08P.@j'&<  '.@jiP''`'3. 3..@j'&P@@<@T 08P.@j'&<  '.@jiP''`'3. 3..@j'&P@@<@TU .@j`'3.ppyA.@j.@j.@jQ$f .@j.@j.@jRA.@j.@j.@jA.@j.@j.@jA.@j.@j.@jA.@j.@j.@j?A.@j.@j.@jMA.@j.@j.@jmA.@j.@j.@jnA.@j.@j.@jxmKb$.@j.@j.@jX`hpx@$Q.@j.@j.@jU$.@j.@j.@j (08Q$.@j.@j.@j@HPX`hpxR$l.@j.@j.@jKA.@j.@j.@joC.@j.@j.@jzA.@j.@j.@j{A.@j.@j.@jqm.@j.@j.@j (08\$.@j.@j.@j<$.@j.@j.@j$>.@j.@j.@j@$.@j.@j.@jD$s.@j.@j.@jH$.@j.@j.@jFA.@j.@j.@jOm .@j.@j.@jPXN$.@j.@j.@j`h $.@j.@j.@jpA.@j.@j.@j|A.@j.@j.@j}A.@j.@j.@jNA.@j.@j.@jO$`a.@j.@j.@j$.@j.@j.@j@H$.@j.@j.@jPX$.@j.@j.@j`h$.@j.@j.@j_$.@j.@j.@jo$.@j.@j.@j~$.@j.@j.@jA.@j.@j.@jpA.@j.@j.@jrA.@j.@j.@jsA.@j.@j.@jtA.@j.@j.@juA.@j.@j.@jvу1s [S(D; a0#1:a|/j@[5L6x76tHGSaECFHrcopxڂF)yƭT[;>5%iA`@Mp6' LF->~~3. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4_$4 (J7J7P!!P6P6#11( TTT,,#11PtdP(QtdNetBSDAPaXU SR ffffUSWVP[/-t$$ujPjjj̇ju0F $u8& Q/tu4\uk;,s,9rD$t PPڤ;s9rLP諤$06v@ PUSWV [È.-A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]pUSWV[û,-;$s'$~*u.UE9r^_[]oSWV[l,-(;s9r^_[f$SW&,-5u1ƃ54tЃ$t$k_[SW+-4uYƃ4(t|$<$kt8?t<$k(tЃ_[WVD$0tP>tKj/V t@Ƹ!!H%PVrt&uVh!h!hTf2[^_`SWVh!h!hTf25 1۸!!H%PmCPrFhTf2j why$hTf2 uhTf2j j͜D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc54n2Y\ u$1^_[Vh!Vh! 50n2h!jLwVh!j USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S%ptutD$D$$D$% D$t$@N D$l$h8n2h $訛D$ @l$0tD$Ph#胛j 虚D$  |$\$4t$,s$L$)L >QPh!C D$  L$s()@L$L bQPh!L$ D$  s D t 4%h!L$ D dtPh!ϚD$(@9XU\$D$T$T$9tt$N9BD$4%50n2h-!t 1h^_[]t$|h!)%WS$hA!h^!jUUD50n2h|!jjt$|h!50n2hq!3$h !jhc 54n2S u150n2h0!jSWVPD$Hw#t$>%Wgt ub%$h%!Wgt N1AQhc54n2qR u 1^_[50n2hE!jUSWVP|$t$7+&hA!WV, fu ,;0n2u _2)u 0n2uhD!?L!t 0n2hjQOr 4n2u 50n2hU!Ihu3$(T%SUzft uUh~!jqh^!j$NPVS\% PV6Tf2PhY!V Vjjh!.X%T%h!hTf2Й uj54n2FrWVοV%etuVh!j~%^_VPΉj PQ x $9u^Vh!j{~WVοV%VetuVh!jM~t%^_USWV\$$1n2 n2o2 |o2sVj=P,x<$hjjh%U蜐 o2H F H o2VP3u o2t;#=t%{  o2##=uthU! o2tttjut!tcu o2H o2^_[]  o2jVh!W Wh !4$h!4$h%!j|ho!h!D$L$01c1PjPjt$h#茈n2n2o2|o21PjPjt$h!\o2o2h!jA|1hjPPt$h!(o2o21PjPPt$h!!,1tVj軍 o2u$1PjPjt$h,!̇o2|o2ËD$o2h=!j{1hjPPt$hS!莇o2o2h_!js{ o2u$1PjPjt$hv!Tn2n2ËD$n2h!j/{1hjPPt$h!o2o21hjPPt$h!n2n2fSWVo2t/ xo2to2 t5ho2)փ>8F uho2n2lo2 po2 n2n2;n2 n2r*jUn2ho2n2 n2 po2lo2^_[ápo2 lo2 t n2n2h%h $jzh%h $jzh%h $jyh%h $jyUSWVt$|$6d"SjuSVW趟 u=_2P]o2u,o2+/$o2o2а%Ah!jeyo2а%1QQPk o2y 5o2do2 do2 =,1ro2uhQ!롡n2u#n2n2!o2а%1 o2Ho2а% hQP3k n2yJ1 o2H o2 hP5n2Q n2 n2y 5n2n2n2 o2utS1V |o2o2o29o2rZ do2t= o2 n2@ n2t# do2) |o2I n2 do2ujgn2 ho2n2o2 o2t o2 o2t o2h`u;5o2 n2=o2 o25n2VP5n2W o21VhXo2v)hjZhjZ5n25n25n2n2hԲO-,1` o2t% o2o2 $o2 o2;o2 o2ss$ho2 |o2tQj QjPH o25|o25ho25o2P$ xd5o2-|o21‰1 to2 xo2=lo2 po2o2o2=lo2 po2 o2 o2xPh $,o2u6o2j5o25|o25o2P  t5o2h $ o2 o2|o2 xo2to2=lo2 po2o2=lo2 po2o2C o2s xo2to2=lo2 po2 o2=lo2 po2$o2u@s)t@o2Do2H ho2PQQJ to2ho2o2=n2 n2j1po2lo21xo2to2h}!j3Ph $jtWVo2=t=H=ju <o2n2 n2t;n29щ5n2s))Rj5n2FF n2 n2n2 n2 u\5o2=o2 tJ5n2j5n2F n2 n2n2 n2n2ʉn2)Ɖ=o25o2 t jY=n2uo2jPu a8u*o25n2Pt^_h"jSsh!USWVn2|$,tn2n2(p‰D$l$|$,u o2 xT$ o2o2 t!o2jQP5n2R !ƒ~t$VShn2 $~ D$ ` a18D$ Z o2o2 ʋ-To2Po2t>5n25n2QPHo2Lo2(o2,o21o2o2T$<$t$ Po2-To2l$13L$ 0o24o2D$11 n2t,n2u#n25n2h!4T$n2L$ AD$)ʋ$tЃ|1@|p9@|5o2o2*n21 n2T$1 uK(o2,o2I$T$ n2n2)ѣn2 n25n2-n290o24o2$ t n2)PQ5n2 n21n2n2 n2n2 t(0o2(o254o25,o2QPVR蕂 tjh %j3a$^_[]5n2h2!5n2h!5n2h!jo5n2h $jpUSWVt$(|$,\$$Uhn2j+a C4WVs(P( S^8jUja ?^8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[h!joV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu]8u F ́Ĵ^v$h $jnVP9v VVPQ8 t1$^fSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWVn2 n2t/jh"jr^ n2 n2tjh"jT^ 1t$PVFȺMb׋ `o2-։+Xo2D$H \o2iى tL$ 1FD$|$ 54o250o25,o25(o25$o25 o25o25o2h!jdW,WNPWjk] Do2@o2 t?ƒ ʺh %t#RQPh!jd|$4W调WNPWj] =o2u =M=o2ui $=o2u=o2vq( tD$*jUWt$ t$j@P]&%Pht!q=o2~0^4NXC0.PhX#hTf2p h!'C0PhX#hTf2o h!N^_[C0бPhX#hTf2o hR%hN q2uáq2u tjwGjFUSWVjƋ|$11K< @u=,p2t?jj58p2萏 58p2J0p24p2,p258p2UjW A)߉n0p2 4p2N F5s2q0s2s2-0p2F 4p2JB0PhX#hTf2`n hR%Mrh!]1H4p20p2B0=PhX#hTf2n h !'A0PhX#hTf2m h!LV1^_[]Vt$5s2q0Fs2s2^WVL$ q25p2819~vRO9G9~-81p2~Zp2΋Nu#81)Ou9~81RN981 D uh!h $$EGuȿ|w WjP 1T L ш @uhq2hjV P<1Fth!h $De^_[]Ã?w )QjP; 1L$ 1 Gu@w ۃЃ6w1$% 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVPs2 t uhI!XC^_[]eC$ts28u@s25s2Nj-s21;-s2M1WtÃ=4s2tj jwSVVVSt$x1Ʌ;L$uWwZ?E;-s2|1MVq215q25q25tq25xq25|q2ҋ5|q2 q2u q2uu ^j:jq;V5xq295tq2}|q2Iq2P5|q2ޅtC5xq2|q2 q2u q2urufL$tq2r5tq2 1^60PhX#hTf2b hR%A q2u‹ q2u tj:j9USWV l$ D$fD$p 1P tq2q219|q2@u 9uq2Sks2 t$$PPh,  $ s2| t %e2ڃuh"Q.Uuhz!Q-jD$P 4Ë $pq29}=lq2]q29|A‰T$R5lq2NjD$pq2=lq2 q2uq22$@PSW =s2?5ƅts2VPP,+ s28uK=lq2뜣q2Gh"5s2,t:jPDžc!x Q:? ^_[]Í|$'40\PhX#hTf2=` hR%> q2uq2utj8}!j&7WV tq25q219}'|q2FىDuw9@u1=q2^_USWVD$L$9tVtq2r=|q2~=q29 t9|1Cq2Mu9|1Cq2=|q2 9u^_[]fUSWVl$}!uEhM"PUT1hM"P_Åt*t$Sǀ}!u?S=20PUh"%hTf2^h!=eS&(x(=q2uWh+!hTf2^ 5s2+t$0R20臠PUh"%hTf2g^h!=^_[]USWV |$$Wơq2$4s2D$s21-q2-4s29-q2t\$=s2t$ gDž~w11q25q2Y6tss2PPjJ Å q2uq2t$ Dž|$$\$9t$utt !<$u=q2t!!9u 4s2 uhTf2Ps9¡4s2Ƌ q2Ӏu1A9|$t $ q2 4s2q2t )) q2u q2ut j4 ^_[]j3USWV1|$=q2t WrGHOHt uG `-q29}q2Vq29rFU5q2~-q2q2 q2u q20u 4s2F8WF&<1ۍF-q29~Nq2 q29wUQ ~t7-q2q2 q2uq2uhtkq20 F/0=PhX#hTf2[ hR%9 q2q2j2G @utLq20 Fq28.0PhX#hTf2Z h!Y9-1q20=4s2=q2  )Ɖ^_[]js1USWV|$?!uGh""Pt$WI,VPZÅt2l$t$ US NjD$8!u?S=-0PWh"%hTf2Yh!{8mS#x-=q2uWh+!hTf2Y t D$ )@ʼn3>-0sPt$h"%hTf2PYh!8^_[]USWVPl$Uƃ=q2t1ۅtf;l$ `1V$th~;-s2u=4s2t =q2u8 GWPt$ F x4EEs @6;l$ |=q2tt$$$^_[]USWV|$\$l$19t[=q23t UPrUPwFy,0GPhX#hTf2(X h,!61^_[]USWVP\$5s2FEx @u}|~PVq6tjq29~lq2q29SP-zgƉq2q2 q2u.q2_tO5s2;^_[]Ë5q2W5s2V . ,1xщǃ|$uEs2| /5q29$~Zq29V5q2jycÉ5q2q2 q2uq2t q2W5s2Ua ,$+HPS5q2D( |$tM1BDžhc!4)0-PhX#hTf2V hR%41 q2q25q29} q2|$Nq2q29͋|$|MVP3xt05q2q2 q2u q2umua(/ 9)0nPhX#hTf2OU hR%4 q2t1q2uj-j/,SWV11e2H e27he2yu8e2@%fe29ue2H e2ÍF=s29~Yq29wW5s2w=s2s2 q2u q2t s20u 4s2F r2C'0Ph>!hTf2S hI!2%e21t s20s2s2^_['0轕PhX#hTf2S hR%U2 q2uq2u tj_+j*USWV\$ D$1tt$h[!UQD$ l$1uHD5f2J f2;f2у  e2Qe2;=D1|he2h$1GD5 | <\t<f2H f2;f2he2j\Ue2H e2\\5tjj Sh`! tVG`!)Ȋi!f2J f2;f2Vу J e2Qe2\$ !0f2H f2;f2he2PUe2H e2D50 f2Qf2ɋ\$ ; f2he2PT e2Qe2D50 f2Qf2; f2he2PzT e2Qe2Dhe2QTT4 f2Qf2; f2~;ȃ t3 e2Qe2D$F9he2QThe2P똡f2H f2~e2H e2 he2j S1^_[]fWVD$L$L$$$0| $ |r1q2hr!t$t$ S[ ot9EtzSq2ǃxtostypf,;r2먡_2  $)D$|$ta$8-uWq2D$|<_2bq2S q2Dq25$L$jjthj1FhVVjhjhr2ƅux'q2|$t$8t$0|$t[hTf2hz!$8u h!_-ju$hTf2hy!h}!--y =q2ths2hX#hTf2EN r2tPh $>Lhe2 xt` s2| s2x51gs2QPP M=r2=q2hTf2hz!h!:,j%e2r2hc!,%e2΃t0hTf2hz!SjY515r2hTf2hz!-h!+V'Q=q2ths25r2h!hTf2LjrjkPhl%hTf2nL jdC=q2junhs25r2h!hTf2/Lf$j0yjpt$8!$h0hq23 uhs2hX#hTf2K jL$ ɸ!q2Phht@j x#$r@1D$ rD1ËL$=q2t1@ q2Ql"L$=q2t1@ q2Q#WV1F=q2t9|$ ?!t!h"W&tj/Wth!)1^_ s2s2s2s2x> s2 s2 s2s2 s2;t,uQs29;us2빋 s2| s2s2t9ts21Ƀ USWVPxm2s2DJ@t t@s2@DJ@t uHH s2~Ã=w$%=s2!hD!  != s2" s2A1Qptntl  Ӊ s2A˃= s2FP”^ U s2@߈\$ ̀1ۈL$QuH s2H1KDB@,Aǡs2 s2  Pj  5s2j$1  ˣs2@̃=r2t=q2y= s26DB@jLǡs2@1Hptntl   ˣs2@̃= s2DB@8!h0!= s21Hptntl  ˣs2@̋ s21PptntlN  ӣs2@̡s2HQPN"s2@1Hptntl%  ˣs2@̍H s2 s2 p1Pptntl   ӣs2@̡s2PPv s2A1Qptntl  Љ s2Aˡs2PPH-s2s2= s2=s2 9=s2 -s2s29 9w hu! s2PP s2A1Qptntl  Љ s2Aˡs2PPl@ s2A1Qptntl  Љ s2ADB@;h! 1ЍrЃ sOj hs25s2 ,s2wW8"%(s2 s2:o t!gc ptrP  A s2< b=$s2Ho1s2PP9 s2-s2 = s2=s2 9=s2s2-s2s2@1Hptntl  ˣs2@̃= s2F1Hptntl  ˣs2@̃= s2h! 1@s2 s2AQP2 s2<j hs25s2 @1m8"h!N@1 s2x w = s2s2ts20hx%Z> s2x A =s2u;.5s2O1@s2 s2AQP@ s2jPP>s2x  1q1ۃ=q2Ƀ=r2 ˃hI!% s2x  =s2u-5s25s2 5s2g s2x ? =s2uL-5s25s2: s2@;s2?7s2-s2x =s2u , s2IQ Ts2x =s2u,s2 s29QPns2x QVP s2y F( s2y 1 s2y P5s25s2g s2A1Qptnt lu  Љ s2Aω s2y  s2s2=@19|PRQ 1= s2u s2s2 ǡs2@1Hptntl  ˣs2@̉s2z !s2SPhAs2x  1@+q2q2uF%s2x ,;u<1=r2t1r2s2x =s2hs2hX#hTf2< s2x }*x1Hptntlu  ˣs2@Уs2x 'q2G1s2s2s2@Hptnt lu  ˣs2Уs2x =q2q2u"|$Wt""5s25s2QP';s2r2s2x ==s2uJ)=q2q2u5s2Q5;s2)r2h`!h!h!,s2hI!%,s21< *5 s2y qt0s2@P60s2@P!=q2h{]%+s2x )5s2j 6'(Y$i*tEEp $A8GMi s291s2)@أs2=s2t W6Ur21 q2u q2u u^_[]jjSWV=q2uj貽L$ɸ!q2s2Pjh""h!Hy|h߫"GtkP=Yà P@tGWP|3/tf/Ved.hDhup5s2jh""Vj=q2ujL$ɸ!q2jhr2USWVPl$5s2'Ƌ=s2s2-s29ʼn) u)E1u1$q2E@q2V}tzP蘹t_s2PPj DžtOr2q2Hq2u q2u[uE6Ms2@Pi1,$l& q2u q2ut j1^_[]jUSWV$q2 q2th!ckjP~s2L$F$ Ds29} @s2Vq2@s29|BVPH5Ds2@s2 q2u q2! s2 u1C1E҃!%=q2hq2PMƉ$ Ds29Vq29V5@s2H5Ds2@s2 q2" q27 09L$]9q29|WPG=Ds2@s2 q2]9~[q29V5@s2?G/5Ds2@s2 q2u q2yt v@s2 s2 (E s2Qs29\u=Qs2I ( @s2G (E,$s s2L$A s2 0s2y Hs2)9~_q29VPYFI5Ds2@s2 q2u q2 Hs2@s2| 0s2A(EA0s2Hs29r s2L$A s27 q23/ s2Qs2 ( s2݀ (5Ls29}0s2Rq20s29|KVPiEt]5Ls20s2 q2u q2S5@s2Pl 0s2Hs2D$1!PB0wdPhX#hTf2X" hR% q2 q2u!u#^_[]h!qh}!gj'jVj9tL$Qq p PIH10cPhX#hTf2! hR%n1^Vs2t.L$19 Xs2uXs2Hs2t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'hs2XWV s2 td< uhI!1 Qs2I t;8t7P1ǡt2t?= s2u6PEt295t2h!R5t2j8t2tV s25q2WPe t2t.h'hs2QP85t2OHt23/0bPhX#hTf2 hR%^_USWV=s2 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-u29}=u2Mq2u29|KUPAtYlj-u2u2 q2uq2uyS5s2W 5s2=4s2tsj jSWme0`PhX#hTf2 hR%1 q2u*q2u(tjh.6$h![1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17us2 uu2E#ts2 uE1^_[]8uPs2HЉʀπwRcj hs25s2蛟 1w58"uh!1gu@s2ErUSWVs2H s2H%u,8Xu's2 u2h!t18u=u29  u2L1}5u29~[q29V5 u2"?#5u2 u2 q2u q2\t Y u2 s2Qs2 u (\t u^s28uTs2H s2 u21< u0=s2u't s2| t %e2ىs28q2 u29|NWP3>t8=u2 u2 q2u q2uuuw5u20 u2M1I10f]PhX#hTf2G hR%1 q2u q2uu^_[]Hs2,j'jUSWVPL$s2s219s2}%s2ȃ Eh!Kl$ s2PUVPt$$KǸ1$s2PPu2q21S̪ás2tP芬EPPjM Ņtl9u q2l$ uq2ue$s2s2+s29}yFs2@s2P%Ut$ Pt$$hDž+9 q2u1q2uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=4s2tj jvS肮vލD$jPjSuat1t$ED$$D$1E $A9T$ 4u29Ɖ $T$~cq2t$ 9V5u2;\5u2u2 q2t$ T$uq2=4s2tjj RS藭T$=u2RSW 4$D$D$ u2 $9~bt$ q2$9V5u2N:5u2u2 q2t$ uq2=4s2tjj t$(S=u2t$SW. Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVuj&D$)D$u29~Vq2 u29SQC9u2u2 q2uq2|$~#D$$ D$ ud$th!$=4s2\$tjj SV賫u2SVP u2f |$%C<0 XPhX#hTf2 hR% q2t e^_[]Ë q2u tjjUSWVPt$ =u2T$- u2E<\<&I,$D$h)u29~Yq29W5u27=u2u2 q2T$uq2%$9C u21F9uEEπ;D$$,$L$l)u29~Yq29W5u2 7>=u2u2 q2T$uq2ml9}C u21F9u,$y^=u29}u2_q29|W5u26=u2u2 q2tT$ q2T$M 0E+ u2;u25u29}u2Jq2u29|KVP5t)5u2u2 q2u q2u^u`I04UPhX#hTf2 hR% q2u q2uu؃^_[]jjfWV$u2 u29|ld u2j Qhu2 tJPTPhX#hTf2 hR%@5u2:1u2 u2k$u2L$t$T$ =u2@Q葤 u2$u2RDVuu25$u2@LF5$u2u2^_SWV$u2$u2r9 u2@<u|L19tWW99u$u2s2H1s2L1^_[USWV=H1=L1=$u2t r2s2$s2D$j荣q2$u2 u2ÍS4R4nr@44v\1L1 [ u2\1l1sRt6,lmL)1 u2t)|?wt)LI1 u2t~l)}L1 u2,u44vL1Y u2l1}w4R4Ӆ HA9~Ru24@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=s2t׫H1s2$H1L1s2D$L11 q2u) q2u&tj\h9!$^_[]jlUSWVL\$d3VhI!N!tNjt$`hY!SV; fttu=,;߃u _2r|$L$ D$1%!D$PVƋO9rPSt$  tu;_Յuͅu t$h!-|$dD$ Du$$1Fl$?uSt$ h^!jkL$j QPL $;Fl$|1ƋD$8u&1zPUy!Uh $jJD$ th!jNjC=m@!sHQPW xs{QPW x4$Uh!  =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@Wh y?60Ph!ӍL$fqQhmW: 3Uh^"D$ukD$Ph "hv!  T$D"h!T$!h!f2H f2~e2H e2 PhY!khe2j yt$8t$8t$8t$8t$4h!( t$Ht$Ht$Ht$Ht$8h! t$h! t$ h! jPh3!hTf2  jSWV֋|$t '!?t-!VQP  JB8f2H f2;f2he2j<e2H e2 e2H e2>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hZ!蒮thl!Pu(u2hp!hthl!Pu hz!e'jhl!hp!& Pu h!j~0WD$ u h!jt$,)݉\$D$$D$11D$$h!SU$ c7~+Hr߃8tlH w&$0%,;$뼃4t6맃dtket/1@D$=,;umWt$Xh!5,;KD$71@D$$+L$ _2 _2T$uA_2$T$uȋ$D$,jj@R諛l$L$ $tL$ $L$,1ۋD$P.CEu S)St$PʼnD$$ Ul$$T$DtIL$ىL$$U$E L$)QPRM 4$EuED$ush!h$(Mu]h!bh!XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh,u2t$ t$,QPRm9t$ T.yj!=,u2y h!|$$tQt$(jVjhS#y h!"jVjh5,u2y h+!h!\Lǽt$(1CUVSwD$PUVSw5,u2t$,1L$XAAA @D$HPQS =(u2u'l$hD$h8jUl%J ul$uhDžy hm"1O~fVS5,u2 VSt$V |$h5,u2El$0fE<u1lu@hWj uH8:18tƉjjU tD$68Zt8tEVSt$C x )b8#Tht$|$l$8fE=(u2ul$0fE9EjD$LPj< |$@f9fGfG,u2G$jVU  tQf|$<tٺtf|$4t?,u2L$0u+fD$<=(u2ufD$4 8t$>Nf|$Dt1BuNfD$Dh|$u%j t$h=!jt$TjhS#yˁh!PhB!hTf2jPD$L$jQ5,u2 XUSWVA1K8uSt<։hU7 ~WUVV ~)u11ۃ8#ۉ؁^_[]ÐSWVP|$\$WSEHƅu]jj2#tqƉx jPSڃ ǀ;t$8u1A8Љ4DAtt;L5rSh!jv> 10h~!WV|$x$t,WDWHDWDW4Dx uWfjtw\wX=19}5PBt851WVh!#|^_USWVT (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx$5$l$(\$tL$y$u 1 D$xOT$`RQPVD$tPaD$d0jt$dr>D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RPG̀ uCt1t RP|GL$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PUD$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RPF$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph!,h!)|$PQt$t$RhU!j"-C$t&8$\T$XT$H|$RQt$t$Vh!j,$L$l$8h!h !hh!%USWV u|$Wk1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h!j+NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWP膯l1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hSj,PSD$HPh% |$0hSj,6SUtND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWh!j)^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh8! 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ Hu2Hu2Pu2Pu2`u25du2D$!x _2)hTf2jjjh>!L$$exL$$=u2x =u2tD$l)&1PPD$Vm D$TH Qq T$T$ t$t$QShe!jh# 11KL$0t.