uD$, .3=$.3=-3~01-3 8jG;=-3|h-3t(.3;0.3~<$~0.3 h-3 ,.3$(.3~1 ;j_G9u4.31;.3uD$Ph-3th-3 d-39~~51ɋ\-34*1 `-3444A; d-3|١h-3) $ 4.3h-3 4.3; .3~(M3 j4.3H4.3;.3؉^_[]WV|$t$ =M3u1WVP PV WVt1@1^_Ð.3H ȁ\G3r1\G3G3.3G3|G3G3 G3 G3G3G3G3G3G3G3USWVL$0D$,l$$G3$G3G3t-9Br }$r1z3|$( HG3u$$rG3t :=G3G3G3<$:rBJ jl$(jWG3tC:G3t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?G3t_ )ϋ,$]}G3tG3tV+BJ NF=G3uW-G3MEu$9ˉ|-G3],$ϋ=G3t sKӋ$JHJ^_[]USWV1=M3tD|$(T$$!t3|0G3G3=G3t'9PH }=G3u11CŋE1ЋM 1 u ]u,G3G3G3EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR} [3!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[ [3u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVStG3 11؉^_[]Ã=G3xÃ=M3u 0+31M3Phx"4VG3xNH G3d|@G3* G35G39|jh"z5G3^USWV|$ l$1ɃG3G3tKC9⻤G3G31 G31 5G3v vB1IʅI~nVv 4$9ʼn1I1PPt$R9 [3 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$R [3uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=3~%GW8É!Ѓu O;=3|܄u<$<$US111 )ȃ^_[]USWV1PP@uejh"2.31111ۉu WVSU1PPWV+ [3u Ɖ!Ѓu.3^_[]WVT$D$ =$N3t 5N31)|щƉ^_fUSWV t$ >-uF(s7h]%+V+h"+艣D$1S6]+S)S\^S"Spjy W~"h6#À8t>tkV聪tmSʼnD$1$U% $ȃ$jP'袷t$PSh "%t$UCt$l  Sa'Ņu>tVh!F'US-Uwl jW!W~1FVJ]V'D$$t*P*h"y*/j ))30+3t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjh".1N\$h""SO4h]%Q)SH)h";)3(1S|&S[jj # 1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVS Gjhض"1KtL tGf;t=ËFHN~ ;F~à tQu VSFVu1Vj 8 1GWZWg%e1=0+3VZ^_[]fSWV1G31K4t 5u'#ar'G__ _Gt PNi GF6u^_[ËL$ 1ɅV-$t:L3'W.t7^uM3L31L3L3L33 M3L31L3L3 L3L3t P`f L3Fu,~1S薺PW豺Fv)f ^F~ ^v;3t PNu VSWh ^_[ËL$t@;3tjh"x)1HËA QUSWVD$T$1ɾG3=39~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9L3u L3L3uUSWV\$SκƋL3t@PPV uL3L3d DžL3Wd u^_[]USWV=N3|$,t$0hX#WD> l$L3L3!ʃtWj UQP"L3uL3 hr=#V tL3VUL3Ph"W=u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=39Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P^c  $FQF^_[]V=3tjh7"&dt$D$tt/uKV3;m?u7=1xCjhm"뵃=1x%3Qh"l&^jhY"jh"{Vơ3t Pb VޣP3Vhb 53蛙 ^33VD$$L$ t tC8.@L$$VhMu%Q 1>jh"1xxPh"j V8V||P|0tB D$0Ph";D$$VhMu%P >t.jh"1M3L$Qh̷"$^ãM31V1x$ 31Vh@BVPRQ_M3^VD$$L$ t tC8.@L$$Vh53#Q 1>jh"1xxPh"j V6V||P|0tB D$0Phe";D$$Vh53#P >t.jh3"1M3L$QhI"#^ãM31V1x$ 31Vh@BVPRQ&M3^V|$u%t$jVt0Ph"N#^V|$u%t$jV؇t0Ph"#^SWVD$L$tPM3p=3tjhʸ""VP>PR Zt V踘)X!ЃtV谕5M3SW? ^_[VD$L$tt\uoPe01_Pơ01t=(1t P^ VӟP01V]^ 01Qh"!^V|$uJt$ =\M3tV3-M3h$_V_h@^^WVD$t t0t$R3l7=tDMtGhuXF 1PpM3R3Qh $5!Emtwt su!FF1FR3FR3F$17N] V^_D$u5M36Ã|$"7VD$Hs^\jh"7<1V)h$&Ph"h"V;1xu'h="hw"h"hϹ"h "hA"hv"j^^WVD$t$ʃc"y$"&m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=N3utjhº"$FVPMy0Ph"^_ÉPh"USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;P+3~T+3A9s } uE9u9t},u E&| t1P+3+L+3x1 ^_[]WVD$Pt t*$TVPVLD$ps D$ stopD$Tab =t1|i1Gt$rVfD,V4T+3hf"P軺 G;=t1|ViD andD theDen t$VD5x1h"Pk 0Ph $D^_à D$t t+uyL$tJQtQytWjh)"Mà$1L$%1AAD$PhM"!%1%1$1$1%1 $1%1 V D$t t]D$t$jh#QVP46hr=#Vt5>t M3 $M38M3tP9M3r=#L$QhW"O ^ËD$Hsjho"/Åu  3Ã|$u=M3D$u =M3~GTM3ÃD$ u)=N3| Ph"N3ÃD$ u)=N3| Ph"N3D$u"=N3t=3t*!ƒÃD$ t t%uCD$ 1^u2@t+$1"1P7Qhܻ"V D$,L$(t tC1ɉ N3 N38,uT@L$,t$Vh#Ql >tejh"Ot$5 N35N3h$jV,0Ph("#t$D$,Vh#P >tjh"9 ^ã N3N3D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$(#&d~&s wR$P#&s wU$#&gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G0N31 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh`"1QZS0N3^[ÍD$PhE"҃=M3= N3=N3Ë M31 3+N3t$4Ph"hM3 M3USWVl$,H ,M3t&AUjQD$}ol$,7F]$x#&|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph"hM3Գ M3FVEŅ8D$EH$#&E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=\M3nAL$,9 ItIT$uWoD$,7M3j+o2Ph"M3V蒲 T$jV%D$,|$?+3t PP GP 3CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WP |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh0M3P ,M3I,M3^_[]É|$|$ u D$Ph" D$Phּ"͉-,M3ōD$8Phs"uA0h"j*h0M3%ËI1Ph"j*h0M3%USWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph"=j UQ xt-u)%tt0Ph"1H^_[]SWV9toӉQ@jP ljtG\$=M3t <\u ~t F <$t)\tPSt GFFuD$Qhƽ"1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$0M3Ph"|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hR"3rtPA~11@USWV\$(|$$1E=TN3uhXN3;?TN30[39<$l$D$l$ =N3t=.3t=M3u1=N3ubPjD$P D$tD 19PaHD$=l 3t=4N3tft$,SWE TN3=l 3u"t1PN3@PN3| j=y!b8T8#1Hpt9=0[3tN3[1TN3D$ D$D$$PD$Pj 9=0[3t  [3t, [3TN3^_[]øjhXN3蛢UVVIVe^]USWV\$0 ` SLVA,jUVSh^"UP-^_[]Vt$V_ uVhb"hN31 N3^USWV D$0щL$l$ |$$t$4PWUƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWV]Ջ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$Sւ׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WP荂Ét$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWi)$l$D$ ׋ $D$ՋD$1PPU\$S譁ыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPHe^]fSWVP [3t 0+3Z1N3WP(t>1C4$$N3u V WSCu ^_[S=R3tR3 \$1=R3r 1H 1R3[V51N3t(N31VP51 9t 0+3^Vt$51^Ã=R3tR3r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVcيl"O u݃|$0xG-Wt$8 ^_[]USWV\$8T$0t$,11|$GUSRVيl"O u݃|$0xG-Wt$8{ ^_[]SWV|$(L$$\$ 1Ѝt$Fl"NuxF-VQ.^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$P ƃ^_[]WV t$RVQ t|$P3GuV^_9Hw @sÃtP=USWVPt$|$R3V<$=M3uԇTh=3 "Vt$ P]Eu 348JMp;53| 0+3^_[]VWj .^_[]ËL$T$d"PPh}" USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFuR3^_[]WVt$|$ zt!1Ph"Ph"d"PPh}" ^_WV|$t$ t%WVra7ft=3 0+3 j Qu jF^_fUSWV\$l$=M3u<؉%t1U1GWP?[PW1WPPUVd[1 jj1=31Ƀ=[3HPVWV Åt!Wj9 |$t8jh"'D$ tP8D$ 019 D$ 89t V9 ^_[]Vt$tP768 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQy ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u D$E ʀ[} M3@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ør%fL$tt"u$ 33HI 3IR3ʋTUSWVD$T$ 35R3|1Gll\G9uTD^_[]SWVD$L$53R3|F|\\|N B^_[á3~Ph5R3 USWV 3; R3R3th!t 1G31K;)1G1I4:tl!GtˉPk5  3jQJƣR33R3~PhVF !t\l^_[]USWVPL$\$As 311H$(u31@$1R3<#|tZR34ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$R31H; t$z|#=3|O1;Ll |C9u^_[]USWV 3~.R311F1l9޻r G9u1@^_[]USWVL$T$9~1@+5R3A1G1֋l9߻rB9u^_[]ËT$3!х1A9Hh%&*R3=\M3<&&t&&P R3h&&R3h%&1hl%& 1h%&$1USWV \$4Z3R3|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$$&=M3EQ-s4C$ىË $Fw$\$&#Fw}$ $&X!уj WRPBBtDt L=M3!153hr=#P41sTu~-#PuYQA tLу|=RP螽1 $1=Z3R37f1=.3u ÊCCs|,v, l,uȡ(3!ƒtظ:,u53资j W5.3QTу 35N3n9|$ V5353蛅PtmƉV/ +1+5Q ic+Ɖ!уRPUVZ3=R3H8 Z3H=R3wA53kP豄 !уRPaٹ N3 3VQRPg 353,Pkyփr9RPٺٹ}"RPOj WRP$I"QD$ tOՉr6UPlٹ}RPVt$!j WP( I"/153Mj WP j W1P9D!@|R3d"9 Z3t R3d" ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5M3Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^51~V5pM31=\M3tȉt 1R30A(3^5$1'SWVQHNjZ3عZ39r ЍZ3WVS ;Z3;^_[VQ!уu$x 3H9}FV!уtt^^Ð1Z3Z3Z3Z3WV|$ =(+3t5Z3tZ= 3ta=3|<1W!уtRP虆Ws@G3H9|vuZ3覍5Z3^_USWV 11D$L$!ȃ1D$1D$ 1H1111= 3=(+3t4$=3|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$3H9|u $u^_[]Ã^_[]鍌^_[]TZ3K|$thZ3m=Z3t1=Z3Z3j jh""V΋At Pc) FVC^hZ3SWVt$>t_w () W) ߅u1F FF1HZ3Z3[3[3^_[h[3SWVQ1u(\$|$[3St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-[3Vt;xH|p$x Hȅu^_SWV|$t$u;[3Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=M3uH 151!ȃt3191|$|$ !@tp\$9ϋ\$(|$}^Z3U1tHt$ !t Q9y}1I(t(t$=LN3tT$$1=Z3uȅt^_[]hZ3Z3=LN3tUWVjW7!t"j]jRPWV je^_]Ã=Z3u M3[3Z3d Z3Vj5<1t2Z3jVx 1F=LN3u=Z3u@11N^USWV(U ]1Nt$ t$tr:tm1Z3PSi( LN31 M3t)1V5Z3hZ3 LN3M3ttxq @3Z3 LN3t =M3tj)LN3u=Z3tZ39Z3J\$tP1ػ&!Ѓ1ojh"D$Pj@t$>SD$$PL$Qt$Tt$V>[3$u:[3 [3!ƒt&9L$L$|D$;Z3D$Z3t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d[3T$X/ t$e t$ Y \$(T$_CtN4$jjD$xP$Pt$4t$5Z35Z32$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$ V T$1H#E t0E t L$PL$THD$$e^_[]Ã=LN3u?hZ3L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ .3L$.3L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$.3}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8.30+3t$ t$  }tEL$L$H1USWV8=[3[35Z3Z3D$$8u=[3u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}[3 [3ȉT$!Ѓtsu!9t$ƄuYZ35Z3;t$T$$|@Ut$ 9D$ЉʋD$4$P+3@EhZ3h[3}!P+3 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># Z3L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=Z3Z3!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$[3 [3!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ [3D$[3D$$Z3D$ Z3e^_[]1JЋ4$|$9ωL$}@D$ P+3 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=[3 USWVt$h[3tH>tC\$1EjU1GGGUSxL[3G=[3-5[3t~'V u[30+3^_[]Wl USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5Z3jjSt$DPV5Z35Z3s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@c3Ph[3RUSWV T$(\$$t$ 1`1PURS)ˉ<à uVh $Wt$|$u u)u%u!1ɃtsQl1Phb"t DhO")^_[]SWV \$ hSh"# uPth"x) ^_[2xEhSh."o# 4$t t$j VBh<"뙿 hm W51t$S jW|$WQ[9uR1Vt$k4$pjֿSh"(VWV|$ 51j/Vt@jWhZ"QV"^_1@c3PjBÊD$f2J f2;$f2~{у ts f2Q f2jPhc3h"" thc3hM"Prt:j51P? f=1u5Pa3ůh f2Qhc3h"USWVt$81GWh!5a3迢 1-c3hp SDD$ha3SD$U Whtd35a3赣 tLtFPFuf=1Pa3tjQPz Pju^t$4l$0jSMD$T$1D$EHM~EHMU9ڃÃ=c3uf=|1u0Iڃ% tM 1f=|1@ ЈD$P D$ƒ t|f=|1Qq f=|1uf=1tT$j \$Ct,j Cu\$T$f=|1x댉\$ 넻 $f=1tD$ @D$ Phe"ڃf=1c35l1MjW5Pa3輡 c3 c3 u61=4c3#$ |19uj5$t h"$jܼڀ tf=|1u j ttFPFujKÉU t$j^f=1t'+\$|$f=|1i"t"WSP jhtd35a3x ha3jjw(^_[]USWVP\$D$jP5Pa3 f=11=c35l1޻jD$P5Pa3I W9=c3ttػ1FU Ph"KtMVhp[35Pa3- =c35l1iVD$P5Pa3՟ WL9=c3u^_[]WVjPh$d3h"% t ^_ht[3h$d3Hrh$""ы t[3u x[3Q[hM"P=tAf=1x[3"t"PQhWLWh"V \Wh"Lh!v j3c3USWV$f2J f2;$f2у  f2Q f2t$hVh" 1GWh!5a3 WS蓏Wj舏ha3Sj Whtd35a3 *x>jGƉ׉U J~*9u$h f2QEh<"!11f=1tjG)RPh" jhtd35a30 1ha3VW* WV谎Wj襎^_[]j5Pa3:W謷1SjoSWeVVh"SuUSWV$f2J f2;$f2у  f2Q f2t$hVh" 1GWh!5a3" WS賍Wj訍ha3Sj Whtd35a3$ ,(x>j FƉ׉U*H~*9u$h f2QEh<"011f=1tjE)RPh" jhtd35a3P 1ha3VWJ WVЌWjŌ^_[]1W5Pa3Yj5Pa3IS軵Wj而WSvVVh"W膺USWVPhI"G1GWj9Wj.9&tDƅtZWF9uhO"1VjVj ^_[]hdf2WjheT#Wh&"Z1Sj貋SV裋-1j/U2t@SQU hdf2WVheT#zWh"WWVPjh#5a3觘 f=1t%51>t=a3VPVWx 1FVh"5a3a |$VW5a3荙 ?nu51h1" ^_VPjPVhC" t=a3u.5 1VkyVhI"ɿhQ"|P^Vt$j5a3肙VtVh]"臿hT":Ej[WV5,1t)>t$=Pa3VވPVWc jSj{VhVhk" V1t$1jh#5a3 1u1$1%1t$1t$1f=1t51t$$51f=<1"t!Pn1t$11d31t$1j1t$$1f=1"t!P^WV,|$8V5Pa3bh!Wt! $#a3 $ a3a31GVW5Pa3 ha3Wj8^_WV,t$8W5Pa3-bh!Vo1Ʌ#G OWj5Pa3g8^_V1Vh{t 5Pa3=v jQVhzt 5Pa3v ^S\$1u4=jP輖[ESWV|$\$1FtCWPt1^_[fUSWVl$$1d3xd3<`3%PhP1h"t$4Ua1I~1L$$D$=_38O>HЃ sX 4HЉ5<`3jhP1h"t$4U߃ufH1K$l'&<;d3뷃EF<;jhG"S jhH"Sو hx"S胉D$QPuV<;hGQ%SShG#S=zhx"S'$_=_3<;@a31@D$<$XD$d3=xd3<;j/S`Pxd3k<$$YxD$ P1PhPjPP5<;4_ <`3L$ !P5<;h1"Q~?Ha3d3La3=<;Wz*Sh@$hxd3F 1@1H1HD$1@$D$~1HD$$_2)t5|$L$(4h$Vct5@a3Ha3d3La3I Vj܃VjуVjƃVj軃_35<`3h"j V耷V4$jh f2Nx"w'&P_ D$tu1=_3 1A111ɣ<1 111=d3t 1=Ha3t5<`3 uW6uB=Ha3u5<`3 u3^_[]xVhe"Hh"Ah":h"j5<`3h"!h"h"h" h"h"j賞hdf2jj@h"PNjfhdf2jhh-"0NjFfUSWV,|$@h jW^1ۅ_3=Ha3h_3;u.j ׫1=La3ȍPUxPa3j詫Pa3x3=_3u?jP Pa3teQPa3Uh $9_3WŅ?1GVj=_3t1O,^_[]ÉVQZ=La3uL$ @Vj5Pa3B 1Vh t 5Pa3o Vj豀1@_3jh_3:fWVP= `3t 5`3t$uh"[\ƅh"D\t8/u11" P] Vh1P虶 NK%1 (&9uQPt$ '&uڃ=<`3u%h<`3h#t$s u <`3%hd3h$t$N u d3=d3j:h:"t$耵 1Ʌuǡxd3u'>/5xd3jV蚹xd3d35d3Ha3d3=<`3u <`3%d3Y1ɉ d3xd3t=d3ud3t =@a3lj:h~#t$蹴 1Ʌ d3=Ha3u6d3t=d3tP5xd3ʁ1Ha35d3j:h%t$T t 1j:h%t$3 t 1j:h"t$ t 1j:hG#t$ t 1j:h%t$г t 1j:hC"t$诳 t 1j:h4#t$莳 t 1j:hR"t$m t 1j:h> %t$L t <1j:hu$t$+ t <1j:hb!t$ t |1j:h~#t$ t 1j:h>#t$Ȳ tLa3j:hN#t$課 t 1=d3u d31=d3u d31d3tPhF",d3tPh<:"d3tPhӚ%d3tPh$hd3hn"t$裾 u d3hd3h#"t$~ u d3hd3h{"t$Y u d3 5xd35`3 `3t%j,VFtA1ɉ5xd3 `3^_Vh=" VhU"h"j街ttu$Vh"7h "h"!j7fSWV t$ |$6?=g$`3m(`3C,`3i0`31ht"P~4`3VW8=La31hTa3S{T a3Ta3%a3%a3%a3fa3 a3a3fa3a3ha3jS ha3ha3ha3h!v jy"94`3t"Ph $da3 x |AEjj5Pa3 xPj5Pa3Ȉ h"jRu hz"j處1h"VW苻 vtHЃ rt+vh"8`3ō HЉ<`3봡_2)ǃG<1m2DHu0Ww=r$hh"`h&"j$SGhWh@`3h ?t GG?u@a3@`35<`3h"j V'I Wj7xWj,xWj!xWjxVtuh"h"jh f2Qh"S1t Da3 hx"=Ha3t51u,u5=Ha351{51h"j赓Ph" WV-ƿdf2Phz"W` Vh"WQ jG=a3tha3htj]e jySWV51t>u+t$c3t Pk V,ƣc31hx"Vyts4c3hG#Vytah)#VytShE$VytehGQ%Vyt1df2Vh_"Wo WFG4c3$11ɺ10 ߈c3Bu^_[ñ1WV,|$8V5Pa3OWVFWVL#NF=La3t L$f=1t D$#$d$d$ wfD$ f=<1t $Vj5Pa38^_ha3jj SVPf=1tj>t$R 10utztD$=4`3„u10u1f=11몈D$< t< u>jV5Pa3z f=1t|$ ۔"td"P`u 2 <1tu 1tt A8u1f=1t m2DAt |m2DAD$jV5Pa3 f=1D$P_/hTa3jjO USWVt$D$ $1=a3h jsD$1CSjshTa3SW Vh $Ĩha3-tWD$ ha3jj t$jMsUjBs=a3uD$ 1;$ȃ^_[]Ët$$4$e2H e2~e2H e2he2teȋL$ < U;t$ KD$ V1FVjr5a3h۔"Vha3,SWVP1\$ x1t%,`319u Gt+t' u9tpD$jP5Pa3 Yـƀ_r0c3^?t@آ1c32c3 0c31c3h0c3h $PW1^_[Pe2H e2~e2H e2$e2Qst1Ƀ=4c3!YXD$_r0c3^?<t@ 1c32c3 0c31c30c3SWVT$L$D$=4c3ut1<18c31F9uRQPU~ y{8th$J)^_[hQ"USL$ \$1B1t 9tA8u[VL$0b3tSA ."8t6u(^@\VPt0c3)ƃuf^?݈@0b3^VD$Ph9"j=x1x1,`3Ft1_r0c3^?<t@ 1c32c3 0c31c3h0c3h>"_r0c3^?<t@ 1c32c3 0c31c3F t*vPh0c3hB"蜤,`3~ v 7^ÐWV1Ftd3VW5a3| VW5a3} ^_USWVt$jV5a3}  uD$41؍oD<jV5a3r} D$< t r֍,f=1tc3t P;o u1D$y1D$h"Pc3tD$y1D$nD$jP5a3{^_[]1f=11USWV1GWj nWjnn VWmVjma3fCPa3CfC 1l$jjSw| ~}D$tvjhtd35a37| ~]td3Bt8StGWuG1GWtd3U5a3z WUl$5a3{ 1f=11D$hU5Pa3{ jƉ,<=4c3  A9rWD$Pj0z f=1c3tyf=1~g|$_r5,1Pt. c3YSQ;Y~ڃ tZG9r QR貦l$!y-.w8u!PWjl$U)8VEh@ jf=1tc3t PyljfSWV1t31^tPGtF tFFu҉5 1h"hWOhM"WtRVhW t4=8`3tWh"qj WƚtWVk%%1^_[USWV|$h$W4nj Wj=W5t@C@uSh$Wmu S6ÉXj?W5t0tO@t8JS?!tOYt@t 腗tWh"F~5=1t,1Ft = @t >t~vuك=d3~h۔"d3^_[]SWV΋d3C!w\Cd3؋ f2Qf2; $f2h f2j ɣd3 f2Q f2 Xd3#|>Wgأd3NI$L(&Wh(#8d3@d3N Q1f~ @d3f2H f2t;$f2lh f2j! ld3v Wh" `Wh(#貝d3@d3N tEPPgd3V f2H f2!6h $`d3#|d3h۔"^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n"L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh$SRjuW 1@WxljR1^_[SWV11t8ϻ1WPjt!CtWPit Cuމ^_[USWV׉A tS^؃H$l(&n tWUitjPu U WuF tQfB t 茓th"*N 1?!9~ t~ N 9tF N^_[]h"fSWV,1f=1t h"|$r ۔"'"<1u#j5Pa3^~1F=d3uv/oh"̙ÍHЃw$(&h}$2PPhq"褙 )h8c#hږ"hJ" hU"hd"yh"l,^_[USWVP1e3jh"5Pa3[q j-Shf@5Pa3=R $tR(|(PV5Pa3\r $j0V.ufjOhe3.tjKhe3.u@Uhxt 5Pa3Q Uhyt 5Pa3Q OEh"舘11@^_[]USWV D$h2 jcD$d3|$hd3 us51 jW5Pa3zq jl$ÈD$Vat1:ul$B9u|$tjjbD$t$jxb1 ^_[]VP1Vhxt 5Pa3P j+Vhyt 5Pa3P j5Pa3{j+j5Pa3{jh"5Pa3Lo "<0t<3th" h"1FVd+Phf@5Pa3O jh"5Pa3n V0+j5Pa3 {jhxt 5Pa3O 5Pa3 q^jh۔"5Pa3n h-"dd3jhd3^fUSWV $ uC#h\jh8e3O 1HHe3e3hG"<t F"df3O"he"<$tdf3$ h}"USܢ ƃw$(& 8e3׃B/<;8jL$QP{ $9bLf3Pf3 9e3냀 8e3w<;%df3` 8e3T 8e3H-<;h4"Ug|ſ")&h8"UNVWUE u<7t;utC 8e3KD5tX<=Eh=L%U~Nƃt=tU]USD$0@<=uEjD$PU( L$9` t ,QIK8e3h4"VX,<0$ $ <;"5<;f3VPaf3tAG$VPa$ 8e3Xf3\f3 9e3y=@e3nh=L%U+MUPh;" |jh"h"hq h%"h"hhx"hn"hKh6"袧h"Vh"蒲 Whv"&UVsh"vhp"jyWhT"ZiQWh" <;Ph"jyu*8e3 t5_2)~1҅ S| Wh)"+t%thz"|$ DTf3$ $ 4hW uW$ 4h^"9ō$UhP tʼn-De3=8e3`f3hPU-j He3u$t ?#P5De3h"hLe3P4u5De3h"@e3uG=Tf3ty@e3f3=f3tVf3h8e3Q@e3u7J$ @e3z$u+h8e3Pu,@e305De3h"Z:u5De3h"E= l$ 1rh$ US> |4ōPUS> < ߁WjP$> N1\$ PPh; tB=NýjPU  9 Z8t Z8uxY8u2N1 T$ PPS 9ǃu8Y8u<\$Shmdv= t*hR"#Wv h"v h{"FN1 T$ UUPB ljl$Shmdv< 91EUSWV$F~ 1jUWSPa9u!D$=жxt9wwF̓uv h"% v h"趢ST$1uD1Gu<jUPSv!a9tu&v h{"h"a1^_[]hPv h"<hv"h"h h"h"hh"h"hh"USWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ PZ; D$VUP; s DD$st$s 8D$ s <D$tf4$l$4U`*&Ot_uhb".h$h $hdf27 `*&hf"hdf2 uhdf2j 趢d*&D$l$4$sf@8tD4$t$xV@S`JPSV% \$$Vt$SsK1D$0D$,D$(D$$d$sD$4j@HP; st$st$h"Kt$h":t$h")t$ h"t$th"L$9d*&t uQh" `*&h&"|$4tD$4Ph2"|$ gvVD$PUg9 16D$8uT$Bg)QPR th"@1@^_[]USWVӉ͋t$V' 1Htkt$t$VSU]tGU!Yt$t$VWU]9uVSW t'WO T W9 1H^_[]W( USWV$$$|G8-t _2$D$ 1FD$h,"WS莋 it 1*&19t9At&9IuJuiu3$tHPh# AtPqhD"ٝ 늡<;A뀃Dtou&t$ mt$d<;$W$uQ 1t$hWV!7 jSV $FWPP uh|}%VhiP6 u h"jdWWT$*&1l$D$G_HrY7SchjD$*PU6 ft$fD$CL$fA37S hjD$&P6 ft$fD$f\$ $T$0 T$T7hjR5 SEZft$fD$fD$PSU6 $T$l$GD$x|$ hhjD$$Pb5 \$ $ sh"{sh="{s h`"{sh}"{sh"{sh"~{s h"n{s$h"^{s(h#"N{sHh<">{s,hc".{s0h"{s4h"{s8h"zsXf|$rL$I"fw *&L$T$ t$"VRQPh" yh"h"j`D$f=111hjD$$P02 fD$|$<1fD$ $T$1h $xH$|*&L$f|$"t"PExD$=ufD$L$IL$}1|$D$L$ tm214/Drt#E9uT$ЃDPh"w~|$uj1pjPP jt$t$ Vu  VhiW&0 u h"D$(|$ u,$PD$D$,$|$ 1hSW!0 GG?t$>hSD$$P/ G$0hSW/ jl$UW  wh"Fvh f2 Wh:it$VF/ uO j.2uh f2jk KWh:iV/ u CwK8)|$""Pi$rkLPD$$PQF/ $<1|$Vh*"cut$kL4t4*&ho"=uh"0u48~1D=P5tG9uh?#4 D$4!4"4#4$4%PSWRQt$h"t4(h"t444,40k<SWPRQPh"st4`hA"_thf"Rt4\t hu"9tt hz"'th?#4d6|$1A t$t&u/7t$t nu Qh"sFL9Mt$ $t$qV NP$t$RVNhq"Ph"hdf2Ou jElUSWV։1hUS, jWS  sUPPx t'Sh9iP", tVtMĔ^_[]h|}%h"j&ZUSWV׉1hVU(, jSU  }VPP tAUh:iP+ uGPh"1FSLĐ^_[]h|}%jYVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Ph"q^WVh"qf>r1D~Ph˔%qGH9|j]p^_WVh"qf>r91D>Phz"oq 9} j:xpG9|h?#>q^_WV$fGjRWw WhiV(* t Đ^_h"j;XfUSWVu }6hd"jٯ h"VW} Hw$*&f3f3ԃBu|1PP5<; f3불f3f3f3f3f3f3너f3f3sjh f2O_f3S3=_2=f3u.1L$A AAAQj jI =f3f3f3f3f3f3e21O=tf3+/$3tchr=#VT=t^=f3ukjjVH ƅD$ PVD$(!=<\$yB  e2u1PPV_H Ɖx\$f3f2=tf35f3PL$QG ƅ~E1f3VPSrF i)u5f35f3t$G ƿy5f3h $:f3e21O=\$t$9ȉQTHL$5f3u ύD$ PSQ5f3r*Vh f3VhA"Af3f3f3f3f3VG3h $\f33VG3h*"Ɍˋ$B65f39Ph"hdf2n 1@f3+/$;e2t=hr=#W:t1"=f3uM"PWn;? \$e2\$=f3 1$ӋFHN~ HV8ƒ =f3u u u1G1=f3up=f3u< u7 =f3>hd"h%"h f2m f2@t>$@$Ph "h f2emڃ f2@ t_  =f3f2H f2;$f2h f2j$Ep  =f3xf2H f2;$f2h f2j^o:=f3,f2H f2;$f2h f2jMoڃ f2H f2$ f2H f2^f2H f2!;$f2h f2jI5o f2H f2I f2H f2Mf2H f2%;$f2h f2j-nڃu! f2H f2-m2DPuWf2H f2;$f2~ƒ t f2H f2h f2Ranڃf2H f2";$f2h f2j^&nڃuv f2H f2^?tЃ@Ӌ f2Qf2; $f2~ ȃ t f2Q f2Vh f2Pm=F @t5f3h $f3f f2@uie2\$t V3(e2%e2Wh $Gf31;`h f2T3uf3e^_[]h!j"Oh+/$fUSWV$$0hd"j趦 11E1D$D$D$D$$׉jh 1hZ"$VLjQ~Hw@$+&ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$j<;$ىY1ɉPXuG _2$T:-u"j9uzuI _2 u _2)t u <$u|$uM1ۋD$Ã<$D$ tD$ @$4u9>WuTWh"D$u5t뢍D$PW蚫u!Wh"Mhk"jL$1 |$ $jSV u h"P$1uF;8Vg^1CHHf wy$h+&|$uhUÅu뼋ss 耧 PVh^" |$u.jSU ss I PVh^"Ƅ 1F $tCPpQ|$t KP;AmPsT$Z|$Osh $1F7h7%jKPPh"hdf2]fjS]fUSWV$$6Q1hd"UM -j3-j3-j3-j31ChB"VW'q e'H wu$+&j3-j3-j3Ńo'fil k3뙃prvk3oaj3k3j3%j3-j3-j37j3-j3-j3j3 j3k3k3k3k3k3k3u _2)ǃ=k3j3u-tX1Ƀ=j3=j3tL$H=j3=j3=j3=j3tʉT$4OZk3jZk3PZt$lVUhH1) 9rUh"\hH1`+H1 @1QT$/u>t$|9A@1A @1I1vy/thO"h"jHt$ D1Dh j,=j3u$PhH1$PhH1Wu@68uT\=k3u=j3t@j3 j3t3D$ P6葦1#$=@txUhH1D$ P6ަu6h $jG#D$=@uj3 k31ۉ  t1ۀ|$/uhH1h".t9U)r|/u (IHr IH9/touɉt$PX k3USWVT$juQ PUD$1t$CHfw?$+&ss ͡ PVt$ h^"F Psh"4>|$(5D1C,H1)=|5TShH1h "~ t$V1Ga{DuO|$u C(D$?Cj/D$ PAYt L$)@L$D$h"Q,T$CS(L$)ʀ</t ~/t/FD$щT$H1)rPhH1h/"t$PV  L$@1@1=I1vx/u H@1=j3tD$PhH1DD$PhH1賣T$KP3Qt$31 u@T$(3Qt$$3q u.shH1hP"} CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH1hv""} 1Gt$#KPqt$1BD$ $+&=j3L$ QP T$ j3 k3sHtbffM ${3Q${3T$ $k3t$/D$ !=@8fush"4|jSt$ V 1G)=j3tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=k3t$tjQ\${3H ${3< k3tICPphH1}94sh";{D$ PhH1?1u=k3thH1sh!#[ VÅc1G108uFVde^_[]h-"h%"h6hG"h@"h?h"o7h $h7%jAc0hH1fWVt$$D$(H0JH(x,z H4x8J z@/uD$PV蕒"X$hSW W>t?$ VPh$hW;KD$PW;"t VQD$PW蚒Å@{4WVY/PVFt@\$L$/PWrFt@L$ Q\$Su)D$ )=|\$=0{4u=4{4h f2oWh"hdf2|M e2H e2~e2H e2he2É؃t9 t4e2H e2~e2H e2he2ƒ߃Y=({4u#D$=@uW:EW2[u8=@{4u WV+&,{4 PWQVQ&tW#1ۀ=D{4$E{4VPWh "zJhdf2jj h"/9D$t$QVP Ƅ fDŽ$.$$PQ\$4$9|$ t#t$WP$ D$Ƅ fDŽ$.$PQi$3$$3$ $3$$3$  WVh"*i fD$L$TTPQKËD$L$TTPQ2USWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPj^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP8^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP<^_[]USWV |$87"hd"j jIt7D$Phht@j uD$tL1P{4T{4X{4=u \{4t$41۽h"WVR HσG$8,&X{41`{41P{4{4{4T{41`{4X{4d{4h{4x{4낃w{4{4^{4O{4@|{41H{4"{4{4@1P{4{4{4p{4t{4{4|{4{4 \{4=l{4t l{4d{4{4{41V{4G{4{41C+d{41`{4X{4h{4T{4l{4`{41X{4d{41@{4d{41`{4X{4h{4T{4{4{4P{41M{4{4rH{4ct{4p{4J1P{4{4{44h{41`{4X{4d{4T{4_2D$=T{4u=h{4u =`{4th0"tP護L1=l{4u l{4{4 d{4L$$ ȉD${4 x{4{4 H{4L$D$ ы{4 T$ L$u1 T$ ={4t ŋ$u|$u|$ t+uh{4j4{4 {4={4H{4tL$t*t,uw1 kL$t;t=u^ Ri K =t{4u==p{4 t/ (P !N =t{4u=p{4 t {4)θ\ =X{4u/ =h{4u! =d{4u=`{4m t" {4t1AT1U4L{4 ^_[]Ph"hdf2kB ja9USWV΋\$={4 t1PSRl ~jP1ɉ={4tW L݉t$=|{4D$WÉL$ CHHf$X-&ks PUh^"y_ L{4{Dt{T.u =\{4tw={4uL={4u%sh2"c?1TSh" _L|$|sh3"7?{4VWʼnى=|{4ut jSWr WÅ0WO08u ^_[]jh7%j&WVD$ qH1ftYT$zHftIf t$f tf9t={4uyDt,RQ{41f Duf u RQ^_fu1@fu1HUSWVL$d{4D$ d{4u ={4D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$P PSl$$h^" ]t$X 1@F FL{4Z|$dt~T.u-=\{4t"fu={4uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=d{4t-T$$L$(={4t-shׇ%j $W9$D$\l$t$0KjsjoDžt={4tshׇ%j $U9jspŅtщ|$W‹L$@D$9ʉT$@l$ U^ʼnD$<9L$<={4t/hr=#sl D$TP&T$ 9щL$ 1|$PHR  à t$Pr2 Ct$ P\2={4t +Cl$TUP<2Upb ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p={4tD$|t$ |$ n{4ʃQPRW$RPh!jV7VD$|={4t$ |$ tHVUUUȉD$|$D$<$$SWh΢#VUj7UQ$t$hׇ%VUG7U.$={4tDŽ$Mt$4t$ f2J f2;$f2~у t f2Q f2Guh f2Q}5={4tXD>f2J f2;$f2~!у t f2Q f2Gu7h f2Q5L$D$ ρÃ{4T$9{4}`;L$}XD>f2J f2;$f2~!у t f2Q f2Guh f2Q4f2H f2;$f2h f2j [4 f2H f2 1D>f2J f2;$f2~!у t f2Q f2Guh f2Q3f2H f2;$f2h f2j 3 f2H f2 e^_[]SWV΃={4t vrh$c1TVO^_[SWV΃={4t vh$1TV^_[Ã={4tATPqh$- ÃTQh $-Í` f w5$t-&f2H f2;$f2h f2j@I/f2H f2;$f2h f2j*f2H f2;$f2h f2j=kf2H f2;$f2h f2j%Df2H f2w;$f2oh f2j|!f2H f2g;$f2_h f2j/11@á f2H f2@ f2H f2=֡ f2H f2%á f2H f2|밡 f2H f2/1á f2H f2*USWVl$(}={4tE G={4t={4t(DGx{41 {4Í4^69L1} ^_[]{E ;\1~*P5{4kN tM \1{4{44FMt%$Q  Qt $ B$Iu$ L1șƉșD$$t$D$ D$|$1ۋt$={4t( {4 U tt$ ;4$}Z;D$}El$)šf2H f2;$f2h f2j / f2H f2 MuC;\$rf2H f2~ f2H f2 h f2j t/D$@D$;D$ ^_[]jOLUSWVt$~={4tF G={4t={4t(Gx{41 {4Í,C L1-9} ^_[][Gșljș|$$.1E  E;|$|6f2H f2~ f2H f2 h f2j g.1V ={4t(41;$}D$)áf2H f2;$f2h f2j . f2H f2 KuGm=f2H f2~ f2H f2 h f2j -^_[]USWV|$={4t_ C1ۃ={4t={4t(C=x{471F  Ff2H f2;$f2h f2j, - f2H f2, +N,f2Pf2; L1} 0;$f2(h f2j ,;~& f2H f2 " f2H f2 h f2j ,1W ={4t(4_ŋvf2H f2~ f2H f2 h f2j /,^_[]fSWV|${4Wqt pSP> t81PWV Vh $&VN ^_[h"Wh"j USWV$U4(F$$1 |$1 9$)덄$PSUD$P` tXǃt-tat$"c ?tL$T$d$.?T$O$E1 $ ;j2r9vL$?T$$$^_[]SWV ΉRQSw` 1t4u t|uHth f2PjSt Vec lj ^_[fUSWV$$31hd"Wc W%$ D$D$ h<$SV1 mu05<;荳tChPY$WL 뼃pu D$ 뭃u _2,uk5<;h"j #D$=@u.$VtP 9r*th"j|WP~ ty/t AƄ/@L$M$D$S|/uH9tx/@tj/Sޅt@VL$rSh"@1A $'@PVt$ ] ٍ$Ct1@$Mg4$ˡPPh"hdf2"j{4USWV։π={4ujV%t~VWGt98uR\$@SV{ft{SWmf9Wh $1ۀ={4VWh!  VWh #( w={4u=jW$uWh"H#D$H=@V={4/jV$D$@PV/ejW|$uD$1Pt$LD$2x d"t $D$1Pt$\`S1Pt$`TVPSt$D$BPh$"hdf2 #D$H=u}1PPW t$HhVc \$D${4{4V.CVh@"謡1C؍e^_[]ÉVh_"hdf2?  e2H e2~e2H e2he2ÃtH tC e2I e2~e2Pe2he2^ e2 tuÃ߉1ۃYM@Vh $۠'${4Sj5 {4t$|$SPt$  Å11S5{4t$l 9x߉={4t{\$(t$,l$( %$$L$$D$ l$ |$T$ fT$l$\$l$T${4RQPVSt$(t$(hs"hdf2$5{45{4t$  Å6|$W\$St$uVhn"蔟SD$hL$l$JD$pBD$tB D$xBD$|BRW!tVh["?t$\t$\W> 8tVhi"#D$HD$Ht$\$ \$D$t$Ph $֞V+tVhP"軞t$S1V薞5{4t$t$ЋD$HPWtVh}"^$Wt8-t$Vh"+ WrtV|$W++t WhP"H1ۀ={4DVt$SWVP׉jWP萜 t$t-h"h"@:h"h"菝1@^_[%tPh"h": jWP t$th "h "%tPh "1돸"={4u""jWVhk%Ph!S qSh $ݜjs "jVhk%h"h!WpWUSWV8`1t P`11|4|4|4 |4|4h42it$L$-&hjV `1Vh_"0jG`1hhVe `1 |4hjV4 `1?Vh"0jͳ|4u11`1|4d11t~|4ttja`1|4l11@5`1|4l11@DVhy"0jE`1t|4tj`1 '5tQ`1h|4P,xC$|4%= ts=`=@5|4h"j許 5|4h"0j膲5`1`1 |41HPhm8@5`1  1ɅA |4-x|45t|4 |4ˋ 2ut'5x'51v$-&=t'5=x'5>1jSS5`1!ƒu 8f|4-x|45t|4 a1H 22=|4Gt =}r t~=x'5x'5q˃u#=t'5tPWUV ~jWUVj tw߿(=x'5u x'5~~=1|118^_[]111RSWV։ωSWz1D$t,t\$W344$9t$-ctjt$ Z"1@jt$=#1PW4$t$jSVVx^_[h# h.#hA#jtVP=`1x=(5 (5t}=|4ut=(5tD(5HQP~'Q &h41|4|4$Pj 5)5h"5(5 5(5b= |4uKh|45`1u4#$|4=u"x|4 t|4u5|4# |4=2w=(5t1~ jP5`11~jQP (5 (5t4=|4u+5(5hgu" (55(5肮`1=|4u |4tP1|4|4(5t1 (5 (5t'=(5tG(5HQP~Q h4Pj \(5(5tZ5)5h'"uC5(5 '5'5 u '5'5jhQP7RPh,"V1V5(5v5h4^USWV=2 f2tdf2D$WʔO+|4 |4 u1@1ɉ$L$=(52\$5'55'5hP#hS<$t$W5'55'5U$h]"RPWh[#hVk$VSh#hWO}W,PW}tf=4t]t$5045,4hP#hV$Vh4h#hWWPWjN 2u_5h4<$t$WjVs$h*$RPWh[#hS$S]Vh#hPj(5D$=1Oh4D$ P#D$5'55'5VSP%$5'55'5VSP'5 '5 '5'54$t$VPQ$h]"RPVh[#hS $S]$QL$Qt$Wt$$h&#hP $t$VdPVj "$PW5)5h^"t$e^_[]V~=|4u(=|1~h~V5`1 |1~^V|41=|4uE1jVV5`1uxRP5`1 yh9"0jd 1N^Ã=|4uhY"jI&1=|4u5)55x'5h"j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5|1=|4t$t$5`1 ƃu*~3|4;5x'5tc5x'5tU|4L~ |4?5|1x51h"j, 151h"0j^_USWVP5|1|$l$1ۡ`1$WUt$ ƅ~)tދD$9u|4|4!|1|4Hs-8 uc1h "Vh5|1:~\%tS1jPP5`1x})RP5`1z yPbl8tDb8t:X8t0Ty:H8t >8u |11(8Eu |1xt |41|4=|4uh5"j腥`tx>(5Ht)t h"51h"jL 1%h"j51hj"0j^_[]USWV1N=|4=|1 2uh"j٤|4<u|4-|4sg|4|41jWW5`1wxXͽuWURP)jWU5`17yQu t#|4@|4=|1:h$#Ff@Phm5`1 x|1hT#j1^_[]USWV \$$|$ l$(1uu5|1|41jVV5`1]x\D$ljT$Ӄ=|4D$x|4t|49L$ujRP5`1x+D$T$EU,=|4u#lh#0j |11N ^_[]USWV~=|1$(~$$~|4t)h#j蔢I1u)1ɍ|$h~W5`1k 0|$fGWhm5`1 fD$D$Whm5`1 \$h~S5`1 $h~S5`1 GfD$D$Whm5`1c |1t1<$uzfD$D$Whm5`1$ f $ x'511F$$~jQUR\mы$ʉD$ ʋ$$~) hZ#b1F|?1jPP5`1辿xg)y11=1|!h#11Fs1ohw#RjRP5`1q1yKh9#.hW#"h#h# h#0jB 1N5|1~^_[]fD$D$ D$Shm5`1ʾ y^t$h#Nt$h#0j٠SWV Vh)5j yh#0j袠 jVj yh#0jv 1N=|4|4=|4=\)5u5)5h#趟=|4hl1Whd1Wo |4aX#tb# 1=#t#QWPA S8 2#t"P5)5h#h#h #hH#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5|45|4h#sWhy#T5)5h#Ah#4h #'hH#<=\)5th#j{51h#5)5h#ҝh<#ŝ|$h Wf|$.|$t+D$5..L$f tW(= r@h# hL#hh#Y5)5h#Fh<#9sWy\Wh#|4|15)5hk#(5 ^_[h#М|4t P3* Ẃ|4t |41|4|1h#j|52mtt$11Hfhh|4)Ath|441hr#0j臜 1Ht$誯h#0jX 1HVt$VyuVh#0j*^\SWV|$$WFƃu[[1~tHNtt 9 tu/2PWFt#D$=@t 1N|^_[USWV1F(5PH{(5P kjYƉ+d4Hw> (5SPh4Q@ P4$ T4L$QPh4\h4Cjuh4[jh4^uH=4/u+-Bu"4PPh44P}l h f2WVh4M<f2@ubP4X4 T4 \4QP.t (5P(jh)5j$ xsZ1e^_[]Fh#0jՙ USWV (1x&,1kL19|׋yM1II1l41PQÅy19}WDu=2h #j.hhl4OÅy1ۉ9|(1x(,1kLShl41y݅u=2teh #j迗l41E$sVhm4l4Pj )؍l41Eh? #ji1IkFL1(5Shl4#1ɉ^_[]USWV D$(5xGD$k4$1F1l4SQ291C(5hl4h4P$ (5Qu*D$PUhl4Q8 l4tu=2h#j耖t$hm4hl4yi $W1CttUtB:x9u=2tFh#j,Whl4Q19uhW#j1H ^_[]h}#th4Q<t h41h#USWV1C(5PH(5P yjl~Ɖ׃='5t/52th#0j4 e=(5t Rrx7t$t4(5P(jh)5j lzbV1ۉ؍e^_[]Ít$\$D$d4Hw5 (5VPh4Q@ P4D$ T4L$ h4kWeh4duy=(5tSh4@t^(5 (5tSh4?h4Ujh4Xt@h4EmP4X4 T4 \4QP=4/u+?<u"4PPh44Pf (5 (5tSh44? (5tp(5|NPWt$h4)6Q=(5(5D$L;4D$P 4Ph48(5Ф4t@t=)5u Pl=2t1d4Hr@tZ tUh4l'9D$X;4D$\4?uD$Ph4$Ã|$=)5ut$h4Å(5VSh4P@ =)5uSh4/!؃=(5\$C=(56D$(5HQPQ (5=(5D$L;4D$P 4P4X4 T4 \4QPDy h4j=(5\$^=(5Q(5HQPQ D$L;4D$P 4D$X;4D$\4OPj p(5D$uP4D$ T4L$ QPpФ4x525(5詑P4X4 T4 \4QPh4ji\$=D$L;4D$P 4Pj (5USWVj/h41Uh4?2t>54h|4Ug /tOGh|4WUh4h#jjO1N,K|/t1Nuh4h#jj^_[]SWV=(501F (5t9t71h#jێmQHb(5P R=(5t i<(5x t `m#(5 (5t#5)5h#5(5 (5ujh4^t(P4X4 T4 \4QPu1=(5th4hxuth4ly(5P(ljgSW, xa(5 (5t&=(5t5(5hgu"2(51G*ƃuejh)5j ^_[USWV $(5xu d?*1F(5P,(5@0D$ juD$T$=(5jSh49]jh4Q$=(5th4~gh4+th42dd4 w's1PP5Ę4j $jh4Pƀ=4/u+4u"4PPh44P^ =)5t4$h4Z' (5t:(5|Pt$t$h4s.Ph40(5h4h4T$t8=(5=(5(5HQP~dQ c(5L$Qt$4SPD ƉPS?&=(5tc=(5tZ(5HQP~3Q 2Pj ~(5Ph4%dPj W(5D$L$ʃ|QP  T4P4ʃ|QPxnh4*1C@TPh4Z%Z5Ę4h#0jh48ch4)t (5P4 jh)5j =(5tn)11Fe^_[]þ4PV$Vb뙉Ph4$뇃=(5t cxIx(5PHx11@USWV $$h 5)5Sͩ = u$ /,4ŏ4/t EƄ4/FED$P5)53#D$=@`1Gxv%xmlxd=(5t exRh4!(ttjh)5jI Gm'15)5h'#j 1GĐ ^_[]I5)5hE#0j҈5)5hl#뻸 )D$ )D$$h4 X(5 (5tV1=4/4t$PUG ;D$vh4h#jN _D$PS 3E4WT&W^jh4Kt'h4K`h4&'VSh4NR xơ(5 (5tD$Ph4p2I=(5t5(5h4+(5h4=(5tEh4C=(5(5D$D;4D$H 4h4{d4Ht 1PP5Ę4 $jh4#Pt$h4 Wh4D$P;4D$T47wD$ Ph4;(5tk=(5tbD$D;4D$H 4Nh4h4^^D$D;4D$H 4D$P;4D$T4 5Ę4h#0j蕅P4WWWh4!Ph4=(5e=(5X(5HQP~ Q Pj (5 D$D;4D$H 4Ufp'5p4t'5u (5@t'5=~| h~Phj #thPh #j蜃1Hãx'515|4y x1'5'5 p'5t'5ʉ'5 '5p'5p4=2u=t'5t4=~| h~Ph #thPh #j1H5|4 y xp'5x'5'5'51'5'5p'5p4~1x'5USWV=(5th( #j艂1I^_[]Ã=t'5x'51ut'51IxՋ='5+='5|$\$51UVSW)9|11UV$)݃p'5|J'5 1'5~H5x'5P'5'5;'5r֋ p'5 1'5'51)ȉQPx[p'5Ɖ5'5 1ȣ'5)='5'5 x'51'5'521hY #jWV1N=1=2uh #jy1'5'5515p'5Z11~9} G{u'Ph #j~ xI1='5='5515p'5~ p'5 '5'5'5 '51^_ËD$L$'5)ʉ'5QPRe USWVu ]1D$ D$ D$'5 '5)ȉ9؉| '5)։ x'5QPVS0)ЍT$RPQ 1ID$L$ )'5 '5|~ '5'5)ЅqxUtX '5'5D$9ؿ|‰'5)ظ|D$L$ 1H1@D$D$e^_[]V1='5515p'5~# p'5 '5'5 '5'5V1xC=(5t/x&5'55'5515p'5~'51 (51H^V'5;p'5v*5'5)QjP 5'551^USWVt$'5 '5ƒ|]; '5'5}O1h #W}='5='5$-p'51 ( '59)1 -p'51ۡ11PUK;1tS1'5'5Sp'5 1'59)QP륉'5 '5Nj-p'5S5'5U" +'51)US'5'5p'5 )VQS '5(5Htt(51O1^_[]É-'5USWVP\$1~cl$'5$5'5<$)"513x3ǡ'5$5'59|WUVL 5'5)11H^_[]USWVPD$~Z\$ '5 $5'5ŋ<$)Dž~9'5$5'59|WVSښ 5'5)D$^_[]ËD$)USWV\$ l$؃|~'5D$='5t$)#514x\ơ'5D$='519|VQWD$  ='5)Éظ|$1H$$^_[]USWV$  $x$|$D$|=(5t7P$蘄y#謵$ h"0j.{$|r '51N'5)ȅ51  '59غ|PQ$Ҹ ~|)à '5 '5ظ| uXP$փ$3D$8$3L$4 $ h #jUy hx$ h #j5y L芴$ h #0j z'e$ h"0jy111o^_[]USWV$$x$|$$D$x-D$PQ΂t"4$hD #0jny L$|L$1$p0L$1'5 '5)ȅ\$^ '59|4$ST$ RT$RPQ$P~R|$ =)5 '5tP;CJ '5)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=)5t% u!$9$t4$hl #jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=(5$4t1PW贀y#ȱh"0jQw1HD$sD$$P$<v4$t臱VhD #0jw $l$ l$\$ 515p'5W lj\$11ËD$ 9D$D$D$p'5}$4$t$ L$ QL$,QWP$PWP$@ ى9u1515p'5$<V ljޅz11 ͉$03x$3|$ uRD$$P$8I$3D$\$3L$X $0<$\$t*Wh #<$Wh #jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]趯$0h #0j8u1K<$苯<$W$4h #0j uUSWV|$7t6|>/u/1N='5MWhM #js '5.|$tjh W V $='5'5_Sh #VP$hƅE<$8$S x<Sh #P$Y$yw_0=(5t5(5Yt$h #Vjs15'5$ $ Qh #0js1N^_[ÉUSWV|$?/tGj/PmƳUWu/Fj/VmƅuhW=(5t$$W jWy3UWu%D$ PW)jUPWV/Fj/Vm1ۅA4t*PWt1K#D$1=@ۉ؃|^_[]/WVD$t$ $POyu~|Wh #0j r$tDPyN$h #0jq$ 1$'5^_USWVD$Et$$^߅tP记yWh #0jpq=(5t<$8$W 1 (5tt)$($u7='5ujd'5PV'5'5!UW2 2t%1PPL$H$X$T$W$tJSW'y!SWh #0jpWr$q 1$'5^_[]WVX1uA|$ t$t$W` t(5(5p膪Why#0jp1N^_Vt$#D$ PV7t%5(5Up=Vh#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=2t =2D$PV9t轩Vh2#0jKo_=2u&D$DL$HL$$Mbl$L‰T$=2u'D$PL$TL$D$ Mbl$X‰T$WVQt658Nu} u&WVuVhN#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVt%#D$=@uVh #jm 1HjW |^_[USWV׉L$]D$PSt6St$辮th0wwS tՃ} tL1@_1=(5uTG3D$ 3L$ uKG3D$O 3L$ u9t$hQ#jUl 1St$h#Vj6m1He^_[]ø#D$=@u%h %StS0S} D6Sho#0jl댋D$$u1@Ë $jPUWV}wPVI1@xN=(5t1A$$3L$ $3$ u*0$3L$,$3T$ uVhO #j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $-&5)5ht#Fuu=(5tlD$PUKuZD$ !=uHhWU6 ƄD$PWuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PU)Ut$ʪ 4$U L$ t uu$UFD$y)Q8=(5us<$8$U xZL$ A$詤t$Uh~ #0j3j1H=(5t2<$8$U Uh #Wji1ɡ(5tt1Ƀ$ !($t($t$$5)5h'"CjU0xN1=(5=2=2Uh #Uh #j7h 1OD$PUx=1$ ?#D$ PU1@=(5u;L$ ($/7t$h #0jh$ PU1@Pt$6UK21 2t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW1x1K=(5t މ|^_[]ø#D$=@u5h %W諚1EtXWyĉ#$t Wy5(5)h # WU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5p)5l)5 h)5d)5L$T$tI AQPF DUVP 9t_L$ xZjPUQ萄ҋT$0y@oEP Džt<$\$MQVP[ D$8+$T$0)+|$$>h#jJe*蟠t$8h#菠t$8h#0jf1O ^_[]SWV1|$tQ\$1OjWWSЃxjh'5S蜢 y%##\$ SV0je^_[Vt$ xFP蹤=(5t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$( ~H111Ã1T |A9uV$P$( ǀ$1111틴$(3x$3|$ uUP$(mxLX$3D$8T$3L$4 uF1VVV$(KxE$($\h#裞h".h#j%c #z$(h7#0jc1N|(^_[]V=(5t'5=(5t'5=(5t@'5='5uh  '5t01x&=(5tDyh#jhb1N^WV'5tP\e1'5'51N'5t '5tqA'5uj1e2H e2~e2H e2he2tN;41u1tB '59G= |+'5xx'5 PW1t-'58j5'5h'50] '5&1^_SWV|$tR?tMj tSƋ\$W_H~ </u>ۉ^F='5t%'5p!h#j`1Hh#5'55'51^_[á'5t@=(5t'5=(5u0=(5t'D$$u'5tjP5'5p WV=(5tB5'5t;11G~u)uh #jA`6hX#hdf2 vu^_USWV ='5u%'51N'5u'5}$ $ $L$Pc'5t#HHf w=$-&ph##"ph8#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$pٝ I '5qh#0 phV#p j_e=(5t\@PL$QL$ Qpp p09Bx8'5jjt$t$t$t$phr#p j[_ '51N1 $ .&LJ$Ƅ  LJ$LJ$=(5twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G '5 VqPF~  '5VqP%~ 5)5h'"1u'5@e^_[]fUSWVT\$tl$h=(5P($T$L$X$1V8$V<$d"d"t4$tVjQjRD$Ph#S $u2@$%  RPh#UhX#^|$x$h#SEPD$Ph%S$Hs Uh#u# Uh!S[ S2]X^_[]Sj USWV@L$E\$CD$PS~{3joD96#|,#L$QPj@t$Vjrue^_[]SWVT|$dT$t$X$hS($$WVSh#t[d^_[SWVt$F=u1H|$Pdt6t)G\$QjPSMVS|]Gu܃^_[Ã^_[`]USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V(5~1F1u(5h#j9W^ÐSWVL$D$t$|$<;'5t'5tt\^_[铿}\1KZ'5teSP?Rti:tdx:_29}j <;@_2sPVWW hV'5:-u/'5È'5n'5'5`S6hB#_2=S6hY#hdf2Ľ?^_[f1Ã='5u1á(50h#jV '5t"H '5p0h-#hdf2i5)5ht#tu_sUSWVd|$|j/7蟵)5t@l$x)5ht#P )5t#1C(5\)5D$ D$1D$$jh1h #WUHЃJw$.&;t$$@$<.&<;|4묡2t 2(52r2t c2P=29#\$(5! <;kt'5 t'5|4#|4$1(55<;R2t 22\$(5t|42e(5(5L|42=(5.(5 Pt$ * NL$ <; '5$LF|42|42|42|42'5<;'5|4#(5q5<;[Z 2@K 28<;8-u x|4D$ =x(5u (5(522|4#(52'55<;WO (5\)5s$)5d2U(5x(5?|41@D$ )2 L$ ƒ ʺdf2t f2 _2(5ƒu 9u , l$D$kL1(5'5 )5!1$jh81h7#WUW/~HЃJS$/&41ƍHw$/&$)5뫅!<;|42\)5||4#m(5@X(5ˀC(51|4#"(5 <;@Ƀl~mtKotRpd(5SatDeJ1A (5 (5 2 2 2"2(5 2@{pe<;|4SH(53 <; '5'51ɉ5<;"](5(5<;L$h jLjh1Q(5bl 5<;Vhx"ρV(14(5 (5@5<; i@(5|4(5|4$(55<;9i <;E t'5N(54(5 $! <; }(5(55<; =(5@(5 1%=2(5 f2 0akG1A11|$<$t)5D$tGNutNj]]h#S[1t[h#SGuE'5'5j5'5S^ 1AL$y#$]1'5<$D$hr=#S~l$\$thM"SDžu e21 ðt5h#S}~u3'5S I 1urL$tP؅uAJjh#Sv} uP'5D$t t Pd CP/ىQK ؉D$1ES#jt$ S 1AL$"1ED$\$t t P hr=#S}t Wz=|(5<$l$S|$;'5,21ɺ G1Fmفt#u41A 02<1A 02!521ɺ.1!# $ 4u (51=rnFr0s9-_2D)5PM_29}j4NxP_2@_21_29 1VV4b x_2@_29| Qh#j?H 1FPh'#V(H V讦5<;hj#h#jHj舦5<;h#hh#5<;h#jG df2Vh#J$51WV5 51WV% Vh~]$gJ5<;hj#0h#jjG!jmhI#jCGt$hJ#jjP$t,(XN8@tUjP$yFD$8Uh#Wyz1D$h.D$1$hr=#UFzthM"U脮Džu Je2tkðtAh#Sztjh#S/y tj1ujSðuhr=#Uyt Wv=|(5Uh#l$}$l$h#W]y]tjWB\$rt D$W1|$ td^_[]á|4t8uhI!Q|4t8u|4N!Uh#j E USWV|$$UWUVdNJ00ht$跩tAtZ/UVUWUd488ht$vut$h#0jxE1H1^_[]á'5t H '5hdf2h#*GjТWVdf21FWVhh#@WVhh#@WVhhW#m@WVhhQ#Y@VpUSWVPˉjPQe փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Qe($1>tj,V>Åtj=V>tmj tdAE0H@'5='5t t(5st(5uhq#j6B1O^_[]h#h#h#j B4$ ɋD$L$01uWV5)5h#hdf2] t(ο#Ph6#$hdf25 !uءlf2H lf2~df2H df2 hdf2j =^_SWVPωPQX t4Ƌ$| tC$S赾 t'ǍCPVW` DG |(5 |(51^_[USWV$t%t_݊M\tS8uEEh#j@Ej UEƃjSV% t3l$hUVP|WUh#j\@SO $EE<\t:uCCU% $AStRC1fGt,PtStgtstp1B ы$J@u $A=(5tZ(5HVVC4$u Wh#ji? 1H^_[]VVC h# (5 (51V4$ Wh0#USWV\$tK;tFjk tLNjl$1pSnG woD$G95(5t%(5x!hU#j>1Nhj#=(5=(5^_[]WV5(5t;11GFu)uh#j^>6hX#hdf2٥ vu^_USWV(51 l$$=(5Kt(=(5t!9t)@tB9uKKt8<(5CS Dž$h#j=z$uEP%#t?NjCt /C;WlC |/uHC C$#h#j2=Ct/C1N^_[]USWV|$LJ$(5tOwCu kPUC |/uPV3o t2[u1=(5O=(5=(5 2$=(5tW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=(5tGtlD$@1G8D$@1D$\1GEt$ hf#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh#j59tNjE|$tDD$@t:$t$PVh#hdf2eVh#hdf2P $t+Et$h PVyU 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVhL#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7C&(5df2WVVjuD$L$ L$$VjDVjuD$L$ L$$VjVjuD$L$ L$$VjVjwuD$L$ L$$Vjɑh5#? )51)5)5 )5P )5t$,NFF FF |$WVjBe y|$ujWj*e WVje y|$ujWjd WVjd y|$ujWjd WVjd y|$ujWjd TWVjd y|$ujWjzd (D$,WVj ^d  WVjJd 0=2t3i=)‹1@?9 tR=,)5t3<$/>3i=)‹1@9 tR 0)51QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=()5ujh= ()5#t\u#uGW tjxGj jW? 蝩 />3i=)Ë ()5,t 98t#@u $jժ t!8h $1(Wh#j9- h#h#j!-^_[]USWVP|$1N=,)5ujh= ,)5#t\u#uGW tjxGj jWB ' />3i=)Ë ,)5,t 98t#@u $jة t!8h $1(WhG#j<, ho#h#j$,^_[]USWVt$totij/V1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉh#j+1H^_[]1j ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjS CS>tKt^?tYڃCKt6C;C C})VWhQ#j*S茸 h#C=0)5t$4)5X Vh#jW* 4Vh#0)54)51Wh5#j** S ht#}VQh#j*USWVPϊۉ$tsm211JDhu.e[YAuۉ4$uLÅt>VX,FN4A1R5L113WX1J 4$$1&G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACS@NV!1҃ډЃ^_[]fV1=8)5u*jh  8)5uh#j1(1N^USWV 8)51Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj Ël$EP  $$$KCs{ D$C $C1^_[]Ët$ h 3PG  1$$CHC1FwCE3̴ Sô S踴 h#j&1NwUSWV8)5t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j tx@ LHDh"#jY 1^_[]USWVD)5CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj J1ɉHT$, $$$P HN HF F t$1 H;@u D)5-L)5H)5H)5-L)5Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@H)5=L)5l$T$s}ډD$0! umщjt[L)5=H)5 tIjٛ t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph!#j  h!#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=P)5u*jh= P)5uh&"#j1N^WVP)5t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(T t^t$htAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<Wu h\"#jj ^_[]USWV P)51Kt$/>3i=)‹5 fF0 $j j0PT3 (5 (5t,(5T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U2 $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0Ua2 $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U1 $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R1 t$ h$#$%$ $LJ$m9rD$ )yQj0U0 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U0 $ t%h$#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjhr#WMC t1H^_jh$#W3C u(=\)5ut)5ut)5h$#jjUSWVl$hUh1N\$1h$WS. K$ǃ4$Yt"Yh PQv0 Ǎ A/G<rH )Uhh)5hd)5o   Php)5hl)5G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VP8yEtQQP  ƅ(8$VPyElQQP˳ 1D$@$$$$$ȃJ-σwY$d1&<2ǃ$)$QgtxuD%#-u~t6hM"ViDžu'n<0 PVh&#jHe21FUWt5Ë$rt$Vh&#j$_Ft1N1e2t W1^_[]fVjh/a"?xKh""P.)5t)hM"Vl.)51u;5)511VH@=(5th/a"hd'#j 1H1^WVPD$$|$t (5t$(5 (5t"=(5thdf2j (5df25)5hT"W+g 4$VW.k Wj Æ ^_P)5t$L$T$ $RQPk 5)5XSWV|$1N|5)5t,\$OPWSȄ t;j S1t^_[SWVPD$ $|$t (5|$t$(5 (5t"=(5th f2j (5df25)5hT"S*f 4$WS-j ~Vd Ph#hdf2e hdf2j 螅 ^_[fUSWV} u7hd"j \$1h $WVp LtPt߃95_2D$h*#+ ƀ8/h'#VJmush#V8mua$PVtKD$Ph %̨t4$3D$ $3L$ u$3D$$3L$ t1PP觢ƅu j02Vh f2f2@uj[h!jIPh'#hdf2nd jd[USWV$$6ehd"jb 11Ch'#VUPo e~%q~3كrtރvt_x)5ŃV.PtrكRtwftAi)5)5뒃Wt6duq)5z)5l)5)5W)5I)5;u_29|=)5u 1Ĉ^_[] D$hx j+$D$,$S* I9v9/u؃@]9v8/@tj/SL[t@À;.uCt<.u{t0\$u h%(#腀C\$)5EHu]j$8u )5PgYj)5a$8tӋD$t$ VWr )5tRtD$Wb;=)5u58ts58?ti58t_Wh $Htj PWh^" +D$@uD)5u;Wh(#k)5;;=)5uW0ڀ=)5utV/tD$%=@t/==)5u uW_oWTY )5 )5х ˉ4=)5u Ő=)5t@jPt$ u h'#7P)uM48VNjGHHf wO$1&=)5WOwP"{jWV GG \=)5uWOwP:GHftIfgft9G =)5u P PW}G  GwW)5?38=)5uG ?tow  PUh^"| c=)5uO1zuSwXmt))5t 28t128?t'28ut/wh $)5VGDž6=)5u =)5t)5wAw7h7%jCww 蜞 PVh^"jgCRPhE(#hdf2"^ jU)5USWV΀=)5uLVh'#hdf2] hdf2e2H e2e2H e201C=)5l$$#E=jR`D18D$PuA=)5uvVh'#'{1Zhe2'Ɖt9 t4e2H e2~e2H e2he2'ƒ1ۃYÉ؃^_[]ÍD$x d"t $1Pu1Pu]VPWSD$Ph'#hdf2\USWVAӉ΅:#K1jhV3 $ǍD$PW.D$3CL$3 D$(3CL$$3K #D$ =nD$W31PPPW D$$h PQ! KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PW1 D$L$D$)T$T$ 9D$t;$SVg)5Vh $J).)5Vh $(Wo31@e^_[]0W2u1PPPW uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW0 D$L$D$)T$T$ 9D$t10W021PPPWZ h j$Pk KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW/ D$L$D$)T$ T$9D$te/W1j1PPPW Th j$P CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PWK0 ;D$t$$P$!PE L$)L$L$L$ |$D$ hw.W0|1PPPW fCXK\D$L$ȃ|o^jr \$9ËD$| S$PW4. 9D$)؋L$D$ظL$|-W^01USWV\$l$UEtMƊAuA)k')*5j襹UԹGG SG)5<)5 *5t^_[]Ã=*5t^_[]USWV\$tKƊAuA)k')Ƌ,)51Gt?uS"tmt&uS"u4)5jVJ1^_[]ËD$t @ъ@uA)k'))5WVt$ >tVG t|$u G?*5wx| wm| Wd|  *5u=*5t^_WVt$ *51<)5t)5VPs8uG'u *5t^_Ã=*5t^_:USWV|$tWBuA)k'))51t(l$sWT!tu tC uމ^_[]jt$ }t@1ËD$L$ pq!SWV*5ƍ1Pu1 )5tQ:t @ C'u9 *5u=*5t)h jVW ~R1ۋph~(#*pb52HQPP&2Q C9uW}^_[hl(#WV11 )5t))5Q:ujPuFȋ G'uƉ^_USWVj258H 25(11C}t$Ej=PQt)AQUkh(#52)TjUt_Uh~(#)w842HQPP^%2Q 25H 25(S Uh(#52( u1^_[]Vh"tauj425t$1Pc ơ25H 25@u1^fWVP5X*5m2DBuFA&ut t- P*5]$1&NF밉jWV  d*5`*5 A&jP*5h*51D>GA&uGPF`*5WVPP  `*58^|~u$PPh(#P~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5X*5^_ÊVF|uܹո ѹ Ǹ É)B$:@BA&uVPQh(# fUSWV|$,t$(St=P*5jLVt:xIuxNt@jLPj V1tE@j Pl)=P*55T*55X*5"1,=\*5uƉS+^_[]ù')#V=\*5)u ^5T*5Qh)#*WVd"|$ |$wL2 P2 25>t'F 25Q25BN@>vuڋ7 25Q25t @뭅+L2@P!5(75VrƉRPh $$ 1 ^_USWV8׉ˋ `*5d*5D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh!jV/JjVt$ 3' USWV Ջ\$$St$$tƉ׃=\*5%up1҉  ډD$$=\*5&uU1ۉ D$`*5 d*5ME \$$L$SPy t D$$ ^_[]ùC)#SWV֍Qȋ\$L$|$$d2&  u !ڃ SQWVuN99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWV<Ɖ׉^_[߹)#)#)#wSWVP=(75h*5(75Q}*Ɖ=(75=2ttxt>u%1ۉSPV Ɖ9u$8t*8u+$t@A& t$@u^_[ù)#9^%USWVPՋ\$St$gƉ׃=\*5uKh$`*5 d*5MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljա\*5HwSjP ljա\*5uND$`*5 d*5N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!TH`*5 d*5N"ىWP1Eكra$"ى=\*5#É\*5݅~h\*5 `*52É׃'1H`*5 d*5NLىWP1 1`*5 d*5NىWPÉ\*5L`*5 d*5NىWPe$É׍Eكw\*5|$4t;~l-\*5b1A1Ǎt$WSh!jV{DjV5`*50't1I1@1l$QPh!jUEDjU6K! ؉^_[]ù_)#TQ)#Jz)#@USWV֋] $t$ơ`*5 d*5L$ D$T$uPV֋=\*5Ww,E&8E&}uPW ֋=\*5ȃ}tً$VPt$ ֍GwE&;E Qȉe^_[]fUSWVb2$D$ h)#d=etuD$ j250hl*5GVSN?S U @P蠨ál*5)QPS l*5)١25pQ;VO PSS)$jh߫"$ƅ<.u 1~.D0tD$S @PD$jVD$Pu1 Åt$耄 Pt$ h@*#: Đ^_[]Ê<-~|5p*5u5l*5$cD$t$h *#SVh*#h)#V=l*5t^À=x*5u3x*5h*#NPtVl*5^OSVD$ *5P=x\|$j *5u=*5t4tI|$tO=2u =2t=5l*5hX#(1N *5u$=*5thU*#E  ^[SWV|$;l*5tytuW> @PJt*5WP85L2P225?/=l*5?GH 25ЧƊGF?25Ջ p*5tQh l*5*5p*5l*5jG *5u=*5t=l*5"V5p*5h*# V5l*5h*#n /u25Nt*5{Ht/t@1@t*5h"Sz tg;t^h %Sc tL25H 25讦/@;tS 25Q25艦O@?u+' L29r9v25F~/uЋt*5ƅ/jh*#*'1;L2u 25Q25/@=25u 25*5p*5t Pf l*5p*55L2豢l*5V5p*5h*# V5l*5h*# *5u=*5t^_[át*5t HQt/tA1A t*5UVutf>/ua$Ph %KtGPV:t6$3D$$3 $ u$$3L$3D$ 1e^]Sh $%t/h $u258Ltj258j*5l*5uj=l*5522f`5l*5{2HQPP2Q 52S2@u1[h*#[0~ Ph*#Ah*#7SWVW迠WP{u2\$V]8"u6W荠WP{tV<l*5V!