#`SPh!jA#V5u2[Su24u2t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1h]mjP88H H;1D$8<9u28D$D$ tD$tD$;D$DT$@D$(4t$8t$t$t$0|$(WVh! HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhz!je1gD$4$DŽ$߬$D$D$D$@$߬$ Է%a111CƋD$|$8D$|$H|$LjD$LPhu2VL$HL$8t/u2ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh!b11ҋt$  t<=`u2du2$T$p$1߬$$$߬$Hu2Hu2Pu2Pu2DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP:31A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=u2$t1J8D$<D$ۋL$؋u2k,L$1T$9|L$$)щL$ Ɖ$D$HPWh!W $PhD$(% yN(L$ L$tL$L$8]:u*t$ tD$Phh!j  ,uh,!jl  uhI!jX  M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$P'jD$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP3D$ t(Gdt;<r61@h(t 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWNJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RPe4$]0hVP:| ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$Vh[!jGT$$BRt RPRPVWjt$$Vh,!t$$k,PED$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph!j D$,|$D$T|$XD$TPh% t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =0u2yh!j]e11t$ t$$k,t$D(D$L(L$(}tTt  t1L$(VWt$Q](̷%[$t$ D$L$9Éʋ|$S=0u2tQPjWhY!j]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh % 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$Q4D$XD$TPh]% |$t$t$kL$,9 $ ?t$螏0PVh6!jD$,]|$t$t$t$L$$QtXt$|9|$11k,D(t P;|$}L$֋L$]t$QYt$D$,TD$, m4$yD$,`14tPP1h%j,,u׋$e^_[]USWVu2tWjjP: u29u u24t0jQzx!=0u2h!jt$u2xi8t8PWh!QaV`tPSh!W=jt8Vh!j 1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 1I 11u2Iu顀1Pu2 1~ t1@u2@9uUSWVD$911A9|G1ScƉ<$~ SjVo 1D$~Q1ɡu2t<1*tBEB(B$B4!؉B8<:tWBuA;L$u5u275u2$1^_[]V$u2 u2D$D$ ط%T$ t$ 15u2t$T$L$D$\$ $r!赵$^Vt$FtN H N tNHNfr v V u2^VD$`sH) u2u2 u2HtP4BPQ@@1ҋu2v9tu2u2rh!jtp4F@u2^USWVD$T$#15u2tC=u211-u29| n-u29t%9P4uH$3L$X(3\$ t Fu1^_[]h !h!hh!/USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv OF V>u2 u2 19|[5u2tFNu u25u2t5FNHNFy F4VPVu2@u21@j@PjU1@P[F ~4D$F(^$F0^,n#1^8u2 u2t q4u2^G FtH 7~ F^_[]É u2=h#!h!hh;!h!hh!Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP u2Hu2N^,H u2u2u2H@u2P u2 u2Hu2H4Iu2H89t;tprpu240u2t4F u2H^h\!hU!h4h!USWV}]uuu W@t u21@u21HCSuu WW KN0F,xNF4VPe^_[]vjv j fUSWVP|$gз%s̷%G4$O,51w0VPww D$0^_[]USWVPt$ffз%s̷%F4$N,=1~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ jn8p u2HtƒQ u2@ u2^_WVt$ u2F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h!h!h h!YUSWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$FFF }F F$|$0tfhj褴ljPLtLXt uB\I\$$|$ C$|$4Nh!<1ɺPt`tLtt l$,\$(|$0uejvttPNttP$A 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=1lj1l$1 UPQSWVhj諲Ë}Pw STZ P G1PWH¹tTt 1߀<$u1 t1 L$QWURPVhjNjl$hu PY P E1PUtA|$4t h!jSW1^_[]u C4CHKL1}Mt|$4t7hm!t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPh!:$  $ V 19tQRh ! 1@^USWV |$,\$$t$ tCPPt Ttt4RQhu!N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth!ahe2$9D$(u KHKpStURQPt$DljT$t h !u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh!b 2VRh!K T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhx! D$L$9tQP$$h!t$Ht$nL$tI9ȋt$ tPQ$$h!襋1t$\^_[]h1!h#!hh>!聟h1!h#!hPD$L$ $QPj1 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$!D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP7|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP$ D$TBL$?ttXLT$BtJ J T$$T$ QP?L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv 2 t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h! D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h!hO!h h!h!h h!h^!h"h!8USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQ. ^_[]USWVL$T$ B2ulF1Gd%Uh3"=t,$f2H f2~e2H e2 he2j -yu q1^_[]VTf2PPh!VuVjjh! !@L%Phɢ"hTf2|uX%ujglUSWV׉΋*h!UrA%tCt[PUXAjhh 2s 52 2t22 2WVS5 2|M^_[]Uh~!jZ52h $j%ZUSWV$:$D$VuP- 9$j uP- 5H1ɉ\$QSu蓎 Ƌ8 H8"u11F9Ή$<$G1ɉQSu ` ËD$8ՉG8"u !t$$Vhyd5 2* tbVh!q^_[]jh!7jh!.uh!$h4!hN!$p hh!h!jWX$052h^"jlXUSWV}E phJ$V?Fh!V>h`$V>SD$(P5 2KZ#D$0= M$L$A1yyy D$Phwd5 2w) D$tG\$ D$ L$|$j 載ljL$ NjL$IuɉNjD$ D$|$uhj4D$v1111O w+Ow?u$L$A1AAA D$Phwd5 2(  \$tmt$ NL$,D$(2D$FD$FD$ FD$$~D$(P PWt$,t$t$t$h!n KuD$1D$|$Ynhxd 5 2'R521111VQRP52h:!nhxd 5 2' 2LQhk!anww ww52h!8nw_G|$9w  jPQ5 2A'!¡2tNSVPh!mWt$ 5 2-G P$9t\)"Qvhe2y SVPh!كT$;r ZƉ[|$?e^_[]jjT52h!lhC"h$!h!hTf2o jfQh!WV$u>$jvW2( s'Wh{dЀ5 2% t^_jh!jS652h^"jSVPPhtd@5 2% $t%t52h!el$,!u!52QCl2$$q!q!sd"QPhJ!l 2$$ q!sd"QPhv!k 2$$q!sd"QPh!k 2$$q!sd"QPh!k 2$$sd"VPh!k^52h!jRWV$u^Vhzd@5 2n$ tH$D$PWVh0!.k$PwwwwVh>! k^_%52h!jtT$da3 D$dD$ tTj/S+tF1;tٍT$d#3D$dD$,t>\$:t$1\$(X%%h"!` u1\^_[]hz!hS!z_2=2uj=$2,2 222 2Yh+!5,;h!Ph!jdG2=(2u th!0" 2 2t uh!t=1uh!)ǃ|u D1j=82|$\G1PPL$lQPjWt2t$d!yt"1PPD$lPVjW̠t51=82u4$P51u#$=u82(2 $2 ,2  2=\2 ɡ1=82t&jQP8 1u[51hq'#jhhl2QPy1y"h48hl2h"`~1l2=82u'L$dQP 51h?"hh2hrdAPa 51h|"Uhh2hedA51- 51h"hl2h,"$$t(hQP51hI"~}$$ƒ 2>s1@![Vs ) ȣ2222? 2 2Ĭ22`22d25251=2=h2?w$2(2=,2L[V,2?(2) $2>r$r$$2 `2d2\2u 11]u1hQP5 1u25\2h $c5161jU51|Vu`2u Vh%"8 11hd2t1A1A1ۉL$@1hd2Ĭ2 2hȬ2=2u#D2$2H2(2L2,2 t$\F|$LSSWSjV蝜t$Lt\2n 1QQWPjVky5\2\251j/VAUt@UUUU)ʹ3333!!сisT21&2t!tt"2b2cԋ*2 42821.2‰ <2@2H21 D21AhQh02' i-02=D2 / 42ً82P+==w !r%1H$D$ ʀŸw1D$ $}ȹ*2yt2t  uD21I $L$9 0211O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj 21҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$$2-(2=,282D$42t T$$T$ 2=42uu 1; D27=2l2_hQ""E\281uh!"E\2L8L$(L8L$$L8L$ L8L$48\$81=1Ɖڋ\$4PVQR赹PSt$@t$,t$4t$|u u22Uh"Phf"h"Phe2jdU>21K1Kޅ`1PPPPPP =18h5"1"28LFu=2uRh"%tajh"O1"WjWWWP+h"t҉b2u "2=(2u 2u ,21g=(2\2D$tD$|D$h""21N=t 蹵@ 1o"WhVVWP+9tigfff։f52D2L$ȃjP rD$ u h!j5h""]1HL$ Ajh"N1۾2D$f2tB?t=kWUh!NN j2L$ DD 3$ D$tD$D$ u2 D2102|(.tq<(tk{PWh!M 824202t (BD$,T(2D$ TL 3$3L$ щtT$ D2T$D$,F9u߃|$~O1l$GVWh"FM T$ L D3$3L$ tT$FЉT$9uT$1۹"VWSSSP)T$ ‰ $DD$Rv 2=ue2$@D$ $#D$u D$ %1$L$19;ta $Ȣ2= 2u$2u,2u (2=2t8d2~ h"kȬ2~lh"k]h "訨= 2u1Ip2 Ԭ2t h!"}h"td2oȬ2e$jyDt1 2*2t 2t3$ D$ 2 u=D250282421|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 2|$E9u KD $2D(2D,2DL /`2 d2WQD$lP. D-T21ۉl$(-D$D$D2$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$82 425D2T2D$t$u~t:t  Iu(2 щ $ ,2t&=u2օ4$u 2G2tiX2Ȩuh@"hU$1X2tj2=u2Ѕ$tNT2=2u"Phu"Q0h@"~QPh"t X2 =X2uQ#$tZ$tH$1X2ti2х $t4$P5T2h"Q=2u5T2hR"1t"1 2=u 22^_[]VPD$ L$ $QP@Ch"0e2H e2~e2H e20he2Ɖ t9tDe2H e2~e2H e2he2ƒ1Y^h5"jPUSWV1=<2˃y CS t Ĭ25211 uY1ɉNVt11@5C C!t "Ph "蹲 h "JO1He^_[]SWVP$1;1u+82u"QhmdP] y h`J#\11hd2<=X2u;5X2|- X21Puh"V=D2~e102111 4282Pt,028C;D2|hv"蠱Sh"萱$1;1u+82u"QhmdPR y h`J#Q^_[USWVP։1ɉQPU  1O}t#Ë$8u8"u r1^_[]USWVP։ϋl$=2T+02 d2túd"t;$76PSRh"T$a-7St$h"H-D$7UPS\$ Sh"#-7PUSh" -77PUSh",7PUSh",7?PUSh!",77PUSh2",7PUShC"t,7?PUShU"Y,'1PPPUt$(SRh"0,^_[]USWVˉ1u=02h""踈T$$8$43|$͉)uhd"Wh.")' |$Z)uhd"WhQ"' D$|$*2:)2(2 '2l$M?>*2.2KL$ u}tGE)9H9^_[]USWV,։L$D$DD$^"tD$y"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h"x# ,2(2D$HL$LVSQPD$T$D$PVSUPD$|$ D$@VSPWuljӸ1=1ƉT$ L$@PVt$QR9PSW|$LWVUl$lt$,t$,t$(t$@h"",he2jdh2B |h5"h2{2\$ $t < uC{ - xm2DAu<-j D$$Ph2Z> D$$\$ hN%SK|$(@D$Ph9"S $ϋT$ t։t=t$h"S] t't$h<"SG ct$ |$@D$1=1ы5P2jVWRD$ՋD$D$D$D$D$$t$t$D$$  T$T2u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th5"S z< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhf"q 2Vƀ2t$Vh@"A  5P2D$,$t$P։ω,^_[]h5"jUSWV΃ twttu"^T$(|$$+T2уD$ ;42"L$ 82|.|$,T$0 @2|$9=<2|=2u|$4u 1^_[]Ë-D2~} ʉ$9tw02|(tk 42t( T( (t1+T29\$ \$$}2;T$}#=2u6|$4ttD(OG1nF"t(n9Չػ}n9l$\$QAuƉ&2tt  $tt ^*2 4211 82t$ -D2t$|$$|$}02] ʀ|(tP 42t( ;L$T$|L( (9Ή} =2{|$(t ;02KC 82424"1$t=t 42 82S"=2|$(5H2502F1L2H2D2@2<28242Ɔ&2t$ |$(P&29H2u8502F1L2H2D2@2<28242021Ƀ|$(T$3\$1 5D2n 02|+D$Nu 02[\$j5T242)؋ 02P|$(t$ hhj>02VfǀUH2L$ 82D$42ƋD$$ȉ5<2@2D211D2u02=2h""u "w"=21|$(9 H2u8502D1L2H2D2@2<2824202Ju UPQԇ D21|$(tD$42D$825<2=@2^_[]h!jnWV02t^ tڋt֋|҉tΡ024 D2 QPV0 D2ƀ^_USWV T$L$D2@hPh02  D202~C8242$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR{ 02;UjPf fDŽ;UtZF , M ;M;MU;; 42 T2T$)ʉUL$  T21 EE=,2 (2ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! MD2 ^_[]h4"jWV1=02Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5xm2<tD~t@ uB 1u€πr<r1@^_USWV 1D$Ӌ51݉t$މ$!!jVWt$!1Kl$ 11uhUPxzQ5`2P ;1u[jVW51j!1Kt?D$H5`2#$SUP 51V51  ;1tÉ؃ ^_[]h"jUSWV$0$,1@D$l$D$D$ $1h""WV" suM3j U5,;_/ á,;8=L$908"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-_2)1<$L$jhQP4e6ht2hedAP =2<9l$| <@f2UjDž\$ t|f2H f2~e2H e2 he2j Cjht2he2 f2H f2~e2H e2 he2j <$ D$ttd"tW#"Ph7#"D$f2t2Waf2gdWPVy xnu)D$PhwdV^ h%"h%"oV1^_[]Ph""25,;h#"j4 h#"h%"fSj ۓPhd#"hTf2 j USWV\T$2< $S,D$9d$ՉjRPt$ V11 Sl$UV 9 1U\$tL$j@PQ 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4%h$"T$l$ 21ɺ21MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$2t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf 2ŅtMaQ4%h$"T$ t tuf f1112|$ 22T$22f2l$E<$g\$ttXaQ4%h1$" ;B Q4%h_$" <$\$t4%h$"<$l$!F1D4 !Ph%"Vs GPSh&"V[GPSh&"VHVjjh%GXtVjj h&"GXtVjjh*&"GXtVjjh/&"ˤVj /w(h8&"V w,hJ&"V w0h]&"V w8hr&"V w4h&"V w= 2L$s("t0IPWt$h("j 2{<|$\$W4$/Wh)"h)"Sa4$u h!jF j/Pt|4$4$,/jUSWV\$ l$|$t$1E2% 22h)"WV h~n3itVn 2Ѓa~.btCd2봃otBs2띃NuS,;221=22mjShd%5,;A tHP EuA_2)ރu4t$$V41ut$(t^_[]hh("j&܄Ph)"hTf2 j$)"=2uD$ D$@)"2t ~#P=2u :%=2u )"=2u +#@P0h)"h~%jkWVPhM"Qkt1ƉPjPW" W>xt jPV6P^_ÐWVt$|$ VW?t$?/tWhc)"t"Vh|)"f"^_WhN)"jfWVt$ |$7WVUSWV $$l$WVSU$ $ hU3WhX!uWVh4*"jGTD$@tF$j$h%hVm#V$$$h=*"jUSWV$$$$D$1 h)*"SU $D$D$1G$D$ȃ 1$%N|w5,;Ft|$`N|Z5,;Fx|$Cj$h%5,; P 5,;UFp<$h)*"SU  V_2H9$|U4n$W^.l$\$t <$tu;D$ PWEtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]hh("j0Whh1$jG#ހPha*"hTf2 j@WVPt$jWV貃 9u9t x^_Vt$h*"jVt$Vt@^hu"V^Vt$Vt@^hb$V|^WVPt$jWV) 9t9u x^_Vh*"jWVt$|$ VW;t$?/tWhc)"Vh|)"^_WhN)"jfL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QdD$ T$M⿪t׋E4D$T9\$E0D$Ds h*"i-1VWt$ t$MdP:1@PPVVu4u0u)OËPhh%P; }D@u hh% hh%S }D@PE,CEh$V2\$th$Vh*", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5Ph+"+%t9\$t h.+"+\$pD$p\$D$D$ 9\$~\$~tSha+"+\$9|1} t h+"k+hW5L2h+"}4xME0;E4ru0h+" +},u,D$D E4t h ,"<D$T 1u D$D5 t$ D$$$$L$$$E@$D$,D$(A$AD$|AD$0A $CD$4D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$,"(D$ D$L$41۾ËT$||$|tL3L$4 3tD D$ WA(\$tt$1F9tWh^," (D$ 1tt$ tЉ|$TB7D7R'tt htD$pt\$1t$T$2:|$D$xtIt$)Wh,"Tf2P |$)Wh,"Tf2Ps D$ $L$t$}D@tCW&1@9tWh},"&L$G$D$$|$tD$|D$P$\$hT$,T$ T$uttP>Fx@HIt$81VRtRRP*t$ tPh!9QL$xtL$tD$8@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

CS t$ \$t RP>CSD$@@ju tf tffCD$@PdBu tȉChR t RP=CS1ɊtD$|019s$D$@@dtA t$ uˊ t$ t|$|?rWIFD$(+D$L$,L$ ʃ{1QPWV,th?3"j茭1F\$D1VPShE3"D$XWVPSp%|$$u1Ʌ|$t1ɉAw1@|$Phs3"D$tt$5D2582542t$\t$dt$<5@25<2Q5,250251PWt$L@ƃ|$4tVMUSWVӉ $ |$j W\$ Se Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph3"1L$8ɉ׉u L$8t 1@׉׉|$l$ /8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h3"3QPWUt$t$h3" QPWUt$t$h&4" t$t$h3"jUSWVTf21F/WVUhr4"ZWVjh4"ZWVj!h4"nZWVjh4"]Z WVSh4"HZWVj+h5"7ZWVj;h.5"&ZWVj$hj5"ZWVUh5"ZWVjh5"YWVjh5"Yh5"WWVj h 6"YWVSh,6"YV˻fD$t1B9| 1I 112Iu顴1PQ2 1~ t1@2@9uUSWVD$911A9|G1SƉ<$~ SjVz{ 1D$~Q1ɡ2t<1*tBEB(B$B4!؉B8<:tWBuA;L$u5252$1^_[]V$l2 p2D$D$ ط%T$ t$ 15t2t$T$L$D$\$ $r!1$^Vt$FtN H N tNHNfr v V h2^VD$`sH) x2|2 2HtP4BPQ@@1ҋ2v9t22rh!j藧tp4F@2^USWVD$T$#152tC=h211-t29| n-t29t%9P4uH$3L$X(3\$ t Fu1^_[]h !h!hh!USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>h2 2 19|[52tFNu 252t5FNHNFy F4VPVh2@h21@j@PU1@PF ~4D$F(^$F0^,n#1^82 2t q42^G FtH 7~ F^_[]É 2=h#!h!hh;!h!hh!Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 2H2N^,H x2|22H@2P 2 2H2H4I2H89t;tprp2402t4F 2H^h\!hU!h4h!vUSWV}]uuu W@t l21@p21HCSuu WW KN0F,xNF4VPe^_[]vjv u fUSWVP|$g %s%G4$O,51w0VPww D$0^_[]USWVPt$ff %s%F4$N,=1~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 2HtƒQ 2@ 2^_WVt$ 2F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFohjvs vR^_HUSWVPT$|$:%42\$ 2$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^421ہ=2| t Pt221t 98t@^_[]Ã^_[]`V15252hVh2r 52^ft$ t$ jSWVt$frLN4F,=1~0WPvv 1 %t\fv4V1AN4F,=1~0WPvv 1%1;NuN^_[h!1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR1׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS_$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h!h!h h!USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPY 3T$3D$M u1^_[]USWV(t$F@}F}F ~F F$|$0tfhj ljPLtLXt uB\I\$$|$ C$|$4Nh!Z <1ɺPt`tLtt l$,\$(|$0uejttPʾttP蠾A 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=1lj1l$1 UPQSWVhj'Ë}Pw Se P G1PWH¹tTt 1߀<$u1 t1 L$QWURPVhjvNjl$hu Pe P E1PUtA|$4t h!S2W1^_[]u C4CHKL1}Mt|$4t7hm!wt$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPh!:$  $ Vx19tQRh ! 1@^USWV |$,\$$t$ tCPPt Ttt4RQhu!N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth!ݨhe2DD$(u KHKpStURQPt$DljT$t h !Lu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh! 2VRh! T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$Zt$~ D$D$@D$ $D$ l|0ChD$D$@D$<$D$ @F h4$D$|!|$u\ 1l$ )ЋT${,;ut 3徐t 3tt1 u$T$t$ \$8 L$899v6T$T$T$ T$D$ D$@D$D$D$puD$ 11L$ I,$t$UQPhx!D$L$9tQP$$h!t$Ht$L$tI9ȋt$ tPQ$$h!V1t$h\^_[]h1!h#!hh>!h1!h#!hPD$L$ $QPj1 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$!D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|ttq|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP*$ D$TBL$?ttXLT$BtJ J T$$T$ QPL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP%ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV D$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv > t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h! D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h!hO!h h!h!h h!h^!h"h!贕USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p wA L$H SjQ}9 ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QP蹃1 ^Vt$ V(1y?1I+F$ыT$ptj42QPm1 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jD迏Ɖ t,U蕏Ftf^81FFH1|$<΋t$ 2uN 2NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPt$~$K\$tSD$ hD$@p$Fx~"1ɋ@ L;H|PHsu"l$ \$ 2{2 2\$L,D(Pl$ tttt$T 1¹pt Ѝ t$@F01FHD$Pt$.KCLLtPQ4$ϕXtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(2y 22Py`P迬D$@2 2C9݋|$"Shj="Sh="G]h="5]t$<L$D$D$L$ oPVtXljo 1tX L@uH~vCtTjhhx>"\ VF$^_[]V- )UjS! D$ D$ CD$CD$C D$C$Cl$Uhf"VS u D$CV)1$<;obD$D$PSh>"[ =USWV$0xjWS_ƅ~F$0h$1jU$_~4$hP% C9uЋ$4hM"S=Ǎ$ىh\?"$0St| uƄ$ $0ph?"QU9D$$0qh?"QP9ىD$PU}PUS2 u׋$0EED$1ɍ$D$ $PhSZ D$PD$PD$PD$Ph$Sg]D$L$ T$ ыD$E L$ T$ D $A9L$D$uPh ?"h>"E}Sh ?"h?" Sh ?"hj 5,;P Cr2밋,;$PCrj h"V ىVtS1P{-uE$ ~S4V $PhjSPt$VWuVh~A" *Wh3A"jÍD$LPSu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA hG"Qhr$PPrr @r ,r .%r0B$PPh%r0BV 8YShB"A*r'r)rzD$(hA"Ph)r])r9r rBD$>PD,r<r<|$$$PWS?$XAQj2$TPQo $PhxH"Phr<rr hA"jhr +rryt$$$PVWS>ލ$P|$xh>F"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP\ $PhH"Phr "tWD"PSh)E"s/ .1$P;$hB"Shrt$VUH"9;$PVhH" /|$$VhH"/hA"jhr t$jU=2:$hI"Whrt$*I"?c.\$jhI"WhrS$d|1$XAA$Pj2PQ $Ph`H"Phr9rhM"$`>ߋN8%wD%PVhbB", `Ouet$$P\$ ZShC",hB"$P\$;$PPh_E", V+hOB"Sh*rt$  09rhL"hM" $\>$Th $0, VG+hM"ڈ$X~:$\1j h#VG ;"tQ裈C`;$X|j *~-hVk`Ouj *$X1~$1:t @`9u9u$\Ph}E"]+1@\D$,\$H|$PS$hjV L$,9F VhE"VhrW h#M"譇F0PhE"*F0Pv,v(v$hF"*j )h0M"g$ThF"*PhC"hA"Fh$VykD$0L$4$PND$8Fh[D"Vh(r WM  FtsShzD"%*$PtPh$ *hD")$Tt*Mbi)QRhD") j ($XqPShD") ]hTM"N$X~n$1Wȃw,\)"$%L$7B"!B"B"% BM"B"PRhlB"#) F`;$X|ۋt$~G$`>G8tu #P%w \%QWhlB"( `Kut$hB"VhrP>_M"ttM"PUt$1 E$`$d $jj h#QPjVyjh/#V} V$`t$VhC"#($XMbi)QR$\VhNC"'$|$|$|$|$|$|VhC"' $\uM@#1whM"QL$!r*I"$PPVm't$hD"!11҉4hӀB9ud"t@#QPt$hC"'=2~S$h1h'y"&1PQhC"& C uߍ_ j % rt$hC"Vh&r@t$";$PtPD" "tWD"RPt$hD"g&t$ USWV`p׉͋$tphI"SI,$tÃr t1C1|L$PVQ Ou vu hu Z$1hoVW# owt1$0 j2t W F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh::"W Ƈ$L$h;B"Qh+rU9uhA"jhr U`p^_[]WV1VFF FFFFF hG"VhrQFĘ^SWV։ϋ\$1D$$jh~$S tVjhG"S tBjh"S t.jhH"Sk jh"SS u$D$D$hH"PhrWh H"PhrW=2t?|$F"tF"PVh3H"G# |$u$44%VhNH"(# ^_[$oWVƿTf2PhI"W$ Vh)J"W$ VhaJ"W$ VhJ"W$ VhJ"W$ VhJ"W$ VhJ"W$ VhK"W$ Vh!K"Wp$ Vh8K"Wa$ VhYK"WR$ Vh~K"WC$ VhK"W4$ VhK"W%$ VhK"W$ VhK"W$ Vh L"W# Vh*L"W# VhKL"W# VhbL"W# VhyL"W# VhL"W# VhL"W# jVRhQU, t^Vh $jWVPΉ1WPhPPj PQ u^_VhL"Qj7USWV։ωl$PU\$hjS E9C ShE"ShrW VhRF" ssss hkF" ss3hF" {F"F"tF"t$(PhF"  t$4t$4t$4hF"z $t$Ht$Ht$Hh%G"Z D$8PhXG"G $tF"VhkG"* $44%h~G" $hG"Ę^_[]t$ t$ t$  tt$hA"jUSWVӉύD$(jP1t$`FFF FFD$hd"V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP蚅D$HD$PD$P %5ط%|$D$ fD$ l$ \$Tl$+D$Ty1%Ph $j($PHT$D$ +T$(+D$0хyL$XD$\D$\5%D$XuT$hL$l+D$$D$ $߬$8%ݜ$ܼ$D$pt$t$$߬$8%ݜ$݄$T$xL$|l$x8%ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|RhI"j$P DŽ$ <\$D9r< Tf2H Tf2 Ku@;D$05hTf2Q hTf2Q \hTf2j R&L$,A;L$ @|$t$tD$h9rp19shTf2j %Wi.t$tD$$|$ L$1$WPh"$WPhz;$WD tB$PhAT"hTf2 UhlQ"鍄$PhX#ڍ$PhWQ"ˁĸ^_[]USWV|$W!1tv=2u8t(=2u*2Y*r W 뻋 222Hf 2AQPh2p ^_[]WVt$ !1Ht[=2u52J4>s5=2 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h %St jh#S t ;/u f. Gf./WS9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PStH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 51 2H $s-t$$tHfHxt P2)1^USWV=2the2jjhU"虓jj9#tvƃ=2the2jjhU"h21GNIIˋ^s 2 tVfV(2ޅu2=21WS"ơ2Krk=2tV$PhU"he2 ~uV7dV'%V`v v"2F$52vu;22K^_[]USWVPl$2M1t$"Džt.w w!ƅu hU"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=2tW"PhV"he2 W_1l$$ttF9u t G9t$p%Qt$h2hV"hTf2<$WbWE&F~X|$<thV"V_VCbV&vfFt$ t$ t$ hV"hTf2EuFufFFV!|$WP`WV&N=21ۈ22|NIL2h2 2ǀ2|NAMǀ2EFNDt$h2hV"he21N1@=21ۈ22|NIL22W1ǀ2FNDǀ2|INOW 2ǀ2|NAMǀ2EFNDVdPt$h2h,V"he25C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=2#~VPt$h9V"hTf21t$h2h W"]a >W\Ut$$t$$|$$WX ƃ*VhqV"V%]1@KGufGfG1@=2$ WbPt$h2h,V"he2Ut$$t$$|$$WƀH1@=2ىV_bPWh2h_V" |$u V[v vY2F$52Ut$$t$$WDUt$$t$$W.PZN1@=2t-ى,VaPWh2h,V"he2؃^_[]S122|NIL2t!h2Xǀ2APEǀ2|ONTt!h22ǀ2FNDǀ2|INOt(h2 ǀ2|NAMǀ2EFNDƀ 2t(h2߾ǀ2|MODǀ2ECHGƀ 2[SWV=2the2jjh%W"2=21VWftmxtg 2W sJX tCf{u7=2tSPh?W"he2 S\S [빃;=22k52tc~ tWuLfth]W"W Z=2tWRPh?W"he2 Wy\W9 륋v$^_[SWV=2the2jj huW"蜊2tS21{ t$C$Su[SFuՅu52thW"VKYv$^_[USWV= 2R2utDhe2jj"hW",the2jjhW"52t$G!jj#^ơ@2;2D22,׋-2WV]Ɖ׋ D2@29sAWV2ÅuWVhW"p\ SPhW"hTf2u c렉1‰1 u`WVÅu h/X"%\CuhEX"SXCt SZcSSPCcQPWVhX"hTf2:K29tPt$ ZU-2@2;2D22^_[]USWV=2the2jjh]X"`f82jY9T jj\ʼnT$2 2PQ\D$5D25@2J\Ɖt$U9\ʼn$St$p\Él$9$\$D2 @29ˉs6f82j8DTk D$;@2D2rM\$ -29sID295@2s9-2tS 2E9uD2 @29\$ D2 @29ΉsZWVÅu hU"YSCPhW"hTf2 cWV[ƉסD2 @2911 uU9t$D$ rIWV<Åu hU"|YSPKAc9-2u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5D25@2fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=2the2jjhvX"賅FtVPXfvu݃=2the2jj hX"q2=21ҹ$RL$QtMƋhtDEt9VP|$ Wj1ۀ~UiCSPW+W em븋L$$; 22r^_[]SWV=2the2jjhX"詄2=2rc11CWS5t:FfN~u %fFfthX"VYSvuȃ;22r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWhX"V ~u,|$ t%hX"VRWhX"hTf2 1^_[]fUSWV`=2the2jjhY"u525252h8Y"hh1 2 t=2uFFF%)Fu9rV9=2tJhe2jjh\"~F 2t(t$he2jjh\"}F 21V9vtRPh\"he2 2the2j r$ 9̓>t9߁^_[]á(2tPjt$t$X}uù1WVIAfF=42|C82)f@25$2jQh<2|u542F1<2PVQlS =82F42^_ù1Qh9]"i舻8u"h]"h|]"52h]]"hTf2jWVjh1,1t)h t 8@ Wܿ^_V@2 D2t7#<2=@u%o>@2 D2t<2!=@t^USWV$$$ $jhWVH,<2tE1M1 tmjWVS$8jWVS$8t$Sh$hVV$ 02U Rh502DžtGh %PItSh Z"hTf2 502DžtGh"P tSh3Z"hTf2 502[Nj5021jPP6+^^$DOGrhPD$Ph\Z"hTf2f:hPt$V` $(j7V@ 02u D502Nj502j1PP6T+^^X^_[]SWV׉1jPP1"+FF9tX\$)yWh\"hTf2 %؉jQP6~tF hP6 F^_[USWV|$_ OtGhS7赻 GO9}vDty)9|n4 ȉG.uFh$P;-22rv=2tUhZ"hTf2 \GP1=2t:PhZ"hTf2 %1=2thTf2jjhyZ"Px1^_[]USWVD$$PwD$x/@th$Q1ƀ81Mbi)<2H1ًP1 t 02P RVZ502At\G9uGSVP t502Džu*h$D$P tƀ8MbE^_[]USWVt$!M1 tFjhRW,<2t(E1M1 tm`ƋU R^_[]ËD$0X USWVX=2the2jj&hZ"xv 2  t^"O?SwSFv1V^_[]USWVj/Q1t.VE/tÀxtVh`">߉^_[]USWV|$u h_">Wq2u`Ɖˋ-(2UPDžuh _"z>-(2)ً29w؉9vlj<2|$2WS~^_[]USWV։ϋ\$ t;=22rVWh`"= -22QPVWr{s LK$\=2t%[$tC1K 1 uh`"S9^_[]SWVt$f~th^"V9~u(~th^"Vg9~ th^"VS9FN tkQPDžuh^"V)99tt79uNH4~^ SW FtPh^"V8.>W胜222F$52^_[ËAP 9ttЋR9uIHËIH ha"Qt8Vt$V22^SWV|$t$Åuh^"V,8;^ty^C Fs j/WGS贛2 2W W菛FV86P1ɅF fN^_[USWVd=2the2jjh%_"wh=2td|$xh""Wƅu060kPh?["hTf2L Wh@_";t$ f 221؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6gvuݡ2$2؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(Wf[u2$52L$T$9΋$D 1$T$|2~L1\$2 tAD$t$ jjSifG29|͋ 2 $52T$|L$<q$Q Ai0242QA 22QA 2A$t$ Vjj(QeF @t3ݤ0Phm_"hTf2 t$xhy_"8VIh^_[]USWV$=2the2jjh_"ee1PPU? Džy0Q0Ph@["hTf2g Uh_"88D$,PWry00DPh_"hTf2% Uh`"7$jSaƅu h*`"7SVWT xD$j(PW@ y0蔣0Ph\"hTf2 UhR`"{7W# 2RrD$l$42=02,$1Չ1 9$hTf2jjht`"jj525232jPn2u h_"6PjPh %HĨ^_[]f82D$L$ 4202D$L$ 22=2u t$(6t$pPh`"S6D$ L$$ 22L$T$ 2<)2؅~ڋt=2tPWhGj"he2 =2 22hQV< 22^_[]t 2 PUhGj"k s-2hh2U 40iPhj"hTf2J j@USWVE2f82\2 X2D$i"Vh i"hTf2^_USWV 1D$ 22$L$D$ 2D$=2u hg"=2Tt hg" 2ȅwEA 2 $ L$u |$~D$$D$D$E Ɖ=,2r11F؉Ét$02D$tkHL$ D$ 1 9D$ tP$ PUD$ $L$=1~bD$ tP$ PUD$ ;$D$D$ u $T$P$ PӃD$;$L$|$L$D$ +D$ $T$P$ PӃD$|$ߋ$t$9ø$L$$L$=t$|$|J|$~CD$ tP$ PUD$ D$ L$$P$ PӃD$|$~=D$$D$D$] t$|$؉AF; ,2^,2)|#=2t)Phg"he2 ,29})12tL$a,2FƉ9|׉޹2 uC$L$|4=2R=2t5252hg"he2芤|$~52hh"O =2u7f=2y-=,2~1t$ljG;=,2|칌2~#2h 2&te^_[]á2fD$ D2L$ D2}Ph@2肇QPh@252hi"hTf2貣j訚SWV|$t$28;2vhUi"b 282WVP 2^_[52hj"hTf2H j>USWV$$=2t$hf"he2 Z$ $(މ4$9{CKQPh:"hl$Ue=2t CU341hf"he2茢tUCKQB+{))σf"WRL$ QP$(赛CKQB3{))σ4$g"WRL$ QP$,OBCKQB;k))΃ g"Vt$RL$ QP$,t%=2$(tqUh+g"he2胡 \{$(u0jh;g"D$ P tFjhvg"D$ P tk=2the2jjhg"69(jtzwC@Ng"P$~6C@Ng"P$=C@ig"Pj$$!C@Yg"Pj$$q u_{C@ig"Pj$$蹈!C@Yg"Pj$$ =2J=2t&d";$ tf"Phf"he2謟 =2the2j D^_[]qgSWV|$t$=2tL2WVhP2P =2uWV5H2tu t^_[Ë5@2=D22r0&PSWVhoi"hTf2jSWVt$=2tL2Vt$hP2P =2ujjV5H2 V!ƒt^_[Ë5@2=D22gr0PSWVhi"hTf2zjpV2tuf82VVVC ^PD$L$ $QPhTf2; XaG V=2t114Bu11Bu=Iu1@'525D25@2Phk"hTf2蛝1^SWV\$j/Se1tMƊ?SDžu#Sjj0SDPO/F^_[WV|$ thm"WWNƃ=2uhVx=2t.u Ft#q"juhq"jtuSWV$$$Vhp"hWÌ3S ^_[USWVӉ΋|$-3R}WPSUf SgW9u ^_[]j\=3u"p"j3SWV t$t$4hp"jVS#jfƅ~'|$01ۍ)QP53f ~9߉ ^_[jUSWV t$4|$8\$Whq"jS誋-3SVPSUe WV53e 1Bt$ ^_[]SWV Ӊύt$sKt$ tVWh^"0 |$W,b01HFu3h8#W Wt9h$WVt'\$j SW  $ 9uy6hr"U$~h8#WVt@h$WVt.\$j SW  D$ 9uyvh#r"j}oD$PhU53bA u ^_[2h3r"jsoSWV |$t$ >h8#WVt9h$WUt'\$j SW  $ 9uy6hr"U$~h8#WUt@h$WUt.\$j SW  D$ 9uyvh#r"jnD$PhU53j@ u ^_[:h?r"j{nUSWVh詠$(1hWD$ Pc@ |$ |$ D$~P1ۈD$$,,jUh!T tjUhQs"S tG99ufD$u\$ tR$,4jVhh %S EjVhWs"S 4jVh\s"S 5\$ D$7f@jh0uht$Vj P53D$^ރ9tD$j@hes"P? ߉tD$PAODaryDpriml$t?tD$POD andfD D$PNDgrowfDnt$VND defDectsDuVNjhs"P> V53535353hs"Et2tR}jhs"Vt> uH}j1hMt"VO> #}jIht"V*> t6WhG"SSh $EUփOut$? hx"^_[]1h2s"jkUSWV}\$j S53O D$t"NuD$Hj@PjSPht"jj$j$Vjj53rF=tPht"VD$D$ D$$fD$t$j VE 0 9 1L$81qAQQ a A j QV53-D$t$ *jht"E pP  D$ @L$jhtjPjQ53ht"vhe29D$t$H1D$`D$L'Ƅ$0VhQ`53I; $j D$tPS; |$'y9D$(ȋL$;%|"@D$PhWu"́he2j %D$$<JD$ D$ L$jhtjPjQ53~e^_[]ÄtH<t<u'53hu" 53h#u"hTf21 P53h6u"hTf2h_u"ht"jShE 0ht"`USWV $ ~($ 1j4hnu"N ?C9u1CCJt$LUPV : CJjh'UVjS53~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P53535353hru"  vL$D$$jh'hVjS53Ffȁw$VhU VhU ƅtL$D$jh'h$PjS53]$f1Ɂw$PUhWhx"WhX# vL$D$jh'h$PjS53$f1Ɂwhx"gt$ t$ 1؃;D$ D$4ƜF>|$Ń %h7%h$?~ ~y)L$z"xQRPhz"WVtohWVt$D$ 8%u8%t#u@u+t'Qhw{"VP/o)V%P+ RQh{"VPo^_SWV|$t$t$hz"Ep~t1DPhz"*pCF9rj 7oFY(WPV ^_[fUSWV`$l$xT$1\$|rSUR) _w$G $G$GX0WhQ`t$|( t-D$[u`^_[]<t$<t-<uCjW53.ht"jV53h" 53h"hTf2q P53h͑"hTf2pjgUSWV\$$|$(t$,1EEVPWL( E \$ ]Ejh'VWjUt$4$^_[]SVL$T$D$ \$F^Fjh'PRjVQt$^[USWVt$|$ \$$1EESPW' E]jh'SWjUV,$^_[]USWVt$ l$tIl$L$߉<r uBGu".Ko13Ār< uF9ul$E^_[])1l$: rx\u@tfE\\7tE\: 0E:$ 0E:$ 0EIt]EG9ufUSWV } 7Nv]h"WS?z Hw$%,;3փDu3$3 333333 3(3v,3j1FV舰Ph"VSuO5_29}E3 3=3uuu  3= 3u3th" Ȩt&T%=3u!Ph/"ЋsD$PKh;"S1< 38 3D$L$@ 3 D 3D*hr=#P9|-3, 3, 3)he2PWg G?t + 3rx9u+ 3 , 3\$)<+xm2T$JDHUBRMk<8 3D$ < 3L$D$1ɸ-3T$ωD$ \$SA4ƋD$)D$tGD$ D$H 1ۋL$|$-3VQP 33-3ۉu\$ xm2DQu+<:wS3eKC CCCCuh?"QD$P'D$\$S]3 $%D$KL$  S J#GBD$ @h-330 38 3 < 3uh"h@ 35PhO"7i5H 3uQaP_/#t H 31jPPlb =3u'[tu/hc"djaaj jh#! MPhr"hjaKAkdT*T$JKL$KL$ KL$L$ \$ KD(B\$ TH\$ KSAL$AKSAL$A KSAL$AKAL$AQ'D 3@ 3!уu+D$T$8 3< 3hB"jNPhk"hTf2`i jV`USWVP=< 358 31,9|1C=< 358 39}`s%H-%E9ƉMm|)t6jju uL$J/L$9ȃ}  $Q21F,MUۉu1;}E|uE EmubWV"VvsWj1Wj 1Wj1Wj0hhV? x`j"h"P.> h@ 3 jPV> jho]$V> -3Wd/PWV= V@@^_SWV։ϡL 3H L 3uhhP 3P 3h"h"hS dh""StZÉ "td"hP 35H 3Ph"SgY|@h@ 3 Ph"Sf yh"Phʒ"j!<|.i< d"t@#QPh7"Sf t Sjj!h[" Sjjh}"V0 3tSPjh-3<hT 3/u;hV/jYS%1W YWV.^_[WVP"= 3u%3<u"3uƓ"u#!h-35H 3Wh"jj)h"l=3uhݔ"V= 3u6hhh"= xjh"P{; V= 3Wh"jQVa 3h"j.\VELj{h#"辿 3u3ujj<"uƓ""u"$=$3u D$@˓"D$=(3u Γ"=,3u ѓ"=3u )"=3u ~#=3u }#v# 3uH18h"prWPVS< 78Vhԓ"j8 78Vh"j=3u h"rjZjhT 3hW"zfUSWVGPh"hTf2a jXfUSWV<\$T|$P$3h"SWl `~$ %3уAtVMu\333p1"33듡,;3 3 3v 3k}_2= 3t =3a-3 3 t =3C)׋ 3 53 3tuu 31Et$T$t h1e21$3(3h xƅt 1GL$ 11PVWWj!D$tvhM"P`1-,3UUh,3UPԳt6À;tىPMSUUh,3UW蠳ÅuW1)&t7~ D$G UO=03Ã<^_[]h" 53h $jD~h/"Ph&"Ph"Ph"Ph"PhѢ"Ph"hTf2+_8j!VUSWVpT$ L$$$43&ƍ43D$\D$`$L3&L3L$XL$H)L$L)L$dtMuI|$ tB1\$L|$Hd"t %L$$ L$D$ \$<$D$g%D!F9t$ uȋu] }trOl1|$ wd"L$L$dL$L$` $D$ D$$ %wd" GD$t$ D$LD$D$H$D$g% ދ] =3 1=3tD$L3$T"!1nD$L3D$43$ "[KwDa$$l%D$v#$*"u[GG0O4D$L$$@"/#ؖ"ߖ" ""D$$*" [D$,G@D$$Q"[%3d"D$0pu?t$3<$D$d"Gt$<$D$"3'L%ىШpu:|$t$34$|$4$D$"كှ'L%] yBD$t$34$D$4$D$"'L%sBD$t$34$yD$4$D$ "`'L% sBD$t$34$1D$4$D$"'L% sBD$t$34$D$4$D$"'L% sBD$t$34$D$4$D$&"'L% sBD$t$34$YD$4$D$0"@'L% sBD$t$34$D$4$D$^"'L%sBD$t$34$D$4$D$4"'L%fyBD$t$34$D$4$D$>"i'L%sBD$t$34$:D$4$D$%!'L%}tQL$ D$h$D$"D$ V|$t$34$|$D$hD$}4$D$0D$D$3$\" WGHtD$$m" WG(D$$w"V$ V|$,u=31t| 3uteXu<$L$$T$  3u t GX@r9=3uD$43$T"pVGXHw $C"$.Gt u UtVtR|$,ދxT$$\$ ,H L$t$D$,D$\$T$ D$D$L3$43ƋG@T$$\$ tnuj1D$D$L$(L$ D$\$$D$(u; 3 $3Y=3LD$43$"UU3D$(M I"$%|$D$ D$D$$$_83ZG4D$hL$$T$ JL$0$rnLưD$81D$D$D$hD$ t$D$0D$D$$$"4$~D$8E*8 D$h$n1uG0D$$5"PTD$,-1D$D$D$(D$ t$ht$D$ D$D$$$o14$D$D$et$h\$(1D$D$\$ t$D$ D$D$$$D$(D$4$D$43D$(1ɉL$L$D$ t$ht$D$ D$D$$$蹔{4$D$D$$l`1D$D$D$(D$ t$D$ D$D$$$\D$($D$43S1D$D$D$(D$ t$ht$D$ D$D$$$4$D$D$43c[iF D$|$D$ D$D$$D$ D$D$D$L3$43V'8 D$($kt31D$D$\$ t$D$ D$D$$$@&A1Ah1$D$43D$Ö"SD$ @D$0t$h1AtD$h9k4${^G4D$TD$hD$PЉD$8D$4|$,T$<|$PO8D$4@L$DD$@D;tNI΃ ;t$8r\D$DL$@D(;FuK~1Ht0<$sjT$<1Ht |$t$ $ T$"D$4SPV08 ljӉT$tD$p!Ѓ"8""08PVh"%1<== 31$1Ct$|$81 t$4t$0D$(t$tt$pj,T$R[A1OD$D$1D$ D$j=QYD$ tOAL$ \$ hp"Vut=j,SAL$D$"hp"V421۰D$t$h$%Vh"VNhJ%Vgh#VhG$V.h#Vc |$$i \$ Ct$ɍQw1$%>a΀-% plj\$ Cut$BT$ҋ $)|$41ɉQD$PSc D$ D$ 938*f8\$ L$ D$D$W|$h n"S^Dh1%SH;h#S27h9#S3hO"S'hT"SD$t$ |$@t1ɉQD$PSb D$D$ 9؋t$8?8|$!1ɉQD$PSd L$ 99։D$L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh434t1hR"v 1<== 3 ڍt$81 D$ \$phjSh43PVT$RS$1BD$L4JD4`L$p$QRSRPV(3 3u1$P/#w %Qh43h"F (31<=4 j=V29= 3 j=VT$81 D$ t$ hjVh43PRW0\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP$h43h9"D$49t 8Vhy"S1JD$ $$Qh&",=3D$t$=3$D$D$,D$\$(VGC@D$p9Vh"0輈Pt$hơ"|$oQhB"=3D$WSt$h."VD$ 81ҸD$ |$\$ Cj"$P]ÍD$pWVPSt$ $PO\$ E $43jt$tS7 $43jWV# -r0觇Ph43h" B3 3$Ph43h"%kCD$ $u1@t$2|$ Qh"(11G|$1\$ tpupth#Q荿D$ t$D$t1@L$ ɉ$%t"PQ^Q|$t V8t1j t$ l4$`St$hy"FQt$h"7.l1m1L$ L$ ف$K{8P|$Wz<D$ t@j QSA D$ ;$|$8tQtUL$4 T$hjRh43QWt$ l1T$ gL$4D$ 431ɍAD$4tT8`T$ Q$QRQPW贂c3 3T$J/#w%Pt$h"t$L$ $d$ r $3 $tu¸9#tT"PQh"|$D$u |$u |$TF1@]$%t"Pt$h"$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qh["0݃Pt$hv"|$L$lj% L$St$h"{D$$%;1ɉQD$PS[ L$ 9t 9St$h#",D$ D$ D$D$0L$0RPQt$,t$$PktBD$tUtsD$ |$43jVPM D$h|$t}811FD$&|$43VVP  D$'$D$8|$43jVP D$p43jVP UD$1=3D$44$Vt$hٟ" Ph"=3he^_[]4$h"ًt$D$t$$t$SM@9s Vt$hb" S%@D$t$|81ɉQD$PS() T$tD$pD$ 9t8u 8 St$h"Qh "1ɉQD$PSCY ƋD$ 9t8t}St$hD"St$h["D$t$։D$L$8`OGL$0d$ rxL$D$nT$;L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h" jx4j-}Ph43h" hў"h"h"h43hÖ"SWVPD$t$|$L$ $QP6799w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS{1Ht$L$ltT$d;WuT$h;W(u QT ŃtD$ppPU D$DGXHr PNdoXd^_[]USWV$l13843t 3/3Sh43tW43މ)ˉESQ|$ W DW3V\VCfǀ3/SUpu43Uh3%,^_[]USWVhT$D$e"(%1Ch3D$ CL$;rjt$V ufD$jD$Pjh3Vnt%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVP(SWt$hE"|$$j@WVP SWt$hU"jWVPt$=h1腹PhT"WY: 3t5,3Ph֝"5h16:D$$PV5h1/> 03^_V΅tO Hw;s1 3 $3te 0{Ph43hߝ"M Atʡ 3 $3t"x 0{Ph43h"% u =3t^ju0USWV=3ˋ}3 3 t u tthe2jVu}ti= 3|}t j -6MO؃thD$VuP t$UtuRhT"6{5p1Rh$6 bD$VuP9 tMD$PVh"\6 D$VuP t+t$ t$ Vh "*6]D$ s*P? D$L$ r!QPh΢# rD$rIPhf"QPh6#xt$hݬ#5}u h"5j 4e^_[]Ph%USWVP=3u(ˋl$ D$$|$53 3 t u^_[]Åtthe2jt$W܅ 3| t j A4$^_[]uCuWt$h:"4 K4$~DN1ۅtPhz"4t#= 3uPh+"49t 3C뿃u,h"4't+ORhT"{4rt51t ttt ttth"w# 9uЋkT ;$tl  1L$D$Sjh:"-# {t+1:LtPh"# G,;{r܃TD$@TL$9uj !VL1A ^_[]h43h"+USWV }=3t D$ toh"Wtc&1ɉt$QVW T$$9t8u8,Wuh" =3j11CL$ t$PSQVuu5ctWt =31=3u?