^_[Åup0} Ph*#jl*5tjPh*#. h*#ÐUSWVD$ 2fa1Ƀ|$‰tpыLh~#S9 $th"S$ u 1t$.4NJ]taM\uNEU\rw$2&\0u!11ЃwxAunjt$>2HQPP2Q t$.PN    ȉš2HQPPS2Q<$t*2HQPP2Q 522Hu 1^_[]ÁfHh+#jf|*5uRL$ *5jP落V=*5t *5K15*50ppp VPj 9505t =2ujVV^jpPT$=*5u *5D$ $1APV*5*5t1It$aVPL$T$ D$$PD$*5jWVP|$t$D$$4$ WWV׉ΡX2t L29ty u hL2 =*5*5u PhT"h`2 =*5t5*5hT"h`2 t*t$ Wh`2 x4h$h`2xVy Ph $h`2 2HQPP 2Q h`23 ^_SWV|$t$\$ SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$ 4$w^WVt$ |$g WY^_PT$D$ $1IP>XËT$1It$)Vf3&T$ L$9upu'0fuQh[%j h*5*5@^1*5*5*5*5WV|$ |t|$wL2 P2 25>t'F 25Q256N@>vuڋ7 25Q25t   @*515+L2@Pơ*5PV *5^_USWV\$0t$,|$W輚5(75jV j j=82thƉ؃$1t7=2u.D$0t f $uQVi=*5u"W诚j莶=82u11EiWSu *5D$0u^_[]jUSWVL$,|$(206̓Vę$3&Uw1ۀ=2_=*5Mjw1ۀ=21=*5$=*5jwH1ۀ=2=*5=*5uQ=045tfjw1ۀ=2=*5=*5t  u8V#1tu *51l=045tUW_j\$0SWh a=045tWD$,E=045tt$,WK_=045tt$,WE\$,SW=045tRUW=045t;UWyPht,# hL2 k=045twww. *5@jw1=*5*5 jwa=*5t *51V蠗VeL$,=x55t =r2t *5tu u^_[]PjUSWV@|$T5|*5D$$wG=*2tttn$655(75P$P5h,#(Gtj P52K Kȅuh,#52l$jUth5|*55*5j]<$t&4$h,#52E|$*5\$X*5-|*5j wD$ *5u=*5tSw*55|*5j *5u=*5t]<$t&4$h,#52@^_[]j5|*5謳USWV\$;s=*2{$655(75PPoh,#bstj V52 vh,#8u h,#&2HQPP2Q 52l$*5tteu f|tF1ۃjU|Sl$SP~ tuQVg|*5Ju *5u=*5tjsUsV藁*5 *5u=*5ttJ=*2tA{t;$655(75P8Ph,#52^_[]SWV|$*5jw1=2t *55*5^_[Ë\$1*5u/? *5ut΅tSw5*5*5t"u8*5H *5K*5jw=2tru+*5H *5*51 1@65*5+USWV1=2t5*5|$0D$Pm[thUS- =*5tiD$*5,$\$4>G(75=*2 $65PQwP+h<\"w 2HQPP 2Q=u2HQPP2Q 52Vjuw  Sw5*5=2uZ*5t"u**5H *59*5m"u*5H *5 *5 *55*5D$P蕐 ^_[]USWV|$0t$VB@O (75jPw(, _1=*51{t'G(75$pWWuuޡ*5[tZtT1=*5uI=2u@l$41; u{C(75Us t=*5u =2tʋ-*5-*5V蝏 ^_[]USWV\$K1t@ *5PSxƋk1Ou,D$}t]1{PuVy uR *5u=*5t~ jW|$x4$jt$}jux Wu<$t$fmE{t Vv1 VW|*5 *5u=*5tA^_[]Åx WG0j Ph,#USWV$$D$1t$ 55D$$55D$D55D$Ht$05*5$P讍5*5E(75L$XIEtH1F\$XljtwuG(75hSW]) 1ɉȋOυuNjL$\u L$4IEt6t$4NjG(75w蚹tjVW) GDžuԋL$81D$ D$Xt D$ ȅuD$ P؋$D$XtH$r4$ ȅu$1ɉL$@=2t=*5u|$ ~ $@D$@D$ )$=*2$655(75P4Pl$41dz=u)2HQPP2Q9}j=W,Ɖt>uk2HQPPx2QFP4U 1Ո`1t$XtOË$t)2HQPP2Qv É΅u$u t(PV52 مt ȋN΅uء2HQPP2Q 52|$ +t$4~jh4&WU u|$$ƅuf|$$ L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t D$$|$ u$|$<‹$t$t$$t$4V0fD$ 9 fD$D$$ f=045t*fsD$= t= u ft$}u$D$@f%`u D$*5jUqD$,ED$D$tD$L$`2 =z2u f|$t$Ut$4\s t@*5|$D$D$`t$deD$,F L$*5=*5tYD$t;=*5u*5=*5t.t$`jt$hL$D$Hs*|$$ toD$ t$,u*5.u D$@1@Ht$,$p*5=*5H> $At:ʉ9-ЊQ-t u{yh8‰uD$_}t } ]1HL$|AAA 75D$(75\$l1GSQW =*56QNj*51-*5UD$pPj D$ |*5I D$(75_UUW $1ɅȉD$PPVM25\$|f25D$ H25$25125*5 75L$( *5L$L75D$D$hP *5u=*5t$jV7|*5D$ 5|*5|$t&D$1f|$tH 5555$*5h t$8*5H *5=t$L$QPD *5*5t$)D$(75D$D55D$H55D$L*5h25轚25t$|D$ |*5|$Pt j *5u=*5t=*5u 1*5*5D$G$jW辢|*5D$ =|*5h!t$8S5*5t$ Ut$u3Ft,p謨tF 55QjRp ^SWVQt1OS jjP t6]>F1"jjP tv2^^_[USWV|$41GGG =2l$0\$S}*5AjUfjUPxh uA*5=*5t4$1CSt$pSU\$t$h$w *5u=*5tgS}^_[]h,#VP*5u1PPVPjh2-W tF$P{*5t.1QQVPjh2V t*5@=PATH5*5? *5 2 2^á*5SVhd"258uj1^[1ۈ22蹎5*5thB vq6525 55SSQPV*5á*5ËD$ *5*5PËD$@*5 *51*5*5Vt$ |$|vPh,-#F1@ *59~1Ҁ8cB*5 *51^WV15*5V2590t\Wt{250PjPH5*55*5*5@*5jCx5*5JWY{*5^_USWV$55$j/W.t@D$PWZD$ %=`t|=@t}Ā^_[]ÉjWS/ tFƍl$UVZuD$ %=`uV5zjWS ƅuWh9%Wh>-#Wh(#L$*5x *5V|$|D$ p#*5*55*5uu~9} ~ *5*5^11@1USWV4hd"|$$WWT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$hT-#52(14^_[]UWV׉΋ *5uj'Znk< *511D$ T$l$ %D$ $,$<$\$ D$q-#D$?6u0uFjh#WK %W|80uHx.t x0@te^_]USWV|$7j/V萨u#$jVP uaK$$WV47 PuX 1@Ɖ$m=*5ud$$UVuG8t88t.8 uPVWt Vwju$P OfSƒrtt~ *57PSPVh^"jSWVt$|$t$VWu t ^_[Ã|$u0jWC6ku25*5V=j]USWVPD$tnt$ t%1;t <:t9tGt$3,89-P2}v,; L2t,WSQL$ 2L$ |9/u 1xAA/D$PL$Qc*5E9u,;E-*5L$Et <:tEL$<:t1ED$(Q $+ L2AQt^_[]USWV$1C1D$ 1D$D$D$\$hv-#芍Hw5$4&\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ 259A2593t$$1CjWtV@wM$4&|$t&|$ t4t=02x'@ |$u25H 258u55PVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿ*5/tPEȃw?$4&|$u/|$ u&u |$tf<u t$Um묃X+5r522$@th-#1@$$$$^_[]SWVt$*5*5t5Hftfu9502| P5 9p}Ëu̓X+5r *5t^_[Ã=*5t^_[USWV$G$$4&o55EjWS PrM䃼$$twh-# Vh-#>GPh $*5w6PQa_ *5u=*5th-#D$Ph-#/th-#h-#GPh $I t*2HQPP2Q*2HQPP2Q ^_[]ÃPWh-#_SWV|$tWȊ Bu%iC)ʾ!)!*53tFWPtc6|$tT*5W[PnƉf@@ WP *5u=*5t %1X+5^_[*5X+5Q2  *5u =*5USWV$$$j/$turfEE^559tth.#Vt $j$q1Ʌt@@t`tm$umtisD$ P$9OxfE$K-88$ u=02x $u  \u =02y& u $MƋ$1Mtfyu02YL$$j$P 1OD$VnG*5tAPh .# |t$t-'5*5h.#{t>/u19}-9j$$PM ƅvvD$ PVMx3D$(!D$ =u8=*5$Nu$8t8t }D$}o$E$\$|$$t$t'52jS P$h(%VfEo$T$pƋ$$*5|$ÍD$ uj$HfxT$ ufBuω7 *5u=*5t sׅt"G GfEG EG fEGE fEEĜ^_[]*5T$ Éuj$fxE$ufBj *5tbiVC+L2PjVij$t3fxu*SVm$=*5V$h.#SWVP0B&1t8|$8B&L$8u%tWPL$ t us^_[SWVP@C&1t3|$HC&L$8uWPPL$ t us^_[V@C&t%HC&jPf@NHu^V*5 02trft fuxB =X+5r^USWVP\$=551N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh .#wt1<:CG럡02y x5021Ʌx $y $Q502^_[]SWV*5*5>t+fuw|W$, ߉?u׃X+5r *5t^_[Ã=*5t^_[2WV|$D$ *5jP+@ft*fu vfFGF GF GF *5t^_Ã=*5t^_WV t$D$L$ *5fO 2fOPlGWVU *5t ^_Ã=*5t ^_cjt$itfxup=%1USWV t$811G$1D$h+.#Xot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШP25:KB25*#$1\$ D$4$߅u U=<9&t,]@9&<9&8uUPujUƃ<$t0vhX#4$25H 25(t|h.#%j v tuh.#vhX#2584$t2HQPPB2Q l4$t%UhX#KPh.#+h.#,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$ 5&D$j/UjU(~06B Ph˞":uhh$/#Yuh.#Bu h.#7t.UhX#++55 t$|$tJHh/#Wt$25H 25(ouh#돡55D$ FjUD$PK P~dN<$ud"|$t.#Ph.#vShX#ht$ct$1 ^_[]hA.#y.#ctd"RVhd.#Vh/.#1PPt$  5L2@PcUSWV|$D$\$=2t\+5H `+5 L2 d+5 P2 251ɉ h+5 x+5H (75Sp25tH 25~d+5d+5FeH d+5d+5+L2PVb+5|+5u%Vj2bp +5+5s|+5UV+5-+55|+5x=tE|+50va5+5΅u!dd+5252V6_+5|+5t O+5G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t55t D$2 55D$d+5+L2D$?~uЃtRWT$4$ D$1@D$ wy< 25H 25d+5$!PVVT$0/>u!y@u=D$ D$\+5$25H 25d+5=\+5utd+5+ L2;L$~axu[25Hd+5625H 25 d+5 25H 25d+5$ |$D$/ЉD$$ 25H 25d+5iaT$,H d+5$t)Ut$ 袏td+5+L2jPHPX T$,>~=u|$ D$ }RV"T$4h| u(7525H 25~#d+5%`T$,H d+5 `T$,H d+5$Ut$ ɎT$4d+5+L2jPHPuT$8 9`T$,H d+5>25H 25~d+5 `T$,H d+58 t(75i_T$,H d+5(75H_T$,H d+5$&_T$,H d+5D$$ |$tu^_[]USWVt$,\$(=x+5t55t$D$ 2&jP\XNF55D$ h+51oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=+5*5+5u(Q9PY+5NQP5+5 +5 *5u=*5tȻ+59t31Ʌt AuQP!u=+57v  +56^_Vt$t"+50v5+5΅u^V5h+5t1*56P 5h+5 *5uۃ=*5t1x+5h+5^USWVt$(PYd+5+L2PXL2Gtr}t  KvC#:t /tQ t7=2tAL$,u8 25Q25B[O@랃tPY^_[]Ã=25u [25L28t!P: tx P9Yu$h߫"RljPYGËD$,tÊ?&$< t< s4< w*25H 25~d+5jZH d+525H 25~d+5@ZH d+5Gw/u}/uEP USWV,D$DD$L$@9A|$$D$t1A&‰T$D$D%D$ j=L$QD$pD$$L$(<$ L$ u:|$L$D$ PQ 1ڋ\$L$ H65T$)11Gd+5+L2D$D$<$u \$H l%t$l$UPRTT$LQST$L$ t,1t}y;@ڋL$ u\+5d+5+L2=2\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =25t1C L$@11ۃ9|$t$ |$Wt$T$RV WUL$(/<$ }D$1|@uD$25H 25~ d+5ՍQd+5ZWd+5MPd+5EK1ۋl$$]|$ D$EÊ?&$< u.25H 25~d+5 VT$H d+525H 25~d+5 VT$H d+5]EuKl$ u% d+5L2)d+5 25\$\$L$ D$E< w.25H 25~d+5 VT$H d+525H 25~d+5 UT$H d+5]Eu1L$ }D$n $Ip$H5&|$t25H 25~Td+5R1G>L$u0L$ QVw1>t5d+5Ud+5ۋ\$uh2tc*<) t`25H 25~d+5BH d+5552*55d+51d+5^_[ÃЃ w議j PV^ 蒰8ű$<=tuw~;52525b55D$525ØD$D$‰؃AD$$Z|$ T$L$T$|$,?&$< u*25H 25~d+5~AH d+525H 25~$H $ d+5Qd+5 =Ad+5 $Q$ Pd+5$eØt2H d+525H 25~$H $ d+5Qd+5 >d+5 $Q$ Pd+5$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-G25P25=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rࡄ+59tH9u $8/t F %Q!D$;5+5tF/}tEEGXـxs@<$uokt$btdǀx .u.uN jWt$G t8tG@u@/UPWVQ5+5=*5tt$tWE/Q +5߀xruX@8tB@9tD$P5+5x5+5,Ą^_[]ËD$1Ʌt AuQPFWV|$ W @P8WPj8p +5+5^_USWV\$D$|nOʼnmIWP)|$SUÉpsx 7u߅u҉3D$^_[]SWVt$(\$$W>8C `+5L2d+5P225x+5js25H 25~d+59H d+5d+5+L2P6jVP W7^_[USWVt$FPhf"脪2HQPP52|$Q1ۃ|11E4LE9uShV#*2HQPPۥ2Q|=1C4F2HQPP螥2QC9u1^_[]Ðh/#6h/#,+5H +5~+5H +5#=~u+5H +5USWVP82H +5t+u y+5H +5~xhL2[h`2N +5182~PX+5hSp菩 {eۥ8t_82xL¥8#>WjW !Pjj  h0#82p+582@1ҋ+5  +5@@P t 1++5+582{tXAˋ-+5M +5~ @لt+5أ+5=2t$5+5D$052ңD$+5H +50~^_[]ø+5+51+5+5h/#褕USWV=82w *5^t)kU~D(< t< u 82Hc F+5F+5F +5G $9t V  *5t^_[]Ã=*5t^_[]饔V +51~^Ë82r t ~6u1@1z+5 +5SWV\$t$|$*5 82y tj1 82I  82A$A +5H +5H +5H XtK =+55+5 *5t^_[Ã=*5t^_[ʓWV$*5jW警ƍD$PVquT#D$ =uD1PPPV u2jPV! u <$ELF1PPPV uZVy9t:$Ph *5u=*5tĀ^_Wh 0#cVͦhU0#PV躦Wh;0# Ph|1#WV11Fh1#>kt!Zu忀ރlt puԉпɁu25tg8tbPh $Mm=2u =2u@25tA52jPvW:25H 25@ujMMW52 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh%W蟗\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th%y"jD$P耗 ] /5)i5rOC-D2+9tti-;)t RPhK3#jl$ U%\$D$P$t+,D$0hT3#jSS\$҇ŋCt:tBuM ,%PhY3#jQ褖D,ingD,Runn}=tQ4 l$ ,j SP1 D$xxl$ ?S5l$ ō,@)QPhb3#0 hA%jQ ݍ,PWD$P=݃FD$ ݋\$GHO WlH EuݍCWP$u/1M|t؁Ph߫#W N1MM|FGHO WH GHOl$  WސH|1GHO W躐H ~T$KW)D$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =2$tCt>5@2<9t%5@2<PV蚟$=/5~y\$t$1=/5tEt*t t.<$u u/S0=/5u WE;-/5| $^_[]Ȑ0E hjPh0#USWVD$4\$,tl$0|$WUS} ƃus8=x55t*5/5/5D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o/5D$ /5$iD$ 9T$tcu tQ=05t 1=2uL$,uP9tPtu 2P *5u=*5tH^_[]Vt$*59tP džƆ1z *5t^Ã=*5t^~WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h1#5t$ntpu25D$D$D$t 258D$t(1PPS舒 EjS詟==/5u|$1/5-25~6@ /5D$u}t!AH Et{1jPƅt9u ED$u :u G Eu25t Dt111D$uD$/5L$L$t$D$\$l$|$ /5@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$/5C$jU9 L$tc|$tNuJD$1rȋi4hf"jD$(Prl$D$D$L$D$u U D$\$l$t0~Ot)D$/5y\$l$D$tUD$tMjPS ?jVDžtjuS =2u V Ń퀉0^_[]h1# {Sh1#zSh1#zUSWVP1$1C11h1#1it"gu$ڃjt puЉ̉( 25t yjPƅt,1t/5)i5rO@PhH2#H$t#tH~1i0 tPh%}11G^_[]Ã~1i4h"E2HQP~G ;| Z %PކG ;| 2Z;|lh2#iyh*2#_yV1=/5ujt$ St1+^V1=/5t. /5~$A/51F:uI}^V=2tO=05tFD$t+ /5i5rOA1ɋ2u0VQh2#R躉^USWV=/5u65/5~%=/5Ft WN/5l$/5~"5/5HI}*5tfiP5Ƌ-/5=/5iPUVj ~ ;uKuU l$hƋ=/55/5i 1҉AJw)׉=/5 *5u=*5tv*5fdž=21/51B|iP# *5u=*5thv^_[]USWV \$<|$41HL$AAA UQj ƅt#tFjUj VSt$@Wl$\$<$D$ 5 ^_[]0jUj談 Vf Ph2#$vUSWVt$$|$ 05t!WW>~jVjb 61-05|*5\05UU ~UVj0 -/5l$t$t%t =2ttttk0hWj<Wj1t uuamul1V蹈Vh$ˇtOh$h 0#%u`.Vj薧uV5@2tTWjzWjzt*=2t!WjzWjzWjzu/5^_[]R0 hPh0#tUSWVt$ l$|$1ۃ=05t/t*=2t!ttSVu5<2tEL$ji4DDt QP ^_[]WVD$t$ N /5=2u=22t=/5jP=/5~/5>f@..@.^_WVt$ =*5NJujVjS 瀾tW5@2<u%+/5i5rO9D2t jVt=tu  ρπtt=ttu jwu V *5u=*5t r^_0 hPh0#UrSVD$L$ =2t1ۅ SPj- ^[Ët$1҅tހu1=/5u2/5u) /5~/5:tzt Iuh2#~/51@SWVt$$1@=/5|$(1@>$|j"$5&Wh3#bjvu hn"h $tjjvjv 1~ h,#21@^tjs%;th2#h$jvhY?%1Wvh2#1Wvh2#Wvh2#jvu hn"xh"kjvm~ t+u hn"Gh2#:jv <u hn"h2#2#Rjvu hn"h2#7h<\"v h{"jvh2#jvu hn"h$;h2#kFp]h{"P~tF1SwJh".Sw 1> 2#t2#P uh2#h/#vh3#v 3#'1Ӥ"13#3#3#13#N9tQhf"jWWSxuF x%Phf"jVVjv S hr=#51^_[h2#h2#jvUSWV fD$ /5 /5l$ 1D$U$u1!" $,6&]1x&~'t!=\t_"t $Q\$ \|$ B]ڃ 33# t73#,$$׃߻V%!$}D$:3#@3#} uH3#$Y?%)4$<$zT$tvӃuxu;Hx@u8/UD$PVx D$pL$t 1D$tD$p1ɋ05905*5tH1 8t:tGt89=P2Z 9=P2~*55L2WPV\ >?3#<=25l VVl: fiDle cDhangD ged߉Vv2HQPPv2Q D$pL$t 0505E;-/51-/5D$PĔ^_[]lfUSWV<1UjlD$hhh UPjpz !:9u 9ÈP05j U{ T05jX05hd"U h3#0H2,$Uh\05F%t$T|$P|*5\05!0505蘗eD$PVWVWL=P05 Àud{=2n$h3#*5ttQu *5 *5<$B=25=05(ȃu6 050525$*5u菗=*5u72HQPPft2Q h`2tD$P*5=*5tsf$$=P05u>h߫"袀D7&t1Ph3#QPP[V$=2u2 P05t N=P05uEt$(Vh3#/t8t$PTPV$(75=2t =25tj6&kuD$P25u/jM=2tFh"rh`2ws*1ɀ=2ˆQP/i=2u=25t42(755*5p$$#uSWVD$8t^*5jPwƅx jV *5u=*5tdx"1=2t=*2t*21G ^_[11=2t 21jV3V=2tt*2u2^_[USWV|$(V11C=x55tnn1=2u4t0j52 jh`2q2P=82t.te=2u\1Ƀ=/5 /5jP`h1;tW1R=2uIu=2t7=2t.h3#pEVu؅$uV#^_[]Vt$*5jVux1jP *5u=*5tbj^OVh 0# ct1Ã|$|D$pPn'nft$蝳 th3#bt$t$j th3#bWV|$ We@PV tWP茓^_h3#jbSWV|$P29~b9*5؃P tr H2 L2P2H2 *5u=*5t aP2*55L2>L2)P2 *5u=*5tOa^_[h3#aD$t L2) P2L2j h3#jr MdD$ H2 L2H P2H 25H 25H25ËD$*5H 25P *5u =*5`Vt$*5H2;t H2P@ FL2FP2F 25 *5t^Ã=*5t^M`USWVP2<k*5-L25H205t|F9uuH2PV,  H2H2+ P2 25L2=P225tG90uC H2 L2H+HH x@WSUPR 5L2=P2 *5t^_[]Ã=*5t^_[]c_h3#_D$*5L2)P2 *5u =*5(_V5P2P2255L2^V5P2+525P2)255L2^ËD$ L2) P2 P2L2+D$ȣ25USWV(L$@D$D$@t-΍i11PyawDGÉ,$Eu1ۋD$1 [2t$Y2t(812uƆ22u Z2@uă^_[V(D$ T$029tu6#RPh47#Kt#12t(812uƆ22u숁22^WVt$ ~t)~tPڬ uvƬ ^_USWV jA 25t_y 8-uUD$$25125P  25y8-@P1F Pơ25)*525=25~-25Ft7 251Nࡴ251ɋu25 *5=*5I1F525P)ƅ2599S*5 2525lj4$މt$\$)1*C/5259rL$ 9v!\$ۋ4$ P; 25w4$ 9vQ9w25 *5u=*5tHW1 ^_[]hY7#BIhH7#8Ih7#.Ih8#$ISWVT$ 25tstm8u'1z:trrD8uAÀ~:u"9u 25Q25 tf 251ɉ 25D525>1t6?-u1t+O^25-uta5251^_[Ph7#JHPh7#?H|$u1PjPPe*5jw258t PI *5u=*5tzG1ËD$Ѓ w#j jP u2525ËL$~ND$tH  25=25u 252525h25h25Qppho7#SGUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjhd"h7#AZ J|$:uUD$8@?jPh7#Z ^jUh7#Y 1|$D$0)@<Ph7#h`2 W jh7#Gg1?\$D$01@11T$4*l$Phf"j UAWhUh7#uY D$EEjUt$0WY u0^_[]À|$:uD$8@:Ph7#K1L$0L$4UjDfVD$ 821qqA1Ʌ /50P$R82p ]t u 1%8282@j* 82 u^qqh8#DPD$/5/$QXUSWV'ơ82@tu'tƃ 82 x,$@D$t.$x#18uWPKtG@9&uD$tKjD$pD)t6NjpV\FWPV E$ht82@^_[]USWV82@|$u 82A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq82@@|$Fu6|$uD82@ 82Ap8 u舭|$u82@^_[]jjX 82ASWVƻt u j pxʡ82@^_[USWV82kE1͋ 82x t*/5,PN82@ C1Ƀ8Qs s j@82HOH O oKy K9t?U1CSp Sh>&P= 82HO@ G 582!^_[]WV@t$P 82A uyWIC wWh9#48&h9#j"Q Wh9#j"P%RW CuL$Lx48&h:#Vh9#jPQWUSWV82@1u 1=2tMtݡ82@xuUj @jtÉGpj`aC+t82@tj,(pƉ^_[]h8#82t$p0h":#_?USWV82@$ u82@$EŃCߡ82@$d7&$ 82APUj já821Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt82xJjG B u082x,u%@A&t@/@A&uh8#jÀ=2tjjj 82H0+H8O U 82p0j^@ 82QPI H pGu582~ hT %vrCm|$F82xujD$ 82Hu 82H L$ qx0j@82HKH K {@;u.82x }82x|$ T@0GjG 82@t(HS u 82@82x\$\$j 82HK @0Cku82x ux,uhT %pAjP@<21ɉH H 82Q0PCAHrAAtejC9t jW\G @:82@ u82@$EŃ!ߡ82@E<$t!t;tj pXÉ{؃^_[]/ uS\$|$82X0j2x@ 82QPI H X t\$|$D$C 82APsVL 82jj 5jj,jj#jj jjhT %jjjjWV82x$G Hs82jpW$ uq82p(x,u~ 82At8 u @A8 @tHA~րxru\tuՀhT9#82p0+p8j@ 82QPI H pG .Pt82@F 82t1^_jjVt$&9u^jVVL$1A&tA1B1t AA&u^uVt$j@ 82QPI H p^USWV |$$tD$ D$$D$l$E1$82xc 82x0$t $j\ƃF 82QVI N ~ut. 82IA&tAt=t AA&u1c82H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc42 82A4FA~րxruwtuՀh9#BL$T$$@ 1}D$8j(82 $+H8N~L$NL$$N @0FEPqqj/v uG42 82+A8FF82@4 ^_[]jjjjh49#L$1A&tAt=t AA&u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;X05}X;T05~PT05I;-u{tBuG82x0+x8j@ 82QPI H xF^_[F hF9#lUSWV|$42D$蜛=u ?vl$$5L2P225G$|$ t u _ t19uD@ $ tC9u?,$ u4282HH }Mt9t u>u:<$ t=u)$)jWP( |$l$$uS\uN25H 253\F蓚 u%25H 25  F42#á25H 25ƈF tA=v42'=t h|9& u4282HH 25H 25r=L2)FV,82x42+D$^_[]USWV$$1҉T$ T$$D$(54282r0=>&t1$|$ fw|$1/fFn D$j8fNL2 P2 25=@&u ƒ=25‹nD>  $7&==&u f|>z 2542Bס82==&Xf|>LCD>fT$ 聘T!uhЃo\0N,C05,/L>=?&fu 25Bn׍MN|$=@01fD T.fTT.fTT.fTD?&fD1AL$!(ljƒ(M 25FD 25BvNO|$s@81ɃfD T7fTD@&DfDfD> Ȗ = 25\GT$ t$>Hff 25T$ Bf|>D>u6t$賏 nMn 25}f|>  25BFfL D$$D$f|>tD>t 25Bf|>u D>v 25BW 25B*Ã{t A& 25}E+=L2 25E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $b nMnD.==&u 25 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD>&fD 25T$ B1AL$ I) NjFfL 25B) 4282@8xt /5 /5$ 9W Nf|F\=`4" $"}f|  25T$ BFu6$訌 Ft$HFuhD$$D$ Poſ1۹$ 8&D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD>&fDu6t $蕋 FHF 25BM= t]\t 'u ̑ t =u 42821Ƀxɉ /5$6 25T$ 'uF|=& 25F$袔?&$< u 25T$ BT$ 25 cb,t$@  4282xD/5?A&L$ m2DAD$D$ݓ|$}~?&f|t 25 25B\?& u 25BNf|t 25B1@D$ 25 25B݉ý {"XŃ', D$0$: nt$T$ Mn 25B1@D$t$C/5$4#U d` Ń< ?\u:\ 0 \$1ێHЃ w&Hw ÃHÃéOu M 25vNO|$@81BfD T7fTT7fTT7fTD?&fD]L$ uk%=I =25 D$ wF 25P?ˀ 25@ww 25 x?ɀtw 25@ 25W?ˀul 25GXT$ W 25x ?ʀtw 25E 25O?ʀ 25Gw7 25x?ʀtw 25E 25O ?ʀtw 25G 25A?ʀtw 25A 25H?ˀ*35 35D$D$$35ڎ1zA&t.25H 25LjGq A&u\KЃ w425H 25LjG; ÃЃ D$ u t 25׃Z 25H 25]=Gt/ up}tk25J 25/#@ǽh#tE%t@Ń:bD$D$$9&¸U1#,W9ur1|$Nf|uf|t Ms@ L29T$ vNK؃|$ @11fT T3fTT3|3|t3ft1BfTft|=&fq fq ƋT$ +5H +5~+5H +5 rËFD\$D$$9&JQ19&)G 25x?ʀtw 25E 25O?ʀtw 25G 25A ?ʀtw 25A 25H?ʀtw 25@ 25A?ˀa2 25AD$ ??25H 25~2G:25H 25~$_1c:B ˆB1==&nD=@&G==&tf|cf|.325H 25莿5L2Gf|uNT$ ؃t 4$t$nŀ>ts4$flT$ )B82L$H,L$H $վ82pM tΉ$ Nu82xĨ^_[]1HE;X05} ;T05~T05>uxkjy1$&tu>tyu6EBE9E0E"EEEA 葈}82h$ Ή$~ Nu=tuS$q:#$9#42 82A0$9#u$9#b$:#V$:#J$:#>$:#2V 82xt@@ ^Ãx t#/5$)82@ @8 42H0+5H +5~+5H +50Cƃ~0:=F $8&փ t=u럃F~t\u^觃 42@42 82A0yt/5 K/5$(*;|u0d|82@=t*b4$D$D$=&Kuۡ82@1v u4282HH @1@Q&82@-82@82@&tQ;ub82@ 苅82@p82@82@ ?82@uҁ\u?ȁ u64282@81Ƀxɉ /5P&ڄjjhg!ل rVȋ 82y8~0 25Q25@ 82Q8rq8^USWV\ӉΡ82@D$ 1,$|*5D$+L2D$$UP*5$~S"ʼn$S5L2P  l$|$tD$$|*5 *5u=*5tOw42D$-L2P22582x t*/5P%82@ 8ǃ[~!\u9'ǃ[C tJ$Q u"4282HH s`un=ub\tX`tS42 82QQ NDt""u$25H 25~E\E \@ŋ 25A25@25H 25ٷEL2@|$t~Pt$jP% D$pŋȅut$ j轴E82xtH@1D$42D$jNǡ42D$Kt5 82At$ D$AEx82@t$ Ex P29ًl$踵 P29~=L225t1SUW  )25*5Uw $ *5t\$=*5\$t 82T$ Q|*5Nf|u%Du 25Q256@Vt$+t$ 25Q25@~.F25B25ȅAJ։ȃՃ\^_[]á82L$H0h:#W<$t 4$v /82@D$|*5jP5jj#jjVtQAv N^V 82d"ytA5/5t7t u(65`65542P5/57:#^USWVt$,|$0l$U5P21BW;L2u(VG359w& 35WVS Uڲ^_[]Áw: t9v$P5 35o tã 35$35랾O:#뤾]:#USWVT$L$ -|*5jƊ*2*5D$1|$082D$|$ljWDtJD$82*2V!-|*5D$*5*5d"jUC\$t$l$=|*51F5*5D$082$V\$Sπ zVh>&P 82A |$t|$t=2u ;#@݅u:T$1rIJ$JB *2VVRL -L2=82D$*2t$D$|*5D$*5؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV 351t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu 35tu(Mxju PQ.Ex P$Ur uF^_[]USWVl$ t$\$|$t|h@VSlF VSFDžt9u 9t Sy$9u95D2}5D2^_[]Åy0 PVSh;#W7$WVSh;#USWVt$ |$\$l$jMEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!jl@ 35$35M|$];X05};T05~T05Eu9] u 35tX9X535t-pt 9^t6SLF9t S # 351tF9Yt? 35tHt 9Y jjS}" PkD$($@t 9XjS7"1x*535  b35 T059|AQjS! ǃt;=D2~=D2x jjW! jݫ$JBXxp *5|$u=*5tu35t$(WUN mC 1O ntuK535jS@! DžD8t 8ujjS! Dž0 PSh;# \$t 2t2|$t 2t2^_[]j ߈ PSh;# G0 351tT$9Qt uÉVt$535j Vq  u 35|Qj VS  u8FPj V?  u$j j V-  ujj V  t;D2~D2^h;# WV|$ t;G;35|.GPSƋG9tVPWw w^_WV H2 A H21F |71FPWW y w;D2~D2Pgfff  35^_USWV$$$~*5 8k$9&n  35t9i V 35tQt 9j b Y<(O8=2tNnjUƍD$PV#D$ =nhh]n$SUoƅtjV!SjV $/nhh nhh U- ƅV;5D2~5D2|'u" 29uu-jjWk 9t1jPWV *5uQ=*5tH A1jPWUy v 0, PWVPWZ *5t Ā^_[]Ã=*5tĀ^_[]L hh j ڄ PWUh0;# A0辄 PWhT;#{ F 1F5*5V0 PUh&#Q 8V8*5j0 PUh};# USWVP>xa|$\$;D2~D2oU^ = VUSH 1jSS t!t$$^_[]h,#4$1EUj, Uj! UU Uj Sj  Vwt$  S VD$535*5PV]35V]i  *5t^Ã=*5t^1=35SWV535t4|$t^tCx P.jV6u^_[SWV|$ D29|ȋt$|9}9| D29tVjjVW 9u^_[WSn PVh;#+WV35 |;X05| p35t$ Pj V y28t 8u>35 jjV ;D2~=D29t V^_Vj 迣tL$ T$5 350 35PH^á 35tT$ 359Pt uPg USWV$|$<\$81D$ $D$1F54;5_2h <#WSL !1tbhv#Whr=#Wtuo1<035tE*54035_ 035t jV *5u=*5tF@u045>h}#Wthy!Wt D$1p@|MD$K}hk%Wt8D$D$he=#L j521CKD$D$u}h=#n v11 t=t8<035u.u hj=# VaPh$^  GF@uh" F@uu=045t1uu莩ND$E11P@É|$t<035tW4035hX#Ah=#<035t4035 hr=#SfPh/"c Eluh>#52 Cu|$tE1F-*5D$t P1<035D$t4035\ D$035t jS< *5u=*5tEt h"11<035t:0358u.u ht=#VLPh$I   GF@uh"F@ut h"i1<035t?0358t3h=#D4035gVPh/" F@u1^_[]ËE8-uxu1D$1FUSWV|$4t$0t1 <445=045 $t/1C=05tYuU~2t;tuA1=2/035t1ۀ8Ã@u1=2Cu1C4551t&<9t]t]u]1YD$PjVI l$u=2d1E UVt^u455u jV'1D$D$ D$D$N?r U 1@ DD$jPj   $ u445V@^_[]À=2u=25u =2=21EV*5035>t8t6GY 045r1045*5 *5t^Ã=*5t^QSWVt$u 0451ۃÿ035t60358t+*5SPf *5u=*5t435=045ru^_[*^_[V1=045u#0351A:t2>u 045r^WV|$ 0=045u =*51=*5u0u+t =835u"=*5tW=t55uN*5]tE<035t;0358t/445x55=2t)u$=*5ujWW-0^_ðPWV|$t$ 455uWV 455<rjVuƆ455^_á35=045t1Åt8uUSWVt551Gx55<445u@@uu445=045u΋4035tã|55S-*5VϒjPVV t<$tS-*5m t55^_[]ù@rA<045tøWVt$ 9555t)1WjWjWj555^_ËD$5555USWVhD$=55u55)=t55t|55t D$D$*555*5=x55tt$,jV!u 5|*5et$,jVu45|*5=045u%=035t?t1035PW*5jV躰u5|*5;jc|$wfs 555p1ۍD$X XXPj%SW;\$\$ \$\$O?r 1@ DD$jPj V{f52t$WVt$|$ ?t*FHN V>Qu952u V^_52t$WVt$ Nfu55FNtF t0fu^~*5 ?NQP躏F N)N*5v}F FF *5u=*5t V N^_Vt$F t-)t'VfxQPR yNFN F^52t$USWVP|$t$j'Vt~th.>#V<k>t!h|:&V1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=2uUWMGHO W]H"WVGHO W3H"^_[]WVh|:&Q0j'V胾t)19<>^_hL2oh`2bUSWVD$~@|$l$1SWUr t 8tF r)~1H^_[]ËD$)D$*5X2tP[P 1X2P2 *5u =*5zPD$L$ T$$RQP XVPt$t$V躃 tt$ P4$O ^h3>#PD$L$ $QP52 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+(75+55Pqq h?#jh75i%75SWVP55:&C PVw u,$$w舦CGσCGCuhd65Vh>#8 u*$ X65X65\65`65^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUv2l t61^_[]ËD$t8SV .Ƌ\65`u`65$M \65>#t>#$53#ta%D`65㟉\65t$D$$6# ^[WV<5|*51$|$PWݨt $D$PL$LT$H=|*5PQR 5|*5$<^_USWVL$T$tHtA|$9t91A&Írjt/9t+1A&tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t UV?Ƌ $A$~ C@ $Q$f=t @UPWVp ^_[]SVh>#WV<5|*5*5$|$jWqu"D$LL$H=|*5*5PQ5|*5$*5<^_USWVD$ èu|$=Z2uÍD$PQW Ƌ@*5Nt$݁ uF @SPуF`u v!K F~tuF1Ɏ! s%t É^~55t55u55t j'~ *5uk=*5tb[r2j[XxL$H @ $  $#`uWNJ `u W>J fy^_[]vv h># D$@!|$$~L$( t 9-uD$@-=25u0@=25tc@=*5tf@=2ti@=2tl@=P05tp@=2ts@jPh?#,WVt$|$ *5twyVP? *5t^_Ã=*5t^_WVt$ t|$Wv 6u^_USWVP\$*5jڄƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFR菄SP}j=SڵSgUPu< ؉G@542542hT2Pq ~ F1gjt$D65uQG L$<=u555H552UjS $81F FF55D65~75575 *5u=*5t^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ *5t8Q12<08uF=u =ut j=RTF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVl651tr:1҃Љu75r׍Pfƻl65Nj+t7Mȃu%EttUЃuEmŃ75r^_[]SWVl65>tLGu% uwE Gu#WE @tw腁Gg;u75r^_[2SWV|$tfh ?#WW_9uWh $V't*tUj'Wt8)WPh;?# h8?# Gh|=#WhK$^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhι#tUhι#>=uD2HQP~ j( P 2j)n~=uGuth"EU2HQPP2Q ^_[]USWVP75u 75 ho75T$ t$\$l651<$?tIOt !T$ ttуt݋ 759|QP5T$(75% 75 :DNtuV _ BPRуG u w> FGF GFGVn> N^_[ËD$ *ÃuD$jpp 1h?#USWVP1$1E1h?#蛓e~ft&vtxu teuԃe$뺋-25Et=$ ˃1$u P ƄuWu ƋEu1^_[]SWVt$|$h\%6u"h?#tDO1@$d;&N19eNVTNVv IF~uENV F(t!u0P 1x8)uxu x^_[h @#Uh?#KWV|։π9!utN,75tfxt?(u >)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP I1>?f u%PVY1u%#L$1PV*Y1t1Ʌȃ|^_1@Ow$|;&1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$ t$19{USWVӉϋu075fx@$;&$PWW1ۅD$PVWr$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PWV1ۅD$PVV$L$$t$<|$@11$;D$D9t$ aZ$PWiV1ۅBD$PVQV,$3D$ $3L$ $$3L$3D$1 dVWe1ۅTVWU1ۅfVWEVW11ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]6Q9-u1tQyt8ytBÄth;@#Q9=&t1h, jjh=&Qh, jjh<&h, jj h<&RËD$L$  )VL$D$ 2)u AJ)^USWVP_j PV* ljB8t"8ځ8"u 11E9s:$9t( m2@DQ@uuN9t ڃ^_[]VhO@#1Vh>@#&USWV׉it 9Fup  ^^19uM1PPO~ōPqPU(~ LH;NuS5 #~^_[]ÐUSWVt$(hd"jL D$,^H $x?-Ok-u)sstdluu~xwGWwÅu"m2DHt'1Ʌ S覘كhz@#hm2DH\ƃ~ƀtV)tV{Vh`@#j ރ $h%S1Ʌt:Suu+$891V52}VB|-$K$8ʉT$hk%W1Ʌ9ufمu$1D$\$ $,}%urU YDžl$UW$u.@#|)" $4Ph%C 1@D$l$t jWj D$PUx ljӋD$9t-ف8ur1u a8tQu"xd"UPh@# 1@D$\$ $4h@#1@D$F \$ t$PhX#j*5PPPPh@#522jWVPΉj WQ 9u=у|=}^_Vh@#jQh@#j52TjWV@p+5+5+55<>t)j=W3thW>u0Phf"j@VjVhA# Vh2hx" #VWh7# L53#ta%VQh6# j,hA#h6#q VWh#3#bL^_=*5t 1+5+5>82251252525935tj8=35u2L22`22tP0 2Vj215*5><25/595T2t\2@8@uj*5jt55uƀt55@u *5u=*5t0^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$D&$C&Vw vVw d_ t"Vst Vw?w<N@F1Vw q#w N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$uD&E$0D&Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t, Ã|$, USWVPu }4758752f`|j%vܙm O1@ 0<75D$,@75|$@t$(q%v>%L$ h B#V]<*u C h"S\1N .u{*u{ 1HD$Ch"S\1HD$  t$CD$'C`L$&~QF0 $D&. D$׋L$ jj D$tfL$tjWt$QPhX75TFu$D&<75l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$PhX75(<75L$ Q0豮|$<75H <75T$ l$=875uM|$L$ jL D$tbL$l$tf|$ L$D$$X75bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$X75L$\$L$$X8G<750<75E ƋL$ cjl |$D$VPt$w<75<75<75<751  <75 <75Wt$*|$$X75 \$$75T75t P( VP T75҉D$xF\$wZ$TE&a=&t1"u@"*\\t#'u0'btnv fre\qFuZm2AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~V75D75T$t Pw' T$D75H75t PW' T$15H755L75Љ\$H\tF5L75X])P0tXM\$u/^t-u#F5L75벸^tic\$>T$ j5L75F5L75{ m21:DYt 7GuF5L75\$DF5L75ȋ\$+1L$ jlD$t1L$t5WQg75L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hX75 PRQt$QP  575FP H75 VjxP聶 7sH75T$t t$L$ t PVRQhD75^YMT$L$ t1PRQhD75?Y.VWhX751PQ*t$P PQhD75Y tD75P75T$z \trB<]*<0tu$E& ?$pE&."'#Eu uShB#I475 4$m2D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu hQB#475\),ҋ4$u|$ uWhlB#x475 ^_[]WVP<750tp<751ɉQPV Nj m2B#DQt$cDC#r& <75+ @75VQP 4751^_SVˡP75H P75 u:2Prp~r0 P{2Q 밅uP75)2HQPPD2Q^[SWVP<750t"<75<'t<"u1B^_[11fe1ɉQPV7 lj+t:<-t6 m2DAu)<75+@75VPhC#ƿ 475 $ڃ^_[SWVӉQ輿ǃArVhB#}475GPVhX75cc D$U75V75ƇW75^_[USWVP׉1PPP"t ,>UF@PUQt x$tG9tC<75+@75VPhB#<75+@75VPhB#舾 475$^_[]WV9t"΀:t9<75+@759t\VPhB#Z<75+@75PhnC#kD8"uD=<75+=@75j"!7 PVWhC#6RPhC#% 475^_USWV\$$8l$}h6H j jhF&Uƅu!h6H j jhF&UeƅH h]#uFj PV[ 8u$8u؃^_[Vh $j~WVhH#j@USWV f]575 ]5ƒ ]575+ ]5€ш ]575 ]57575hG"Gt h;J#/t8ƿLP&_N#PVutG uVhNN#jg $$1ɉhzI#SUB P6$K&75kj j5<; ƃu蝮8"57575v <;f75Wj j5<; ƃ _%75j j5<;O ƃu8"G5757575751A5<;_5<;h"V˥tchI#V蹥K7575B7575/75#8"tD575  9u75rCjhI#5<;hI##VhI#5<;hI# 5<;hI#j.u hJ# 75t 1ҁ‰75]5փ9575u<975u2]5975u#]59 2t 27575=75u\1ɅQhHJ# _2=75t)ͅt=75ut 1jhh75P4 $yh75h $j=75u1D$(Pt$'zu#D$0=u 75751N1$tL& $$h]"{7!t$h2T#Qh$hVVpth""Pk$Ph $W75=5 $==5=75p;5B=hM"tt1@$$Phmdt$ hhZJ#h|tW衻WhT# $=<5u <5 =<5u <5 4$h;5 T75 $$1 uWhPh;5 1<5<5<5<5tjVh<5i h;5\ $RhST;5h75VW0 575VWF5 W'l$t$D$ 1ɉHHD$UD$ Pj 8Džy#F8#Bjf7x߉DžVWx9ujUjŪ 1|$nhM"$P~<hjh;5p ^ WNt $h?T#h f2me2H e2~e2H e28he2ljt9 t4e2H e2~e2H e2he2Νƒ߃NyjUj豩 hm"TT1;5 f2h75VW4. 575VWj3 h;5dtd($Ph $S$P1@PjUj P1Phk"&wXT#tǍ$PWh%V,D$uh!Z$P ~$jPhZ"QQ覵ƃu W VWVθL#XM&PVt uVhL#jG 7575G75G75O1]5t^_^_WV΃=]5 ]5t>75t49t0I#I#9t"9t"QPhUO# 575]5]5^_SWVX#P@R&d"OJtQPhS#h f2d"OLtQPhS#h f2d"ONtQPhS#h f2d"OPtQPhS#h f2d"OTtQPhS#h f2<$f$1۽a f2PjjheS#8bwVhT# f2P<wVhT# f2P%GtmÈJ9|6{u;[tVPWhK#D$(ffL$(D$ 1ۉa)D$u!)tPt$hK#]L$4 <)ǘ΋I<9vt$hK#4$N<.”T$9vt$h"L#$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$hSL# D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( <5<5t$(L$QhVk  D$ 1hdT#VCtG<$h5"V 4(1>tYj:W\D$AL$\$h5"SZ ,1tD$h`%Wڔtkh#WȔhT#W貔\D$PhT#Ww D$q;75ef<5ujh%l$!U胁 l$Q&1tUPx QFQ&r܉1hD$ Pj <$WhhT#D$ D$t$ <$}trÉD$h &"U t:h+&"U t/h0&"U t$UWhT#; F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhT#D$ D$T<5FʼnD$uf5;5l$u D$l$l$hR$W谒hC%W蚒h U#W脒h+U#Wnh9U#WX hJU#WBh"W,ThZU#WhhU#WhuU#WUhY1"WԑkhyU#W辑hU#W訑hU#W蒑hU#W|<w ~W|$WhU#  T1<$P<5jD$<$rt$Wh~T# D$f;5@<$WhT#75f<5jUh<5jUh<5$Y <$t$ht$0V J21jD$ Pj< D$ <5뜉1jD$ Pj D$$<5q1jD$ Pj uuD$0<5J1jD$ Pj uND$(<5#1jD$ Pj u'D$4<51jD$ Pj^ tt$W|$WhU#`D$,<51hD$ Pj uD$f@<51hD$ Pj uD$fB<5a1hD$ Pj ^D$fD<511hD$ Pj .D$fF<51jD$ Pjc D$H<51jD$ Pj8 D$L<5; 75sr"jW|$WhU#W|$WhU#΍L$$ t$<5|$]5L$$ L$<5t$]5rh5"VPl$}}L&1ۋ>t.W@Lt t uPUW ÁHM&r D$m2MDHu D$"91hD$ Pj t4$hhT#D$ \$"r)Ut$h#V# hRV#D$1ۋD$<5ND$<5Wh4(t$|t%h5"V, L$1Ҁ<tʉT$D$< w'<$$L&L$ L$<5<$tL$$L$ L$<5|$]5cL$$t D$|$]5L$<516FL$<$C fF|$]5L$! L$<5|$]5t8L$$ D$|$]5tL$<511A<$D$ h;51D$ ȁ(^_[]4$h V# D$ WVPθWEV;5|<5f<5h;5 f<5=75u=75u#$}h;5hgdV 1h;5hfdV yo8t e8uv$=75u(PhmdVn xX52hQ 1=75u$h;5hgdV2 y O#1G^_ùqO#hZJ# 뙃=2tt$ t$ t$ u 豑1HVD$ t$=;5thPh;5u ^D$L$01軉V_t,uVh-P#-t"uVhO#Vh $>VhO#VhUP#$^h]5hmd52& USWV8 $RPh h=5Q诙]5 75v|Pt$hP# lj D$T$1D$ XƉ 11 ‹l$$?5 ]5=59=5hWD$Pt $;D$d"==5t =}t=}uЉD$$Q#=75tȋ 75=WEVuT$tf975rD$Pftt=75%4$t$Uh]Q# D$t=VEW=75$t=VEW4$t$UVh#Q#6=75|4$t$UVhQ#==5$D$PSt$Ut$VhQ# =75u $h75S f2V 575SVI SGSt$VhVWmr =5D$ L$D$11t4$hP#;8^_[]USWV T$ $11F1Ń=75|Uh5R# QPWD$Pt$诖9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=75tUPhR#< Ɖ ^_[]Ã=75tUhKR#t:=75tUhlR#ċL$T$tPh;511@PhQ#]t"j QP u虌8"t1H751YhQ#j PhR#_]t"j QP uP8"t1H751YhR#jSWV։ϋ\$+75tItEu751tGtB=5$?5]59w1=5 1tth;5QA1@^_[VhR#jL$1=75T$ PG1ɅɉWV]5~( WRPh=5Q ]59u ^_hR#uQVhS#j謜PQVh1S#jmUSWVPӉ΋l$|$uj WV- Euۊ"9"t:M";L$ w,O>t" t9tm2DJ@t1^_[]WV1t>΀9t7h5"Vn<t#ƍFh5"P1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)WhV#Wh V# 1۹]5؃^_[]ËL$9/up0<5D$\$A/jPU u$D$ $<5D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.WhhT#9]5!Wh V##]51 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uhX#D$$Th(X#Sut]I"R&W|PWS '> uۀ$U-$T14S&D$XP tpC"uD$TPh]#s$T$끹{]#S&j" $eFMu SQЃ {Sh3X# h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$hY#t0/$PQhY#R~$  ^_575t$h f2 Á"=]5u8"PhD]#Q? ~5$w$DR&]5]5 h^#VhT]#P~I$ $u ~ˍ|$@WV9t"b&J~PH k$TR&1OJH w@$|R& %B(D$ D$$l$ CtGtngtbcB8D$D$l$c%ɋB(D$(D$,l$(B%ɋB(D$8D$<l$8%ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=]5uHr8jVSWkD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph^#h^#آ~USWV|$t$t$h%"V襤 Gw4LT&h>!Ph%"V GPSh&"VgGPSh&"VTVjjh׊%"9GXtVjj h&" 9GXtVjjh*&"8GXtVjjh/&"8Vj w(h8&"Vۣ w,hJ&"Vʣ w0h]&"V蹣 w8hr&"V訣 w4h&"V藣 wu 1<1A71Au01<  $jj@PD$P4'D$ Ph $ҙC9u<$u4f2H f2~ f2H f2 h f2j 连1^_[]hB_#jƀfUSWV $ $ D$-@1]5]5]5]5]5]5$]5]5]5t$ hS_#US+ c~!P$@U& ]5˃PtdT]=<;?1AJ5<;]5뒹 .<;]5hd"n ]5b ]5D$]5T$:@=]5l<;D$ Tnt uBxou D$ 1Ɉ ]5h=L%V跱t]5hd"`ء<;$j:W-C-]5tWuetm]5S c$ \W]5t]5t ]5_29$ 1ɉL$tVh$P/ tj/Ulu Uh(2"h7$h$ U舕V?mDžuVlDž7h$P迟 Ƌoh)#Wdt(hb!Wdthd_#W}dpV 1QQ$ 4PU7L$9C9$ $ 9tUklj?,$u1QhD$PQV h]5hzd@PN tq$ PhedAWN Wp|$ W _D8$9",0V&uWo^5,$h h 5]5P Ġ ^_[]h_#j&|$Ph $jB|Vhg_#j|h!h!ʍD$ Ph `# D$ Ph`#j |D$ Ph:`#롍D$ Ph``#땍L$ Q4U&h`#USWV։ϋl$j茤 V U CCCOK G^_[]QhV&Ph`#hdf2jUSWVP׉΋tAS]W]4$4(VS菤 Wh_#Vt$ Pw W\ É^_[]USWV|$1_h)#Sat$hb!Sathd_#Sau\]5toU3kat[u=]5t .=]5t%]5toU34at [u^_[]USWV$D$|$]5d"tW3`t CÅush#t$ `uD$$D$ ]5t L$ mt L$ ^$D$ D$hw $$ t$h $hV$0|$D$4$L$h=L%Q˫1G@΍K9|,SP莢 Ŋt><-u(GD$tj=V't>FD$ GD_#th=L%D$PDu|$1F1B,$֋$$$,$D]5tPd"t{!P$h_#( xF1Ë$4h$ C9uj t2ƅ|$t t$1 4$& tA710h_#|$t t$ 4$ ^_[]ÍD$jPVt x!L$ȃtuuh"r묁tlP PUh^" 끉 ]5utD$P$"uW$P$]u"t "Pv vvh{b#hdf2 6[$SWV։ϋY Wss ss҃ \c5t~j DWss ssԅuA \c5^_[ÐWV1t$|$ ɉ @4uUȉXȉX\ȉ\ȉ PQ4040<8i<8D@ID@LH)LHTP TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40o40<8O<8D@/D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7Vw wV FwwVFwwzVF^_USWV\$l$EffEffCEffCEffCu u(S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu]SCuuISCu$u 5S$C EDȉCDu,u(S,C(E@ȉC@u4u0S4C0EHȉCHudh'd#VŋFNd5tbSQP d5x Pe5~,=(e5tffOfGG@ Չn,~$N()ǃ~$N(=Pe59<$D$hP-Pe5>N,ș)N,)n$F(teh'd#V$FNd5tbSQP d5HT$<L=(e5tAf=(e5t4f.<$ ^_[]c5Pe5F,)F$N($fOt@ c5븋D$L$t$ QPQPUSWV$$$ $$$(hι#SV\1j ;rD$SVWUhPD؃r_Le595He5rPSV Pt7=(e5tf%]"=@tn"WQh$d Whb#T^_[]USWVP|$\$s s@=(e5tf9uR e5t=c5t=e5tj:D$1PPPs sQs s6Odc53C `c53K u 2&=(e5tf%]"=@tn"Qhb#胣s s/)SUhb#q c5u =e5t:yj phc#c5thd#=c5uh%c#u=e5(e5t7t;f5c5D$ e5jhb#S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=(e5tf=(e5tGf]"@tn"Ph,c#/SVz.=c5t)1=e5L L hd#h6c#$p$l tRQf@ dc5`c5 1VW 2L$@D$DD$ t$|$ e5pt95(e5tʋ e55(e5T$Htt tɉL$LL$QPh@c#=c5uhXc#5152PPPjdc5`c5  52RPjjt:d5=c5hd#fD$L$ dc5`c55dc5=`c5 tYjj=e5H(e5tt,fI=(e5tftfI=(e5tfIfHVW51dc5`c59c5t-j m dc5`c5 djjQP dc5`c5 AQP=(e5tf%=@5dc55`c58,$t$R=Le5He5 t# Fjj WS9ݹÉrFND$P9|$P$d닔$hjj RS )ˀ0^N9whc#訞hc#Ntf5dc5`c5152WWWjdc5`c5 CRP52jj_h_c#hc#1c51P^_[]Ë$d#`c5 dc5$tҍt$PtV$lSUQP4$SUfH1G@u5dc55`c5h"SUu.$l#$pth"5dc55`c5SUq5dc55`c5H=e5(e5fA=(e5fh_c#c5hc#h"jj5dc55`c5D$DD$O t$\$ VS@@PD$PQVSf@5dc55`c5tfA=(e5tfA$l$p!fHG5dc55`c5qf@5dc55`c5SU5SUhc# t$p$phd#j =c5j iUSWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡd5@4 1WjPQWWRS 9=(e5f2 Pe5ff2=(e5twf2 Pe5ff2=(e5tjf22f2=d5t2ȃ=(e5t]D$ Yf2 Pe5f2f2 Pe5f2f22f2=d5t27D$ G UV=e5l$$tApQt=(e5tRPGA(=(e5t1ҋ d5I4-d5teQRP d5xtt$V/11jWp =Pe5=(e5tf=Pe5f2d5;x4})}jh2W@ =Pe5E d5A49rE =(e5t<$fGj \$l$u6_=(e5tf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=(e5tfUVfXW|$$Wf@t$$W=e5H(e5tt,fA=(e5tftfA=(e5tfAfH ^_[]UUSWV$$1Q Le5He59;$$߃9։$PU$T$L1 B(B $BjZr1B$J$=e5pt$ =(e5t ɋ=e5(e5L$xtt tɋ=e55(e51L$|1ɅDT t$t RP̿5Pe5UVRPM^ tE{[|$t}SW蒿ljUVSW^)SWjlj_{[ |$t]SWMljUVSW])SW%lj?UVSW])Ӌ$xX#UVSW|])Ӌ$xX D$4PS $$W$VWVhPWV e51ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =(e5t SWA d5L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =e5<$\$T$|$(t$,DpLtL|Dx=(e5RSVTtDpd5D$0X0vv/RP!VFvv  RSVFt|tx|$8D$T$Rl$$D(D,=(e5tFB\pTtd5B0FN FNDxD$L|׉L$L$؉D(MU =(e5t]RQ^ d5I0VPBU EMhɡd5@0 ȃ=(e5t3ȃ=(e5EhD,t($d5@0MU EhEhD,=e5L$ tL$D$D$=d5,$\$ 1QOP\$  t19}#8@#pLp0l$$ d5ɋD$taVt$P= d5x4ƍ$5Pe5pS! d5@0fPt$t$ d5x5Pe5Sp Pe5=(e5tf؋Pe5f2d5B09}+^jh2SL Pe5d5B0N9rF =e5tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL d5taPt$t$$ d5x=e5t$,|$(DxL|DpLt1҉TxT|FN=d5<$09(e5QP)RP讹VF^vv藹 )RP膹L$(D,D(D,EM =(e5\$QPL d5I0)RP0U EEhhȋ5d5N0 )ȃ=(e5t^ȋ5d5T)FN^FV )S\$L$4$*5d5V0)EM Ehh )ЋL$Ev8QS c51Ą^_[]Éjh2p $Phpd#k=c5thd#3hd#߻F & d5@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(FW ^nFD$hF$D$pFD$lFe5pt =(e5tɡe5=(e5L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=(e5tf)9F=(e5\$tAf)=(e5t4f=(e5t'fL$=(e5fVT$Rt)f~T$JR>>fD>=d5tq1@1$CD$ƈCCEUL$ q/G9<$u1A=c5=e5\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=c5t Vt$t$Ut$h;d#X1Ƀȃ^_[]1A=c5t1=e5<$\$ HfUSWV $8$4}tE1ɉM4M019 e5‹DT 9 (e5tRPM$U(E$f M$E$U( u ^_[]%=uLId5(9‰|ǃ=c5t<|u=e5tFNFh1 te5tD$hVP* |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =(e5t RP d5I0VQRP膽։D$D$ ЉT$t d5=e5Q8k=e5L$$tL$D$ =(e5t QPq d5#8t@DQL!!IT u‹$8U t#DT tE=(e5t!RP D t(=(e5t1҉EU}@U=}@|$c5EM QPQPh$3WWhd#聇hd#'uQ{u u d5y0ƃ=e5(e5t:tMPW9?UUlCD$T$NQt PW~V ~V hg#Ʊe5d5@ 뛋5d5F8E -e5T$$tT$D$ =(e5t RP良v0 I)؉$ʉT$t*DT tZ=(e5t RP=$8D t6=(e5tȋ$81҉AQSt$t$tv<$8}@ud<$D$|Wc5E$8I QPQPh$3UUhd#薅hd#<$<t7d5Ht)$|$-e5Cq qƃ=e5t0FV=(e5|$$tJRP)RP4FV =(e5|$$t&RP)RP׭)FV )FV hg#袯e5d5@ USWV|$ \$tLe59He5alc5 hc5 ‹-d5t9ˉrux9ˉ\$؉jL$QWPʸց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$סd5t`v0WUL d5d5pxjV|$(WSJ)Љ hc5lc5=e5jVPSJ d5A^_[]WShe#d5@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$d5p0vv_ $G d5y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQP¶19rÃ=,e5$t$ \$ti=e5t,ۉ~A1_t4T\$F9uۉ~1O ɋW @9uG W5e5萲t$ D$x. d5;Xt|$#=e5t JًL B tmt$v vhg#hWMWVt=e5t$$B1ɉL c5t$ $$Bt$ B Cd5;Xt`R5e5踱T$\$1ۃ=e5t%JًT tN=(e5t#RPkBt/=(e5t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tbc5L$AI QPQPh$7W]Whd#hd#|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=e5t+FV=(e5tGRPR+D$RPB1FV =(e5t*RP'+D$RP+D$ډFV +D$ډFV hg#ީe5d5@ 1@$5USWV\$41F~3|$0l$,|!$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ d5; d5u3P5d5f =d5t-d5d5d d5d5Qd54 ^_[]hf#\tSWV|$t$d5d5QPWV<tH 1P1 t^_[WVh;f# tVd5tR d5~%d546k ;5d5sd5Prk 5d5dk 1d5d5^SWV\$t$s sǃuG=(e5tfL$%]"=@tn"RQh%t s s=c5tfhg#<`e5de5{@t1H1PPQQsHsDs su SW=e5t6hhe5W -hRf#葠u7=c5{놹 pe5s sd5H c5^_[WV|$t$ WVhXf#A CLe595He50WVhaf#yA=c5t7=e5pt=(e5tPW t 0hι#'=e5pt=(e5tPhQ% A=(e5tfPhif#@=c5tqPhT"@1Ƀ=e5DT =(e5t RPvRPhrf#@ =e5tF(F=(e5tjP|tPh}f#b@^_SWVD$H8=(e5t3P PP0p4u'11C9}QBRQp< P0p4^_[USWV|$_8+t]Cw