= 3u6L$1J1ыT$1 u#MUPj h"1ɅRaMUPjV tK=3u-= 3u$1H3$3|$ uMUjj h"MUjjP e^_[]ÉSWVtxm2q~FDx@uAFX@ut9vxm20Dr@tH^_[USWVPω11s6tUVh`"S}UhV#S| t9VvJ4$Euuhd"DƉ$t^_[]hl"hg"jmhl"hz"USWV\։ύD$ jPj Ph 1u0D$F|fD$Y|Uh"j D$ Pf$L$D$ L$/Phz"j D$ P>[ $fL xm2/LA .sD$ L<u\$ S|jPj S E9[|$ t D$ P{Vh"'d^_[]WVth΋u\~8tU~4~`N4F8 I9rPH1F0F4F8FXHr PHFX^_fUSWV\$33hT"sP\su 3zh!Pou 3j3Jmx &蹶'?c.53芓h!P u LM3=LM3_"t"l$PKrt Pu|Qߋ<-t<+u{uNhok%StGSM16khd"q3t8u)hk"q3Pqt 3aT#hr"}q3Pqt 3{"1=3tjh"~FP7֛j觛N=3u0j_`ujjB= 3t!=hM3u=3ujh" C1FVV7=L3uhr=#501u\~jhˣ"B jM5L3f:0BuK@33!Ѓt4M33Bzu=pM3t0譚|pM3jS=M3u T 3=R3~jh"u j j 6GWVt$ y53533ut[<|=N3t=(3t|1'V1Wu=WSBVWV|$ W@jP=tWP^_t$t$=tjh "jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@9,3<03U5 [35=`3u 43`3U=v====,=XAf2 43id3h3l3F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff f̩;D$d3D$L$d$ h3 l3D$D$fD$ D$5 [3uPj5 [34 ,3,^_[]VPhht@j^ t1h%"ktPn$t$uչZ$~p3h "rkt(P0# p3 p31 p3 p3u.h0"!kt PߋFM#Tƅ~5t3h+"jtP請# t3 t3 t3 t3P^V[tPh=3t1H V貇^PL$$x31Qw$%8"M(uMfx3 x;"4>"+A""D"G"J"M"=YÉP"/ufx3S"ufx3x3WV׉vu1=3u WV^_SWVPhV"iPi1Ʌ 1hq$uiz%t3Qh3谄t3i"t3Vy C"3l"3o"3%3 u"3r"|3!y33333333~ "t 3"!"t 3=lM3t8=3u/湰"3؋%3=3u 313d"u 3d"#3t8u 33d"%q3=3tt8u 33d"#": 3t8u 3 3o]$湳"  3t 8t1@  3d"1 3d""s$VWWh 3h 3qq"d%V5 35 3h 3h 3H"z$V5 35 3h 3h 3"z$V5 35 3h( 3h$ 34#;tlj=, 3GF#m0 3I%⹹F#d"d"tơ 38t,<$1QQP舅 PW> <$W@$h"4 3@%=1d"ud"ud" 38t2<$ p3IQjP  PW<$W&@$۔"S>8 3FG# tÉ< 3%#d"tƹ!=3ud"t‰hd"Ɖ5@ 3>u +3^_[É0=$0 3z8{lV t<0 1=3u V1^USWV׋t$$\$l$;Et*+u(z$d"t D$ L$M^_[]USWVր9tMτtC1P 383U5p3Wt~ P 31P 3U5p3VW~ ;P 3|ut$ 3^_[]Ë 3p3USWVL $։ύl$ D$?hҤ"Wx)?SWU( D h! VU} $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$赣xt$4h! VW"} L^_[]Ë 3p3V=pM3t = 3=M3uF 3p338t!38t=3u 8 31B(3=M3u 3p3b=M3t 3p3HD 3=\M3t!=p3|1Fj 2F;5p3|^Ë < 31B^ 8 31B < 31B=D 3ug=pM3t = 3uN=M3t 3p3=M3u 3p3=M3u 3p3D 3Ã=3"D 3Ë 4 31BY @ 3p3Ht$j5 3U 1B)=TM3tË , 39tp3 =PM3jË 3p3 31BV=M3< 3t8 31B5H 3t-F=33t31BV^Ã=33t31B^_-$H 3t  31B>H 3t ( 31B'H 3t 31BH 3t  31BH 3WVD$ #=$1 lj Ƌ  3j"  3j $ 3j=N3ttV$ 3j5H 3^_WV|$ 1Ʌ<+u OL$ GWj-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$t%1@ÃQ*A wO$D% ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$1 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th-$VtrL$PQV t4uRL$x٤" $x2P ٤"T$x ߤ"$x "w^1Jդ"^aD$# $1  H 39uVD$ T$5$1! щ щ! ‰ 19^Ã=1th"Ë 0 31BSWV@΃=1ttL 3tVstx1Cj S*VGVSP_GVh$P$ L 3=L 3!Vh¤"j@WWZ@^_[ËD$P 3WV91t#֍|$RQjW1B$51^_Ãw%ÉfUSWVPt$ P!уtRPtt jh"jh "l$$\$|$Q t^tY9uE}95u =Ճt(ˉ $19u tC ;$u~2KՃujhQ"t jh "jh7"D ^_[]1ۅs IQRP踒fVt$t=1tjhe"51^á1xy=T 3uE X 30@#4@u.T 3jhz"?t [3t1P153:.3V1N=X 3t9t/ X 3,@wB$@(@1҉,@Ɖ^USWV=1X 3@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh"1@$qQ51I 9D$}X 3럃^_[]USWV-X 31|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5[3(X 3@9@S X 31JЅt8=\ 3u/@u1u0@4@ "&[WVX 31t[@t @4v X 34@0@{!уt RPF1G)t [3t^_USWVX 3t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHX 39t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë X 3t$@(@ ,@1HUSWV5X 31H(@$@9t#H1ًP1 u,@;Hs DN3%D$z9tG1؋O1 D$ ~9 $tG#G=M3t @t1x9 @}lh j"tH @1HGG7FGF8~FNOG Fx ~,@;GsN+M3~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@誷!ƒ5X 3@@1tOD1Q@u;G  )RQ@w u&X 30@4@P%OD1@l$1tʼn$yjhǥ"1=3u 1x~OUQP 5X 3@@o<$t0@D$4@=\ 3tU=N3u#L$ Qh $ N3j2=\ 3t=M3u q=[35X 39>tOOHOX 35X 3wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jh"  +31H^_[]USWVX 3ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H1áX 3@u1I4@0@Ë9t1JQQ 9u@o X 34@0@1@@(@$@,@PPP@7!ƒtjh"81PPjt$ !1WVX 30@4@!΃t@@9} 0@4@^_SV\$t$ 53({X 3h8@jX 3@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV!ƒtX 3 X 3@P53vzX 3@u@^[SV5X 3@  ˀuH9tPQP Pj#dž @vv Hu5X 3@uE u@5X 3dž@tV #1X 3P53y^[áX 3t@1fWV|$t$ t=` 3ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnV5tD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV hd"j8h"lLh!3h!3h!3h!3\$ -uF :tjh"]jNbt'.t5!3bt0:wtptcu+!3F&jSh!3 !3jSQ ,uF!3!3!3!3!3!3!3!3!3!3!3!3!3!3!3!3h"J1tPhk"J1F$1Vhv"Whd 3P(h"dJVh"Whh 3P ^_[h">JPJj361B th"Jƅu&h"Iƅuhê"Iƅt]h"V3u6h"V!u$h"Vuh"Vt1B"w1 xm2TA ruƀl 3ƀl 3ƀl 3@=u=` 3D$l 3SVt$ !3M1ۅuD!3;1Cu11(u!=dM3u1 1ۅÉ^[D$l 3ËL$=r!=` 3tP5d 3j hl!3'l 3u l!3m!3ul!3ESCl!3Ãw@l 3uQh"VPt$ u !3ESCuw l 3u;Vt V5h 3B$!3xPV@,@l 3uPh"V5d 3j h!3!3^WVD$L$ =` 3=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$%F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=` 3t'~3P19wKS>~-19s2C,9r9v)CK$SUTuF8AUBV9o ɋl$u9tSv t1|$jjSOF ~.EFE0uE^_[]V*3t";T1t1FVh!3P/ *3p^USWV\$,=` 3tV *3tgفuH$*3J $*3*319*Qh*3~- *35*31E4 *3J$*3*31E *3=*3u *3 *31҅; <1t҉օt1PS;H*$%=(*3+"0*3Шu*%=tS  *31 *3]^_[]Ét$(*35*3 1y)3!3)É 1n1|$ l9} SWh!3 uԉnd"t*3!3VW=)3=!35* )38u!e0(*3,*3tPJ,*3%MD$P詮-)3E˨ -)3E(*3 (*3? ǃ*3^_[](*3] v(*3e(*3)3=!3v!x ux ;|)3=!3w%(*3)3< t )38 t(*3(*3 (*3*3B5)3a(*3)38r (*3)3=!3wx u )3=!3\x tQ )3=!3.uD$ L$PjQ课 $T$e^_]Ë $*31; *3|!3á*3t @@@ 11i\1PPUSWV=3׉΋$$L$ D$1AyōD$PUC$#D$=xhM"UUsW$ShU@ 0jhm"U$ ShU D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(1D$ $X1D$D$ $Uj $Pt$Wփ ShU S_1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=3o=81u=h1u =G3P1TAP@PjVP{W|8QZtQL8h""WÉ4$pu1ND$PV諀x#D$ =uhVIh`"a0tPQƅdո(1Ex uָX1Fx uhm"hX#S T$Z^VUh"S:S輦4$VW/W[VRĀ^_[]SWVh"/P/tt;^_[&hr=#V1ۅt+h$VtV<1AÅt^_[SWV|$\$t$t.9tFtVaF(1tX1u%"+"QhX#PO tWh"v: Y=81t"h"hX#v V(1=h1t%h"hX#v VX1^_[^_[USWVPӋl$D$ $uSPPSS1tD$ t}t8^_[]StV믉h!3jPN SPuSqWV)38L$ Ƌ*3 t39}I9u)3xtWD$)3$*3V)38t,t$<$PD$)38uڃ^_SWV !3*3$ t3+ *3|51ۉ|$8tZO\$t3+*3$9|Ӏ8t-t$|$D$|$D$$8u$!3)ȣ*35)3^V^_[V5)3!3tR)3)Ɗ 0@u 15)3A=)3!3"*3=!3 1@^À=!3t8*3)3 15)3*31@á)38t AUSWVPQ诠$1;t.߉WjU $)ډfu $;uƉ^_[]USWVh߫"O+h"@+Vh"P@ Åt^_[]jhɫ"Wz@ t Vh"Pe@ Uuh֫"*Vh"P:@ ÅuVh"W%@ WV9G t'փtPh"V G?G uG^_ÐH*3i ËD$u5Ã<1Ph"USWVD-$3ÅE\$9uz$1ۀ|tisljDDs9u>rjjx L*3L*3$t,tV#hj:} =[3TeuYÃ=[3e4΃eH*3~o6/=`*3u #=*3 t t =^=`*3;*3Ct}.CЃ jS&ed~hp*3 \*3X*3=H*3t H*35=H*3u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=H*3iH*3ih$jjS\Fc`$%=3 {]%t53#-l15H*3=ES[jUY  xSH*3H݃t =M3-P*3>!(Ƌ 1ķ>tjVUP t j=1u J[\ 1jry C$H% 5H*3 h"9d39039h3=`*3S`*3C1Ƀ *3*3ῃ5`*35`*3H*3/U]VsWWr!2@*=3%Q*3H*37 N3H*3hhS#jj*3*3n=3 5T1H*3 }h"H*3 _gh]%y1PPv N31; X*3P*3 \*3H\*3X*3/=3 H*3%h"1PP9d39039h3؉ك u. u.S莍i*35l1H*3%aih{]%{jVy*3*3 PZw P*3 **3уBЃ@*? !1҃ ƒ!D$Z=`*3,9d3t 903h 9h3W jhK"j#t$(VOVrlp1BsRtM&=3=H*373P*3ЩuP*3Mj5<1ùe=[3Iv_*-t%+q1҃¹) *3*3S\B D$t1< *3D$ D$ PD$PD$ P萪 `*3tjD$D$-<{|Q<`ʃ=*3tR D$HL$@븃@*3|$ ^s 8eBH*3emhȬ"1PPL!ùe9d3e903e9h3e e 1?PS1FP@/*3Phd"5*35`*3虤 1;5X*3\*3|\*3X*3n蔰VVA 1;X*3\*3  \*3X*3|3'M1PP53 =tM3 *3 t|7ػT 1;X*3\*3|\*3X*3蛻=M3X*3u' \*3|5l*35h*3PX*31QQm1;X*3\*3 \*3X*3|3|C=M3u5l*35h*3P1PP53A \*3X*31҉3P5M31;X*3 \*3|\*3X*3M3聺觮5\*35X*3DT5M3JH*3NVh"h1PP5 ùe9d3e903e9h3e e /йSE*re|褹ʭt.3t*31t.3 dM3 x*3dM3 0N3 |*30N3h"CjjhW"\*3݋5X*31ɸd9 jh{"=3t>t5t*3t.3x*3dM3|*30N3j)eD$t Pj{@eJr蘬 L$Qh $1;X*3\*3|\*3X*3)O=M3X*3u' \*3|5l*35h*3zMX*3jjP1;X*3\*3|\*3X*3跷ݫjj蟷ūD$<1D$Ph"=3jh"VR \*3X*3M3 \*3X*3M3X*31ɉ \*3|\*3X*31@Pe(ejh"e1;X*3\*3|YX*3\*3 諶Ѫ=M3u5l*35h*3Ljj- \*3X*3ʃEݣM3c \*3X*3M3*3  *31; X*3P*3 \*3|\*3X*3q j5<1?X*315*3"5*31;X*3 P*3\*3|\*3X*3 j5<1RCiX*31D5*3=M3t5l*35h*3J1=W \*3iX*3me53V?P/V$X*31ɉ \*3|\*3X*31@PuGjh"X*31ɉ \*3|\*3X*31@Pk 2V_e!ֹe5M3RPyJ1A诳է \*3X*31҉AQPcMt.3Nnt.3H*3>X`hӬ"r1PP?ùe9d3e903e9h3e e S賁+̲1PP5M3n豲צ1PP5M3jP#'X*3\*3ؽy蟦=M3t5l*35h*3Gjj5X*3d:0ؔX*3\*3艽*Pjj5X*39; eS贔D$D$Ph5"{豱ӡX*31ɉ \*3|\*3X*31@P"etbt3tFu j11A; X*3\*3d"|d"L$Qhl"11%X*31ɉ \*3|\*3X*31@P'"e11A; X*3\*3d"|d"L$Qh"je53<hr=#PR531=tjh,"o5l1H*3nvh{]%1SVUh蠻Ag53rSPx]M3 t3݉X*3 \*3t.39‰}X*35\*3)‰t.3 +3eM3 t3X*3 \*3t.3 +3i1\*3X*315M3QPHFjh"H3D$Ph"d ։u=p*3tX*3 \*3p*3e,5p*35X*3tI~V8Jjh"bUSWVP趮ܢGVD$1Ƀɉlj щ |.3x.3\ 3=[3uH9ljD$u21xUUjn6 9-[3u;=x.3|.3D$t\ 3 [32t8teue^_[]USWVPӉơP*3uP*31 r4$0utV4$#P*3P*31ESWPO áP*3 P*3 *3tu1Fx` sKu j]j%u0SW5P*3 áP*3 P*3 *3ujh"t 4$4$^_[]WV=1u=pM3t = 3u袬׮t 33!ʃt]53QY +3u =1uP5\M3=\ 3\M3\ 3u _BLE5\M3=\ 31jPPB ^_SWV*3߾̘%tr=#H*3/ V+=*3u V@t h̭"t u{]%]%P1+3PP^_[V蛫ơH*3"~S.#V$^%=3*3VPujhk"  tY>!t *3t P V!*3=3M*3.h_"qF<+t< t 3t QO V菛3/7E=3V蜭he"Pt% =3V^XX*3^(N5X*3jF5X*3jQP軯^5*3V5*35`*3`*373P*3P*3PV3h_"hd"r^SV P*3t s7H*3ZbP*3shq"iP*3 sh|"QP*3 sh"9P*3th"#P*3 sh" P*3fyh"P*31Ct$‰sSh"jVӲVP*3CuϹI"t$ s"Q+3^[fD$=` 3t@WV|$ Wjeƅ~WhV m ^_USWVt$0l$(|$$t U},$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD ` 3H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t W WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f *3 *3 *3 *3USWVi $AD$)< u?FP貛^tP,{9~"ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp1hhh1hЭ"htjPV jh"h"hQtjh"h"h>jh)"h"hQtjh:"h2"h>^Vt$ t:j j tL$HΉp *3*3jh@"荞^Vt$ t:j jm tL$HΉp *3*3jh`"H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃV 1H^_[]h" t8tMjQP[ ƅuh߫"t98t4jh"P/ ǍEjPW W= iUUUSWVP1F=3jt$蒈P#19jV n1PPPSg!ƒJVWS <$S11 ?$:81xM'x+xG1O|E(|n|dȃ|$*3t*3Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW^ S1N^_[]4$= |t|uVP11xtɉSWVh*3t$b<ƅui\$h*3e5*3PSh*3I5*3P|*3t*3h*35*3p^_[ËT$ *3t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=M3ÃB1ۃ=M3ÃCɍH9 p3~Pj#|k +3SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=M3ÃB61ۃ=M3ÃC%|$mu9p3~HPj#j +3؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PpV0ʼnPpD$X9vpG$11Ʌu2~>9sWt$Vnt t't1:%11F9r':$1u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWHpV19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQDt1=,N3ƃtEuG%t|Qh "hh"AVh $6 Eu ?=u QhU"$ u 覣!ƒtVHQh3"^Ã=,N3t$3tPP&t53ËD$t53PF$1PUSWVu1953O3t_jP%=3tJtWg%W"=3u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =M3uID$xAPZHt4D$8\$Ph "FًT$WVt$j 1@t=3jWd$53t$V$t$53g$53$h353#3t$ t$ ۨ@N3=(N3111[3D$4PD$,$jUuWP$W UYڃ,$C^_[]SVt$ hr=#V]1Ct'h"V]thܮ"V]1ۅÉ^[WV$ VtVWVstWt^_USWV 1=M3]=3Pj\hN"1Ƌ|$ 11@L|uM@-u)Fhr=#W\)1%tuQ%t s@AAۃ\$WVXWX؃D$jPtWVt$PW_ "SM 1tXt^~u1O\$$D$jPWkg uQD$P4D$(0r=#^jh"4|1 ^_[]ÉOV,;t;V,1|$rɅuŋD$(ܮ"1O;PrS芷 USWV=3t^_[]j荈h"t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh'"U{PljD$UVhVW]VS\$NV,8jUHrS\$SVUP84$袶 S虶 \W臶 VQ+ V|V$#N@ |^WV|$=M3taPW1=M3#D$=WaU*jP`qWP׃hP1LPWTx#D$=@{WUjPqWP艃h@1Vp WoƉ|^_V|$PV/x D$XT$\1jPPVRD|^UWV蒊lj53# QPt1GL$ T$3*33 *31@ u,L$3 *3$3*3 u!tL$\9|$X}e^_]øZ"Vt$VT9vHx/uAΉ^fVn +31ы5+31 u^ã+3+3=PM3t^6~^P~SWV1ۃ=\ 3t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=+3t+3USWV- N3~ON}= N3~Q111SWuljӉ:}qF;5 N3|؃=N3' =N31=N3|=p3111;5 N3| V|ljՉ!<$=N3FD$1; N3át3D$ 3D$t.3D$$t313t.3PPSUt$ ljՋD$ t3D$3D$t.39pt$j pF1Mp3H91Z{1@^_[]Vh 2F;5 N3uj{ t j2^USWV\$,=+3t+3&|$$t$ l$p3t  $9~ M3$x 9} H9$!tT=t'sujjh(4$jw!уtjt$WRPS#^_[]Åtp3HPjytm=\ 3tPay1u11FUvUVRPVjv!уu [3tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V p3~&111RP!уtF p39| 1 p319^fVt$tsVGF953u#1=1tu1Ɂ1tщ 3AF=1tH $+3v y vn ^e ^ËD$1tQ11tЅtË 11tËD$1t 11tËD$1tI11tá$+3USWV\$S@Nj511tv WN6W诪 |$j4j'fSeFSF 1HF$F F1FFF0F,1tFq0@@F=1t@$+3VEESIËnUI9Ë\$sU SKeFW 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=t.3jjPWV^_USWV,T$Dl$@ظBӃ=}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-94+3">$4,$tt=t|<94+3|wC^w \$D$Shŵ"jWBl$4,$d"f94+3u+94+3}94+3t94+3hu_G t t1"~#ut|\tt t tL@?3~|$j=W9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEu "d"6$4t$ t t_G̵"d"$40tUP9tu"dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQV5,+3^_[]SWV׉Ή50+35(+3h"hSh=w )WVRQ{h,+3S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl1 t^8+38+39+3JtGtO GO 8+39+3l1 t8+3u8+3^_[]ÍZ w6$"&tEGЃTZ$@"&btPeu>f8+3랄tGOm>"놃>۔"w>7%h>I%YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]8+39+3d   >8+3 8+3 9+3:+3>+3Rhŵ"jh8+34f"8+3_t>d"vVh0"D-3P+t D-3!hA"蹻H-3Pt H-3R"jVLL-3jVLP-35@+3h-3h-31-3PҎ $u.3^1|$á.3.3ST-31-3X-3 L-3P-3 X-3X-3@X-3;T-3|1ۉ.3.3 .3$.3(.3,.30.34.38.3<.3@.3D.3H.31H.3.3h-3#h-3-3P $u.3[USWV\$0l$,1=M3uSUƉסM3 N3SU\*@u6 11!ʃt'9݋T$0|1@9-1T$0| H.3=M3tU tH.3-3Z-3\-3t-3M3 -39}Q-3Ɓ\-3 t-3ك=M3WV^! tt$j VRP)NV".1 M3)~$-3r5-3Ƃ\-3 t-3Iu܅~+1ɊT 5-3~=-3\-3t-3A9uס-3H -3ƀ\-3 t-3-3.3^_[]Ë M3t M3=M3t1M3@V5T-3X-39}9 P-3<u"L-30Ph-3 P-3X-3F9|Ӌ5T-35X-3-3.3^SWVt$\$u$D$0j?oP,/=` 3t&v!Ss1҅ SVqt1҃Pn1҅t$StX-3~- P-3Vt[uP-3 X-3LV3Zt X-3t> P-3VtV[t'i=` 3tVs1҅ƒK1JFVY# 3#3#53#3‰^_[QY# 3#3ʉ# 3#3áX-3L.3.3P.3áL.3X-3P.3.3ËL$1wQ5D-3\1SVt$ 1ۃw)V5D-36uV5H-3#1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJk"9u!B1@uDA;1A+u%uVt1@^ÃwV5D-3Cu߸ع#L$1uj jE1ɉHHG SWV=8.3 u|$t$\$t-1 |15\.35X.3tm1@Z ug8N3t dM3uU=0.3~+d.3 `.3\@h.30.38.35X.3=\.318.3=` 3 0.3%=uah.3Ph.3l.319Rhl.3bmhl.3ml.35d.35`.3d.3 `.3H h.30.3u"h.3l.3x,1WV=` 3t h.31At^_[ÉШu-%=tS0l0.3=d.35`.3뢋d.3 `.3h.30.3USWVӋl$,|$((.3=M3.3uBu>%j jzC1҉PP.3@.3(.3(.3twQPl'UWS .3xtD.3Ph-3蔅1.3(.3u+0N3tdM3A\$l$͉=` 31؋5X-3L-3(.3Rk5X-3UWS% 65.3裆 .3-3PV軄.3@-3VP诅V荄 .3AVUUUЍ@@.3$.3 t.39}oh-3藅ơ$.3 t.3Y$gQVlu&L-3X-3PjVPm,.3$#5L-3-39|X-3l$ EVjUek L$ )v %uh-3蚃5.3b .3 X-3; T-3 5L-3|tq=P-30jf jP-39u"_l$\$u4Шx$_l$\$u$5L-3 _ ‰$ u*4N3t =dM3uKuG ڃ^_[]` 3m_uiud1UWj.3+-3 t1@+391J$;D+3} qɉы4H+3)t _L-3\$ PjSi 1EL$L-3) X-3PjS`i ǡP-3 X-3tW4V).3~Z,.3t\ [5x1)Й)֋$F UWh$ N1(.3E1-(.3$_PdtUW ]` 3t6=M3t-QdtQd UWl $UWS t1@1^_[]SWV=h.3~4։1l.3Pd VW u C;h.3|1h.3)^_[Ã=0.3~d.3 `.30.31WV=0.3~d.3 `.3m0.3|$t$ =8.3uu 15\.35X.3itb=M3tY$.3t39.3| .3.3.3X-3At3 $.3H9.3}M3 j M3M3jf=N3.3tLH.3tBx $.3 t39}; j,.3P $.3 t39}H.3ы $.3 t39|L=3tC3„u0=M3t't4|$t- 1j1j 1j5X-395@+3 uL-30P-3^_V=M3uajm5D-3tMȺj9٤"Fu=D.3u"Ⱥjx"Fu^SWV։ˋ=X-3GX-39=@+3 uL-38P-34D$ .3; .3~~ .3X-3.3 .3^_[SWVT-3 X-39}1T$5P-3ׁtu Ӊ X-3@9|^_[ËD$L$ \-3t-3VD$ L$=4.3u=M3ttNI1҉ tK1G-39~t-3\-3+5T-3)΋ P-3 L-30 ~^4.3$.3USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8[3u/@+3H9| Qu@L-38GO1H^_[]cS L-39t L-3Mtۉ>?SUSWV-@+3\-jSv jSv DžtVtRU5L-3V  P-3UPW  UV} 5L-3H} 5L-3=P-3@+31t W%} 1Gt V} ^_[]USWVL$D$ʃQPO1H…t$=@+3L-3D8OlV tn[3uc~L-3>-@+3u@L-3 (I=@+39rHŠIJL-39s=@+3)\8OVà uQL$ t L-3t=@+391H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= V{ 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15t.31Kt.3|EtESSP tt.3@ԋ=X-39=@+3 uS1Hte1ɺ|1:tWAuN1|11I:t?@u21|11I:t%@u1|11I:t @u^ËL$H1Ʌx 1USWV։Q@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=M3u1@$5.3+5$.3~1; t3^USWV։L$|$0\$,Ѓt,.3!t6tC؃T$RjQPWSQ=N3=@.31ۀ=<.3tw4$<.3 .3ىȺVUUUЍ@)I-3~4,I-31E 8Vt$0j* G;}|Cu4$SG H.3tf |.3x.3!Ƴttt$,9} 5x.3=|.3<.31ۃtQL-3 X-3T$ 1ۅ~&L$ PjQ\ X-3~P-3\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E$.3;t.3uX.3#.3uD$,.3=.3=-3~01-3 8jG;=-3|h-3t.3; .3~<$~ .3 X-3 .3$.3~1 ;j_G9u$.31;t.3uD$Ph-3tX-3 T-39~~51ɋL-34*1 P-3444A; T-3|١X-3) $ $.3X-3 $.3; t.3~(M3 j$.3H$.3;t.3؉^_[]WV|$t$ =M3u1WVP PV WVt1@1^_Ð.3H ȁLG3r1LG3G3.3G3lG3G3 G3 G3G3G3G3G3G3G3USWVL$0D$,l$$G3$G3G3t-9Br }$r1z3|$( HG3u$$rG3t :=G3G3G3<$:rBJ jl$(jWG3tC:G3t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?G3t_ )ϋ,$]}G3tG3tV+BJ NF=G3uW-G3MEu$9ˉ|-G3],$ϋ=G3t sKӋ$JHJ^_[]USWV1=M3tD|$(T$$!t3|0G3G3=G3t'9PH }=G3u11CŋE1ЋM 1 u ]u,G3G3G3EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}[3!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[[3u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVStG3 11؉^_[]Ã=G3xÃ=M3u  +31M3Phx"4VG3xNH G3d|@G3* G35G39|jh"z5G3^USWV|$ l$1ɃG3G3tKC9⻔G3G31 G31 5G3v vB1IʅI~nVv 4$9ʼn1I1PPt$R9[3 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$R[3uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=p3~%GW8É!Ѓu O;=p3|܄u<$<$US111 )ȃ^_[]USWV1PP@uejh"2.31111ۉu WVSU1PPWV+[3u Ɖ!Ѓu.3^_[]WVT$D$ =N3t 5 N31)|щƉ^_fUSWV t$ >-uF(s7h{]%+V+h"+艣D$1S6]+S)S\^SK S jy W. h6#À8t>tkV聪tmSʼnD$ $U  $ȃ$jP'袷t$PSh!%t$U@t$l  Sa'Ņu>tVh!F'U+Uk j@WWW.1FVJ]V'D$$t*P*h"y*/j ))3 +3t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjh".1N\$h""S4h{]%Q)SH)h";)3(1S|&S[jj 1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSDjhض"1KtL tGf;t=ËFHN~ ;F~à tQu VSpDV%1Vj 1GWZWg%e1= +3VZ^_[]fSWV1G31K4t 5u'#ar'G__ _Gt Ph GF6u^_[ËL$ 1ɅV-$t:L3'W.t7^uM3L31L3L3L33 M3L31L3L3 L3L3t Pe L3Fu,~1S薺PW豺Fve ^F~ ^v;3t PNu VSWh ^_[ËL$t@;3tjh"x)1HËA QUSWVD$T$1ɾG3=39~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9L3u L3L3uUSWV\$SκƋL3t@PPVsuL3L3`d DžL3WMd u^_[]USWV=M3|$,t$0hX#W; l$L3L3!ʃtWj UQP"L3uL3 hr=#VtL3VUL3Ph"W;u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=p39Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft Pb  $FQF^_[]V=3tjh7"&dt$D$tt/uKV3;m?u7=1xCjhm"뵃=1x%3Qh"l&^jhY"jh"{Vơ3t Pa VޣP3Va 53蛙 ^33VD$$L$ t tC8.@L$$Vh7u%Q 1>jh"1xxPh"j V5V||P|0tB D$0Ph";D$$Vh7u%P >t.jh"1M3L$Qh̷"$^ãM31V1x$ p31Vh@BVPRQ_M3^VD$$L$ t tC8.@L$$Vh53#Q 1>jh"1xxPh"j V4Vq||P|0tB D$0Phe";D$$Vh53#P >t.jh3"1M3L$QhI"#^ãM31V1x$ t31Vh@BVPRQ&M3^V|$u%t$jVt0Ph"N#^V|$u%t$jV؇t0Ph"#^SWVD$L$tPL3p=3tjhʸ""VP>PR Zt V踘)X!ЃtV谕5M3SW? ^_[VD$L$tt\uoPe01_Pơ01t=(1t P] VӟP01V] 01Qh"!^V|$uJt$ =LM3tV3-L3h$_V_h@^^WVD$t t0t$R3l7=tDMtGhuXF 1P`M3R3Qh $5!Emtwt su!FF1FR3FR3F$17\ V^_D$u5M36Ã|$"7VD$Hs^\jh"7<1V)h$&Ph"h"V};1xu'h="hw"h"hϹ"h "hA"hv"j^^WVD$t$ʃc"y$"&m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=N3utjhº"$FVPMy0Ph"^_ÉPh"USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;@+3~D+3A9s } uE9u9t},u E&| t1@+3+<+3x1 ^_[]WVD$Pt t*$TVPVLD$ps D$ stopD$Tab =t1|i1Gt$rVUfD,VE4D+3hf"Pk G;=t1|VD andD theDen t$V5x1h"P 0Ph $D^_à D$t t+uyL$tJQtQytWjh)"Mà$1L$%1AAD$PhM"!%1%1$1$1%1 $1%1 V D$t t]D$t$jh#QVP46hr=#Vbt5>t M3 $M38M3tP9M3r=#L$QhW"O ^ËD$Hsjho"/Åu 3Ã|$u=M3D$u =M3~GTM3ÃD$ u)=M3| Ph"M3ÃD$ u)=M3| Ph"M3D$u"=N3t=3t*!ƒÃD$ t t%uCD$ 1^u2@t+$1"1P7Qhܻ"V D$,L$(t tC1ɉ N3 N38,uT@L$,t$Vh#Ql >tejh"Ot$5N35 N3h$jV)0Ph("#t$D$,Vh#P >tjh"9 ^ãN3 N3D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$ #&d~&s wR$H#&s wU$"&gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G N31 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh`"1QZS N3^[ÍD$PhE"҃=M3=N3= N3Ë M31 p3+ N3t$4Ph"hL3蔲 L3USWVl$,H M3t&AUjQD$}ol$,7F]$p#&|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph"hL3脱 L3FVEŅ8D$EH$#&E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=LM3nAL$,9 ItIT$uWoD$,7L3j+o2Ph"L3VB T$jV%D$,|$?+3t PKP GP 3CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WO |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh M3P M3IM3^_[]É|$|$ u D$Ph" D$Phּ"͉-M3ōD$8Phs"uA0h"j*h M3#ËI1Ph"j*h M3~#USWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph"=j UQ xt-u)%tt0Ph"1H^_[]SWV9toӉQ@jP ljtG\$=M3t <\u ~t F <$t)\tPS諹t GFFuD$Qhƽ"1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$ M3Ph"|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hR"3rtP~11@USWV\$(|$$1E=DN3uhHN3?DN3 [39<$l$D$l$ =N3t=.3t=M3u1=|N3ubPjD$Pu D$tD 19PaHD$=\ 3t=$N3tft$,SW DN3=\ 3u"t1@N3@@N3| j=y!88#1Hpt9= [3t|N3[1DN3D$ D$D$$PD$Pj~ 9= [3t [3t, [3DN3^_[]øjhHN3KUVVVe^]USWV\$>0s_ SV,jUVSh^"UP^_[]Vt$V@_ uVhb"h}N3 }N3^USWV D$0щL$l$ |$$t$4PWUpƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWV Ջ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$S膀׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WP=Ét$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWi)$l$D$ ׋ $D$ՋD$1PPU\$S]ыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPe^]fSWVP[3t  +3Z1N3WP(t>1C4$$N3u V WSCu ^_[S=R3tR3 \$1=R3r 1H 1R3[V51N3t(N31VP51` 9t  +3^Vt$51^Ã=R3tR3r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVيl"O u݃|$0xG-Wt$8 ^_[]USWV\$8T$0t$,11|$GUSRVيl"O u݃|$0xG-Wt$8+ ^_[]SWV|$(L$$\$ 1Ѝt$Fl"NuxF-VQ ^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$P ƃ^_[]WV t$RVQ t|$P3GuVe^_9Hw @sÃtP=USWVPt$|$R3V<$=M3uԇTh=3 "Vt$ P]Eu 348JMp;5t3|  +3^_[]VWj .^_[]ËL$T$d"PPh}" USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFuR3^_[]WVt$|$ zt!1Ph"Ph"d"PPh}" ^_WV|$t$ t%WVra7ft=t3  +3 j Qu jF^_fUSWV\$l$=M3u<؉%t1U1GWP?[PW1WPPUVd[1 jj1=31Ƀ=[3HPVWU Åt!W8 |$t8jh"'D$ tP5D$ 08 D$ 89t V8 ^_[]Vt$tPr56]8 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQ=y ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u D$E ʀ[} M3@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø\%fL$tt"u$ p3p3HI p3IR3ʋTUSWVD$T$ p35R3|1Gll\G9uTD^_[]SWVD$L$5p3R3|F|\\|N B^_[áp3~Ph5R3 USWV p3; R3R3th!t 1G31K;)1G1I4:tl!GtˉP4  p3jQJƣR3p3R3~PhV !t\l^_[]USWVPL$\$As p311H$(up31@$1R3<#|tZR34ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$R31H; t$z|#=p3|O1;Ll |C9u^_[]USWV p3~.R311F1l9޻r G9u1@^_[]USWVL$T$9~1@+5R3A1G1֋l9߻rB9u^_[]ËT$p3!х1A9Hh%&*R3=LM34&&t%&P R3h&&R3h%&1hd%& 1h%&$1USWV \$4Z3R3|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$$&=M3EQ-s4C$ىË $Fw$T$&#Fw}$$&X!уj WRPBBtDt L=M3!153hr=#P1sTu~-#PuYQA tLу|=RP螽1 $1=Z3R37f1=t.3u ÊCCs|,v, l,uȡ3!ƒtظ:,u53资j W5t.3QTу p35 N3n9|$ V5353蛅PtmƉVZ/ +1+5Q ic+Ɖ!уRPUVZ3=R3H8 Z3H=R3wA53kP豄 !уRPaٹ N3 p3VQRPzg 353,Pkyփr9RPٺٹ}"RPOj WRP$I"QD$ tOՉr6UPlٹ}RPVt$!j WP( I"/153Mj WP j W1P9D!@|R3d"9 Z3t R3d" ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5M3Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^51~V5`M31=LM3tȉt 1R30A3^5$1'SWVQNjZ3عZ39r ЍZ3WVS蠗 ;Z3;^_[VQ!уu$x p3H9}FV!уtt^^Ð1Z3Z3Z3Z3WV|$ =+3t5Z3tZ= 3ta=p3|<1W!уtRP虆Ws@Gp3H9|vuZ3覍5Z3^_USWV 11D$L$!ȃ1D$1D$ 1H1111= 3=+3t4$=p3|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$p3H9|u $u^_[]Ã^_[]鍌^_[]TZ3K|$thZ3m=Z3t1=Z3Z3j jh""V΋At P( FVC^hZ3SWVt$>t_w ( W( ߅u1F FF1HZ3Z3Z3Z3^_[hZ3SWVQ1u(\$|$Z3St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-Z3Vt;xH|p$x Hȅu^_SWV|$t$u;Z3Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=M3uH 151!ȃt3191|$|$ !@tp\$9ϋ\$(|$}^Z3U1tHt$ !t Q9y}1I(t(t$=D$Pj@t$>SD$$PL$Qt$Tt$V> [3$u:Z3 Z3!ƒt&9L$L$|D$;Z3D$Z3t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$dZ3T$X/ t$ t$  \$(T$_CtN4$jjD$xP$Pt$4t$5Z35Z32$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$ V  T$1H#E t0E t L$PL$THD$$e^_[]Ã=# Z3L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=Z3Z3!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$Z3 Z3!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ Z3D$Z3D$$Z3D$ Z3e^_[]1JЋ4$|$9ωL$}@D$ @+3 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd= [3 USWVt$hZ3tH>tC\$1EjU1GGGUSxL [3G= [3-5 [3t~'V u [3 +3^_[]W USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5Z3jjSt$DPV5Z35Z3s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@c3Ph[3bPUSWV T$(\$$t$ 1`1PURS葓)ˉ<à uVh $t$|$u u)u%u!1ɃtsQl1Phb"t DhO"m'^_[]SWV \$ hSh"# uPIth"(' ^_[/xEhSh."o# 4$譤t t$蝤j Vh<"뙿 hm W趔51t$S jW蘔|$W[O[9uR1Vt$4$ j膽Sh"@&VgWV|$ 51j/Vt@jWhZ"QV ^_1@c3PjÊD$f2J f2;f2~{у ts e2Qe2jPhc3h"" thc3hM"P"t:j51P? f=1u5@a3uhe2Qhc3h"rUSWVt$81GWh!5a3o 1-c3hp SD$ha3SD$UI Whdd35a3e tLtFPFuf=1@a3tjQP* P蟬j%\t$4l$0jKD$T$1D$EHM~EHMUڃÃ=c3uf=|1u0Iڃ% tM 1f=|1@ ЈD$P D$ƒ t|f=|1Qq f=|1uf=1tT$j \$Ct,j Cu\$T$f=|1x댉\$ 넻 $f=1tD$ @D$ Phe"Gڃf=1c35l1jW5@a3l c3 c3 u61=$c3#$ |19uj賺5$t h"v"j茺ڀ tf=|1u j ttFPFujHÉU輐t$jf=1t'+\$|$f=|1i"t"WSP jhdd35a3( hpa3jj'(^_[]USWVP\$D$jP5@a3 f=11=c35l1莹jD$P5@a3 Wp9=c3ttػ1FU Ph"dKtMVh`[35@a3- =c35l1VD$P5@a3腝 W9=c3u^_[]WVjPhd3h"% t ^_hd[3hd3Hrh$"| ы d[3u h[3Q[hM"PtAf=1h[3"t"PQhWWh"V \Wh":Lh!v jc3USWV$f2J f2;f2у  e2Qe2t$hVh" 1GWh!5a3貚 WSCWj8ha3Sj Whdd35a3贛 'x>jEƉ׉UG~*9u$he2QBEh<"11f=1tjHE)RPh" jhdd35a3 1hpa3VW WV`WjU^_[]j5@a3W\1SjSWVVh">S%USWV$f2J f2;f2у  e2Qe2t$hVh" 1GWh!5a3Ҙ WScWjXha3Sj Whdd35a3ԙ %x>jCƉ׉UE~*9u$he2QbEh<"11f=1tjhC)RPh" jhdd35a3 1hpa3VW WV耊Wju^_[]1W5@a3 j5@a3SkWj0WS&VVh"OW6USWVPhI"1GWjWjމ9$tDƅtZWD9uhO"1Vj蛉Vj萉 ^_[]hTf2WjheT#Uh&"Z1SjbSVS-1j/Ut@SQU hTf2WVheT#*Uh"W蜥WVPjh#5a3W f=1t%51>t=a3V裇PVW( 1FVh"5a3 |$VW5a3= ?nu51h1"Ž ^_VPjPVhC" t=a3u.5 1VyVhI"yhQ",P^Vt$j5a32VtVh]"7hT"Ej WV5,1t)>t$=@a3V莆PVW jYQj{VhVhk" V1t$1jh#5a3谔 1u1$1%1t$1t$1f=1t51t$$51f=<1"t!Pn1t$11d31t$1j1t$$1f=1"t!P^WV,|$8V5@a3X`h!W蚉t! $#pa3 $ pa3pa31GVW5@a3z hpa3Wjj8^_WV,t$8W5@a3_h!V1Ʌ#G OWj5@a38^_V1Vh{t 5@a3s j3OVhzt 5@a3s ^S\$1u:jPl[ESWV|$\$1FtCWPt1^_[fUSWVl$$1|d3hd3,`3%PhP1h"t$4U1I~1L$$D$=_38O>HЃ sX 4HЉ5,`3jhP1h"t$4U觼߃ufH1K$d'&,;|d3뷃EF,;jhG"S衆 jhH"S艆 hx"S3D$QPuV,;h1Q%ShG#Szhx"S׆$_=_3,;0a31@D$<$XD$d3=hd3,;j/SNhd3k<$$YxD$ P1PhPjPP5,;\ ,`3L$ !P5,;h1"Q.=8a3d3/5hd3jVJhd3|d35d38a3d3=,`3u ,`3%d3Y1ɉ d3hd3t=|d3u|d3t =0a3lj:h~#t$! 1Ʌ d3=8a3u6|d3t=d3tP5hd3z18a35d3j:hي%t$輳 t 1j:hݚ%t$蛳 t 1j:h"t$z t 1j:hG#t$Y t 1j:h%t$8 t 1j:hC"t$ t 1j:h4#t$ t 1j:hR"t$ղ t 1j:h& %t$贲 t <1j:h]$t$蓲 t <1j:hb!t$r t |1j:h~#t$Q t 1j:h>#t$0 tu+t$c3t P V)ƣc31hx"Vwts$c3hG#Vwtah)#V{wtSh0$Viwteh1Q%VWwt1Tf2Vh_"W WD$c3$11ɺ10 ߈c3Bu^_[ñ1WV,|$8V5@a3MWVWV#NF=jV5@a3z f=1t|$ ۔"td"P4`u 2 <1tu 1tt A8u1f=1t xm2DAt lm2DAD$jV5@a3 f=1D$P/hDa3jj USWVt$D$ $1=a3h jeqD$1CSjSqhDa3SW Vh $tha37+tWD$ hpa3jj{ t$jpUjp=a3uD$ 1;$ȃ^_[]Ët$$4$e2H e2~e2H e2he2SreȋL$ < U;t$ KD$ V1FVjYp5a3h۔"FVha3*SWVP1\$ x1t%`319u Gt+t' u9tpD$jP5@a3 Yـƀ_r c3^?t@آ!c3"c3  c3!c3h c3h $ͤPW1^_[Pe2H e2~e2H e2$e2qt1Ƀ=$c3!YXD$_r c3^?<t@ !c3"c3 c3!c3 c3SWVT$L$D$=$c3ut1<1(c31F9uRQP| yy8tht$&^_[hQ"USL$ \$1B1t 9tA8u[VL$ b3tSA ."8t6u(^@\VPt c3)ƃuf^?݈@ b3^VD$Ph9"=x1x1`3Ft1_r c3^?<t@ !c3"c3 c3!c3h c3h>"詢_r c3^?<t@ !c3"c3 c3!c3F t*vPh c3hB"L`3~ v 7^ÐWV1Fdd3VW5a3=z VW5a3m{ ^_USWVt$jV5a3K{  uD$41؍oD<jV5a3"{ D$< t r֍,f=1tc3t Pl u1D$y1D$h"Pãc3tD$y1D$nD$jP5a3Oy^_[]1f=11USWV1GWjkWjkn VWkVjka3fC@a3CfC 1l$jjS'z ~}D$tvjhdd35a3y ~]dd3Bt8StGWuG1GWdd3U5a3ux WUl$5a3y 1f=11D$hU5@a3gy jƉ,<=$c3  A9rWD$Pjw f=1c3tyf=1~g|$_r5,1Pt. c3YSQ;Y~ڃ tZG9r QRbl$!y-t8u!PWjl$U5V~Eh@jf=1tc3t P)jj诗fSWV1t31^tPGEtF tFFu҉5 1h"hWhM"W豠tRVhW< t4=(`3tWh"!j WvtWV[i%%1^_[USWV|$h$Wkj Wj=W3t@C@uSh$Wku S6ÉXj?W53t0tO@t8JS?!tOYt@t 5tWh"~5=1t,1Ft = @t t~vuك=d3~h۔"^d3^_[]SWV΋d3C!w\Cd3؋ f2Qf2; f2he2j yd3 e2Qe2 Xd3#|>Weأd3NI$D(&Wh(#d3@d3N Q1f~ @d3f2H f2t;f2lhe2j!轠ld3v Wh"r `Wh(#bd3@d3N tEPPdd3Ve2H e2!6h $d3#|d3h۔"