WVQrtu^_Qhf#oUSWV(] }d5D$1 tSW述19t%1SW虰ƀ8t Le5He59׉r Le5He5111 Ѻd5$D$ jPSW跤t$ƉыT$ ʉ)Ћd5T$9ы $t$t$D$ ҃ w 9rjP]_ tkt$ t$T$ QtPt$D$ T$ D$Љ$9s $D$A9u<$t1D$te T$d5Vhf#(oD$L$Ld5L$ SW0Ƌ d5D$\Tt$uT$ ( $ $I#L$֋$Jȋ $։t$ ΋I T$ RPhXd5d55td5t$M $e5(e5ttut5d5t$ 5td5 D$xU tU tt$hf#m=$e5thXd5xd5d5jSWd5$D$xU up\t$ 4$t$ ,H d5LT$Lh P5,d5 5d55,d5襦=(e5t,d5PP護5,d5跓0d5E%=t$D$ t*ȁt,1@D$@d5p81FhXd5讪xd5SWD$e5$t$V<$t.=(e5tXRPtL$QtAp  EfH=(e5tȋL$A(=(e5EfL$ApQt EfAXt$V芽V (e5L$t RPݔL$A Q$A0Q4A(Q,t$d5@T$Ȋ $ t1L$tMPVD$ 舔L$QAD$ PViL$D$Ћt$!D$11L$qA qAEfAdt$V裼=(e5tɃ=(e5$$T$D$HH H d5IT t1Ҋ $tL$QA )PRT$ D$蟓L$Q A$T$ȉAh`e5de5d5@ =d5tD$ L$Aڍe^_[]USWVP-d55d5jt$pt$p\TtN!NN WPhXd5kd55td5U $e5(e5ttut5d5U5td5C }U tU tShf#|i1t$1FO L$hN D$dFQPǡe5pt =(e5tɡe5=(e5$L$Httuˡe5=(e5\$LdtXu D$DVWg=e5thhe5Ww pe5󥡤d5X t$ht$h蠨|$Dt!1H1PPQQt$\t$\t$(t$(菬 `e5de5<$d5jt$pt$p/Ł}U uu\ ,E d5LD9h P5,d5E 5d55,d5=(e5t,d5PP5,d50d5hXd5Mxd5P^_[]USWV\$0T$,t$(d5HPډ t.=(e5tf=(e5e51ɉ$D\$ۉT$u t Pʏd5<$R01L$41́@T$d51+J0#L$,#l$091۸ T$9и|0<$L$(DpTt|$RP1l$ l$9}16L$11ۋL$F)߉ӉŃw9}߃F<$T$tYL$(|$uSRP譎GD(|$u1҉ 1 d5q0RPa $D$(DT|$u1҉  d5q0RP) $Fjt$SUӃ=e5D$|$ t6 $iSPWt$T|=(e5t6WR׉& $iSPWt$mT=(e5t1L$ tYSl$ Ut$QT$6D$$`d5p0Wt$c $N1D$4 $d5p01^_[]t$ t$hg#(cUSWV@Me51TD =(e5tPR D$,T$(D$(T$,5d5F0D$EtH@t)PQnjD$T$@htȉD$5d5D$L$|$D$|$D$NP\$,D$(É1 t1ҹ 9|kލL$0ád5@0 T$D$=e5D$0T$T$4=(e5t RPMDpTt\$9Ѓ}11@D$|$ ]D$1\$|$G)T$L$֋T$|$w9É}Ӊ\$|$D$ G|$|$u=e5T$t'L$=(e5t!RPCD$DT=(e5t1 t>=e5RMT$=(e5HRP9L$0ơd5@0 T$D$=e5D$0T$T$4=(e5t$$t RP荊Mt$t$$=(e5tȋMD(d5@0T$,‹t$(΃=e5(e5t+tMVR(uVFt$t$ 7KVRMQ AD$:MQqD$T$AQ!EL$DT=(e5t1ҋ d5q0RP耐 ƋL$ jWSQ#Ӄ=e5D$ t7~SPt$t$$NjT=(e5t RPK|$)~SPt$t$$=(e5tȋ|$1҉\$$ t/f d5q0RPݏ xËD$L$ L$0|ád5@0 T$ʋL$ȃ=e5L$0T$D$t!D$4=(e5t)PQ膈D$ T$8=(e5t@ɉL$ D$ =c5t h]i#X=e5t h{i#Xhi#X/=c5u hi#WX=c5u hi#W3=c5u hj#W6=c5u h&j#W<=d5t=c5u hEj#WT d5|$Y8֋T$  SP5\e55Xe55de55`e5h`j#Wd,$kdыd5@DWSQPlD$T$iщډWSUR1jj RP(RPt$t$t$t$t$VD$Phj#$$=c5 d5+He5 Le5`e5 de5`e5 de5 tQPhj#5$ =c5-d5KC)s, Xe5-\e5Ջs4HS8\$ ډD$$+8e5$T$m#*L hRf#xu/SU=e5hhe5P c5 Ǿpe5|$݋\$ =c5t$@TD$,=l$$@hnm#9x*SU=e5$5d5F4 (e5fQPAt Ǿpe5|$(D$D$T$0كD$9T$0Љl$(V Xj he5P_ D$ D$ {~hq닅t)fQPsf $AQf $AQ F4D$ D$f9^d5D$@0T$ t$QPVR~ʼnׅD$,%1= ̓|$@%=e5$T$ L$um=d5td t^;9иrN $yhtEe5Q(=(e5t=ʋ d57=c5D$ WUt$ Ph}m#D$L$Id5d5jRVP{ =c5L$$t$ \$ t(Ƅt$S$PVQhm#?L$<VQjƃ(S$QP芄 =e54$t 1FFFhd5\$ T$ D$(x+9‹T$ʋT$ r=c5D$Xt1NPSWUʼnFظ|߃\$ <$w4Fe5<$t LX FuWFsT$ `e5de5$@=(e5tfL$fAf|$l$$j , hX d5d5T$ =c5t| $=(e5t RP\oRPh5n#l=c5gq$ʋT=(e5t RPoWURPVhm#9($DX=(e5tPhn#c5hNn#Ehm#frT$ '|$@@u' T$t$SUt$A he5t$D$, F=e5=d5$@=(e5tffu$@=(e5tfft}SU{$@=(e5t?f=(e5t/ȃ=(e5 $ApfAAt$f=(e5t $ApfAA $AtfA1ɉ g5 g5 f5 f5l$T\$Xe5pt4$9 (e5t ʡe5 (e5$tt4$tʡe5 (e51ɉ$dtX$t $D$LPt$衹=e5=e5t=c5u,$$@\=(e5tȅSUhhn#C hn#,p~SUؾ19 (e5t1ɉH\H`HdHhHl$f!B=e5,$(E\=(e5tȅƄ$E\=(e5tȋ d5I0H111҉,$L$ D$t ߋ d5Y8Om\=(e5t͋ d5#8߉@DYL!!ÊIT u,$\$lD`Td t<=(e5t RPSkD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9d5H4 D$|$׉D$|$=e5t݋AQ=(e5t-RPj!Eh=(e5tȋt$|$1҉11 ˉl$$WVRPSUhn#uA=c5tho#=lht#m|$t;SU蕼ƃ=e5D$|t1$=(e5t RPjFVc5=(e5tȉFhܽ$|$jj$$$$SU z $A`Id=(e5tEQP|i $plphci1$D=(e5tWUPVhm#  $AhQl D\$C5d5;^,T$$L$ f5f5׃ƃ=f55f5 d59˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-d5t$| ؋T$(tu3D$1 Kl$@؃,Ut$H30 ƋD$9\$(s+l$ Uhl#>jSWUt$@hl#hm#m=j[sUSWV |$ ow@u Xw VUp D$t|VUh5u#w wf5 f5ʃǃf5=f5|$ |:w whl#= =c5hm#qjG $D$|$tjVU¾ @e5<)1CVUhs#D$,p p*g5 g5ʃǃg5=g5 j # hp d5tHd5 d59tDy1Y1 t 9u,Xe5\e5$|$ ,d5d5Q1I1 ы|$ td5$G0W4L$Aڃ]D$ p phm#J< =c5t)hn#g1C+c5h*m#;hm#h1Ct ؃ ^_[]c5jpjfUSWVP$T$1B@B 3 d5g5d5x,11=le5t>Q:d5x,$kd1PWSQho#hdf2n le5d51ۃVU聶tzljl$ t$e5pt=(e5tʡe5 (e51ɉT$HtttȉD$LVUz8tD$PWbu(Cd5;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$g5ŅtTM1ًU1 u3VShs#w wg5HPUMpXg5 d59tmu1 d5ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $W&ho#F9hc#eh.p#ejj聴=e5(e5f@=(e5fh=o#8hc#eeU1hPVPVҜ1Bhoo#8hc#'et21VWhVWVW莜1 tahTo#+7c5hm#du<tf@=(e5tf @f=d5tjjxfh<= j5d55d5zT$1B@BO= -d5d5  $le5$Wt>E6+5d5=d5kdPWVQho#hdf2]le5uF$ho#vv 躑 Pe5A1ڍF$h.p#cvv 6ǃ=e5F$ (e5&jP_1 Pe5I F NQPQPhSt=e5F$ Pe5t%QjPShr#ho#>6#c5QjPShr#ho#36=c5thd#`=c51F$Pe5 I1)щN$uh%c#b-vv *ǃ=e5F$ (e5$Wt jP^1҉GW1҉GW }hjD$\P =e5(e5D$tt7fD$T@jv$;^-fD$T@jv$^fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=e5$tD$\=(e5tL$Lu$D$PD$PD$XPyle5;,$/c5$W=0e5v0e55d5;4$]|$T{$AhjW -e5=(e5tt0fD$T@js$\&tPfD$T@js$\FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=e5$|$TtD$\=(e5tD$L$|$TtD$\D$PD$PW٧;4$=d5;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h2p#ss QPTh.p#(^t~s sqf@fNCKK CQPh"ss oOCK =c5thp#ss QPCKh"QPss fN c5;<$=d5d54~^1ۋ/uu q]]8u9rۋ=d5/CK tS  StQP HKX9rjj轄`^_[]c5j&ej_Pho#/L$D$@, +A,USWV $0 n8$=e5ui=d5t`E=(e5tȅtNE=(e5t$;He5Le5s&E=(e5tjPo@E$F0N4 utEh %P)$0 F=(e5tȍL$A=d5AAhh %Q蔸 d5 (e5tD$D$L$L$D$h|p#v v薉 E=(e5tfM9v%}EPhp#.p#hp#4[4/E=(e5f)=(e5f=(e5fEtf=(e5t΋$0 AI 1 hLp#QP辈 h.p#Z$0 F=(e5tȉE$p#PpZEL$fAWQUFi $)fEPUV$i =(e5tfD$fXWPUi $0 G0W4w wmfH$Xc5$0 =d5t>}t8hep#v v贇 h.p#Yu EBc5F0N411G9 v vGD$@=(e5tȍL$A=d5AAhh"Q (e5 d5 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=(e5t2f)=(e5t%ffD$=(e5ff(e5 )fD$1fM$0 A0Q4MT$ tjQkfHD$=(e5tfPjU D$fEutEh"Pl$L$Aq $0 JR ωtljhp#RQUW݅l$EMك9v%}EPhq#*)q#hp#qWD$$0 T$ 3F0V4=c5h r#nUڃD$=(e5t΋D$p@ =d5X}$0 ~hp#v vڄ Eh.p#VJc5Bp#$0 1GPVtXD$T$ F0V4=c5h r#TڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUVd D$fXSPUd E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQUed $EtMw\}.uVV4~0|Juh;q# } .u8hKq#v v% Eh.p# U4$F0V4=(e5tȋ Le59He5s5h\q#juv v݂hkq#T4$=d5E=(e5tȃu}uE=(e5tȃtb}u\FN U=(e5tʋ4$hrq#jRQPX=(e5t}Eh.p#T1 (e5EtjPgC$0 A4y0q#$0 t=c5q#=e5JR u=(e5tPjVRQ菁hkq#cSƋE=(e5tjP1Ƀ=(e5t f(e51ہ@€@t f (e5fGc54$Crv $0 A4y0AI U=(e5tʋ4$hHo#jRQP褀hkq#xRc5zE=(e5tjP)Ë@ C$0 A4y0AI $QPQPhRcE=(e5l$\$tȋM=(e5t1퍜$UQUPhScShq#$"Phq# %9-c5thr#Ol$\$ hkq#zQƃl$\$$0 A4y0| AI KC=d5taEO9tU$0 AI U=(e5thq#jRQP%GEh.p#Pu $ c5fO4$E  ^_[]ËM PShq#"ȃ=(e5tUSWVT d5d5,=le5t>)"=d5kdPWVQhr#hdf2le5}ww cO W $T$ WGO ƀÄ:1=c5t4= e5t+=e5t"uGO 1F9ƺw1 tbQPc8uS=he5xJ1v6KNj@ $GD$wOG tQPb8u E;-he5|E;-he5=4$h0d5e5tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$ 5d55,d5 <95(e5t,d5PPM5,d5)0d5d5$:u#uv#P.t=c5*9c5u~=c5hQv#,d5 h P5,d5= 5d55,d52;=(e5t,d5PP:L5,d5D(0d5jVjsVƅu jv`u jh`^_[]h5v# .t=c58@c5fD$L$ g5g5á g5ág5VPD$ L$ $df2QPV. Vj j USWVt$̤8g5ut5 g5hT"g5l$\$=g5t!u5 g5h`#g5US yW Ph#g5ttj g5tu^_[]Ë5 g5^OPVh`#B j(PD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj jUSWVug5$Ph$J$|hWV輦 t Ƅ|D$PV1ۋD$ !=`= بtLV舣0h$P Džu6hg5h $1 Vh$P/ DžD$PWgVha#Wh&a#ue^_[]Ë$3D$($3L$$ ug5Vhhg5 t9Ǎ$PWx#$= uVhna#{Vh6a#pWhPa#eUEM JRtHPQha# t$t$ha#hhk5Fk5]ák5tjЃj SWV<01Gj0hW&W芣 =k5jj0^_SWV01GW_WSjSޕ֠0^_[USWV$ e5e5=c5$XPV=c5u6#$`= t#Vh"ohm#)jV' e5R=c5<$8e5=c5t hv#Vhv#<g51e5dc5`c50d51I d5 d5(d5Td5 @d5 # BVh 0#lJ-u hx#*ld5 h P5,d5n4 5d55,d52=(e5t,d5PP"C5,d5,0d51=c5td5PhBx#d5tZ$e5u6t2=g5u!=c5sx#t,#PhNx#41OB c5uhxx#d58< 5,d50d5d5hKy#hpy# udd5ǀh P5,d5S/ 5d55,d5,=(e5t,d5PP>5,d50d5d5@ d5HHщ8<=c5tho#=c5uh.p#u_h 5d55,d5i( 5d55,d5&=(e5t,d5PP75,d5'0d5Td5d5D@RL҉111C QPhz#[ d5HLщ@D=c5tho# =c5uh.p#h 5d55,d5' 5d55,d5.%=(e5t,d5PP665,d5@0d5Td5*HHPLщ8<҉@D1ۉd5 e5c5d51Ƀ,=c5hz#1L$ d5L9| 9Phy#d5=c5tho#=c5uhpy#Ih 5d55,d5& 5d55,d5#=(e5t,d5PP45,d50d5Td5@hz#L$>d5d5ǀ,04ǀ(<HHPLщ8<҉@Dh P5,d5Q% 5d55,d5"=(e5t,d5PP45,d50d5Td5 e5c5G?d5L-=c5th {#:h4{#7d5d5ǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5,d5# 5d55,d5!=(e5t,d5PP25,d50d5Td5=Td5t}=c5uth 5d55,d5# 5d55,d52!=(e5t,d5PP:2d5ph5,d55Pd5># h4d55e5=d5VhLVjPn G011D$)9|ËLG8 $HLOd t1SRPV5e56t0|$u)h{#hm#s1AL$=$e5tLSVV36 d5A8$HLId t1SRPV5e5U=(e5t SVV5 =d5G0ŋ $A9 <:PVQ D>/|)Ot$L$6m52m5$!D$h8Jm5$ D$tB?JL$h)PRQdSWVD$t$ Le595He5r==d5 d5jSPVH)޹294v t^_[PVha#CWV|$ wu$PX&1XD$@uPw w Ph $*=c5th4#h=#t ^_PhE#趽le5USWV$\TM@$ 5uh`耤h`VP =c5t h@#7=$e51ۃL뀃=(e5t\,L$UPQE DPPz$\, (e5L$L$UPQE |$u $PP@1LDffLD@9u=(e5t8PP\(e5L$UQPjE t"PP\L$UQPDE  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h#(USWV\$t$=d5!ߋ,t9Xt6@u|$t&jt1ɉH HHXh1^_[]h#VD$ L$5d5#p9tыR9u @^USWVt$|$VW/d5!t7^Fu+11 33 1u{ d5tqt$0|$,\$(l$$T$m5t9PtjRQ m5(Xxp L$ m5t9HtjQ5d5 m5(Xxp ^_[]WV d51!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$Z&$1Aȋ$sY9UX&|SƉ\$1@$D$:\$ D$ PSB$D$jSV }tS*tN$PhF|@V.6 x4D$t PVU$$JhF V5$USWVP1hUU= ƉRP)9-(e5t1@fCM+PUUSF d5;A0u $ytWVC^_[]Ë\$-d55(e5SUqRPX$@ `d5ؔؐh P5,d5_ 5d55,d5 =(e5t,d5PP5,d50d5[USWVt$(~Ohol(e5tUQQՉ 1=e5L$$t| tWVƉt$$H$ád5@05(e5QPWVsUC cMhml=(e5tUQՋt$( }d5@0ˉ9Éʉ\$4$rQPUt$tLPDTGlOh|$ wL$,=(e5tȋ|$d51ɉSh#=c5thd#hXc#lt$" d5QP#T$1RQQD$P1Aád5;X0t$~~1Ƀ=e5T$DT =(e5|$t RP&L$ pL$QSRPǍPm5$|$1D$D$t1)ÉعF@jPlD`r9w<$r$l$T1C @<$9uG<$;|$}d5X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡd5@0)ȃ`T$1ۡm5ـ#hA#b=c5tho#*h.p# ع`֋,$L$t1ɉȉD$ օt$ tH d5i0T$,RQUt$> d5;A0l$,} $L$l$l$,d5@0D$Mt$ |1TT1PD$T$ ʃ=(e5t RP]L$(ωQM D$H 9tet$C9\$t$$hY# c54$F4$;t$SD$`1c50^_[]ËL$ ʋ d5f9u Sh#褤D$`,t$$h"#ljk d5Ph#CUSWVT$L$D$0(D$ X=(e5tSUʼnӉ OD$$d5@09ʼn} t$t$5D$PSUt$< d5;A0 t$~QPSUu~t$4SUWt$T$LtL$A L$ Q5(e5t9RPt$ƉT$ St$1ӋT$1 t<$G RQ0D11 u5\$$9t ;D$t`GPD$ GPWTt RP$<$G L$;L$t9ta щʼn$;D$t`1h#辢^_[]USWV d5$d5x0UWt$0t$0)Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PR m5T$4$1B srl$,$ ȈU1wX=(e5t d5!9GX=(e5tȋL$,1Ph##蚡 m5L$ $  h #y=c5tho#Ah.p#t$D$OPWTP1GTGP^_[]c51USWV|$,u#tu#d51@$d5sll$d5td5 L$  ƍD$1PQQVK9 d5;A0-T$zu D$`1]l$z$Ń1EGpD$hB D$ Pt$ u&xMt(T$hB D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWht#џ=c5th#h#Et3s ss3st$Vn[E;,$uc5w$tu"Ph"#0jNfUSWV0\$T|$HOX=(e5t1D$,D$(D$$D$ D$D$PL$Qs tPst$OG(e5҉L$D$td$PQÉ׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h #˽'h2#h#h h(#uPhr#`O4$V0Vh #h#h h#h܇#hWVt$ F,t@m5th)#:F,Pˈ1~,>d9~8uv0譈^_hH#h_#h h(#uD$x,u@Pt Pwohr#h`#h h(#tWV΋I01t*N8~2IN8tPQP P$N0G;~4vɃ~8u^_h2#h#h, h(#gthH#h#h2 USWVEH1Bx,T$1h/wM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vS=e^_[]hs#h#hF h(#sUSWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]h#h#hK h(#zrUSWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]hs#h#h` h#h#ha h(#qUSWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]hs#hʇ#hq h#hʇ#hs h(#qUSWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]h#h#h~ h(#^pfUSWV\$$|$ l$t$m5t5e5SWUhB#\[USWV5e5 1^_[]USWV\$$|$ l$t$m5t5e5SWUhs#[USWV5e51^_[]V=c5th#Œ2j5m5Htah؉#腌hm#+tSm5xL~61 m5 s"@Pt4h#|Z m5m5F;pL|^5m5vj?Sm5t'x,tPm5Pm5ám5t x,tt$t$t$t$P1WVt$|$ VW=e5dtX=(e5ts,d5`uau33 u1@1^_WV c5t1 m5 d51!`u/aʀs2hlpx1Ph%#ԊPh[#hm#gJh@#蹊d5 ǀdƀah P5,d5 5d55,d5=(e5t,d5PP5,d5Ѱ0d5d5!1111QWRPjhm5hhw#hm#艶lh@#ۉd5 ǀdh P5,d5< 5d55,d5=(e5t,d5PP5,d50d5 d5dPs+aʀu Ph[#Ph#hm#蟵h#d5ǀdƀah P5,d5U 5d55,d5=(e5t,d5PP 5,d50d5^_jOUSWV1L$ AL$HAL$@AL$<L$ j&L$A j&Aj&Aj&]u }h#SV@c ka~(bt@it YltAsttuJD$PW,5uVPD$DPD$DPD$,PW(D$HPWC# D$ PW$uh$[&jƉe^_[]Ãu95_2ujhj&D$P u1PPD$Pje95_2t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQVRPt$8t$@t$8t$@W1u2h#R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]S^kt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ S t$\D$Phf"hV^D$@w ww7VPh#S 1hu#+hNj#WfUSWV1L$(AL$$t$@L$ D$ }] hM#WS_ aLuKVbtit'cD$ Pu D$(Pu3 D$$Pu udt AuZD$ 9_2u~]#D1غ$Phzd@e  tN|$$tOh8[&j[t$ {yt$@oy1Oe^_[]h8[&j'11J$THPT$,L$(HL$x1VVVVV]PeT$4 @T$ƋD$(D$8D$,D$4D$$D$#(#PV1H^_[]ËD$P ËD$ P SWV|$ËL$T$D$@f@@f@փ|fp fx^_[ËL$D$@ @TD$ A ËD$@ @TD$A ËD$ @ @TD$A USWVD$ t$hx t11t0Vh#hdf29D$4C9u萸Ph/#SxV#D$ td" V#d"$L$Ru0QSh`#hdf29D$<r31F4$t0t$hd"Shu#hdf28D$@ F9u1H^_[]ËD$j$,(*USWV|$(jWujWth#W1Nڃ^_[]1VVVjW tSӉ$Ճ$ՋD$49L$0t$,s,11Ʌ,Eȉ h#s,$ʃЃ,$9Չ|ˉ$|$(W xt h֑#'HP ,$9|ډȃ u h#$jjjW>$\$SVjPjt$ t$jjW: X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPNDE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q ` H @AQ@A$Q @QHALh#S[h3#hS#USWVP\$|$tus$! $ "$jTtQ1@PVSjPt$8t$8W E1u>4$h#W V [Sh`#W4$h{#W 1H^_[]UWV} uOʃ<;|RQPhu#VJPR%x& $T$W1ٹ|$5<;h# 5<;hL"VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhj&V"x 1OujV5<;>uW?,VQ>~Ih#Q1$VQ7 t1Ph#Qx 1O^_SWVP|$1N?u;j S5<;K 8u1u5<;hL"t$ ^_[WV|$1N?t5<;谰1t^_hF#t$USWV 1O1;B։ˍD$ j P5<;L уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5<;"x(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,jhj&t$u$ tjVt$t$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0wh̒#VIz1t^_[]1;BB  Fjhj&Pt 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hܒ#W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Ph#Q 1HUSWVt$|$ t)l$\$$jWUSy0 tWUSh##1h#V*l$(\$$jWUSF0 tWUSh\#V1H^_[]Ã|jWUS蜒11USWV\$1s3h=L%5<;2 t^1W_&tuWh#t$ 1N_&_& Ch=L%j Džu^_[]WV|$ _&_&Wh#T+u^_USWV t$@\$p ׋C0!K4!T$, ыT$( ЉC0K4t$t$ D$(P K H $YTL$ Q #|0#l4 l$, |$(|0l4|$ QPW t$$h #W 1t$$h#t$(d WV|$jhj&W`o 1Nu.W5<;6t5<;h+#t$ 1^_USWVl$$\$ |$t$jj hd"USjV9 yD$USWhX#`(|$tVh#K(j a' ^_[]ÐWV_2;$$,(h]#^ $hh#'j$,(:RPhy# h#vjV p FQPh#' v,v(h# v4v0h# F8Phf"hWU3WhЖ#;'vPh#+'1$h_&jIĈh#ƃ1HĀ^_fUSWVD$ $t|$$L$|$t$,t$4RQ~L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh`#P%1D$Bh`# D$_$ӃD$DL$H(X,EP!t$@E X,L$H(u4$t$w7t$Hh#u1fUSWVPM(,|$8O] D$1h#uSK sujsWVVuutqD$9_21t$M tN(F,9ˉ|ىˉǃ;4$rΉD$+D$T$щߋ\$9ljD$ +D$L$,9t$L$;L$|$D$11CT$09Ӌ\$49щ;L$$|$( $$T$u11҃]|r tht^1B$D$thӟ#SG 0+T$x|$yRt$hu#udh#D$t$th#S11A $1A;L$0D$4D$,L$ |L$Vt$VjS @L$)΋T$׋jp jRQWVS 6 $p q 袾  yq @N F$FV0~4j\V軻FSȾ H @AQ@Q A$Pƃ׃q0y4QLAHS?D$ ulD$ \$$ $L$(|T$ |D$ fft$Hu1hP#h#Sh2#SfUSWV0u1L$ L$AL$AD$] }D$h#VS a~bt1iugD$ PW*u5D$PW$D$PWut3NT$T${lhM%_1D$|$|HWt;L$L$(L$L$$xupt3L$(P3T$$ t @ut$ t 9_2uD$L$ t!T$ T$thg&jve^_[]t$t$ QPt$WߐUSWV}u 1L$ \$CD$hǠ#WV t4H w]$g&SuF D$ Puuut%xL$룃L$뜃L$땃L$뎃L$뇃95_2j}Wqu hע#^\$D$|$|=W`t0L$T$xuXt01΋x1 }@u؋\$ mWt9^\vuSh#W 1Hhh&je^_[]þѠ#h$ V h# Vm h# ]WD$ޠ#D$נ#v6 \$Sv v S f2H f2;$f2h f2j  f2H f2 \$'f2H f2;$f2h f2j  f2H f2 FtHPh#yN1v6v C f2H f2~a f2H f2 ]h$y"2N1v6v  f2H f2  f2H f2 h f2j ^ Sh $P|$3W \$Shf"P$ S SWuhh%WŹ Wh#w~u(hDn5hf"hSe Sh#K)Sh#;D$Phf"hS, }ShC#hn#$f~ jj hd"RPj|$7W蓞 xWh $"$f~ RPh! f2H f2~ f2H f2 h f2j |$G8jm$Sj$P蟴Sh#?h¡#2G0O4 tQPh$PPh#Y}qh f2j FHsF 8-uJF $1҉QQ$$Phf"hSShC#vG1Ѡ#h$ V^ h# VJ h#XWpD$ޠ#D$tD$נ#1ot$w7] Vw w Vf2H f2;$f2h f2j  f2H f2 \$f2H f2;$f2h f2j  f2H f2 GtPhӢ#P h&y"Af2H f2;$f2h f2j H f2H f2 f2H f2;$f2h f2j  f2H f2 Ow7w  f2H f2~ f2H f2 h f2j hF D$Sh#[$1۹#v6SJ $|$c#v vS, \$'Wh $PS$Whf"PVVSuhh%S  VSh# GPhf"hVVhd#G8$jmVj$PҰVh#rh#eG0O4 t#$QPhRP\$ Rh#UUSWVӋ$$$$g&h#" Ft h#hA#F ~1ɋӉ13$ 6@uhK#h#h#yl8|$Vhf"hWaWuQhz#DĘ> t h#)hȍ# 1A AAt$Qhf"hVVh#h%#h3#Ĕhl#|$uhusuqVhv#oh܍#uuulhb#b#td"PRh3$>Ĝ;8jmWj$VzVhf"hWWh#Đ^_[]USWV΋\$$|$ ʉl$͍L$jj hd"UPjQx yD$SWVhʢ#|$tUh#j  ^_[]USWVDt$`l$\\$XT$1 j&A j&Aj&Aj&B0k#` hx#VU= k)Hw]r$uStJPSu7HsutPD$PS uh,h&jD^_[]1Hu߅tjhj&D$P< t9-_2uPhGFD$PS벃luhM%1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uh#SW a~bt)iuRt7D$PV"uUt$D$PVtD$PV8uh@h&jռe^_[]ÃluhM%1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=_2d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H `n5H \n5@Xn5 Tn5hTn51`n5F\n5FXn5FTn5F^Vt$|$uD$ hdn50pn5FDln5F@hn5FPV  f2tkS`hk&jٮV h #$1ORt$Ҩ 1O4$Ĩ 6h f2V藃V1*Uh8#$y Vt$耨 ^_[]ÅtVf hB#h#h h~#hZ#hh3#h)#hh #fUSWV]} r=#D$D$ h#SW iu5<;tFumD$ D$9=_2uUj]$,(読ǃD$T$ЃD$,jS9t%D$t6h#hk&j.jS D$ tjStD$t h#w@hr=#V軲#tQx "hX#Pl )j$PO hn#Vk h#D$ Pk jhP>P D$0Phm#t$ D$0$L$ 11t$ L$ D$Ph$#t$ bD$\Pt$ tpt$h#S 1O1P Vҥ 0h#hŨ#S辥V謥 h#S袥t$荥 ֋D$+D$ L$,D$D$@L$$L$ D$HPhQ$V# D$TL$ 9L$PD$LL$9L$HD$$4$e =4$萨 D$ @M$PP$t1PPPEܚ!ƒE$|$ 1]Qt$腹 ;$F;t$ ukh #S詣1Oe^_[]h<#ug-t$h#uy hh#h%#u]1O1t$b]D$L$$jQP!ƒBD$;D$w6E$t$Pt$]謸 ;$F;t$vhȍ#t$g h}g%Pg P hPt$ hd#Vg P莒 D$(vt$(v ËD$1AL$D$D$4|L$L$4|D$D$lPh#S9 P|$l$PhGS"S ($Ph#S $Ph#S $Ph#Sn $48Vh`%SK $Ph#S* $Ph#S `$PhƧ#S ?$Phӧ#S $Ph#S >u$L$4fL$fB$Ph#S $Ph#St t$(` Åt$(芤 $fǀU1PPPE!ƒ[u$t$袵 ;$4t$8 D$t$ң fËt$01 |$lD$Ph`%St D$lPt$WD$Ph$#S@ D$|Pt$#$Ph$S `$PhQ$S{ B$PhJi"S] $D$Ph$$S tj$$Pt$ 蛔 D$DPh#S D$D9M$ $ȃhL$pQP躕 t$n Åt$蘢 U$61QQP!ƒ~t$ M$$VP譳 9U]$|$$D$jRP蛔!ƒ=M$$VPT 9E$1SP|$W肔 GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$#}T$0L$4 tH)Љ|M1K8/$;81$;tyh)#YXjhG#Ph8@%hM#L$(D$, t )|1hG#Wh8@%$;|$tv vSj 6D$1P?@ ^_[]h#h# h6#h|}%j詻 USWV $ShHl&U Ǿhm&󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAHT2qL1ATAPAXkiA\V#A`i Adf#Ah!i Alv#ApRhQ$0$0 ^_[]ËL$L$ USWVuE X8D$Phu"Vs |$V V 'C 1Љً'L$I$1 sD$PZ8D$D$ t2t$ ^ {uWv蝠u{u C $\$uoh#D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$ ۂ E0t!t+M4S9rQSP赂 0t,h­# MHtU4uL9rRQP臂 t$|$t%u@uhV́ tIa81tSul|$tDEM9rQWP6 u@u`V臁 u@yu@u`Vq teEptUt$8ЃtEu8uXVG t, ^_[]h^#h:#Ah^#h#5h^#hw#)u\u\hح#udSh#j wlh $j fUSWVt$cL 1tvt$M t[S tCPX Vt$P tPUW3Q uW趉 S 1S W'L ^_[]USWVu]Ph~#S t$f1j?1Nt}ǍD$ Ph#S! td\$ t\hjD$P! jS\$S ShiW t$E L$Uf jQh~#P^ je^_[]PPh#t$ u1$YVPt$ t$t$V tPh#V` u1$^USWVt$t$|M t Nj\$ Pih 9v荛? 耛1N*Ƌl$Wih VPU^ )SjU~ ^_[]USWVt$t$M t?Nj\$ Pg 9s9Ƌl$W h VPU )SjU~  ۚ?1N^_[]UPhSn"u t$衚1H]USWV@uPh߭#V ] hI#V.L tPQg |$ P\$$ShiV\@ |$ jSe PhI#u N V虆 ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP>e t!PhI#SM V> 1He^_[]h$hF#hh#WV|$$hI#W.K t;Pf u1VAf jPV3} VhiWQ? t^_hS#hC#jVh#hu#j脪 Vn5h2V V n5hxV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh#hV>tVhڮ#V FߋD$t$j7QPh#hV>tVh#=VċF߁^UVuPh#V t3$L$ AQhiV= u h#E1e^]h$h#hhu#UVuPh9#V t3$L$ AQhiVe= u h=#D1e^]h$h4#hhu#UWV}W#ƉPh<#W tZt4$P<tW@PV(b tGPhƵ#u J t>V#1e^_]h$hH#hhu#qh#hH#hW# hH#hq#jͧ h#t$G tPhƵ#t$)J Hh%h#hhu#WVPt$|$D$PVW tKD$tUhm#WG tPhm#VI H^_h%hε#hhu#hε#hw#j h#jѦ SWV$h˱#S&G t]Pb GAsdWRt^WPh˱#StNpxPhiS3; u?V11HĐ^_[h#h̶#h#j h"#jD USWV 1CCj7Shxi Pw uh?#?,$PuhX##Ɖl$D$Shxi Ww u h~#jĥ $L$9~D$~*1t j pSh $BG;|$|j NVj USWVH4x&D$@0x&D$<,x&D$85$t5u#D$1D$11D$=(t5D$(PjUu h#|$T$(L$,T$։L$ ȉƒ\$06eĉL$T$|$|$ɚ; t$D$\$=(t5u11D$\$W|$|$ |$|$|$ |$ ʚ;||$t$ L$ӋD$D$t$\$\$Ë|$t$ D$$Pr"u h6#j t$ D$D$t$$1|$\$F = 2@O9t uGtMF L$u@T$(\$,T$ 3T$3L$ u L$9L$0 L$9L$ \$ \$} VЃuGt^VЃtTjD$ u Wh/#j覞 P9D$L$AËD$L$AËD$L$AËD$L$AËD$ 2 21ËD$ 2 21ËD$ 2 21ËD$ 2 21ËD$H@ 2 21SV\$ Sh 2QLuCЃ r"CrCr 01H^[h 2H?r  ؈ 21ыL$t s51ÍAЃ r)Aw AwÉ蛋1HUSWV1t$ D$hVP!o 2xs5t8u^s5ǁs5s5s5s5s5s5s5s5t5t5t5 t5t5@wh 2R&uh#0h 29&uhԴ#ht 2 &u h#j $5 2tvh2%61t5t5t52tt 2$h 2$U ƃV B~>CNt5F v/FwD$n&!t5Au"h #$n&t5xu>Wu4D$P1VhVVj V5<;X (t59t$:*ƀs5l `C Lvms 22u$2t5 t5rt5#t5D$P1VhVVj V5<;W $t59t$taYt5>t5O"t5CatTl5$2+wtz29t 2 2$ÿ2؉$2_2 t5$u =#t5uB=s5=t5=t5u|t =#t5u =s5uftu^#t5uS$ttH)ŋ$L$ T$ RQL$QWPU%ut4 u&h!h#,5<;hD`%j蚘 t$PD$P & u h8#D$t,DtVPyDžuh!hE#JW WtS)uh!h:#Wuh!h# 2t H9t@h!ha#$@ t%VWЃ$WjihӰ#h!h*hu#0USWVg1 3 uh#h#j苗 Ƹ 2jmPEd"d"t#jL 2PEt#USWh#hdf2۱ 2t VSm##ud"WWWWWQWh#hdf2蕱$Vq j肨V 21tT$q9t Iu^WVΉhjWh D$Ph#V tZhc$V6 tQPQ L$PyRPQh WhiV* u h$#2Ĕ^_h%h#hhu#WV h.#Q;6 t;P,Q  u1WNQ j PW@h Whui V^* t ^_h#h#hihu#h4#j莕 hޱ# 1ÃD$ 1ɉJJJ JJ BRhiP) t1h#j5 $1ɉJJRhiP) u 1Đh"#j Qh 2kCUSWV΅t R,2 B0 ;0 0($D$P!\$D$1t$$tsV,{sD$tVP{Vh#W trC=t5D$uCt\=t5uCuM="t5uCt>=!t5uLhj$Vf VhiWn( t!$uۋt$$4u= t5t ~ j ah f2sqIWt& 2ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhv#h$ViVUh#z jl$U$VS Vhit$qd t$,$t!Ph#0Vh#P.,$jt$V Vh~it$d t$tPh#ުj ꍄ$P$$ j:QPh5#h$P$t'$Uh#bUsE}uj:$$h5#h$Pf$t'$Uhͳ#UsE}u- 24$tVWUmuj|$W$V谸 $$ DŽ$@Vhit$Vb u$ hڳ#|1@Pl$U%jWl$0UK 1@D$81D$$$ t-ƒ ʺd"t@#Rh!QPh "h#$$ t-ƒ ʺd"t@#Rh#QPh "h#輥j Ҥ- 2#Pj USWV Ӊ΋|$4h.#QD, tPgG 1EUhvi Vv j UE Ph.#S4. Vf H ^_[]VD$tLd"t$jj QPRjVD Vm @#uzd"PVh#-у d"t@#QhWs"PRh "h#ȣ ^WVΉhjW] WhiV tD$Ĕ^_ÐSWV$h$V* u6h!#V* u$hZ#V* uh#V* tD0t5 ,t5=4t5!lj=0t5hjSb\ {Sh7iV t Đ^_[he#j Vt$V'Ph $詢tV蘤tPhr#膢t$V٤t%L$ PQh7$b V蹤=L%uߋD$=rPh{#4^USWV$WW1ɃtQÉ1 jVU述 Uh8i(SZ D$ sjP7QƉD$$Uh8i(SZ :t$~Phƹ#`h $t$D$;D$t(h$8h $t$ ej)=j 3\$#|$h #1Ay&9xu H uh%àt$(hjVZ Vhi$ St$<\$8h #o.#Ex&Qt8u 9A uVh*#7 Vh#1#X4hd"h7$ j jmtz D$ ~[11ۋ!9uIuUԠPhҹ#趟h#詟h#4j 诞D$ 1AC9|M rVļ^_[]Ph#$h#h:#h!h# h#h#ju Vjmu8t5hVV2^h#j< hdf2jjHhB#5UVuU OPh#V t!#0t5 $ 0t51e^]h$h#hh*#?USWV(ӉQtoh#U% t0t5H1 Rh8i(U u s8uIjh#S t)D$0t5t(^_[]h#Vh̺#j h#h#h#j SWVt$T$;h$V/% t\Ƌ0t5PJ@ V@ PWt+Ɖ߁PWt2 É0t511H^_[h%h޺#hh*#h#WV֋|$ QVWPh#j WVPt$T$th!#Vh$ tkP? VN? PWTt>ƉPV50t5̠ ǣ,t5V1u 0t5$hdE#Z1H^_h%h#hh*#WVPt$T$hZ#V# tbP> V> PWtIƉPV50t5$ ǣ4t5VA1u! 0t5$hdE#q1H^_USWVt$T$1h#V%# thƋ-0t5P@> V> PW t6ƉPW裞t>V ݉-0t511H^_[]h%h#h2h*#ݯh"fSWV|$ tp1H>t$|$\$jF PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V; tE$$PwCt/$F ~G F1o o 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QPKU Ɖ׃с11E9r Io8"t$8t7o1H^_[];sC| C 9s} o"WV> t/t$ L$Ps(,tD$$F ^C F1n USWVuD$ tV} ]CtP7X tEC tP7B u/D$ PhSn"7 u$D$1$Bn1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V t|$,$h=L%W赱D$%tD$1{tj/t$8tAL$L$4yyyyy D$AAD$ PQt$ t$ 踢tsË|$D$4t'u#D$XPt$;D$4D$4D$ PD$8Pt$ t$ GÅuD$ xl1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxrl1X \$TfD$t7|$0j WP; t9t1ۉD$=rk"11HD$$PN|$1OL$L$D$L$T$PQRh#V覸 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$PNjD$fVSPN sD$ t P躟4$W6 W <4$uM S]s {te|$t^t$Vt$t_@PW5 W谼tNVsE0 ߉VuV ۉt3EF ^C F1Vt$h#h#h#hW# h#hq#j1{ WVt$tVa]ri1H^_V t3t$L$|$ Pwt΋D$F ~G F13i USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'h<$t@1@>g.1-t PuT 1GG GGg1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7 t+{0t>-uUsF_t>Vs6_t)uf f1H^_[]Ís s(CtP7o uCtP7Y t1@뿋C$1$hz&4v6 !6 P_<  v6 tMtk $t$ 4$UQp WV@t5h 2VVHt5h۲VPt5hWVW^_USWV, $@ 1 8t5t1ۈ$+$*|$hjWA WhKiVb l$(EPƀ}u jU踥 $GL$$*SjQhRPU莃u jW} $L$ $+SjQhUPWV1f|$0t,L$f|$ 0t,D$ t/#L$ T$QUR$6QPh#蕇, ^_[]hdf2jj7h#DjhIit$  t1h#jn WVt$ H 29tEttC9uI1m21\Z s@tA9u##t:"uWVQ ^_[SWVD$,1ɉL$L$L$L$ L$L$ $tt$  t$L$0$D$xb9r^tύGPhV= t $ۍCP!t"f8SQP= Y1^_[SWVjt5t$蚽t*|$\$jPWΒ WSV< ^_[h>#h#j k USWV$$$hjU< ]UWVjĜ^_[]USWV$$8sjjljP`\$hjS< jVSI> X#$<uߝ%$D$sVPk }EyPUD$(Pj< D$ED$D$PhiW; tjD$@:$<tkC 1Ҁ=t5R1RRh$3RQP}u7$#t-$#Pt$hɢ" h#hA#3$1P9(^_[]h#h#h#h:# h#h2#ji USWV$GPRt\Ƌ$hjS: jUS^ D$yQWP; Sh iVe: tD$,V8+t h|}%jph V81t V8/u 1Ĕ^_[]ha#%변= t5tt$t$$Phq#ʀUSWVt$t9|$\$nUSNuF H9uPUfu 6u1^_[]ðfUWV u|$ jtRPh#VA t($fD$Wh9iVl 1uh#U1He^_]h#h#j$t^h#D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh3#ja P1Hx^_[]h#h#jOa WV0t$<|$jWhK#V萴t8Wf t7HfJBRhiV t!10^_h'#h#Wh2#j` hc#j` SWVtt5h 2VS|t5h 2W@VgW^t5hV3t5hWt5hSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW2 Whi$ U $!h9#Yx$HQPۍ\$4|$fGWhiU t$@#f|$*uJ#=t5t PwfD$(WhiU t$S#f|$*u]#=t5t Pw|$fG WhiU t2D$*=) Phh#w=t5t hp#gwfD$(IWhiU> t2D$*=) Phv#2w=t5t h#w1Shi8U |$Dh#v1tPDL@uShi8U t$HuM1|TuD@uD$L|Cm2L$P9Dzty:t|$jQh#R uVh#Lv11t j,ZuDLxPtT h#vv<u h.#uj u$PhiU tDh#u$t$h#u h"uj tPhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR% Ph#'u$=tPh# uj t$=tPh#t^_[]Ph#j[ hdf2jhh# ÃD$1ɉJJ JJ fBRhiPm t1hc#j[ 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h3#jc[ USWV,$@$PhiV tr$A jjj". xgljj2 xi$-hSWL xB$/uE$0uf$Ciu.h#1H h#h۾#zWM 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'hB#hy$h>#h9#h#hm#hs#QL$4Qh#or(D$f($-D$](E!L$:!PS E P $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q t5t t5Et5tIAtcAtCAtPA tSA@tBAyAAT$ht5UWt$PVt$D$VPRRhG#q,l$ }"E!Ê<)\<${&=t5`Cs|$[VPWl$Phr#h#p#<*<0<2=t5<$x#<t#sQh $CpӤ"1L;d"y#QRPhg"pG=L%9u<]K%C=Ph#h $o=t5S<$CPh#oKPh#oK s k t?L$D$F#PWh7$Vo N]%܋L$D$(Mu} L$D$D$F#PtPtPu/## "#I"QPh7$n N]%D$ŋL$D$(ȉ</=t5%<C<$|&#=t5CPh#=t5CKSRQPh#hſ#nC~@sFNuQPhٿ#m IRQPhϿ#mMuj>ll$ L=t5?CPh#m(sh#h $zm=t5<$CPh#XmKPh#BmCk tAt$D$x#\PVh7$m O]%܋D$t$)E}twt$D$p#ttu/## "#I"QPh7$l N]%D$<t$)ƃl$ rPh#Tlj>jk<$€#${&#rQ=PuJC<u;h#h $k=t5yCKQPh9#k ]=t5Pȹ#6<"<(## ######## ###h#h $k=t5<$CPh^#j1D3 d"t#T3 ׃l3 URWPQ&hl#juj>il$ <.###CPCHÃ)gj jiEŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]h#h#jP WVD$(1www ww7fWfGfGwWhiQ6 uh#g1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQ"$ ;l$D$tD...PW2^_[]Wh#Q# 1<$tɍGrD$X1.Phz"ST E;,$sGwUSWV։ϋ\$Qh $UhW1)Ǎ 9~)jg^_[]ø wt&øI"øSw&øI"VPt$ D$Ph#Vۏ tD$P^h$h#hhC#$|VPt$ D$PhT#V莏 tD$P^h$h#hhC#{WVt$(|$WhiV tgD$Ph#V& t7D$D$WhiV 1uh#1H^_h$h#hhC#O{h#jM fUSWV8_ y hz#h$3 y h#hjh#9kt\L$jQP D$tPh#jh#j D 21 VPh  VPUSWQRPh`$1EVRQUh;BVWhF. 1H\$(C CCVWPPUPP P P PPPPS8VSjP= |$www wwVWj1 VWj1 V? S? W? D$ @ )T$VVQRWP1I9u :8tމ5t5 D 2tщ1@8^_[]h#Oj 0jj|` h#` u8#jVht#jh1#h#Vh!h ~$ j 0j 0USWV`~ZD$=t5tIt@ƍD$H@ L$1jQRRjPut$Vh#< 1t$HFFF FF1G>\$SVjA0 l$ UVW20 zƅZD 21OjUj t:9uB$=h#jV<  W88uh D 29tttn1VSj/ VD$$Pj/ D 2vhK#@jjjA 1VSjO/ VU6hz#1=D 2u$=|$ u'1VSj/ VWj / `^_[]Ét҃t̓ u1Ht$8F FFV: Ph#u1#WVft#D$8x xx8WPV9 !{jh#h;*#聀 ~$SWF Wh'#j V-SWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP- $H $u˃^_[át5H t5t$Vt$VPh#ij V5-D 2VPD$$Ht5t$ I?r5$ !P$Ѕuσ^PD$L$ $QPj螢 oXWV1N=t5tED$@ L$1҉RRQWjPTt4$ h#^_VQI; jh&:9 jV9 tP`t^VhO#>j,Vha#)j+PD$L$ $QPj輡 荡XPD$L$ $QPj蝡 njZ XÐUSWV$$D$D$D$,1H$11D$h#WSk f~/P w`1A$&5<;] D$u[FtR=5<;D$,D$낃g<;8#u(@j L$ QP $D$8L<;Pvn@$)<;8#u)@j L$ QP D$D$8<;L$QP蛔 j D$ P5<;| D$D$8c1Fj D$ P5<;E $D$85<;h#8_2<=t5u-t5~q5t51ۋtVP*uJVh $\FtPh#\FtPh#\j [-t5C 9|?,u)É\$(k <D$jT D$PT Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0611ɉQD$ P4du D4D$8u 18tz`Xt$7t5u t5-t5CPV)t Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP$ jR |$tt$ VUWT  UWF6 /8C|$$8D$@PW'tD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWit!t$ VUWHT #|$$tS9u$UW5 RWs7 $D$utSPW/7 uWh#l1ļ^_[]Ë m2DQu@ 5<;h# Phz#j? hD#Wh $h$#Ph $SWVƿdf2Ph#WZ 1CWShh#QVh#WbZ SYQVP1PPVPjhH 2u=4$pt5t01QQVPjhH 2Ɨu$t5^h"h!jL? SWV|$uWD$8H  1҉؀&9u$  &9u 1&1ҋL$1^_[h=jjhP 2t$qQt@1ËD$0t$d%WV|$ u;D$H! 9w9t!؀&r&1&L$1^_SWVD$L$t@P% wru؀&rb&[P p! 9w сr.؀&r#r3#1&T$ 1^_[V|$u7D$ H΁ w9t؀&9t&1&L$1^V|$u;D$ P% wr!؀&r&1&T$ 1^WV|$ uBD$0P  ؀&w&s 1&T$ 1^_V|$u;D$ P% wr!؀&r&1&T$ 1^V|$u;D$ P% ?wr!؀&r&1&T$ 1^fUSWV $ D$ $D$&11D$hJ#$ Vla c~$ &t5|1EAtauv1A밃L$_L$Xt5PL$IL$B<;:ىyL$ $<$s5<;$<;D$ىAS-_2t5)~t5t t5Ht5.f(t$ H# eÃ1t$kh)#U5!t$hb!U#!thd_#U!u#4$suK 0$Lt" Åu+h|#U t$uKD$Ph$P[ kK1PPWs Vt$st1EK" Å $$ 4hV0[ Ã<$L$h#$ 4$\jSy+ ƃut'8$hSV  j/VLt@V#@9vHH9wr$jP + ƃht5hzd@Vk  iD$PhedAVN  V+ 1tSDaFk<$$P$ 4 D$tV' u=Vq& u0$ 4& u$ 4E& Hŋxh)#Wzt(hb!Whthd_#WV!mh|#U;u8t(ʼnD$u$ ʼnD$G$w utƉD$u$ ƉD$z$P% tNjh|#StG Ƥ1$UhSfX  1ۉSSSWt$t$t$D$jP Dž~11D$4$P u L$ Ou1wVQ) 1=u5t3u5,$9ȉ}!w 4&1&t1PPPPt$t$$ tʼnĨ ^_[]hW#jg5 VSh $j5 $ 4h#hU#ዄ$ 4h#뻍$PSh `#sh#SWVP΋9tRWh]#SR_W&v RL]^_[PPPh#hdf2OjFUSWV11C:nu~ou 1@$1$Q\h=L%D$P3 t<18nuxot,$VPuth=L%j`3 ut$[u^_[]USWVPωjP 1~:Ë,$WPtWPt Ku^_[]USWVӉ͋$|$(WV胉 t2\$$$ $t([u%D$ =Vh#_d)h)"SU1ɅL$ $|$ uf|$(/u $("K$D$$jPX Él$|$$jh#V ōjZD$ PD$0P u-t L$PVQ  Ku|$(l$$t ẇ"t Ầ)# t b!Z$&$, PW tq$ mhU#D$ b!1ۀ=t5u =t5h#Pj t$Wh#QJ%&jj@ZD$|$ tjh#Uh t?$ٺ)"st$(Uh5# $(Uh'$hPwH$DŽ$0ffsDŽ$,t_puDŽ$(moun$D$$(D$D$$(h=L%P-c1G@F9NjD$|,6VPY ɉD$t3o-uj=St6CD$_#h=L%$,PbÅu 1G 1GD$D$D$L$ D$L$(LD$D=t5$u t5tQh=#H|&1G1D$4h$hHF9uj yG1ۀ=t5$tD$PE u hض"Q艭|$(t_ƅ$t PVpt$Jp$u |$ $H$tt4$2hm"$t Pot$o$(t$! jj *WSt$ ~)D$ u|$ jWt$ 탼$u$(h f2PQ|$($(jPV t"$(؃tTu*tGh"1C؁^_[]ÁttPPWh^"bf 1ۃ$u1ۃ=t5u t5t$, Pt$,V苣 t$, Vhv#=t5uj$t7t$ 1FV Vt$nB u hC#A%t&$($(SPh$hW_Dt$W+ j8tD$(PWh_# uD8u$(QD$,PQhc#j-USWV ˁD$Pj VL$ Qh#(E#+t$1&Gt6t =t5t#$t "FwPh7$D G!Ņt G &rt4$t "Ud"t@#FUQPh#D1tK$t "FPh#dDZt 0h $ hf"6D=t5$t "FstspPh#D=t5$t "Ph $Csds`sTsPh#Cslshs\sXh#C=t5|Ut$ 1|$$hVPPh)"Pt$u(|$ t!j V3tVWh#MC hY?%"tjl#Ph $C^_[]WVt$t-t|$ PWtu頨u54 1u5^_WVD$ 18nuxou u5Pt_1,tu@APOZtCƉ8j,W21Gt@Gj,P'hp"`h!QWuj1^_fWVt$ |$7 WVUSWV$$l$WVSU$$hhU3Wh!6< uWVh4*"j( D$@t.D$t$QPh|&hVGaVjD:USWV$$$1hWS 8D$$81G=4;=_2D$ C|D$D$1D$h#UVM T~H wV$& $׃Gt!M5<;L$ 뱀L$5<;-$Ax|$뎃UL$5<;($At|$_ $V $M5<;L$|$0P$h܃&5<;SG&PG $_2)ƃ|$|$t L$T$ ttL$ T$|$u 1AL$t$St$V$r$$Ap\$t t|$uSD$PVʄt\uD$0$AtuD$4$Ax|$u#D$ L$ L$Ĕ^_[]hh("j& Vhh1$蹿Ph7#hdf2@ j7fWVPt$jWV 9u9t x^_Vt$h*"jq% Vt$VNt@^hu"V^Vt$VSt@^hw$V|^WVPt$jWV 9t9u x^_Vh*"j$ WVt$|$ VWz t$?/tWhc)"t]Vh|)"f]^_WhN)"j$ fWVt$ |$7 WVSWV$D$\$VPWS$,$,njS7Vh$7 u$tu!D$("t$("j5s("0PVt$ h("j# USWV\$ l$|$t$1E1@4;_2h1*"WVI ou%jSh&5<;CtEPCǃuA_2)ރu4t$$V4Nut$(t;^_[]hh("jo# %Ph))"hdf2= j4fWVt$|$ VWx t$?/tWhc)"[Vh|)"[^_WhN)"j" fWVt$ |$7 WVUSWV $$l$WVSU$ $ hU3Wh?$5 uWVh4*"j" D$@tY$$QPh&hVZV$$$$$h#:j3USWVMu1} ]hD$ PV D$ FxD$D$D$D$D$h#WSvG L~)Hw;$&5<;Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5<;L$1@D$kjuh܇&5<;AP@=N|45<;ۮ1@D$5<;Fp1@D$5<;L$ 1@D$_2H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ N~tuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ W賻Wj@$N|dže^_[]hh("jg t$hh1$Ph#hdf29 j0WVPt$jWV 9u9t x^_Vt$h*"j Vt$V;Ht@^hu"V^Vt$V7Mt@^hw$V|^WVPt$jWVa 9t9u x^_Vh*"jL WVt$|$ VW+t t$?/tWhc)"VVh|)"V^_WhN)"j3 fWVt$ |$7 WV1^_USWVp|$o$o\$WVUS$$jHSuWh$1 uI* 8KD$  =8v5%D$ Vt$S jHSt$D$@D$ $p QPh&hVUD$tS\$O$oj j ShWt$ P>1tPq@Ph(#Ut$ SWh8#5t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@hW#`581p^_[]WVh4*"j j+.SWV\$D$@u+t$$t;SP t7Vd]1 u5Cu5C^_[hp"j& j-USWVPL$$T$ l$\$1$1 2֍zh>#USA @~7W$&OӃ23=4v58v5먀'룋 <;DF@N@늋 <;IF(NnOe <;R2KF ? 20O' <;aF8N 0v5O <;gfP{D$ p4t$ N @OPt$(hd&5<;:Ƌ$t 0v5t'tOt@tOsO t=4v58v5 s=8v54v5g@tOy  2sg st1A T$ J shu"VH8 <;wF N" <;xF0N=8v5uc4v5gu\5_2)uOht|$0W t$,tWD$(0t$(^_[]hh("jn Bh#j- SWVP׉Ήj SQ  9u ~^_[WVh#j h#h#hw#hG#h#Ph#hdf21 j(fWVt$|$ VWl t$?/tWhc)"DOVh|)"6O^_WhN)"j fD$Htu L$fHQh#jH SWVP\$$CxP CjjpT 1Ox\ƉC@HtuMKfHjPjjV(ppV ujt$ t$ Vlj^_[Qh#j WVt$F1GyiD$ PWQ 9ujt$ t$ vX 1H^_fUSWVl$\$|$USW 1IL$$fG1AAAAAAAAA,v5B,v5ʉQċT$0Aȋt$,AˉYЋD$(͉iԋ\$ ˉY؃č^<RSh(PQhx Wt5v%NɅuNɅt(Qh #h#D- H1I^_[])V$o$$$ɉȉFFF D$pjPjVjjhR w2s0nPh#h^", QH1HD$pȁ^USWVt$\$l$ |$$WUSVt$$1N|I; ,v5u=OɃu3_˅t( 80Sh>#h#+Ɖ^_[]VD$L$ T$r؉1Jf^USWV D$jlj1111ɉD$ظ $}`|$Ӌ$$Pt$t$@t$@t$0T$D&8j趮|$ $ىNjD$)щ|$뎸9D$,,$Pt$,t$(T$0 t$||u3jA)9}hz݃D$,|%L$,9QPhc#hF#*K<1H ^_[]fUSWVd$xj[Vhv5 j@Vt4$Fj:V$A $$|1D$hhhhh hh(K H|$WPh$V5tP4PVh#I #CD$D$ @4$D$ UhD$PX D$,$Uj$lS V9rȉ$`WVS jD$PW$lPjt$hD$(P t.2,$AuU=8v5uLD$D$ 1@D$x $t)ɋ,$t;|$ hl#ZH1@v5$Dv5,$  tD$f@1ɺ,$uwщfPʅtL$SʉQS ʉQ SffQ@f;CuUfҸtP=r fAf‹ $Dsu|$1^_[]USWVM ]ED$ \$b#t!؃ut$V轛T$}RƸ9rGhjP LABLGˉ_ ffGGVt$PY uur12wȉfOe^_[]ËL$”19v f39rËL$D$”19v f39rfUSWV\$t$pD$0w55h#P !uCt h#PuO w5= w5D$#tD$#1MD$,D$(D$$1D$D$<$\$t$SW# P4E1A$d&=<;h"WxhI#Wb<$t=<;W+@,<;1#PPhPPVv5Yjj5<; D$,9<;1#PPhPjv5 = w5=<;jhv5h$2WP <;1#PPhPj$w5<;1#PPhPhov5r<;v5a1@D$(S<;1$PPhPj%v5(<;1#PPjcPPh2=<;hw$Whu"W w5w5=w5w5= w5=<;yW$@<;1#PPhPj?(w5B<;1#PPhPjp21Ghdf2Wj>h@#q=w5<$=<;h$Wuw5G=<;1V#PPjPPd21@D$$<;1S"PPjPPjw5m<;1#PPhPh< w5P9<;1#PPhPj,w5 =<;=v5j:WdAj/WQ.?yw5<;빻#l$0UU݋\$UW|$Pv 4w50w5sm2DH,WID$hsR$Wh%Wv5W w5N16#PPhPj l2,w5 m2DHW赆D$<$v5h0#_2=d2_=w5tVh#z5<;h"#j5<;h#Zh`#Phh("j. Wh #9Wh#.D$ =w5u1= w5@w5$1󫍄$Bv5Al$$+D$ - w5t1$ 1D$$$MljL$$ PWi?t$h# w5l$Ul$RQP $׉ȉ 0w5=4w51| h#$t/$$T$9‰sQt$t$WPh#tFtA w5WPU u54w550w5t$h#|$(F=$PU$j uRt$h*#ޏ A#$=`h8w5h#1=w5 $VhPu Vh>#al$VjD$P 0w5- w5-4w5݃=w5~VUWt$hX# |>9|Pt$t$ )̓ }4$3\$l$ v5v5ɋ|$  v5=w5 4w550w5σ|,@σ|1ҿ9  w59|щ v5|$ D=w5Ejjh8w5x .h8w5h>#v5=w5tv5w5t&hQh#=* w5v5t=|hPh#* =v5u1=v51@v5=(w5u v5(w5=h2,=v5t#jhg#h?#h4#)v5=$w5u=d2v5$w5t$t$ t$4Ut$$Vt$t 9t V t U = w59$PtEntƃh# Hj vPh#jd$ P9 j jx jn h$q <{5$ w50w5ApQtv5@jxQP$Ph#1 gP0yVh#jd$ P$\ $|$8jU$Pwe $PS>u/jZ$P$dP` u$<mfsjWV 9uD$8%PJP$Ph#h#|$D$D$4jP+ $u/h8w5hQ#$Phv#jX h"j /dev38w5 dž,<tx(=w5dž dž,dž(Ɔ l2p2u(jh#=w5-5D{5u"jh#=w5,5D{5 v5N0v5F4Qt$Qh#o=w5w,5D{5F4Ht$Ph#D=w5S,5D{5F4 w59}"QPh0# =w5+,5D{5F0=)hPh^# =w5+5D{5F0=|)hPh# =w5+5D{5F0N49}QPh# =w5+v5D{5;v5|QUUUU)ʹ3333!!сis{09\~\{0\\5v5sXș9}%CX=w5~Qh#D{5sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$h#=w5**D{5{4$= w511F9tA uPh[#j $Kd=4w550w5 u։<8=d2[ WVhH#@ =w5)D{5<$C4$8= w5`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQP^Njs8ƒPVRW)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh|#=w5',w5tm D{5yxH1҉$q1ҋ8$$)$<$$1C$I8$ (w5=D{5_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W91C1 t׉Ë$$QPV$$V%`9s($$$VÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRP^ƒ$$$$$$׋$$$RPVQ]$9wȃr$9‹$֋$r‰$$$$$B1WRQPË$Ë$ʃQPRS})ÍC4$$W$$P$Q\@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQ覽j$P$$[@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh#V =w5 D{5B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d2$_|HL!ʉG41SSjhjPSi_T{5N D{5I4QSP赫 D{5H X{5 T{5 \{5P44Q5`{5щ d{5`@#HL 9| Hh h2H< v5HX $w5H\ v5PTXH fǀ$l%=D{5O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d25O _(HLJ$w5$$$t!LJ^F=w5$$߬$$ڌ$%ݔ$ɊOd t1G0 T$D$\$t$ED$\$$# D{5$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$#=D{5O0 9| IУh{5l{5= w5u\Tu))Уl{51VVjhjPV,[p{5uh{59l{5l{55l{5jPi =w5G4w5 0w51ظ|(RQh:# =w54w5 0w55p{55 w5~ ș)dہ|4&GuȹC=w5tL1$PP$$5v5V1= w5VhZN w51u;1$VhjVu  =p{55D{5h`VWJ =w5tWV5D{5x\p{5hhP躥 1@$=w5h#H=w5|o5D{5N,I\Tt~!NȃN׊Nd1 t1WPh΢#RRU$f29u1H$Whht@P襤 PPftu!ѡw5t $ Q$=w5u$|&D{5H,$$DŽ$%$ D{5I,$1$ DŽ$1h f2虆D{5$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ h#RF=w5Y D{5j5H{5٢ 5H{5FU $F +$^D{5$~J`^p=d2uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=w5uFh$ NlK`ڍOȃ$ډFd;v&h#D=w5D{55H{5F $11ہ~U uv`щSAD{5$~!ـ1@ H{5Il D{55H{5F=d2Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5H{5N uҋD{5B8H!tk)D4D{5B8)Nj5H{5$9sE)ȉـ1B~U uv`5H{5F$CHu͋D{5B8$؋N9ȉ$J`~U uv`щSD{5$~!ـ1@ H{5Il D{55H{5F=d2Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45H{5;Vs2р1@~U uv`5H{5F$BɋD{5$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$\{5H \{5V$P V PV~x; `{5up=w5td{5s4PP D{5X{5@X{5Kd15d{5s4d{5\{5 D{5q4jPx D{55H{5{0 9 p{5PVQ蒛 =w5tp{55D{5P5H{5g D{5y0p{5$ryxtG$\x%TuCl$AP$ D{5Ou$ց\TtQ!QЃyId t15p{55h{53 5D{5\TG~8^xN`1?9'l{5+$~0lj$Ɖ$)ى$=p{5$e%Glp{5l{59wߋ$9w$D{5$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=w5} $H$$$~A=w52$=|j.=扄$d"t $ D{5ׁ\TtQ!QЃYId t1RP$VhR#$$;$$|W=w59D{5H,t =w5 $$ DŽ$j ?DŽ$CD{5;X,/$~ j =w5 $hjP= d2 w5+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A$h $ld2fDŽ$2tt2$_ lj$DŽ$D{5H4$ $ H5D{5D@VL!! $`Nd8 fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t2@ lj$DŽ$ D{5H4$ $l$h  5D{5D@~L!! $߉$Nd t1$Sv4$j2D{5@0p9w Au1H$$DŽ$1$$tO8 ǡw5D{5@05w5V$SQP$h$l w5ɉ$$$t RPN5$CPKT$l$hߍ$󥃼$$tA$ȃ=w5CX$tFDŽ$PQ418$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$24$pthj$P覒 D{5\T$$i$$ $$$$DŽ$H0$$_$ D{5@$D$@L!! $`$h $l$  D{5Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h D{5@$D$ @L!! $$$ $$h$lD{5Hd t1$S6j$$V D{5$ȔȐG$11F$t = w5$$=D{540=d20w4w+_1p{5$`SWPʏ $PjSa =w5t$W\=w5tp{5ǀ\8 D{5=p{5x\hhP w5QPڝWV=w5tT{5 D{5q4PP׸ 5D{5HLNd t15T{5v4t5d{595\{5vG=w5tD{5p4VVx 5d{5X{5@X{5=D{5Od1Vw45l{55p{5vD{5@4P5T{5]e^_[]ÿWjV 1= w5VW\h"LBhy#0j& j%j(<{5j jj'jh[#Lhs#Bjjjjjjjjjjj USWV=w5ua΋\$= w5t w5<{5St$P@ 4׋ w5UPSt$$5P{5褱 9u^_[]0`PWVh4# j$USWV"=w5΅ t{5uD{5H4H h{5 t{5 = w5;0w54w5D{5;}FWh &1I!;HtG#P;Pt;H uV9R_1ڍ_5p{5P= w5Wh De^_[]USWV΋L$l$= w5t=w5teUjQp׋ w5SPUt$$5L{5 9t?00PWVh#Yj"? w5<{5UPQ> ^_[]SI`wD$$&1C:Qh#hdf2 .  [SWV1ۃ=w5։ SjQ =d2@fF F)f ^_[USWV Ӊϋ5D{5F Nd t15H{5G=w5tH{55D{5PP跳 H{5yU +y/\$|$y1U =D{51=U L$D$uq`|$ G`Ӊ $u щw*l$$Б&р4l$skPh#hdf2+ =D{5H{5D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah}# h-#hW#d+11҉ ^_[]ÉՁ|$U u L$I` L$w$&ʉـ1@BPh#hdf21 8ʍ 6ʍ   1$5D{5$~3%)1@ H{5Il 5D{5H{5K=T{5Od$sC=d2CNdЋT$ t1҉t$VQPR谕{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRL$|$ щT$ՉD$ȋL$D$VW|$RPrыt$ʋL$Vt$QRP誔$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45D{5;F8|$}X1Bσ) H{5yU uI`1@5D{5;F8|$|=w5tH{5VPP 5D{5F Nd t15H{5USWV$΋=D{5G Od t15H{5=w5tH{55D{5PP胮 H{5xU t)h}#j'=w5(H{5xU ‹l$(H $t@\$=w5tH{55D{5PP =D{5G Od t15H{5wD{5T{5HC, $9r%UQh# =w5VD{5 $\D$jT$RPQ0D$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5p{5WD{5\Tudp{5jpxt$0t$  $<=w5WV1L(ɉL(@ u1LXɉLX@ul$p{5jpxt$0t$ $,;=w5trUV胪1tttp"TtDpC u1"Cu) % $D l$hVUk % $D9Pl$D{5T$5p{5p0^_[]j[j TWV։σ=d2ȃ@PQR =w5t'ȉGffF=d2u GffF^_fUSWV$8tW虮 ƅuWh8"j $$<$4D$Phd@U tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h$t$M 1 Sh8"U CPhB9"U C Ph9"U CPh9"U CPh&9"Uu CK,C,Qh99"U] C0PhN9"UK $@D$t P 1-Uhzd@$<W~ t1 VhedAWh~ hjU~ D$ P$4 D$, 9L$cL$9u0$S11:膚8tx$0h8"Gb$11҉ $ƅ*ŰPhj PU ^_[]$0h8"jy USWV81ۍD$4ShPSu1NtAljSPSWuW^ uMU D$t$$$Q1e^_[]fWVt$|$ VW t$?/tWhc)"TVh|)"F^_WhN)"j質 fUSWV|$$\$(SWt$(t$(譼 )jj`SW)~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jV| 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^#ljt$1={5 |$u ={5{5)j5{55{55{5gף{5{51҉|`$$P$T u$$j5{5QP $׉ȉ {5={51| h#$t.$$$9‰sQt$t$ WPh#qt$Vj$u Vh># {5{5%{5ʼn߃={5~VWUt$hX#|>9|Pt$t$ )σ}4$ |{5-x{5uU-|{5uY5{5={5{5@19lj| 19ǃ| |{5u x{5͋5{5={5{5ˉjURP臀={5l$ {5uA@19lj$ $t$u h{5h#jPVWv|$wext23$2fs3$ WhA%"h{5h&Vh{5h`#} 19ǃ} h# {5t$VUt$  U蚑 t 9t V舑 jUSWVӉ $譌|$j W\$ S Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph3"1L$8ɉ׉u L$8t 1@׉׉|$l$ Ћ8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h3"3QPWUt$t$h3" QPWUt$t$h&4" t$t$h3"j蟜 WV6df2Ph#VW 1GVWjh4"#LVh&RW,USWVu} D$8jPN=5555|{5%UUUU)3333!!щ%ix{5B{59922T$u tv|$΍Q5555 5VT$ 55ډ5P…Ƅ!) 51f1ҁ‰t$$r={5{5\$9D$ ̅5T$51t$$ËT$ u׍؉)9H1D$ 1{5 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ{55552t$ƺQ=ą5D$ȅ5D$ Ѕ55D$551 555D$8555S555N55555[ 5f5Ǡ f55 2f5\$H$SW 93rWh5" 5{5|$t"VzYjVh 5Bl 1055t5p55D$5 5+ 5 1҃r1I155~σRVPW55H19w+5ȅ5|$OL$)9r΅u 5f5v55|{55ȅ5V؅5YVjPi GD$AD$ 11L$\$55tn 5tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& ȅ5@5t v5 ȅ5@ ؅51H؅5L2 ؅5D1\$;|$t5)á؅5f\0 ؅5D1 5u\$fT1 ؅5T1fD1L$ G;|$tD$ 5|$11t$55={5~i |{5 i{5x{5Q5{55{5PRuh#f 5 |{555PQWh2#?ȅ5@5܅51QQjhjPQ5I 5܅5jPfg ={5uk{5 {51! V5{5 1N1Ƀ *,%Fu  1@D$$={5|>hy#% ={5|(L$ 5 51PQh΢#PPثD$$f29u1H|$LWhht@P.f PPftu!ыt${5tL$QT$={5uL$L$D$ 1D$L$ 11T$h f2ZH=5t$tX 5tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f55515 55D$ hh5Pe 55ą5P5؅5Vt$e =5=5 515{5ǡ܅5)؉1t$ P =5Wjh5d ą5H9|$u_555 5)ʍZ9s1Gр5B9r)5VhP|d t$ 1Ƀr!11ƃ5Cω 9rωp 9ǿs"ˀ5CI 9rޡ؅5L$  51Ҹ5Pt$ 55Vj5Pc 5 5L$)QhPc u15@ u؅5L$ D 51Ҿ5Vt$# 55jVKc =Ѕ5tb1=̅5t 12ýH5F;5̅5r؅5L$ D 51h555 G;=Ѕ5r={5t$|\tX=5te 5t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A={5|$T$T$|ʉj.ݧt$몸d"|$|$t $ 5 5jQt$,PhR#pT$;D$_={5* ą5t={5u&D$ D$D$j A1h" ~ j ={5d=515$hjV-a fF쀁fFD$8FFF fF55 ׉؉t$ ֍$fBt  5$,F܉VDF81 L$ F4D$4z 51CL$ =5W˾D$(\W趾D$S5ȅ5tPjt$0 ` v5 9`L$97|$0N5L$,ʋL$(T$ą51GL$ T$D$  5D$5D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP^ L$ D$1t$V 51CL$ \$v5 ȅ5=5t$,9sD$()QjP^ t$iL$ D$41ҋt$(VW'VD$Yj=5t5t 222@1=5à r t$hhjV] fFAƭfF5ÉFD$8FFF蕓 5fFfFV 5AFmlj\$r*D$p1ۋ 51zC9uߊ 51h55555f52|$D$1ۉt$ 2x1ɉt$)r5RQP\ Wh25V] 25D$ f5 51Vt$ \9\$t552D$ CiL$T 1VhVD$pPQ\ 955t5t222fD$TAfD$V2ƉD$XD$8D$\D$`D$dё fD$lfD$n 51@D$pAD$| 51h555iL$Tj f51ۃ=5 55<hh5W[ 55ą5P5؅5V[ 55 515{5ơ܅5)؉1WP5܅555Ze^_[]h~#hV# #h#P`h[#Ph~#h#Vh*#RhR#PRh}#hVh#hVh#RVh#Wh9#VPhs#hX#vjVWt$hw#gh#`h#Yhy#Rh#KRQhi#B#1#'h~#h#"h~#h#h~#h# h~#h%#j} USWVЅ5=5tr 5tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(ȅ5Ѓ5t v5 ȅ5Ѓ^_[]SWV={5u0׉΋ {5\$QPSt$ 55~ 9u^_[WVhS#h3#jƆ USWV={5΁ 6u=51 5 6{511;{5-{5ǡ|{559v@1ShX&8!;HtH#P;Pt1A xVWhH6h#p h# hdf2T"܇71B 77@܇777ć77ȇ777 7 uCءȇ77ć77 7 77 77 ؉+7ć7D$HT$Ll$H7+ȇ7D$8D$85%v?|$ D$ fD$l$\$4l$ D$4Ӊ 77X%wh6 77 7777ʚ; 776eĉ711ۋ77D$T$ ؋7ć7D$7D$ȇ7D$57L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05%X%t$v 7757=7|$(t$(|$D$ fD$ l$ \$,l$|$,=7ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă57 7=76t 1A6y7\6 X69}(7i-@=B'6@9u7e^_[]h#h #j8j USWVhЇ7jm 06%\$Du{'-Ї7؇7D$hD$h5%\$Dݜ$݄$h7j u{(-7ȇ7D$dD$d5%݄$\$D܇7;6D$D7 7 t]+ 7ć7$$߬$7+ȇ7D$\D$\5%`%s=7uZ6tQ7 7 t5+ 7ć7L$xD$|l$x7+ȇ7D$XD$X5%wD$DD$D76 %w١ć7 7 t>+ 77$$߬$ȇ7+7D$`D$`5%D$Dw\$86$fDŽ$jh7jX D$8 %|$&D$& fD$Bl$B\$Tl$&t$Tj$PY SD$lD$lPD$,Pj5`65d656X <h7jZ d6D$8<BC97)؉D$D$8 T$&\$A9h7I؉L$A ܇7Iff9u7ȇ7X7ć7T77P7`7 d7uȇ7h7ć7d77`776 1D$1\T8 GT8l1A h#hdf2A6<1A t$,9 PVh#*~ ΍T$(jt$>Ph#}D$ 6t$؉T$΍T$(jt$F$ܖ&h#΍T$(jt$JhD#N}΍T$(jt$bF$̖&hR#΍T$(jt$$Fft$NfQPh#| ΍T$(jt$؉t$h#΍T$(jt$^؉t$h#v΍T$(jt$z0FT_h0#G΍T$(jt$9FPh#΍T$(jt$ ؉t$h#΍T$(jt$؉t$h#΍T$(jt$d؉t$h#΍T$(jt$9؉t$hB%T΍T$(jt$X؉t$h#)΍T$(jt$-؉t$h#zhF#zPhd#zL$lL$AQ D$iPh#zhc# hq#h#gzNh7h#Mzt$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ7#L$dT$C;$7u#Ph(7QD$XL$$ D$L$7PQh(793 T$Ҹ7#u1G8#T$PNyL$r |$ rIf2H f2~ f2H f2 h f2j 2~(  }T$A{^N2D$ˀ) h=#xuPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPhB#)xh!#x9 |$ sSf2H f2~ f2H f2 h f2j |  }KF߉Ήs(T$h)#swL$T$؅t%f2H f2~ f2H f2 1I h f2j R|h f2ء7;6*؅tء6!^L$AQ T$Q=T7 P7 t+)|$L$p|$tl$pX7)ЉD$PD$P5%p7p7x7x72v27v7\$CfK%7f!t7 7T$ .KfKf7D$ 7@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$J7@)t2(uK 76t1 7h;# 7 6 PVh#t Ph#h#h#h#AfPh#h-#hA#hY#hr#h#h#h#h#h#wh#mh #c 7hf#&t1BD$D$pf2@)f~\6tSωL$!ȹT$V!RPt$ h#sT$ D$,6t1RT$D$fxf526ruTt$,m L$IfɋT$8RD$4\$T$T$$T$ $L$D$41BX6C9D$=6 ؉T$5\6|$76)RQP\ GD$9L$~D$8:6uG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E5\6)6t$>RQPh#3r\6;X6}0u hv)$rPhu#rCы\$1B\$D$\$D$T$jh#j Y 1Ah=!WVbG87~b 77 f2Qf2; $f2h f2j.v7 f2Q f2.H 7by`) 77 f2Qf2; $f2h f2j/v7 f2Q f2H 7|tN= 7t4f2H f2~ f2H f2 h f2j u 77h f2G hdf2: 77ć77ȇ7 7F8^_jj:1A1=7PiUSWV׉E\$1AM6]E uWVhW#ot hu#oSh{#o6t5@D$ %\$D$$#yo6fyuhdf2je^_[]UVh1AtD$H6$#%o܇7D$$#o7D$$#n7tD$$#n܇7t9+ 7} $#!L$LD$L %D$Ht$H\$$#n$ m 76 7L$DD$D=p7@|-x7% 2 7\$,D$(\$ D$\$D$\$D$$$#m6T7 P7 t5+ `7d7L$XD$\l$XX7+h7D$@D$@5%7 7 t7+ 77L$PD$Tl$P7+7D$L> QPh#l6tkD>L> QPh@#F|>uGD>6ufPhv#j"L> ffPQha#hj ^_[WV6u8jjV蚮 t'86: PWh#hh7h"6 Ph $hh7h^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h#V $t$t$ t$SPh#ui UPh#[i t$t$t$ h#Bit$6 Ph#(it$  Ph͹#ir0G9s'GPhz"h| KG9r߃$^_[]fUSWVƀ8-uFhƓ"V6u 7h"V61u 7T$,11CD$D$h#Rt$0mu Hw؉$&\$̃duE뻁뱀=7t\랉\$떁댁낃u1 _21;L$(uj1L$ 1ɉT$Љ $P1L$Au $APGD$t2ڋL$ PWL W0f uމ$DxpuY|$uj3 Džu%_ P{}/#t8=7uIj VhƓ"B Wh#T1FVPh $VM SUB h"=7Mj Vh" Wh#V \$d"#!'#VWS苪 jjVWS}\$u> 1GWW0Wj0Wj0Wj0WV0Wj 0VW? u h)#jM jj? uk;6#8j uj= j j jW? t)qtOQ j j0? u;L#8t1Aj jh"裧 ukWh#jhb#لt$U@ #Q:0WW> #td"V PSh7$WK SWh#j+AVj%=7ud"VPh#hdf2efj[]fD$tPhj#%]hl&Ph~#hdf2(fj]USWVPu } hl&WV'q cR~5StET 7͍Hw4$X&ܑ7벃Lؑ77둃ftTdL Б7t7e7V7G78ԑ7) _2x7=7tjjh$< 7ND$ jjj"M 7jL$$Qh@hP\ u h%7i )ލ<S H $|&=ԑ7t1Aj D$<1CPSD$D$ PS҃D$D$$PS軃D$D$(PS褃D$ D$,PS荃D$D$0PSvD$D$4PS_D$8|$ |$z |$o |$ d |$Y |$N F  7D$8gtj57< rD$ D$d"D$D$d"_;-7SL t.H$1ۃ=7uWh#h#ho$蜀 >h%S.g =7uh#h#ho$_ 1C7FLCSS H3 VT$W$& \$@1ɍP$t&(71A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 1207#7L$L$# 1AD$ PD$@PD$ D$<+7R D$ Pj$ 72 72 72 77׋t$#D$ Pj7d$zT$ ED$ L$TL$@JL$C 7"2-L$#d$d$d$L$׋t$87:P7@.X7"@7H7 `7\$ p777 t 7t 71SSP*w L$Y\=ԑ7j$)/jD$D$ D$d"D$d"7L$9a|$u q7 7ta|$  ‰4 D$=7T$tD$1@D$ 11ۉD$01hxShx7 atgcuL${7 7z7 7@ 77777 7 p7 7tJt$(~A|t17t|$ ObT77tPt$ tH@WVh7 7=7t=7u#7tMD$tH@Vt$ W@ =7t=7uL$#7tDD$(tIAVPW =7t=7uL$(#{7tDD$,tIAVPW =7t=7uL$,#.7tDD$4tIAVPWW =7t=7uL$4$#7 tDD$0tIAVPW  =7t=7uL$01#x7)f=x7=7tP=7uG=7t4f2H f2~ f2H f2 h f2j K^x71=Б7IWhx757 1 u+.87t.t)7|$t+u-#/9|$Ph#!#|$# PњPh#Ox7.83u= 7t".1ۃ8= 71ۀ?D$#1D$hPQjːPVhZ#Qy PVhL#zE Q>PSVhi#_Eh f2"^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV誄+D$  P\1PPWSjVr|$dt$ \$hr#m D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy92tE2P{y$L$t h#h#QQhuF%PPh#C C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lPr=#PPha#07^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh07ShF#hh07\>07[SWV$L$4D$1G&t$"tZ@:t9rD$Ph#o?,^_[SWV|$t^D$uFD$jjP蘃 t1Nj0j.Vt@h)7P0 u7ut$ K$hVh07+ 07^_[VD$L$ 1Ҁ0QRRhh07VP : thhB%h07 07^Au yuyt$Qtu ȃPO QG APhj#hh07<07SWVD$07Q4P#R+74P#R,7ƄR-7.r|I Vh $jv =D71t <7` ,71QRRP5(75<7n A ;3D$jPj- u/h#>1AFL$ t4u4D$%  1QRQPh# 4gV轐 YUSWV։ϳh0"VW@ tu=@7<;@7Ӄau1ʃut-_2)t+ta=@7uX <7tpE9ujf,u65@7t$h3g#Vmth#V[u91AGƿdf2Ph#W5 Vh-#W5 j+WVƿdf2Ph;$W4 Vhx$W4 Vh$W4 Vh$W4 Vh$W4 Vh$W4 Vh$W4 Vh$Ws4 Vh<$Wd4 jZ+USWV|׉΍l$|QhU\; PUwxsD$tVhC#QD$tVhh#Q=$7u 47tL$|=47t@$71C=07u WUj* yVh $1ۉ؁|^_[]j*SWVΉQhS: t!1G=07u%5<7Sj0* yVh $~1^_[USWV 1t$ >WWVWh|& u;D$ D$ PHWWVD$Ph|& tt$9YĨ ^_[]h $t$  tԉ1|$l$Vh$PVSPHt$t$Wh|dD$P \$tN1D$;D$ 2i9t$sVt$St!ʼnD$t$Wh|dt$B ul$$WhedAP' f$a$>ukSt$h(2"hx\%h$W[.Ƅ$t<75 $ 9$t蓰$QPWt/ $Kà9Éu|$$P 1h $j Å~A1ۉh "PujVh(2"h7$h$W-Ƅ$|$t<7\ $ 9$t躯$QPW. C;\$ mUV|$l$|$$PUSWV R uj7'D$$D$<$shY$V-th$V3hU7 Ƅ$h$sut s h$V7tt s h\$V~7t P< <7D$ hf$VU7tHá@7th3g#PX(j,StZ S ,PD$PUrxD$!=`ÉUh $  SˬDž?tG<$tSWUh$h "%h$V5+V tEUh$JLZhp$8L?Uh$h%h$P*15@7t$% }eD$ |$< $ T$7jj hd"PQjR D$\$ T$2jj hd"PQjR a)؉L$ T$Ojj hd"QPjR -D$,\$xL$L$|l$xt$p|$tl$p %$L$sL$L$VL$L$[L$D$ D$dD$\$D$$$$|$SWQPD$D$ SWPVt$$Pt$hP$)$a<$ |$<t$T$7jj hd"QPjR 9\$؋|$ T$2jj hd"PQjRu )t$ \$Ojj hd"VPjSA SD$6PD$?Phg$2D$L$,PQ D$$#D$<T$T$SRQPD$D$L$ St$ PQ_+|$t$$ St$ VW>L$$QPQt$ Qt$0h$"t$ $ t$,t$ \$WSPQD$D$t$ WSPQ $)T$T$D$( WSRQ$L$$߬$ $$L$$߬$ %$L$,L$ L$dL$L$LL$L$@L$\$D$D$$$$!