^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n"L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh$ShuW 1@W(ljR1^_[SWV11t8ϻ1WPgt!CtWPgt Cuމ^_[USWV׉A tS^؃H$d(&n tWUPgtjPu UC W%F tQfB t <th"*N 1?!9~ t~ N 9tF N^_[]h"fSWV,1f=1t h"藘|$:$tTf3$ h}"US茠 ƃw$(& (e3׃B/,;8jL$QP+ $9bWh)"Ǯ+t%thz"誮|$ DDf3$ $ 4hWa uW$ 4h^"9ō$UhP耲 tʼn-4e3=(e3Pf3hPUg 8e3ut$t ?#P54e3h"h< < ߁WjP; N1\$ PPh; tB=NýjPU  9W8t W8uxW8u2N1 T$ PPS 9ǃu8uW8u<\$Shmdv: t*hR"#Wv h"v h{"FN1 T$ UUPB ljl$ShmdvZ: 91EUSWV$F~ 1jUWSP_9u!D$=жxt9wwF̓uv h" v h"fST$1uD1Gu<jUPSv^9tu&v h{"h"1^_[]hPv h"hv"h"h h"h"hh"h"hh"謔USWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ P 9 D$VUPK9 s DD$st$s 8D$ s <D$tf4$l$4UX*&4Mt_uhb"ޞh$h $hTf2 X*&hf"hTf2ʀ uhTf2j f\*&D$l$4$sf@8tD4$t$xV@SHPSV \$$Vt$S#K1D$0D$,D$(D$$d$sD$4j@HPi9 st$st$h"}t$h"}t$h"}t$ h"}t$th"}L$9\*&t uQh" X*&h&"}|$4tD$4Ph2"m}|$ gvVD$PU7 16D$8uT$Bg)QPR th"1@^_[]USWVӉ͋t$V菖 1Htkt$t$VSUQ[tGUVt$t$VWU^[9uVSW/ t'W跦 ZR W衦 1H^_[]W萦 USWV$$$|G8-t _2$D$ 1FD$h,"WS> it 1*&19t9At&9IuJuiu3$tHPh# AtPqhD"艛 늡,;A뀃Dtou&t$ mt$d,;$W$uQ 1t$hWV4 jSV $FWPP uhf}%VhiP>4 u h"jZbWUT$*&1l$D$G_HrY7ShjD$*P4 ft$fD$CL$fA37ShjD$&P3 ft$fD$f\$ $T$0 T$T7hjR3 SCZft$fD$fD$PSU3 $T$l$GD$x|$ hhjD$$P3 \$ $ sh"~ysh="nys h`"^ysh}"Nysh">ysh".ys h"ys$h"ys(h#"xsHh<"xs,hc"xs0h"xs4h"xs8h"xsXf|$rL$I"fw *&L$T$ t$"VRQPh"vh"h"j]D$f=111hjD$$P/ fD$|$<1fD$ $T$1h $1vH$t*&L$f|$"t"PuD$=ufD$L$IL$}1|$D$L$ txm214/Drt#E9uT$ЃDPh"su~|$ujmjPPC jt$t$ V%  VhiW- u h"D$(|$ u,$PD$D$,$|$ 1hSW- GG?t$>hSD$$P- G$0hSW- jl$UWf  wh"she2Wh:it$V, uO j.rhe2jcIWh:iV, u Cw:I8)|$""P$rkLPD$$PQ, $<1|$Vh*"st$kL4t4*&ho"rh"r48~1D=PqG9uh?#s4 D$4!4"4#4$4%PSWRQt$h"ir4(h"Ur444,40k<SWPRQPh"#r4`hA"rhf"r4\t hu"qt hz"qh?#4d6|$1A t$t&u/7t$t nu Qh"zqFL9Mt$ $t$qVKP$t$RVKhq"/Ph"hTf2r jiUSWV։1hUSW* jWS; sUPP( t'Sh9iP) tV$KĔ^_[]hf}%h"jWUSWV׉1hVU) jSU }VPP tAUh:iPS) uGPh"L1FSJĐ^_[]hf}%jDWVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Ph"o^WVh"|of>r1D~Ph%aoGH9|j]nn^_WVh":of>r91D>Phz"o 9} j:(nG9|h?#n^_WV$fGjRW' WhiV' t Đ^_h"jUfUSWVu }6hd"jA h"VW|{ Hw$*&f3f3ԃBu|1PP5,;8 f3불f3f3f3f3f3f3너f3f3sjhe2_f3S3=_2=f3u.1L$A AAAQj jG =f3f3f3f3f3f3e21O=tf3+/$3tchr=#V;t^=f3ukjjVzF ƅD$ PVbD$(!=<\$yB  e2u1PPVF Ɖx\$f3 f2=tf35f3PL$Q|E ƅ~E1f3VPS"D i)u5f35f3t$hd"h%"he2?k f2@t>$@$Ph "he2kڃ f2@ t_  =f3f2H f2;f2he2j$m  =f3xf2H f2;f2he2j^m:=f3,f2H f2;f2he2jMEmڃe2H e2$e2H e2^f2H f2!;f2he2jIl e2H e2I e2H e2Mf2H f2%;f2he2j-lڃu!e2H e2-xm2DPuWf2H f2;f2~ƒ te2H e2he2Rlڃf2H f2";f2he2j^kڃuve2H e2^?tЃ@Ӌ f2Qf2; f2~ ȃ t e2Qe2Vhe2Pbk=F @t5f3h $>f3f f2@uie2\$t VE1(e2%e2Wh $f31;`he21uf3e^_[]h!jLh+/$fUSWV$$0ihd"j 11E1D$D$D$D$$׉jh 1hZ"$VgQ~Hw@$ +&ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$j,;$ىY1ɉPXuG _2$T:-u"j9uzuI _2 u _2)t u <$u|$uM1ۋD$Ã<$D$ PtD$ $4u9>WuTWh"D$u5t뢍D$PWJu!Wh"Mhk"jJ$1 |$ $jSV} u h"P1u88V\1CHHf wy$`+&|$uhUÅu뼋ss PVh^"譂 |$u.jSU5  ss 豦 PVh^"v 1F $tCPpQ[|$t KP;AmPsT$Z|$Osh $z1F7h!%jI>PPh"hTf2 dj[fUSWV$$61hd"U赢 -j3-j3-j3-j31ChB"VWn e'H wu$+&j3-j3-j3Ńo'filj3뙃prvk3oaj3j3j3%j3-j3-j37j3-j3-j3j3 j3j3j3j3j3j3k3u _2)ǃ=k3j3u-tX1Ƀ=j3=j3tL$H=j3=j3=j3=j3tʉT$4Wk3jsX k3PeXt$lVUhH1 9rUh"\hH1)H1 @1QT$/u>t$|9A@1A @1I1vy/thO"h"jGFt$ D1Dh j)=j3u$PhH1蛤$PhH1u@48uT\=k3u=j3t@j3 j3t3D$ P6A1#$=@txUhH1D$ P6莤u6h $jE#D$=@uj3 k31ۉ  t1ۀ|$/uhH1h".t9U'r|/u (IHr IH9/touɉt$PVk3USWVT$juQ PD$1t$CHfw?$+&ss 5 PVt$ h^"| Psh"|>|$(5D1C,H1)=|5TShH1h "| t$V[1Ga{DuO|$u C(D$?Cj/D$ PVt L$)@L$D$h"Q|*T$CS(L$)ʀ</t ~/t/FD$щT$H1)rPhH1h/"t$PV L$@1@1=I1vx/u H@1=j3tD$PhH1D$PhH1cT$KP3Qt$31 u@T$(3Qt$$3q u.shH1hP"?{ CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH1hv"z 1Gt$#KPqt$1BD$ $+&=j3L$ QP T$ j3 k3sHtbffM {3Q{3T$ k3t$/D$ !=@8fush"yjSt$ Vt 1G)=j3tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=j3t$tjQ\{3H {3<k3tICPphH1-74sh"xD$ PhH11u=k3thH1sh!X VZÅc1G1o.8uFVe^_[]h-"h%"h6hG"h@"h?h"=m7h $h!%j?.hH1fWVt$$D$(H0JH(x,z H4x8J z@.G1PhH1l-thH1h"1Ft\=j3uSolW&t US. UhH1.u%,&8-ulthH1h"1FuWhH1t1F^_[]WV$ hWvM) t,$t'hH1<`thH1h""vh"hH1W$+tWh"1@^_Ã=j3tjvP(1V|$ thH1_t hH1h""t$vhH1q+thH1h"k1@^Ã=j3t jV1V|$ thH1W_t hH1h"(t$v$v vhH1IthH1h"1@^Ã=j3t jVF1PPh"hTf2PjuGUSWV|$j/SHt@Ë$hٝ%S`uGhd"WV][ X_2)ƃHt4u*j1h"WV[ e~!r8$ ,&,{4˃K~3LtgP{4믃st\vtcw({4듃FuX{4 {4${4({4m${4 {4Z{4N0{4B4{46uX_2)ފ 0{44 -5{4{4u={4u${4u {4({4,ttu'MUj M %jPEt=,{4u4PV̒u$#D$=u@"YjaEPVuB#D$=@tM19t<1jA ŋ9uUEVh $jb3PPh"hTf2MjDUSWV׉΀=0{4tj}$hVS =w6S?t)$ PQhm$WS&J94!?A ={4u L$QVЃu#D$=@` Vh $P1C؍e^_[]Í\$SW5u#D$=@=,{4u"SW芐u#D$=@=0{4({4>/uD$PVE"X$hSW W;<t?$ VPhm$hWHD$PW"t VQXD$PWJÅ0{4WV /PVBDt@\$L$/PW"Dt@L$ Q\$Su)D$ )=|\$= {4u=${4he2Wh"hTf2,K e2H e2~e2H e2he2É؃t9 t4e2H e2~e2H e2he2Jƒ߃Y={4u#D$=@uWBWXu8=0{4u WV#{4 PWQVQ$tW#1ۀ=4{4$5{4VPWh "*HhTf2jj h"9D$t$QVP Ƅ fDŽ$.$$PQr\$4$9|$ t#t$WP[$ D$Ƅ fDŽ$.$PQ$3$$3$ $3$$3$  WVh"f fD$L$TTPQËD$L$TTPQUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQPN^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP7^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP^_[]USWV |$87hd"j臄 jt7D$Phht@j uD$tL1@{4D{4H{4;u L{4t$41۽h"WVVP HσG$0,&H{41P{41@{4t{4x{4D{41P{4H{4T{4X{4h{4낃w{4{4^{4O{4@l{418{4"{4{4@1@{4t{4x{4`{4d{4|{4l{4p{4 L{4=\{4t \{4T{4{4{41V{4G{4{41C+T{41P{4H{4X{4D{4\{4P{41H{4T{41@{4T{41P{4H{4X{4D{4{4{4@{41M{4{4r8{4cd{4`{4J1@{4t{4x{44X{41P{4H{4T{4D{4_2D$=D{4u=X{4u =P{4th0"tP]L1=\{4u \{4{4 T{4L$$ ȉD${4 h{4{4 8{4L$D$ ы|{4 T$ L$u1 T$ ={4t ŋ$u|$u|$ t+uh{4j {4 {4={48{4tL$t*t,uw1 kL$t;t=u^ Ri K =d{4u==`{4 t/ (P !N =d{4u=`{4 t {4)θ\ =H{4u/ =X{4u! =T{4u=P{4m t" {4t1AT1U4<{4 ^_[]KPh"hTf2@ j7USWV΋\$=p{4 t1PSR ~jP1ɉ=|{4tW< L݉t$=l{4D$W<ÉL$ CHHf$P-&ks d PUh^")] <{4{Dt{T.u =L{4tw={4uL={4u%sh2"=1TSh"\L|$|sh3"<{4VWʼnى=l{4ut jSW" W9ÅW0WG0@8u ^_[]jh!%j#WVD$ qH1ftYT$zHftIf t$f tf9t=|{4uyDt,RQ{41f Duf u RQ^_fu1@fu1HUSWVL$d{4D$ T{4u ={4D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$P~ PSl$$h^"Zt$X 1@F F<{4Z|$dt~T.u-=L{4t"fu=|{4uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=T{4t-T$$L$(={4t-sh%j $W7$D$\l$t$0KjsmDžt={4tsh%j $Ua7jsRnŅtщ|$W/‹L$@D$9ʉT$@l$ UʼnD$<9L$<={4t/hr=#sl3 D$TPT$ 9щL$ 1|$PQ  à t$P"0 Ct$ P 0={4t +Cl$TUP/Ua ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p={4tD$|t$ |$ n{4ʃQPRW_$RPh!jV~5VeD$|={4t$ |$ tHVUUUȉD$|$D$<$$SWh΢#VU5U$t$h%VU4U$={4tDŽ$Mt$4t$ f2J f2;f2~у t e2Qe2Guhe2Q-3={4tXD>f2J f2;f2~!у t e2Qe2Gu7he2Q2L$D$ ρÃ{4T$9{4}`;L$}XD>f2J f2;f2~!у t e2Qe2Guhe2Q62f2H f2;f2he2j 2e2H e2 1D>f2J f2;f2~!у t e2Qe2Guhe2Q1f2H f2;f2he2j z1e2H e2 e^_[]SWV΃={4t vrh$c1TVO^_[SWV΃={4t vh$1TV^_[Ã={4tATPqhm$+ ÃTQh $|+Í` f w5$l-&f2H f2;f2he2j@I/f2H f2;f2he2j*f2H f2;f2he2j=kf2H f2;f2he2j%Df2H f2w;f2ohe2j|!f2H f2g;f2_he2j//1@áe2H e2@e2H e2=֡e2H e2%áe2H e2|밡e2H e2/1áe2H e2*USWVl$(}={4tE G={4t={4t(DGh{41 {4Í4^69L1} ^_[]{E ;\1~*P5{4M tM \1{4{44FMt%$Q  Qt $ B$Iu$ L1șƉșD$$t$D$ D$|$1ۋt$={4t( {4 U tt$ ;4$}Z;D$}El$)šf2H f2;f2he2j {-e2H e2 MuC;\$rf2H f2~e2H e2 he2j $-D$@D$;D$ ^_[]jLUSWVt$~={4tF G={4t={4t(Gh{41 {4Í,C L1-9} ^_[][Gșljș|$$.1E  E;|$|6f2H f2~e2H e2 he2j ,1V ={4t(41;$}D$)áf2H f2;f2he2j +e2H e2 KuGm=f2H f2~e2H e2 he2j f+^_[]USWV|$={4t_ C1ۃ={4t={4t(C=h{471F  Ff2H f2;f2he2j,*e2H e2, +N,f2Pf2; L1} 0;f2(he2j *;~&e2H e2 "e2H e2 he2j E*1W ={4t(4_ŋvf2H f2~e2H e2 he2j )^_[]fSWV|$x{4W!t pSP> t81PWV裲 Vh $C$VON ^_[h"Wh"j= USWV$U4(F$$1 |$1 9$)덄$PSUD$PH` tXǃt-tat$b ?tL$T$d$.?T$O$E1 $ ;j2r9vL$?T$$$^_[]SWV ΉRQS_ 1t4u t|uHthe2PjS譹t Vb lj ^_[fUSWV$$3豯1hd"Wec W8%$ D$D$ h'$SV/ mu05,;=tChP $WBL 뼃pu D$ 뭃u _2,uk5,;h"jA #D$=@u.$VtP 9r*th"jx|WP. ty/t AƄ/@L$M$D$S|/uH9tx/@tj/SBޅt@V`L$rSh">1A $'@PVt$  ٍ$Ct1@$Mg4$`{PPh"hTf2J j@{4USWV։π={4ujV5#t~VWt98uR\$@SV+dt{SWd9Wh $1ۀ={4VWh! VWh #ؠ w={4u=jW"uWh"H#D$H=@V={4/jVU"D$@PVbjW,"uD$1Pt$LD$2x d"t$D$1Pt$\Q1Pt$`oRVPSt$D$BPh$"hTf2#D$H=u}1PPW/ t$HhV \$D${4{4V,CVh@"\1C؍e^_[]ÉVh_"hTf2 e2H e2~e2H e2he2MÃtH tC e2I e2~e2Pe2he2 e2 tuÃ߉1ۃYM@Vh $苞'${4S4 {4t$|$SPt$ } Å11S5{4t$ 9x߉={4t{\$(t$,l$( ط%$$L$$D$ l$ |$T$ fT$l$\$l$T${4RQPVSt$(t$(hs"hTf2Y$5{45{4t$  Å6|$W\$Skt$uVhn"DSD$hL$l$JD$pBD$tB D$xBD$|BRWtVh["t$\t$\W ^8tVhi"辜#D$HD$Ht$\$ \$D$t$Ph $膜V)tVhP"kt$S1VF5{4t$t$ЋD$HPWPtVh}"$WNt8-t$Vh"ۛ W"tV|$W(t WhP"H1ۀ={4DVt$SWVP׉CjWP@ t$t-h"h"7h"h"?1@^_[%tPh"h"7 jWP͙ t$th "h "%tPh "1돸"={4u""jWVhok%Ph!SnSh $荚j# "jVhok%h"h!WnWUSWV8`1t P`11{4{4{4{4|4X42it$L$-&hjV^ `1iVh_"0jG`1hhV `1{4hjV `1Vh"0jͳ|4u11`1|4d11t~|4ttja`1|4l11@5`1|4l11@DgVhy"0jE`1t|4tj`1 '5tQ`1h |4PܹxC|4%= ts=`=@5|4h"j許 5|4h"0j膲5`1K`1{41HPhm8@5`1 1ɅA |4-h|45d|4{4ˋ 2ud'5h'51v$-&=d'5=h'5>1jSS5`1K!ƒu8f|4-h|45d|4 a1H 22=t|4Gt =}r t~=h'5h'5q˃u#=d'5tPWUV4 ~jWUV tw߿(=h'5u h'5~~=1|118^_[]111RSWV։ωSwx1D$t,t\$W34$t$ctjt$Z"1@jt$=#1PW4$t$jSVVx^_[h# h.#hA#j$VP=`1x=(5 (5t}=|4ut=(5tD(5HQP~'Q &X41{4{4$Pj 5)5h"5(5@ 5(5={4uKh |45`1Ƶu4#|4=u"h|4 d|4u5|4E!{4=2w=(5t1~ jP5`1:1~jQP裒 (5 (5t4=|4u+5(5hgu"躭(55(52`1={4u {4tP1{4{4(5t1 (5 (5t'=(5tG(5HQP~Q X4Pj (5(5tZ5)5h'"uC5(5 '5'5 u t'5p'5jhQPRPh,"V_1V5(5&5X4^USWV=2e2tTf2D$WzO+|4 |4 u1@1ɉ$L$=(52\$5'55'5hP#hSY <$t$W5'55'5$h]"RPWh[#hV $VSh#hW }WPW}tf=4t]t$5 454hP#hV $Vh4h#hW WzPWj 2u_5X4<$t$WjV#$h*$RPWh[#hS9 $S]Vh#hP (5D$=1OX4D$ P#D$5'55'5VSP $5t'55p'5VSP t'5 p'5 '5'54$t$VPQV$h]"RPVh[#hSl $S]$QL$Qt$Wt$$h&#hP8 $t$VPVj "$PW5)5h^"t$De^_[]V~=|4u(=|1~h~V5`1} |1~^V|41=|4uE1jVV5`1%xRP5`1 yh9"0jd 1N^Ã=|4uhY"jI&1={4u5)55h'5h"j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSU; ~)t^_[]WV5|1=|4t$t$5`18 ƃu*~3{4;5h'5tc5h'5tU{4L~ {4?5|1x51h"j, 1/51h"0j^_USWVP5|1|$l$1ۡ`1$WUt$C ƅ~)tދD$9u|4{4!|1|4Hs-8 uc1h "Vh5|1:~\%tS1jPP5`1x})RP5`1* yPb8tD8t:8t0Ty:8t 8u |118Eu |1xt |41{4=|4uh5"j腥`tx>(5Ht)t h"51h"jL 1%h"jF51hj"0j^_[]USWV1N=|4=|1 2uh"j٤{4<u{4-|4sg{4t|41jWW5`1'xXͽuWURP )jWU5`1yQu t#{4@{4=|1:h$#Ff@Phm5`1v x|1hT#j1^_[]USWV \$$|$ l$(1uu5|1|41jVV5`1 x\D$ljT$Ӄ=|4D$h|4d|49L$ujRP5`1x+D$T$EU,=|4u#h#0j |11N ^_[]USWV~=|1$(~$$~|4t)h#j蔢I1u)1ɍ|$h~W5`1 0|$fGWhm5`1誾 fD$D$Whm5`1 \$h~S5`1 $h~S5`1 GfD$D$Whm5`1 |1t1<$uzfD$D$Whm5`1Խ f $ h'511F$$~jQUR kы$ʉD$ ʋ$$~) hZ#b1F|?1jPP5`1nxg)y11=1|!h#11Fs1ohw#RjRP5`1!1yKh9#.hW#"{h#oh# ch#0jB 1N5|1~^_[]fD$D$ D$Shm5`1z yt$h#t$h#0j٠SWV Vh)5j yh#0j袠 jVjc yh#0jv 1N=|4|4=|4=L)5u5)5h#趟=|4hl1Whd1Wio |4aX#tb# 1=#t#QWPA S8 2#t"P5)5h#h#h #hH#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5|45|4h#sWhy#T5)5h#Ah#4h #'hH#<=L)5th#j{51h#5)5h#ҝh<#ŝ|$h Wf|$.|$t+D$5..L$f tW= r@h# hL#hh#Y5)5h#Fh<#9sWy\Wh#|4|15)5hk#(5 ^_[h#М|4t P) W}|4t |41|4|1h#j|52mtt$11Hfhh|4>th|441hr#0j臜 1Ht$Zyh#0jX 1HVt$V)uLVh#0j*^\SWV|$$WJDƃu[ 1~tHNtt 9 tu/PWCt#D$=@t 1N|^_[USWV1F(5PH{(5P kj Ɖ+T4Hw> (5SPh4Q@ @4$ D4L$QPh4\h4Cjuh4[jh4^uH=4/u+-Bu"4PaPh44P-j he2WVh4M<f2@ub@4H4 D4 L4QP.t (5P(jh)5j xsZ1e^_[]h#0jՙ USWV (1x&,1kL19|׋yM1II1\41PQÅy19}WDu=2h #j.hh\4OÅy1ۉ9|(1x(,1kLSh\41y݅u=2teh #j迗\41E$sVh]4\4PLh )؍\41Eh? #ji1IkFL1(5Sh\4#1ɉ^_[]USWV D$(5xGD$[4$1F1\4SQ291C(5h\4h4P$ (5Qu*D$PUh\4Q8 \4tu=2h#j耖t$h]4h\4)g $W1CttUtB:x9u=2tFh#j,Wh\4Q19uhW#j1H ^_[]h}#th4Q<t X41h#USWV1C(5PH(5P yj|Ɖ׃='5t/52tUh#0j4 e=(5t Rrx7t$t4(5P(jh)5j lzbV1ۉ؍e^_[]Ít$\$D$T4Hw5 (5VPh4Q@ @4D$ D4L$ h4kWeh4duy=(5tSh4=t^(5 (5tSh4=h4Ujh4Xt@h4Em@4H4 D4 L4QP=4/u+?<u"4PsPh44P?d (5 (5tSh4< (5tp(5|NPWt$h4)6Q=(5(5D$L;4D$P4Ph48(54t@t=(5u Pl=2t1T4Hr@tZ tUh4l'9D$X;4D$\4?uD$Ph4$Ã|$=(5ut$h4Å(5VSh4P@ =(5uSh4/!؃=(5\$C=(56D$(5HQPQ (5=(5D$L;4D$P4@4H4 D4 L4QPDy h4j=(5\$^=(5Q(5HQPQ D$L;4D$P4D$X;4D$\4OPj (5D$u@4D$ D4L$ QPp4x525(5Y@4H4 D4 L4QPh4ji\$=D$L;4D$P4Pj X(5USWVj/h4^1Uh4/t>54h|4U /tOGh|4WUh4h#jjO1N,K|/t1Nuh4h#jj^_[]SWV=(501F (5t9t71h#jێmQHb(5P R=(5t i<(5x t `m#(5 (5t#5)5h#5(5 (5ujh4^t(@4H4 D4 L4QPu1=(5th4hxuth4ly(5P(ljgSW, xa(5 (5t&=(5t5(5hgu"2(51G*ƃuejh)5j? ^_[USWV $(5xu d?*1F(5P,(5@0D$ jsD$T$=(5jSh49]jh4Q$=(5th4~gh4+th42dT4 w's1PP54 $jh4Pƀ=4/u+4u"4PƸPh44P\ =(5t4$h4Z' (5t:(5|Pt$t$h4s.Ph40(5X4h4T$t8=(5=(5(5HQP~dQ c(5L$Qt$4SPD ƉPS?&=(5tc=(5tZ(5HQP~3Q 2Pj .(5Ph4%dPj (5D$L$ʃ|QP  D4@4ʃ|QPxnh4*1C@TPh4Z% 54h#0jh48ch4)t (5P4 jh)5jr =(5tn)11Fe^_[]þ4PV$Vb뙉Ph4$뇃=(5t cxIx(5PHx11@USWV $$h 5(5S} = u$ /,4ŏ4/t EƄ4/FED$P5(51#D$=@`1Gxv%xmlxd=(5t exRh4!(ttjh)5j Gm'15(5h'#j 1GĐ ^_[]5(5hE#0j҈5(5hl#뻸 )D$ )D$$h4 X(5 (5tV1=4/4t$PU ;D$vh4h#jN _D$PS0E4WT&W^jh4Kt'h4K`h4&'VSh4NR xơ(5 (5tD$Ph4 0I=(5t5(5h4+(5X4=(5tEh4C=(5(5D$D;4D$H4h4{T4Ht 1PP54 $jh4#Pt$h4 Wh4D$P;4D$T47wD$ Ph4;(5tk=(5tbD$D;4D$H4Nh4h4^^D$D;4D$H4D$P;4D$T4輽54h#0j蕅P4WWWh4!Ph4=(5e=(5X(5HQP~ Q Pj (5 D$D;4D$H4Uf`'5`4d'5u (5@d'5=~| h~Phj #thPh #j蜃1Hãh'515|4y x1t'5p'5 `'5d'5ʉx'5 |'5`'5`4=2u=d'5t4=~| h~Ph #thPh #j1H5|4 y x`'5h'5x'5|'51'5'5`'5`4~1h'5USWV=(5th( #j艂1I^_[]Ã=d'5h'51ud'51IxՋ=x'5+=|'5|$\$51UVSW~)9|11UV$)݃`'5|J|'5 1x'5~H5h'5P|'5|'5;x'5r֋ `'5 1x'5|'51)ȉQPx[`'5Ɖ5|'5 1ȣx'5)='5'5 h'51t'5p'521hY #jWV1N=1=2uh #jy1'5'5515`'5Z11~9} G{u'Ph #j~ xI1='5='5515`'5~ `'5 |'5'5'5 x'51^_ËD$L$|'5)ʉ|'5QPR USWVu ]1D$ D$ D$x'5 |'5)ȉ9؉| |'5)։ h'5QPVS)ЍT$RPQ 1ID$L$ )'5 '5|~ x'5|'5)ЅqxUtX x'5|'5D$9ؿ|‰|'5)ظ|D$L$ 1H1@D$D$e^_[]V1='5515`'5~# `'5 |'5'5 x'5'5V1xC=(5t/x&5'55'5515`'5~'51 (51H^V|'5;`'5v*5x'5)QjP跚 5|'551^USWVt$'5 '5ƒ|]; p'5t'5}O1h #W}=t'5=p'5$-`'51 ( x'59)1 -`'51ۡ11PUK;1tS1t'5p'5S`'5 1x'59)QP륉p'5 t'5Nj-`'5S5x'5Uҙ +|'51)USp'5t'5`'5 )VQS薙 |'5(5Htt(51O1^_[]É-|'5USWVP\$1~cl$x'5$5|'5<$)"513x3ǡx'5$5|'59|WUV 5|'5)11H^_[]USWVPD$~Z\$ x'5 $5|'5ŋ<$)Dž~9x'5$5|'59|WVS芘 5|'5)D$^_[]ËD$)USWV\$ l$؃|~x'5D$=|'5t$)#514x\ơx'5D$=|'519|VQWD$ 蛗 =|'5)Éظ|$1H$$^_[]USWV$  $x$|$D$|=(5t7P$Hy#\$ h"0j.{$|r |'51Nx'5)ȅ51  |'59غ|PQ$肶 ~|)à |'5 |'5ظ| uXP$膁$3D$8$3L$4 $ h #jUy hx$ h #j5y L:$ h #0j z'$ h"0jy111o^_[]USWV$$x$|$$D$x-D$PQ~t"蒱4$hD #0jny L$|L$1$p0L$1x'5 |'5)ȅ\$^ |'59|4$ST$ RT$RPQ$P~R|$ =(5 |'5tP;CJ |'5)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=(5t% u!$9$t4$hl #jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=(5$4t1PWd~y#xh"0jQw1HD$sD$$P$<&~4$t7VhD #0jw $l$ l$\$ 515`'5W萲 lj\$11ËD$ 9D$D$D$`'5}$4$t$ L$ QL$,QWP$PWP$@ ى9u1515`'5$< ljޅz11 ͉$03x$3|$ uRD$$P$8|$3D$\$3L$X $0<$\$t*Wh #<$Wh #jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]f$0h #0j8u1K<$;<$W$4h #0j uUSWV|$7t6|>/u/1N='5MWhM #js '5.|$tjh W蚰 V{ $='5'5_Sh #VPV$ƅE<$8$S x<Sh #P$ $yw0=(5t5(5 r$h #Vjs15'5$" $轫Qh #0js1N^_[É负USWV|$?/tGj/PkƳUWu/Fj/VTkƅuhW=(5t$$W jWGy3UWYu%D$ PW)jUPWV/Fj/Vj1ۅA4t*PW}t1K#D$1=@ۉ؃|^_[]/WVD$t$ $Pyu~,Wh #0j r$tDPy$h #0jq$1 1$'5^_USWVD$Et$$^߅tP^y蒩Wh #0jpq=(5t<$8$W 1 (5tt)$($u7='5uj'5P'5'5!UW2 2t%1PPL$H$X$T$W$tJSW׮y!諨SWh #0jpW"$ 1$'5^_[]WV1uA|$ t$t$W t(5(5Nn6Why#0jp1N^_Vt$#D$ PVt%5(5nVh#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=2t =2D$PVtmVh2#0jKo_=2u&D$DL$HL$$Mbl$L‰T$=2u'D$PL$TL$D$ Mbl$X‰T$WVt68Nu} u&WVuƦVhN#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVt%#D$=@uVh #jm 1HjW |^_[USWV׉L$]D$PSOt6St$nth¥0wwS tՃ} tL1@_1=(5uTG3D$ 3L$ uKG3D$O 3L$ u9t$hQ#jUl 1St$h#Vj6m1He^_[]ø#D$=@u%h %SptS0S} DSho#0jl댋D$$u1@Ë $jPUWV}wPV1@xN=(5t1A$$3L$ $3$ u*0$3L$,$3T$ uVhO #j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $-&5)5ht#uu=(5tlD$PUuZD$ !=uHhWU ƄD$PWuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUUt$z 4$U/轢L$ t uu$UFD$y)Q8=(5us<$8$U xZL$ A$Yt$Uh~ #0j3j1H=(5t2<$8$U Uh #Wji1ɡ(5tt1Ƀ$ !($t($t$$5)5h'"jUxN1=(5=2=2Uh #Uh #j7h 1OD$PUx=1$ ?#D$ PU1@=(5u;L$ ($/t$h #0jh$ PU1@Pt$6UK21 2t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW1x1K=(5t މ|^_[]ø#D$=@u5h %W[1EtXWyĉ#$t Wky5(5e #輟WU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5`)5\)5 X)5T)5L$T$tI AQP DUVP 9t_L$ xZjPUQ@ҋT$0y@oEP| Džt<$\$MQVP  D$8+$T$0)+|$$>h#jJe*Ot$8h#?t$8h#0jf1O ^_[]SWV1|$tQ\$1OjWWS老xjh'5SL y%##\$НSV0je^_[Vt$ xFPi=(5t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(Ơ ~H111Ã1T |A9uV$P$(葠 ǀ$1111틴$(3x$3|$ uUP$(kxLX$3D$8T$3L$4 uF1VVV$(xE$($\h#Sh".h#j%c #*$(h7#0jc1N|(^_[]V=(5t'5=(5t'5=(5t@'5='5uh '5t01x&=(5tDyh#jhb1N^WV'5tP c1'5'51N'5t '5tqA'5uj1e2H e2~e2H e2he2赑tN;41u1tB '59G= |+'5xx'5 PW1t-'58j5'5h'5Z '5&1^_SWV|$tR?tMj $ tSƋ\$WH~ </u>ۉ^F='5t%'5p!h#j`1Hh#5'55'51^_[á'5t@=(5t'5=(5u0=(5t'D$$u'5tjP5'59n WV=(5tB5'5t;11G~u)uh #jA`6hX#hTf2l vu^_USWV ='5u%'51N'5u'5}$ $ $L$Pa'5t#HHf w=$-&ph##"ph8#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p艛  '5qh#0 phV#p j_e=(5t\@PL$QL$ Qpp p09Bx8'5jjt$t$t$t$phr#p j[_ '51N1 $.&LJ$Ƅ  LJ$LJ$=(5twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G '5 VqP{  '5VqP{ 5)5h'"蒎1u'5@e^_[]fUSWVT\$tl$h=(5P($貦T$L$X$1V8$9V<$d"d"t4$tVjQjRD$Ph#S $u2@$%  RPh#UhX#^|$x$h#SXEPD$Ph%SA$Hs Uh#u# Uh!S  SZX^_[]Sj USWV@L$E\$CD$PSf|{3jB96#|,#L$QPj@t$Vpue^_[]SWVT|$dT$t$X$hS($ԤWVSh#t[d^_[SWVt$F=u1H|$Phbt6t)G\$QjPSFKVS,[Gu܃^_[Ã^_[[USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V(5~1F1u(5h#j9W^ÐSWVL$D$t$|$,;'5t'5tt\^_[C}\1KZ'5teSPOti:tdx:_29}j ,;@_2sPVW hV'5:-u/'5È'5n'5'5`S6hB#_2=S6hY#hTf2t?^_[f1Ã='5u1á(50h#jV '5t"H '5p0h-#hTf25)5ht#$u_sUSWVd|$|j/7O)5t@l$x)5ht#P)5t#1C(5L)5D$ D$1D$$jh1h #WUHЃJw$.&;t$$@$4.&,;|4묡2t 2(52r2t c2P=29#\$(5! ,;kd'5 d'5|4#|4$1(55,;R2t 22\$(5t|42e(5(5L|42=(5.(5 Pt$ * NL$ ,; '5$LF|42|42|42|42'5,;'5|4#(5q5,;[Z 2@K 28,;8-u x|4D$ =h(5u (5(522|4#(52'55,;WO (5L)5s)5d2U(5h(5?|41@D$ )2 L$ ƒ ʺTf2te2 _2(5ƒu 9u , l$D$kL1(5'5 )5!1$jh81h7#WU/~HЃJS$/&41ƍHw$/&)5뫅!,;|42L)5||4#m(5@X(5ˀC(51|4#"(5 ,;@Ƀl~mtKotRpd(5SatDeJ1A (5 (5 2 2 2"2(5 2@{pe,;|4SH(53 ,; '5'51ɉ5,;"](5(5,;L$h jLjh1Q衫(5bl 5,;Vhx"V&14(5 (5@5,; i@(5|4(5|4$(55,;9i ,;E d'5N(54(5 $! ,; }(5(55,; =(5@(5 1%=2(5e2 0akG1A11|$<$t(5D$tGNutNj]]h#S }1t[h#S|uE'5'5j5'5S^ 1AL$y#$]1'5<$D$hr=#S~|l$\$thM"S贰Džu e21 ðt5h#S-|u3'5S I 1urL$tP؅uAJjh#S&{ uP'5D$t t P CP-ىQ ؉D$1ES#jt$ S 1AL$"1ED$\$t t PX hr=#SE{t Wx=l(5<$l$S|$;'5,21ɺ G1Fmفt#u41A 02<1A 02!521ɺ.1!# $ 4u (51=rnFr0s9-_2D(5PM_29}j4NxP_2@_21_29 1VV4b x_2@_29| Qh#j?H 1FPh'#V(H V^5,;hj#h#jHj85,;h#hh#5,;h#jG Tf2Vh#JHy$51WV 51WVլ Vho]$H5,;hj#0h#jjG!j蚣mhI#jCGt$hJ#jjP$t,(XN8@tUjP$yFD$8Uh#W)x1D$h.D$1$hr=#UwthM"U4Džu Je2tkðtAh#Swtjh#Sv tj1ujSðuhr=#UPwt Wt=l(5Uh#l$}$l$h#W w]tjWB\$rt D$W1|$ td^_[]á|4t8uhI!NO|4t8u|4N!Uh#j E USWV|$$UWUVEbNJ00ht$跩tAtZ/UVUWb488ht$vu}t$h#0jxE1H1^_[]á'5t H '5hTf2h#Dj耠WVTf21FWVhh#E>WVhh#1>WVhhW#>WVhhQ# >V USWVPˉjPQb փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Q&$1>tj,V;Åtj=V;tmj d tdAE0H@'5='5t d(5sd(5uhq#j6B1O^_[]h#h#h#j B4$e ɋD$L$01JsWV5)5h#hTf2  t(ο#Ph6#$hTf2 !uء\f2H \f2~Tf2H Tf2 hTf2j ^_SWVPωPQt4Ƌ$| tC$S t'ǍCPVW7^ DG l(5 l(51^_[USWV$t%t_݊M\tS8uEEh#j@Ej腽 UEƃjSV t3l$hUVP,WUh#j\@S $EE<\t:uCCUf# $AStRC1fGt,PtStgtstp1B ы$J@u $A=p(5tZt(5HVV4$ Wh#ji? 1H^_[]VV h# p(5 t(51V4$} Wh0#USWV\$tK;tFjӻ tLNjl$1pSkG woD$G95x(5t%|(5x!hU#j>1Nhj#=x(5=|(5^_[]WV5x(5t;11GFu)uh#j^>6hX#hTf2艣 vu^_USWVx(51 l$$=(5Kt(=(5t!9t)@tB9uKKt8?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=(5tGtlD$@1G8D$@1D$\1GEt$ hf#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh#j59tNjE|$tDD$@t:$t$PVh#hTf2Vh#hTf2 $t+Et$h PV)S 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVhL#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7#(5Tf2WVVjuD$L$ L$$VjVjyuD$L$ L$$VjˏVjPuD$L$ L$$Vj袏Vj'uD$L$ L$$Vjyh5#<(51)5 )5)5P )5t$,NFF FF |$WVjb y|$ujWjb WVjb y|$ujWjb WVjb y|$ujWjb WVjnb y|$ujWjVb TWVjBb y|$ujWj*b (D$,WVj b  WVja 0=2t3i=)‹1@?9 tR=)5t3<$/>3i=)‹1@9 tR )51QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=)5ujh=| )5#t\u#uGWv tjxGj jW  />3i=)Ë )5,t 98t#@u $j= t!8h $1(Wh#j9- h#h#j!-^_[]USWVP|$1N=)5ujh= )5#t\u#uGWV tjxGj jW 菢 />3i=)Ë )5,t 98t#@u $j@ t!8h $1(WhG#j<, ho#h#j$,^_[]USWVt$totij/V謉1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉh#j+1H^_[]1j] ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjS CS>tKt^?tYڃCKt6C;C C})VWhQ#j*S h#C= )5t$$)5X Vh#jW* 4Vh# )5$)51Wh5#j** S腷 ht#}VQh#j*USWVPϊۉ$tsxm211JDhu.e[YAuۉ4$%JÅt>VV,FN4A1RI113WBV1J 4$$ 1&G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSKV!1҃ډЃ^_[]fV1=()5u*jh ()5uh#j1(1N^USWV ()51Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj^ Ël$EP  $$$KCs{ D$C $C1^_[]Ët$ h 3PE  1$$CHC1FwCE34 S+ S h#j&1NwUSWV()5t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6jf tx@ LHDh"#jY 1^_[]USWV4)5CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXjT J1ɉHT$, $$$P HN HF F t$1 H;@u 4)5-<)58)58)5-<)5Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@8)5=<)5l$T$s}ډD$0! umщjt[<)5=8)5 tIjA t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph!#j  h!#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=@)5u*jh=H @)5uh&"#j1N^WV@)5t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(輙 t^t$tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<Wݩ h\"#jj ^_[]USWV @)51Kt$/>3i=)‹tjhr#W@ t1H^_jh$#W@ u(=L)5ud)5ud)5h$#jjUSWVl$hUh1N\$1h$WS, K$ǃ4$Yt"Yh PQ&. Ǎ A/G<rH )UhX)5hT)5o   Ph`)5h\)5G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPyEtQQP  ƅ(8$VP¨yElQQP˳ 1D$@$$$$$ȃJ-σwY$\1&<2ǃ$)$QgtxuD%#-u~t6hM"VfDžu':0S PVh&#jHe21FUWt5Ë$rt$Vh&#j$_Ft1N1e2t WD/^_[]fVjh/a"g=xKh""P3,p)5t)hM"V,t)51u;5p)5.V==(5th/a"hd'#j 1H1^WVPD$$|$t (5t$(5 (5t"=(5thTf2j 讄(5Tf25)5hT"Wd 4$VWh Wj s ^_Pp)5t$L$T$ $RQPh 5p)5rXSWV|$1N|5t)5t,\$OPWSx t;j S51t^_[SWVPD$ $|$t (5|$t$(5 (5t"=(5the2j 譃(5Tf25)5hT"Sc 4$WSg ~V̥ Ph#hTf2c hTf2j N ^_[fUSWV} u7hd"jM \$1h $WVn LtPt߃95_2D$h*#ƀ8/h'#Vjush#Vjua$PV蓦tKD$Ph %|t4$3D$ $3L$ u$3D$$3L$ t1PPWƅu j02V/he22f2@uj?Yh!jGNPh'#hTf2b jYUSWV$$6hd"jʠ 11Ch'#VUm e~%q~3كrtރvt_x)5ŃV.PtrكRtwftAi|)5)5뒃Wt6duqx)5z)5l|)5)5W)5I)5;u_29|=|)5u 1Ĉ^_[] D$hx j)$D$,$S\( I9v9/u؃@]9v8/@tj/SXt@À;.uCt<.u{t0\$u h%(#5~C\$)5EHu]j$8u )5PWjp)5a$8tӋD$t$ VW" )5tRtD$W9=|)5uy38tso38?tie38t_Wh $Htj胡 PWh^"H} +D$@uDx)5u;Wh(#})5;;=)5uWڀ=|)5utV/tD$%=@t/==)5u uWmWW |)5 )5х ˉ4=)5u Ő=)5t@jPt$ u h'#7Pu18VNjGHHf wO$1&=|)5WOwP"{jWVO GG \=|)5uWOwP:GHftIfgft9G =|)5u Pf PW}G  GwU|)508=|)5uG ?tow PUh^"z c=)5uO1zuSwkt)|)5t c08t1Y08?t'O08ut/wh $)5VDž6=)5u =)5t)5wwd5h!%jcAww  PVh^"jAPhE(#hTf2[ jR)5USWV΀=)5uLVh'#hTf2[ hTf2re2H e2e2H e201C=)5l$$#E=jRT^.8D$Pu?=)5uvVh'#x1Zhe2v%Ɖt9 t4e2H e2~e2H e2he26%ƒ1ۃYÉ؃^_[]ÍD$x d"t$1Pu譌1Pu VPWSD$Ph'#hTf2BZUSWVAӉ΅:#K1jhV1 $ǍD$PW.D$3CL$3 D$(3CL$$3K #D$ =kD$W11PPPW D$$h PQ KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PW6/ D$L$D$)T$T$ 9D$t;$SV)5Vh $),)5Vh $W11@e^_[]l.W0u1PPPW uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW/. D$L$D$)T$T$ 9D$t1-W/1PPPW  h j$P KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW~- D$L$D$)T$ T$9D$t-W//j1PPPWY Th j$Pj CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW- ;D$t$$P$!P L$)L$L$L$ |$D$ h',WA.|1PPPWk  fCXK\D$L$ȃ|ohr \$9ËD$| S$PW+ 9D$)؋L$D$ظL$|t+W.1USWV\$l$UEtMƊAuA)k')t*5j襹UԹGG SG)5<)5 t*5t^_[]Ã=x*5t^_[]USWV\$tKƊAuA)k')Ƌ,)51Gt?uS tmt&uSr u4)5jVJ1^_[]ËD$t @ъ@uA)k'))5WVt$ >tVG t|$u G?t*5w{ w{ W{  t*5u=x*5t^_WVt$ t*51<)5t)5VPs8uG'u t*5t^_Ã=x*5t^_:USWV|$tWBuA)k'))51t(l$sWtu tC uމ^_[]jt$ }t@1ËD$L$ pqSWVt*5ƍ1Pu1 )5tQ:t @ C'u9 t*5u=x*5t)h jVW~R1ۋph~(#*pb52HQPP&2Q C9uW}^_[hl(#WV11 )5t))5Q:ujPuFȋ G'uƉ^_USWVj258H 25(11C}t$Ej=Pt)AQUkh(#52)TjUt_Uh~(#)w842HQPP^%2Q 25H 25(S Uh(#52( u1^_[]Vh"tauj425t$1Pc ơ25H 25@u1^fWVP5H*5xm2DBuFA&ut t- @*5]$1&NF밉jWV@  T*5P*5 A&j@*5X*51D>GA&uGPFP*5WVP P*58^|~u$PPh(#P~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5H*5^_ÊVF|uܹո ѹ Ǹ É)B$:@BA&uVPQh(# fUSWV|$,t$(St=@*5jLVPt:xIuxNt@jLPj V/1tE@j P)=@*55D*55H*5"1,=L*5uƉS+^_[]ù')#V=L*5)u ^5D*5Qh)#*WVd"|$ |$wL2 P2 25>t'F 25Q25BN@>vuڋ7 25Q25t @뭅+L2@P!575VrƉRPh $$ 1 ^_USWV8׉ˋ P*5T*5D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh!jVGjVt$ 3' USWV Ջ\$$St$$tƉ׃=L*5%up1҉  ډD$$=L*5&uU1ۉ D$P*5 T*5ME \$$L$SPy t D$$ ^_[]ùC)#SWV֍Qȋ\$L$|$$\2&  u !ڃ SQWV%L99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹)#)#)#wSWVP=75X*575Q}*Ɖ=75=2ttxt>u%1ۉSPV Ɖ9u$8t*8u+$t@A& t$@u^_[ù)##^%USWVPՋ\$St$gƉ׃=L*5uKh$P*5 T*5MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաL*5HwSjP ljաL*5uND$P*5 T*5N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THP*5 T*5N"ىWP1Eكra$"ى=L*5#ÉL*5݅~hL*5 P*52É׃'1HP*5 T*5NLىWP1 1P*5 T*5NىWPÉL*5LP*5 T*5NىWPe$É׍EكwL*5|$4t;~l-L*5b1A1Ǎt$WSh!jV+BjV5P*50't1I1@1l$QPh!jUAjU6K! ؉^_[]ù_)#TQ)#Jz)#@USWV֋] $t$ơP*5 T*5L$ D$T$uPV֋=L*5Ww,E&8E&}uPW ֋=L*5ȃ}tً$VPt$ ֍GwE&;E Qȉe^_[]fUSWVb2$D$ h)#d=etuD$ j250h\*5GVSK?SQ UF @P蠨á\*5)QPST \*5)١25pQ9V PS'$jh߫"$ƅ<.u 1~.D0t/ua$Ph %tGPVt6$3D$$3 $ u$$3L$3D$ 1e^]Sh $%t/h $u258Ltj258j*5\*5uj=\*5522f`5\*5{2HQPP2Q 52S2@u1[h*#[0} Ph*#Ah*#7SWVW迠WPyu2\$V]d8"u6W荠WP[ytV<\*5V!^_[Åu 0U} Ph*#j\*5tjPh*#. h*#ÐUSWVD$ 2fa1Ƀ|$‰tpыLh~#S$th"Su 1t$.4NJ]taM\uNEU\rw$2&\0u!11ЃwxAunjt$>2HQPP2Q t$.PN    ȉš2HQPPS2Q<$t*2HQPP2Q 522Hu 1^_[]ÁfHh+#jfl*5uL$ p*5jP@V=t*5t x*5K15x*50ppp VPjY 9505t =2ujVxV^jpPT$=*5u *5D$ $1APVx*5t*5t1It$aVPL$T$ D$$PD$*5jWVP|$t$D$$ 4$ WWV׉ΡX2t L29ty u hL2 =*5*5u轶PhT"h`2 =*5t5*5hT"h`2 t*t$ Wh`2 x4h$h`2xV=y Ph $h`2 2HQPP 2Q h`23 ^_SWV|$t$\$ SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$7 4$w^WVt$ |$ WY^_PT$D$ $1IP>XËT$1It$)Vf2&T$ L$9upu'0fuQhE%j h|*5|*5@^1*5*5*5*5WV|$ |t|$wL2 P2 25>t'F 25Q256N@>vuڋ7 25Q25t   @*515+L2@Pơ*5PV *5^_USWV\$0t$,|$W輚575jV j j=82thƉ؃$1t7=2u.D$0t f $uQVi=*5u"W诚j莶=82u11EiWSu *5D$0u^_[]jUSWVL$,|$(206̓Vę$3&Uw1ۀ=2_=*5Mjw1ۀ=21=*5$=*5jwH1ۀ=2=*5=*5uQ= 45tfjw1ۀ=2=*5=*5t  u8V#1tu *51l= 45tUW_j\$0SWh a= 45tWD$,E= 45tt$,WK_= 45tt$,WE\$,SW= 45tRUW= 45t;UWyPht,# hL2 k= 45twww. *5@jw1=*5*5 jwa=*5t *51V蠗VeL$,=h55t =r2t *5tu u^_[]PjUSWV@|$T5l*5D$$wG=*2tttn65575P$P5h,#(Gtj P52K Kȅuh,#52l$jU/th5l*55p*5j]<$t&4$h,#52E|$*5\$Xt*5-l*5j wD$ t*5u=x*5tSwt*55l*5j t*5u=x*5t]<$t&4$h,#52@^_[]j5l*5\USWV\$;s=*2{65575PPoh,#bstj V52 vh,#8u h,#&2HQPP2Q 52l$t*5tteu f|tF1ۃjU|Sl$SP~ tuQVg|*5Ju t*5u=x*5tjsUsV藁*5 t*5u=x*5ttJ=*2tA{t;65575P8Ph,#52^_[]SWV|$*5jw1=2t *55*5^_[Ë\$1*5u/? *5ut΅tSw5*5*5t"u8*5H *5K*5jw=2tru+*5H *5*51 1@65*5+USWV1=2t5*5|$0D$Pm[thUS- =*5tiD$*5,$\$4>G75=*2 65PQwP+h<\"w 2HQPP 2Q=u2HQPP2Q 52Vjuw  Sw5*5=2uZ*5t"u**5H *59*5m"u*5H *5 *5 *55*5D$P蕐 ^_[]USWV|$0t$VB@O 75jPw(, _1=*51{t'G75$pWWuuޡ*5[tZtT1=*5uI=2u@l$41; u{C75Us t=*5u =2tʋ-*5-*5V蝏 ^_[]USWV\$K1t@ t*5PSxƋk1Ou,D$}t]1{PuVy uR t*5u=x*5t~ jW|$x4$Mjt$}jux W%<$t$mE{t Vv1 VW|*5 t*5u=x*5tA^_[]Åx W0,j Ph,#USWV$$D$1t$ 55D$$55D$D55D$Ht$05*5$P讍5*5E75L$XIEtH1F\$XljtwuG75hSW]) 1ɉȋOυuNjL$\u L$4IEt6t$4NjG75w蚹tjVW) GDžuԋL$81D$ D$Xt D$ ȅuD$ P؋$D$XtH$r4$ ȅu$1ɉL$@=2t=*5u|$ ~ $@D$@D$ )$=*265575P4Pl$41dz=u)2HQPP2Q9}j=WܹƉt>uk2HQPPx2QFP4U 1Ո`1t$XtOË$t)2HQPP2Qv É΅u$u t(PV52 مt ȋN΅uء2HQPP2Q 52|$ +t$4~jhx4&W u|$$ƅuf|$$ L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t D$$|$ u$|$<‹$t$t$$t$4V0fD$ 9 fD$D$$ f= 45t*fsD$= t= u ft$}u$D$@f%`u D$t*5jUqD$,ED$D$tD$L$`2 =z2u f|$t$Ut$4\s t@*5|$D$D$`t$dD$,F L$t*5=x*5tYD$t;=*5ut*5=x*5t.t$`jt$hL$D$Hs*|$$ toD$ t$,u*5.u D$@1@Ht$,$pt*5=x*5H> $At:ʉ9-ЊQ-t u{yh8‰uD$_}t } ]1HL$|AAA 75D$(75\$l1GSQW =*5QNj*51-*5UD$pPjH D$ l*5I D$(75_UUW蝠 $1ɅȉD$PPVM25\$|f25D$ H25$25125t*5 75L$( *5L$L75D$D$hP t*5u=x*5t$jV7l*5D$ 5l*5|$t&D$1f|$tH 5555$*5h t$8*5H *5=t$L$QPD *5t*5t$)D$(75D$D55D$H55D$L*5h25轚25t$|D$ l*5|$Pt j t*5u=x*5t=*5u 1*5*5D$G$jWnl*5D$ =l*5h!t$8S5*5t$ Ut$u3Ft,p謨tF 55QjRp ^SWVQt1OS jjP t6 >F1"jjP tv^^_[USWV|$41GGG =2l$0\$S}t*5AjUfjUPxh uAt*5=x*5t4$B1CSt$pSU\$t$$w t*5u=x*5tgS}^_[]h,#VP*5u1PPVPjh2V tF$P{*5t.1QQVPjh2`V t*5@=PATH5*5> *5 2 2^á*5SVhd"258uj1^[1ۈ22蹎5*5thB vq6525 55SSQPV*5á*5ËD$ *5*5PËD$@*5 *51*5*5Vt$ |$|vPh,-#F1@ *59~1Ҁ8cB*5 *51^WV15*5V2590t\Wt{250PjPH5*55*5*5@*5jCx5*5JWY{*5^_USWV$55$j/Wިt@D$PWXD$ %=`t|=@t}Ā^_[]ÉjWS/ tFƍl$UVXXuD$ %=`uV5zjWS ƅuWh!