$D$ PJ1Ge^_[]h?"j h!hx$USWV $ $ h $VW. fu H7t R1ы _29<$$\$PhV* &$UV] tJD$PUft>D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h&$h$S\$ =H7uD$+#D$ P$Pw 8\$t$Ph0$H7PU uUh $֢1@$~#Qh $Q?1@$\$$$Ĕ ^_[]$Ph $j OPh;$hdf2! jUSWV L$L7$T$t-P7*jhL7 P7šL7$T$1i E$48t!u6$t$PT$ uF$t$PT$ tEM<ǃ hU#股1 ^_[]ËD$ t 0L7$4$݋D$ t 0L7$$ؾT7PhhT7' uhT7h $j6 fVD$t.})zhQ8h\$57 lI8T $%&PQh7$57w2#u57h#覺 lI8^ËD$ H^WVθ%&PVHt)uVh$57 lI8SGt8tPwh$Z wh$Huj whQ8 GQ8Q8^_WVD$ t;5Q8D$=(7 7u (7&;pt8@uVh~$jz @u=(R8th(R8Ph$襀 Ph$蕀u5Q8=(7^_Ã|$t $ilI8Ã|$t %HlI8Ã|$t $r'lI8Ã|$uhR8h$57 lI8Ã|$uhQ8h$57R űlI8Ã|$uhQ8h$57! 蔱lI8SWV$$DŽ$HH$pƋ$ ƒtS!=XI8E$t@$;$atσ=dI8 =hI8 PSj $;rtr1Auu($$h$$PQ te$P$$h/$PQu t8$(1;BQPVW'V1B.lI8^_[USWVx֋$$t{tp11@=m2D_t1z\t r9΅t<΄t45m2AҀ|Vy5m2TVP5m2@u΋$ $t`1HhI8trʄt<$1ۊpI8t8tCu 9sI8B+$=FFu4$D$|$ 1 I8$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ M8<$؉D$M8$to\[$uvz$\$-m2BDEJ<0HB,t ]tVрy$t[m2BDC$G)=~"B $tG)=BJB5Am2<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$57h$莲 <$?uhVWq x^_[]USWV0$Du%$H$DhJ$PQ\ y1E-Z8h*j0UhX7蜘 t$H4$=7I1VV$P Í|$0;=7=Z8$H5hI85dI85`I8s =XI8E$t@$9ƒ=7RPSQ7y=Z8uE=7t<77$HctZ87 Z8VV$P Å 4$jZ8ЩlI80^_[]Ã$D|Ã=7t=7;1 T$󫋄$HRjh4 |$D$=7ʉǃ=Z8$H[L$05hI85dI8j =XI8E$t@$9Ã=7VPRQw=Z8u9=7t0577$H1tZ857G=7-=Z8$H$HL$05hI85dI8j ƃ=XI8E$t@$$H9=7PVRQv=Z8u_=7tV=77$H1tZ8=7$$H4hV$0D$PU E;$Dnj=7t#7@=u1Hjh"P jhX7ݔ WV=Z8t@=7t757= 87 8157= 8u Z8^_USWV1@=7S= 8Fϻ4$ͅtUShB$5757ͫt$PhVhe2xdm2L$DH?u"t5 7RPh<$Q07#57jj6h$m071lI8^_h_$h7t$t$ lI8hh$h$7t$t$lI8WVD$ tZ}UuZt$~h!WpCtOh"W^CtBWy7vh$57 J1H_1=71@17 71Ҿ"t! щ 7PVh$57x1=7lI8^_ËD$uD$L$h$PQ tvD$ph$gu<=lI8u0=(7t57h$> D$ph$Vgu+LR8xV8xZ8.lI8VD$ L$lI8t u]H 7HQ*tsP t8c=xR87t5hxR8h $P; lI8(^飘Vh$[Pjj$h%$Vk*^ËD$tIDuD$L$h/$PQS t$D$phJ$7fuLR8 lI8SWVD$-uD$L$h$PQ  1G=Z8h*jĴWhX70 t D$1VVt$H ǀ?tx=Z8tyD$thWhJ$deu LR8=Z8uB=7t9=77D$btZ8=7 Z8VVt$ DžaSj߳Z8ԖlI8^_[ËD$uD$L$hR$PQ tmD$_D$L$h\$PQ tI|$BD$phd$]du8D$phl$DduLR8Ãt(lI8USWVt$ |$.E1ۈ$57jj,ht$$% u v1.褔lI8^_[]lI8USWV D$ #D$$L$ h$PQ[ L$ ȃ#D$$L$ h$$PQ1 D$ L$$|<$Dhr=#t$t3$8|t+4$$H$$ 3D$$h$0WD$1E-Z8h*j菰UhX7 t D$$\t$=Z81D$ H9=7""t"$9t$tT#T$$VVP4t$Q̀Z8u?=7t677D$$" Z8tA Z87E_t$j讯Z8$9t4$$葒lI8 ^_[]SWV$tKjjY[atK~Sk 9uWj01uh$~1HlI8^_[þV Fujjh6#" ~$tj/V t@hQW肶 =7t857Vj 7HQP~ Q Pj 1|j5,I8hZ"WV5R  jWV'R Vh$}lI8jSWVPD$D$t&D$t$h $PV rlI8^_[ËD$ph $^u|$h $\ tD$x|$Wh' $~^WPjWk uP|$h/ $ t D$x |$Wh9 $+^WDPjW 1ۃuM|$ Àu*D$p Vh9 $]VPjVز 757hA $聖 D$lI8=xZ8t =xV8u.=xV8t#hxV8hv $57 lI857jj%hP $蛏ËD$lI8=xR8u=xR8t#hxR8h $57t lI857jj$h%$2ËD$uD$L$h $PQ蠺 teD$ph $\u<=lI8u0=(7t57h $+ D$ph $C\uLR8,lI8ËD$uD$L$h $PQ teD$ph $[u<=lI8u0=(7t57h $联 D$ph $[uLR8肍lI8ËD$t8uD$L$h $PQY tD$L$QPhd" 2lI8USWVh$Vܱ $|F$$h1Gh4Vs 9}hh $Vs G9$uVh $Zu j5(7(7uhs $YD$ ph} $Y5(7^VD$t$5(7(7u h $X%ȊlI8D$ ph $X5(7^Ã|$u|$t荊lI8Ã=7t 1PP)jW=7t 1PP j|$u|$t4lI8Ã=7th $X鏽V1VVcV}VPD$ D$t}uD$p*ӉlI8h $W#t+h %W#t h $W~#u7 1Cvtt7u7Xz1H!7P57h $571lI8^_[VD$ L$lI8ʃuCuD<"2tKD"2Vd"tQPj h$57Zu^yjpp lI8^WV|$ W`tQƋ|$@tPq FWծF=(7t3|$t,P6h1$57Wh$57 ^_WV|$D$ lI8uIwЈtAƋ@tP F6hH$57\ lI8^_xwh$573 ^_V|$t.=TR8t65(7(7h$~F5(7(oxlI857jj,hY$x^VD$Hr8xlI8`=\R8t$5(7(7u(h$F-57jj,h$NxD$ ph$E5(7^VD$u5=TR8t=T$ 5(7(7Ju:Qh$E;wlI8057jj,h$wrQh$ME 5(7^fUSWV@$(@u$,@tw~!$,@$(@h $PQ tӋ=7~+$,@X1Z8j US购 t F9u19u2$,@ph$57# lI8@^_[]ÍD$h@h7PG Z8D$@1ɽ $L$99` m2OGGDA@u7ȃ$t \u_GGY m2WDQuViuAG;$(@}/$,@ 8)Q4V譚 $,@41@$F?tG|1ۍҍBWGDQu苄$(@9|ˋ$,@ 8)QtV= $,@tz踅t70tƃu57h $'57h $~ t;=7u257h ${ lI8D$@9G=(7t<57h7{ 7HQP~ Q Pj Rj 6\$SQ t7t705 8V = 8t'~t!7HQP;H~EQh@D$Ph7 胄 8$(@t7$,@Pj븃<$JE1A;$(@t4fUSWV1$D$jh7a t%=7t 1PPI<$~KD$@$AhjhhZj Y<$t(=7t$t 1PP$^_[]Ë|$ \$1D$9}ƋD$j:4trtȝ7=7u 7D$ Y$-87t+hr=#Ujt}|tU87<$~D$@$D$<$d-SWV։jh$Q襸 jh$W荸 tlh$W tjh$We uYt F t8t4hI$Ut8tjh$W+ t ^_[ (11VPP ^_[)WSh$ju USWV$\$@t$<|$j h$Wu |$D$ 1D$D$SƉ$P蚤D0$D$d0$uV1KPi* F|$Dt$d$`t$hl$dt$lY$hD$d|$p$lL$tf$pOG8>h$P(t$Dh$$t$茱 $t|$@t$t$@ЃD$;87t|$tt$)D$L$d3.$`'.$c.$tW.|$Htt$HD$H|$Ptt$PD$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=87t;P譡D$HL$H+87tD$Ej/t$L t@Pt$Dh$t$HaD$t$Q87L$D|$D$81DI8@I8ډ׋$$|$̝7‹$4$8$ L7ˉƉ$D$@1S$PU$+$$$$+$ى|g@By)Q<j$PHU$+$$$$+$ΉЃ||$`t$@$Dt$$|$`tCt$5̝75Н78 heT#5Н72M|$`=$@$Dt$h{">Yhr=#t$܈D$8|jjj n$D$@h""P!U D$@|$@DŽ$%DI8 @I8 m!ڃt9}M#$H5l$,|$ $tc?tTj/W L$9uut$@jh$Vl @L$ǃuC=7taD$t$uI$t>thy$V-1Ʌ $t}thy$Us-1ɉL$<=7=7t 1PP=71|$DhPWk |$L$D$L$D$ tD$ D$$=77L$QPq=77t=ut$8t$8t$ Ts t D$,t>D$Pj 3D$T$I"tQPh$ "D$Pj跓<$l$,|$u'j/VlEtG1|$t>tFhh%l$LUj l$t$1l$ -LR8D$PjЫ9-LR8*x1l$,1Kd}Z<$t3$DSVW3j Sh$Wd, SUWY, <$hh\%t$LVi t$l$D$ D$<4uT577=<7$t$hP|$LWi |$D$Pj5787uj/U藨 t@ʼnD$ D$$=<7tAD$Pj-?>uP=lI8uDhdf2jhh$D)1D$Pjd8lI81ۃcÍL$%L$0d؁D^_[]1Eh,$H Ph$h$j~ USWV օ\$ |$$jh$Q辉 l$t=jh$U覉 t;jh$U蒉 t9T$(.C fCPC fC C 1}Gt$j/U`B$t9lj)CSRyS\$$UPg { uG<$W&xC Uxj@V B|$$tZ{ u 7w@PwƋ_j:SAt@PwG_Ot[uUnj]UA$tYÊ@t<:uL)SUV V~,$}:1j:VAAtEt$t$Vh$1ۋ\$ t3tHj PU2 }t $9ut=s fCt$t$Uh$ CC tWt_uk7KUVh$ t$t$Vh$ \$ n1HJ37(ud"UPvC{u{ $t$P.vC1 ^_[]h[$ja WV։2vvuGvuGF G FfG^_USWVȀ%t u7Qt*5m2|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdjw\=7t` lR8 7<$l$\$HWj j UhSww/ t hI"VS_ j VU_ =(7t*$xt!f$tz$USP57Xw jw$ x6ư=(7uPwwVvyWV~ USh$?' #$d$dh$ lI84$贮 xwwh 7] G 74$茮 $ 7D$HSh(7V D$H(7= 7uD$jUjjVx hM"Vko8h""Vko8=o8=(7t5lR8h4$57 j}^\$WSjUV WShUVߜ lR8c$d$dh$% 1h $^ o8t Pmo8t PmlI8V| 1L^_[]VD$xuGxuAHyu8y u2yu)Qq@ffqQ1҉Q Q@^USWV81ۍ|$4D77h>j-UD$(D$ hjUD$,D$D$7D$D$$$lI811L$8L$\$0D$t$$ 7<tPTW5o8莁=W5o8tr&wW5o8PtPhW5o84tPhhhȿ#5o8譢5o8<Cà u $E(7uw|$5uprk=7ub=TI8t&t uu5lR8hb#57( 7HQP;H\˃ PQ $wm2DXtlI8CУlI8lI8uss)5 $ ȸdtȃrum2DXu 1@OuJ t$ tB$T$у)l$t=7s=J\$\$$\$l$"$T$ыl$ދ$L$t$ dڃ( ʹtu-u|$t lI8D$ $؅t荌$79L$`L$AL$PPS=(7\$0l$uE5u@=7u77HQP~ Q Pj 蘣57*:D$x u@uhD$t@wuj׃=7D$,t=t@wujփ57=D7jaP$Lt o8@ u}1ۉ7Sg9(7t71@t14&hh$57Ş 578lI8t$ jPt$jP(t$ jOt$jOlI818^_[]Vr07j~O=7t#7@=u1Hjh"P=t D7=H7u q0^jhL7& Vq0jO=7t#7@=u1Hjh"Ps 7=H7u dq0^jhL7 WVP=o8|$D7h>jNƍD$$PW5o8Q 5o8heT#~8 5o877h $W(i1ɅQǃ=D7t @w3t.VjINhF$覺 lI81^_jփUSWVu} 1D$(D$ H7T$L$LI8;"D$D7@71KO8 uhu lW ]=\I8tO8  |$ Q8tEQ89t jPz\jSCI57h7$ K=7th7hι#57] 57jh@h7he2'tEt W= 8kt70t&ƅu' $ $$57Py / $~ t $=7t 8j 6WB t78t705 8V = 8t'~t!7HQP;H~Q~ n Pj_hj hZj ^_Ã=7t7HQP~Q fPj t_fV5 7u<<"2t!@"2h"PhtFuh#$jA 5 7#$tPhh7J3 7^SWV|$1t*<"2t!<"2WPt Cuމ^_[V57u<<"2t!@"2hs$P轘tFuh#$jp@ 57d"tPhh72 7^V 87$I8$ 81(I8 t7A 85P5t7:t 8^USWV1|$-2t}D$2111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,h#D$P"&t uu ^_[]c9ơ7=7#tY$$Qh*$$PY 2t72 7ttPl#PV^9 7uV-jVNj D$E3Vxtǃu&Vt$ha$$ Vt$h}$$57YE|$tw7j h$57X"j 7t$V( t$D$PjW Mr^_[]USWVP 8$I8$t!uL(I8t.u=(I8A 89!"2"2(I8 ,I8A t tu (I8(I8tu$(I81B(I8 ,I8$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5$I8 8;$$I8 81tu (I8(I8,I8^_[]WVt$ t8<"2tD"2VP耔tuVh$$j3< G^_h$$f="2u 1 "27@=u1HP8 1;"2USWV}uCjho8 o8o8o8o8o8o8@I8 DI8 o8o8|$(jW @I8@7 DI8 D7w+o85o8G1;o8)ʉT$t$o89o8s?D$0o8D$(L$, o8o8o8=o8D$7D$"7ʃ|;D$L$y =,7`E\$ |$tY1${ {{;{{WSW.M ;{{{ {{|$$PS\$jR U$C1ۉ___ __$PWj"  1@G ____SW|$ S\$L =,7fDŽ$ HI8t$Ph $hQ3Q1Fxr r11ݜ$D$8dt$4) 4&RSt$Dh'$QPN jh7 VD$ B J1rrJVRVqF $^Ã0D$4L$8T$ 1ɉJJJ JJQRP x$1H0V"0j"0^USWVh=(7u=,7u }t$XjV{ +o8~=o8N+ o8y@BD$HT$Ll$HL$$D$$5%D7 @7Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ иd"t@#|$d5LI8PRQhD'$hWI|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQd"r@#+|$QRhW'$Pt$=I$ų i)s<$*<$Hrr޸t1@D$))kd΍ o8HQP~ Q P ʍHr̃t"1o8HQP~ Q Pu \t"u5o8HQP~ QP6 o8Gduo81G o8HQP~ Q P [~#\uEo8HQP~%Q'H wr? t:,u3P t%o8Gdzh($_ 1No8=o8iK$,&ho8P tu :v2USWVՉho8Q~tDj.VR1ۅt6UP~u&)Who8V u1ۀo81C^_[]SWVD$=7t5lR8h($57@ nD$t$h#PV` uA 077t 7t$~Vt. |79PQlI8^_[Pv|t=07t"=(7t5|7h<)$57E@ 1G=7 Sh%hQ8t =Q8=Q8Shc)$hQ8U =R8Shm)$hR8< =$R8ShD!hQ8# =Q8ShU%h(R8  HR8=71PPv h)$j$ WVPh7ơ7?snt$hc*$PR? Ɔ7 7?)PRQhe25 x?t$|$  81; t7 ^_PhG*$8 ^hi*$t$h)*$57> =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=7tDt WdhQ#$.$t Vdh@$PD$D$ L$PQRSm:4$uu|$l$ 77tQSh*$P=Sh*$P= D$WjPUhe2tU57sƉ$t=07t`VS <WFWt$P Wh#Vθ WSVø $t Pc4$Vh $莟uD$uqh $& t66h"t$h)*$57<lI8kt$VD$VBPjV D$Ph' $Ƌ|$WPjW u{D$ u?h/ $ tt$VD$ VPjV D$ 8Ph9 $肞Ƌ|$ WPjWk 1ۃD$  ˀuPh9 $>u_4$|Z81F=7uR7,=7Z8Sh1#Ouh:*$1Y 1$tPa$|$t.WPjW D$tPwaD$|$ t&WPjWe D$ t PAad^_[]h@h$h7 t705 8WhhxR8gx uxR8xV8xZ8V5(7=7u (7h $軜t>ht)$hk80r1ɀk8.)hk8Phy)$579jh)$hk8 tfjh#hk8x tN=7pR8ttR8j h)$hk8~ uh57h)$ S=7pR8ttR8Q8j h$hQ8 thQ8h\$57#9 1HhR8dR8`R8\R8XR8TR8l7h$g1Ƀu 1AlR8u ǀlR8u TR8l75(7^Vt$tm2DH@tNFuhM.$VutQjh$V tDhR.$Vut9h\%Vut.h^.$Vuu'hR8XR8\R8 `R8dR8^áo8t Pc1o87pR8tR8=7u 747d7h7|Z8t P^|Z8=7t77j=7t#7@=u1Hjh"Pu jh7v WV 0jk=7tpo8t1@=u1HjP 5o8]o847x#jP_ 547Q 477|$ j =7tDo8t1@=u1HjP 5o8o871TI8P8u  0^_Wh)$jO D$tP!t h-$j- h#.$jQ USWVt$ \$l$|$WSUS tUh| u;HDO 1 t,$ t,$fO gK9uX e2I e2~e2Pe2he2 e2 tuÅt,$g t^_[]Vt$VJt^Vh-$jV hhxR8r txR8USWV=Z87t`=7tW$tw\t8Phh\p8R j h\p8W\p8tJ\t81P\t8`t8tNjwt`t8`t8t$h5x7V= |0/thh$Vc hhs*$VP V7B5$$P/  (7L$(7PI8$-,71PI8,7$ t1=7PGt*""1SSQPVh$a"u8lI8d$$r tk8$ t1=7PND$(7$PI8-,7hM"V+3\t8V A\t8t2*$75\t8\t8Vh*$謳  h*$=P 1^_[]USWV,=7t8l$@11 SjhU* tUhV$O ",^_[]<$tދD$0S; ,^_[]WVP5(7=7u (7|$=dR8tft$h*$uqj hk8c@j WPK  =m2LO@1 57jj(h*$ru=lI8u=dR8u dR81HtJ=7uA57hk8( 7HQP~ Q Pj 31H‰5(7^_USWV45(7=7u (7\$L=lI8=XR8!t$Hh +$Ғ+j hk8t|$j.hk8thk8k84$uYk8519 k81f u>hk8h,+$57/ fk820hk8hh+$57/ k8t$1 U2Vh{+$U+ D$(V !у $ (757jj(h*$u=lI8u=XR8u XR8tj=7ua57hk8. 7HQP~ Q 0Pj 1# 7tUh+$57. 4$|$5(7=lI81Hƒ4^_[]t$h+$j2hdt8 tdt8h+$jv USWV\$l$jWYkh#WIkUh+$S* Džu&Uh,$Sy* DžuUh,$Sd* Vjk^_[]SWVxZ85(7=7u (7=lI8h*#xV8u_j hk8^tL8tGx"uAHt.1Ҁ"ux"u"@xV8ZHt@r1ӍxV85(7=lI8^_[SWV$h$VF V h %P1Fta\$SWg t?|$/uH$VMPVS 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh%P. ƅu 4$- 1$^USWVHu\$ $Cj j ShWuu  t I"hVW j VS 7]t/M I9Nt vuvvS jjS0 ƃPjS \$fD$=7~%|$@jW: 7O$Cuu S VjP 1D$ PWhp! D$ PWh#h-$茤 81\$@jPPhSvv thhI"S[ 8Sh,$6 -D$ PWh3-$8$\$=7~N1PD$P1 T$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,#8t8#tj}ud8AuZku<FD$ t:D$L$ PQhhuH t\$ ۋEu Y D$ PWh$ 1He^_[]A t$ SWV|$GHO~H0^_[Ë\$1NWu4G `f@u%8t 8#ug GHO~막뭅tUSWV|$\$GHO~H^_[]1M;G~ uWS $u4G `f@u<8t 8#ug GHO~렉륋t$t cWV|$h#Wt.h%Wt!t$?tt$ hh-$芡 1F1^_$0 th-$j Vt$ Vt$ 0 t^Vh-$j] USWVHE ML$8t$QPVy DUt$F|$ |$_ $&Cىt KDP@uD$ m2|$1 ,,C t ^DH@ujGt-Ê m2DA@CCu 1OD$" 8m2L$C CDP@uʃ;K}/ K>C<\W O Cj$jGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E8ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$~8$$ D$ PhWZ  h)G1$C<\  Cٍ$ j  H$$ j  Êtm2DH@tKCu$ D$VVD$PVo8z Ǎ$$ D$ VVD$PVI8T 94$ =j21@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$~8L$ QhP ~811 |$ 1 $R7t1BuڋD$8L$ Qj P6 Ǎ$Pj t$6 ^ŃuuD$ L$ }D$HPQ4xWt$ P $(4$hUt$P螴 L$l$ ȉD$<9 ɽ|$Xm2CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't m2DQ@tVFu$$  Qσ s[j $( PS u8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A m2CDP@t Cu;|kwm2Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ V_xE =Ȇ8 hh V EKCDH@uٺ\4$yG=Ȇ8 GKoCDH@uٺf4$KfCDH@uٺs4$ GQC t _DH@uC%ƋD$pW@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVSƍ$ jhU0 uG1,|8t!9}uEpV<*mj |8xt$p@ |8>GWVt$F1Ejhht8f Å1|$څ,5 858h5$|$t5 858h2$t8 t811<|8t6 uGp5 858h8$ WM߅uFuL8t@PyP8t8P`x8(^_[]R5 858h23$j 5 858h3$5 858hA4$VQR5 858hS3$$P5 858h3$$P5 858h4$jjUj 5 858h6$lV5 858h5$UP5 858h]6$>5 858h6$(5 858h%7$Q5 858hn7$5 858h6$5 858h7$jj 5 858h4$5 858h7$5 858h8$5 858h@8$n5 858h4$X5 858hz4$B5 858h3$,$P5 858h3$Sh $95 858hR7$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@uL8_NSFJ1<|8tJ9ouwvSӿt?G $pS|$698^_[]Ë$@S5 858hs8$j SWV׉HЃ s%j SV8 G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S2 uC9t8st8؃^_[]Ë58= 8SP PWVhG6$j USWVP׉΋$1m~ w]$& 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x "2"2>u)jH1҉P5"2 "25ojnH@"28 "2>u j5t8h f2ٴu Ԇ8PU h!j djPPh9$hdf23 j) USWV\$|$t$ ؆81EtB5܆8WV 885܆8D188Ht8hM"p ܆8 8I 8Kph+"jh8 rf8"8 ... 888@8 ؆8 =8u88#uxnu І8  8W1 t,E-8@J}؆88R)ʉ1ɉ89‹\$k81m1 8Q8u>#u~nu І8t܆81B C1ɾ8f 8@81ɋ\$u8\$t1A ^_[]ɰQh $j% USWV|8uN 819u:=8u8e2e2 8+/$$8 f2(8!81NHQPPͲ8=e2P胱=,8tC,8S\S5 8] th,85 8 o,8=,8tM$8t= f2tPV$85 8h,8p ,8(8=8t8 8 8@ 8 8=8QP[+rf|$88t0W5 8,8V6 W58Vfb =<W5 8$V W5 8$U Vt dU PWVhx9$Wh,8 9h,8$8޻t= f2t P袯h""h,8 $8rH9tt$t$PF $8H9tȋL$!QP@ (8,8=Ć8u8 8$8 f2(8!hM"P 85 8h $f Ԇ88$@1Q58PZ 58h8h8 ƅttb8|0 uNt$@ $@ $QV58P81@|^_[]5 8h $j 5 8h"h`9$hJ9$5 8h@9$j h.9$h.9$e =,8uh79$ze h,8j# h 9$벡8@ u:HQP~ QP肮t58PnY 1=8t Ć8t SWV 8X1t^hM"3 t&Nj@HOW uWެ[뾋HWPX W輬1F^_[Vt$Vt^Vh:$j Vt$ D$tVPuVh:$jW V^WV|$t$ WVt^_WVh':$j# SWVP\$|$,8t P D$jPSW PL,8VPSW ,8^_[USWV8jh0891FD$88t8T8JBtOz T$R uW|$+;A 0848|8ыR L$y th|$ 8)щ;HT$7D$t{T$A 0848+|8. 8;H@ 0848|$to|8u1ۉ81;A81;AT$t1~T$ |8=x81ۉ__ WjWSQPH|$t4JT$B8 8;H`T8T$|85x81~>~ VjVWQPG1FT$1|8=x81ۉ__ WjWSQP Z;"2r5$8jjh$o1t$ D$13Ph:$5$8 F9ut$ t$L$)4"2F9r5$8jjh$o5$8j$J 5$8j : $8@ @9  ֡І8 88u55$8548j508+o=<8t5$8j n jh08Y 885 =88( 5$8548j508n=<8t5$8j q 볋5H8L89P8+08T$JQ|8T$ut Q;P 48T$I|8D=88yBu%hh rڰ F 548508P5 ;48 jh"r  _ T$=X8ujjhd"hX8 88D$048D$,08D$(<8@8D808X8<8L$(t$, X85\8L$0 `8d8l8h8=88_ 48QZ=j2908 @ 08 489r P8֍L8@PQP85H8 tT$\$ 848D$D$@nD$\$ x88ɉ\$ uHP1p L$$1 u\$LjWSh84D$@P T x88XP \$$1Ӌp1D$ ً\$u=;|$T$$} |$ jjWh8x88P1AL$)t$Ӊ\$\$ L$t |8 |81҉PP T$Pt8BjPRSQ<=L$uD$ظD$fu8508T$\$D$8L$tjjD$@Ph8t$ tF@+6vFt P讥 uF6^_ËFp vh $jR USWV ՉL$88щT$Љ$ m2x8E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B 89r7 8P58888$x80D$SPt$V7 it}ŋ4$L$]\4$L$t&uE\89r+8P58ƣ8858F1C4$88\$D$ 89ȋ$r+ 8Q58;888 ^_[]USWV`}$111D$h:$u W> uu5<;>ut0Gtg<;;u<;$8u _2ȉL$91t*Vdt@T$?D$D$t Vlj|$\$ |$t?1h=L%S t+8ttDGh:$jN 1E L$3 th %ĥ u3h $j> tD$PW uh:$ۃ|$ tt$` uh:$뼅tt$ uh#렋Cu/h6#4n ~$tjh:$VV VeSPu QVh:$ MHPh:$hdf2 j UVQt@t $e^]Vh:$j WVP։蕜1ɉQPWu V?t$8tm1H^_Y8"u #Ft1fUSWV\$t:{u4PD4ƋD$pVotD$0pV Cf{~a11C404t?L$qP)t+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPMF tvP:v ߂F vv‚F^USWVP1k<j02~4j02$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ùp pUSWVPk<j02j02$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùqGq8r)rhdf2jjCh5;$sZj艼 V1=8t'SY}t*jjj VV"5p;85p;!8j5p;\@8jP8t#1ɺX02A<.u81 1@^USWV D$0f 98Z 8,I fEE!f ufE(Mt!U1f~ t @9ufE,$ ]tE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPPy/tCÀ8t? m2DAhdf2j Wl@$&MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$&E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEu_LrW=m$ 5l;肣5l;蒣1QQPSBt$V5l;5p;e1U#*19}1ۋ$p$ *ŊEt9}1< ˊEE5p;h>$1VV5p;UVj5p;Vj5p; 5p; 5p;4= m2DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&hdf2j bxu+=8 8σqt$V,dVVx5p;\Ihdf2j[ ,$,$fUuE 9|)BfUhdf2j! ,$T$4xut EfEuGza|1x(| E9}ED ufMhdf2j !}Eu)uvE t uPcuؿf;}]D; jtOTD; tt$4UЃF4; ~ttt$4WZuE tuPƻu kvE u)uNvE8,Et)uyE t uPfu۾EtPEEf~3M1tRMEGЃ9|׋E4t t$4UЃuuEE tPuE ^_[]Rt$58t$t$h>$hdf2 ZR$@ t$St$t$ t$UPhG>$'R $A It$U58t$SQPh=$hdf2衹 $j藰 USWVT$qЉD$ q Gud$ T$T$ $P%%ǽ)j PM)1Ƀ QWl$ U|$ WD$p迁tS;tNt$Cj SL)؃ QSVWD$pt G}uo $ $l$Atl$|$qqKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W !L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SC G΋<$9Ƌt$ufth>$VSwI|$Gu1PPw|$ GL$G)VQw w4 ^_[]D$L$8 fAËL$1x9 8~8USWVl$0.89}=8DP58>Ǎ PjQm =8ۉ8t @tFj8<5@83c$h81=8P^$D$L$ttu* h"8h8 h8CWVL$D$t$ $ܥ&1Ƀ)lj oh8b8Q8h$Pzt*t!h O8 W^_hËD$L$ttu*h8h8 h8;Vt$ hNN As'T$fzufJvPhq$huhhY^ËD$L$Q1Ɂ~t't%u'f!tKu1Af fffHËD$Ik@ltH@1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH 1@ËD$Ik@ltH1@*013161h;$虓 1@j :1h;${ 1P18j81hVVPPj jh] =>8t#1GWVhI$= WVhS$. hI$蟅 hS$蒅 1^_ø81hPPQQj jh 1h081Ë @8AR@@81ËD$1@8 ~$1@8<$1@8<$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$@1@ËD$@1@ËD$@1@t$1@VPt$+ƉPjVE] tjjV 4$O1@^jt$ 1@WV|$jWktW¼jVP衽 1@^_WV|$jW8tW菼VP-1@^_áD8ƀxjjPA 1@5D8<ujj5D8 1@jt$ ׾1@jt$ ž1@Vt$ D8ƀx6 j65D8IJ 1@^VD8)thmjW1H/t$ ƀxj6P脲 jj65D851@^WVD8)thmj1N?|$ƀx1FV7P- jj75D8޼V75D8 ^_VD8)thmj蛚1H8t$ ƀxj6Pȱ jj65D8yV۷1@^ËD$05D81@Vt$ D8ƀxj6Pp D8)t Pf1QQ6P 1@^ËD$1@ËD$1@ËD$1@ËD$1@ËD$ =$1@ËD$=$1@ËD$=$1@ËD$&=$1@ËD$3=$1@ËD$==$1@ËD$G=$1@ËD$Y=$1@ËD$f=$1@ËD$q=$1@ËD$p=$1@ËD${=$1@ËD$x"1@ËD$$1@ËD$#1@ËD$/#1@ËD$$1@ËD$=$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ø"81hPPQQj jh t 1ø81hPPQQj jh P 1ø81hPPQQj jh, 1ËD$1@VD$ 119‰)hVVQQj jh  1^ø81hPPQQj jh 1VD$ 01jPPQQj jh Ɔ1^VD$ 0h$P;ethVhd"hF1hVVPPj jjd3 1^WVD$81hVVPPj jh t#1GWVhI$ WVhS$ֵ hI$G~ hS$:~ 1^_ËD$@1@ø81jPPQQj jje 1ø81jPPQQj jjqr 1ø81hPPQQj jhN 1ËD$1@ËD$L$A f@1@ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1@ËD$@%1@ËD$@K1@ËD$@1@ËD$@1@ËD$@1@ËD$@1@1@ËD$1@USWVPt$11Mf$0jWWSSUUh W x;}ԉ1@^_[]ËD$1@USWVP1A~9~^Պ\; 1ۋT$~N,$9uh>$PRQm_vrh $PRQP_|$ Ft$uMh $v;FVx$9tكaw~ ـb(Qh>$P踻 t^WPS\$z]F8tt$SVЃ F9u vr^_[]fUSWV|$5ď8ti=ď8WVzW+zG-ȏ89v1W uá̏8t Ps̏8=ȏ8Џ8ԏ8^_[]SWVt$E2t5؏8PE21SSVVl 1NtjSSPK؏81ASSWQQPSE2Wl =E2t@hκ$Wq`t5؏8WE2W ܏81^_[WVt$ w?=E2t-t)95܏8r!PE t;؏8slj4\;2^_5ď8YЏ8ԏ85ď8-̏8Em2\Jك@to@uwt uDZ@t< ty< =8u =8tI5ď8vtj 5ď8 =8uj 5ď8Џ8ԏ888?=8u"5ď8lvtj 5ď8j 5ď8188Џ8ԏ88 8f)ԏ81ۈD$uЏ8C5ď8ut$L$4 5ď8Lv9Ƌt$|25ď86vVUUU9}j 5ď8|$uCj 5ď8KVW5ď8\ E߃ @ ȢЏ8ԏ8=8uW5ď8"ut7j 5ď8n%5̏85ď8HX88Џ8ԏ85ď8蛓 ^_[]t$Ph $VPt$D$ L$ $PVPS1A4$^hd"t$t$t$t$USWVP|$ \$$l$(t$5ď8DЏ8ԏ8D$,$VpUP1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GWj5ď8f1ɉV,$E|$@t[D$@8tRD$u:h$5ď8Vt$@5ď8Vh?#5ď8VWt$Dt$G h$5ď8]V4$V5ď8rD$ 5ď8r5ď8Ps‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US5ď8JV5ď8rth]%US5ď8V/)PS5ď8 5ď8蠐5ď8bÃ~0L$ZD$  %ݙ L$X1)<(x1 m2~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP QtRD$(υ~] $9I\$)RPQr KOuLuH|$@tAt$t$D|$WE WZShdf2jR D$z19Dzf tN;L$$} m2DXuhdf2j  $9A)RPQ $8GED$t+)j Pt$5ď8L$Џ8ԏ8D$t8ʋL$ u|$@t$;D$@u  $L$t$t$PD 4$ 0^_[]hd"t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(5ď8oo5ď8?o$tKۋ|$,;SQ|$0L$Dȃ19AD$LD$Ut$HP;1t$PQQN Źt3;|$,t.D$DE9}S@QŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j P tC@j PuL$$)݃} 9WUQS5ď8ƅ|$ 蝕VUƅtV5l;@4$5ď8/PW35ď8LPWH1PPW> W赋D$E|$ GWUPS5ď8SPŋ=ď8VPW=ď8V@LPWfH5ď8舿Џ8ԏ8#WUt$ Shֺ$5ď8辭1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV4$tWVVBWbUPBWwB^_[]hd"t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP*1B4$SWV]^_[]hd"t$t$t$t$USWVP|$ \$$l$(t$5ď8Џ8ԏ8D$,$VAUP14$SWt$(^_[]hd"t$VPt$D$ L$ $PVPY1ɉ4$ ^V5ď8Mj5ď8}j^fUSWV $$$ x8158588?$58Wc8WVP< &Ft(=08tvvP> vh08A>vuɸ@88888h$);$|$ h5$SU e~o~1pMrtCID8붃fi5<;hM"V wPhWp \$h5"W D jPhdT#o t \$Sh|$W$ u4 W$&WKPWVu t }u몋}tED$th5"S3 <=u̍4@h5"P FhZ$V;0t$VW< F|8h8h8h@$5<;E `SL$$$ Dmf<;$.P*3jh#h#$7 ڥQB5p;gǃ5p;g1FVVPW"}$8t458585$8hB| 8VjKVj Kh`jJ5p;p)Xhh8 D$D$@V՗ljD$ VƗD$1ÅjP  $t|$ o u*t$ %n ut$ $n jz|rjUtc1L$ <:B '@9u1PPPPPjPPj jUVPv4t(jvt$WAWU11VG|$ t$~14.4#C9uWV jtPj谽jVh"ĝ ]x8jE8j"6 8_uи=|8t j躣 jjg軞081 ^_[]Ét$ h1GQWP蟄 PhX#hdf2 V(Wv =hdf2jj,h$zjv hdf2VjhF$YVpv V1Fhdf2VhEhԽ$7VNv UWVV h߫"#Py  }[=8t>VMPh$W~ 5858CH8=(8t>VPh,$W~ 5(8y5(8G(8=8uhdf2jjhC$Be^_]Ã=,8tá8tt$P[r j0u j)u h߫""tPx t h$x Zjdhw hjUSWVB L$Q-  P|U Ń j hǽ$U ~ uF t$|$ Wys WDfD/UW` WDjŋ>7P%Itn,$n ;nu:FUW踝t^FPv蠝tFljFn ~D$P 4$ UV SzT ŅSg& ^_[]ËD$L$I4s1@fUSWV1t$|8jV t$t$ t$t$4$jVP!<=|8Pr#t$Vj >hj]jYj蘅jVsh#$Qa  vV/ 蘊Vjj^4?15|8蟲z~D8VPX~Bjh-yD8jPWyjhy=8VVu%D8ǀ$jhxup}D8Ph $jXC jȒtOD8)tTPCu2P.Ku#POuTjh0xPo^_[]Ë$l$ D$jP藙tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UG9u1PG9uU~U$tG10L$9 t.T94t&zt T98t4t9t9y`$El9rۉt14UtG9uV4fV&SWV1t$t$t$ t$t$4$5|8jVՐjSr4PV~8 D8$*tKuKt!PуtD8$PD8L$$Q tXD$t$VTVx)V2Ou_$uj$t*V^_[À)ujhcu VCt5l;z1WW5p; 5p;ٮ5p;zSj m9;xhj_jZj]jV'Jh#$\ _$j$}USWVο$WQS/ Whu$S WSU/ Wh8$U S1tGUt0VVVVVVVVVVVhQ"h41PP:t US:^_[]SWV$SQV7/ Shu$Vh SVW/ Sh8$WL Wt VW^_[WV1t$t$t$ t$t$4$5|8OjV蹍tkj;o4PVf5xGD8*tD$$tL$PQt$VqLtVO^_ÉWj ,?t1hj`PP~u{fUSWV$$$$1EQt < tEBT$BL$ Q;D$l$1@$4V;9D$pPt$Vk? Z$DaD$|$ $%t umm2DJ@tiOGPXhg%dj D$(PW藋 L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5m2t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8um2DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt04$+ Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW 58t@W蝌Ph$V?q 58 58:8sh"h$uq 8t*W@Ph$Vp 58 .5$8D0tPh"h7$j[o1e^_]Ph$hdf2p j~g UWVV =(8t>V訋1Ph,$V腅 5(8 5(895(8wh""h3$p (8t81hC$W6V?PhN$W 5(8 $C0Phg$h7$j[x1e^_]V1hhPhtPjjPj jjhE2hٸ4xjP豪VŹ^hdf2jjh|$!8tPjjh|$jf SWVD$x1|$8t(8 P1; PPVh^"W˔^_[USWV$$$L$$QPhV k $hM"V $D$W:1K4$ 1G9r6|$  WUՎŋ$(\5F4$蜄 ÃugD$ PV腱uH|$dhM"Vn $t:|$G=8tVh$h$Pym 1KS1D5$$t 4$H 4$6u8tVh$h$Pm 1ۉ؁Ĉ^_[]Ur$$$1KT USWVu ED$l|$$PVW  ED$8D$1ۉΊ<'t  j Fj'V[u V4ljt$ t$PS'4 D$ t$ )VPh:"L$Q h$Vt t+9s'T%u@u @Qj*Pg# ;'uC|${*1\$ |$D$8j/W*d tW É@/ W É|$PD$3S]C ND$+D$D$ .t Vt$W6 tS"C Džu]D$T$L$;ȉD$Pt$ ϋD$L$Wt$t$ h$P_ 뒋D$L$T$;t R S |$\$ h $S G|$\$1\$L$< t$0Vhht@W! fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$$T$0d=p; jP|$ W 5p;8m:5p;hj5p;^5p;lp;D$D$$D$$1WSQ D$(L$VWSPQl61NB|$p$ ,8h,8hptt$$^  t$(t$ J8t P(8\$t Pn£81t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@5,8L$@EL$D$D$ ~;Ƅ tD$ $ tI@j,SD$xP% hS#} PSt$$]= D$|t~? D$ur8tPWU 58|$uL$T$0D$heT#Wn tf heT#PW|$W.WjFD$ jjD$4Pt$,V< 9uL$,ȃttptud|$ $j$h $V  8t VP&f VjKK $\$,8>i$t${> t$(o> ҈8t P8&L$,ȃ\$tuht$-,1&1tthXNjt$,1he2z E@L$utuL$$T$0Ét$to|$ SISIىÉ; p;thPjjT- p;|$t19ut h", A1CD$ 0|$>9}@D$hoP+TAIg|$u9Mx{;5p;tVHjP脿|$ۋ|$t h"Y+hPC+;ge2H e2~e2#he2g.9Nj|$tgjA );5p;t V|$ t E%u15p;,5p; j5p;~Xft$$ʉtwP踉uW覉D$td$8u-e^_[]D$t$ hs$jbH Vh$PY 1S|; 1FVp; Sjh$: VSF] ~t$E; $ D$pL$|PSt$0} t$(/a8t*t$h$Pdb 58+8(8t*t$hX#P1b 5(8+(8h%D$ 0&.u.h$D$ p.ut$v t$e s h8yEt8tPq= u%t$V6辶 6h$ jU,ZL$1Ph$ USWV։5p;1@P5p;EV5p;w_dh1PSUs) K=hP((=hPS1CS8) =Wh $Յ=h~]$'FPUuc5p;D@)VUPRQ5p;_tcjPEmt05p;ޮPV5p;f$PV 1PPV߻ Vfc^_[]hdf2Sj+h$SV USWV-1@=8$hs$Pj huD$1D$ $ $?$V '9̝$VWaPWt$ | VWFG|$$T&m2D$W&PWt$ c* uD$L$DAu >uD$ |$O 4$ ))ht$P FD$ |$$ ))Ƅt$Ԅ$ń8 }? jS} ƃ $NfFp;Ju1ҹhvRRRRQRRQjSD$DPjuH4D$D$D$ D$ jt3D$ Pt$D$ p 8 )) hPh8 14x&jVh8( t1GuD$(Vh$j@$SY 1PPD$0PD$XPS t|$Lub4|&h8h7$h.jsk"D$L1QD$PPQQS Sh$u1=8su=8lum2 8DH$D$$Ph$萷 u5$nfsu( $D$1@D$ |$$tD$$D$$i jvJh1Wt$TV> j!W|$0W. iW*]hh_$uRChH8PPjI=H8 hH8PPhh"h+$[ Phx$jKp h$W=ph($W/ph$W!ph$WphH8h$Wp =H8t!hH8h$Wo $9h$Woh$Woh$WoW#h$joh8h$hc DŽ$hK8VVj~j hc$V藞 K8defa1ȋ O8ult1 j h]$hK8Z K8manu1ȋ N8ual1 K81 K8none1 O8 tlf=K8 tb=K8t`hK8h8hm$j`tCh8h$Sj`~$$oK88hhD$Oh#igh8hD$hQ$h [ 8 8hC$D$ Pj ~ht$ h8 t$~j h8th$D$ Pj[ ~ht$ hf8U t$f~j hf8t=f8t 8h>$D$ Pj ~ht$ h8 t$~=8u:h$D$ Pj ~ht$ h8 t$}j h8't=8t 8hh8^ u=8t 8D$1@$" hG8S$W, V8PPjxV8PPjw SW"t%8|$$|$ t |$uj8PPjyE|$t j8PPjz^h8 =-8u=B$=r!ƒM$tX$=ujQh-8J j-8PPj{h8PPj}8u4D$D$Pj|$uhf8PPj|x=f8##tf8=K8c$tK8=8t8|$ti=8##t8=-8#t-8=8t8SVWQRh8Ph8h8hQ"h,$L=-8##t-8=8t8WVQRh8Ph8h8hQ"h|(jjj xP- J8m$Ph $hB hb}<h8h$hSP S;"jrj!R$H1WWV$Ph$ t( ;$P$Tsh$jPt^DŽ$ 1WWV$Ph$ ? ;$0$4&h3$jPhauq58a1H t$艝t$~y1t$jt$_yh}$j<$t$j81@$F=f8h""h$ S h$jgt$(V VmPh$h$Wg=8th8h$Wxg =f8thf8h $W\g 1h$VLgVWm=85|$tk1h8h8h8h!$VI8jhA$W  hWWVjFj jh tNjjSP' |$ =-8Qh-8h8h8hi$jkDŽ$ch DŽ$attaDŽ$n/slDŽ$/sbihI8S4 |$$h $Wh D$Lt$t$L8th $Wh ut$LD$LPV =8t8VDPV |$ u/=8t&h$Vh8h$V |$ t1A&hh$h\1Ʌ 8j8e^_[]h8h8h$jt8tPjj"h$1Fhdf2Vjh$VF 58th蔻VP h}hdf2P j{F USWVL$,!ij u!D$@tP\ jPh8 L$,%ij u!D$@tP$ jPh-8T jPPc ƍ\$1 jh8S Sh8i(V V?' ulD$PNhPhK8 WNt;Ƹ#K8SPU SVU WNƸ=L%uցļ^_[]VPh8h$PjW"Vt$a2 VjV2 tfjh$V@ u;h$VU u&h$VU ujh$V u"h"j1 ƅu4$s^Ét t t@hVhJ8 SWVt$hVw uT|$tMƄ$j.Vt#GSVh8K SWh8 hVh8/ ^_[SWV8Sdh8UhShG8 =8tO)~!8.u8Ph8ԉt(G8Vh %W Vh8W ^_[ËD$w&ød"USWV$Vh$(u $1퍌$Uh$W :HUUW f@$|$$jh$P 9tx/uG/$N~/vt$jh$Pa d"w&1҅‰)ˍL$$QSRPh$hUG ^_[]Ƅ$8USWV΋l$M9vb׋D$tU|$t /u"t)|t<8|01ɀ=8/8QPh$hh(8F 1^ËL$1Bjh$8WVt$=8u jG7Wj u1@l8B58蕷1ɀ=8/8$QPVWh81F c1ɀ=8/8QPVWh8 F 1^_Vt$V'eЉjh8$^WV D$Ph8S u:$nfsu-Vh8h8: Vh8h8' tWj 1F?t[h8h"8h$ju>8P$h8VWh8%E h8VWh8E 1 ^_SWV=8hV8u(h %m]u5hG8hY$V=f8t h$=H8t h+$ٷ|$h8hf$hW`D h""W ƅzWPhw$j\h.|#V\=K8thK8h$V\ h$j\8uG"WPhw$jg\=K8tDhK8h-8h8h$VA\=8tCh$Uh8h$h-8h8h$V\h$j[h"h$ |Ph$j[ $SW[h($W[SW[=8th8hC$W[ h8h[$Wl[ =8tLhG8hι#WK[ h8hX#W8[ Wbh$j [h$0[uh8h$T=H8th$tTh8h,$bTt Vja^_[USWV։ϸjPP tCËl$hjW ojh8W WVSU S 1H^_[]USWV T$ˋ$ Ph$u d"$$t8h$jPG t&D$h$蟴$D$D$$S^\$ PWS. 8|$u8PVSUh$t$Uƀ<$th$~PtR1 ^_[]ý $+T$L$t$!u/Átu#Ãt6u8h6h/u uhB%!wب&hhYV D$L$FFhV~ ȃ ^SWVP1ۉSSWSjh&Ѐt{4$X1ۅtjSSWPjh&襀tEh $VB' t&|$\$PS׃th $j' uVi Vi1ۉ؃^_[USWV$x&\$|$jSP ƅt Eu$wS7 wh"7ӽ G^_[]WVd&|$ut&t%|$ jWQI t u1^_ËL$E24USWV1td։σSb PSW  t u6P1PhPPj D$PU0 D$t΀8uɃ<$uð1^_[]ËL$E2w4USWVl$\$1}$hnW6StOD$SWPHDWWRt.ljFt(V$'E$EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ4 $V1VP  95|8D$40$X@h%P@tt$45p;Bhe2T 5p;R$9r |8ɉt$ =1MD$Ni8D$$11t=i8,48tǍXUS N݉|$|$l$$8D8ƀyH1ۉLPTXVUQ D8" .hQP VUh8 ,D8L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQPD8$()1HD,048Ƃ(1 |8<58Y8|$c[ 8P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً |8ɋD$L$ӾV Wd"QSPSl$GU D8$H@ VWd"RPQSD$BP 8t% D8QUHDRhX$P; =D8$0蜧ơD8$p肧L$*QUPVWjj:XD$ D$D$ PjvD$ t.-|8L$QP5D8 u<5D8h`tS$Pdž$l$D8()8 8 8VP8VjP L$ D$@D$9 |8yuƇy$u4P4 44S$똋D$D8$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$p;D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4p;El$L$),$|4xfDŽ4DŽ4p;T4E,$DB8t$ 9zt$D$tj$Dx[fDŽDŽp;D4B=ND$?P1D$ +D$D$$|$y+DxYfDŽDŽp;D4B1hPPPPjPPjjR$Pjw4$1K|$$8h $j賤 D$Wt$"sD$tvl4u^u3h1PPPPQPPQjt$,$Pj4ÃtCD$WSrD$lxS1H$^_[]1M4$褁$<t4u/hhPh6F2Y D8F21@멃=|8yu|8|8s19dL$w BsÁt1USWVD$$D8*t1G.$ )$Ph$hV2 $jt(hgkNVh$h j$ $W\D8$Ph@$hVd2 WVh$@ ]h$Vjj\ R1PP3Ahjl1q$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$Sڡt$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$&hk$D$P׎ w$D$|$X3|$0tPh$hW0 Wh$D$Pz $D$$zh3$D$P? ?$D$E$i3|$0tPh$hW,0 D3t#Ph$j\$S0 S\$W D3t#Ph$j\$S/ S\$W L3{,"t#$tWRh$D$ P胍 D3@$t$D$$D3|$0tL3tQh$hWW/ Wh$D$P$ -$D$-$Q|3$t$PD$P $D$$!hM$D$Pь Y$D$a$D3 $t!t$PQh%h+t)$j4$JXtQ8Xd3U$ ޳=|8t$ $QD3$t<|$t4øSS$PW$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRh$U茋 EtjP 4 t4$HW؁ ^_[]Ê$ h$W$D$jVO ù D$jQQPS- S  9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uh$SGVUh3$S7$ Pu1Vt$h$P4$OV$ l$Shf"U虷 h薛UWVjP5L1PG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQY^_[9rwًz89y8rw19HUSWV D81G*ZƄ$h$ch""ha#3謜Ph$jC 58t荜 D8QPh$V. 5h $SCD8)\$J$WP[x$L$@PQ`$ $d$ PVH$ D$@PhU$SBC D$0PV["D$0L$8L$D$h "Pw\$D$H$194$h "WFuށǐW$W# SS;t$$ *h躙8tPjjh$1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7>#td"$$\$t7ȉL$7 T$wX?$D$ $D$$&d"$uht$$Pf $Pt$h$t=uD7L7qQPh$u/#$>#dD>#t $D$ -$ $T$h$RT$ D$L$ 1@D$h$T$Y$D$L$ h$RnuD7>#t$$D7d"@t*$d"y/$d"t7$T$(d"t>$T$ |$$d"tG$L$,d"tN$d"tZ$ d"tb$t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h$t$D?@غRPh$t$?ClE;F{Pp\$CPWd SPt$0|$4hiL$0QjP. P8W[PtVhl$t$? S:P=08u#D$@08@@hPihj$\$ S>h$S>h$S>=08th08h$S> $ 1|$@VVPWh$3 ;wd"r53#t53#Qh$SB> h$}h $ph$c=08t h$Mh!$@1h$W=S Wye^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ &h*$U) UeuhY$h*$U U>FjVG1Ktljt$(2"h9$ G_$$G$G kw(2"GhK$¥ G _$${$$C(s4C8&h]$蘥 C<{@$CDsP$sT&Sh*$U7 UstlSho$U (2"U< F_$$F^ kFSh$U F&U F _$$F$^(kF48ihY$h*$U袮 UtlY$Who$U聮 (2"U袤 F_$$F~ ^Wh$UM F&Um F _$$F$~(^48+4$iƷm۶|$981Kh$Wtzha#+tiD$ha#PjL Wl$UVt$t$!L6LOu4$LD8Ph $h? 1PP}#D8)t5Ph@$hU! 鋔$ 1$ 91AP蒒uDFl9Ɖr:D8Ph $h蒑 1PP"ݖ69ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhch$h$hh$7 L$T$jt$oËL$T$jt$XWV׉κ$jujWhd"VhL"< ^_VH81ɾ 9r^^VD$H8tU@8xtlIuAH1FVVjjhhH80QRx tjhH8j" tH8^À=H8tjhH8j H8USWV 1WWj &iP8SPj  t$ Yám2D$1/dev4$D$iƋ1N/ u1FSt$$Pf/dev uDL$DAt|tER|$$t.jVj t m2L$Nj4$D$/devG4$D$M[1O4$1O1V=H ^_[]USWVPD$tPpP11OFtFh$Pt.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T$w"$PhV"h$V{ ^_[]Vt$D$QPNt(D$t%t!hhPQsD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$58.@ujP?D$1҅D$t 9tL$BuT$ЋT$P]1hPPh#h#jjAPjQQhE2w i4WPZw EM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h%PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jP/>D$1҅ӅtwUt\P,40Ut5L${|$P]>$tL$ST$Dځ8Nut/$E t$FDЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W^<ŅjWI<{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ 1D$$@$;E tL$ A;L$tI1۸hSSh1Shju1@G8y6@u8$VPWSh8 uVPWSh8 1^_[USWV |$ faa@D$>$1Cd"=8th$j8V;sPWh7$hvD$PUAD$hN858h$j蜙x8CtW5"8u8QWh8Vt$D$PWh$SF$'D$D$ =mdt2Vh8h8  Vh8h8 1$hVS  t$t$t$D$ 8jVV_ ~;Ƹ PV#D$i jQP^ e9]D$|$h`Ww~*o ~#u4h8h08# 21jiTp08ލ$8Hf@p;tJu1SSSSSjSSjjUVjlL4jmoPV>VMkt8Ph08{ u`~*=8t!h$jI18Pjn)D$WjP>\$tt21ۅ1C؁ļ^_[]hP$h>$h2hq$ USWV|1ۀ=08t}h08hr$j蹕 ue8 $$8h8VWSU h8VWSh8 VUF#N@1 É؃|^_[]ËD$L$I1@Ã=8th$j8Vt$ D$t POnVj=n5$8^USWVPWj<1F?tih8h8h:$j袔uL88 $[$h8VWSUh8 h8VWSUh8 1^_[]SWVPVj]<>u1@;8]$h8VWSh8 h8VWSh8{ 1^_[ù1@t m8It1ùtAW8t 1ùD$W8AuL8ËD$L8SWVhlhz1$hWV覷 㹘G2WSChWWhX>Wj658WjWPVWUI4SP2;VFJİ^_[USWV|$1i/t\1tWL8tI1r rr2c0u&1q1ur1ۃ0݃ dr @뜃|$tB dBBd^_[]USWV|$D$L$BJ 0uQ=81۾%-8B0t#1urFL8tu89u'Cϸ89t0L88t80 58|$QjVPh$W$^_[]WV|$t$ Nt tuhd$ld$n$2t$jjPWV^_USWV|$=8t h8l;WxW8u8l$}QWVh $hU 1PP; ơ8t3ЃMPUcAuu#D$=ueߋ$$$tt8Plۉt{uhs$jn$tjPUh$hOg=8$tx8hhSjP jPWK#VB#nUh$h VX V#$t|8Uh $hOi jj7h5$81@|^_[]Ë;hp%Wgt(h$WUth$WC=8uZ8hgSjP jPVI""=8t=8tUh$jێ CL81$<81Vt$h$VtV8t 8(8^t$28u8USWVt$,VD$j$t$Vto1\$l$t$GSVhVVj UPZ L$Vtu(;D$0s"L$44hL$|$)L$OGj$W艎DžuD$@PDžj$t$0]|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$V 1D$44U8 D$44$D$D$ j$SŅm<$t$ >tV\$S VR$|$);\$u ^_[]h$h$hG hq$V SV5G21/t.T$ G29u9t L8t q/u^[V1ɍt$QQPVh$ y1t1^USWV|$(1$PPWVh$Ө $D$(1PPWVh$蚨 Z$LF1d$Pj%3$>$&hd~]$Udhgh$dhgUdW<5$8^D$hjU5$8S &PPqhVjU5$8(VBt PVW? WD$ P@St$5$8=S 5$8,5$8Sjh$ j D$ PUW Uh %c D$(SSWVh$ $jH h %fMuQ1AtCjV u4Vh$"1ɉtjV uVh$j舉 D$(SSWVh$L u$~h$jTLȁĐ^_[]1USWVhh $9(8tPjjh$躊188|8x8t8p88G2/u D$8G2ڃ9tL8u@p8Q/uD$/u.8p819haj躇 G21@|$>ZL8M t8L$ |8L$j5l;5p;,5p;.=8th$jه8886P5p8h1$jaTa8Wj /D$ttRN1ҋ0t1t /u oBrgL8uƃL881L8uAuVwD$u,D$ t8D$|81@L88^/ |8Fp88QR5t8585x8Ph8$hE` jj._5$8]1[8tvhE$hVu>h-_t$FVjT.~th~$jh$jh$j1GX8yX8tfh$j辅h$`L$QP@6u{h$`$QP6uYD$3$L$3$ t?h$h:$Ugt!hD$j6h:$h$'b!裩1=8th$j8]$1L$VVPQh$謡 }t|$ th$jT蟄jSe^_[]1F]VD$FVj,F^SWVPD$$h"h$bt@Ƌ|$^1Ph$S9 4$WV VV h$S^_[USWV-I2ta1FI2t&U7Re1tUh $h\] 111Fo u1tjh|1@1^_[]Vh$^t$hPV脩 hh8Vq x(8ƀ8h($Q j/P؃@$$8^SWVh1$.^8hPV  VP8K58m 88PVh7$hW) jWh?" hOV!j<7 1hhF$WWhOjHj j j jVWW84ƣtJ2WPU*tJ2V_9W jj讷t$58hm$WVp h$]$WPS S SVju jjI1@^_[UWVjo WWt W |$ hPWv j WtHZ8 8tV(I"RWQPh(%hge^_]1PPj< USWV=8uj5O2E ǣ858uO2Pfƣ8^V=8~GtO88W萝 WŴ;8t18hX 8A i8$8$V y))L$H 9Jx .@ SPt$إ D$Ph860=8-O29|uP58 8QjP詣 P58 8 QjPp -O2D$%=@t=ut-8D h18D8 it$h$t$#g =8-888Pi  8D G=8V@ V/ $$8B 8fJh jjQPvĄ^_[]VPt$D$ L$ $tt$VP (8t 4$VP ^PD$L$ T$$RQP XUSWV$01D$$h$XL$Ph $QD h$XL$Ph $QD h$XPh $QD 4$ Phr$t$ \ D$ t$T h""PL D$\$t$ hS tt1h5"SA 4$0P P$4V踴 u <.=tSh $t$t t$ hS3 ut$ 聲 t$u 4$t$ t3h1TUt$FVj$~t$t$t$t$z3jPD$t PD$t PWh $h4U jj}#bT5$8{1N^_[]t$ o t$ d V{11N4$: t$. t$/t$#4$VD$FVj"F^SWVPD$$h"h$Xt@Ƌ|$>U1Ph$S 4$WV8 V蠰 h$S_^_[h$h$.S($)1ۅtH!t]! 1ۅÉ[USWVh;*#{Pd D$1Ʌ$l$hhS#UG ti\$WPS迟 9s?hh$Sa =w%hVSa =wjSP t@hhS#U u4$| 1jV 1Ʌȁ^_[]4$N 1AVt$Vn1|TsrLc1f ^Vt$h$V赱tV8t 8$8^WVt$ D$wǃr9t\c0tSPQj5 V5p;2V5$82V5p;nV5$8_5p;15$8#5p;%5$8^_WVt$ V u.>vd0$PVWh1$hdf2x X$^_WVt$ 0EPp4PGt$>FFVjwF^_SWV=G2/t/t$G2GtPVt /u?É^_[USWVj$t$ w1ۅtKƉ|$\$FUShSSj WV $Vtu;D$ rj$Vbwƅu1؃^_[]VPT$ D$t$4$VP ^USWVӉϋl$jUtMƅtPt$V SNVUP tP׃SX VO ^_[]VPT$ D$t$4$]VPv ^À=8ua8g!h8$8$l8#8/#8&!8SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlWH$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQPd $LL $UT4L$ L8L$T$T@Lƽ$$hVWU趧 uD5<w |5L Ku1PPD$Pӳ )ƍD$Phd@V/ |$D$|PhedAV V\f$1 GaD$P$,ha$t$V@c 1PPV $C]su PUhh8t$˷t.8CD001 81 u=8tZF9|4$mja$,h$$0ub EPP jOh8D$4Pn D${O1ɳ$$uƒrL+1Ht$,D04$ղt$$,h$u b EVPh#Pa EtE @E w-G$9@  Vt؁^_[]1D$L$I@PL8wʀuW8AuL8 L81USWV$$1$hWVؐ E jSohWWhX>Wh58Wj jPVW}"4SPZVn#1Ĭ^_[]ËD$1ɋ0t1urL8A1ËD$1ɋ0t1urL8A1USWV ։D$ $ZD1$ V D$$ ,$D$$#` $D$u$D$$$$u:$D\$$8) \$\$$&4HD$\$$)|$=8=8=8$ <$D$D$^$,<$q|$4$D$ 8D$$_ |$D$ 8D$8D$$=8u$wD$1Ƀ O2\$J2C|$D$$$~]$dC\$$({|$!<$D$8D$J2S=O2d"|$l$ D$D$E$$niljl$4$m K=8u $>vD$|$D$$$$~]$B\$$'1|$u1="8=8=8$ <$D$D$^$^<$t|$4$D$ 8D$$F] |$D$ 8D$"8D$r$$ahuLl$ t$<$D$$@h$ \$<$D$B$%h$Z l$4$ > ^_[]Á=M2ftp] $=M2PFSWV|$ty8GO4VS豠tRVR t{S588Vh858h$hS jSh?" fGtJ2~"PiptV^{Ve1^_[ËD$ 8Ɓ8 8fH 8fH1SWVt$88V~)S4:Q F8F8F1^_[ËD$L$01蒟fSWV1ۉShPS$ ktD$$P] t V诫8V蛫Ӧ81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6u61^_ðt$hzd@t$  SWV$1ۉShPSW~t/S$SPW03Vɪy 81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=x81SWt$ t$L$ T$0D$T$SWt$ t$D$ ׋ 8t$ t$(莌$L$\PSWt$t$,t$RPPQ $x81WSt$t$踖D$T$WSVt$衖É֋= 8t$Ht$H$PWVSt$t$$PPPQ $VD$`Pjhg1@USWV u C(D$|$8hjW wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@Ǿ &|$D$u$l&B h&Bd&B`&QP׾p&B@ tu Ǿ&pЋ$+L$L$8L$9Ǿ&HQQQQRPRPjD$7 fOfGK|1 $;L$T$Rt$HP kD$4lKs|4C 19<A9uqT$RT$LRt$LPt'$+D$P$L$TCKt$(|M1e^_[]t$C QPt FK5džH1jPPPh<hPPjjj VjM4%SP[WoVgUSWVt$vv0J! ~ N$ t ~N)É9|11ۉn$^ FV1^_[]USWV8] RsPQL u s s$s sst$t$0 )x" 1Nv9} +KsȉC S$1e^_[]ËD$p( 1ËD$@HpL1ËD$@HpL1USWVl$0EH|$SPW$ 1SWWVVjjj = tjm21҉tDH@tӉOGڄu܅tEۋl$0t/t)hr=#SD$ 膓L$ tEH/uj#EH@EH`L1^_[]/EHjSPr EHHLSWV t$ vDhׇ%WS 1WSSPPjjh3< SFDNHA`1 ^_[ËL$Ahh1USWVL$Ayt~܋\$;;tlHu\$klT$<ư\8L$A$0;N @4$vD$F@ F58Jme^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|94$ukGllPw{GX FPvUt~C $i)ىQRP& 1D7D77rfD7 D7 4$~Efn'  V)RQP& fNfF V/^_[]USWVt$ PQ\>1ۃt 1D$G jP>L$ A$W t׉\$ A mOu\$ 8fA |$tArfAA 1AA tAfAA͆ A /AvfAA) 91jEVVhhhrjJVjVQPhX84C(OL$<@C,SP{,BD$$4D$+{tR[L11HD$Cu5{t/t*Ch$PKuF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0$ƋEp$PVjWGU:ƃu4UtUƃuEtDjUуƃu:C(C,SP{,1s$C$10s$C$s(|C(1ۅÉ؃^_[]h$h $hlh$ USWVt$ kFllPvNj\$FFi )tkllklPRQ # ,$kl11CPs8Nj$ /L$s)RQt$ " 1/D/D/D/ m{l$ }$Ffs$fCEfC S-USى1M1^_[]WV$|$hWP t,1HhWWPjjPh+ WP1^_USWVD8t$ 1$V蹕/} V7$T$GD$ pjVD$D$ 1ɺ<t$$t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$$|$W- 1P15x8ss?lRP΢#W$P- CKKV5x8QP lRPW$V`- 1P5x8s3kRPW|$dW:- $D$Ht$L|$P 8D$TD$HPjt$( ƸPD$P$W  PVW  V`L$wA;L$D$4|$HD$0G 8GjRWjPl D$1Ex tjSrWjPB Ã|$tjTSWjP# jU;WjP ۉt$t2t.$L$ PRVSƋ|$Whw$Q t$$|t%L$ PSƋ|$ Wh$Q| t$St-$L$ PRVƋ|$Whz$QK t$ "L$ PƋ|$Wh$Q' t$PSVWx8D$D$] ٹ}$L$ |D$ L$L$<1jPWSiRPh΢#j$P賟 t">tt$ Vh$D$DPs D$8D$ D$8t$XjVt$(1IQjFj QP  D$89D$ t PV$Pn |$YtZV MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV* )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơx8}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP׌ $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPfVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋x81щT$1)΋EM M1WRQPIeljT$1Pt$uu.e)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSdD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$h΢#jV跚 C `L$rL$DPhg$uL$DPhl$jQz D$D---D$D$s 8CjO SjPX ƋEx tjPg SjP7 1jQK SjP ÍD$ tSWVh$P SVh$P VWSzx8D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`h΢#j$P* t"?tt$ Wh$D$LP D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t P$PW+h{{ t|$uuxD$t HL>@D> >jhT> wE%rh_D $uR1jPPPhwhPj jjj%VjM4x!t$PwWV胾1@^_[]h$h$hh$Ҫ WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ @&N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; `&tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$VhV#jS葑 t$]E#fEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuB$huD$ PD$(PD$0P|$W xt$ t$(t$0h>$hTL$.hdf2jjhX$-D8,jhP  D8$WzM(@)3P9&D8$P D8ǁ$1hh^D$ }~e1D$,=X8 D$$)Pt$ttt tUhg$h D$P$El$ ;(|D$ Pj-[D$ |$L$ X8T$򋄂 ȃT8HL$HL$@ D$14^_[]oSWV=P8u9t$bjP裇 Vthj贿1ۉ^_[USWVD$x(t[o0'ƋpPVUjh賠WuhvjjB1ۉ^_[]ðËL$=P8u1/1|$tL$=P8u 1B 1B1Uzh$Rh$jD$ 1ɉQQPRjhO2t $5 D$th$jV]1@1@USWV}1t8p8tL$ T$QRWЃ uGOL$ D$GOL$$D$ T8@D$ L$D8;\`}3GQqO9‰ω|ω t؉ t8p8+1}hj薚u} D$D$D$ D$1D$,1ɉ$u/\$,3\$1 \$ D$ Ë$>t#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hIjlu t1@t=T8t@u.1}hjؘu tEx ~$rth$tV$M u@=Uu,>t'D$ L$D8;\M`|ˀuK(Ѓt tu tP7jZjWQWƍD$(PV9"$1 $$QPVV $VW9$ul$`=u]tP$PS6 $5fǃU'VbWWh $h$ uGe^_[]SWV0\$@1҉1 F FFF =P8tjP4D$VjRRS,0<^_[USWVD8(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$h$jt1e^]USWV8=P8EM 0~klP1,ËE E8؃lklQSP ߾&D8$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C t$V|$Wh$^ 8VWh$Pwt 58Ih$H0蚴PVh7$j[1PP>rvV;D0$ t$t$Vh$hWp t$Z= 8tWh$Ps 58 Wh $h$k 1 ^_[]SWVt$|$Fpc1V$t$;J8tSh$PLs 58 Sh$h $Pk WV1^_[WV1|$hVW~* hWVhd?t[he|8<$jj8$t$WPQhWh$h 1^_yy1/ h;$Y1hh$hfUSWV\$p|$LhjW) t [10P2D$D$tt;un莁8DP2+txh$D$ Pj 8t PnhA$h8j FPH:;4PSh$D$Pjs8t#D$$P8Pt$h$S q \$S8$S^<$s lP2>0lP29$Ph7$h8j8XP2E;h8h8h8W$ 1 P21Ctu 0+wt"L$o oo/C G FL$5l;s1WW5p; 5p;諧5p;]sD$LhLWWh(hj&jFWjWVPW;4ƍD$PVV(\^_[]|8h6jP/xVFumhKSWV|$D$L$p6ƋS(VPh$W.^_[fL$1SWVPӉh$kh""Plo tǃuOWjj1hO$M=8th$/Ph1$Wn h$Ph1$ *Wjj(h$pVh$Wn W7 @th$h$Pj8h$Ph $Qjuh$P| 8t 4$Vh#$Pn 584$jhl!VG9 1ۅVD؃^_[ËL$1Bf9"Vt$=8u!w v81;59s 9k4ȃ(^Vt$=8ueN1wX&P^ËL$1WVt$|$L$ ȉ1<ɉ^_WVPt$j Wt$ 9tthu1^_1B^_M=8u8ËL$USWV|$=8u1t$USWV D$ =8u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS! F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ hL$h4$heh$z USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]h\$|$ $T$ tuR|$Nj\$QPSWh L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$9u @q9D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$&d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth|1Ot1L$D1 L$8ɋT$]t"9tjQPT$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(9u ^o9D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$&t$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh|*11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQ |$ƄE C ^_[]WVt$ hjP ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut$1^_[]Ãt ux(tthEԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPV >uD$ D$iousD$fictO4uQG4 t51ҋ5m2D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuD l$(Ph$U h""Uu_ [Ɖ$Uh$j%t D$Ph$Vt wXw\w`h$VsPwdh$VswTh$Vs f1ۍ{aE4&WuWuWh$Vs E< t<uEMPWQWh+$Vjs$<I$9|"PVCsC9z1h$W sVJ' D$PD$Pt$\$4ShP$h:$WS l 1(^_[]h$h$hBh,$h$h1hE$h$h h]$h$hhx$h$hh$p USWVhj|{1O1ۍD$ShPS$4 {9+ōF,PhedAU l$$4$0$($<$8у|1҉$$ F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$~t98t4 .jPL$Q D 9D$ u D$4$ ,$F n$9Љ} 1F$F )ЃF n$,$G9t$3$$h`$jP2 r=t31>t9>u 9>t0uk9uV"VOVU,31@19$,|;ЃVՀt$2؁^_[]USWVHD$1Pu譇Rhjy;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d̬&u{ FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h$hp$jg6h,$hp$jh(hE$hp$jih]$hp$jj hx$hp$jkh$j D$T$ L$DrRQP9 ËD$Djt$ P@ USWVl$j/U*P 1NtbNj\$)CDWPU" uHD/t(t+t!u GF "u^_[USWVPӉ΃=8ui"sv<8 99tx(9w4Ju1AQPvã99H 9k4+$1 4+Vhׇ%jRR 1D+ <+ htVPhR2%jWVR 1D+'<+(D+($D+,t+0^_[]V΃=8un8) 1t(@"u9t 99t 4Hu1^USWV|$4L$0Rt$`VQWT ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=9u \9~V19|(1@@89|~@w1A^_[USWVP=9|$(L$111=̬&"\$uӀt0t u@tӋ;t&tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h̬&t$(t$(t$(PPt$0t& 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVmhh̬&h$8 $8l8x11KjyeƃwD݀&DtGCuޅtH=9P;e9t)1ɀ<t |&AuVu^_[1V 9t(91t ҡ9 9F9r9PDu^fUSWVPt$謺1h蛺4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$h7$jQQWRjjh$,1^_[]USWVhu}WWPHD$T$D8L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhvD8@u ǀ@>1t$(F F>D$,Vt$i|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W72D$0F;trԋL$4T$B9rwP,1|$4r!1FD$0P1F;t$4rD$0=04D$p#D$6D$vD$  d"1ۺL$#PWVSh0RQt$kPWd"PShPVD8VL$'Qt$t$t$ t$PPh*f$h~]$SD8$0Y$D8$p8Ft$uD$D$\$(1t1D$pT$xPRVу t\$8CfCCffC C CfCC=9rC fC*C,G1ۍD$(hvSSSSSSSjjWPhߑ48P谑@,ut$VW蟃W賒FuQ1K58nt P{nt$n58an1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h$h$hyh$^R USWV$(E]0HƋEp8ljl$E@ t Pd"PWVSjh[1U5x8|$ wwx$t$R5 8RPSQV; U5x8w$w Bl$45 8RPSPU^; G\$skh|SjPLC PKVd8j!h$V- Vh/qB%L$5 8PRUQ: h$5 8PqB%PUS: hשPSD$Ph$hh 8: 1҃9Q8A \߉$4荩PWhҠ#j$W:: hWh 8 Nw@EƆ8 Ft3N$t.1@Ƅ8-H9s Nr,Ŭ8$EBL$ ;QU 8Vh $W莸 Vh8W h~]$貶İ^_[]USWVX] E81hd"PPPPh$PPY9 9_ vSL$QSWPL t@D$ tWD$8uN 8uhR 8D$9H*hd"VhӠ#Ep6b+D$8u RPt QPVW҃x81VSt$t$nD$$VSt$t$UL$8QRPt$ t$h$EpaD$V9p1h$YQVu WPTtY$UtOwGD$VP)vVQj P W@ )Q$YQP H LCF;puD$VPh $Epa e^_[]USWVLt$`T$d\$1*kvs0C41GPjhQ2  9u vEL$QVUPL 1hPPhY hQ hj6Pjjt$(SP΃4ōt$ VPuU貄S`~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 58W`|$.8L$`ʉAfAD$ 1Ƀx fJ1O S`1L^_[]USWVpU t$01^F4jj Y1AǾ&D$ǃ@&SPHD$ $D8L1OًP|T$|$`1 |$0jP4D$DD$ x8|$ 9ϋ$|$1HPPVt$t$WRQjD$L$4t&t u$Ut$ t$ h|$jt$SMW $ ^_[]USWVՉfD$/D$jh %ZD$5耔t&w8tmSPh$hU!