%Wh>-#Wh(#L$*5x *5V|$|D$ p#*5*55*5uu~9} ~ *5*5^11@1USWV4hd"|$$WT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$hT-#52(14^_[]UWV׉΋ *5uj' lk< *511D$ T$l$ %D$ $,$<$\$ D$q-#D$w?6u0uFjh#W %W@|80uHx.t x0@te^_]USWV|$7j/V@u#$jVP uaK$$WV4 PuU 1@Ɖ$m=*5ud$$UVuGr8t8c8t.Y8 uPV;Ut 2Vwju$P OfSƒrtt~ *57PSPVh^"jSWVt$|$t$VW% t ^_[Ã|$u0jWC6ku25*5V=j]USWVPD$tnt$ t%1;t <:t9tGt$,89-P2}v,; L2t,WSQL$ L$ |9/u 1xAA/D$PL$Q*5E9u,;E-*5L$Et <:tEL$<:t1ED$(Q9 $+ L2AQt^_[]USWV$1C1D$ 1D$D$D$\$hv-#芍Hw5$4&\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ 259A2593t$$1CjWtV@wM$4&|$t&|$ t4t=02x'@ |$u25H 258u55PVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿ*5/tPEȃw?$4&|$u/|$ u&u |$tf<u t$Um묃H+5r522$@th-#1@$$$$^_[]SWVt$t*5*5t5Hftfu9502| P5 9p}Ëu̓H+5r t*5t^_[Ã=x*5t^_[USWV$G$$4&o55EjWS PrM䃼$$twh-# Vh-#>GPh $t*5w6PQa_ t*5u=x*5th-#D$Ph-#/th-#h-#GPh $I t*2HQPP2Q*2HQPP2Q ^_[]ÃPWh-#_SWV|$tWȊ Bu%iC)ʾ!)!*53tFWPtc6|$tTt*5W PnƉf@@ WPn t*5u=x*5t %1H+5^_[t*5H+5Q#2  t*5u =x*5USWV$$$j/$蘝turfEE^559tth.#V{t $j$q1Ʌt@@t`tm$umtisD$ P$LxfE$K88$ u=02x $u  \u =02y& u $MƋ$1Mtfyu02YL$$j$P 1OD$VnG*5tAPh .# |t$t-'5*5h.#{t>/u19}-9j$$PM ƅvvD$ PVpKx3D$(!D$ =u8=*5$Nu$A8t78t -D$}o$E$\$|$$t$t'52jS P$h"%VfEo$T$pƋ$$t*5|$ÍD$ uj$HfxT$ ufBuω7 t*5u=x*5t sׅt"G GfEG EG fEGE fEEĜ^_[]t*5T$ Éuj$fxE$ufBj t*5tbiVtC+L2PjVij$t3fxu*SVm$=x*5V$h.#SWVP(B&1t8|$0B&L$8u%tWPKL$ t us^_[SWVP8C&1t3|$@C&L$8uWPL$ t us^_[V8C&t%@C&jPf@NHu^V*5 02trft fuxB =H+5r^USWVP\$=551N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh .#wt1<:CG럡02y x5021Ʌx $y $Q502^_[]SWVt*5*5>t+fuw|W+ ߉?u׃H+5r t*5t^_[Ã=x*5t^_[2WV|$D$ t*5jP+@ft*fu vfFGF GF GF t*5t^_Ã=x*5t^_WV t$D$L$ t*5fO 2fOPlGWVU t*5t ^_Ã=x*5t ^_cjt$itfxup=%1USWV t$811G$1D$h+.#Xot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШP25:KB25*#$1\$ D$4$߅u U=49&t,]89&49&8uUPtujUƃ<$t0vhX#4$25H 25(t|h.#%j v輔tuh.#vhX#2584$t2HQPPB2Q l4$t%UhX#KPh.#+h.#,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$5&D$j/U諓jU~i0A Ph˞":uhh$/#Yuh.#Bu h.#7t.UhX#++55 t$|$tJHh/#Wt$25H 25(ouh#돡55D$ FjUD$PK P~dN<$ud"|$t.#Ph.#vShX#ht$ct$1 ^_[]hA.#y.#ctd"RVhd.#Vh/.#1PPt$  5L2@PcUSWV|$D$\$=2tL+5H P+5 L2 T+5 P2 251ɉ X+5 h+5H 75Sp25tH 25~T+5T+5FeH T+5T+5+L2PVbp+5l+5u%Vj2bp p+5p+5sl+5UVp+5-p+55l+5x=tEl+50va5p+5΅u!dT+5252V6_p+5l+5t Op+5G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t55t D$2 55D$T+5+L2D$?~uЃtRWT$4$ D$1@D$ wy< 25H 25T+5$!PVVT$0/>u!y@u=D$ D$L+5$25H 25T+5=L+5utT+5+ L2;L$~axu[25HT+5625H 25 T+5 25H 25T+5$ |$D$/ЉD$$ 25H 25T+5iaT$,H T+5$t)Ut$ RtT+5+L2jPHPX T$,>~=u|$ D$ }RV"T$4h| u7525H 25~#T+5%`T$,H T+5 `T$,H T+5$Ut$ yT$4T+5+L2jPHPuT$8 9`T$,H T+5>25H 25~T+5 `T$,H T+58 t75i_T$,H T+575H_T$,H T+5$&_T$,H T+5D$$ |$tu^_[]USWVt$,\$(=h+5t55t$D$ 2&jP\XNF55D$ X+51oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=p+5t*5t+5u(Q¼9PYt+5NQP5t+5 t+5 t*5u=x*5tȻp+59t31Ʌt AuQP!u=p+57v  p+56^_Vt$t"p+50v5p+5΅u^V5X+5t1t*56PJ 5X+5 t*5uۃ=x*5t1h+5X+5^USWVt$(PYT+5+L2PXL2Gtr}t  KvC#:t /tQ t7=2tAL$,u8 25Q25B[O@랃tPY^_[]Ã=25u [25L28t!P tx P9Yu$h߫"RljPYGËD$,tÊ?&$< t< s4< w*25H 25~T+5jZH T+525H 25~T+5@ZH T+5Gw/u}/uEyP USWV,D$DD$L$@9A|$$D$t1A&‰T$D$D%D$ j=L$Q跅D$pD$$L$(<$ L$ u:|$L$D$ PQ 1ڋ\$L$ 865T$)11GT+5+L2D$D$<$u \$H l%t$l$UPRTT$LQST$L$ t,1t}y;@ڋL$ uL+5T+5+L2=2\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =25t1C L$@11ۃ9|$t$ |$Wt$T$RV WUL$(/<$ }D$1|@uD$25H 25~ T+5ՍQT+5ZWT+5MPT+5EK1ۋl$$]|$ D$EÊ?&$< u.25H 25~T+5 VT$H T+525H 25~T+5 VT$H T+5]EuKl$ u% T+5L2)T+5 25\$\$L$ D$E< w.25H 25~T+5 VT$H T+525H 25~T+5 UT$H T+5]Eu1L$ }D$n $Ip$@5&|$t25H 25~TT+5R1G>L$u0L$ QVw1>t5T+5UT+5ۋ\$uh2tc*<) t`25H 25~T+5BH T+5552*55T+51T+5^_[ÃЃ w]j PV\ B8ű$<=tuw~;52525b55D$525ØD$D$‰؃AD$$Z|$ T$L$T$|$,?&$< u*25H 25~T+5~AH T+525H 25~$H $ T+5QT+5 =AT+5 $Q$ PT+5$eØt2H T+525H 25~$H $ T+5QT+5 >T+5 $Q$ PT+5$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-G25P25=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rt+59tH9u $8/t F %QфD$;5t+5tF/}tEEGXـxs@<$uokt$tdǀx .u.uN jWt$G t8tG@u@/UPWV5t+5=x*5tt$}tWE/Q t+5߀xruX@8tB@9tD$P5t+5x5t+5,Ą^_[]ËD$1Ʌt AuQPFWV|$ W軚@P8WP5j8p p+5p+5^_USWV\$D$|nOʼnmIWP)|$SUÉps譞x 7u߅u҉3D$^_[]SWVt$(\$$W>8C P+5L2T+5P225h+5js25H 25~T+59H T+5T+5+L2P6jVP W7^_[USWVt$FPhf"脪2HQPP52|$Q1ۃ|11E4E9uShV#*2HQPPۥ2Q|=1C4F2HQPP螥2QC9u1^_[]Ðh/#6h/#,+5H +5~+5H +5#=~u+5H +5USWVP82H +5t+u y+5H +5~xhL2[h`2N +5182~PX+5hSp? {e苣8t_82xLr8#>WjW !Pjj蟧  h0#82p+582@1ҋ+5  +5@@P t 1++5+582{tXAˋ-+5M +5~ @لt+5أ+5=2t$5+5D$052ңD$+5H +50~^_[]ø+5+51+5+5h/#褕USWV=82w t*5^t)kU豕~D(< t< u 82Hc F+5F+5F +5G $9t V  t*5t^_[]Ã=x*5t^_[]饔V +51~^Ë82r t ~6u1@1z+5 +5SWV\$t$|$t*5 82y tj1 82I  82A$A +5H +5H +5H XtK =+55+5 t*5t^_[Ã=x*5t^_[ʓWV$t*5jW]ƍD$PVEouT#D$ =uD1PPPVà u2jPVѣ u <$ELF1PPPV葃 uZVy9t:$Ph t*5u=x*5tĀ^_Wh 0#cV}hU0#PVjWh;0#kt!Zu忀ރlt puԉпɁu25tg8tbPh $[Km=2u =2u@25tA52jPvW:25H 25@ujJW52 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPhx%W蟗\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th%y"jD$P耗 ] /5)i5rOC-D2+9tti-;)t RPhK3#jl$ U%\$D$P賅$t+,D$0hT3#jSS\$肅ŋCt:tBuM ,%PhY3#jQ褖D,ingD,Runn}=tQ l$ ,j SP1 D$xxl$ ?Sl$ ō,@)QPhb3#0 hA%jQ ݍ,P蠄WD$P=݃FD$ ݋\$GHO WlH EuݍCWP$u/1M|t؁Ph߫#W N1MM|FGHO WH GHOl$  WސH|1GHO W躐H ~T$KW)D$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =2$tCt>5@2蚝99t%5@29PVJ$=/5~y\$t$1=/5tEt*t t.<$u u/S0=/5u WE;-/5| $^_[]x0 hjPh0#USWVD$4\$,tl$0|$WUS} ƃu#8=h55tt*5/5/5D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o/5D$ /5$iD$ 9T$tcu tQ=05t 1=2uL$,uP9tPtu 2P t*5u=x*5tH^_[]Vt$t*59tPH džƆ1z t*5t^Ã=x*5t^~WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h1#5t$ntpu25D$D$D$t 258D$t(1PPS舒 EjS詟==/5u|$1/5-25~6@ /5D$u}t!AH Et{1jPƅt9u ED$u :u G Eu25t Dt111D$uD$/5L$L$t$D$\$l$|$ /5@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$/5C$jU9 L$tc|$tNuJD$1rȋi4hf"jD$(P"l$D$D$L$D$u U D$\$l$t0~Ot)D$/5y\$l$D$tUD$tMjPS ?jVDžtjuS =2u V Ń퀉0^_[]h1# {Sh1#zSh1#zUSWVP1$1C11h1#1it"gu$ڃjt puЉ̉( 25t yjPƅt,1t/5)i5rO@PhH2#H$t#tH~1i0 tPhx%}11G^_[]Ã~1i4h"E2HQP~G ;| Z %PކG ;| 2Z;|lh2#iyh*2#_yV1=/5ujt$ St1+^V1=/5t. /5~$A/51F:uI}^V=2tO=05tFD$t+ /5i5rOA1ɋ2u0VQh2#R躉^USWV=/5u65/5~%=/5Ft WN/5l$/5~"5/5HI}t*5tfiP5Ƌ-/5=/5iPUVRh ~ ;uKuUz l$hƋ=/55/5i 1҉AJw)׉=/5 t*5u=x*5tvt*5fdž=21/51B|iP# t*5u=x*5thv^_[]USWV \$<|$41HL$AAA UQjŅ ƅt#tFjUj訅 VSt$@Wl$\$<$D$ 5 ^_[]观0jUj[ V Ph2#$vUSWVt$$|$ 05t!WW>~jVj 61-05l*5L05UU ~UVj -/5l$t$t%t =2ttttk0hWj<Wj1t uuamul1ViVh${tOh$h 0#%u,VjFuV5@2蓏tTWjzWjzt*=2t!WjzWjzWjzu/5^_[]07 hPh0#tUSWVt$ l$|$1ۃ=05t/t*=2t!ttSVqu5<2tEL$ji4DDt QP ^_[]WVD$t$ N /5=2u=22t=/5jP=/5~/5>f@..@.^_WVt$ t*5NJujVjS 瀾tW5@2Ǎ<u%+/5i5rO9D2t jVt=tu  ρπtt=ttu j4uu V t*5u=x*5t r^_~0 hPh0#UrSVD$L$ =2t1ۅ SPj* ^[Ët$1҅tހu1=/5u2/5u) /5~/5:tzt Iuh2#~/51@SWVt$$1@=/5|$(1@>$|j"$5&Wh3#bjvu hn"h$tjjvjv 1~ h,#21@^tjs%;th2#h$jvhA?%1Wvh2#1Wvh2#Wvh2#jvu hn"xh"kjvm~ t+u hn"Gh2#:jv <u hn"h2#2#Rjvu hn"h2#7h<\"v h{"jvh2#jvu hn"h$;h2#kFp]h{"P~tF1SwJh".Sw 1> 2#t2#P uh2#h/#vh3#v 3#'1Ӥ"13#3#3#13#N9tQhf"jWWSxuF x%Phf"jVVjv S hr=#51^_[h2#h2#jvUSWV fD$ /5 /5l$ 1D$U$u1!" $$6&]1x&~'t!=\t_"t $Q\$ \|$ B]ڃ 33# t73#,$$׃߻@%!$}D$:3#@3#} uH3#$A?%)4$<$zT$tvӃuxu;Hx@u8/UD$PVx D$pL$t 1D$tD$p1ɋ/59/5*5tH1 8t:tGt89=P2Z 9=P2~*55L2WPV\Z >?3#<=25l Vj: fiDle cDhangD ged߉Vv2HQPPv2Q D$pL$t /5/5E;-/51-/5D$PĔ^_[]ifUSWV<1UjjD$hhh UPj x ȗї9u ώ9È@05j Uy D05j0H05hd"U h3#E2,$UhL05"t$T|$Pl*5L05D0505蘗eD$PVWVWL=@05 Àud{=2n$h3#p*5ttQu *5 *5<$B=25=05(ȃu6i050525$p*5u菗=p*5u72HQPPft2Q h`2tD$Pt*5=x*5tsf$$=@05u>h߫"袀<7&t1Ph3#QPP[V$=2u2 @05t N=@05uEt$(Vh3#/t8t$PTPV$75=2t =25tj6&kuD$P25u/jM=2tFh"rh`2ws*1ɀ=2ˆQP/i=2u=25t42755*5p$$#uSWVD$8t^t*5jP`uƅx jV t*5u=x*5tdx"1=2t=*2t*21G ^_[11=2t 21jV3V=2tt*2u2^_[USWV|$(V11C=h55tnn1=2u4t0j52 jh`2q2P=82t.te=2u\1Ƀ=/5 /5jP`h1;tW1R=2uIu=2t7=2t.h3#pEVu؅$uV#^_[]Vt$t*5jVsx1jP t*5u=x*5tbj^OVh 0# ct1Ã|$|D$pPn'nft$ th3#bt$t$ҽ th3#bWV|$ Wb@P農 tWP<^_h3#jbSWV|$P29~b9t*5؃Pd tr H2 L2P2H2 t*5u=x*5t aP2t*55L2>L2)P2 t*5u=x*5tOa^_[h3#aD$t L2) P2L2j h3#jEp aD$ H2 L2H P2H 25H 25H25ËD$t*5H 25P t*5u =x*5`Vt$t*5H2;t H2P FL2FP2F 25 t*5t^Ã=x*5t^M`USWVP2<kt*5-L25H205t|F9uuH2PV蔻  H2H2+ P2 25L2=P225tG90uC H2 L2H+HH x@WSUPaP 5L2=P2 t*5t^_[]Ã=x*5t^_[]c_h3#_D$t*5L2)P2 t*5u =x*5(_V5P2P2255L2^V5P2+525P2)255L2^ËD$ L2) P2 P2L2+D$ȣ25USWV(L$@D$D$@t-΍i11P)_wDGÉ,$Eu1ۋD$Vx  t*5u=x*5t:XӁS1rD$r1@xDw@@uDx@D1 uD$r1@uDw@uDx@D1u$r1@uw@ux@L$T$PQRhS4#li52e 21Ath4#d1@ ^_[]Whi4#WWh4#Wd0< PWh4#WUSWV(f11CD$h4#AR t!HuStau׉\$σʃŻ6&C9t;[ uVh4#W1N25ɉL$|$xtD$ h"Q[te\$ 1 waO11ہ̉ځ Љ ۉӊ€A ru1G11Tt$@1ۄnD$ xjWhjf9ىƉߋD$ \$ D$ |$6&C L$QPnCsP\$3h5#Fg\$ utt$|$ t$|$t$1N11 uh"f+D$@ jPWt$ƉRPh05#f 1 PhV$fgD$x @ #t$C\$SP|$D$ tMt L$L$|$t D$D$|$FSP贄~unj,H05]uT$tT$|$T$|$1I1Ѹ1 uhh5#e FjPWRRPh $e 52b 21Aths5#Ka1@e^_[]t$h4#Th!ST`0 Ph65#St$h 5#S,`0a PhO5#SfSV1T$L$t$ |J@u^[SWV1ҋL$t$1@t z:t1^_[WVPt$$Ѓ w,j WVE t9t9u1u^_Vh5#SVh5#SL$A1@҃Ѓ wAu1SWV\$1tZSStMPh%Sf 1Ft5Wh"Se t"uh!S; t Ѓ s^_[Se1ɅfVt$ |$F25(2Ɓ22u2j25 25u 2 =2=2u't#j,tj,t22<u=2u 2=2u225=2ut 8-u2(22u 322232uހ=225u:u6*525H 2525jP25*525 25t/t_9tZA2525Qt 2525ȣ25258t 25Ax@u25 25^{h6#PUSWVt$25H 25-t+C11C<-t1Eu{-1E1 [2t$Y2t(812uƆ22u Z2@uă^_[V(D$ T$029tu6#RPh47#Kt#12t(812uƆ22u숁22^WVt$ ~t)~tPB uv. ^_USWV jA 25t_y 8-uUD$$25125P  25y8-@P1F Pơ25)t*525=25~-25Ft7i 251Nࡤ251ɋu25 t*5=x*5I1F525P)ƅ2599St*5 2525lj4$މt$\$)1*C/5259rL$ 9v!\$ۋ4$ P; 25w4$ 9vQ9w25 t*5u=x*5tHW1 ^_[]hY7#BIhH7#8Ih7#.Ih8#$ISWVT$ 25tstm8u'1z:trrD8uAÀ~:u"9u 25Q25 tf 251ɉ 25D525>1t6?-u1t+O^25-uta5251^_[Ph7#JHPh7#?H|$u1PjPPet*5jw258t PI t*5u=x*5tzG1ËD$Ѓ w#j jP~ u2525ËL$~ND$tH  25=25u 252525h25h25Qppho7#SGUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjhd"h7#AZ J|$:uUD$8@?jPh7#Z ^jUh7#Y 1|$D$0)@<Ph7#h`2 W jh7#Gg1?\$D$01@11T$4*l$Phf"j UAWhUh7#uY D$EEjUt$0WY u0^_[]À|$:uD$8@:Ph7#K1L$0L$4UjDfVD$ 821qqA1Ʌ /50P$R82p ]t u 1%8282@j* 82 u^qqh8#DPD$/5/$QXUSWV'ơ82@tu'tƃ 82 x,$@D$t.$x#18uWPHtG89&uD$tKjD$pD)t6NjpV DWPV E$ht82@^_[]USWV82@|$u 82A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq82@@|$Fu6|$uD82@ 82Ap8 u舭|$u82@^_[]jjX 82ASWVƻt u j pxʡ82@^_[USWV82kE1͋ 82x t*/5,PN82@ C1Ƀ8Qs s j@82HOH O oKy K9t?U1CSp Sh>&P= 82HO@ G 582!^_[]WV@t$P 82A uyW@ wWh9#48&h9#j"Q Wh9#j"P%RW@uL$Lx48&h:#Vh9#jPQWUSWV82@1u 1=2tMtݡ82@xuUj @jtÉGpj`aC+t82@tj,(pƉ^_[]h8#82t$p0h":#_?USWV82@$ u82@$EŃCߡ82@$\7&$ 82APUj já821Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt82xJjG B u082x,u%@A&t@/@A&uh8#jÀ=2tjjj 82H0+H8O U 82p0j^@ 82QPI H pGu582~ h< %v"Am|$F82xujD$ 82Hu 82H L$ qx0j@82HKH K {@;u.82x }82x|$ T@0GjG 82@t(HS u 82@82x\$\$j 82HK @0Cku82x ux,uh< %p|?jP@<21ɉH H 82Q0PCAHrAAtejC9t jW\G @:82@ u82@$EŃ!ߡ82@E<$t!t;tj pXÉ{؃^_[]/ uS\$|$82X0j2x@ 82QPI H X t\$|$D$C 82APsVL 82jj 5jj,jj#jj jjh< %jjjjWV82x$G Hs82jpW$ uq82p(x,u~ 82At8 u @A8 @tHA~րxru\tuՀhT9#82p0+p8j@ 82QPI H pG .Pt82@F 82t1^_jjVt$&9u^jVVL$1A&tA1B1t AA&u^uVt$j@ 82QPI H p^USWV |$$tD$ D$$D$l$E1$82xc 82x0$t $j\ƃF 82QVI N ~ut. 82IA&tAt=t AA&u1c82H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc42 82A4FA~րxruwtuՀh9#BL$T$$@ 1}D$8j(82 $+H8N~L$NL$$N @0FEPqqj/vuG42 82+A8FF82@4 ^_[]jjjjh49#L$1A&tAt=t AA&u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;H05}X;D05~PD05I;-u{tBuG82x0+x8j@ 82QPI H xF^_[F hF9#lUSWV|$42D$蜛=u ?vl$$5L2P225G$|$ t u _ t19uD@ $ tC9u?,$ u4282HH }Mt9t u>u:<$ t=u)$)jWP( |$l$$uS\uN25H 253\F蓚 u%25H 25  F42#á25H 25ƈF tA=v42'=t ht9& u4282HH 25H 25r=L2)FV,82x42+D$^_[]USWV$$1҉T$ T$$D$(54282r0=>&t1$|$ fw|$1/fFn D$j8fNL2 P2 25=@&u ƒ=25‹nD>  $7&==&u f|>z 2542Bס82==&Xf|>LCD>fT$ 聘T!uhЃo\0N,C05,/L>=?&fu 25Bn׍MN|$=@01fD T.fTT.fTT.fTD?&fD1AL$!(ljƒ(M 25FD 25BvNO|$s@81ɃfD T7fTD@&DfDfD> Ȗ = 25\GT$ t$>Hff 25T$ Bf|>D>u6t$ nMn 25}f|>  25BFfL D$$D$f|>tD>t 25Bf|>u D>v 25BW 25B*Ã{t A& 25}E+=L2 25E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $ʍ nMnD.==&u 25 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD>&fD 25T$ B1AL$ I) NjFfL 25B) 4282@8xt /5 /5$ 9W Nf|F\=`4" $"}f|  25T$ BFu6$ Ft$HFuhD$$D$ Poſ1۹$8&D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD>&fDu6t $ FHF 25BM= t]\t 'u ̑ t =u 42821Ƀxɉ /5$6 25T$ 'uF|=& 25F$袔?&$< u 25T$ BT$ 25 cb,t$@  4282xD/5?A&L$ xm2DAD$D$ݓ|$}~?&f|t 25 25B\?& u 25BNf|t 25B1@D$ 25 25B݉ý {"XŃ', D$0$袈 nt$T$ Mn 25B1@D$t$C/5$4#U d` Ń< ?\u:\ 0 \$1ێHЃ w&Hw ÃHÃéOu M 25vNO|$@81BfD T7fTT7fTT7fTD?&fD]L$ uk%=I =25 D$ wF 25P?ˀ 25@ww 25 x?ɀtw 25@ 25W?ˀul 25GXT$ W 25x ?ʀtw 25E 25O?ʀ 25Gw7 25x?ʀtw 25E 25O ?ʀtw 25G 25A?ʀtw 25A 25H?ˀ*