# VSU 991j/U t5ÍD$9tK9vH8/t@P CߍD$ PWAj D$%= h$PW FƄ$/u&茓$QPh7$hU9" /h$PU hh %U e=@uW x*|$VW$Pr 9r> ? 0|$W W 01Ĉ^_[]hUb t}/u }$$tcD$U9 W. Ɓ`|$tVh$U 9=VWU۟ 9%|$W x(W7 >1F1S 0jh+"j SWVύD$ PQg 1xVD$)tOjWgx@ljj PW W( u $=rɁ uƉĜ^_[USWV h:ljPhW@jl \$hjS jh$D$ƍD$ PhW@V t$1hUSR ,$&tWP u- 8D$C nE,$ !u1L$PPPPhjPPjjj!Qhk4t$t%jɎt$VW]Wl6V ^_[]VD$@t(L$ 4@&VhW1( F$81@^ËD$ 8fH轏 $8tPPQQQh$j۴USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj \>D$48T$y:D$ػ˺#L$~D$<P t3d"D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$d"t$DRQPh$jV D$ T$Bj5x8QP d"t]%t$DQRPh$jV D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5 8t$h7$jt$hVD$XP1WWjjj0?,x8|$4D$0D8L$QW<W,D$DPV-~ljӍD$DPV |$߉څu D$$H؋Pٸ"D$<hn$t$V |$,] {t+[1h$S* t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#ZPt$h7$jt$hVD$XP1PPjjj0˒,j D$DPV  D$׋D$@tm2@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSWy )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5x8PQ |$ RPh΢#jW ; 8CVІSjP jPPh'8 V,A(^_[WVt$ 5p;GR5p;~$uFjP):F$1O~(1h'8QQh%h$hRjFj WjPv$h(8c4F(x;F,VP|Uv(dv$@F(F$~,v$b@F$1^_USWV4ˋA@Pjq$I C{$t%K0 u G fG lJu&fG G5G1G G,=3G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPb+{$4^_[]V$j)#Nv811Fu >tlIut5t.j+Tj,HL$PVho$jPQ 'u tEj,j+L$jPPQo h"Äj*L$QjP5 h~]$蜄j-˃t$R5 8Ph#jFVv j.覃h&PVh $hh(8N İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5x8RQ L$RPh+#jQ G<(\(|(Pu#]j#L$>PSWh$j&Q%j5x8SWT L$t$>QRPh$j&Vq $F|(,u)|$hh艂Ph*$j(W> <$1e<(Ou*?D(Ltۍt$hBPWh'$t$t(Tt(PGPWh#j(V 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPh6$v;t 4$4<|$|$upd^_[]1؍L$>PWh $j&Q@  $L(4RttD(8tPQ҃lj$uFt(Tt(PNlj$FD(Lt&ht$PWh'$j(V 4$hVjP lj|$D(dph蹀PVh/$j(Wm *USWVD8$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPváD8H1WjHDWWQZơD8$1$ D8@u <@TX uDHXT=|8tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W Wd"WRPPQ袱1ҍD$*W Qd"QRhQPuD$$W Qd"Q1Qh0QPM&)ߋD80K~D$p:~L$$QL$.QL$QPt$SPW. D80~Njp}L$$QL$.QL$QPWSSj' / h~]$要0}|$p}G$DŽ$$T$0<$tT$@BfBB5ffJ B 5BfJB5B fJ*B,5=9r~(uB0fB:B<5@1L$0hvWWWWWWWjjPQhFZ4t8PZ@,u$PSLS[$X(؃u D8TXK$&V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VP-D$0VPQ-VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u h$P T$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV5D8Q t@D$4D$8GD$*NjT$\C$BCHfJkllPs*ʼnCD$DklL$s)Ɖ)$ى@RQPst T$*lklQt$PVt 1DDD $1D50 D58j D5dtIL$ HL$T$PD=hD$PzSL$`D=4(D$P6D=hD$PL$`1|$DT$\fBA.1NH^_[]ËD$@1ËD$@1ËD$@1ËD$@1ËD$@1USWVxˋuyD$1 |$$B9T$Ju UD$})Ɖߋ] ˉt$w\$_ }}} ދ\$CKT$,9‰|$}+D$,L$D$L$CK CjlP&CtH{hh&P @=rID$$t?x,u xPtlIu&58t1IHH Pt$$VW5D8 >|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!h L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Oh$D$ P t5hn$t$ u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0p8)ދt8\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$ L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$( L$)։t$ t$A58 1Fh$h$h]hE$d L$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4Su)y8u.q$t"y8uqxu Hu^hA#h$hm h$\ D$x8u@hA#h$hm h$5 V 8; D8tD8t99t‹9u€82t 8^WV΋$tRttyu)89tЋ9u80u1H|$58,1C1҉T TTCD k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D $k"PWh$u"D4\@xt 1ɍ$4jQjQhRVSЃ u fDŽ$4-L$QVSPL tt t 9uP=t$$t$$袍ƋD$&$4WVPh$hS M$4jt$t$8u"DH $4jj hd"QPjSoSW"?D$5$4wh$PX w01k,Cy uC,1uSPQD$=PFL Ph $D$=P.L 10u?x@t$5w L$ 5 9h8~8Ph%$ht$%V hV$ P> L$ 5 9l8$~pPh,$ht$%V藿 hVUh> L$ 5 9p8~1Ph3$ht$%VX hVU)> L$ 5 97 878h:$ht$)V hVU= 9t$PUhD$hZUD$ 9ts $|$|$ u^ 0D0<4t|88uL$81ɋT<|Dtsu|$ $D$@¸Ѓ=8@D$1HD$$D$1i8 9$P58\$ "$x 1ۋWSPQL $($0}U$W Wr |8/tWb fDŽ/ 9 $< R? P$PW t $L|$$t0|$t)$P t$ 9Ǎ$vl$t$؉\$C$;X |$O|$\$@|$5D$tL$4= 9,$Vl  PVh$hD$)P\ 5 9.d"tL"PS踵 >tiD$Pt>Sh$hR$\$  9$DL$4L$0 90|]t$VPhP$WR 9( ( PQVhW$WQt$\$ CCa5 9.> >,>(>$> D$)Pt>Sh$hsQ$$(t$,t$(r 8t PW x81`8tWWh$CVWhH$hdf2ؽ 8t8WhH$P 81Ntjh$P褽 ^_[]1N=8tt$h$jPP SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ D8V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$׿$ytPhptYWtDžtFE tWPV u WV0jVSZ E t VPcV]1HPPSw ƃxx80^_[]hA#h$hm h$ USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4Դ&jP8 D$$tI4 R2N wT$<.$&81N8RP/׉Vj 1G$h,jw~/"01 2 |$4hf"PWǮ 1PWWVVjjUS' WU% xL$<1$^_[]USWV4T$H1z$X11D:tL\$St:PQL t2L$ D$; $…u $;Չډ $ڃ,ut B$Hrt)u.$CM$։$B(r,Jֺ#h 9^~x14^_[]ËD$1A1҉PPP PP@ HH $hLRPh USWV l$8fD$-58u61ۿԴ&VPx 9މuڃ58J\$<|$4$̳&h6  SPVh$Woh7Ǹsu8j5x8 >v L$RPh΢#jQ` 58h8oh9s1PYPWVh$U^4du31P"L$Ph $jQӫ 58h:t)u D$ hf"jP蒫 58h;t)u D$$hf"jPQ 58h<zt)u D$(hf"jP 58h=<t)u D$,hf"jPժ 58h>L$QPVh$W ^_[]USWV$@1K $ $&_ 1hSSVVjjh?"  /t$l$ WSUf UhU$WS( Su |/D1l1_D8, 1@WV<VH /11 11$A t1$B$J1$C( 1tiu`$D,\$ D$4hf"US躨 1USSVVjjt$H! SJ xL$1^_[]WV|$ 1uOG PNs t/1; }OR("h 9x 71^_WVt$ F1hWPb dž dž dž$dž(dž,P40^_USWV$h_t$hPV d $$$&D$@{tUh $V& USV% 8Ouڋ$xhNuhO,SPhT$V}C(~Phf"hVʦ }hPHC,~Phf"hV襦 }hQ#C0~Ph^$hV耦 }hRVPhT$W^_[]USWV$0R2u*11IhvPPPPjj PQQjhR2P40R2Nw'$T($,&WP1N1jWWVVjjhSa lU, V0D$4hf"QP艥 1PD$PPVVjjU D$P x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jPg_ \Qkd)Qhb$V/ ^_USWV$h_|$hPW` $$$D&{hX@ VPhT${hY!vvPhi$W"[hZ1~,t[h[1~0W[h\ǃ4Ven uh_V0FT~Phž"hWA sh][h`^1~`{h^AvXPhu$WF\~Ph^$hWݢ sh_mFd~Phf"hW踢 shaHFh~Phf"hW蓢 shb#Fl~Phž"hWn shcWPhT$V/[hd~1~pPgPWhT$Sm^_[]USWV$@1N R$hT$x& 1jWWVVjjhe|Gl=OlD8,1۹fWS<S1,G,10G041jWWVVjjhg 1`G`iX"j\kd lhD$4hf"QP 1PD$PPVVjjUh D$Pf x1pGp1^_[]1wwVt$F~|F P[k t1@1FF^SWVT$1ۉZBr 1Bl@ZpQkd)Qh$V/+ ^_[VVWh$t$ # ^_[]ÐUSWV$8tW蹄ƅuWh8"j$$<$4D$Phd@U tj1OLVhedAUU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h$t$#1 Sh8"U- CPhB9"U C Ph9"U CPh9"U CPh&9"U CK,C,Qh99"U} C0PhN9"Uk $@D$t P^1-Uhzd@$<WT t1 VhedAWT hjUT D$ P$4 D$, 9L$L$9u0$S11:p 8tx$0h8" b$11҉ $ƅ*ŰP舭j PUU ^_[]$0h8"j虁USWV81ۍD$4ShPSu41NtAljSPSWuW~tuMU D$t$$$Q1e^_[]f=8=8 á8thE)8Vt$8uhEv)89w1 k<8^Vt$=8u hEC)1t*u8 8t892tu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_hI$h2$hh$蔬 SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F&tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$8uh8s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IO sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPWO &Ow$$$&@21^_[Ã!t*Wp1@<QWPV.P rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Ph$QV D$D$uPh$j{t1ۉ؁^_[]E@USWVx$ 8U $=8$D$d D$`t$0Sh$jP Sh)$D$dPjjDjVǻ"St$`lSjlD$0D$XD$(D$HD$D$D$4D$ D$L1D$$D$TD$PD$8D$<D$DD$@|$\$D$y1$D$ D$D$1h5"V脟 -À8tt<L$D$j jSNq lj$h#SS L$ ٹL$ L$Xuj jSq D$D$(|$t#D$(^j jSp D$ T$G|$,|$,D$D$(|$y|$ythh $Wh hSWY |$,E1Wt$4j WSrp lj$ teD$ʉ $tTD$ D$tJjh%#$S tOjh3#S tdjh#S tp|$uh"jjD$0wT$ ׋ $L$BD$DT$@|$<|$TL$P+|$T$D$P|$D$4|$\$|$ $D$D$$j hk&$P. hj4$ۍL$ytȍJ@j`PQT$(> L$( $A0y,D$A8D$ A4D$Hu6|$d\$t/ȃt$`P/Q L$$uD$H\$ȋT$Lt D$ D$8D$ L$L|$ظD$$D$Xh"j iD$0T|$\$JD$ D$8D$<D$DD$@D$D$41D$$D$(D$ G,D$8G D$tPvfWW߅uvF^_[;hq$hh$hh$蕒 D$ph$j iSWV=858t^s3ߥtr=#$t$j(PV6 4$蝣_u9ht|$0VPh#jxWy WVV &t Ĩ^_h#h$hh$觏 USWVσ=8u hE 1t0?t+8t!-8E WPH tt/|$thh=L%S !hvS u4$$$$$St$h$j# ^_[]SWVD$Qt$Rh$Pjh"t$[$jhX&PB uWh"jZ$tAt$h5"W/ 8tjt$2h"jZ$ut$補1ۉ؃^_[USWVӉ΋|$|$tBh$S(B h$SB h$SA h$SA h$SA h$SA h$SA \$h "S* ǀ?t( #(&WPgA uE F@j`WV-. -j(W tj)P t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ A tLu;1ɉL$ L$L$ $1111ۉfwfWGO D$ G D$fG1^_[]Ë|&D$ x&D$t&D$p&$D$fGD$fGD$GD$ G L$ G A똋$t$T$L$ fUSWVTt$ht&D$v&D$ x&D$y&D$z&${&|&}&~&&PQRVUt$t$t$$t$,t$4p&ḥ#j@\$HSn 8&&Sփ UT^_[]ÐUSWV t$ D8480h>$h\$|$USWV[x4$t$t$h>$hUSWV t4$t$t$VЃVo$^_[]USWVD$4D$D$0D$ D80 $48DHD$,D$D$(D$jh>VU6 |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hIPl$ 3hf"WUl WUUj9U H>wѻPD$x0hf"SUk SUUjUt H=wˉD8DD$H1Ƀ|1M1҉$PVRUG5 1Q\$ SRP55 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á8tq.8Vt$ 8u W. 819vFt=N 9wu1wT 98:9^ËD$Hs-s ̼&.hA#h$hh;$m Vt$ =8u-(t;u2L$ rȃs&$tu 091 8:9L9^WVP|$t$=8uI-j PV =v1t-ht X 9t4T 9^_Ë $9u։^_-=P&9tL&9ù^-D$1ËL$T$t$ h5.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jh|-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh@-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G WhD,^_USWVP} uD$Phf,D$PhH,1\$}UM;t;Gs} Sh@$q} ~Sh$yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW ! L$D$ T$VQPRt$Vh$h$Pe $L1QhPjVFx`WhydPA D$VA|$t;jWSA" \$;MU}h$h$h h;${ 1e^_[]RSQ! Sh$RQKe ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVS^ )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋HT 9)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV6g )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SU @$\Cǃ1:k0hWV D$4WhPW$XmD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(!+tÉ|$UFd#D$0jPUQt$(*1 Ⱦu#\$,hPt$  Wnt|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,P P蛡D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjjtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14pFuUpt$D$l$x P"tn{ C K$;}sL$4QjSPL t_D$HtWT 9)1ɉAw Puu2S"j@jPH fdžUS#p1ۉ؁4^_[]h$h$hh;$k\ USWV4D$L D$PhjiƋl$X\$T|$H&WU F|11Kn^؃N$F Fdž?džjh>USi @džPWTvt%D$ D$D$D$F114^_[]h$h[$hh;$X[ USWVhED$$11@D$|$ t&1ɀ8>@,19QvPWJ D$vP6* 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[hC$h'$hxh;$2D USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D7虻15\Q95XQ95`Q9D$D$ D$1D$hs$WUd; pu <;`Q9e~ft$lt*zD$ƒbtCeubD$벡<;D$ ChjVV5<;h~$ \Q9XQ9zVhVV5<;h# D$Vu=_29}4D$$D$l$ t%1PPU D$yUh $IL$ tHt$(Uh$V證 hM"6uRh$fD$0Pt$ #D$8=$$ \Q9XQ9jÍt$0ShVL u UPV= UjD$0, \Q9XQ9Shy h$t$(T1|$P)y h$蛑 y h$vuWjt$~(1St$o(4$tt$h$Sh=#PPct1h$t$t$%(4$*t$5lQ95hQ9pQ9 f2|$tdf2tQ9f2trf2=l$u1HL$(Qhht@Pb PtL$* xQ9t$Buh$lʼnP'yh]$Tf D$ yh$@$uBL$$4jPC'4$Ht$<V6с6h)$jPhj K j|$WUt$ x>tq1.SPt$ t y 19u2hQ9lQ9)u 8t1FVh;$1FVShI$VEt$lD$D$L$D$ L$ D$|$tvD$ PEƋT$ уƉǃtωÁtt؉D$ u ; 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj UQL$ɋD$tP" V P hd"PVhi$hdf2* j! V jV jR VP^Ð=4R2u 4R2tQ9@=u1HP 1;4R2USWV}uCjhQ9 Q9Q9Q9Q9Q9Q9Q9 Q9 Q9Q9|$(jW 5Q95hQ9Q9lQ9?X+=Q9Q9@1;Q9)ω|$$\$ Q995Q9T$s;D$0Q9D$(L$, Q9Q9Q9D$Q9D$$D$ =pQ9EtQ1$w ww7wwVWV! 7www ww$PWj: M$1~~~ ~~$PVj 1@F ~~~~WVW  =pQ9B5fDŽ$ `Q9t$Ph $hQ#% 1F\Q9 XQ9ƒ\$\$xT$T$|l$x@%ݜ$݄$ %L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Wh&$QPq$ xQ99|ӡ`Q9tPL$2 L$)΅~DQ4))hd"Sh$&Rh&$QP# Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4 &QPh&$SW{# L$(+ Q9T$,Q9NjD$0+Q9x@B‰L$hT$ll$h\$@lQ9 hQ91F؃D$@5%|$vqL$`\$dl$`@%ݜ$ܼ$ %1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4 &RSt$Dh'$QP!  \Q9XQ9ȃ||=lQ9hQ9݄$|=s4;T$D$r(|$$\$ ؍4)h)'$؍4)h'$QPi! ƃ}u 4)h"QPC! ơtQ9@=u1H$VQP e^_[]+Q9 Q9T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppr"u%h$T 8t 8#u$SjV= tGtV $1E48FB$)Ex t$7@[h$h$,z h$h$c 7h$h$eS^_[]$Vj$A3t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhI"jPEuh$h${RÉhPKt4Vhd"jPMEuh$h$-R1H^_[USWVp $$$!19L$PVW1Hl$U ƃUU* VD$PW tb$UtM$dt(# $dPU t$jW tu)$-j4'WU) 1Hp^_[]Ë$j-UP D$L$PjD$L$PjSVt$ t P닆t>PDadžW1ۃ1ۋt9PlDdž- t^[V* V( 1u 19^SWVlT$|$$VPC1Nt/ǍD$P PSWU t Wcl^_[USWVӉjh0jQ ǃt{jjjV L$ F"td"h"tŃO$d"d"t G$؉d"t %|$ud"SQRPhW$jhV ^_[]USWV$=~ 71Ha~B11ۋ$4V <(Gs@ ,PVQ C$9u1$WQ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)% jj7ƅuƋNtHNO N uFF9sSP8tVF^ St$P ^GNON1wOWh &Pw {@v>V=1H^_[SWV$uSht$h$EM $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6 8  89h$h$LNF G8~ ~u3FVh &jv S?uh$h$3Lt6hWv  t%uh$LPWVu  s V^_[WVp׉$ftPh7$h$K jL$PQW jjP PjW tnjjW t\PjW tHD$|PWV t2Ph &jp >u6h7$h$J"h7$JW h7$Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Sbڃs tAt1t% t&%S@ su^_[]USWVt$48`ځ% t0ty@ !ȉف tV @t !ف tVat ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jW jW 5^_WVPt$4%@5@u^t8tW%Vy $%8Vh+j?#45@u`V,2<jP,q u h$G,dž,sh$|Gj?3 t1t3u5y $0# $1Ph$F # $1PWh$F^_WVt$ hu"pG8r4@84^_8t8t uh$W譬jJ>^_USWVD\$\t$XFtt+NQT$PQhj@Ruh$FD$n D$SPU69Vt)ǍFxۉ,$t1j@SP SUh$$F SUh$E 1KNދl$Xue^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uVr'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j$(ǃ,f@K(1ɉHHH HrF>rD&>C5F $P w_ǍCWt$P ;)QjP h$Cu^_[]ËFUSWV |$8t$4l$Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQhd$d> SWVt$~ t^_[ËD$|$F @PWDr( ~ t͉^_[gV6uYh$Q肣~PtVAt(t NLtM"tM$PV9^WVt$ >~Lxw16tЄuOF$uItV@u h$4=jjAV? u h$=^_vF$ljjVz? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph3$;G$C$G>C>>-ك**PWQ4 WtHAt[ƃx t Ph$p;$KFNtTHNUh$; 1O 1OOWt#QWtJV<1V\$ GtIO9tA t1UhI$:@1ۉSSD% 1G|$ ~UVt$$H? { t S^\$ HPtQPV P-<uV[+US?^_[]USWV׉΋A Ph$6:11BU$tPVVUU1n 6ujn1^_[]USWV $ D$PQhhat$hl$h]$9$1Ph$91F\$ MbihS$( EuVh$?9uS 87t I 8 uF띃tVh$9D$$ \XPW>&Ƌt8t* SV>uSj$( ҋ>$ 1GOtHONG Pt=;uFGGtIO9tA t3@UUD" ;WQjj.>jV(t0<t$VtSB< t<=VS= hl$7 ^_[]Vt$N Qt<tv$vLP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/? 7 Vh$h^"!7T$1|$`F(f9t(~ tωӍV QPRh$6ڋL$tf~(^>8u(F*4$QPω~E ~ tcF D$F*|$ <UWSPωT$ P\$Sh$6 <PUt$WPSh8$5T$ V>t*4$QV2 H^_[]WVt$4rDD$ tN8tCt;D$ jP,L u!hU$h$5 j-^_Ã~+ajjj ̓kh$h$hf$5 1m9h$h$hf$4 <6Rh$5@h}$h$hf$4 111dh5%h$hf$w4 @+X1BWDPU h}$hv$hf$14 11G1=Q9Q96u P9W+Q9zh$h$hf$3 t0S vPh$44WVP1PPPVCD@PjVlN48@t @ sfyt ‰48WV{K^_USWVP$t8D$ \$9}$w ŋD$4Vi tE9u݋D$ 9t9 u~<$h$Wm1PPt$$ sUVW s W@W;9t>G 1PPt$$ UWD$$ W42D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1G@8u^_[]USWV \$@l$8;h $W .h$W !h,$W D$$D$h<$W| |$t$<t$ ǃt1Fl$<4 GF9uW$t$<l$U WUD$P$ E t=1FߋD$@D$PK Wt$U EE F9t$@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[] |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tW tFt$9t$V_Ѓ с u VXV{^USWV$1t$t$($|/xhY$W h $W \$,hVS jjǃ0r$8R21O$$0@4jV)9u11@PP$u1Ajj uD$l$(D$ D$D$$d$t$Uh&P$Vc?u$duiM)4tQ6uD$ 럍Hv H w?$L&<;$\w$(&D$$D$[D$ PxGD$$D$2 $d 1@D$D$D$$h5<;fp $hD$$D$D$$1@D$x ˀD$D$FD$9_2t$bS{($h($$p$l_2)$艄$\$,Su1VVVS6$U$PjSA\$h%L D$9_2$4$|$0W ?_21VV4Wo6&$$Pjl$|$t\UHrBPt$h$# t$\$ S*g 8$Ut $`$d$`$d_2T$ QR$4 $$`h!h$l$,<$茄D$ t<t,<ulh,%@H D@Ug uDh%H LHUL h%G TPUCs D$1D VhT""4$h!h$"D$1Cl$,$bu Uuh!h$d"D$PU'$tCt)QqtrqpQ#$PDŽ$WU':$t P菵 $ }$nUqq$VU# U+A$;8R2t P%$dP@1uh$ !$dt3$Xt'L$jQP uh!h$#!$j"$hh f2 $$d ؁^_[]Ë$r,u'_2Qj$4 $u*$`1PQQw $$c@u hU$$VUI hx$$`5 $d$`$dUh`jj$=t'Uh`j$($}h!h$h!h$D$L$Ph:$U$"hF#(L 8th!h$3$`) L$a 8 S$`$d$dl$,hh$, u!贼 8th$h!h$ hh$, u!| 8th$h!h$^ U芺tUh!h$Uh4$1k$`r;$d@ щ$`$dU*tePh!h$KD$ Pjh0j,mK hm"yUPh$ U$`$d҃ ց uK$`$dr>1r_2$L$ QPUM W$`$d$r _2$d"d"t$ t$VQRhV%+rU{\$,1D$WhPiu h$ShN]j$$nuh!h$N$u($`r$d$d$`L$$PQS!$"$1l$,~O$4P t x u$$$4PF$$9|t$t׃z Ru$dh3$P_S[$bhM$Jhn~%yD$ L$$$XPǽUh\\j$d$ uh!h$:lH $dhV$o$dD$ L$$$XQ1Uh\\j$d$W uh!h$7S$D$xh!h$`_h$h!h$9h!hK$*h!h$h!h$ $O3b Pha$$`m$8l$,t01 t$VV$ uً$t$VPS VSmD$$b@t S$$1t*1G{ tS!u΋[uً$`<$$r>$1Ʌt z uRl$,<$$l$,<$$u@u0$d@ht$PJD$,PB't#%@tD$,Ph+Qj$dWD$0P"0$01~ tVh5jj$$vSά WVjh$莹t*VPMuVh$MWAh$h0#0^_Vt$V<t$pApdr$Ph$NjjtVh[jdj ^WVPt$D$uPhJ%h$ jP,q tuIhJ%h8uM, ,Ndž,>wt=D$|$ffN(ffOfuj[ ȉG_1_F*N>QPST F>)^_[USWV$lt pvh)%PWj t=wM$lD 8th)%h $h$u)hW%h)%hh=% $$l~>1ɀhL QSP ƍl$hUPt$ ͵U =wfD @PUhh)%W=udhW%h%htI{>tA,$fEC(ffEEK*S>RQP̏ C>4() PR1pČ^_[]ÍF Ph`%n tt {>u[[ht h%? ~>t$fF(ffCCN*V>RQP1 F>4)mC Ph% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#芪 1HXju V >8t~L$ T$pFhf@H X@fPFM1^_[]h4%h $hGhB%h $hHh% D$tFL$tt 9Jt ө  Ʃ 1HBH@M1@h4%h_%hh% USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;v 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$h4%h%h h%h%hh%h%hh% L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]h4%hr%h|h% D$t L$HH@Lh4%h%hh% D$t@Lh4%h%hh%l 11WVD$ t!L$T$t$|$x0p4P8H<1^_h4%h%hh%" USWV(l$<\$߾Ⱦ&1|$ |$|$<$E4t.1FM0 I?r E4  G9rՉt$@PjY 1Nt91D$ D$D$D$9E4t$1E0jS4ǜ t G;}4r1(^_[]h4%h $hYh%B Q9tD$ Q9QQ9Q9WVjPj1tMƃPjt/1vN F NN F N$(F(N,FH VL^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t PNSv@1F@FDFMF t@PtQPV P؋PtQPV$ PjF uPtQPV, PBF(uFN^_[jt$USWVu-~L =Q9t'Q9H Q9Q9N8tv|x| @t,'\$$df2SVU Uj $ tv 臚 7 z V1H11Ʌt $BD<IG9uލ|$$ ^ F>L$jPWVt uF>*PWV} 1T^_[]VD$0tVUjV v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8`VGw}uM ufE O $PJt $jSVPUQt$4Vjt$8]$?=^_[]ËL$1t$VËD$t 0F. VD$0tVBVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV{ Fjŋ$@V' $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP诏 tًv\$~;1$D$0Pt脏 tF9u19D$$"$8ЃD$P1~11TjT$4R46 t GP9|PX~11\jT$4R4 t FX9|XD$ 9D$H$~11LjT$4R4覗 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$WuVh%t$ 0|$w$H;D$t$\hjSKlj$w jD$4PVz CG$C D$ jt$ VUz C yQPD$|Py D$lD$ @D$pUhi$@x l$D$m@t$ FGF<<y<$l$D$0P$0蹌 R`~/1djT$4R4觕 F;`|ӰD$|$0WQe~t$\yWhD%e$_w ɺ@r <t5<(<$L$ 1@ut$hD%$1@fG(FG>O*VTPRQvw $t$6@u<$tW{tmWqG@WfGDGȉGHW~t GPGH$G sW}GLGMO9EVh%W%$7t)|$ jVWvw w_ jVSbw rՑ 1N^_[]j:SQ t/@1UQhQQj QP` G8mt舑 (G8GjSPv O t m2DPu:pKCu1l$PVhVVj USX` G0Et=it.u1@1QVhVVj VP%` <$ O4G4SWV$WjS_t F jPS v WSh~is tD$Đ^_[USWVP!D Q9 Q9 Q9Q9hw %FQ9 Q9 $<  O+VQP9r 9v1 LJ\$ I;<j,jU@t ǃD hO %Vj,j&Ht ǃL hO %'j,jPt ǃT hO %t$$Whp&Veq D$9rhO %h[ %[H$|$ 7D$PWD$t$h5"D$Pv ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW螖D$u?\$S~ J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0WAqD$t|#t3=w&AL$0hO %h^" HD$1D$S0Wq 1ɍD$D$$D$ 01D$ύD$PD$$PD$h5"D$Pp ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h#UU h%U? h3#U) $D1)h%U 1Ʌ<$t$VW| H9t- t u!H\Ht$9u1@$D$$<jPS草 1Ʌ $1@D$S$@tXtT$@S7 $1B*$Dt,t($DS $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$S1 `Dd<t A`NhO %<$Dt&u"t$ $<趆 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U&~ tu;uHUh %&D$uuUh0D#t$$t$$P&t$$^_[]USWVt$ t-tQN  8uP5|$t-tQ uPtt*t$1PPUe t xTuXTj卆jPW5 $@DtW,Du싾@WXHLtW,Lu싾HW&PTtW,Tu싾PWX\tWg,\u싾XW(V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(_2|$$t)`#L$# $ 1CƋl$ \$18$s$Sh&Pt$ujt$\L$,1VSWPUAjt$\t$ VSWUkU#jt$\t$$VSWUMUjt$\t$(VSWU|$Xj=|$\W= Ê@tC< t< u CCu1j h8 %Wt j hD %Wt jhQ %Wt jhx %Wt jhq %Wt jhg %W}t jhd %Wet jh %WMt jh %W5t Pjh %Wt 8j h %Wt ?L$P1T$XPfL$T$t$XVY(1Kj/V7< uD$|$PjP L$r L$rL$T$t$XV'1Kj/V; uD$|$P jP< XL$ r  L$ r  |$XDD$Pi4$PTt$X'TCD$P@3|$X D$P$;8R2t PB11j|$\W6!ƉD$V茼yjW t>th$Vr V$ǀl@F |$X L$P T$Xj #' D$X |$PjP^ <7h %h %OD$Xt$P jP h%|$Xx D$P$<t$Xd#  $<PU D$PX|$X h"|$\W3q t$1VWjWWWWPb L$P9>t$Xh % |$X t$1VWhWWWWt$tG L$PA 9>t$Xh! % |$Xt $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV"$6?mjt$\D$ 0USWVcO jt$\t$$USWVEOjt$\t$(D$Pt$P1t$X#džD$X= 84 j/PY7 1|$Pt@j/PC7 tƍt$X.#t/PF1V #6 |$X t$1VWjWWWWt$t_ L$P9>t$Xh= % L$P ЉT$jt$\# h%~|$Xq j,|$\WP6 * ƀx 9l$Ps%ƅ |$1WShSjSSt$tE ,9h %T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFuu냃|$X0t$1VWjWWWWt$t蔐 L$P9>:t$Xh % |$XD$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1Vl @jP   L$j ZP< t< lGG|$Xt$P$ft$X $h %|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P&$Ɛjt$\V3u7D$0J|s 8Ut$Xh %011IT$P  =D$P-D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hP V fFPfFSfFVfF^fdžƆ D$P f$6l$Ptu|$Xt hW %@D$X  y@Uh= %D$P |$X D$P D$P D$P |$Xn$6t$Pvih_ %fl$P@Dil$PPTT*BE$ E|$X.E$$(i1|$Xl$PX$\@D$P` D$P D$P D$P" D$P  D$P D$P u |$X4t$XVڪ@@ $dD |$X|$XG\$PH  @D$P D$P D$P@ D$P |$X$; l$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV|Fu8jt$\t$ USWVbFujt$\t$,USWVHF t$Xh %l$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tV賉 9]Vh %'D$PG D$P7 D$P ' D$P D$Pƀ D$P@|$Xt$1VWjWWWWt$t L$P9>t$Xh%|$Xtut$1VWjWWWWt$tو L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$t蛈 L$P9>At$Xh%Qh% %P C t$Xh %Wf` à \$S螮ƅ|$PPh %SVD  jvVj/t$\G, AL$1|$P# KD$ɋl$t t OGuh % N|$XoE1j:W+ l$t2At$1VUhUUUUQ  9.Mh % j=W]+  ED$(@1 t H@Wh} %+D$Pƀ 1K1t$P # $D$P1t$P D$X.U$ D$L$t$X3d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu `XNul$P(BjRQ豴 Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/Ut) SGJVh %>nT$P   xUh %=D$(h %J h %Ɔ <h % D$Pǀh % 1K$dVh+%D1DDD DD.u h % 1D$(1h$Wjh%W1xh>%Wh#WphhL"WZPh%WDJh%W.h9#Wzh%WhWs"Wh%W h%W> t$ h%W h%V h%Vs h%V] h%VGY hGS"V1Z h%VT h%VE hRc$V6 h%V' h%V h%V h %V h%V h%Vk hdE#VU Vh%  t KC  t KCWh- %Ɔ  xt$P1$ƀhuh %XttC< t< CuhG%0ǃh %D$,Kǃ%1CƆ 1CL$PTGt$P jW l 륉h,%W\ t-h,%W{\ th$Wi\ t h|%WG\ t@Ch%V-\ th%V\ D$P@ tsFH t t@@1 t H@ttC< t< Cuh`%ƇhhG%wsF< < F1$SUj tUh %1C CC"$f8l$1USjxSjSSW@~ $D9]$ƃWh %ttC< t< Cuhv%Ɔ L$P1S=flF D$PVa 7Ƈh'D$Pǀ 1'S #؄  H@เsƇhD$PǀFt< t< u GGu1L$l$S$ L$1W F 4$VÍD$PSN#CUPA#؃8L$QP.#D$PVSP SL$PT$Xj 6t$PjPja 1Ӄ  (jVtZl$P  h$" 1F؄t  H@h&%1K؃<^_[]ù@D$PǀǍ0PVj whg%F -{]< < Ch %G11|Kh@ ыD$* * h % C{K< t< tC C{< < Cht$1VWjWjDWWSy L$P9>sSh %8l$1S 1K;4$(ƍ|$WPQ FWPD 8UP5 D$P4$VP L$PT$XjCut$PjPFCt+j/S/ tIGC1L$P4 1D$PVSjZ u7tb\$1SVhVVVVW7x L$P93tQUh %tGSh %1F FF@dD$PƀMG=6 @/@(!  t$ %|$(t u$Wh%t$蜽t$1D$( s$t %@uh%j?suh%ItF1tC< t< Cuh2#Wt)Wk Åu"=1rWh%31ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP t(t$Qk,1҉T(T$T T!h %S螬IVD$0D$ FD$(F^ t8UM ljD$FWUP= >)QjPU= 1FFL$TT$`r|$\s72USWV׉ˋt$$VM >"u y"uIFA $Vj"ct*Ń!9 VSb ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=m2DWtCT41Fu|$ D$ |$jjD$P T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9vV 71M^_[]USWVՉϋR j=P ,$|$D$ VcJ 1ۉ\$t?t9D$ 1j=S )9uWVSM D$\EuVި4$v t5ƍEjPt$  4DL$h%Uh%h% |$$t#4$ tzSRD$hW%Ӎ D$tHTMPR) hz%h%hhW%蕍 Vt$t#1PPV/ t@Tt$ V0 ^Vt$t$Ƙ^h#%h%hdhW%/ SWV1SSQ. t&WV+ W蔠SSV|. Džu^_[WV|$ t^ǘ1PPWU. tPWe+ hƅthjV@1 ^_h%y1h#%h%huhW%n D$t L$tHThz%h%hh%h%hhW%0 Vt$t61tpT^h%h%hhW% WVt$D$ L$zVP' 9tVL 1^_ËD$HTt1Pt$ h%h%hhW%{ USWV\$tF+1PPU, t.jVU, 9^TuVU) V_u^_[]SWV D$4toHTty9|$0uPLjPWq% t<Ƌ\$8PW}) Sh/%j Wt VNV ^_[hz%h %h h%h %hh%h %hhW%l USWVa$c$L$<D$ VPU }W D$]8D$HVPS SVËET%t Etu%[Dž4D$ PUâD$ PU4D$1xPPD$P) jWD$Px) ËGTx tuvD$HthWt1GPt!G8PwT?u hU%wGt;D$TuG9t;D$TuWV! t߅PbGTWL$ Q! O|tp@|$u'OT;HTuG8 $8QPL$L$4$L$zQt$ o% 4$UuL$jyC6WD$ P! +OT;HTuO88PQ: WD$P$ WV5" 95G hL% WYYtGX $XPQL$ Ax;GxU>uF 8Vt hc%跨ňjjU9' jWU#' Gt ;D$TG9t ;D$TWU$ WV urGTL$tIѺ!! tD%WWj03u!E 8tE 8t h%ާW߅11SSVS& tLWVc# WU 9t!E hL%舧WSSV & Džu1VD$PVD$ PD^_[]t$ t$ hËT$11;T$ tэ HUSWVӉ΋BTx tt /4u$SGtCP7t1Wl$SVP DžGT;CTuQGt ;CtuFSWnu8GttCtuGKQPNuG8K8QP:%t%SGtr7tCtt-SjJ1D 8t h%Wj1u2C 8t(h%ե%t%ScSj0uC 8th%菥1ɅtWV2! W^_[]ËCT@$u Cx;Gx%Why%hr%h;hW%8 D$t%@<t <u øC /1h)%h%j;h% D$t%@<t <u øB /1h)%h4%jQh%貁 D$tBHttu#xðÃxux uxuxaB /1h)%h?%j}h%R D$t>Ht4t uxjh&PӲ B /1h)%hQ%hh% D$tEHt;tu&xÃxu x uxuxA /1h)%h_%hh%荀 USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^"A Wo1=u!GB9r1ɍ|$0+@ /1NjB1ɉÀthAu_1ۀ=Q9uD1FFFF FFGFQ9SVrVW_uPQ9މ^_[]Åt 1u19[:Rt1h)%hn%hh%C hz%hn%h'USWVP|$G<t<$ $ l$W)Ã|WhVl# ۋ|$t(ٸF\$$)؃|PjV7# 1=Q9u+Q9W9u!Q9W? /1N^_[]h%h%hnh%;~ SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQ ^_[h%h%hh%h%hh%} USWV|$t$)Ã|UhV " t(ٸFx)PjV! ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQaGSKWVPQ3 ^_[CPhj#WVf 1t߉h%h%h{h%h%h|h%| D$tL$tf Hh)%h%hh%h%hh%<| VD$t&L$ t/fqPp QPI H^h)%h%hh%h%hh%{ fV#,&Ph%f u^USWVD$t$V1Ij0V1|$/ooo WV5&t-1C |&I?r @<   DE9u֋-&t/11C &I?r <   DF9uWt$VT; 1ɉt$\T$\RVQ2P#^V(t ; 81I $ȃD^_[]WVP|$D$L$ $QPWk tWjL t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP轅 tbL$1tHh%hm%hM8| /IG?uWG9rD$^_[]h}%hm%hh$%ty USWVl$t$|$t1ۅu>t7NLM$t%M"tÉS1ۃ1Ct:tV>tXtSh%t؉8txt@HtPt؉CjV.t.Vt!th%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPV|L 1H^_SWVD$1t^|${t8 1NA~0jh%W'0 uW臿WN, G9rh f2z ^_[USWV |$ 7u ;l$$Ujh%U/ \$C UPWh%NS$t^DžtnjSW 7 8thC%h"荙9h%~1HzSlt$hC%h^"R tG11CGt0WJ ؃uh%h% ?Ņu1 ^_[]Ë$t|$u%tPWhe%hN% =mQ[PWhe%hs%辘KUSWVӊB D$ L$$t WȂ *QPpNjD$$7@uMh;*#$ )%tQh!%W  PhG%We |$ t$hN%W@ {D$ D$hX%$U- t$h%U- UE) |(6h%U- 1>h$Q- hM"$Uu- 5hM$U_- h$UI-  h%U3- h$U- h$U- 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Ph]%W I4X&hj%W +7$@D$o|$L$ uMD$@tBL$qPShf$W"Af$D$ E|$tShf$W <$tBt88t/SQt"D$pHpDShf$WAM|$ tSW3D$ t7t1Ph $W D$ 0uWI W萂ǀ|$ WD$(P D$ A#t'%Phv%W; vKL$t>$%tRh%W AsHh%W 'CPPh%W  s$h%W SmPh%W {Pt;CQt$(stPhhV tVh%WT {xtCxPh%W3 tr7@OǀD$(h&P t0ts~ t!V^t&PD$,P9uvh,%Oh,%B1OĨ^_[]D$D$D$h%W<\ t1PPt$0V tc1PPVs 9th $h $W[ oET Ph $W[ QjUt$0V% Ņu1UVWUY{ h$$V' hX%V' h$V' hM"Vi' h%VS' hM$$7' tzh$$' '%tn|$"D$<u D$xuT|$t Su@|$"$<u D$xDu'|$ tjSu'%A#(A#A#D$ A#A#t'%Uh%W Vh%Wv S,E%tPh%WP 3E%t= t1tVD%u vuPh %W ?Q@th%W|$"D$<uMD$@tBL$q PSh9$W0;9$D$ S|$"$<D$@LL$qPPSh9$Wtl{USWVl$t2E1Ft/׉˃PWh=%S tEu11N^_[]USWV\$l$|$ttUPW 1tk<.tgh"W$ tUh$W}$ tCj h~%W# t/tj.W tUW\ 1t^_[]D=|Vt$ 'Bءf2H f2;$f2h f2j [  f2H f2 Fut$f2H f2;$f2h f2j Z  f2H f2 Fsh%sU Fsh %]U Fsh#GU F shL"1U F%%%%% %@uwxn%rhFS"r]%rRQc$ rG%r<%r1%r&f9#r%r%QdT F sh%NT F sh%8T Fth$$T Fs h%T f2H f2~ f2H f2 h f2j Y h f2 ^ù%TVT$ L$\tX9t(,Nu2l1th9t,Ju^USWV$$Vqtg$$QPVh$h$h%USQ 1N@t+9w');@MQP'At9w :)߉h$h$h%USlQ ^_[]USWVD$<P t$ $h "VAl ]NjD$@HD$?1jh!%W ujh%W u|$D$4Njt$0tNF tA.t;\$SP* D$P1U1HPUUUUSYC 9l$u9t[,OuD$,Njt$(\$Sv  t-D$P1U1HPUUUUSC 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ h "Vj Dž4$~y14$oy& 1H^_[]4$Ny& USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQ t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$$ V x$ "1H|$0t1rЃ^_[]M$ @$ 73$ USWVT$$D$ |$\$,ۉ$l$(1\$]fsuym2DHesm2DH@O\txm2DH# \\$ $2f\\ $$P#T$$P#O$sZ/t uP" tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1Z" T$$t4<$t s%|$$u1F!" 71N^_[]USWV Ί m2D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMEl6! 1 ^_[]ÿ! 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3V 18 1H(D$ .%tH%L$QSPWV?I Ą^_[]USWVt$HD$DD$L$I 8$(ts h1"VI Vj=h tk$,C r7 rp   V1$UWhP\u%Vj3h 1ɃIUWVM$/S$SWh $VyUWV# D t$$UWPhS S[9 $tVj g L$C @yj.$Pt$j詐 d$Ph $VKG E$8u*$@$UjS C@G jPS fC $4CCD V$4P UShipb C O*W>RQP UShip+  1N^_[]WVPRQ5 ~u~uF $`19؁Ĭ^_[]hB%{oUSWV(ˋl$ 81th%h %%d$1t$|$PuL$QufD$RD$t$ D$Plt$ Wt$PD$`PVjt$,u+w$kUVEA 1ҍu RRVPjQfke^]SWV t$01GGGGG GGF jPW FtGFlGFhGj Whri 0} 0^_[USWV |$4(1CCCCC CCw jVSY Shqi U* uVh%bL$ȃփ9t1D$j Shsi 0 uVh%qb ^_[]USWVD$t$1s9s+tKCG u1" 1H^_[]USWVtY։ϊB<t^<<Fu~^SVU Utf VW[WuVWWxVR{tPtUoxR /dVWyuVW0zt:xB^t-t8t!8_>uG*SVPo tu 1^_[]fD$fx(t1ËL$ D$fx(uD$ V1ËL$ D$fx(u D$o V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS |$jjI`Ƌ$(@h@hH%ljFuJ1ۍl$ShQ%j U& h@UwFuC 8tǍ\$($PhqB@W f<$f|$ jUS ShlBW txD$PhpBWe tZ$$VЃuBD$PhfB@v3 t(D$FP>F u+ h\%^Ft PUV)O1ĸ^_[]USWVt$fFtV)vv v AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP ^USWV L$@T$*@h t$ Vh%U $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@莦ËD$D$ PSCL$QP ؃8L$QPSt$@车9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PUNEL$QP=8L$QP*Ut$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $PnPVh%S1I/ދ$0$4Wj$@U t|$r $,84$GPhnP$0Vh%WwSYGPVh%WR$0$4|$WjU $,t|$w1Ћ $ QmPVh%$4$4#]SmPVh%$4轴T$ }ltE$u?ClhPhhWWVh%$4i{,t=u8C,j@Ph@hWWVh%$4$$0t1WPC,;r鋆Dt%@1W"C,;Drlth1WC,;lrF $'1|$TPÀsE,$0;rT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$Phv&Vt$$@$@$L0 >}k|$`$0PDL$L$QWhv&Pt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$Phv&St$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ V t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$J  = V1(^_[]ËL$DtD$L$tPVQ D$ƅu SWVD$ L$tT$$w .11t$|$X+9s "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p @v\F\^VF`t# P?v`F`^SWVjh0jM 1NǍ\$PSPhW trjSjjW t]jSh@hW tBD$$1ɉ $L$ L$L$D$fD$DtD$jPW  t W^_[USWVt$+VjUAChu,$t#tVh)Pj@^  r5%sN%PSh4%ePSh%I 1Bh) ^_[]WV΋tF>rD&\& GTt tB9tt9BTtI䋆tÀ~>r QVh%I ^_ËD$$POL$1Bh)` SWVt$tgw]Vh)j @^ w$dPSh%H GLh W ^_[USWVhuD$D$G$D$GH t-wa9GGGG G _G_1ɉO OG_T$SPwD$@tGH%_0wF SPh%H _0G89+\$8D$<l$8 %|$ D$ fD$l$|$Xl$ D$XG8N PQh%G w$cw(<PSVhT%KGG0GHs% w$bPVhz%G G0GH%c1HG8G4 w$bPVh%F 8\$0D$4l$0 %|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( ܷ%|$D$ fD$l$|$Hl$D$HG4N PQh %xF ?G0D$ D$$l$ ܷ%|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu Poaw0PVha%E w$Paw0PVha%Et$6u$HujGtGht:?%tP%IX%GHPuXj<c@O;Au<t %?u~%GH0ts]Sh)w4Q;Sh0w8P;Sh1w0Py;C w8w4Ph%yD 1HG8G4]@uPD$u>C wiVPh%8D wwhV3uVh%DOhD$L$u2wHS3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;th$CjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h%h %hhK%s SWVt$^ Sh#%'BG0+G8PShG%A Vh Wj81G?6u%EHPV Vh$%|? ^_[]WV։h,j")t/L$ PǀcSc tfǀ 1 ,^_ËL$ha4VD$tF9tAtIdtI;u D$ th$P^USWVPt$t1t+l$$# uVjj4^_[] GiP6mVKAtAt;<t5^ w$;YPSh%= j1VUjt4/w L.o ow;.GOGO oo_H,$uGdGhSV VU=w-1GG G$^_[]USWVxT$΋}D$t$(HL @r@t‹D$PLih D$ɀT$wȈBBV*QRP芼 T$(  D$tz tA<t]<tYD$PPj< D$ 1SPD$XP. 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Ph%9t$*]tVSt$Dj/e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ KD$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSP8 ǃL$D$؋L$؋T$B)Á+),PjR蟲 ,L$1OAhT|$ 1|$CD$PjsǃSt$ P蒲 G D$G D$ GGDCff_f_1ۉT$SfGEh5 fGG@D$ffGSf f_ t$WhD$ p\W F PhT%/ ΃]w'6uh(%V VjjA&1gydA$jD$PVo$ D$D$uD$HwK*PQt$ : u)C Pt$hO"%* ىt$ t$ [u^_[]WVt$ Vt>wwvw k ]WT6ttt9uq@苆t'P{%džtPdž1^_UWV}tuPG><r 'u#r G(ftf u  s% u`h) ƍG 4$D$,$5%D$\$$;%u(WhJVjde^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0jw* u&h4j@`GH$GP_iVjhStSE0, pLJ  twAQ \ BjWhfjP[hr"%h$7'sY EX>@P, UB( A J*R>RQPب  ]rts4 t*Mq @T$hRQPPV]h"%2C>t2Mq M*T$hRPQPV]h"%% Pj1wLw w wL$u]rruG XixiF SPh"%F% D$h$PS6ΪNRhr"%%@u3EpCP t: @ NH M plYh"%(%u Vh~"%%h"%v$e2=u1HL$h$QP t=w:F h#%Ph#%$ w 1Ƀ8tmF SPh^"$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQPY h#%C$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6hL$ <G cSc{ ni;`CLsu%1C &cMScq s$X=PVh?#%! M1C1G G\$"O0)G4)G8uL$YME Ph$ A}w s$;PVh##% WuWVt$ VhJjtht j66t^_USWVt$ ~3E(L$tW9ud G N Qt$(Ph_%>W0Edh$WWNttxV1ɄutZE tS@;FuK_ Pe:PSh#% uWt W+8#4 uE$;FuUhudEh>t ^_[]Ër^tuMEEVF $PE}t\$G$u=EHs%j7~ruHWЃ댋Et {WZtstـT$sO$tPЃ8u)ʃAr 讻 N@H@USWV׉΋D$$E t @9u ;M$^ P8PSh#%L EiP6r$u!}@uHhjjWV Džt jWVjj|$$tD$EHPVK#8#4 u2j1Vha(jj؃^_[]ËL$h WWVP֋T$D$WPt$ 1Ht<$u 1t ɉ^_ËL$hcWSWV1{\t^_[ÉjhQ蟻 C\t4Wh=Xjpuh%h$} 8u"5HV2h% Wh%h^"> 1NcD$T$ PUSWV$$($$$$_\ftPh%h$ ch$USY t'sPUV`t3_\t,Ct$?tF Ph%h^" V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%h$  t `jW0 tD$ WV h%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ' t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r P3PVh& %$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@s %n1ɋl$ T$Et*u4 %& Vhr %" %L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$ !%t$\$SWVStǍF WPh !% WQ} /6uh!%VEiP6ΛVha(uPj EP'uD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S蜈 t$)4$teSPheR"Vt$Wh!%t$( eR"ۋD$t$0$ P)4$L$ t/PUVt$Wh!%QSPheR"t$Wh!%t$$7 $PUt$ Wh"%Q  h!%V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EPtUWP豏 +މ^_[]SWV(΋6ulVjj3K AuA jQV_ t=Ht*ub 4$s(PVh5"% OVD|$ss D$L$ q qQPWV8  >(^_[VD$ Ph"% v B1F FFL^L$hfWËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Ph% %GHPVq^_[WVt$ F PhY#%g OhGL^_D$ȅtȰ (1SWV\$C r{ 1H4t${GPhV ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0h&D$(P Edx t]SXƀH|EdH #HL$|$WVrhEd@ D$WPYhF9VD$(PY1VVP. VVP ƍF8Pbuz3WMhVPF SWWG| WD$(PXjVP螅 ƅuSD$(P臮C$t{tlSWD$|$WP@gFWP3gF8MdQP gXMdQP gVD$(PWS蔭1PPD$,P toVD$(P ~xF| uF|FXMdQPfVt$|~ 9tV;UVqT1PPD$,Pu ƅuC$t$xh&D$P/} 1PPVB ƍC D$~dV`Sn8U`?1PP$ 9tC9t?UWd T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$} F PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u&p G` 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ uL$( Ʌt ѹ )QPhE%jWS ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]h$% VD$t:t0t!PtQPV PuVj^WV|$ 1u7jt @1H1N^_USWV $ yrb t$ $ q>YtiDD$ \$fl$Ӌl$ h%%WU_  8th%%h%%t$@s"j@{Dž@7 D>1ɨ1QSVx PQFRC F CFKN\$l$ ! F ! F D$(t8tjVW uʋu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF 莓 oUSWVD$1tW8tQ\$l$G@tjUP u8u@$Vu4jjt @H h&%1^USWV0hjdƅT$PL$LD$H|$D~Ӄ^dNdžu`P VLPVH@FDV@PQ5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUtNj.PUjt:NhVRPhE%j.Q @jPW t&@`F`Nd#ho%%Vy1F`F`uNd 0^_[]WVt$ 1WWV# t1@WWVL9 1^_USWVD$$t8tb\$(勇tK0tEFPU#t.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]USWVD$t81t7\$t(tEPjSP tmu^_[]SWV|$\$L$Ƌ@t9Xu9x t)jtXx N HF 1hU%%K1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP_ t&hPt$ h|%%t$-H1Ƀ H1ËD$1t' t!1Qd(u Q` uSWV|$uuu jPW t$H:u @`PUjPVWTtaQPAHd1IH H$ǀjPj781Fuh%W0J1N^_[11SVt$ ^d؃ FdF`u uhF Ph&% F NhQPh#% u2 tQd s((th%PI^[USWV |$41G$ujjWT t ^_[]ËsWt׋trNf(@_>t .o*ShD&U ShL&U TD$ 1L$A AAPj@QWj1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dUP U: V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS t=m<$hj.PSj21T$ JO9zPWE`t.tRD$@D$,$KU5E hUPh&%3 4$A f4$& 1SWVt$\$Gt!PtQPW Pt1jPWtt2jP4%W51VPj4^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPU tKd(1tD$ @`C`|$u%CdtC KhQt$(Ph%%C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JSN0t4$>} 1H1^_[]SWV\${C KhQPWkƋD$džuC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUy?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPt t u"GPt$,h=(% GdD$ D$1xG O4SQPt t $tsOdtYG %tc$OhQRPhT(%hWj[u!qg 81tgg 8t hf(%Sw$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPwYs t $t8$C O0QPhv(% OtHO\$u4$FTjPS NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$e D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRhQj螽D$ t;t$(h(% j6Qh%V,e^_[]SWVt$Vjj艽tj11G9quƁjmمuިt?5j6  sh%V+^_[USWV] D$@Cxt$rj.VL$0Qj|$,wVh(%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPhT)%h(%e^_[]T$rRQPh(%ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQ t8D$ L$rQPh)%h RQhu)% \Rh)%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVP9 L$  uhj/ËD$CNC KFCF CCj.L$vQPG Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph)%T$$RGTD$0Pjq $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h)%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h+%<<tj<uŃt$hh+%|$$HL$Xpx jP$PC D$<t$h*%|$rst$h+%$p΁Vt$ h#+%t$$C$x|$D$ƀt$h*%B1|$t +D$(t$( 4XPjQB Vt$D$`PB \$Zt$h+%t$ 訾 $A D$PAD$LIL$HD$DD$xdt4D$t!t$ut$h.,%赺|$$t$L$U@AH|$u D$&D$6D$t0t$ t$<t$0V)j6t$ \$1ɿSQWҰV1QW轰hX%t$D$u%D$6j D$@`L@O|$ut$hh,%몋sLߋD$,9CPut$,t$V* VGPD$$t$,XGLtbt$,Vt$P%; wPD$(À|$$.&D$$h)%ø|$$3WQ%t$4q t$h+%Etk,΋D$9t ,JutVt$4q t$hP*%U|$u/j |$u$jt$ut$hX,%$t$et$4t$t$hr*%|$$tL$11BL$jSD$(D$$UWV}u WYh舚 ƍG 4$D$,$5%D$\$$<-%ԶWhqVjíe^_]WVt$ VhWۭVhqWĭVhBW譭^_SWV|$G Pht-%聶ujj蛠Ɖ6GF_>tC FPjTt.t+@JAH *RWPK8 tF F^_[h-% ^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh-%袴L$jQV u h-%$BHJAWhBjj*G Ph-%+WhBW iSh.%|Yjt7UhjPs@h-%h$O)h-%=d^_[]USWV׉΋A1PUSͪFVUS跪t!NtHNVJFxUUt$Pt$PtQP P9vL,V#^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUh#%! t#@uUh,%' S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h,%j봋4$VUh-%%. WjDu!oP 81teP 8t h,%QL$o@G WQSRPU踶tDD$GdՃGdD$ j.PUjvt'OQPhE%j.Vx h,%ر)h軔  WhPj)8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPw{ Odt Od tY?uŋFuh%Pch%PMt-u~`?w#F0gF Ph-%^_[]jt$趾USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh#.%h$ jSWQ tD$ SVk h#.%詯p^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh5.%w PUn!D$C,9r|$t"w 7h5.%Tw PW8!,Nu^_[]WVt$ tqwgVhfj胥1GGG G XGftW^_# Vh/%h^"w ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUWh u?u^_[]USWVD$t81t9\$l$tp|tSUV u6u1^_[]1USWV$.FX|$ j.WUj\$wWh=.%腭$$tXjVWr ÅFD$Pjt$ L$QƋ ulp|$NjSW: tL$9uPWV薻 t0 D$ PShk.%+ ^_[]h].%蟬jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PSh.%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh.%$ WSh.%藫 F PSh/%ت t){4t#D$} t*tu Vh1% Vh0%蔪jjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]E~0%f`&9t Qf9Au<< <\$H $d&|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh1%oD D$ PD$p Vh.1%% D$ PD$p VhW1% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPh1%wD$`$T$B"pF L$ QPh}1%P 1Br&$F  $QL$$QPh82%<$tD$x%$l$ |$$ PD$$PVh1%蓥D$wD 1L$ T$t$QPR SWVPjh0j 1NtKljjSj hPht $jSjj)Wgt WAH^_[WV jh0jt ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW达D$jPV` t?jWj$j)V7gt"$jWh@hVgu%h5/%螤VZG h5/%艤1N ^_SWV\$|$1tD$&1ۃ ʾrft1ۋhDj͍H(H,| t1ۉfǀ<fǀ?WjhP jjW t W G PhC/%ߢWhW購 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ Whb7%P E]1@EEE,E ]$z t( Vhj jWh7%h^"t^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$&D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPShjPh7%h$Ġ$1ۋ6<$tD$D$$t;F SPh"%Ο D$$hPS6V%Ch7%6Jh"%蘟e2=u1HL$$hQPA Ã37@$:VL$QRP% \$\$TSjqj?D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Ph"%~T$E|$wD藏S GDtL$$SQP _Hbh7%Ğߋ$t|1QhQP芰T$R6#\$sD$1CDCH%-ۅt}u2c< 8tnY< 8tdD$ Ph7%h^"6 FD$ u9H|t;A`t"ftftAdu y  Љe^_[]1ɉH1BPP@ H~ Wh!8%\ot/Vhj jۓ1WhC8%h^"b vF Ph7%h*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjPwcE <$L$ V諟txEtptk8] 1ɉHH@H HH$7NE0%$P67!11Ӌ$PR*uLjEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 t8%tPV"ELPu4 u<Udž6ttFtu7@t'P=dž ^_[]à Vh8%h^"ٚL$1jSWV|$WhjdtxWh=S>WhS'WhCSWh Sws^_[SWVt${Du ?~ Wh8%P 1@1ɉKCCS(C|S KtHd sHdit x\t^_[Wh8%h^"k ^_[ønL$x\tBL$ 4SWV|$t$_u~G`ux{ ur 6ugtXuG@Psmt3O WhjP迋uhf/%h$蟘t|t$WPV6^_[D$T$J P&)USWV$1@|$D{l$HwF6 C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1WoC,$;lrD$Vhv/%PM D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P. D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hWt$$t$$t$PD$\0 t0L$ D$ PQhVt$$t$$t$PD$\0 D$ L$)1H3 t$|1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s 3 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP贅G4 w$&2   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP  D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUPP D$Ãx3 t 11A9r1Ë71$1 $&D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ Ph/%虐1l$S3qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N 'H 'H 'H '|$ t*G>r!D& D$H<D$@l VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh% D$P4 uOt$ pffBfBpɋ<$tXQlR ڃ p7t$ffBfB<$tD$WVPRj ڃ L$t3D$fffBt$tVWRω1 ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQP |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHP dtKWUP D=l$_D$ fǀ<! 1fw &)h2%葃R|$Qh2%j W\J D$l$ f9<t1}~ QWh2%PEt$sf<"! fu.Wh2%z'Ex'Et'Ep'El6tj!zD$0^_[]USWV΃|$$w VhM3%躂1H׋ 1ۉt$$S1ItUf $]h]d]`\$,Džu\$SjTƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vhh3%&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph4%蒀k(UPh5%& ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh5%4},WVh95%Ȁ ^_[]V΋QhjFw1ɉHH@@ @ @$t ^D VhS5%h^"* ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth$VtP6jVjj`v-wx9Dth5%Vu Vh5%<^_É1jVUSWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh6%Q|15%8WjjVuD$$PjoP<$w$ &8uJ/6%=ǃ86%8u+0%8u0%8u 66%8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h>6%} ؋?ut$u {`<$uhs`t$ h`6%{} 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h3%u:fD$D$D$PjUVD$0T$4)̓w! t$h"4%ufjPD$DPa D$LȉD$LD$PȋL$LD$P9v)= t$Pt$Pt$hB4%ul$4D$h|tjD$@PUF upmjhD$DPt$<ǀ#fD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h3%]st t$h3%ws|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPh#%r wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Phg4%rt}u^_[]8V6)^_[]SWV΋y Wh4%q 1CCCC CC$gt^_[Wh4%h^"q ^_[Vt$F Ph4%q1B^L$Vt$?N Qhf5%Po 1B^jL$WVt'׉΃|jt$RPKt j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV1t:ǀ#L/艈L/f$HC;,T^_[]SWVt$VhWjg1CC C XCC~ ;u Wh5%p Wh5%ot^_[Wh6%h^"o ^_[ËL$Vt$VhjifF Ph7%o1B^hVt$?N Qh7%Prm 1B^2L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh7%h$n tjS0 tD$ WSV h7%vn`^_[]ËL$aVt$?N QhV8%P?l Vhjd1^L$NL$@$R;Шh;%)$PVjQ,6ud$xt R;th ;%J$ppj0j)5hR;$uc$5h6%P;5PVh:% u2=TV2lR;r-0*hL;%}h3;%slR;TV20 WBD$u h;%Bu rR9@9u> pR;1|R;xR;= xR;= |R;DŽ$R;@t$jPjh5hR;#D$8@=TR;u2D$8jPj j)5hR;#uh;%hi;%|$u.D$8jPj+j)5hR;Q#u>h;%P1|$L$8jQj*j)5hR;#u h;%R;rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5hR;Q"y h <%Q R;t+DŽ$j$Pj&j)5hR;"uK1ۃ|$$PV2D$,tD$t3S?R;uhA<%h&<%ƣQ9Q9|$$tF1FFFFF  F)F.N,Q9Q99rF t$ƃ|$t.t$荄L$Aut$h^<%+PV2D$,|$,tF)F/PV2F  R;@;DŽ$jjj" y hy<%R;TR; R;XR;$R;\R;(R;`R;,R;fR;'udR;0R;|$tjt$ j.j)Vv =PV2ujhR;V yPh<%UPhPV2Pj)V0 uY=PV2tjhPV2j j)V th<%$PhR;V yh<%h<%h<%V D$ TV2 | h<%IE$jPhh5hR;qt$8jVj$j)5hR;Ry hV=%QjVj%j)5hR;,y hs=%+R;H H r8r TV20 s~|9~ h<%`Dt$jVhh5hR;y h*=%jVhh5hR;hh@=%d8TV2PQh=%$ R;Ѓ1۹r;PSSQVRhR;Ur;tI"Qh=%# R;ЃPSSPVPhLR;tI"VMt$0tWNuzVj- Vj" 1R;R;L$?V1Fhdf2VhhE% V USWVX R;R;t91ɉ R9 R91GH R; R;R;f R; r+rm ]1sq R9 R9Y R9 R9TR;R9XR;R9\R; R9`R;$R9  R9 R9 t1R9 |R;xR;R9 R9fR9TV2UfR9 pR;ff R9fR9=lR;u"t$@jV.ȣR9FȣR9TV2Q9LR;Q91L$@A AR9Y Q9Q9PhQ95hR; ƅx9t&y hD0%jVS5HR;hD%%! R;uWhaV2W) R;R;R;R;R;R;R;R; u2ءR;R;R;R;R;R; P؉+R;5R;D$8t$%-: t$& 8,h=! 8hc.%Tj芮 R;h>%D$h t$dt9t1~)u~,u ,< 19wΉօuɋt$|$D$h r[L$dL$tOL$L$ L$ȋ9t9y)uy/u 9 19wΉ\$,t$uh>%8ءR; R;t 9 ؅ R; FjhTR;P\_ u!F$ dR;9R; Ѓr;P1PPhWjVtI"Whm>%k I L$L$ t;|$)u .u tj 19wωt$t$\$,uh>%F(=ME R;t$Ph=% <Ff9pR;FfR;R;=lR;'fD$FȉD$(F ȋ|$P)lj|$PD$HL$Ly@B|$P+D$(D$HL$L$$߬$%$ڼ$8R;H7ءR;HR;?% t$|$\$,=lR;u ݄$\$$F?% D$D$(t hT?% D$|1|$ ;|$Dw|$D|$x R98j@9uD$ g ȈR;|$R;t$Ѓr;P1PPhVjRytI"VWh # t$Ffff9fDfPh?% 1@Ph`V2P:Ph#hA% hA% hA% hA%w h-%m hA%c hA%Y hA%O hE%nj.$Wt$|jJ]uj.hI"WF WhB% j.Wt$,j]uj.hI"W WhB%"h(B% h " Nf?%fw &P  R;GNju j.$Pt$ jn\]hxB%<hB% h " Nf?%fw &P  R;F hB%Ffff=fh?%fPh?%FffQPh?%` sFPh@%H L$$T$ /Ftc|$ umhF%h@% Fz$h&hA%t$Ɖt$ t$QRPh[?% hF#lPh@%`4&hf"  R;F<<?%h<@%b  R;tFj@%sV@%P< K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( m2D$0LA :$sn$PQ F9uEPhaA%~ hA% h'A%h%q R;tPh">%Z R;tI R;9~h#: 0D$D$L$d$ % \$$# f2H f2~ f2H f2 h f2j  R;lR;tzR;$$R;|-R;XV2R;$\$\$\$ \$$4>%Q $h f2 h f2 USWV $$919gՉ $t$ $;8t$hh %$,b =&GШu+$ ؃?9?)9K9si m2LA :$sn$PQhV =hV$,Ё =GC~ 9r9$$ul&hh %$,V =wDG$8:$ t-؍L$VSthV$,1 1 ^_[]USWVP։1|$4$u9|.HPhw@%t %wS$&W )1@1sC9uÅu.Phև%  t$߉E1 `^_[]USWV4)ȃ'hB% :։ϋ ˉ hF%b_ˉ $Wf_oUSRQt$PhhC%c Gl$j.UPj~Muj.hI"Uz UhC%, Gj.UPjKMuj.hI"UG _U^()|c؉<+<'uehB%0<9#<,uthB% '<+ughB% <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5v;t$PV;hD$$HL$L$ 1x1PPPW> jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$v;D$PVPL$@D$D$ 1 G|$<$D$=pV2$TD$j=h%|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=h%S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSPg SVUg |$|$t$ "+Hj=h%P Ņt$,] 04$Q" 0D$$&߈FHGNm&Þw$&:܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4^ "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H y dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=w;u t11jNtw;1w;w;t P1@hM"hF% w;1USWV1=w;MT$ l$(L$DžD$5w;hhw;S  |$t$ z"j hw; D$w;h z"V w;tUP uTWV w;WV t7j L$QP  x#L$9u w;;D$ D$uL$us w;8 w;APQ~ PQ  w; tuQhhw;Q  |$uw;1^_[]w;{;{;1Ҋ+~,u"1t$L$t' t" t΅tAL$=8~;u8~; t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=w;u#w;w;tP菺 w;t w;1^w;w;tP[ w;VtJT$1Aj<ƃ=w;u#w;w;tP w;t w;1^t w;t D$w;1@1USWV D$,L$(l$$~ )$1H$`t w;1A\$9|ωL$ tgp9tX tt$ P t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$w;w;tP w;D$,L$$ ^_[]f11f11Ã=<~;u /t(@~;11hhp~;PjNt@~;1t;<~;t P1@hM"hF%S<~;1USWVT$1=t;+\$0L$ D$D$|$(D$5<~;t$8S  l$,D$ D$D$t$j SB \$1 h z"VE|$tt$(PF u~ z"WVEWVt^j L$QP xJL$9uAE;D$ D$<u/h z"Vtj L$QP x L$9t[ <~;8 <~;APQ~ PQ  <~; tuQt$8Sf  E hhS#VEthhS#VwhhS#Vah z"VEHh z"VE /h z"VE$j:t$ 茀 1@|$ ut;1^_[]WV=<~;u et3t$|$ 11t$t$Wj1tЉ^_1@PPhhp~;h@~;t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=p;u+t;<~;tPL$% L$<~;D$$tˉ01C؃^_[t;<~;tP <~;PPhhp~;h@~;t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=p;u+t;<~;tPL$Q L$<~;D$$tˉ01C؃^_[t p;t D$p;1@1fUSWV\$l$t$V PVW U PUWz S PSWf t$ Vɱ PVWN ^_[]WV t$uRt>DžtA=z;t ^_Épxj Ph! ؀=x;u1F1=y;tt 1맋5tV2h d"QQhF%Pփh USWV1ۀ=;t ؁^_[]! D$ |$GSSPh|;jW&u |;KM ; ;r1H;d"1ۃt2u3hWhG% D5;~ȍQ2w$&;PAu ;?$D$-tV2qg h"L$QhG%PՃ;xV2@;|V2 ;I9@V2 ;I9@z;x;y;;;y;p;gxV2 ;A9~WHxV2O;F|V2|t%ƍC!t2)É$)t*;L$ ;$)PD$p xPh؂;ӏ =;=;WjD$hpj Ph! 5tV2_ d"QQhF%5tV2_ d"QQh#G%Pփ~ 111{PZDWhV ESWV 1L$ |$ ru\95Ԃ;s(>tGǀ=;u.;=;rN;=;rD; DžtVjWF =y;t^聳 1ހ=z;t& ^_[À=x;u1Ffu]pxj Ph!m 뺋5tV2m^ d"QQhXG%Pփ& NUSWV|$4t$0Ë Ԃ;9s&Ă;9 8Ս1ʅ/;99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95;95;H_ŋ Ă;!9r؅ ;9s9s_; 8!9t.M9wI9rE;8! |V2!9u!=;=;;Rf ʼn9rPVU"  8!!ōD$p ؂;PVL$} D$PVt$8苎 Ȃ;Pt$jUVµthŋ$L$Ai Qh؂;萋 =;=;u=y;m 1=z;tM^_[]t$h؂;4 O=x;1GDu3t몍D$0xhj Ph!6 5tV2*[ d"QQhG%Pփ 9U7)SjZP)MPjSK :9/ $)QjZP)PjS tƉ111USWVˡĂ;!9ta)‹ ;h t u9=,$)<l u=;OE$)ÍFu\wl_&xD$X ؂;PWE PWY =;N V;5;w(& w_&1É;GsG1B TGHO;Mu9}tAtDEWP軋 5u%E9tt9sMxt MPQӈ }-E $ut=;tGV^_[]ÃWU茈 VjZS> vjZv ) VjZS V t$=z;tt ^É01ɉHHj Ph!i ҋL$SWVȋĂ;!9t+)֋ ;| u 9t%)D @A Qh؂;] @D^_[USWV=;t^_[]þd"VVVh H%tV2Vh"h "h*H%tV2$"=;u"&^%=;uMu%8"=;u!RQPh6H%tV2%=z;uOH%$"=x;u̓"z$=y;u߬#RH%=;u+$VRQPtV2tV2$ |;|$gfff̉ҍ4މ劄1"GO wһd""SUWhUH%T$t$|$f4SUWh\H%tV2tV2$ ;Ggfff̉ҍ<߉劄9"FN whd"h"VhkH%T$tV2$ ;|$gfff̉ҍ4މ劄1"GO whd"h"WhzH%T$tV2$ ;|$gfff̉ҍ4މ劄1"GO wҸd"PPWhH%T$tV2$ xV2|$gfff̉ҍ4މ劄1"GO wҾd"Vhjl#WhH%T$VVVhH%tV2USWV΃=;tPt Ă;3!1P0ǡ; Ă;!)ȉ9r1Ux0;9tEuótP-;!1PPjhjUPa@ t(;t ;=;= ;-;1ۉ^_[]V΃? ; ; ;v$1u ;Ɖ ;^USWVP;;; 0trƃh&P F,=;=;4$t|n011FEEh&P证 ـEEC;(9r:5tV2[S d"QQhH%Pփ=;;11;9s[ $,0EEh&P! s+;C;]ǡ;;(9r;9$sj,Ѓ0EEh&P踀 ; ;s ;)ÉE;ǡ;;;(9r$^_[] L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡ;D$Ԃ;D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9;s$5;!։Ņ9;v6J Љ  ȉ  F1r{@p9;sBJ Љ  ȉ  F;; V2u%1I#5;!֡; |V2HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU tPU $Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=;t=;uVj1^_[]VhUS USWV5Ă;1!-;t E;1- ;E@;;v@uW- ;E@ ;tE3t,ÉE uUh؂;} =;t"=;t!;E-;^_[]VhVjS蔅 USWVΊ ;T$ T$FD$t$V$D$9Btr$u$…̂;ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S~ ~VS{ SD$x,t @,KZ ;tjNjD$G Ĝ; Ђ;)ʉWOT1Nt TtWt${ -Ђ;T$ ;^_[]1USWVȋ5Ă;!) ;L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ;94$1PPh;p Åk jS;WR SWf} ;;;-;r ;-;1WWjhj\$SU6 t\tV9tRSPs uEV j@\$S0h -tV2J h"ShH%PՃ=;1lj1;4$9v(Ȃ; 1QQjPjVQ6 @wg1=;j%ŋ5Ă;!Ɖ)tP%;9tut݉<$/;u1]4$D$x Ph;Ex tA<$;C 9r09$v+jSV~ SV{ ;;uɉD^_[] V|; ;r!1F<u. ;|;F9r^USWVP $1N=Ă;1!׉) ;D$)ot +t=;;Ђ;v|u+HL)͉ll+;̂;s| ullD +lD;G,$vuWVz DGWVx ;_s_u.G WPz =;u.M,t ;-},^_[]jPR 5;^_[]USWV@׉9 ;95;j#;;u >9uP#;;FjWV蚣 *1ۡ;t  ;8 ;H@; ;v@j ;H@ ; 3H ;HPh;v ;9rWV u=貛 j@S0ơ -tV2F h"ShH%PՃ=;9=;u];t  ;6 ;H@; ;v@u, ;H@ ;t=;p xPh;v @^_[]9;u);; fV2øV2ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[áj2SD$t$P4WVL$T$ ‹q~y ;q~ t 1~9 QP^_D$ m2DAD$ m2DAD$ m2DA%D$ m2DAD$ m2DAD$ m2DAD$ m2DAD$ m2DA%D$ m2DA D$ m2DA@D$ m2DA%D$ m2DA%D$ m2DA@WV1F|$ 4&WB tF u1^_ËD$t w$&1ËL$1t9t1ҍB|uËL$1t# t|$tm2LH1H rËD$t m2DA$H1ËL$tT$At9ut1VD$t$tPt$V{ ^D$ m2DAD$ |m2DAWVD$ d"d"tƀ>t$ǖ 0DPWVhC%hdf2^_Ð1|$w L$t9tøV2f|$3"td"fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[]< 1۾$$T$$IwL$I`q|$ \$߉t`r&j`PSQy `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ Px t F;&tm&D$&D$,&1FthPt$$Vz V] Ft$N tVD$PSlx |$ut$`e|$ \$|$u,1F|$uu1;&t$`=u- 01H^_[]Ë& r ,$$&t u‰,$$&4&<$t9rPQt$w 1t/<$t9v艓 |fL$dI%9 <'vxm2fL$yI%9 p'v`2føÃD$L$L$ L$D$Vt$ t$Vhdf2H h!V*t" 0kPh#hdf2 df2Vj VX ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t( 0  1$^ÐWV|$ W4&D tFu1 ^_D$ftL$QŜ&1USWV$п$$ u VT  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#n;4$Y(111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$;L$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$L& j F H @(N]_?[\;^r~uFF;;C><% ^q{t|~F~F ;^r~uF;FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF;F^9րրw t$rI{i9s <$=m2]D_\,<$t~uF F;;Au~uF ;F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=Am2IDJt"m9~~uF ;NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF ;F"{u@9s m2DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup m2DAu f'tf`uW~F=@9t8}@u~uF ~uF ;FЉL<$USWV t$ ^h.\u/;nr~uFF;;EMŁ'$~]$x&|tfύ]Љ8S dBt@SB*@.[Oω\σ~uF;FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF;FωωD$$xt~uF ;.n~EFx m2DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s2m2 DJt"r 9~~uF ;N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF ;FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF;F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! ljm2TXL$21@u"|m2TXL$1t$1ɅtT$T$1=j2E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8u;F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 m2LAtx |m2um2f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ F^_[USWV1y19sC11-m2D]t#=k)CB9u1Bt=|yuA ;Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$&)@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' F;FUSWV\$1=j29v1@(ϋF,@jPv(" t|F(N,QV,fH~<t}m2Dh j21҃9v1B j2|m2Dh1҃9v)1BuG ;G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF;;;^_Ã~uF;NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF;F1^_[]É؉D$I%&t$t$U >M1PVh{t$Vt$pL$xtEpt$t$4 ? L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ I ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf m2>|$u l$`\$\z m2D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" m2T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA m2D$¿!DQf_֋D$ !DAf|$$_8tV|$um2L$ DHuf|$$_u3|$um2T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$P&$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ & ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf m2>|$u l$`\$\z m2D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" m2T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA m2D$¿!DQf_֋D$ !DAf|$$_8tV|$um2L$ DHuf|$$_u3|$um2T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V @wj/VI 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh$L%jPh ;|K ;ø2%Vt$1Ʌ1t э^fffffffVYT$ws^ÐUSWV[øl$,D$(u1T$|$;D$ T$$75PW ETPW PW \PWv tdPWb |$D$ tHѰPW) oPW ʰPW iwPW tPW |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [$ @$ $ ,1P79r 胼$ t+$ $$ FhPWI $D$ D$jD$$ xfD$4D$dzv /$$ AfAfIQPRhW <rt$ VPj $D$ $P;1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ VɃhPW j:W D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVP7t Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃK7D$ $t1L$ L9s ዄ$ @<C8L$|IWt$tjhQPR*D$4 rqPh$P9$$9s|$$$9s$$[1 $L9s D$HL$H P RQt$ Ph$P8$$9sD$4rqPh$P7${$_9sD$hI$/9s狄$ @rPQh$P"7$$9s獃t$Ph$P6$$ o9sD$ tWrQPh$Pb6$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ U2$$$9sD$dL$HL$PL$pRt$t$t$$h$P5D$L$HL$HL$HL$,HL$(HL$$H @ T$0PQt$,t$4t$ =9u8jj t P> 1 4n 0ǃ ǃƃ t: 01^_[ÐUSWV[å$01 uut!j/V uS tƅuƍ|$ijVPQhW+=r ?h@VcǍD$ jPW Y D$$W tLD, L$Pjhjjj QD$(PN Ƌ<$t'Vu D$8 t 8  L$^_[]ÐSWV[V uLQPv(6ƃ $tj/V uA¬Ɖ獃ijVPQhW4*=rC ?t" VPr tEFu7hh%@V  hVPY a jj t=jjj# !ƒt"D1 PC 1ur 0f 0^_[N 8#uVt׉/ ƐS[î>[ÐS[Ît$[ÐUSWV[`u } D$<$ t$u$$D$P*ut=k<T$JL$|D$x$L$x$PQ$$$Pt$lH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$`1DPu@4 $ 9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$ D$@j PWU 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $ \$ 8u$$>$0։ D$|D$$D$$D$$$D$ t$t$|$|$$L$PQL|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR^"ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6W8G4jjdv6] jjdRPWPGLjh'v65 W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$,s L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$t9u1^_[ÐUSWV[L$tEׁu$C t+t9u11ՉL$!։1^_[]ÐUSWV[k|$GtB#l$%t$P6<t!G t7t9uӾ^_[]ÐUSWV[ tC#l$ t$P;t!G t7t9uӾ^_[]ÐUSWV[ËtC#l$ t$PV;t!G t7t9uӾ^_[]ÐUSWV[t$0t$,{ǍIVP‰t$D$(%D$1퍃D$ <$l$tg|$ !RP:tG t@/t;L$uЃt'D$ t$jR…<$uNt$0t><$9tRm PUW?h >&t1<$W"^_[]fUSWV[~t$D$hEt'1PV9t%D=u1 uhKVPjMD$@ 8^_[]ÐUSWV[X~|$ D$hEt$1PW)9t%D5u ^_[]ËD$@ 40tMW D$jPt$V} ŋD$18t% r"u## u#B"tt$ a74$WPjуHhKWPjSV[-}t$ v#!v !V!^[ÐUSWV[|D$,8tD$,1퐐8@uj8HƋ|$(WGxF$"jUF D$ D$,F>ID$Pt$O1}nu1ɀ}ouL$D$j=U蔍 tǃ|$D$,t1PU6tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8 t 4$tVk1^_[]ÍhKUPjUSWV[5{$4$, 0PjPUV uj:Uw ujPU- tKt$}/3t$UhV jVPU¿ Pt$UD$P)|$ KjjWjjV5mt$ jjWPjV`5t$/$D$PVǍD$t$jDžjt$W uj$4$4jWMtƍD$Phzd@VC VD$(Pt$ uP$0>4r$0VPW FD$ GL$ KjjQPjRH4tqVUWr RH 0o$0X2 0{k# 8uj/UŃt$ $0UWw 0VQPWX 111 0o$0P$4) 11,$j$4V$4WjUP.,PWt$t8HPQ&< 0{$0P$4蠮 1,$D$PU 0^_[]Í,$UPVW1 (+=WP$8$8VcfffffffS[wD$D$ $L$T$jjPQjR12yD$[fffffS[ûvD$D$ >$L$T$jjPQjR1yD$[ÐS[[vD$D$ ?$L$T$jjPQjRq1yD$[ÐS[u$L$jjPQRqyD$[fffffYuT$u|ÐS[~ut$ SWV[\u|$Wt$t$/ 9r ?WVPj^_[ÐSWV[ u|$Wt$t$n 9rQ ?WVPj^_[ÐSV[ýtt$ Ypƅu(Pj^[ÐSV[}tt$t$oƅu(Pj^[ÐSWV[L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ D$ D$$D$(D$,T$ |$)\$<$\$0WRT$ RQP ؋\$0Pt$ $ڋ\$0Rt$L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ t$)$\$0VRT$ RQP;D$s $T$L$ t$$L$ )9v" 2L$ ;L$s $#L$ L$ D$9l$Ds$D$L$ ݃L$ L$$D$(D$,T$ t$)R $\$0VRT$ RPQL\$<L$D$(T$$)9sqT$@f\$0WRD$ PjjR\$Pʅ~D$ |$\$0VRD$ PjjT$4ωD$ ;D$4s $>L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ |$)v>$\$0WRT$ RQP;\$0VRD$ PjjS1҅l$D\$0WRD$ Pjj'T$@~D$ t$ t$ ~!‹L$ s1|$,D$ tVD$(;D$s $,D$ D$ Xt$ wx;D$s $l$L$ \$$L$ )9v" +L$ ;L$s $#L$ L$ D$9s$D$L$ L$ L$$D$(D$,T$ |$)vH $\$0WRT$ RPQED$ y|$Q ;D$s݋ $L$D$ ͋\$0WRD$ Pjj)D$ u|$,L$ t@;L$s3$ >"\$0 L$ ;L$s$#1L$ 1L$ T$t$$)9v" 2L$ ;L$s $ #L$ L$ T$9s$ T$L$ L$ L$$D$(D$,9s$ T$L$ L$ 9v_r $D #T$r= $D /T$9s$ T$L$ L$ 9vr $D #T$t $D uD$ H^_[]ÐS[ndjt$t$t$t$t$8[fS[>dL$T$ Pt$t$t$[ÐUSWV[c|$$t$|$0t$(aD$ j/U*u ,$t|MUPt$ WVt$8IuU 8uFt$ t$Pt$t$@t$ H8 H81^_[þD$t@:$ðfffffffSV[]S8t :Pu t㋋QXQP)& t.PT$06ʹ^[ÍPT jffffS[þRD$ ~ L$u [ËPQ2  [ÐS[~RD$~ L$ u [PQt$ [ÐS[>Rjt$ 0 [ÐS[Rjt$t$t [ÐSV[Q0t$t$V,+ tD$~ L$u  PQV ^[ÐSV[}Qt$ t$t$V* tD$~ L$u  PQV ^[ÐSV[Q0t$t$Vl* tjt$Vh ^[ÐSV[Pt$ t$t$V * tjt$V ^[ÐUSWV [xPt$4@|$5D$t4L$ ʁtPDDt1t ʁPH^Ë6u吐S[4t$0[ÐUSWV _Ǩ4D$ T$$сtHDD t16|$t сHHPT$~YP$1;|$t<<$~P,R4$Z! ˉZfBtBtXDۋ\$jP/Z1 ^_[]ø񐐐WVZ½3D$ t9pHD?t;:u@D ^_øS[^3t$0[ÐUSWV0[(3|$D:D$Hx,pL$L|$DGDD$GHD$ fD$$GLfD$,D$(G|$D$Pw|mw|ut EGDǃ@ <ǃD ^ǃH vǃP #ǃ :ǃ( 'ǃ, #ǃ0 #ǃ4 #ǃT -ǃL -ǃ\ _ǃp |ǃ oǃP -ǃX -ǃt <ǃx >ǃ| *ǃ !ǃ f2Ot^t8tjtfx ؋tvQjPW1 QTpQTtQTxT|=u^_[]ÐVY(1 T$tpqttqtxqt|1=u^ÐUSWVP[' l$j+GG(ujjQUQP5q upPj,j3BQPFej>(P j<x j^ jv j# j: j' j# j# j# j-@ j-x j_h j|XX joHH jp8 jr(h jy jz j{ j| j} ǃP !ǃ< +ǃx !ǃ@ ,ǃ !ǃD -ǃ !ǃH .ǃ %ǃP 0ǃ %ǃ `ǃ %ǃ aǃ ǃ( fǃ ǃ, gǃ %ǃ0 hǃ &ǃ4 iǃ( %ǃ8 jǃP %ǃ< kǃx %ǃ@ lǃ %ǃD mǃ <%ǃH nǃ@ %ǃT qǃ #ǃL oǃ #ǃ\ sǃ %ǃ` tǃ $%ǃd uǃ 4%ǃh vǃ0 ,%ǃl wǃX %ǃp xǃH ǃ ~ǃ #ǃP pǃh #ǃX rǃ d"ǃt yǃ e"ǃx zǃ ǃ| {ǃ `"ǃ |ǃ ǃ }2NthtBt'zxØ Ò ϋtuQjPV2 p 꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVX{" l$+4+ع x( PPu^_[]fffffffX"L$fǀ ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[!t$0[ÐUSWV@[Ø!|$TED$G8$u!O9OuO9Ou 9u_uWEt W%|$XE3t:d10蛏Eǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3d/1j ‰PD$<x-.D$8|$AG $tJt PwW W~"G @t;p 8u1E3t%d10蕍Eǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u*E2$t L$Xu$ L$Xt$AsiSV[=0t$t$V tt$Vj^[ÐSV[t$ t$t$V@ tt$V^[ÐUSWVL$[ä|$0D$(T$ 2D$ED$4D$D$ fHLtW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃ ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4 ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃ D$4Pjjjc 4449)4L$ 4QWPt$4;4}2Dž4t(D$4PVt$ t$ 1|$0f 4)Ɖ4fǃ ff9t |$ u |$ t)Q)Rk* t$VUF @f|$tg&D$@ 4444H44L$ 4QjPt$e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4f f1jD$` `4rփփ19‰4 4f fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f f1Pjj!Q ) jS[nt$j[ffS[N0t$ [ÐUSWV$[|$u!G2t PR2GHtȍL$ QPVUN |$<2ȉL$uCT$ GHtȍ RPQU |$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(ڜP7 tjjPO ,GTP6 tjjP% GX!2@@xGX GXO <W$d OT h2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$VLX P芦D$$<$$u$P3$ HuǐuUW PD$$鐐<$$u$}P# Huǐul$Ut$V躗VU$|$~"14O;>|:V1^_[ÐUSWV[ fǃ hqu$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$`Lj T<TV$2@\L4tV=Q =wlj<$hVt$ VB VQ 1rNj2Z1퐐T,jj L,LNp9u^_[]Í\PjS[N 0[ÐUSWV [( |$ EG8$u%O9OuO9Ou9$uxWo/t W貋`8tUEHAIL$WW9uOO 9L$u-O OQRt$ PhGGMIAG GAE3t4d10xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R*G4$趝=u8 $A @11 $<x=D$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a UY 8uE3 $tԋd10vL$Eǀ3뤐SV[ 0t$t$V\ t V^[ÐSV[t$ t$t$V t Vr^[ÐSWVP[Ë$t&T$t$2PWj $^_[ÐUSWVP[(1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[kT$9D$PmK 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[Å1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[D$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9  f$t|$u!|$t'QL$ )RW蜘ŃuRG @tGU 8u=D$3t.d10rD$ǀ3G @|$tmG  f Hȃ  fftVW著=Vt Hȃ 9 Hȃ f9ufǃ f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f D$DhhA Qʃʃ19 f ^_[]ýG @tB"S 8u8t$3t)d10)pǀ3g 룸~Pjj Q juSWV[<|$W臕ƃuOG @tD}R 8u:3t)d10oǀ3^_[ÐUSWV[ûtt$339}3AP3t' 333343;33PQRPA 33t331^_[]ÐUSWV[tt$339}3AP3t' 333343;33PQRPq 33t331^_[]ÐSP[$tT$ 2Pjj $[ÐX tT$QT1øUSWV[ÖTAx43fTFT$P贜j 讑+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhto DHDHDHDH uǀD$ FF^_[]øPjj\,PjjQx jq1PfjxqffffS[0[ÐUSWV[è|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQ4uF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|?t1fF9vʋGPt$wW&"W1^_[]ÐSV[-0t$t$V| t VN^[ÐSV[t$ t$t$V@ t V^[ffSWV([é0Wt$<3WV0^_[ÐSWV([it$8Wt$@2WVt0^_[ÐSWV([)0t$3t 1[ÐS[3t1[ÐSV[ý3t13tj2222a3d3ǁ222Pt3jP  ^[ÐSV[3t13tj2222a3d3ǁ20Pt3jPl ^[ÐSV[}8th3tA3tG22o30Qt3jQ ^[ÐSV[|$ 3t13tw2|$t%22o3 22o30Pt3jP$ ^[øSV[-8th3t3tG22o30Qt3jQ蒃 ^[ÐSWV[Üt$6 3t3Gd88 r 3W}3udž311WjPv.2HvWjPJ2HvWjP,F@:t2HvWj<Pdž3^_[ÐS[Þ[ÐX3ÐS[^0|1[ÐS[.13t)PtЁ3QP^ [ÐS[13t+PtЁ3QjP| [ÐX3u1Ês3ÐX_3u1Êu3ÐX/3tD$s31ÐX3t L$u31ÐXL$31fffffffSWV [ÉD$ D$D$$ t$VWj; XD$D$D$ $jWjO; jj<jVj1;,^_[ÐUSWV[13PtЁ3QP   u j, ƃ  ~:Pjj4/ $; u jPj/ 1 }t&jÓEHjjQppW@|t4QjP Et"@:t@4Qj8 @4Uj @UjX pjjjpuǀ3Qt43PjQ~ ^_[]ÐUSWV[3 ulPjA+  ƃ  uRLD$D$D$ D$D$D$ L$PQjC- ǃ @HtȍL$Qhht@P tBL$t9D$t0d9 t ǁ39tǀ3d(8$9hu9xt WUPK 9hu9xt WUPzK Qt43PQ It3PjW<| Ժ6@$06d^_[]ÐS[ ulPjl)  ƃ [ÐS[ u j-) ƃ [ÐSV[ê@HtȉQhht@PC t!$tL$td Hwtǀ3^[t$ЃS[  uOL$D$D$D$ D$D$ PQj* ǃ [ÐS[Û ~:PjjK* $; u jPj(* 1 [ÐS[>3t[ËPtЁ3QPi [S[Qt3PjQy [ÐS[ÞQt43PQ [ÐS[^^[ffffffSV[=|$ ta@|$t|u7x1t-4QjP 3pT1^[þfffffffUSWV[ëT$2tt6usRRt1u8]RuARt'24PjR* p^_[]ÐSV[2tt6uq IIt1҅u8[ Iu? It%24PjQ p^[fUSWVP[Zt$tF8 t V7_F8@u^_[]ÐvtF$~N,19$t؋~^(,ME9~߃E 98}։8ҐUSWVPD$@tGH $~P,194$t؋xX(,MM9~߃M 99}։9҃^_[]ÐD$tL$9H}1Ë@,$ðÐUSWV|$tfT$x[L$q)~P|$xH9|~<֋D$@,9}*L$yY(,MM9~߃M 99}Ӊ91^_[]ÐUSWVPL$T$q)|$ 9|։4$ ';$}o|$$u.yY(A,,ME9~u 9}ˉǐY(A,D$w'Pj&<[ø[ÐSWV[t$t@|$FX32@@TtPVWvX01^_[S[Þt3tt$P[ø[ÐS[^t3tt$ t$ P? [ø[ÐS[t3tt$Pc[ø[ÐS[t3tt$ t$ P [ø[ÐS[Þt3tt$P[ø[ÐS[^t&3tL$ t$Qt$P&[ø[ÐSV[ 0t\Ɔ43t)2Fpt9PVPVR(3tP]3V^[ÐS[Ît3tL$jQP [ø[ÐXO1t T$~93|4 RDÐS[t3t PV[ø[ÐS[D$t3t PkV[ø[ÐS[Ît3tP'Vt^[ø[ÐUSWV[K0Ɔ43t)2FttrPVPV茾a3tR3~>11;3}:tt3PT^_[]ÐS[ÎT$t$t$ [ÐUSWV[X93|$0t$,T$ $up`MDH@utl$4D$ U 鐐t$ D$PL$ QD$ P4x)t$耋tL$9D$)<9u AT$)RUt( $4T$4R7D$0D71^_[]ÐS[t3t P[ø[ÐUSWV[8D$ $4VjPjNtSʼnt$UeƅtMD$ $t$UD$PVtT$t$$V V>u^_[]ÐUSWV[|$3t P 3~/11퐐440t0;3|4t3ǃwwLJ3j0jm4tW2Ht<@xX3~3'Pl72@HX3@$4Ƈ31^_[]ÐUSWV[t$3t P3~/11퐐448s0;3|4s^_[]ÐUSWVXxt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([(4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$W 1Ґ$t$V|$(WD$0P%t$$xŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V $4D$)Džu |$ $tR1VT$ * 4$)tWj V T$L$ (^_[]ÐUSWV`[x14t `΋43t42NzRЃPWV"PV訵hk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<W PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DP@y;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$PD$T$3;4}D$PRjQD$PRjQȨNj$D(P誃D$$L$ ;47&ffffUSWV[{|$$D$hjjUh t)ƃ|$t:L$tVD$ tNt*T$D19tL$  11fVUl$ U" D^_[]USWV[|$$2t$PƋl$r:D$0zD$4YuX9uE$E EEEEE EEEuDE$E EEEEE EED$%ED9tL$ ft M}Wt$U 1^_[]ÐWVYmD$T$ t$w4  p@^_fffSWV[ t$V~tyы9uv0jv,j9p9p 9pt P jVj1^_[v4rj9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PiffffVXt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[|$ uT${[ø[ÐS[|$uT$ L$O[ø[ÐS[þ|$ uT$[ø[ÐS[Î|$uT$ L$[ø[ÐSWV[\|$u<t$D$9% ƉM1^_[øSWV[|$u8t$D$|$% Ɖ81^_[øVXt9|$ u2AX2#Q@Q@p1~8tt$ Q@^ÐVL$t9|$u2AX2#Q@Q@p1~8tt$  Q@^ÐS[T$R[S[L$T$ 6[ÐS[îT$[S[ÎL$T$ [ÐSWV[lt$8tCGX2@TtgAWW@x8tg@1^_[ÐSWV[t$|$tCGX2@TtgAWfW]@x8tg@ 1^_[ÐUSWV[{΋AX2GTt tNA t tNA t tNA@t tNA@fy tNAt tNAt tN@t 4tN@ t tN@ @t tN@@t tN@t @tN@t(tt Vt"G8tt V:1t$׋NX2#N@N@Rz8t N@^_[]øSWV[̿΋AX2@Tt{ @f @tf@t Vt V1t Iy8tf@^_[ÀfA =fA9fA@5fAf1fA-fA)f@%f@ !f@@f@f@RD$t@@øÐXHTtG1 u<uA uFuKuP(uUa1(uHT t  t @t t (tt 8tt tLt ÐXHT1  4@(1( S  N @I D ?4<9 6@3@0(tt 8tt tLt ffSWV[t$8V? PVW ^_[ÐSWV[ܺL$|$t$x"1t%<t9u WPWVN ^_[ÐSWV[|t$|$WPWV ^_[ÐSWV[LL$|$0x1t!<t9u WIPWV ^_[ÐSWV[0t$t$V; t|$WPWVn ^_[SWV[Üt$t$t$V t(L$ |$x#1t&<t9uWPWV ^_[SWV[,t$t$t$V t|$W=PWV ^_[ÐSWV[ܸ0t$t$V+ t$L$|$x1t"<t9uWPWV7 ^_[USWV[e$AL$I,D$$|$@1 $D$HL$D$ $[UT$1 |$@T$ D$D$jD$Pt$t$D$$Pt$$)~"D$@PVUD$PnxNjT$u$^_[]$USWV[U$$AI,D$$|$<1 $$HL$ D$$hUT$1 |$<T$D$$D$$D$Pt$t$D$ P$$)~"D$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZžL$1~t$ ~9J$u9r ^ÐUSWV[[D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU7x71^_[]ÐUSWVP[ڐt$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux lQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p d912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [xt$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV1 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[T$L$ Aq D$t$jVPt$ ^[ÐUSWVX،$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQFEE;~} K(t$몉SV[T$L$ Aq D$t$jVPt$ ^[ÐUSWV[ûl$1t>19)Rju uuu0tPU^_[]ÐUSWV$[Xt$D1Sl$HGL$L$T$ jt$t$t$8[ÐUSWV[t$L$F +A F(~~Xn01N,,NT$+JR, AEQUM vP<E;~}F(^_[]ÐUSWVD$XX2h P8ցp8x;{ umueP8x[$u9uxu p8x9u6q ~t-Iu!ut duP8^_[]ÐD$t @:$1ffffffUSWV[ûD$L$Qq +P+p yijUWjjVRQP$^_[]fffUSWVH[h|$\|$`L$lT$ht$d!1D$xt$t$p)xՉ!)D$xL$T$x!$x4$)t$`v9l$ ,$)׋t$\v9| T$ 9|$|P!)l$tD$`H9͉L$)D$\@9Ɖ|9~jt$d衦1H^_[]Ë $ًD$ D$D$D$l$!|$Fl$9tD$\@,|$x|$D$L$D$ 9w,$t$)D$ Pt$dt$;|$ w|$|t`DH@uUVt$hX D$(GD$ D$$G tqt$$T(@xL$$ rjfffffS[0[ÐUSWVP[~t$19pHt?<$1F:t~tnxV¥vvv vU<$u- F9u" Q+Vy1҉VI+N y1ɉNA^_[]ø񐐐S[>~L$1qqq qj [ÐUSWV\X~D$4lAX1xbT$D$AQ8L$$T$ tD$$ $l$p|$tt$|AY;D$94D$ @T$tt BH8@A8࿉A8j#E8E8 A8E8ADEDAHEHA8 T$!D$H9׉ЉT$(9UD$p$|$8׉|$D҉T$\$j`D$@, ! jt$UWV*|$ D$$hxD$0\$u;i|+A;D$D$$xA8 $T$\$Wt$ D$$xuL$|$  $9hL$l$,T$9JыT$,uRq9~K9}Gph\$jG, \$jVUt$8U|$")T$@D$$p P֋|$ 9GL$i9UX9<$uL$I, tE\$ \$j D$@,L$  jUQVQ(T$@D$pD$$pt$$<$;T$(Ջ\$t$W"tG‹yuD$ $\$D$@i$@\\$j@CD$@4jV *l$,A8\$tjD$@8L$<$ 1;|$Lt$tWH y@Pv4VjQV T$t$ U2NjD$@VjU O΋L$0IvXh2ttj<t$$t$$tUD$@0?4Pjt$@zU D$|$ x xD$<;x}@,L$4pH FD fFVP !ZD T fNT 49D$<;x||$G,t$wp#O, AcT$t$ t$;|$LofrfL$ f|#udl$0T$(ft$ΉD$8)jVl$UQUh%T$\$D$ PUNKL$0)ϋ\$jWUVU+%|$(D$@f|$ut$8Qfr4QjPT$t$ VǃD$<L$,;HL$}hD$$pyiW9u9l$ u A,t>\$jT$ D$@, !D jUt$t$V=$L$$AʋL$$ ABAd4PjQR f~XGuRD$$Gh2uD9u%PD$@0;7?w t6?vut$@u tAGj>@4jQ ytdt4PjQQ @듃xHpo9u9uD$@@,\$jL$ D$@@, ! jWUt$V"L$@I1f|$X,,Et\$pu% ED$@H9ƋT$@Zz,1f1Ճ9G9pPoO9u9uD$@@,tC\$jT$ L$|$@G, ! jt$Ut$V!wWD$<pP`1l$|:$T$ $9wx,1L$(cL$< q@A\$jRD$$p|1҃ډЃh^_[]Ët$ ;p tZ$\$([,t$4$;subpt{j\$WUt3ul$lx,t$ |D${l$lt$1PJ҉t$p,$T$J׋L$t܉|$8${[,;{ubxts$h\$VUEt(ul$lp,L$il$lT$t$T$8ʋHL$N1T$9x,L$\$9|ʋ IT$TRZ3YttL$<$׋\$߉|$ x|$<$<|$()˃$1ۋL$ L$|$9$t(ً\$([k3lډl$u\$ \$|$)ߋL$9׉\$ }<$1D$1%|$,1ɉ11_D$8l|$\$T$,z<$Xڋ\$|$D|$49T$,<$|$,|$4|$4WT$DT$+T$,|$ |$9|$DT$4T$B;T$4T$4\$ mD$/t$t$(؉$ C9ӉtD$, L$~ыD$0lD$ P,y,\$ًt$[,;]u ;L$|\$ډ$T$T$(;L$l$|$DT$4vptEL$0 I,$ y@,L$(h\$WUUt.uD$( $ȉ $;L$} D$ 떐l$\$|$DT$4L$$9t t$(lϋHL$, $t$(9$l9L$8L$ًT$ 9щL$ L$0 QD9X \$X X Pq|G\$ l D$0AHBfBALfBt,jAD\$Rq|\$l$ulx;X D$u\ T$P1r11덭X Ph UD ǀw X PQR l IX D$P\ D$0݋D$\$T$)ډT$HNjT$ )׉|$8)B|$HD$0p@D$+|$D$@H0t$(ɋT$xpuFt0t'|$  T$l?;WߋT$HT$Rt$$Qsg 4VjPH jjjt$t$8D$@t$ VjpppH jjt$ jjD$@WQft$ jP,H t$D$8|$HT$ )׉|$|$l$H|$TI,|$DD$L PQDK t*NjD$9 t#W蔆$~ 1ɋ$4PjW8, ^_[]Ë0D$4L$ d;> MIIlttt$ jQ+ j 9D$uǃ USWV$T$ [t@ D$PBpL$ t$tIT$$d t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$lPjt$G* ǃ ǃ 11ҋdD$8 tlj)D$8>$0D$8 $<t$u; } t$Ћl$)$t$@@9 9<$lPjQ) @x H$L$T$ t$dՉL$)4/L$T$ 9~L$T$ <$lPjt$( ǃ D$ ; ;T$ 9<$ to j Pd:x) @ltlQjPu( F t3 j P:x) j j   ǃ 1;  $ll$*ǃ ;  @@ltWjP' yA t`j t$<9x )ȉ }u D$8o@@lU8 LQj u ;  l"UjP& ; ~U   @@xuă tjWc8x) j띍l ; ~- @UjF& yxD$8 )ȃ,$D$ D$4$jP% D$(19 ș)Љփ< 9D$@u t!j t$;7x) j t D$@, @D` D$,$.  -; !D$P, t$j<L|$ tv ufL$L!;H@L$uSDuLf~54t t [L$ fu-@t!,$UjP#$  t0j t$5x )ȉ j ^ǃ tD$ D$ $^_[])ȃ|,9t$,$,@tUjPd# <,$ t!j t$5x) j  ; ~nUjP# ;  @@xu̓ t!jt$4x) j<룉PS[Î7D$ t# PQ94x) P1[fffX?7Hy8~DyD~>Hlt htðuu냹tt u1ÐX6@ xÐUSWV [è6AP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t4PjR MAҾt.4PjR $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21ClD$L$ /jt$uYD$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVZ1L$09ft$4?9\$89l2uC}w<$-4$t$4sjjQw_w-s yjQf>2~w-s qjQf ^_[]ÐUSWV[.L$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW84QjPH 1^_[]ÐSWVZ.L$x?9J\~2D$t$|$ Irftf>vf1^_[S[þ-jj 1[ÐUSWVZ˜-t$4L$0l2uI_w-szjQw!TQff ffffǂ?t* f8p"f8r"DŽ8t" '2 lD$ D$t$vt$;D$ tT$;u݋PT$~ҋP@,D$Ӄ1T$;t$t~1D$@$u?T$t֍$|1T$u,$8렋$x1(9tW1ȩu W1u%1^_[]ÐX+h2ÐUSWV[h+t$ t@@1EHd9l2p"fx fr"ycRtC$D$4PjR ,L$!A@ $ !A@Ep"f@dfx0ɋ2@Ql=44QjPk Er"Zfp"fx fr"yVRt6$4PjR , $!A@Ep"f@dfx0ɋ2@Q34QjP Er"]fx*ҋ2@R4E34QjPs Efxd#H@ H@^_[]ÐSWV[,)|$l2tAun@tY4QjP ,!G@9/@t4QjP ,!G@f@d^_[ÐX(f@dffSWV[\(D$ yOQW~ ;O~ t Q WPW?^_[ÐSWV['|$D$OQW~ ;O~ t Q WP舨W?^_[ÐSWV[Ì'xWt$yW>^_[ÐSWV[L'|$Wt$@W>^_[fffffffUSWVX 'tLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j xL$h( $ș)l$T$ $L$$$D$wx)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$J7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$HQD$g1fT$t$j vxŋh0L$ș)L$4$T$ l$lt$mD$$Յ $$vx;l$tl$l)"Px‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ k(T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ KQЙ~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ KQЙ~ ƃQWT$H ^_[]ÐSWV[l|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[  jt$t$t$P1[ÐSV[í  jVjt$PJ1^[fSWVP[k|$t t9t QD$PXL$QjPW!L$N|$kK)l$kK) ha;hai)RPU\t;y t0q$t~fuUv\u1 q R^_[]ÐUSWV[ØD$$L$t@1D$D$>D$PWL$QjPWL$kL|$kC)l$kC) a;ai? )TPU[t7q tAy$t+nuUwi[u ATy^_[]USWV[xD$(L$1҄t@1D$D$8>D$D$PnVL$QjPVl$-?L|$ ) i)ʼn) i)ka{alj*SiŠ)ǍUPD$PdZt1D$HU<tzp t:h$D$t}suPu ZD$uދ} مt3l$,t+Et$WPuVQUEЃ^_[]ÐS[t$ t$t$ [ÐUSWVH[øt$\TlD$PND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$USL$QjPUYL$ȿNt$kK)kK) ha3hai)RPUW$D$$RED$j=UhtƉH$$D$<$|$WRL$QjPW[L$Ƚ-?Lt$) i)) i)KasaƉ*SiŠ)ƍUPWVD$5tcL$f <$|$W/RL$QjPWL$ȽkLt$kC)kC) a3ai? )TPWBVtD$EUE!D$TD $$D$)PUURPUU*PUUPUU PU}UtPUiUtr#PUUUte)PUAUtXPU-Uu^O1<5.' D$UBPNj$tP0P 1L$;D$v==wL$L$Qt$#L$uD$ 9D$ tf, UQC~,$t'UW0~|$BUW4+1t$ 1 t]|$uf, FM $QP}4$.O  $LD=uVQ}VO $4D$ H^_[]1|$t4$襭1USWV[Æ hWT$L$ $L$`1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃGQM=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$?V 1Pʋ$H $$$H $<<$Rt$W /$//$H $>$D$^_[]ÐUSWV]X2~:^^t@\|,$n*^ÍxЃs.ÉD$$`D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%`Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[û1l$E<%uEpuEπ r?Sуstlu~;|$~,|$tS릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[L$ T$D$$Pj [ÐUSWVX$1h ։ͅu4$ u'$h 5 @0t$E4}0u"$hݔE, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$Qσstlu7D$ ~ ~$QDŽ또fЉ9N1ҍ$1$$u>D$$hjP5 l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,距E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $ hȉىӉl$ |$uGD$1l$뀋$`DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $i$t"A$|t+H$D+$N1$uՋ$N1ڃV$j!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,RE,}0M4T$$V$0PRQv1$E4$M1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$P@P=D$π$O6\`D$TDl$H$th$V{?9r‹E0M4ʃ9‰\$WE,y$H$|T$`t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$DJ1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$I1L$ ʀŸw Dʀ¿~4r$fI1ۋu0M4A9s E,u,߃$Vu,:rE,u0M4tڍqu4 $I1$P$H$H1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,tRE,}0M4$V$0Pt$QpE4E,M4},$G1^_[]ÐSP[-T$ D$$1Pj= [ÐS[t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[ýT$ D$$1Pj [ffffXL$ÐUSWV[h|$(t$ l$u:Pƅ>l$$ujhjHL$tfjVP NjD$uj(P/D$@ x |$(uVqE\1F4V9Pk1D$tGuP|$(x |$(tF|$(mV|$(֞Phht@U( t$t$tL$t RB(JtR1PtjjPH IA(p1\$91\$-4$K\$P5D$PPD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$2 ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q* ^_[]USWV[D$t uyp|$ 1퐐/t <,tQL$%$P.tt2ƃ$UWP 4$t$P 11^_[]ÐUSWV[K|$ t$FN,9vtU6~uCu;Ust.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[ê|$ l$PWJ)uLt}D$x@ȃǃtVot$ U))Lstƃntfuă뿐1ɋT$z Hf0D$8l$|$ u)1|$WuPt$D/W#prWuPt$D1TL$4xT$$s$tntfuσ1} t WPV l$ E|$f>t WPV }t0EfEfF}WuV f},t&E(fE,fF}(Wu V_ f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[{|$ t$FN,9vtU6vu]uUUktHnNT$l$f,Ninf|FFWRPg  ~F 1^_[]ÐSWV[t$FNy9vtW6vuCu;Wkt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[Hl$D`EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1ϟbGj|ULD$tL$j|Ut L$U=r6UPt$P 10^_[]ËD$tPrL$ =r"D$t+PNL$=rQUPt$T^jjP'stt$ $@ 1D5t <,tFP/iD$4 VUP  D5$(L$tSD$HtJ11t <,tFPh Vt$P  D5$h|$t+D$Ht"t$ $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0$l$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p k$D$t$HjjjPjfWjQaVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[|$ $ ftGt D1DWG(f hwUs =wb, Ƅ |)ƋtVPU? 9vD|ŃƋGtVPU 9s D|ŃE$^_[]ÐSV[t$ tavfvfvfv fv$fv,fVf19 uǃ ^[ÐX @ÐY_ @upUSWV[5$(E$$4D$$0j:Wyt4rjQP  t0V$0W NjE;$^_[]Ã@u 1$tMHu,t6Pu4tXx<f$O:t @t@uS4$l$w$D$j@UP <:t$EF<:uEl$4$D$D$Otu P9@P8耡ǃ qDbD$O$$,PQhWZ: t" ǃtM輹j  $jD@D)3P4+3PӠPtܠj/V5t|$uW$jPRQV'WT$*$jPRWUQV跑VPj!SV[Ýt$ j:Vt4rjQPm tt$V?1^[ÐVYNT$փ1u$t^1@^USWVH[t$dl$`L$\D$Dȃ=$u@<$yL$VPj@Q7T$tLT 9 $ƅtID$\WU@b ~*)NjD$\u $dVUQB ;L$Dt[a1Kt$\@A$2DŽ@DŽ$T $;D$Du ЃH^_[]迶USWVT[è|$pL$ll$hD$P=$u@ $t$ uL$WPj@Q6t$t$ T$Ijj D$Wt$$ $t$j ^9<$u-;D$PuyL$T^_[]WQU ;L$PtNT@$DŽ@DŽ$ ;D$Pu T^_[]`USWVD[XL$`T$dt$X}|$@uM$u @t9ƀRQt$dPj@WI5 tRQt$dV M;L$@uD^_[]詴SWV[Ü|$=uj$u @tVw}tL!@s$dDŽ@DŽ$WA^_[ÐUSWVP[D$hT$dML$LL$pL$t$lуuc$u @tOz=m8@tW=mT$ vPQj@R3x. VPR$ b<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l@  4()uT$ff׺r$σߺfDfu,$tу$$1c E;D$Lu^P^_[]Ët$d@ $ DŽ@DŽ$ ,$1,$|S[nD$u&$u @t-[Pv[ÐS[D$u&$u @tY-[t$ P"[ÐSV[ýt$ j:V&t4rjQP tt$Vw-^[ÐSWV[\|$t$j:Vt4rjQP( tWhVe  WhV ^_[SP[D$ L$ $L$ƒu&$u @t--Qt$Pu  [ÐS[ÎD$u$u @t1[PT[ÐSV[=t$ j:Vt4rjQP  tt$Vvb-^[ÐUSWV׉[ԴRjj %D$UWt$$l t$j 19tG4$@ $ DŽ@DŽ$^_[]ÐUSWVL[&D$D$H1,<jU@ u} t @u D<@u^@ $ DŽ@DŽ$D$;D$HL^_[]Íl$ E< us{UC8|$jW@1 u|$ u}Fu@+ $ DŽ@DŽ$Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:# D$t$DRL$D# A @`? 019<$# D$D@ @`ƒ?091# D$D@ @`Ń?+09# D$D@ D$@|$`D$?0;|$  ՋL$#  <$‹D$Dp# D$L$ D1 <@4$T$<`Ń?|$_u+019QL$ T$D $L @`ʃ?|$_u019 l$ D$L(D$<_D$$D @`Ń?+019 ՋL$ T$D |$_$D @`ƒ?09uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t;D$(Q,^_[]É<$t$D$# VRPQT$T$L$ t$ ?30|$D/? 0D/ ?0D/D$0/T$T$L$ t$ ?30D/? 0D/ ?0D/D$0D/D$L$ < 0L/ ?0L/ 0D/D/ # <$<$bUSWV[U$D$$  ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# У34t2tkƷ< sԃ1@tt# tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ѣ|$| t!qtAD>1tBD>׹@# УD,|t.tkŷ< s݃1@tt# tр‍  1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ѣ|$| t!qtAD>1tBD>׸@# УD|$t=2t$Fi%I<<fw1@tt# tlj瀍 ; 1ttD~t#  fABG w~4ABG w~4ABG w~4ABG w~4ABG w~4AG wʼn41 @tt# tlj瀍 ; 1ttD~t$QG$A# G$B# $u1 @tt# tlj瀍 ; 1ttD~t⍃# 0pQPQPQu# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فр3ʉрUɀʈǃ$ ǃ$ ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ΀# D$# D$x# D$t# D$p# D$l#  ʋD$h# ыD$d# D$`# D$\#  D$X# D$T# D$P# D$L#  D$H# D$D# D$@# ʋD$<# D$8# D$4#  D$0# D$,# D$(# ΋D$$# D$ # D$#  ω D$# ɋD$# ? ? ։? T$ځˆ $T$ 1# u# E# Qu# ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ J΃   ˈ ˌ   4$l$T$ L$ Ń4ƈ x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]USWV(]D$<X%UUUUʁUUUՍ4P᪪ň Ō x    x   x   x   x   x   UUUU  $؃ň Ō x    x   x   x   x   x   T$H  l$ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3 3 3 3 3<$t$3~3 3 3 3 3 3 3 3 3 3 3 3 1#t$t$D$|$811t$3= $3= $3= $3= $3= t$$3= $$1L$t$|$l$3l>l$|$l$ 3 3 D$35 35 35 35 3 3 3 3 D$t$D$D$$7֋T$ Bl$l$l$$xl$   $x    x   $x    x   $x    x = = $x    x   ȃx   x   x !  ! x ! ! x "  " x 5" 5" x # # D$@P1(^_[]ÐS[[D$1ɐȊt tT Tt t t4 uP1[ÐSV[ړD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[ВMD$$D$DD$@D$9\$6D$L$T$@jjPQjRMqD$HPj zZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVW6tD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP#$jP#D$0Pje\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]跉USWVd[å$|D$<$`$ hjD$@PiQ DŽ$@D$V$@8$u H$@D$$@UV|$ljD$PMt;uH WP(WPuD$WP}D$UV $ljD$jPW D$,u:|$$@PW#x$@L$,UV#D$l$0It$\$UV#D$ D$D$ D$$$@&D$ \$UV@#tt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWb"D$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V]/1$xUv$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-qPQRs_h$DUt$@V* j jWL hjUL hj$PL D$@hjPrL D$<;$`u`d^_[]D$RWD$tMT$@PQhRml$ $fffffSV[D$ h`rƉP' )Ɖ^[ÐUSWV[èl$0jD$PU thh`) $)D$j PU $l$1}$K1D=t<$t h`tt$,Mō& 4$t$L$QWPjbV4& L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃t$ Wt$t$Pjbt$(V& &  &   & jQPR ; &  &  &   & jQP ;$& & &  & jQP ;(& & &  & jQP ;,& & &  & jQP ;0& & &  & jQPS ;4& & &  & jQP  Ƅ;8& jjt$H ^_[]fffffUSWVD[؆|$\w 12t$`tD$@jPVT NjD$@9t8tD^_[]8"u trD$ D$ D$D$D$<D$8wD$X$2a$WQjPI0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ C~*4$PWU: F~|DŽ$DŽ$DŽ$DŽ$<$t1$!j$Ua: v ƨtjWƃ' $fǃ' $1' D$' Pt$Q jxPl$U$j VWZB1ҍl$?4$$U9 UV&BT$iȓ$T$) L$i<@UE9D$uj$P4$$U@9 +t$D$fǍl$tt$t$U9D$ fƍ$t4$$U8D$  jVD$ ' ' $$ $ jQP ' ' $$ $ jQPk ' ' $$ $ jQP. ' ' $$ $ jQP ' ' $$ $ jQP ' ' $jQP ' H' @jjVa0 D$;$uD$^_[];hfffffUSWV[%n$ $$D$$AO$WLPVUWP W$$l$ U\QD$\6666D$`6666D$d6666D$h6666D$l6666D$p6666D$t6666D$x6666D$|6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$|6666D$x6666D$t6666D$p6666D$l6666D$h6666D$d6666D$`6666D$\6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\t{E6L$\4\D$tdF$tB$ڹD 0D \0D D 0D ]0D  u$t D 0D \0D $ViMD$\j@PVM $$VM VWhNV/MD$j@PV_M jWVSM VW9ND$;$u ^_[]wdfffUSWVP[jj|$l$t.jPU Ƌ$9t8t"袻1^_[]耻8"u t7ސUSWVPXiL$ |$t$Q̓t2$1ې?09u)ދ$r`?0?0V ?0V?0V^_[]ÐUSWVPXiL$ |$t$Q̓t2$1ې?9u)ދ$r`??V ?V?V^_[]fVYNhT$ t$tt1ut -^Åt=^Åt5^Í(^Í^Í ^ÐUSWV,[gt$@VcL$DV,~09rЍ,1V8T$$V(T$l$ D$D$|$F4D$L$ 9v|$VWuW$u WVf 1,^_[]ÐUSWVH[gl$|BUoƋD$h4$l$D$D$lD$ D$pD$D$tD$D$\D$D$D$ D$$D$(D$`D$,D$dD$0D$4$D$<D$@D$DD$8$PctUV |~D$xt UVP臛 $tL$tA$D$PW$5t!UV W$  UV 1V H^_[]ÐS[Îejjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$8@4[ÐS[>ejjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐS[djjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[Þdjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$8R4[ÐS[Ndjjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[cjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[ècl$hU˨ƉD$ D$PljD$VD$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$D$ tKWV(tD(1t$t$ UT^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[at$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[ajt$t$t$@[ÐS[`jt$t$t$[ÐS[î`jt$t$t$[ÐS[~`jt$ [ÐS[^`jt$ h[ÐS[>`jt$ H[ÐUSWV[`t$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[8_t$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[X^t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐX]L$Q##wÍÐUSWV [H]|$(l$$t$ D$4aD$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[î\D$ hPt$谑 [ÐS[~\ht$t$ё [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[[D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[0D$pML$LjPt$lv D$h|$df$D$VtL$)L$D$PVWdD$ |$$v=D$Dt$.D$lp8L$ QjjV*Vqt|$)cƃPD$2PL$Qxd ? $ $$m=|$D$lp,t$ jjt$>V辔Vt|$)Ƌ $PD$2PL$Q d  $ $,t=D$D$lp(t$ jjt$>VOVs|$)Ƌ $PD$2PL$Qc rg $ $,p=D$D$lp0t$ jjt$>VV+s|$)v#Ƌ $PD$2PL$Q5c sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7#L$R)уtuÐWVt$  r!̐cw^_fffffSWV[l)t$|$G@hjPT^ ܷj@PW^ g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[E'$$N$@r8hUtE\EXETEP$t$tAsE@hjP[ Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV'[ h$$V[hVU< hV1;$u Ą^_[]USWV [Ø%l$(16t$ %T$$NP NT  ()`N`L$$WRPZ ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWPY 1 ^_[]ÐUSWV_.$$hRP~Y RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$XL$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ WK hj$P|K g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQEJ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PVI D$hWD$$hPD$;$xu D$e^_[] ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[X|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[ÛD$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[ûD$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]X$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$*4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$$FQ? T$‰ً$|$D$G<uD$ $Q $ou T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4X8L$ |$ )t$)t$$t$,)wD$ L$?? n T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4EBT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N FFL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q2 l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj j&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B &Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?ፅλGPGX GTG\GG?$L$u aD?~FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  FL$Q? FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$x$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v'tD$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$\~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=o$FL$Q?P$=$NL$Q?D$T$ ߋ t$$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $%USWV[iE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP )t]D$)WPu8 }43M(U,E4E09w)RVP E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[ t$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[ÛL$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU F4n0)Pv8U 1tN0^_[]ÐUSWV[ t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[L$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@~D$?? u)D$(\L$(xÉ$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+T$D$tq01t ^_Átփ*tUSWV _L$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[ȿl$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPH )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[È|$$ $w9>~NQǃ8wHl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw  o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw y o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQ F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw  o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQAL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw  o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw m o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq ~ $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq h $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$Xx$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv  n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv  n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv n n on)n)ouGGD$8xt1$^_[]ÐUSWVX$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu 5 } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu  } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu  } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu " } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]X?ÐUSWV^L$4t;T$8\$0Ӄs3I͉у1&Ӊi913ƒT$4zR13ƒT$4zR13ƒl$4M1ʉ3xT$  1ϋL$ 3Ã1ؐ\=13\=139uЉЉ̉D$ ,׃}l$D$D$D$11|$ $333.3 $3Q333 $3A333D$ $3A 333|$D$ $3A33Љ3|$|$ $L$l$11D$D$333333W133333G1333ȋT$33W 1‰333\$33_1ˋT$ )333É3ϐÉ13W13W13W13W13W13W1Љ3O13RЃ^_[]ÐS[΍t$t$t$ [ÐUSWVX$D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX$D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPXڋ$T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐUSWVPXJ$T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[t$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffX_oÐUÐX/T$J r <ù)ы<ÐS[D$D$ P^[ÐS[þt$ ([ffXL$ d $ x, | 0 8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_ T$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P9L$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVX~D$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$|PP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$Y"mL$ 1 fщ;)t)T$l$L$ 1|\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +t)9~P fHpnh1pXkh (f  fыt$r t$t$ ||$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +4)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVXki\$T$L$o>o4>o>t>|fr | f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[bt$舰ƅt|$7VG  ^_[ÐSV[Íbt$ 9tt$P覧F1ij 蹳^[ÐUSWV[8bt$tLƋ|$$l$ $PJD$PWUƖ 1uR(Vu 7(^_[]ÐUSWV[ëa|$GtE/D(U8]wU"t#V轡=yarau D$0Vc軲1^_[]ÐUSWV[+a|$GtE/D(U\wUz"t#V==tcidu D$0V;1^_[]ÐUSWV[ë`L$A1t3)D(U6\NjD$pU!t D$8ұ0^_[]ÐUSWV[K`l$M1tMuD1V[uV!t(WZ=yarauD$8e W1^_[]ÐUSWV[_l$M1tMuD1Ve[uV'!t(W=tciduD$8 W苝1^_[]ÐSWV[i_Pt$ t$  t6D$t7<$D8WZt$W tD$ 01{r^_[SWV[^Pt$ t$ 螓 tFD$tP<$D8W`Zt$W! t,V=yarauD$ 01"V聜ٯ^_[ÐSWV[I^Pt$ t$  tFD$tP<$D8WYt$Wt,VD=tciduD$ 01"KV9^_[ÐS[î]L$T$ jt$t$ [ÐUSWV[v]Q%Ƌl$$P苢D$PUW tgV6D$tz<$D8WXt$WtH|$$t@V<9t7V6E 438Vu 댅t D$ 01^_[]ÐS[~\L$T$ htcidt$t$ [ffSV[M\t$t$u_Pz=tciduL$1=tcid^[ÐUSWV[[t$t$#_P(=loobul$VEloob^_[]ÐSVP[Ü[D$Pt&Pt$t$` D$VrD$1^[ÐSVP[L[t$t$Vt$t$` D$V.D$1^[ÐSV[Zt$t$t$!^VP8^[ÐSV[Zt$t$t$]VP9^[ÐSV[ÝZt$t$t$]VPg9^[ÐSV[mZt$t$t$]VP9^[ÐSV[=Zt$t$t$a]VP':^[ÐSV[ Zt$t$t$1]VP7:^[ÐSV[Yt$t$t$]VP:^[ÐSV[íYt$t$t$\VP:^[ÐSV[}Yt$t$t$\VPW;^[ÐSV[MYt$t$t$q\VP;^[ÐSV[Yt$t$t$A\VP;^[ÐSV[Xt$t$t$\VP<^[ÐSV[ýXt$t$t$[VPw<^[ÐSV[ÍXt$t$t$[VP<^[ÐSV[]Xt$t$t$[VP<^[ÐSV[-Xt$t$t$Q[VP<^[ÐSV[Wt$t$t$![VP=^[ÐSV[Wt$t$t$ZVPg=^[ÐSV[ÝWt$t$t$ZVP=^[ÐSV[mWt$t$t$ZVP=^[ÐSVP[D$jP4t"Pt$apD$V|D$1^[ÐSVP[Ü>jt$t&Pt$t$On D$Vr|D$1^[ÐSVP[L>jt$t"Pt$oD$V&|D$1^[ÐSVP[=jt$Ft&Pt$t$m D$V{D$1^[ÐSVP[ì=jt$t"Pt$#oD$V{D$1^[ÐSVP[\=t$t$t&Pt$t$ m D$V0{D$1^[ÐSVP[<t$t$Dt"Pt$qnD$VzD$1^[ÐSVP[ì<jt$t&Pt$t$_l D$VzD$1^[ÐSVP[\<jt$t"Pt$mD$V6zD$1^[ÐSVP[ <D$jPTt&Pt$t$k D$VyD$1^[ÐSVP[ì;D$jPt"Pt$!mD$VyD$1^[ÐSVP[\;D$jPt&Pt$t$ k D$V0yD$1^[ÐSVP[:D$jPDt"Pt$qlD$VxD$1^[ÐSVP[ì:jt$t&Pt$t$_j D$VxD$1^[ÐSVP[\:jt$t"Pt$kD$V6xD$1^[ÐSVP[ :t$t$Tt&Pt$t$i D$VwD$1^[ÐSVP[ì9t$t$t"Pt$!kD$VwD$1^[ÐSV[]9t$t$hPy=gntsuV t L$1^[ÐSVP[ 9t$t&Pt$t$h D$VvD$1^[ÐSVP[ü8t$Xt"Pt$5jD$VvD$1^[ÐSVP[l8t$(t&Pt$t$!h D$VDvD$1^[ÐSVP[8t$t"Pt$iD$VuD$1^[ÐSWV[7t$t$gPw=atadu,V Vt|$L$tVU1^_[ÐSVP[\7t$t$4Tt&Pt$t$ g D$V0uD$1^[ÐSVP[6t$t$TSt&Pt$t$f D$VtD$1^[ÐSVP[Ü6t$t$tSt"Pt$hD$VttD$1^[ÐSVP[L6t$t$Rt"Pt$gD$V$tD$1^[ÐUSWV[5t$t$CeP(v=gntsu?V8ŃUDt$UPV t D$8 W1^_[]ÐSV[}5t$t$dPu=gntsuVt L$1^[ÐSVP[,5t$t&Pt$t$d D$VsD$1^[ÐSVP[4t$xt"Pt$UfD$VrD$1^[ÐSVP[Ì4t$Ht&Pt$t$Ad D$VdrD$1^[ÐSVP[<4t$t"Pt$eD$VrD$1^[fffSWV[3|$t$jWVz tt$Vowt WV{1^_[ÐSV[Ý3j ƅt%PVqFF F^[ÐUSWV[K3|$tzj 1tcPVpFF FW;xŃPwtQP諦~n Vp1^_[]Í?PQh/RSV[Í2t$ tVwP4^[Íި?PQh}RSV[-2t$ tVTwP^[Íި?PQh}R_USWV[1D$tfL$ L$QPjj«1x@ƃ$Pt+ǍD$ D$Pt$ t$W苫1ɉV.ʼn^_[]Í˨?PQhURUSWVP׉[&1\dPQXj t}ƍPVnn~L$N uq$' U3' VP]9tBPtnU $u vV1uWyUԋ^_[]ÐS[N0Mt$Pc[ÐUSWVP[0t$t 9.t 1^_[]Fu VmF $P[t͉NjFupPW脣\dPQj t!UP$mF~$F qWsaUSWV[H/l$1t 9}t ^_[]ËE D$PtߋMupQPD$迢\dPQ)j Yt'WP_lE$ED$E y4$iZ.L$1t 9tËA ÐVY^.T$1t 92t^BBtup^ÐS[.T$t 19 uL$ tB ;D$v1[ËBupPQ裡[ÐY-D$t 9t1Ê@$ÐUSWV[Ë-l$1t99Eu.E PtNjEupPW^_[]ÐVY.-T$1t 92t^ËBup^ÐUSWV [,|$ 19t$$9Gt{o F D$D$Pt[$WpȅtЋT$ՋVtэCQPRt$t$V蛦Owo tQ@1 ^_[]ÐUSWVP[,l$9EuwD$tyEti} P!q$PXtFUupCt$RQt$ PM}u tQ1^_[]Í?PQh;RػS[N+D$t9u L$ t9t1[QPzk[ÐS[+L$t 9t1[ËD$ IupPQt[ÐS[þ*L$t 9t1[ËD$ IupPQEt[ÐSV[m*D$ t9u L$t9tf^[ËppЅtItRPsאS[*L$t 9tf[ËD$ IupPQs[ÐUSWV [ø)l$(|$$}(t1^_[ÐUSWV['D$t$x t4hjWV0m tUVjt WV4n1PVo^_[]ÐSV[í&L$T$ 9t9r 1;q u4rpЅtItRP+p1^[ffUS[E&EM L$$D$e[]ÐUSWV [&PQ8' WI' l$UVPtPcW ^_[]Ét$Wj thʼnPUc|$GEOM,$EVÀW|$WEPt(PcV蝀4$/p1l,$UWlQ9uVM.שPQhMR`US[$EM L$$D$e[]ÐUS[Õ$EM L$$D$^e[]ÐUS[U$EM L$$D$e[]ÐSV[$t$ 1t9u Va^[ËD$@$ÐWVY#T$ 1t 9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZ.#L$1t91t^1^ËAQ^ÐVZ"L$1t91t^1^ËAQ^ÐVZ®"L$1t91t^1^ËAQ^ÐVZn"L$1t91t^1^ËAQ^ÐSVPY,"D$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY!D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY !D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY| D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YD$t9u@H@ty1ËT$ BÐSVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YoD$t9u@H@ty1ËT$ BÐSVPY,D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPYD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX_T$t9uBJBuy1ËT$JÐSVYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPYD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY<D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXOT$t9uBJBuy1ËT$JÐS[D$t9u L$ t9t1[QP:Y[ÐVYD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY~D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY.D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVYD$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [Ãu t1D$D$ D$~N~(DN+t 0tV-ushD$WPv T$ D$1ɿ9Th8"yxu2hD$j\hD$WPv{ T$ D$D$9T$rFg8"utHjPVl tu L$e^_[]ÐS[' jPq' PQ@1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[ýD$0' VPCV裸1^[ÐUSWV [xt$4NswD$8t@t@u|*ppQj WwjUVUZ tWVgWt UVY[1 ^_[]ÍQ8שPQhRKWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[nPQq' Pn[ÐS[.' Pn[fD$w sÐS[D$ ;D$uPt$t$ [1[ÐUSWV[ØD$ t$tPWD$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋L$qD$ tL$9QWPN 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋH vHN1 =tP w싔,Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]ÍPQhRcUSWV ]D$ \$$p1}<"$N<\u< $1ۃރST$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍ.PQhR;USWV0[å $Du wDj011<o<$ou}u $hD$(P Y|$0D$D$@@@@ @@<$GHws 琐HOP} w$B8"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BP$B\l$(D$RD$ PUу L$T$ l$UD$D$jQRUW%Xt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUyWu҉pzD$D$Ews 搐<<}jt$W9Q tfjt$W&Q tSjPWQ E $AEtLt@<-Eu<-u}>u$h\t u94$讫10^_[]Ët$t[$NjH<w sO9t1V\ED$"} D$,$t$U"D$m$hōD$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VuT,D$DD$ PD$l$$@T$$H9trueD$9dataD$ 9dictD$W$@arra1Py fals1@e ȍT$8q$@D$stri1D$@5ng hA$@D$$inte1L$D$$@eger1 D$\ T$D$4$RVP D$D$jD$PD$PUVSt/t$t$t$UVT$ D$D$뿋,$t$t(jWt$1 t t$,$VB,$fjD$PD$PRVzSt1jt$t$l$UVT$ jD$PD$PUVISu1{롐S[Njt$ [ÐUSWV[%$j$hjVIY t5ōD$ PU4$t $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPj;UYtjVU/^ |$t'jjjhjt$P|$t-$U~jWU] WUTVUCS[jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[}j@ƅtCPV>jP^F,F0F4F8F<^[ÐUSWV[ t3Pj2tjj@eDžuU٤Oj@J1t=PWH>GjPZ]o,w0G4G8G<1^_[]ÐL$WUSWV[Xt$19nU]N4 Džtbl$~4<$tC1퐐F,ǃ,wj,<j<t$6$D$$x,ljH0l$,UJ6w,4t2$ƅPt$,By& $'L$n@4@<C $΃̓)WRP" L$$A,T$TT$,T A4A<$D$PT$mh:QP65Ft$(PVkt$ ~URt$(|$We"tmP&5URD$ x|$$t$P8$<WVV) L$$A,T$h t$ VWF#9Ƌ|$$usUERD$ D$\PQhR&PQh RPQh2RPQh\RɆԮPQhR誆S[D$t9uL$ t 9t1[Ãt$QP] [ÐUSWV[t$$t 9tFD$ PRF8D$$P4D$$@,D$1׉T$4$)ωD$4$ƃPt$,>t1Ʌ~믉t$9vwL$T$ )VQP D$$@4@<W24$2t$ Q^_[]ÍPQhR bJPQhvRS[^D$t9uL$ t 9t[ÃQPS[ÐS[D$t9u L$ t9t1[QP:4[ÐYD$t 9t1ÃÐYD$t 9t1ÃÐS[nD$t9u L$ t9t1[QP3[ÐS[.jt$ <[ÐUSWV[ l$}t^_[]j@rtƋ|$PVn0jP~OF,F0F4F8F<}(t7htL$7PUrVp0bUSWV ։L$[B|$ *?u-wG"}MG]jjWU -jPwwt,ut$$͕4jPww,(Ox"OD$ $QPht$0Wv$D$=L$$?u%8"uh׃P8:uQ'4jPWX t4jjWG t#jt$(P6t$>t1t$$U. ^_[]ÍuPQhRS[nPt$ [ÐS[>jt$t$d; [ÐS[Pt$ [ÐUSWV[t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPj-D$(Ct(3PQhjRQ.GPLW1^_[]É.PQhhRXIPQhyR9PQhRS[ÎL$A4tPQ4I,Dt*Pq,[ÍլPQhR~PQhR~USWV,[D$@xl$DuVJ}4tS|$(jWl$HU4 tjU3tD$D9(t9$VJ$,VnJPt$D54^_[]jj衊tt$ \At$DVL$*L$ql$$9.|$FySV[ít$D$ PEVuE^[ÐS[nPQF' PC[ÐS[.' PC[ÐS[' jP5C ( PQ1[ÐS[D$L$ PQn1[ÐS[ÞD$ t$PB1[ÐUSWV[kl$}tQ97uGW2DEtS90uOH<1;M uM;H4w\t @,4ȃMWC^_[]ÍFPQhRewFPQhRFwPQhR'wSWV[Ü|$wVqCGt$9uG@WUP@ jNvDžt!PWN Gwo 1^_[]ÐUSWV[Èl$19}EuBM1tDm $t: $Uut^Ut$D$P U;1$D$j~ut"WP$ED$E E^_[]ÐZ¿L$1t 9tËA ÐZL$1t 9tËAÐSV[]T$ t19 uL$t r ;t$v1^[ËR1ttVRQ ᐐUSWVP[D$1t 9t ^_[]ËHh t( $tDUDtt؉Ut$P ąt2#PQhRpY#PQhRpZOL$1t 9tËAÐS[D$t9u L$ t9t1[QPJ [ÐSV[L$ t 9t1^[ËT$19Q ut$tRVqΡ ֐USWV [Èt$(>t~(t  ^_[]ËFjQvPgt҃~$t0D$jPv t ʼn$u ~08"tD$N N$9u8"t=PQhRWo1jPj N,$U:r7ǍFPD$PU tcD$;$uZjPV tD|$u Wj1,$jqƅt-PVF~n W-t WD$$0USWV$[y11T$G=w \⍋TjAPQ u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5D$L$ yt@PQP`[ÐVZL$1t 91u T$ t92t^19^ffffSWV[üj@4iƅtE`WV4>jPB2F,F0F4F8F<^_[ÐUSWVP[Ht3Pjqrtrj@hDžuUyWj@h1tE,$`UW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[È|$1tv`9uloUP1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[J*։ $|$?uwG8]u<GcjjWb tC jPwwt,t1W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%mԱPQjmRYQfmGP=&WQm1^_[]É.~mԱPQjkRYImԱPQj|RwYS[D$H4tH4[Í( ԱPQhR1YUSWV[èD$,hUt$0~Wp%~4tR,$jUt$4V tjV2t`D$090t9$W %$W%Pt$0\ ^_[]jjBet<; 9(u:G@j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ðQ׵PQhRJSWV[\t$~ t 1j Vt ;~ r^_[ÐSWV[|$t$t0t*PVtuj Vm^_[1SWV[üt$F|$uLPVujVm1^_[ÍQ׵PQh$R#ISWV[Üt$F|$uEPVtiu]jV}1^_[ÍQ϶׵PQhER3HUSWV[ët$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]ÍQ׵PQhdRFUSWVP[:D$1ɅQh Dt$7jI1Ƀ#hqI$GGG wtHt$WՃj W=tjW$$<PWtiu千PQWq tDj Wt5D$h VPW`tj WZ7XWX $ȃ^_[]ÐUSWV [õ$($$WtEPx=ŋ$$t$t`?t[Wt.H|/t+1]$,9/;9sfD$ .t$ V?H r\?fDXDXXXXDistXD /.plV?ttUt$ VPD$t 9ujt$D tYj'P'Ut$u t*l$ WU $t1$t$2$l$ 8t$H t U ?s8l8VW\8$ ^_[]É,$9tG9t iy/t)rD$ UWP D, ,$S[~jt$t$ [ÐS[>jt$ [ÐfffffD$ǀǀÐUSWV[T$$L$ |$l$t$u2jDEtUhxL$ H L$$H*s3uFˉ,|\T ^_[]1ķPQjARA6ķPQjBRAUSWV[T$t]D$ |$L$tKutUtMtM L$$tEUTL1Ht t L t L |$$t L2 ^_[]ÍyiķPQjZR@ffffUSWV[(D$8t|$4D$0u<HL$HL$HL$H L$H L$H $x p PHl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dV豇4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[t$@|$t$t$t$ [ffffffS[1;D$[ÐS[ޤ1;D$I[S[þ<8t jA1[ÐS[Î<8t j1[ÐS[^<8t j1[ÐS[.<8t j1[ÐS[<8t j1[ÐS[Σ<8t jQ1[ÐS[Þ<8t j!1[ÐS[n<8t j1[ÐS[><8t j1[ÐS[<8t j1[ÐUSWVXۢ4( ?) R4@( ѐ>t1 @u~1ɍ@( >t 9u#;T$t$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍMQPj譊S[ÞL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV[X|$<vQPt$@t$@ ׉L$`ODH@umD$j PW' ƉN8"u+D"90MjPt$ QIT$91 ,$ .,$ ,$ ,$9,$dT$9މH1,9'T$,$xt*unD$<L$Pt$1ɐD T 9uD$L)̓|$DD$L|$11ɐT 4t T tt TT tt TT tt T9ul$t$DL$ D$HD$(‹D$LЃD$T$$1&T$,L$ D$;T$(t$DD$T$,D$$\$ |$LWPU T$tC1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$L'D$,D$9ŋT$L މ|$9s>$\$ t$TPWT$\ $x NjT$Lt$tB1ɋl$9u)σ|$_Ѓ|$C1ɐTTTTTTTTTTTTTT9u|$ $T$Ll$$|$\$ t$TWUT$\ t+1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$q1Ґ  LLLLLLLLLLLLLL9u\$ U+10^_[]ÐUSWV0[XL$H1t$LL$V\$ D$D$DىL$ )D$D$HNL$t$T$14T$4D$H9wՉ݉L$L|$9s2$\$ PWT$X$x $NjL$L4$l$\$ UWT$XD$Ht$$ft21D T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$t$DL$ D$HD$(‹D$LЃD$T$$1&T$,L$ D$;T$(t$DD$T$,D$$\$ |$LWPU莺 T$tC1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.$\$ PWT$X$x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ $T$Ll$$|$\$ WUT$Xt/1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u\$ U%10^_[]ffUSWV<[HD$u T$PD$8tǃǃT$(9L$(l$XpT$0sT$4\$|$ /L$D$,)\$ǃ|$ l$X1L$u0D$8;L$(D$T4>-u FD$0t$4蕢E<+<-mL$XT$,))D$ $t$љȅuD$+D$,\$؉D$$1L$T$ /t$T΋T$ D$L$9~D$<0D$TuT$ ΋D$tNj$9|D$롐T$$t$Tt4$9|t$l$TD\D,$9|ȋl$=p()ȋt$()։D$4$t$֙uD$(L$$)ș\$؉D$1t$L$ +T$T < L$ D$t$9~D$(D$T<u#ދL$ D$tˋ$9|D$말T$΋L$T<<t $9|L$t$T<4$9|ˋt$ŋD$D$0 L$$ $\$|$ Vtu<-u ~4$<:tkE$<4$P蝎L$ tEH<$W;:&L$A;D$PʋL$TTD$:uH8t}:th4$P! $? tǃǃȃ<^_[]À:uL$:tVL$D$X:L$u^WpH8t}:t}jWPWx:L$~T$0L$ $_D$h/p:t#j=R'ʼn)))ωD$<$t$יut$$)\$؉D$1|$T$ (T$T  T$ D$|$9~ΉD$<D$TuT$ D$tNj$9|D$롋T$͋L$Ttȋ $9|L$l$TD\D,$9|ȋl$1V躿D$\8l$ pD$D$1T$ $\$" $>T$tbQWR uWH $9D$t0ϋNT$\;LuN;Lu N;L tD$딉l$뎃|$t`\$H8D$X8:RQP $L$$D$ \$\$D$\T$l$ t$\$D$\l$ tyD0H8|$Xt?:t RQP 1L$\|1uD1 <-t<+::_yH8tD$X8:tSRP%? Hl$ t,L$)l$XSA;D$PʋL$TTl$Xu{D$L$ D$TL$DL$D$\uLD$8uCH8t}:t1RPm1L$\|1uD1 L$ aL$\D1L1 t1ɋD$`<85pH8t}:t}4$P $E<-t<+u:}:1<: :fffffUSWV[+wT$l$t$@+ tlǃ@+ 9}@L9-u7yID+ -uK-?p^_[]ËtD+ ::ur??t::tsUPQR듍pj-R裇mǃD+ --QR~tRx:ue?u%1x:tH9}gL$|鉻H+ pT$?(ǃH+ ?tp:D$8:?q ffffS[uj jt$t [ÐS[tjt$ [fUSWV[tt$l$tyjj1trj+tkNjD$oGG E,PjQRjW+tKjP 1^_[]8l$u)E}8t(W |$7P(릐USWVP[st$ l$ME 1҉s9r J9sAEOQ0t`U)ƒQjRD$ 耨 E $}E T$)9w΋MVRP褨 E E MU9r‰^_[]ÐUSWV[rT$L$t$ D$t0tUyyGPQhR+pxA)9}8Ti t?GPQhRx3rH HPp 9r@ 1^_[]䐐S[qt$1[fS[qXt$ t$ Pl [ÐS[îqXt$t$t$P([fS[~qL$ 1t$PQt$g[ÐS[Nqjjjt$D[fffffffS[qL$ 1hPQt$[ÐSV[pt$ jjjjV0t^[ffS[þpt$j t$t$x[fffffUSWV[Ëp|$t$jWˍ~G0t ujW谏^_[]fffUSWV[+pt$|$ttft7Wt9fh L$f@Hx$p,L$ H(L$$HDL$(H 01^_[]ÐUSWV[èoj 1L$,l$(D$$t$ T$wGo Ouu u&t,t+$|tܑtڍvt |A 1^_[ÐD$xtÀx|$ÐL$ytI .wuÐSVL$ 1yt^[ÊY u.wT$~9|ԐD$xtÊ@ u<.wL$9Ð|$t1ËD$ÐSWV[+T$吐SWV[ìZt$|$D$VPt$  ^_[ffffffS[nZjjt$t$t$t$[ffS[>Zjt$ t$ t$ t$ t$ t$ [ÐUSWV[Y$$$$ft$tPQj VD$0D$4D$8D$<D$@$D$(D$,D$$D$L$$PQVu2t)6PjPVQ <$D$@tP+ hPV u$%PQt9xuӠP){tUWL$$U$$Ƌ<$t$;$?Ę^_[]ÍOD$$T$DPhQR$|$D$Pjjj$t(D$ PjjjD$ $8x}D$ t$$<$t t$ܭjjt$(LU t$nY$PQ nv nPQ(V6Qt$]jt$?xjj/ynPQUjkt$$ujjx*jt$xt$ جt$̬7ynuYD$p4uMQP6uR$$u8D$@$8j蠞D$npQRj/|$ W L$ $t$$tx%f%jPQ *$t$u+tjU6$PQt$WĶ NjU6$Pt$W訶2j/WctfjUPQWtnWPQS j蓝USWVdT$,L$[TE$`PD$HD$LD$PD$DL$D$DQPjڨ l$$D$D$0D$ l$PBSmjuD$P Džx ul$d $t$pt$pt$pU4$;D$Du H^_[]HS[Mjjt$6 [ÐS[Mjt$t$ [ÐUSWV[åM$$$|$1 tuMD$tTD$BD$ UD$tDD$BD$BD$BϋJ L$D$"肞/D$D$L$ jjQH Ǹ4$$tu1fD$ D$PWxpD$ f4$l$ffD$ UD$ PW˻ yϝ80u==uWv讝#"衝0WY葝0 WG4$;$u Č^_[]EUSWV$[KD$8D$D$D$D$D$D$D$ D$ T$QRVPduS<$t5t$@l$0=N1B,P- W&t$ʾt$޾E;$u6ļ^_[]$$$$WBUSWV[èHD$,L$0T$4t$(/l$$D$ D$f$t$RQPjVC;L$u^_[];BUSWV^%H$D$$D$hP$WhhUD$ D$t$CƄ,t$$Whh$ Uj UXt/`0$1$:WȌt u널,, w\$|Vy͋<$TWÐƄ,  t t рwrt ␐@$tފ$<-$<+$6@4|$D$ t%$4$֋$ߋ\$4$D$$\$D$PjL$Q$"P\$$@|$D$ t%$4$֋$ߋ\$>4$N$\$D$PjL$Q$"P\$D$]$4$֋$ߋ\$Ut$//$$$ߋ\$$PNT$NJ<-td<+$tHɋt$@$t؃L$Q$jP!$tHɋt$@$t؃L$Q$jP^؅\$VQ%$$$ߋ\$$PDT$uYoP$U1u5Ku*@P$&t"tt]tXuto$WhhU^'1D$ D$7,1D$;$uȁĘ^_[]1<USWV[èBD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP#;L$u^_[];<USWV4Չ[!BD$$0ƃT- T- Ƅ$/jjjhVRQ1Ʌ(t$$/jjjhPUWиt1D$(D$$D$ D$D$GD$D$D$ $L$ PQRl$U"4$|$.vt:D$.jjjhWvvuW$3P訊u,$@$/uT- þPRQj14$;D$;$0u ȁ4^_[]:USWV,[s@E$(Ƅ$'$'jjjhPRQV1$@D$ D$D$D$D$D$ D$D$OL$D$ $T$QRV1Pux<$1tdt$&tBD$&jjjhVww荶uV$+Pu$ $11PE;$(u ,^_[]9fffUSWV[?t$,|$(n L$N\$ PjQs F1l$,$1D$' $ $‰ЋL$9 $ރш̀Ѐ w ЉT$d̀şw©T$M̀ſw ɉT$-tuʀ߀¿k w:T$ tՋT$D$> $ $T$- $ $1 $+L$T$,J $ $T$,BЋ$)J)Ӄ!r^_[]ÐUSWV [X=t$ ~Nƃ1 V҉$t`L$FшT$?r?鍋U1 $j@UPQv\$+U1 ~t0|$>L$:$u U1 uL$>͍ >T$1ҍ1 -9si$:U;L$s>t 9sE.9r9s34$h9s맋 $1 9s$U1 ^_[]fffffUSWV[;t$|$tULF \>LFuF ;D$u ^_[1-USWVp[Å3$E$lD$P9hh@V薈 1lj,$t$\hVW4 Ņ~UVD$ P u0W-e0,$xj$uj!_ƅth$\L$QP*1\\>F \>LFuF E;$lup^_[]1[,USWVl[H2$D$hU$$U uj!ƅtVD$XUPY1LX\>F \>LFuF ;D$hul^_[]1+ffS[Î1t$ t$ [ÐS[n1t$ t$ [ÐSV[M191 jPVh D$ jVPj^[fD$ȉty!fSWV[0t$,D$uj)=ƅtZt$(P>1 \>F \>LFuF(;D$u ^_[1G*USWV[50$ $$Pwh@VI1$|$$ $ u#D$P|$WPP|$`l$d$$ʃ|&jQPt$ yd|=P$Pt$O ƅ~.V$P$P |) us84$)a8|$$uj)Vƅ~$$QPJ1\>F \>LFuF(4$W萄|$;$u^_[]1H)3(S[..jjjjt$t$[ÐUSWVt[-$D$pUB$$Uk uj)7ƅtVD$\UP91L\\>F \>LFuF(;D$put^_[]1E'ffUSWV\D$pL$tpxH 1!t$T1ȉ͉L$PʉT$LL$p L$DыT$pZ\$XÙyZ|$H1T$D!1L$tIɉL$yZ1!1T$tRʉ$T$H,$ʼnyZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1͋T$tRʉT$ÙyZ1!1ŋT$tRʉT$́řyZ1!1T$tRʉT$8ȉyZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$<͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$4ƉyZD$1!1ދT$tB8ȉD$0t$ǙyZB<1ʋt$!1ȉD$,ӉyZD$@D$L3$\$ 3\$411!É؉\$1\$@فyZD$3D$ \$$3\$011D$@!1É\$Չ™yZ$3\$l$(3l$,11!1ʼn,$މށƙyZt$@1!1ÉƋl$ 3l$3l$<3l$ʼnl$ ߋD$@߁ǙyZ11ÉŋD$3D$3D$3D$D$މށơn\$@11l$8D$13D$43$D$ىˁán3L$@1D$3D$ 3D$03D$ D$ʉсn113l$$3l$,3l$ʼnl$8D$@Љ,šn11ʋD$ 3D$(3D$3D$D$ ׉l$@ׁǡn11l$$l$(L<>4LuŋD$;D$u^_[]Ë$YffffSWV[It$,D$uj)譮ƅtZt$(P1 \>F \>LFuF(;D$u ^_[1USWV[å$ $$Ph@Vo1$|$$ $ u#D$P|$W:P|$`l$d$$ʃ|&jQPt$ N|=P$Pt$n ƅ~.V$P$P  |) uj84$oj8|$$uj)Ƭƅ~$$QP1\>F \>LFuF(4$Wo|$;$u^_[]1S[Þjjjjt$t$[ÐUSWVt[h$D$pU$$U uj)觫ƅtVD$\UP1L\\>F \>LFuF(;D$put^_[]1ffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[jt$ L$A͉?@)ύ‰Ul$P19wct,B$ WUPxL 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUPL ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [x|$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jW5 ;D$u ^_[]zfffffL$$Yai qyD$A(tQS[HRjjcT [1ÐT$D$ Zbj rz $z(t RPS[jRjT [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[cRjj~S [1ÐT$D$ Zbj rz $RPS[jRj9S [Xt@ffffffSP[D$ L$T$$RQP;[fffS[þjjt$jR[fffffffS[Îjt$t$jr[ÐS[^ht$t$j_r[fffffUSWV [(t$ D$D$$|$jjUVjW>1D$D$ $jjUPjWD$D$$jjUPjWиD$D$$jjUWjP藸uN8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjR 1u ^_[]ÃtOw OsҍHfUSWV[E$$$D$|PhHtHU0 t'$WP$2 19r4"-$PU@tPUt#M;$uRĴ^_[]Í4rWP$Uv2 "9sǃ#D$WUPt$0t$0 OSWV[<1 hVt$ t ~L81^_[ffUSWVh[5 uj'h5 D$Pj5 L$@B1lj1L$ED$$1t$ƋEpD$Pjxw5 L$@B1lj1L$EHD$$1t$Ɖq jP:u(5 L$@B1lj14$e^_[]ffffffUSWV[l$jPUQ u @t tQUmuMjPUQ t 1^_[]ÍuojPVQ Džt`MjPVsQ 1uú!?E1u<-ut<+u`MDHt$}D$j PW L$9e9$YQH}+t؍ ߃/Љ(!ffffVZnL$?w5t<t#΃? ?9tA|t^1^fffffVYT$r1>w ^ffffSWV[t$(WjV@ xqN|$,t?r$Id$D?r'H- d$!L$jWV@ ^_[fffffffSWVP[+t$tB5 PQhRJqx>L$ $5 )QVWRpM5 PQhRq5 = t@= ^_[fffUSWVY{D$t$D$I@t ~_wˉ"+t҃-!ЃÉ^tu/u4u?t#!tu>uG{Pt̉#.!t,#.!u븉# t# )#>  ^_[]ÐUSWV\[XD$pD$$8D$HD$DD$@D$|$$t8"u0s%1>0WD>0\^_[]ÁsWD$9r8l$8D$8jj P' g>0`>8uD$)l$8D$-@@+x @/>Z|$!>`EL$ȉqpS+t Xt-u111#Y Y+tXt-uY !!ݐY !!̅t f-xt f+p}fXPmffffffS[D$L$$D$ QPjjjR1Ƀىȃ[ffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[øT$(`1<}tPDbt6D$)D$(8rl$ udPt$r-ŋ$t$_:0}tPDW4$2?t$&?^:01UPt$-ŋD$G6>oD$G = = D$ 8tP DG^_[]Ët$$T$(,fjVPQRWXj0USWV׉L$[22jeVj+Vt-1~E|$WjPj\yFu<$|$1jrV]tYb $UW]t1j{u%807=w=801^_[]ÐUSWV׉[G= tuX=mu?ru<6B=FtjP_v$=+u4jj_&v=tjP^6<^_[]ÐUSWV[èT$0P1<}tPA_t1D$D$08rl$ u_Pt$l*ŋ$t$Z70}tPAW4$1<t$%<]701UPt$ *ŋD$G6;oD$G = = D$ 8tPAG^_[]Ët$,|$(l$$T$0#VWU[; j-USWVP[Z<>tP@= tD$9Gt7?t9Gu(>tPp@h6k1P+u= E>tP0@吐jUw U ƃu 68tW蘈t4$^_[]fffUSWVH[hl$`t$$WVUt$hqtUVt$Yǃu.58uj螺~;$} VPYǍD$9tLVA$jD$Pt&WPUt$h q{D$$oH^_[]ffffUSWV4[ÈT$`t$Xuptuut덫tŋL$\toD$0WD$HK|$T|$LtD$PT$0xKD$(Gz9G|~dkd׉<$T$`D$L$D$=SQ|^)k׉<$T$`D$(D$L$D$S<$D$dD$D$1D$عD$dD$ $D$(D$Ѓtp$L$ V' 8T$L9v NjL$\0l$$t#)D$ D$,D$,rAD$ jt$t$t$b%t2jt$RPG%tjt$RP0%d$D$ ɿt$t Љσs1dt0N,1 9tDtPvt$FPvF^_[]ÐUSWVYT$tht$1BtBظkw+tրztЃːt *u1^_[]ÐUSWVՉ[B4B tv:#EVP#p}$uMtQjPD$ t$ L$$l$E1퐐f$NQV$r$@ E/%f}/L$@Ɂ1O tgTO tWTO tGTO t7uً$$$VPV$t@uD$$$PQOD$$$PQV(u%#D$=@u;$s!E/F$$L$ ;$u Ĉ^_[]Ë$rUSWV[c$T$ f$$9t$<L$ D$,D$D$$EfR$t%=LEu⋔$B @D$D$PQ9j=*uA=*uA=*D$$AD$9$L$ K D$$);L$ 4 f? G D$D$PQR$1 #L$L@ Eft:$tK=LEu K$hPQw $A @u$Pj $PQ t#$A @1 $p1ɐDM CDM /DM DM u~ID$4PL$DуP$L$8\$l$0XL$0\$$$W$W$6t$4T$D$I t#$Wrw$v ux .u$f:.u@t(x .u"Pt.uxw T$ ;$w'0jf2fu;$w9;$v%$f8tB|$,tY|$$D$ fD$fËD$;$f|$E;D$8f/D$ fD$f9$r f|$91ۈD$D$ $|$D$D$D$D$D$D$7ڐ\$u=*uLw*t;$OL$ڋL$d$t=?t)=[uBD$G=!D$t?w=D$uyt$f9t$uYt$$w1T$ЉFD$ЉT$(|W]uZD$D$;D$(;L$ $tڋ|$9|$D$(D$T$BD$=]zr-u%D$f9wf;BwD$z뾐f;|$tD$랋t$$|$t$fT$f9ljf|$1t$0FTFTFtTF`=u1D$ $T$D$D$D$:ЉƋD$D$uT$=*uI~*t;t$NL$T$L$؋D$t=?t=[u1umF=!t,~*uU|$։‰}f9|$u:g~1ЍWD$(tF]}D$D$;D$(u6;L$ \$$t$tT$9vT$D$t$fD$f;T$f|$D$&މD$׍W=][_-u+D$f9wf;GwD$wf;t$tD$랉ŋ\$$fEL$0$Wt$($]$D$ fxD$D@uP$PvP$P$P$AD$L!=+=D$ f\$$ 1$A @D$4uPPQu 8t$A T$ $$t$ W$$Y$$0Qփum1ɋ$B u^ZH JD$ /GT$ $$P$tL$< ;$u0^_[]ËD$ fD$,ffffUSWV[$$$tu1|$$t D$3|$ ;h@PD$(D$$D$ cL$t$L$\QP|$tXD$D$0t$\ |$d$<0fD$PPj7Y D$ $D$1p1$D$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$tVPVw $D$$uhSND$$D$iD$,D$ 1҉t$Յt6D$D$0D$4At$,jD$8P .jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9L$~<r9gL${<r9KL$z<r9)L$q<r9L$p<r9sL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9t$u4$OD$^D$ $GL$m <s9u9tL$n <sI9uD$$$9r4$tzOD$_WY9t븉t$ypd$i$`t+t'|$ijPw u1Wt$D[Ƌ$>xt$`D$|Ay DAD$$uD$*`ՋD$DJtDHD$D$"$@um  ` DAթD$mjPD$pt$$NjPD$py D$ t$xtG$`L$tZijPq4@̉jPD$p -1ҋ$tmjPD$p1҃ t$D$t$$D$ $D$D$ D$(D$$1GD$ 1PD$1D$ D$D$8 < Y1D$ D$|$t, D$D$\Pj7*S |$ 8|$|$ t"$%tjPw |$t!r D$7%|$X 8|$ $t t$|$H|$tu V\$ t$jl$ U 1$u U];$u Č^_[]iS[^jhjt$t$t$Y[ÐSWV[,= t-= jhjVPt$$t8= 0jFs= = tPQL= u^_[ffUSWV[ë= jjjې = |$= tWQ= 讐 = th1i = 9= wHt Q/\ = UK= t$WUPH = u 1T$ Ɖ^_[]ffSWV[̷8W%= u= jP;.xƃ= 1= t = 1W^_[ÐUSWV[[8W= u= jP-x5ƃ= = UP";D$wUt$*1Y0WQ^_[]ÐS[ζt$,ƃ= [fffffffUSV0[ÔD$D$L$ pjjPQjRqt_E rT$,$$t>Ut$ t$D$l$tt$$t$D$l$Zu L$(L$D$ l$Ze^[]fffUSWV [ȵoPpt\ƀ8tUT$D$j PVG tŋT$t|zt)yVPP1ɿpkP&wA[@xʹa&LQup@9~ $jPEP,$VP%PT$t$$D$ t ƿ= RUPjQ.L$ t>= ^_[]ffSV[M> u*ǃ4> ʡPV,2> tt> VPѲ1^[ÐSV[ݳǃ4> > tPxQ9ʡPV1> uVPZ1^[ÐUSWV [e$ǃ> ǃ> ǃ > ǃ$> ǃ(> ǃ,> ǃ0> 8> > hhU)ND$ 1Ʌ$t$A#L$ $t$ (> L$l$<ǃ> > hhUMD$ 4> t$P蠪j\WVK t8t剃> 8#tj\WVK t8t뉃> j\WVK t8t뉃 > j\WVK 68t牃$> ǃ,> ǃ0> j\WVGK tD8tP腢,> j\WVK t8tPU0> h$> |$$W' |$Ij\PD$ PJ ǀ8tWEu͍n>UWthpUWtTiUWt@e@UWtt, UW`t!GUWLQ(> E5xxMf l$<$j\WVI 8t牃> 8#j\t$VI t8t艃> j\t$VI tOǀ8t扻(> !GPW"$> e@PWetb`$> D$ʡӿ4> PQJ (> l$tэ!GQPuJ > <$j\WVH t8<$tP,> j\WVH X8<$tPΟ0> t$t$1ɋ;$u ȁ ^_[]藨SWV[Ìt$ǃ4> > t P#L.ʡPW[,> t2t+V> u䍃> WP߬1^_[ÐSWV[t$ǃ4> > t PK.ʡPW+> t2t+V> ;u䍃> WP?1^_[ÐS[N> tPCǃ> [ffS[L$T$ j@t$[ÐUSWV0T$[D$H$D$$E͋T$D`D$D$|$\$9EtL$|AyL$DAMZe*?$hPV'DhPVJhPV PhPV WhPV ]ePV ^hPV bhPV XPVg PVO uaePV7 e{ePV UPV EhhPV 5PV %nhPV PV `1DQV>UVt$;g tD$1f6.&)fD$t=u[t$ P[S[t$ ht$1 [ffffffT$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[Äx[Ḯ̀rS[dx[ḭ̀rS[Dx[̀ffff̀ffff/̀ffff^̀rS[x[̀rS[ԋx[Ḥ̀rS[ôx[<̀rS[Ôx[̀rS[tx[ḇ̀rS[Tx[̀rS[4x[ḓ̀rS[x[̀rS[x[`̀rS[Ԋx[R̀rS[ôx[2̀rS[Ôx[ḩ̀rS[tx[P̀rS[Tx[ḷ̀rS[4x[Ḷ̀rS[x[ḉ̀rS[x[̀rS[ԉx[Ḛ̀rS[ôx[̀rS[Ôx[Ḩ̀rS[tx[1̀rS[Tx[Ḍ̀rS[4x[òrS[x[ìrS[x[l̀rS[Ԉx[t̀rS[ôx[s̀rS[Ôx[r̀rS[tx[p̀rS[Tx[j̀rS[4x[m̀rS[x[̀rS[x[Z̀rS[ԇx[ ̀rS[ôx[S[Þx[ᐐ*̀r׋L$Q1fffffỲrJ!QfffffS[>SV[K tFK Pj?$tsK 4+K 4K K R; ^[ËK HK jjjhjPjFo1tȉK uXj$Pj> jS[^D$K );K t PF*[à QPG[ÐS[ljPK uP][ffffS[ޅpPt$t$t$ [ÐUSWV@[àuD$4$8M D$(D$0D$D$,\$<1UB|$D$D$ ^D$L$$RAt$y`DP@t$T$%7D$D$ OL$ۀU|$$ɋ|uL$ |$$1룐|$$|$ODH@uT$ EHhL$8D$D$8WVPt$WV ]D$xW.Pt$W. FD$xWPt$W [D$x WPt$W GD$xWPt$W D$xWPt$W rD$xWfPt$Wf bD$xW>Pt$W> AD$x WPt$W  D$x$WPt$W D$x(WPt$W D$x,WPt$W 1D$D$\$T$ EHL$D$D$8W?Pt$W? D$xWPt$W %D$xWPt$W :D$x WPt$W &D$xWPt$W hD$xWwPt$Ww QD$xWOPt$WO :1D$D$\$D$рD$ G H:D$/D$(҃ 46"T$(T$ Ѓ |$z D$|$GDA@ut$D$  N:D$/D$ 4 "T$T$ Ѓ |$ODH@u|$$t$ |$$D$D$L$:|$P|$Ѐ 7 O:D$/D$ 4d"T$T$ Ѓ dL$ KL$ |$ODHut$D$  N:D$/D$ 4<"T$T$ Ѓ HQot$D$  N:D$/D$ 4>"T$T$W ЃU > |$D$ O:D$/D$  46"T$ T$ЃEt$ʀD$l AЍ~Ƀ 'w~N0rv:sqɍAAЍ~  'wNN0rF9wAɍAAЍ~  'wN0r9wɍAЃ='v1lMAD$ L$oEL$|$D$ O:D$/D$  4d"T$ T$Ѓt$T$ ʀD$ T$ w~AЍ~Ƀ nwVN0rN:sIɍAAЍ~  n0 N0T$ r9wɍAЃHmv1MAL$8t$D$ ;N:D$/D$ 4"T$T$Ѓ4|$Ѐ O:D$/D$ 4 "T$T$Ѓt$ʀD$ F:D$/D$  4 "T$T$ЃT$ ED$VQPt$VQ D$V&D$Pt$V$ 1ɿT$ ]D$IEt$1 \ЉD$8D$<Nt$ʀЀ ws119º !ɺ D$T$ы\$;L$ |FD$8t$EFt PF t\~tM1퐐t(0F t((F t( ;~s F @ƋF PF,t PzF4tPeF8t PUVL^_[]fffSWV[,\t$`W職,L PV:Wh^_[ÐSV[[`VF,L P'9V.^[ÐSWV[ì[`W,L 4L PQ9W^_[fffffUSWV[[[l$UuPUt$VQ1tmNjt$l$Ut$2QDžtqV7t^oEtЃVP虤t Eu릉l$}uEtP轡E^_[]É1ffSWV[ÌZt$|WdL PVOWȵ^_[ÐSV[MZ|V覵dL POV莵^[ÐSWV[ Z|WedL hL PQOWD^_[fffffUSWV$XYt$8T$`D$ 1ۀ0T$u,N 3i=)Njtt+~%L$9N$ut1Ƀ|$tΉL uj()ƉDl$Utwn$Nj 0Q\ 1L utjh=ʼnL 0ƃL LtMjуL @1t*n$FDUQj PA|$z^_[]ËL )USWV[ëNL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉL uj(ƉDl$Utwn$Nj 0Q 1L utjhʼnL 0ƃL LtMjуL @1t*n$FDUQj P|$z^_[]ËL )USWVP[:Ml$UXNjL $tOs;1҉vL ljh=L $uƃL D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$ܕt0L tuR:t!jуL tiE$SL uj(Jŋ$,tIEj |$WP葂 WtE@E$L$1E^_[]t$t@ϐUSWVP[JKl$UhNjL $tOs;1҉vL ljh)L $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0L tuR:t!jуL tiE$SL uj(Zŋ$,tIEj |$WP血 WtE@E$L$1E^_[]t$t@ϐUSWV[[It$|$ tЋL t61=tDtPǃL D$L$ƃL L t?1=tDtPǃL D$L$ƃL ǃL D$ 1^_[]ÐUSWV[KHt$|$ tЋL t61tDtPǃL D$L$ƃL L t?1tDtPǃL D$L$ƃL ǃL D$ 1^_[]ffffffUSWV[5G$tA$1uhƅtcD$E/$tt$$9ux/Ĕ^_[]J?$9u/(>?USWV[{Dt$tD$tdPVxaa1ɐ΍,?UQt&UPy.w耕8"tV g1^_[]ffffUSWV[Ct$VL P6L ƃL ` tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t PǃL ǃL 1F ^_[]ÐUSWVT$t$L$~ 9tS1tT:u>8ut}Y8uuuȀ@t:utȀ:u 1y@t^_[]ÐSP[-BL$ jt$jt$ [ÐUSWVP[A$p$L T$8L$4|$ $h$dʼn\$uL tu$l|$th8|$t:|9v,t:t|u싌$lh$ $L$1xjjjUu|$`PQhl$XU jjjh@U赊jh@6ܕ D$1l$t$(1ɍD$L1Ë$L$AD$$Љ|$L9rB19r0T$\$hWt$0 ƅ4LT$< u|$tT$$$1t$#tT$$l$t ߍX8؉t*s:j|a;$v<t:t|u싌$l덋$$$L$t1<9< t+< t'#<:t <\ut111;T$l$ \$$L$T$$L$)\$QP*T$)ʼnl$‰$L$\$$l$ '|$t t$蟔t$(D$l$tEFH4$=DD$\$t$(l$L$T$$pL$T$D$$1L$,$t$(l$D$֊<:u>tuk{D$؊6U8u Xuuu@=uUt @hƀ:t FuFT$L\$t$$Ut$t$4-\$,L$Lt&]u%F:D$L$,()D$ tD$)T$ D$t:u)ʀ| :D$@t:\$L$ ыD$)9L$ |KT$<,$D$)\$D$PU))\$)D$Ɖ$T$<*)׉ڋ\$QVPN% Wt$DU@% t$ t$t$,/D$L$, \$D$T$l$1ҋ4$t PЋT$ЋL$89T$v6)RV'|$ u(V|$ |$ L$41׌04$jŌ0jL PCt$PL L$<$ 14$$lD$,P"|$,\$D$0jD$HPWUU t t"t$D<u/t$,D$HȾ\$UU|$ <D$\$VD$xWt_WVPk# UUxx1ɊD$D$8T$D$48B\$W$ |$t$+UUZ |$ ;$LutP^_[]00WVƃ|$\$t t$ҏ4$\$U|$t\$t$衏\$t$,njW3XO9L$ÐSWVL$T$ȉ֊t~8t1t0:t+|t&9vt:t |u^_[ÐSWV[ü8|$t$L tPǃL ǃL ƃL ƃL WV]^_[ÐS[^8L tPSǃL ǃL ƃL ƃL 1[ÐUSWV[8$,E$$L uL ȋL u!Q0µL L t1L  L PQ,t $D$uz1L WMW6~ǃL L HL @MQPL u<`1DN@u:t#t L 8|\L L L $ƃL l$L$L$ $Dt\uUL P+uًL t:tuT$ T$WtfW}ǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$W|ǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8&ƃw5L tP|ǃL ǃL ƃL ƃL GW{ǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$u,^_[]À|\u ƃL ƃL [.USWV[H4D$ l$HU:u0U8u't#ϐ7U8uuu@=uE<@}D$jd?0ƃd$L$ƿd$M]d\u}M:ȉʀ0E€0 ȃE€0 ȃ,^u"M:t ts:tn[<$)FdPWO7xу¾2w/:뷃벃뭱멱 륱 롱 띱 뙉,$)u %FPUt L$$WUX^_[]ÐUSWVP[*2D$l$HU:u0U8u't#ϐ7U8uuu@=uE<@D$jdtWƃdNJD$ƹdEt#<:tu)FdPWu4)u袂 "FPWtL$ W^_[]ÐUSWVL$t$T$~ tB:u>8utމ}Z8uÃu뺀@#uZ@tỳ0uB 8/>9v$uPc FN8D} .~ wF F Pk>uWv $ tŃL~?:}|@uH)ƒVԍF F BBQWP"c uvv 葃 ?~?:uF:~t ~ ~8u ~F,;8u e^_[]>'S[.-0t$t$ [ffUSWV [,} F FEFUVzRu)ʃԉF:FJFx9u0Ru] N ;Nue^_[]S&fUSWV0[C,D$(}ĠPQfL t$M L$ML$f|$ L$T$|$QRj WPuOt$ rF|$j WP u0O L$FD$D$ PjL$QrD 79_t$} urP tgM9uWM % PWQPR}Wuz19r"y";L$(L jjP< PED$t$L$ WDt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V\s uEPVu5a ;EsD$t$WKCL$%D$"T$ ;UwRPuv_ 1ɋt$;D$(u ȍe^_[]#S[):jPL "h PK:P [SV[Ý)L hVt$t$t$%t1^[fffSV0[Z)t$DD$@t2D$D$ D$HL$ $@D$1L$V2]븉l$WPU11!$PUNQV9l$V\`D$ $!V\L$WT$9F|$L1 󫋼$$WL$PQT$ RPt$ Htt! $u*G $~oQ $u D$uD$D$D$ D$~3D$HD$D$0D$V[|$WT$9jFT$L1 󫋼$$WRl$,UPt$ Ltt(QD$#D$$D$~kUD$1WPGtWD$03$uD$D$$D$ D$D$0D$~D$HD$WP;S$D$D$,|$L$9sȐVP9rG$)X $u0u8L$$QP(; D$D$T$ -L$$QPy9 D$8u|$|$0$D$D$,D$W9D$l$T$jFT$L1 󫋼$$WRl$,UPt$,(tl$t%)D$ D$$D$l$~UBD$1WP$uD$D$$D$ D$~V~XWP7Q)ЉFL$$QP菔 D$P T$ t 9l$D$D$,q|$cD$T$ u^?|$#L$,|$$L$0 VP]rD$T$ |$ GL$(D$<$Hʀ߀X$uD$VQ $uD$fxWt$,jU,ID$eWt$,jU< $u&@u(u-uu||$|$ |$fD$,T$ L$ )L$L$ m|$[|$$:|$<VP7rL$׋T$ c|$Q||$|$ D$T$ D$D$8׋T$ fD$9I^׋T$ L$Q׋T$ @݉T$ @L$D$,N @1|$8 D$,D$D;$u6D$,^_[]Í$9v׍HL$@VPsRfffffffUSWV[ |$l$ 8unnjU)}0u LJE T$uGEt-U$/E EE}0T$fE ʉ $7to9h};8%fE EMtY9vU8PuPEEi@9tgWV9Ɖ|$UPWA l$ E00L$HcMM@(@ )@$|@({@,}@0]@4\@8$@L$T$ t$ t$ t$ t$ t$ r[ÐUSWV[L$(T$ 7t$T$L$pD$L$11jUt$,jPxD$Ƌ;D$u ^_[]USWV[xD$(L$,T$$>|$T$L$pl$L$T$ jWPjU1xL$ȋ;L$u^_[] USWV[|$t$t V;1pL$1jUWPV ^_[]ÐUSWV[ë|$ t$t V:1pL$T$jUWPV^_[]ÐUSWV[[|$t$t Wx:1p1jUt$$PWy^_[]ÐS[pL$1jPt$t$t$C[ÐS[pL$T$ jPt$ t$ t$ [ÐS[ÎpL$T$ t$Pt$ t$ t$ [ÐSWV[L|$t$W菬uGكs^_[!t_t$t%<LFLF ^_[ÐUSWV[|$ u ^_[]l$ t$W贬t t- t(W蝬tWPu뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[|$0t$,Wt$@[D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv <$|$Dփ 6D$4)D$4@u \҉L$x MVYt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/`DPg%0W$\P$D$4@uWu#`DxuGws>4$$^_[]ËD$4  !rfUS [E$D$D$D$PQED$e[]fffffS[Ît$ t$ [ÐUSWV[U$$%= uRl$4$袂ƅt1fFH0F D$D$D$0t$T$j6,t5D$"D$<u 0G OJ0D$,L$T$T$D$,D$D$D$1D$HGW(|/uL$V7 }t!v$3v$3v$|V|W..^_[]fffS [pPQt$ t$ I ,$ [ÐS [ët$Pt$ t$ ,$ [ÐS[~L$T$ pP[ÐUSWV ׉[DT$4 |tb1=t= T$4t=uD T$41 L$ L$ L$ L$ D$l$ L$RPQUWVs=u("ك Tw" # $T$сK1 $  ȉD$D$ ^_[]ÐS[.L$T$ t$[ffffff̀rS[x[̀rS[x[ ̀rS[ôx[L$D$9tt P9u1fffffffS[nt$ t$ [ÐS[Nt$ t$ [ÐS[.L$T$ pPt$ [ÐUSWV,T$[l$DD$@L$D$\$t?D$@|$"v/*&1t$\$UP\$u+t-tD$D$@tN1D$D$@u90u4 @$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[$x[USWVT[L$pw_<l$l1.t$h D$ʼnD$4\$P4][D$,D$M؃|$xD$ JL$!ϋl$ t$hT$p $dl$ щʉ $9wѐD$ ŋT$;T$hL$xv֍<\$QRW$$\$( D$ ~L$p|$t61ҐD L9u֍*|$p)׃|$rσ|$q1Ґ ,, LllLLllLLllL9u ?D$l$ ؃OL$$L$xD$ l$(\$T$pl$(4$"\$ύ ʉ $9wҐD$ ƋT$;T$(L$xvՍ<\$QRW$$\$( D$ ~L$p|$t61ҐL D9uՍ|$p)׃|$$rσ|$$q1Ґ l,LLllLLllLLllL9u|$4l$,/MD$4|$,4D$ t$80t$h\$QPV$ |$ X\$ىL$0D$D$p@D$<|$ʼnߋ\$9)L$,D$L$D$4L$,|$t$t$(9/9$}D$<4(L$ \$t$xVR$ L$8AL$ D$;|$(r0$t$hL$,\$|$3t$h!l$ t$hD$4;,$=D$/)ʃT$D$tӋD$pt?1ҐEL5MD59u.)֋L$,|$$r|$$u1ҐL,l LllLLllLLllL9uՋL$,L$  $9ыt$hD$ T$  $D$|$x\$t:D$ $ȃL$p U0uuD$0L$p9rދ,$;l$(D$ \$WUP$\$( L$8D$ L$T$ <$9׉[ $<\$t$xQW$ L$0Ȩu$)D$,T$t$0t,L$pU7uuL$p9r<$D$D$ L$ދT$ ct$hD$4<ȃ98IT$pz|$<T$8D$‰D$4t$H9t$h ωp9׉t$HtՉЉt$D͉L$,|$@D$L&D$DBD$DD$LՋT$P9tl$ŋ)<|$ 9t8|$P+|$@9D$09l$;l$ 9\$ |$$\$t$xt$U$\$ L$ L$\$~L$0L$ىl$1҈ډT$$T$p<;|$ L$(l$\$t$xWt$ $T$| ;D$$~7u$?jUTƅtF PVW u$*jU!t@ PVW 18t u $tD$ 81^_[]fff̀rS[$x[ḃ̀rS[x[SWV [|$D$ D$D$$.0L$jjPWjQc1u9 u 01 ^_[fffffSV[mL$D$T$ y9_RVQPi6Q4P 1^[ÐS[D$y%9_P PQj@R  P j@4R P [fUSWVXL$tCt$81ېDWl$llof9u1t9u1)^_[]fffffK̀rS[4x[USWV [t$ D$Pi7$|S_ NL$ 9t6ʉi)iAi ˍ $ 4L$T$ o9s9s}$?9r|t$^uA$t209r9r։ t$A^_[]É݃t209r9r֋9s9r9r봐USWV[h|$8D$Pt )1ҋP1L$4T$0 s7ǃǃǃAQ1@Չt$sAs(11ҁ¹)҃L$ $‹D$4HL$|\$ÉhT$r1L9t;Ⱥ_ Nʉi)iAi ō 뺋D$0 $Dl$S9w9\$rыT$ҍ4)tG109r9r΋9s9r9r봋9t$r9rʉ艃 )D$ L$4t$_^_[]ÐUSWV[آt$.̉׋D$)ō$P t )1ҋP  t 14$D$^_[]ÐUSWVP[WStI 010$9r$9r$ i0mNA900W^_[]ÐS[^t$t$t$ [ÐS[.t$[ffS[D$@ @@@@@@D@0@h jP [ÐUSWV[ØQ 8R h EGGjWE8jP,EǀPǀTǀX`XucǃQ WԦŋ@~*uf~ XEuh?35l$|$h @ h$Ɓ| D$ 1u0dždžjP\E08jPE0ǀPǀTǀXD$ X`zD$ $ȋ|$F FFFFFFDF0@h jP WF^_[]E1␐USWV[+8R h EGGjW!E8jPEǀPǀTǀX`XucǃQ ^_[]ÐUSWV[hԦjsƐ+w?uiƸP0l$x pxkX$, 1׉j0DžDžjPG08jPG0ǀPǀTǀXX`l$$1E^_[]ÐS[Nj輳[fffUSWV[ $j(jD9$hj*9ljt$V6Tn ut1^_[WVctGPVxgtۍGPVctʍG PVctWVcVZ®D$ L$qtu0qwY$ ^ËQ tu*I IH^QPI;@P^@p^^ QPI H^ ^ ^ ^S\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ffìrS[$x[v̀rS[x[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWVL$D$utdT$pא?t 8uلt&~Ր}8t ut 1119^_[]1fUSWV4[Ո$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋ< l$1 r$Xt$\t $X1$Pf$TWՃiriQVPؾ ,$$XtY$\tOFl$0PQjUU$\9ȋ$QU$`m FfNQPR$`U$`1Ʌ9$Fx$P$T)PURQW*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LQPR$`$`l$ 9+ t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`^~$PEDL$pPQ|$W$`UUt;$Tg$P$T)D$D tP|$Wt$L$QRL$)D$D Pt$t$t$RL$)D$D Pt$t$t$RL$)D$D Pt$t$t$RWL$r)D$hD Pt$t$t$RL$9)D$/DPt$t$t$RL$)D$DPt$t$t$W19D$F$PED$1$1pD$ tD$D$׋D$ tD$ $ 1QPt$t$U)H)D$>Ń19t$un 1f$PL$$T)fv fD$ VQURt$L$ ;$T$%T$0L$RQPWst(8WT$\9vpD$0PY_;fǍ$0PQhW#W $\9v QW$`菸 %1QW$`u D$0P^Fl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF M u)L$ QPtPŅ$y+8ET$ PQhRr=$w*;$(v.L$ UQPY $$1%D$1;$ u ^_[]vffUSWV[å|$8$E UPwZE 1Ҩk4$$4$0$,uRUW-VUWt9~uۋ$0tPv u*ft#Q&$4ƃ1ҁD$D$ƉffD$D$hVQP t$D$L$ T$PQVRu0g9t$D$ ff9|$$0$4t*G9D$D$u_GRQPP= uEt$WVUHZ24$1E u UU;$uЁ^_[]1ҋ4$E ttfffffff̀rS[äzx[USWVP[ÊzP[xT$1tJT$ t4i t}um9ujqt$$V 1$11Pax8^_[]ffffffSWV[y|$jW5G=tjW(^_[fffffffXyL$rÐSWV[lyt$VWtF~tP>^_[ÐUSWV[y$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ $D$8D$4D$0D$,D$(D$$D$ D$$\$$b$xuxuxu x$ $\$PT$1t2\$WGtGotP.܋\$$$0$;$ЁĨ^_[]$k$@$QC$FD$8FD$4FD$0FD$,F D$(NL$$vt$ T$t9t5T$ t tu#u u$ D$ D$D$\$$PWWti$t$tf1ۺD$11 ߉D$ŋ6t>N tFtI1л t̉1$1D$\$ \$t$o\D$ L$8L$hL$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$T$ T$PL$LuD$ $L$$Pj$rD$hD$8D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$LL$PL$ D$\$D$8D$hD$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$L$ L$PD$L$4\$ N3D$hD$8D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$T$P1T$ T$LT$ t1#D$! ttD$ 9tFtll$$V9t$(\$[$9މuL$ ȅt$utT$$ۋ\$$u <$t$T$(oL$$$PjL$ 1T$FM@t$Fu \$ =<$3\$ t$iEjjPn x P8wL$$\$$PjND$ 1ҋL$T$Du`xl$\$j%$UwD$UmL$)L$D$H$PUl$U$i4$\$t$H$yL$Du`gl$D$$u&JB$L$$\$$PRUJBD$L$uA>Qs9H0n$l$t$Wͦ\$t$(^_[]ÐUSWV\[hTD$P0D$x8hD$8D$4D$0D$,D$(D$$D$ D$El$ |$uHt$W$T$ RT$RPWQVt,t$D$t$D$EML$@ML$XML$TML$PML$LM L$HML$DD$;$$(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$T$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$T$L$ ut$t$$LUv)1ffffD$@@#Eg@@ܺ@ vT2ÐUSWV[6l$$|$G? OW@)19w_WT$Vt$$PL$ k T$]$19s'D$ 0L$>@9r|$1T$ )URPk^_[]ÐUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [È.|$$D$O $GD$?17l$ )ȃ8SPQWH jPW: EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWb ;D$u ^_[]'fffSP[Ý-Pt$1Ƀ $ȃ[ÐUSWV$Yh-t$8D$D$ L$`1DKNl$\$1Ҁ0u.N (pt$t$Pt$k[ÐSVP[ (D$L$T$t$4$VRQP5^[ÐSVP['D$L$T$$pRQVP^[ffffffSWV[É't$,uQVlt$ D$L$D$D$D$ $D$XjWDPWj:jW}F1Ѓ ^_[fffUSWV[&E$jhj" tMƍ|$hjW[ j$W] WhiVP[ V|tt$D$P1xl,$|$tH 6t9n t}u$vouuW ,$u W ,$`w1E;$u Ĝ^_[]fffffSV[ý%t$ F tv0F0v(F(F,vyFFN yjPi FtF "PQ4tF F 1^[øSV[$t$ F tv_FF F t6kF F ^[ÐSV[Ý$t$ N u@v0F0F t6f jjjj6F0^[ÐUSWVP[*$D$@0%t$A# $QP:E< t< tPUǃUfF~ l$EuE jj EF4$Wtx1퐐< t< ttYT$BH9u% JPrtaL$AFF<4$W9t 1 1F^_[]t 1 tmt t.t |$ ި \$t>t l$ l$|$$xt$\$l$t t$ t$v$1D$ T$Dt$ $u U<VWjPrQ |$t$$|$ 1ɉt$!1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W-Q Pt$l$UQ t l$ /D$$<F\$hPWP |$ l$(D$D$ l$L$ff9NF L$\$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$D$P$t\$|$WUROT$ \$WjRfOT$ |$L$F t\l$Et Njl$U \$Wt$T$RgO E xu D$L$ H$l$L$~ xl$>Et Njl$U\$WQRT$ OT$ L$E ED$\$l$PUw1t$UcD$L$$9sD$DQA1ɉȃ0^_[]D$D\$^S[t$[ffUSWV|[j$n1tGljPW8t)l$XD$\|+Wni Wn1|^_[]jjWjjUjWxnt҃D$ l$<$D$ƅuUW뚐USWV [|$$(rl$ NBCD3EB 3M t9i1 ^_[]Ë|$,j<6Ɖ8D$0FMNUV } ~$E$F(L$w F,w F, F,$wF-T$$ T$$w F- F-nV U(V|$Ǎ<((1t)lj~$BF9r\9rXD$9rPl$$9wHҋ|$1Ѻtr1ҁD$sD$rgV}s@sщʉѺ u׋ $)jQWj[F0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPjF4~F:F:t1F;pS[.t$t$[ÐD$@ ÐSWV[T$|$9W v#wG,ʃt$<u0 Ћ0,fL  )r;GveD$Ot$1^_[ÐUSWV[Ht$,~$ED$\$Pv(t$Q 9quJ9_$D$D$4$It$rD$<$L$HL$D$ l$D$$$$`$ttl$$;W%`t %)l$ $D$D$pt$L D$0^t"l$ $D$D$0t$L D$0^t"l$ $D$D$t$L D$0F^t"l$ $D$D$t$L D$0^t"l$ $D$D$pt$L D$0]t"l$ $D$D$0t$L D$0]t"l$ $D$D$t$L D$0F]t"l$ $D$D$t$L D$0]$t"l$ $D$D$i`tn6.&Vu^_[ÐSWV[ì|$[ƁYjVW[ yWPV ^_[ÐUSWV4[X$D$0D$IuD$HL$j.QPjT$PQj.jR^$tEL$PQV  D.0;D$0u 4^_[]USWV([øt$L$-uAD$QD$ +tD$ +u AD$Q`x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍtщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍtщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$tщ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$`8D_L$u D$(1ˍA^D_uk*… )хt 1Ҁ|0.щ^_[]ÐUSWV[} LD$|$D$ D$P%lHHPPB0ppp RQWjVd$r D$ƀe^_[]USWVP[:l$PPU^^VPUF^PU.^KPU^"PU])PU]PU]5jPUA 1uR`MDHt?:j PU~ :8u$8 L$A.&L$0t9^_[]ÐUSWVP[êl$0PU\txF u6ljPU@ 1u[`MDHtH9j PU} 98u $8 6D$t8^_[]fffffffSWV[|$t$jWGHO~;G~ t H WRYhjW^_[ÐSWV[\T$L$Bpr~ ;B~ t 2~: RQg^_[ÐSWV[ |$(D$$uQ$P#,D$D$D$D$ jW"G0u ǀD$PWjW^_[ffSWV[|lGHt Jt @t A?t/t5Gt9E4'P$ +Pu0) E0M0)u40E HM @PWjdj$+Pu>9E4'P$ +Pu0  E0M0)u40E E PE PWjdj$+P>9E4+'P$ +Pu0w  E0)u4M00M AE 9L$Pt$ jdj$+P=9E4&ƃP$ +Pu0  E0M0)u40E E uEE ;D$ }0L$q\$$E0 E0E4HM0@E ;D$ T$ E4PW'1&E E ;D$ sɃ}4w\$d(&}4u0E WVu,P &%}4%E0 E0HM0E4@MU \$WVu,E P}}$u E ]PQjdj$+W:<9E4O%PWu0  E0M0)u400 M t$ )΍VUUUЃ=T$XPRVQ@0}4\$$ʋE0f (E0E4HM0@D$E HM 8HM @D$QE t$T$[t$Pjdj$+P;9E4-$Ƌ\$P$ +Pu0u \$ E0)u4M00twE L$\$Pt$ jdj$+P:\$9E4#Ƌ\$P$ +Pu0 \$ E0M0)u40E E uE4w#t$M0fA  QU0E4A|$XVWt$u .F9E4\$##VWu0x  E0)u4M00L$M M E4;L$ s]}0u \$"M0fA  QU0E4AMU E4PWu,V""E4L$ 9M r\$"}$ u4u0u jP}$w u 薽E ]PQjdj$+W99E4("PWu0{ E0M0)u40}4u0E MU }$ E PQjdj$+W89E4!PWu0 E0M0)u40E  E ֍;T$  D$dD$`D$\D$X)XVPQT$ D$Xu4u0Pj}0W?lj}0)E4u u |$C;D$ \$ }4 E0 E0HM0E4@ E4u0} PVu,W  }4 E0 E0HM0E4@E E \$P誻M ȃE P蓻E E u0P~rPQV E M E4u0T$ PV!  E C*uPjdj$+W6v }$ u4u0u j脗u0VƉu0)E4E HM @PQjdj$+WW69E4lPWu0 E0M0)u40E E ;D$ M11 }$< u4u0u ju0V7Ɖu0)E4I \$u +E E \$PM QU IT$|$0\$QPVRj(jW5\$ 9E4PWu0 E0M0)u40M t$ )΍VUUUЃ= E48M0ArintAto pA ong Aoo lArd trecoM0E4I }4u0E WVu,P#}4E0 E0HM0E4@MU \$WVu,E P}4E0@ f (E0HM0E4@E L$ )p\$P衸E M4;U0B  ru0M4B\$DPQjdj$+P39E4Ƌ\$P$ +Pu0A E0 0M0)u40}4E0D$nr3)M0 M0E4QU0A_}4sڋ\$E4u0} PVu,WgM ;L$  \$AE AE IL$1$+E ;|$8t1ɉT$|$਀t^L$ P#PQjdjV29E4PWu0 E0M0)u40T$|$L$lE 8D$E ;D$  |$XWu u$u, E4u0} PVu,Wy:E L$ )o |$ 1ҋ\$L$$+р਀tJRPt$ jdjV19E4PQu0 E0M0)u409T$ ыE \$냃}$\$u 褵E E \$P苵E L$|$X\$PVQj2jW1\$9E4PWu0f E0)u4M00M u4}0T$ VW~\$E }4E0 E0E4HM0@M T$ VW7\$E }4vE0 E0E4HM0@M T$ VWQ\$TE }4/E0 E0HM0E4@E MU VWu,Pz}$E ]PWjdj$+P/9E4P$ +Pu0 E0M0)u40E HM @PWjdj$+Pg/9E4|P$ +Pu0 E0M0)u40E E ;D$ L$L$\$Pt$ jdj$+W.9E4 PWu0^ E0M0)u40E E ;D$ r(E4u0} PVu,W}4E0 E0HM0E4@\$u ڲE PPWjdj$+PA.9E4VP$ +Pu0 E0M0)u40u vE P9PWjdj$+P-9E4P$ +Pu0D E0M0)u40u E E PE E PޱE PWVQjdj$ +PY-m|$XWu W 9E4PPWu0 E0M0)u40|}$9u XE E PCE E P.E T$XPWVQj2jR,9E4PWu0 E0M0)u40E4u0} MU PVu,W}$E H}$rb\$]T$XPRVQ x?D$ }4\$E0f (E0E4HM0@ \$qD$ +E }$tUpVQPRjdj$ +W+9E4PWu0 E0)u4M00t$ 9u iD$(D$t$(jdjW0+M )Ήt$|D$<+t$~;D$ƃ\$T$t$PRWo |$}\$5\$-E 8\$Pt$V8\$ ƃ9|$u؍$+)9u4VPu0 E0)u4 0M00\$}4mE0)E0HM0E4@}4E0.sAD$.)M0 M0E4QU0A~*}4sf E0HM0E4@ߋ\$sPjdj$+P)4+D$$D$} \$`D$1҃|$|tL$ L$D$$4+1 D9T$t> ..x\$DK.ẗ$Lx̋D$DH.t뻋\$/֋\$L$ t xL$DA.t.$+)9u4VWu07 E0 0M0)u40D$E E t$ 9PM0+L$NjE ;D$ HM  ɃtڄyL$u2E4e׋M0A  QU0E4A D$T$RPjdjV(9E4PWu0j E0)u4M00D$T$L$Z*D$$D$D$L$L$ \$t$\$9E4Pt$ u0 E0)u4M00D$ ƃ0|09u4\$^|$$ +rz4w|$7$ +r|$7$ +rz4|$7$+Rt$$+2|$7$+2z4|$7$ +r|$7$ +Rt$$ +DŽ$ +====2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +Rt$V$ +Ƅ$+=fDŽ$ +==2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +rz4w|$7$ +r|$7$ +Rt$$+Ƅ$+=U4{ u0$+$ +^>~}0U4FU MU FD$$D$D$D$D$ \$t$;9E4 Pt$ u0P E0)u4M00D$ ƃ0|09u4\$|$E M4U0B  ru0M4B\$QVP2 u0Ɖu0}4)lj}4>r3)E0 E0E4PU0@+}4sڋ\$}4u0H;T$ \$BE D$BE JL$d$D$T$E D$щT$;T$L$t1਀t\D$T$PPQjdj$+Wy9E4PWu0 E0M0)u40T$dE L$D$E ;D$ \$u4u0Pj|u0VJ)E4u0E X\$u4u0Pj|u0V)E4u0E )E4u0} MU \$PVu,WM ;L$ t$ )΍VUUUЃ=rE4\$8kT$X\$PRVQD$c|$|/}4\$6E0f (E0E4HM0@|$[D$$D$D$D$D$ \$t$9E4Pt$ u0# E0)u4M00D$ ƃ0|09u4\$|$raT$$\H @>rET$$H @>rT$$"H @+<$+D$$L$D$ ^_[]fffffffYT$4D$#PTÐUSWV[ۭ|$ l$t$~Jt$~2UVx(ƃ|$tލF9wȉ9v(+t$^_[]ÐUSWVP[J|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }/(^_[]E ffGftC,$RWגxǃ9w,$)xD$ hHGftf,$RW腒f 8 9Xσ95,$)5|$ oGwtc,$RW 8 9σ9,$)|$ oGwtc,$RW衑 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [Ȫ|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$. ^_[]Ð~34$UOx(ŃtߍE;$wMȉ;,$v ;(+l$xD$ h,h,L$H(ht$0Quus]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5@(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[8|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.^_[]Ð~34$U迍x(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu苛U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWVXT$4|$0$D$ D$11ɐq;t$<_T$WT$t$,$?t$8D?‹T$DD$?l$Dc D$fD$Bу1T$r8Ѓ17T4T7T4T7T4T7T49ut41Ґ9uM;L$<T$D$0 4$|$|$l$8T=T5=|$tT$$D$808=;L$0}V xn^c|$8XD$4D$~D$`D$‰<wsBքu1L$ˋ|$?|$ $LOL$t)L$<$\{<$|$ LOL$L$D$<$1$ r $L$t|?TWT$T$ Dzt]$؉ÍF$и rT$ӋD$T$<$t%D$ЉT$;T$8D$^_[]ÉUSWV[ȟ|$t$$ u f0x<$|$Vt$~p$ƃ|$ 19tG,00r7 $ r7jB؃u;$}B.뵉ED$^_[]fXs ÐS[ޞs ht$ P. [ffffÐ1ÐXt ffffffUSWVX[hl$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMn9^L$"jWRPj2jQŃ9D$"PD$tPD$pD$)D$iǓ$))ŅtUT$ 9^T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ 9^|$"jHQPj2jWH9W|$WD$D$lj|$)ƋT$ D$kD$p` txҋ9|Wy>TWPڋD$+D$pyXffffUSWV[Kl$Uvƃ;D$v(`|$UW1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[å$$$hWP! x3l$hU$( xUW|1Ʌ;$u ȁ^_[]ffSVP[ L$t$D$T$ $xRQVPx9rRQP) ^[USWV[û|$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[;|$t$l$tt$$PW%to^_[]VW t W LJWVUF ͐SWV[üt$|$jW1Ƀ PVW ^_[ÐUSWV[{|$tt$O#PW$t0l$VW/ t WRLJWVUM ^_[]ÐSWV[t$t5|$r#u#jV#tjV$F1^_[S[ÞD$tL$ ttu H1[[ÐSWV[Lt$t_|$G?wS>1RjV"t3jVU# tۃtjV"t jV/#E^_[ÐSWV[üt$tAjVq"t2|$jV"wsf~ 1^_[ffS[NL$T$ pP[ÐUSWVT$0L$@[uD$\VrLD$ Pǃ|\$D$t6=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$$ $$$D$D$D$\$$|$,Vt$8PQRWyǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q& t$\$W$PQ%\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$l\$t$,PVD D$,\$PV蠾uD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$NTD$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[Nv|$   >L$s*D$@--tr0twPu@-g[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[luD$Hr %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[ýtt$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[sD$ L$t9u[ÍPQjpR9S[îsD$ #L$t9u[ÍPQjpRD$t&L$tu1u 1tÐS[sL$ D$Qss)ǀ[Ãuu ǀ[ÍPQjpR5S[îrD$tL$ t 1[[ffUSWV[krj 1tQ@@jjP (8t(Wu(^_[]ÐSWVP[q|$OGQ9u0$jQPl "08t  G $GT$pw1^_[ÐSWV[lqt$tRtC|$t3~t-0L~r43;~rP V^_[ÐUSWVP[pD$H $t.(1tt$V肺t 9<$u1^_[]ÐUSWVP[ÚpT$J $Ћ*1|t$W"t94$u|$ l$tWEE$F;$} $)Qtu<|uprP $كU|u!Ǹ1>u5~u/~ -t/9uqL$Dl$@|$<|$ l$L$L$HL$,d,$l$l$PRVQt$t$t$ D$(P*k 1t781L$H^_[]Ã~MF @USWV[Å[$0$8 $ $L$HJ @BLt$FNV6rl$VRQPWhUWhȬzōt$hWj jVP ‰$0u uuuVj PWt$}w$0+i@ ;A7T$ B@$0p t$ V規 $0xD$@ {$0;h/t$&|$$D$)L$L)ʃQRt$ PW~/9s)u̍L$hPQR =t$0@ Wm$0@  $ ;$^_[]W2UL$0@ V,$0@ tt눋GD$fFFfGD$GD$ @@ t$辪$0@ )lRUSWV@[XXD$\L$<(px ux Pt"D$j.PUVt tD$$x D$PL$QRPD$Pt$U $tQL$TA 'l$TU4$tɋ;L$4$D$L'11UVH1(^_[]Ë$D$ L$@T$HD$A D$As |$L4$먋D$DA4$D$ )D$ )rD$D$DD$AD$9v |$Lgt$t$t$PD$PVΉT$訉 FL$N FL$)L$@WQL$ƃ)]L$D$ D$D$D$VWPL L$@9|$ tsL$L$wD$1D$$D$ PݘƃD$)D$Vt$t$ L$@AT$9|$uAT$D$LUF4$;ZUSWV[S|$D$$0PQt4$ 4$A hI荤hVl$ Ujl$UP+‹D$p pp0Wt$UVdWt$ zuBF tt$ G VD$@ ^_[]VWUSWV,ՉL$ [Q$L$D$(tt1 G D$Hj(1 ‰\$D$ ʼnhfHf |$9f׉t$\$$T$TPt$t$06Ƌ$Hfxx\$$PT$LwD$ D$;D$t$`$@D$L$DD$$$PtD$ $@$Du5\$P裕=$L$P9D$ $LP$HDŽ$D$;D$\$|$Lt$$9ubft$ ff $L\$Vt$Pt$3TWt$@Pj% 돍Ef$w rM|$jPD$D$D`OUUOPVt$Lt$HQj% T$L$ t$|$$1ˋD$l$9T$0|$V$PuпtTVuPj% T$09U |$$f|$Du D$8x|$,t$\$t$0Wt$t$t$00Ƹ1$Hfxx\$t$ x1gD$;D$$|$,t$L$(D$89r3l$8(\$PR  l$8L$(+ $‰$ȃL$(L$L$t$u\$V芏T$4ƃt$ t$l$D$ )D$ ;D$4D$@$ 9s'D$@|$0WUQ\ 1l$_l$0l$+D$xzD$xil$ (\$UՎ=!Ńl$ 1$D$D$t$$|$,L$ t$\$RR1\$ t$$ t$$ˉ\$|$,t$D$(D$@$Hd|$,$D$11T$ ;t$,tZT$ :/1$Hl!9ht 9uf|tP݅uT$ tDtN9|1뚅tb;l$,}\M ;l$,tK~TlPΐ|tLf9~fTtLf|tN멋t$$L}t1L$W\$t$<ƋD$4L$)9ƿ\$Pt$@Qy~L$ Mt$$H@ }} EE E8tr˃T$4)ھ)9|P)ˍKT$PC CCT$PSx@t$ut$$ $-t$كʋ $l$()̓D$4)9s\$O$LP\$UQRT${ 4$L$鍄$T$@)ƒ͋D$4)19s:QZ赗$X;$(u@,^_[]Ë$LoR$PUp{ 1뿋t$ $1>?\$hUSWVX[E$l>Wt1T$ T$G j(¸D$$D$ D$(D$A#$1ɉ|$ D$ l$L$Pt$ Vf=ǃt$Vt$ t=ꐐ< t쐐D$$D$ t$l < t< t`PW<t1ɀ8 L$L$D$D$L$ t WPtT$$9s=ȉ(Đt6ƋT$L$x x Wh@PUVV1^_[]ÐSWV[Ì> u PK tXǃx ǃx ǃx ǃx ǃx x !(x Ph@QWV^_[(1fffUSWV4[=T$P|$LD$HL$0trD$,D$(D$$D$ t$D<:u$:6L$ L$|$oD$ L$L$1D$jD$Pt$$VU ujt$t$ VU t+t$ ) Ɖt$ Eu<$:MtG$}nD$L$09[T$ fL$f1D$l$D$ 1l$$|$D$D${谍/t+D$p$D$09L$ fD$ft$|$D$09+D$T$ҹtClj1ҐD/DD.D9u߹)щtv)ȋt$NJT$ )ʈB>\<$.u)$T$rD$09wL$s>$t$$;L$0u?4^_[]$D$09uڋD$,T$PB D$(BD$ L$$J$4USWV X:`8D_u$$ ^_[]ÉD$T$ T$0u+Y t E<)׋$$x`<$1L$D$ D$}T$uUsL$T$E ulD$;tM UE=t܉t$L$8QPRt$ T$u#D$@=u$ELM D$|$uIt$MtȍL$8QPQL$t$$D$$ʉD$|$ T$4t-E uEjjjuT$ $!у‹4$$t$E0D$ E0D$D$ u?|UPuTE)΋M0E0D$ D$ L$tKE<)‰T$Ή4$Et$ $UE8T$,))Ɖt$ƃE<$D$(14$T$uED$,))t$ $E$D$ D$(E D$$ T$4uPD$+D$D$0|>$0D$9D$}&D$,L$0ȉE)Ήu|$(T$$21+ELt$!!jRVuT$ !ƒt`EME0MtU@9tQD$ e ߋD$)D$Uwu E+D$UGtjUNĴ^_[]Wt$t$ uT$ !ƒtˋE0tU@9t Q E0EEEe jUJN1뙍E@L$ 9D$T$$tQE0U fU 뼋L$MEfUSWV [È.t$4D$@u8HL$@D$\$jVK1D$D$D$E1;|$,v`\1WtztLEtD$uWjD$$)Љ$D$PyD$$tt)ȉ$  $EWt$UP $ERQUP x$EWQUP t"$tWE RQUP 1D$u7}u1u-WD$$1pPQd  ^_[]ÐS[n!D$ hPPt$[ÐUSWVP[:!|$t$t!t2ujFQVtZ$$FQVPt=T$$D$ Jt?9:t t j9zuL$(t PVу1^_[]ÐUSWV [Ø D$$L$ 8͋1t1uOWe<$1t0t/ƉD$EL$QUPt-EL$QUt$1;t$(MtQЃ1 $u"PjD$$ $t|փt )ƋEtot`t$ERt$UP |$t,M [14$7D$$ ^_[]Ét$ERt$UP t$|$tϋM t$PU 1u%}uDžu4$D$$1눉넍pPQi1gS[nh(#t$t$ [ÐUSWV[8|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[È|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[(|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[x|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]fffffSV[t$t$Vt$t$t$~>.u^[ÐS[t$t$t$t$t$:[ÐSV[ít$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[Ît$ t$ [ÐS[nD$t$ P[ÐS[>t$[ÐS[t$Z[ffYÐXL$T$ ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVXX$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$PQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$w;t$b\Gn߃^rxo;l$1\,, $*wkdT$Ɖ*t$i $*wi (Ћ4$Wm;|$Yȃ|$ U(!Ћ$PQV xuD$ ƋL$$QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$c(^_[]Ë$ncᐐS[jt$t$t$[ÐUSWV([ø|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ X0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[>L$T$ pPt$ [ÐUSWVT$[t$4L$|$0\$t4D$0|$"v$?Q1T$\$VP@u+t-u!$$l$0tC$l$0u20u- ot'1t P9tGGPGT$JRWO1^_[]ÐUSWV\[è|$x|$|$볅t Vǃ ǃ 蝗$02 tQj P D$HL$L( $ t$aHt$FĔ^_[]ÐS[ND$ L$01r_[ÐSWV[|$t$wv4u 76._^_[fff̀rS[x[USWV[ø|$ <$D$l$$pt$L$T$(PVUWt$<9t; $+t$ ;"1^_[]ÐUSWVP[*t$;8$l$ L$T$$t$,PUVt$8=9tL;8+t$ ?;"1^_[]ÐUSWVtՉL$^Ƣ$D$ D$p$$D$t$$E<%t#P$9HE֐D$D$ 11ɃuۃU|$ u1ǐ u1ɺD$D$D$D$ D$ uXl$$yqQi|$)Ÿ +AD$(ml$$ƃ|$ Qiʐ)mu;i)\fɁf=mD$( 0$Iʉ) i͓$) )҉)у}9)l$|$ OQi)l$$mi)\fɁf=m$@  D$̉ l$$IʉЃ|$ g$ V L$ \$فt$DPQ$j V`$99u\$xk $@ D$̉ $@  D$̉ l$$hQkd)<4 kd(  $l$ \$\$D$\$t$D$qP$j V_$99u$H*R )tȋL$ \$فt$DPQ$j V:_$9<#9uD$\$t$D$qP$j V^$99u\$HQ;D$\$t$D$1P$j Va^$9cS9uB\$ $H+HA$I ȋL$ \$فt$DPQ$j V]$99u$@t)$p$IЃȋL$ \$فt$DPQ$j V4]$96#9uD$[l$$hQkd)<4 kd(  d\$ \$$l$ $~  \$<3D$ ~ Wt$Iu 1\$Pt$- $$9\ \$  9u<$N $@ D$̉ D$DD$D$\$t$D$q P$j Vx[$9zc9uRD$\$t$D$q P$j V[$99u$@L$ \$ف$t$DPQ$j VZ$99uD$\$t$D$qP$j V?Z$9A39u"$H*R )tȋL$ \$فt$DPQ$j VY$99u$@L$ \$فt$DPQ$j VJY$9L39u"$9 9 $91$y L$ 9uD$L$\$7$D$DAD$HAD$LA D$PAD$TAD$XA D$dD$D\$Pt$,t$.RPQjVW$9)9u$9 9$Htȋ\$rt$DPQ$j VW$99ur\$oL$$$Wt$ $ƒ8\$rt$D$qP$j VV$99uD$DD$D$DL$\$$PWt$ $H‹L$Dtȋ$;t$f$$xQkd)Ѝ4 kd(+dF$z  D$D ljNj\$Pt$!ƒ $\$މǍD$DP!ƒ)L$D8$9_ C9u2$Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$`Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$6L$D$9 9uL$Dh$9 9u1 t$l$u7y3$9a-B9B09<\$gt$DRP$j V S$9 9u1 „tÜ\$ \$$l$u2|$ y+ $9-A9tfA09t[ $gt$DRP$j VNR $9\$D9u<$5L$$9 9u1fɋ\$hebf tƜ\$u7y3 $9-A9A09 $g|$DRP$j W)Q $;$9$u䋄$$i$$$$\$\$P1|‹$1‹\$gt$DRP$j VoP$9qc9uRHx1gt$DQP$j VP$99u $L$ 1gt$DQP$j VO$99u $\$1ƍg|$DVP$j WTO$;$s.t/9$u苼$*$$ $W1$z 8-Є$$t9s u7 5\$]\$$n%L$ $<$~}\$t9u4$<$Ήƺųʉ kdk<)΍\$8VP$j t$TVM$$99u<$D$ ;D$pu t^_[]Ë\$USWV [t$ XD$P/8$$D$l$$pt$׋T$(PVUWt$<9t# $) #"1t$ / ^_[]ÐUSWV [t$ XD$P.8T#$D$l$$D$T$(t$0PUVt$<9t# $) #"1t$u. ^_[]ffffUSWVP[jL$y~X$T$GsY11t5iFs0hFށdN$t$>-00t!t$t0J$1ɋ\$+dF$, >-00uȅVaFs0`FށdN$t,>-00t!t$t=J11ɋ\$+\F$, >-00u0 D$d ^_[]ÐSWV[hR_ƅt(T$j!tVoJ81^_[USWVP[D$tBՀ:Pt=ǀ}:ju1ɉPDžF $1퐐9}h.dNPnŃ=~߿TFFF fFdžhFdždFdždNUTC><$~81퍻 9,$t".dNjEPW uƄ.dN_1^_[]ÐS[~t$wn[ÐS[^t$jt$t$[ÐUSWV8[#M 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtfL9| }Z^FD$ 9߉D$ T$|$\$#)L$ #11uj+DXH(4\$tg;~N|X1Ƀ|I|$T$ 9}'4}t$;tt$t}։9|كu>L$dFL$(uV*T$iFH hFdNP(}j[1+dF, GыV+D L\$jhY`QPz ӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U|Rut]9D ΋u}\$%1kD$ \$uuPVftML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐSWV[,t$W$KPbH4 PjV` W#^_[ÐUSWV[ûl$t$W#d uKPUjV` ;WP#^_[]ÐUSWV[K|$t$U#h uƃh U#1Wj(t XH(^_[]ÐSV[t$L$t$j'ttLXH(^[ÐSWV[Ìt$Wa"h uƃh WH"4 1PjC't XH(^_[ÐUSWV[t$|$U!h uƃh U!4 Pj&ttLXH(^_[]ÐUSWV[Ût$|$Ul!h uƃh US!t$jQ&ttLXH(^_[]USWV[+t$U!KPaG` t 5jP.U h uƃh U :jjƉU ^_[]ÐSWV[Ìt$D$t 5jP4WL h uƃh W3 :jj/^_[ÐSWV[t$D$tF t 5jP4Wh uƃh W:jj^_[ÐS[ÞD$t@ PN[ÐUSWV[kt$tF |$U1h uƃh U:Wj^_[]ÐUSWV,[D$$$(=ΉT$y |F 'D$ D$l$jP$LP$LW*|$t ֋|$ ωjD$P$LV*ʼnր|$t |$ |$G $@D$G~$(PjQ* G>D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU(|$u|T$jD$P$L$L(|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ USWV4[L$HD$AD$ AD$A D$AD$AD$A$D$,D$ D$(Vh uƃh VD$|$:L$jWjj'|$uL$jWjj~'|$t1ՉNjt$0|$ xt$ |$H4^_[]Ã|$(xۿ뿐SWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[Ú$Ppd uKPl$|$` tABR lP~;yQq|1)͋$P^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[Ud uKPL2|$t$` tWVP ƉU^_[]ÐUSWV[ÓD$D$fBt π?:t !?:u$,?/4$\$u(\$jW:\$ WS?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrD$\\$hWP8 j.W5tU\$j.Pt59tx/ux.uHt/uэ|$H4$$," 4$\$h@ WǍD$HhPW8 +&y \$~ 0\$W2D$(W gdND$4lPD$0T$LD$D$T$#D$ D$`T$a |$b L$cy ρ D$\T$] t$^ L$_y ΁ Ήt$D$dT$e l$f T$gy Ձ D$hƒt$i L$j T$ky с D$lƒt$m \$n T$o|$y Ӂ D$pƒ|$q t$r T$sy ց ֋D$|$1T$1=y\$$ZL$ʼnL$,ȉ\$@ÉӍ/L$‰Ë\$$[B,9D$(/D$ D$tXD$t‰T$4$\$T$HЋ|$)L$(hL$,QWR5|$#D$ {|$t9D$t9$T$,HXp 1D$uT$1l$t= $Ƅ9>l$ $\DT$ՃD$ 9|$D$ Mȃl$uAT$j ŋD$X l$EÁy] ËD$h ݋D$X T$j ݋T$R l$] y M  É $Ƅ9>t*l L9݉9@1l$l$~iD$9T$$4$1><t >nm^9};|$ |$ 91L$tL$T$14$|$\$$L$ L$T$|$F1\$ ʃ{ s {y $dFJ|$,ӄiFRN 9hF9q\$T$N 1ۅQ΃1rY̓1$\$;8dNT;8eNT;8fNT;8gN9u\$1ۅt"|$41D$(/9uD$4$T$|$1ƄfNfDŽdND$81L$0L$<1ۋl$39l$l$@L$:.>unM߃$iN$\D$1. $tDA)>ii;T$tyl$lp $ Y I|$0,~;uM}|1ۉȋl$p{<$L9t }`$@\$ ۋ4$.S؃1Ƀ1ɋVr<$w̼  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF4$91tA ́ 1ҋ4$v~$x<ыl$hF$dF4$9ũ~ 1\$jUSWV։[QtK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR $Ec\$jt$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0V] >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$iQL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$|1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށp1i4Q9uB ^_[]ÐUSWV0T$ $XD$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$ED$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$)ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ %麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$})jhUt$ }T$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP|)Nj\$jhUt$|L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ jt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPz)jhUt$zU\$T1ڽT$\$jjdURz)jhUt$zt$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$p|$ 9|ځt1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$4XD$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jPn~ e1^_[]fUSWV[Kt$1tGl$)Ήv,|$ Wt$T$,t1Ʌ~|$ 1^_[]fffffSWV[܉t$t W1t1j=t_L$T$PHp  1A"  xuxt%txu8u롾W^_[Ã눐USWV[(t D$ P}   $ L$ȼ L$ǐ|$$tD$$9G t GtO  tGwЃ GЋ 9t DžuZ u';|$r$;|$s<$$<$C<$1 t$ n u#t7W+u^_[]ÐSWV[üt$t W"  xuxt&t xu8uju $p@@  1W^_[ffUSWV[$$$D$$DŽ$DŽ$$ jP$<jPDŽ$TDŽ$XDŽ$\DŽ$pr$TK1D$$d$t$l$x$dU$$P$d;$u ^_[]S[ޅpt$t$Pt$t$[ÐSWVP[ëD$L$T$t$ 4$pVRWQP]^_[ÐSWVP[kD$L$T$t$ |$$<$WVRQP^_[ffffUSWV[+t$}XjWkE`HM`~;Ep~ t EXHMX WRjW4^_[]ÐSWV[ìL$B`pr`~ ;Bp~ t rX~zX XRQA^_[fffffSP[MD$ L$ $XQPR[ÐSVP[D$L$T$$XRQPVp:^[fffffUSWV[؃T$(|$$t$ t&t"T$(qTN @1tVt$jRҠL$0A <$uy‰Ņf1qyQuE)ljuދl$$1$)1t$ ōACAAAjQdxՋ)v1WPVOL$4 9l$QHu0}T$RPVΉ )~>jV l$$jU$+D$1t$ ʼn^_[]ffffffSP[]D$ L$T$$RQP[ÐSVP[,D$L$T$t$4$VRQP8^[fffffffUSWVP[Pt$ 1ht$t$ x=|PfF FfFfn vF$F,F(F $tjjjVx^_[]ffffSWV[|$jWew jWa^_[ffffSWV[܀|$W;D$w+t$9w 9w9w 9wPWV  ^_[{fffffSV[}D$;D$wt$ Pt$Vyi ^[\{VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[4x[USWV[t$F0u ǀFFF tVu"V]tA aV);F|V0u?1FT$i.;Ft F t uVu^_[]fffffffUSWV[K~t$|$l$jU茛pWVPUjU}^_[]ÐUSWV[}u}D$d$G0u ǀD$?$u ,4$G tu)$Wt 3G Mf LfA$`$DŽ$tDŽ$x$|$jPR$jPDŽ$DŽ$DŽ$$hh jP G f$Gf$G$G,$GD$$`$$DŽ$DŽ$DŽ$$Vuu WBƅxW賓1Ƀ ΋D$d$@M42I @+2D$,E$T$tT$D$D$D$DŽ$D$`D$XD$$D$L΋$T$ L$L~1Wt%t됐t\L$L)L$T0T$ً\$ 3KT$L$)Ɖt$T$r/9u8D$T$tT$ L$TZ\$ T$C$D$Pu3\$D$D$T$tT$ T$0/D$#Ƅ$7D$LD$01҉|$LƉِAσ s&1)y1ɉL$0T$to`, $' $L$4D$#L$0L$Dt$T$8$8|$@߃ЍT$t\$@مD$D D$0tD$0ȃ|$XD$";D$XJ9D$@@1D$PӐL$H11Ҁ{D$D$8t|$@)D$8T$PD$D$Hȉ|$@9 $L$4%D$D$@D$PD$HD$(1_)+$9 \$Ѻgfff)À0eT$|D$D$T$ t1ɉT$ uT$|$ D$1D$D$tD$ T$҃\$P)ӃT$H)‹D$X|$4ljT$H‰\$P|$HD$D9NjL$ w}D$XD$4D$( D$0u1$$`$`AϋL$D$D$L$rDW$D$PR dL$|\$D$D$T$0b$jj WQL$2׉ T$)ʀ0$D$4$D$XD$HtA$D$Pu#aT$|\$D$D$хtM1 D$ы$D$0))ˋL$|$|$ D$ G ~r$تCD$ D$L$rD$ t7$D$PuZ`T$|D$D$Ӆt1ɉ넋$تCT$ ‰T$L$r;Ѕt?$D$P}W_\$D$D$L$tt#ً$T$t$D$ѐD$(%|$8ˋL$|$D$8$ȪClj|$L$}$$D$PWC_\$D$D$ljʉ|$8G ωщD$8l$ȪCD$L$r1\$tt2$D$Pu^\$|D$D$tZ1z|$$}t-$D$PWb^\$D$D$D$T$t=}t$$$t$$|$}t$$$t)$D$PW]\$D$D$ucD$u[bD$TD$T}t$$u <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZ< t$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v PE|$8E|$8|1 uT t$ 9wS$w닔!wl$Pmt t$T l$PU\ / U| 룋$L$19u $Ps<^_[]þUSWVP[H=D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$蒁USWV [;D$ 069rljT$D$uj$jWPhv (9$T$JHJHJHJHJ H JH RPE$jWPv 踌(豌8t!觌0t$9蔌0*)4$PjV%p $L$D$ 81 ^_[]ffffUSWVP[:EET$@t$DT$$pU }0"j jD$܋4T$\$8t$<EΉ7tƉP1t?D$|=WjPo )jRPA1 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]}USWV׉[8l$XtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[7m|$hE t$p |$<$_ MM$UD"j jl$l$܋4|$Xt$`MƉ2t|$D$QC-t?ƃ|$|=FWjP4k )jQPe- o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[] yffffUSWV[`3E|\$t*\$4Gs=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$msNjD$L$ttW% ?L$@\$D$4\$ j؋E\$ju P") mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃0܋<܃D$ۄ$܋L|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(w"D$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ R&D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃4ݜ$$$$$݄$D|$<ػ|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$*bM |$ ؃8D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃L$T$vثv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋<|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jqbwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$PcWD$P3bW)^VD$P؋|$ |$(|$ |wD$0ufsD$\$t$W_c\$ Džja|$|$l\$WP!c`؋L$1ҋD$DD$4D$RS]D$t/L$4t9t\$Q2]D$\$P!]\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$t_ )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$;\T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$ncD$T$|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQNt,D$$D$H~$Pt$ND$T$ u 1T$ |$tr $t$Q"PT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ O\$L$ʅ|$@'D$D$8|$LD$D$0L$PRMDž~#T$?؋L$؃T$$jj QF |$@c΋$jj t$F ‹D$8 |$Dt$$$/L$|$D$D$t$QVED$ t.L$t9t$Q6ED$$P&ET$%T$$1|$D$Ȁy0ItL$RDL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QRD jt$ LM|$D$ D$$t$|$ W_D$,t$W^Mt$ t$Mt$t$,k$jj PD ljD$ D$L$L$D$D$QPƉ|$Wt$ Lt$ t$7Mt$,N0L$ x $tPbCL$(T$D:Pt$ LV9CT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj PC D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VB D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$RJt$t$z|$D$ jj QA D$(jj t$A D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPH\$ht$D$ PxIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ GD$I$t$t$ |HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[D$1r 1 9vW<t8Ɖ^_[ÐSWV[ÌD$1r 1 9vW;<t:L$T$8ƃXt𐐐Xut^_[ÐSV[D$ PHpR<^[USWV XT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RU%E|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[ SVH[D$0hjP: D$(D$,DŽ$@DŽ$DD$ D$D$$jPjY ML$(VPQjD$$D$ D$D$D$D$D$jPjM jLjyMS[1S[fffffffUSWV[ëD$|$1tt (h1^_[]ÐUSWV[0}uu蝷\$D$4PDFD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$d#ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ"t$(PV'T$4D$(PV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQ( D$p '3 |$4t$N  D$0P QVR\( t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP" 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}!"P"L$D$ffffUSWVt$F98[M |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[cu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[{t$D$T$<n~,D$9r9s#L$9w)QjP. ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXǀ ǀ fǀ ǀI fǀM ǀ) fǀ- USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[lD$H~( 1u 9r1$PƉ^[fUSWV[ L$P1_ƅD$t/Fn?t P&FF ^_[]1?t P&t )ʉʁ oΉoUSWV[ t$tbF!r VnO<}t3 W=&}F  tW&  ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[l$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR= E!r&UlE!r\Ul1<} $P#}T$,B ti4$#\<}th $P#1}F  t14$}#$ T$, D$TG^_[]Ë  1␐T$1Ɂsrr@r"y(6s@sރx @tS[Nj,tL$H@[ÐUSWV$[D$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU3f<9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [ãE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[Ż$| 1P$1jjUA ʼn$tƒ9t t)D$P$vts#D$ =uXitZfx $tu f~ $fFvF$F,F(F ! OĀ^_[]fffffffS[Ît$t$jt$[fffffSWV[\|$jWGHO~ H0 WSjW^_[ÐS[D$HQP~ Q[P[fffffUSWV[ûL$atrt!w 11Qt_tGҍzw$@ؐ+u˽뿁뷁 L$) p 1^_[]fSWV[|$f jW*G0ǀǀ 1G t WƋO twуy y w\G0tW@9t Qk\G0T\G0ǀǀjWG GGv  ^_[ff̀rS[x[SV[ͷt$ F0u ǀV"uFH^[fSWV[||$8u-GG Ⱦ uuL O @G0taW@9t Q[G0GG81t&W@G GGfG u WG t'HVIPVpGOQPwW$ GO fO 1!t Gf@f  fG ^_[ÐS[D$H u P_[1[fffSWV[t$t@1mT$ |$L$D$t#t8uӉ6@VRQWP26@VRQWP趀6@VRQWPL^_[ÐXOL$JAA A AAAÐfffffUSWV[$uThjR1$džt.%u%D$PQu1t+8$u!8u $t4D$P$UQ)VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQt|$=|F P/#FEt$P#FV EtF4Et UMtЅBt N&tEu  hV VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFVj P ;F@NF(șdžHF DDN ȃN艆8hPjQMPV-$$0$tNCOz(1V Th(1^_[]14dž$j$ZCtJpSH\SHSH TH \THTHWH88oUSWVՉ[TjqLlj1&NL$jPPL$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u1{8"m8^_[]ÐUSWV[٭4jQ! t $81t>0QrPtvQ/t u8~)1 9}8tQ5Q݋t P<VQtg81^_[]ÐSWV[ܬ|$tOWP^_[ÐSV[ÝD$ p|$s t.jt$ 1dž,dž,^[S[.L$tAt[q[ÐSV[D$ p|$t?dž,1t$t$^[ÐSV[ÝD$L$ qtdž,&t 1҃ƒt$t$a^[dž,빐USWV[|$(D$p$xudž$dž(dž 11Ʌt f9 tSHt ()9bf|Qf9udž $뢐V($19jjUV/ Hf9uxV(9vo(f|Qh QjPQVr Hdž(fytV($9 (tdž(f|Q댺f|QRu(f|Q^dž $dž(Ckdž,^_[]Ë(|iw&jt$(t$(PVJuƺm tXiD$$ËD$ ÃrLi#dž$뀋n tD$)K$L$$)A(1ESWV[|$tu^_[ËD$tx4t&jjW uЉuLJ01뷐USWV[è|$(o(o(OG0!D$;G9} $wD$D$ P:$L$L$D$QPt$= $L$QjP( t$ K$D$ Gjw&D $tNG(PxO 9~ LDLDG G,9vG0 G,Ut$WY ^_[]ÐSV[mt$ t$t$ #F,;F(~#F0^[ÐSWV[&4aAVj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nt PW>1Ĭ^_[] D$D$  P708ut$,jV7? $`jV7' K|$,@@@f@D$fAA Pjt$V jV7 jt$ SV[ÍD$ pFtjP6誩 F u^[ffffffUSWVP[*t$$D$hEtjPuB Et_^_[]ÉPt$ UU t݉ƃ<$t-jPt$(jjVU{!@uEj6uŨ j6u诨 fffffUSWVD$  D$$|$ lPɉʉPHɉHP ʉP HffHf@1fl$9LpffLp 8ft8ff48fL8L8f48\8ff\8fL8\8tǃtJL$OL$Oo/OL$OL$OOfoffol$fO> 7l7\7|7<7\7l7L7L7f\7ff\7fL7Php0hPHHPfhfPhHHP h p ph P H H P hpp h PHHPhpphPHHPhpphPH^_[]Át1f9v|pff|p<0f\0ff0f|0|0f\0ff\0f|0D0t^ ~ N n n N ~ ^ N f~ff~ fNoUSWV D$ D$(|$$GHL$H hd$Z1f!fDp9t$1\p<ɉ LflfflfLLtÃtID$CcL$K cCD$CKfkffkfKL$V ;L$L;L$L;l;,;L;L$L;L$L;L;fl;ffl;fL;Php0hPHHPfhfPhHHP h p ph P H H P hpp h PHHPhpphPHHPhpphPHd$1ffDp9t$|p 8l8\8|8<8\8l8L8L8f\8ff\8fL8D8tO o _   _ o O O f_ff_ fOiPɉʉPHɉHH ɉH f@f@ ^_[]ffffUSWV[Ë|$oEtjPu觢 EjWu蜢EtP06E EtP6DžDžtP5DžDžU5W5V^_[]ÐUSWV[È|$0D$,pFtjP6衡 Ft^_[]Ë 1uʃtttjj6g t$b1D$L$T$ |$# l$hxP H@b1jP6 6gY 1KfffffffSV[}D$;D$wt$ Pt$Vy ^[\ffffffL$1s!t11҃9rfWV_ D$tL$ P1<%1^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[HL$4T$0t$,t#D$8yt9W t11҅1116n!ՋN σu1҃01Ʌt3OHOOG8^_[]ÉT$L$D$l$ D$uTD$,FuBVQV N u€thV:l$4|z<$jjc+1hƋD$,p jF+Ft.t D$,l$4D$0F Ftu1V11NT$,NL$N1jt$Pt$f u-FPt$UW7fnsD$$Bt$ u| TD$Pt$@V= d|$1{F(u^Qjv6[ 5@%u^jW6 FL$ QD$ PV= ;FjQ6 jv6 DžFPWjVG% Fxj16w uj_jt$D$BtjR6I 1u:/ujt$t$6 u 1$^_[]1PWpF,D$D$ijQ6Џ gl$;l$tn1ɉ $Eju6諍 UHɃ9u6jP6j $;l$u|$D$T$,D$fP $tkωʋT$LJt 0f@jRu jVu rD$1D$T$D$|$jP6蚎 jW6蝌 ;F]OD$ Pt$ V_: a/t$ |$jt$6+ jW6. .;Fy jL$Q6 ;l$t|$$Eju6΋ Mfu%jP6融 $;l$u|$2ʉD$T$fQ<$t$ L$D$LHljP65 jU68 t><$H*fJ<$uD$L$USWV[È|T$0l$,t$$F( :N;M.N9"$F(  D$(ƅt$,$BfD$PVWm`T$< $E9v$,$BfD$PVW4`T$< bE9uUEtNjP7 $fD$QVWD$_  jt$ 6蚋 T$0,$fT$|$(u -,$fT$GjjjPPQW^T$L{O(,$fT$wjjjVVPW]T$LEO(EjP7 $HfL$QVWD$^ t*jt$ u賊 T$0l$,O($l$,L$F(jQ6~ T$0$FD$fFDU<(DtG PVatjGt PVatMO, F)WPPb fnT$0DVNft>uf+9f9sf9L$,|$0fugT$,zT$0)Ӊft~ft$ty\$ 1f1f9t9Yf9r1ᐃft9f9sf9yf9sfy)|$t$$\$ frR\$,t$$t$$fs>\$,{T$0f{N( 1uN; uN9vfN^_[]1fTYf9\$t|Yf9r1fY|Yf9r1fTY|Yf9r1fTY|Yf9r1롐USWVT$[xA,D$L$\$ ;t$dFjvu $FD$Du<(DtG \$ Pt$ +_E%\$ uI}Ut$ VUV}n@$} ‰$E)QPP ` $fEDufD$ftZ\$uWً$t$fdfEt$fEE \$ jUD$0 Zf%Kt$f9$sffuwUf 3fL$1ff9tIO$f;L$r1ސftf9sfWf9sfW)D$$L$frD$$fsUfUt$\$ jU6赅\$ D$8ujPu蘅 $.PU$ut$U{l1Ʌ $$^_[]1D$"f\Wf9T$$VLWf9r1f4WLWf9r1ftWLWf9r1ftWLWf9r1뜐USWV[Ëtl$|$Et$jP7跂 tBMHjP7萄 E1t+jP7节 tMHjP7c ^_[]f1̀ffff ̀rS[sx[SP[sjjjPt$ 1Ƀ $ȃ[ffffffUSWV[Õs$$$ T$$xt$%Gudt$ $1|5vuN| v?2+$ $<19rj/P^tRB1ɋD$;$ȁĜ^_[]Ðj>\%9r?Xt|$W$)$hPT$RQL$$ $t 9vϐ?/(9w$)L$L$  D$\%D$$tht$U+ t*$hUS31Ƀ89t$1$8j?Pt$M tWH0tȋ $9:<D$ND$19ubD$PU3um9t$uCz3D$PUQ2/1Ʌ#D$$=@L$411Ƀ8jfffSV[ÍpD$;D$w.L$t$ 9w9w9w9wPQV¥ ^[UkffUSWVx[8pD$tD$pD$lD$hD$dL$$T$dP:D$@FD$ uƃܟLPQuƃƃ$;$uĠ^_[]8ZS[Þ`0PPj$jPt" [ÐS[^`0P跻[ÐS[>`0jPe[USWV[`l$j6ƃ#j61jr6j$jU! WUF!^_[]ÐUSWVhL$$D$|L$4Hpx |$8x|$9wL$T$ LJ D T$Éх҉u\$ K1ɉL$TSL$y<9|E+D$fEL$fDMD$DENɉLL\$l$pD$P9D$,D$8L D$ |$T$WPjjt$ud jVud D$ t$ \$l$pD$jPu~d jVupd u՞5jt$$uMd jt$u1ɃYh &5F,jj6X Hʁ@ TP|UfMjP6>Z jW6AX u\F,jj6!X =H+@ )H| fBjP6Y jW6W uǚbN(NPf9$fL$N,L$;|$^OjP6 Y jw6 W COPf9t$&$fD$N(uNftx$fL$N($FfD$1fOLH|jP6=X jW6@V 1Ʌtz@ t닁$fD$N,L$;|$t7OjP6W jw6U t OftjP6W $(|$FtP[F FF($nf~ F(jQt$4Pt$8RV)!@u$Fjt$6(W ^_[]H@ nfOLH|jP6V jW6T uxjP6V jW6T 1xjP6{V jW6vT HUSWV[E|$l$t$FtPF FF($nf~ F(^_[]USWV[æEt$,VT$RQ ǸD$(>  .,$OfL$ D$ŐM;tjUD$0kU /GfD$ wfteL$A ;Mt jl$l$UD$0$U El$ jPD$0S HfOD$fOWt$t$( ulHHf9Ou8pjPuT thjVuR fGOT$(‹OJ/L$;EtjQD$0JT D$((fpL$ fH1^_[]ËD$;MujUD$0 T иfffffUSWV([ãCu~,jj6Q )|$FD$ VƋʋfqDBtjR7oS jV7rQ D$ L$yftZ1ցϋD$ t@t$΋Mfq Pu Q"' tKOT$뵐1ҋL$A uN1f}%L$A }ED$ 1}  fueL$ItZjQ7jP D$t=@fD$D$Pu WN& Ljt$QR D$ L$If9uYL$ItNT$ jQ7O D$t-fD$D$Pu W% t,jt$QQ D$ T$ MfW e^_[]j|$WQzQ D$L$N FE;t$1ɋ}L$Fjv7BO tVHɃ9jt$V}7P L$;t$uD$1ҋt$jt$VQP D$L$O GE;|$1D$Gjw6N jPu6D$WP D$;|$uL$1}fVL$tgL$}LHLL$fFjP7O jt$7M L$rL$1룉jWE0O D$ ufzD$tguD$DA|jQ6IO jW6LM tFP9fyD$uujQ6N D$ Ufff̀rS[Ô>x[ÌrS[t>x[Ḉ̀rS[T>x[̀rS[4>x[ḹ̀rS[>x[S[=t$t$t$Ѓ [fffffSWVL$T$t$r ;uwt1>:8u 9u1)^_[fYo=D$p'Pl'Ph'Pd'P`'P \'PX'PT'@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^x<L$<A$iA D$AQT$QT$IL$1t$$t'l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPxm F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPl <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjV7l^_[]ÐY6D$(P(P(P(P(P |(Px(Pt(@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[6t$t$t$ [ÐS[5t$ t$ F[ÐS[þ5L$T$ j[ÐSV[Í5t$ tA(j@PVj FPhjPxj F@FDFHFL^[ÐUSWVX%5$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8(D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojP` FP3nPtPWjPo` UVj~jUX` FPNHVLN@VDPV^_[]ÐSV[*t$ tAT+j@PV;` FPhjP_ F@FDFHFL^[ÐS[Î*t$t$t$ [ÐS[^*t$ t$ [ÐSWV[<*t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjV^ ^_[fffffffT$D$fUSWV[`)MD$$&yd+Ḱ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <x 1D$D$ D$D$L$8T$jjPQjRtD$8x D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$rL$L$FL$L$L$L$(hjjjPQRD$L$8T$jjPQt$RUL$81 u4rjPI _UiK1D:0D$D$D$ D$L$8T$jjPQjRt$8|$<7QPWVD$D$D$ D$L$8T$jjPQjR_D$XL$ L$hjjjPQRuMD$D$ D$L$8T$jjPQt$RtD$8se^_[]fffffS[^"^ [ÐUSWV,[8"l$@D$D$ D$$D$(L$ D$QPjx WY}1|$D1҃|$H1‰|$| 2         t t} t{ ty tw tu ts d1`YRKD=6/( !    s#4Áƀ uH< |$9T$vQ׋ jjjhjPj| t+f@ fɉ9sfэ4fxtnF|$DtL$DHH|$HtT$HQ|$ tu|$Dtīī1|$Ht̫̫t$zjWj} ,^_[]þ |$ $ |-jjPQjRk<$ ȅUSWV[W4ztV6uZ pP7ƅt3BtUmuWy0ȫtUmujWny^_[]ffS [ u?D$D$$ T$jjPQjR%t [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[l$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQPOV QRP ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRPXt,NQW QRP FEE1^_[]ÐSWV[ÙD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [HT$0|$,D$(L$$)q092sVP菸$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[XL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[H|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[Äx[̀rS[dx[S[Nt$ t$ jt$$t$$t$$t$$t$$  [fffffS[x[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[X$D$D$huET1}8XM4tI$P耩E8*$$E4E0|$ 1D$L$j`QPu8VRƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$ $|$ W莴$Ƅ$D$T\PWt.$Ƅ$8u$L$ThPQP $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$UpF !`jD$$PUF ʼn`D$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PvXt_`u|$ <5$h$PW h$PW U|$|$Tt$h$PW_ |$ u9nuqF$hPW> nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QPmD t$|$"$t$|$t$PRE$$t8^ltC$($,2D$XP$0C $0$$t?^t$t$'h;$r^_[]Ë$($,kc7$QPZC t$bҋ$0t D$TPQ$,$ $$t%(tPD$(PQA $$(1?7$($,91$u$QPB t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QPB t$|$ t$$tPBP$$t T\"$($,uWPA t$l$$t$|$t$POE$$8$j`ߝt@8@P$i$t$|$t$PQOE$$t8f[&t$l$tWO$,$$t(#[?$($,t t$7$QPj@ t$$t$$tPN$$tL$$s.SWV[ tM΋uA~8t:~4~"`N4F8 I9rP׬F8^_[ffffffS[îD$L$ AQ jQ0 [ÐSWV[\|$t$t+jP6 tH  W6,^_[ff̀rS[x[̀rS[x[USWV^Ƶ$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWV[T$D$t#4׉9t u|$))t6t'Xt u) WK^_[]ffffffUSWVLX(D$ L$ht$dl$`1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$UPT$)rx,D$GD$\$ D$pPUW|$x׉ t$pt$ l$ Uу x=l$a\$ t$pt$ |$ WT$x xA|$;l$<l$x$\$ t$p|$ Wt$ T$x x|$|$D$؉D$)\$ D$pPVL$DQ|$x׉ t$pUVу x<\$ t$pUt$DVT$x y!!x\$ t$pUt$DVT$x x|$+L$l$\$ D$pPUL$$QT$x D$t$pWUT$x |$x%I\$ t$p|$Wl$$UT$x x,(x$\$ t$pt$|$$WT$x x|$l$|$\$ D$pPV|$ W|$x׉ t$pUVу x+T$|$\$ P\$ t$pUt$ VT$x y--T$|$\$ x%\$ t$pUt$ VT$x xT$\$ |$,tID$tR\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$L$HD$h9L$\$ t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gqD1pjPQwcM1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[t$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[ø5Pjj%Q7SWV[D$L$Pt prxxp| pPxtz xyVҕ1^_[ÐUSWV[è|$ l$9v`wDt9xtNȅuT$81$Xq3B<B1*׋PtIQPEjPQD$ pD$,@KL$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~yAObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p$ D$ L$Q$ЈA1ÐSV[Ýt$ V P肓tHP tQ P Va1^[ÐSWV[<t$>gthGt tww$Ѓ gpNjPQwH;u<tww$Ѓ RD@^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[D$t$tA|$1ɐt 9u)tPjQ" ^_[fffffffUSWV[xt$0|$,ttq>TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P\ Pt$8=t +l$1jt$8? 1^_[]fffffffUSWV[èD$(@x>T$$B tzu?Rt*= =F \$L$()}u(D$ $L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj W t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$ T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RDT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QP{T$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP# D$$ $t$$L$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ffUSWV[{|$tpjWG 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;HWD\PHWD89 jW%^_[]ÀO @1USWV[Ût$N 1tT~tM.)>1uFFtUWvV, ~)uNDtvу N @1^_[]ffffVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[|t$8u-HN uRt8F0t~@9tR5F0N FFfN ~u VCN u1uVVF11+NN^_[fffffUSWV[å$$G G$=tUL$QPxC#T$ L$xt+OLuo(1; $1D$G u9tiU~x. Go,$̀|$t)OtPt ,$́f o Gfx[T$PQj@R^1ɅD$PudP1҃/w,-D$1T$` DQt$L$ QjhjjjjPv |$ t:L$u $O GCGG;$u"Đ^_[]ùT$tщ1vUSWV|[h$$$F=tYQPxI#L$1 ED$ht1FLu*N(1; E|^_[]fffffS[þjt$ [ÐUSWVP[Ú<8|$t$F0P=F0P)A9tnPjAF0Pt8PQ>jt$bA@N0PǁTt!ǁXN0TtXXu\Qj AN0Q=^_[]ÐSWV[Ì<8tR|$G0P<G0P#@O09t,Pu' @O0PǁT 1T1Q{<^_[ÐSV[<8tJt$ F0PE<F0TuǀP8PA=F0P<^[ÐSWV[Ì<8tn|$t$F0P;tF0Xuj\?F0TuǀP8P<F0P{;^_[ffSV0[D$<L$,QPF1;T$,uȃ0^[ff̀rS[äx[S[Ît$ ht,@t$A [ffffffS[^L$T$ pPt$(t$(t$(t$(t$(t$([ÐUSWV[t$DuT$D$0ut$t#r 11Չ90D$.0t$Ht$4l$U|$W!D$T$08t /|$8l$4/L$u $T$ 9tF\$9T$|l$<9݋|$@} uL"Du$8tV݉*WT$9L$|l$<9Ջ|$@|ωՉ^_[]ÐS[L$T$ t$(t$(t$(t$(t$(t$(t$([ffSWV[Ü|$jWt tVW21^_[ÐUSWV[Kl$jUtt=ǾqtUWU6t1l$UPt$  "19s#[.D.8^_[]ÐSWV[ü|$1t,PWJt |$t=t=tƉ^_[ÐSWV[lLt$WQtPWa VE^_[ÐSWV[,|$GPotƉx @LVPW1^_[ÐS[Lt$Pt L$ 9H [1[ÐUSWV[ØD$01t:>t41 |t$t$ t$ WW$ uD$ <=u.|$$  9ttD$0 M9u; s|9v9tfP~ǃ ǃ $jWPU ,0,8uyPD$0t$ )$jWP +0+8u4)  $PjQK $ L$ ^_[]ÐUSWV[ t 1t0LDtPVt Hى|$LjjD$P tE t5jVt$^ F: tVt$cVG}ŋD$ 9tP,}ǃ ǃ  UjP  ^_[]ÐUSWV[81tR/tL,t4t$t$U! uD$|=uօt D$1^_[]ÐUSWVP[Z|$1|PW tfƀ<=t^tR)tI1 $ $lt+Vt$U u|5=uمxD$8.1^_[]ÐSV[í\P4ƅt(0^[ÐSV[m\PF4ƅt(0^[ÐSV[-\P4ƅtx(0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffSWV[ìt$D$L$~tQPR+ x FPVTf ^_[ÐSV[]t$ F tBNtjjjP !ƒtF '8u;F %T$L$%fF vtRQP) ^[øUSWV[ût$D$L$|$ ntWQPRt !N tfN FPVT fN ^_[]ÐS[ND$HtPV+[ÐD$L$AAA USWVP[D$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[ØD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[D$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[ØL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[T$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$L$$t6 ruLQUqc$t?$L$Uh$19L$^_[]þT0ېffffS[ÞT$B=s`DP[Í[ÐSWV[V$rRQPhWV W] PWj t;$uĄ^_[{ S[T$B=sD$ DP[Í@[ÐS[ÎT$B=s`DP[Í[ÐS[NT$B=sD$ DP[Í[ÐS[T$B=s`DP%[Íf[ÐS[îT$B=sD$ DP%[Í[ÐS[^T$B=s`DP[Í[ÐS[T$B=sD$ DP[Í[ÐS[T$B=s`DP[Í8[ÐS[ÎT$B=sD$ DP[Í[ÐS[>T$B=s`DP[Í[ÐS[T$B=sD$ DP[Í`[ÐS[îT$B=s`DP[Í[ÐS[nT$B=sD$ DP[Í[ÐS[T$B=s`DP%[Í[ÐS[οT$B=sD$ DP%[Í .[ÐS[~T$B=s`DP [Í[ÐS[>T$B=sD$ DP [Í[ÐS[T$B=s`DP@[Í&X[ÐS[îT$B=sD$ DP@[Í.[ÐS[^T$B=s`DP%[Í8[ÐS[T$B=sD$ DP%[Í@n[ÐS[þT$B=s`DP%[ÍJ&[ÐS[nT$B=sD$ DP%[ÍS[ÐS[T$B=sDP[Í[ÐS[޼T$B=sD$ DP[Í^C[ÐS[ÎT$B=sDP[Í[ÐS[NT$B=sD$ DP[Íh[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[Ժx[D$t8t9@€tuuuuH+D$ffSV[jD$ D$D$$jVjd  uƃ tjjjpjVj# jj_fffffffSVP[̹D$L$T$t$4$VRQP ^[fffffffSV0[Êt$̀rS[Dx[S[.jPt$t$t$)[ffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐWVD$$|$t'L$T$t$1~961Ʌ21^_ËT$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐVD$L$ t|$tT$ t121Ҁ9 11^ÐD$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fff$D$4̀D$̀fffffffT̀rS[Ԯx[PS[ý[fffffffS[Î<8t3[Ë[ffff̀rS[Tx[S[>j1[ffSV[0 u#( V<u1( ^[Ðfffffff1ÐÐ1Ð1ÐX Ð1ÐÐUSWV([8|$@t$< xf( HwT5$ uҋ, Ȑ 밋$ t5( t* 9s8u+h ƃ D$ D$$D$ D$D$D$D$ $$ D$( fD$ , D$Wj(Pփ4^_[]ÐfffffffUSWV[ū$E$ l$@$D$$$D$1D$8t$$σ EF <%tL$9sL$א$D$D$ |$0\$Eȃzt5M*.Q1 w#1BMQЃ rx뫐T$ 1ېAEȍQЃ r\$T$ \$^ L$ tȉD$ C $:L$L$D$!\$ $+D$ $ $@ $1}lu $ $ $ $D$yD$$x.uu uu@u0L$8L$T$ A9T$L$f8͉L$ L$у $$ҋ|$x;u'u u&@wʱ-L$xL$ L$11ιq $D$OK $D$UL$ l$,L$L$D$LD$cWL$ $ɋ|$ $u"u su @tD$11l$,l$muQERjU :)9 $lj-L$ $ɋ|$ $u"u u @tD$1)L$D$8 $ɋt$u"u u @tt$1l$,L$L$L1ҿl$L $~|$D$ $L$8D$x1{wD$1gOL$ փD$t$ F~NL$T$ u $ $ʃuʹD$$T$ |$҉l$,|$T$ x$$ u$|$ !tU$>T$8 MÉ19Ɖȉr$򐐐t$ À019t$ rӍi$tz0tu0n $rFNj\$jj VPo4)0M1ɾc9ىr0E$)T$ 9‹t$$L$ǀ|$tD$ D$<p $F \$WU $1҉Džy1D$D$s $tD$ T$ D$9s 09r9s 09s9s09r9s0붉L$L$(ʃ.D$9tfTFl$@E;$u ^_[]ÙfUSWVP[ú1@$t5h$~xX~f tWT$ ^_[]ffffUSWVP[JD$l$H1 m \$D$H1yt9~u~f;{uًv;suD$t~u밉΀~t뉋t}u ~vD$$*jt$P` tAt=}txuHT$f;Ju׃xux uxuxu1^_[]ÐUSWV [$,$Vf1f $$0~ )$,$0hL$ QWPV?x[9wQW葇GP肇;$$u;$(u$ D$ PYmȋ $ $1 ;$u ^_[]іUSWV [Ŝ$ $q if;$$$(J ;$,Ѻx$ #ȋI(ux(u ff9<$|$~hWV$0W$0ЁxS 9wIV'FP$,$,PW|$Wu11<$<$;$u ^_[]iUSWV[PED$} D$0$u\$ jVY=~ t$t} D|$ d|$ QL$0 ;$e^_[]ËKu at8\$ XdVjjP Vt$Wu蛋]KCD$L$|$D$|$ D$9C y{1K ꀉL$9Otr:L=t&/Of;L O;Lt<Of;LOЋ\$ jPQT$ [T$ ] L$]DŽ$\$ $Q$QPT$ T$ ] ut  L$}:Hu[t"uQL$~f;HuF$;H4L$~f;Hu)\$ jP$PZT$ ] |$ u}<]fǃC ~lvr‹9‰}FfDŽS| tًt tȌt tȈ4 | |Ȅ|$ tȀC fD$ D$D$@L$#=@\s t$t|$| t$K$K$KS$$L$fL$<މt$vZuDD DDDLLDVfVL$уutt4؍<؃ǀ 뗋t$Vtȍt$| t$$]D$D$$LDD$D$$4$4$4$4U$0R&UG=r,j$ a;$u;^_[]Åt|.u|$UPQhWfpffffffUSWVX[Èv$L$p|$lGtG ,t$x6zt$|yPVt$|UQ$$E$ 5BBW(fG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$F[xnNj$L$|PQz_$L$xPL$Q]_$ǃ$fB$) $W 9$A A L$|PQ^$L$xPQ^$Pj^$PQ^$ztQ$Wt$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPYƅxՍ7Pj ^7Pt$]7Pj^7Pj]$ 1۸$IUSWV[+sl$ |$t$D$@tPnK) l$$FPj)E]F|PQ(]fFD$@ u1ftPJVP\Vj\G fffG )^_[]ÐUSWVP[:rt$0|$$T$ l$D$@t+PxJT$$׉)Ή $9|bL$(B9wW9vSD$,UP7\EPt$V&\EVt$8P )WP[+t$ ^_[]fffffS[nqjt$ [ÐUSWV[Eq$ $D$0$jU1[Et U uEEEjiU U fE@$hjV̥ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžhtkǃhpjP< EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jUYD$ djVU GPƅD$$}`hVW聁 ƅ_EH}DM\D$ 19s( w `71҅tމ8D$ Ϲրwr tt$$D$ P4tPǍ$WhhP E`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$Ph A$<#t<;t΋$doma1$in $sear1$ch #Sj P$P/ $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  ˇ鍔$P5 $< t< 0$< w 7A< vhQt$~ ƅ_`Pt$dD$ kc$< t< H$< w&h8A< vhQt$VU~ ƅ_j V}tuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< t^PV$< D$<@@@@ @@D$@D$8j5Pj j$PD$PD$;t$ s E$EtJHP,>EDt%uHmPWIu퍃nP=tP҇t]V[ML$0 ;$u ^_[]/_USWV[et$xP&džft91 9s)tQDŽͅtMtt|`9ut覺xt P蒺WfdžtPIdžf^_[]ÐUSV[dEu@ jP y$D$F$F_fF e^[]ÐUSWVx[ócEL$ L$pu@ D$jPxD$3D$fGt$V@,jWVd, VW4GL$ ;L$pue^_[]*]USWV[ct$xP,dž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[aD$Att$0UPx EO $L$(T$ L$L$L$ F< t< tjt$Vf jPVL j PV2 |jPV & j PV j PV jPVʩ  jPV谩 jPV薩  j PV| jPVb VjPVH ,jPV. 4jPV =j PV  >xjPVݨ LjPVè $`FPP5d$/FPP|Gt^GddGtAPt$'F P;P|GGtPQ7< < {$H׋$ut$0UP~ $yP)7뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]A#PV ?r?D$PVt$Qp D$L$Ƅ|$A#PV输?r?D$PVt$p D$L$Ƅ($H^_[]ÐUSWVx[ø]$$l38 h34 p;< t|OY9h@t)Y|x$D$D$%D$ D$D$D$t9PjjjQt_tt.t9T$|$ t 4t P(8h Ƌ 4(FFF@FFFF, t 9uD19u< z |$R   1>F( th 9tF F$FW( r R   ^_[]19u뫐S[Î<QPR jSWV[\<t$8 t3 9t^t, z t7 9u ~t veV\^[19uΐS[>;t$7[ÐWVX;L$ tsAQQBQQAA, tD 49u4 4~ v  ^_19uSWV[|:t$trT t/<t) z l$ E)VPP f}T$$DUMft0uf1f9sf1Kt$$fums)̓fftg,$T$1f)f9t9Qf9r1ᐃft1f9sf1qf9sfq׋T$),$fs$\$ sl$fs1^_[]1ftYf9tljTYf9r1f4YTYf9r1ftYTYf9r1ftYTYf9r1럸ffffUSWV[&t$nEtjPu7 EjVtE 1t u1@u|)vm1Ƀ V“t^_[]ÐUSWV([8&t$@l$<}GtjP7Q6 G ujUj0 81qujWjjjZ 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$Px L$9jD$PD$P밾L$jPQUUu*t$t$x ;D$uTjD$PD$PˋL$O$t:jjj~Y!уtRPi u !1(^_[]fffffUSWV[K$|$ t$tGw#jPdžL$G|$$1D$@DA,Du!@Mu:O}GQWPUVF u^/|$$KQ;v RPt2MQUQRPd EG/1^_[]ffUSWV [#|$(l$ E,D$jju<1 $1\$>\$LHQPu2 jt$u0 @ )HfOTH9t,y;l$$vًl$ $Yf_T$|$(<t\$M)1ɋ\$+Ps$tg;l$tY1<Eju6/ t%MLH<jP61 ;l$ur $1MED$$)fE ȃ ^_[]fffUSWVP[:!|$ L$T$iD}w QR jM $uJ t t})Ƌ $9u>EDEf $fDMftMftMfMB8D$H1^_[]Ë $LM))PRQ T$$ fL}1fD};<$L}D}ftfL}fD}ِUSWV\[( t$pF D$=tD$jjt$|V襐D$4-jj$V耐L$4I H Q*f\$D$<@D$01D$t$D$T$$t$$D~ L$ ~)L$t$0D$ DF)D$D$ Ut$HPL D$ L$ f FD$L$)ȉD$.Qt$P L$ Af,FfɃًT$уfLFflF $T$$tz*9 $f|zz t$)ŋ\$UL$HQt$x x ;D$tT$$DzL$f+L$tH)ЉL$ *\$VPQW ~ff+D~t$frflrD$ $ $t$t$D$9|$1ɋt$4L$4yf $T$HCT$$D$,8۴뿐USWV[øT$B =t $|$ t1|$,t*|$$|$(tMj<tuW"T$ D@aHf=tfWtfO1 ŋJDHjWPV&t`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPV{s+l$͉ $l$,t$0t$ED$9G u*D$G4$P L$,1TSGDHjWPVr t&dž(@f8u$dž  ^_[]ÐUSWV[zA =tl$$G)B fT$L$D$ uf͋t P补,$Uj͞|$(todž(dž $FDGjRPVqtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$4R^_[]DGjt$ PVMq t׋@f8u$dž wSWV[l|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[T$$wA =tF)G D$ *$Ffu^L$t Pˣ4$jL$t$,t$,jWQPt$DFjWPQ ptjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $aPЃ^_[]ÐUSWV[l$0|$$D$jPj t{t$ ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-11-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/netbsd-11-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/netbsd-11-llvm/i386/20260802141041Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/netbsd-11-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndstrdupO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)destroydescribeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotestildeshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openUsage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/netbsd-11-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.File%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALLeq!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %spgrpbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20260802141041Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-11-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/netbsd-11-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260207%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldWriting to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.0_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.The set "$0" is optional and not included on this distribution medium. This is not critical and installation will continue. You can add this set later, e.g. by downloading it via https from the NetBSD CDN. Optional sets are: debug/debug32 containing debug information base32 containing support for running 32bit code on 64bit architectures test containing automatic test programs manhtml containing man pages in html format Some architectures offer different CD vs. DVD ISO images, the DVD images are complete and contain all sets. All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.0_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.0_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlolo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %spkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1134: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1181: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %sgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemptemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtopbuf != NULLlen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initaddr != NULLsa_in6_init - %s /home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646tolowertoupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/netbsd-11-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist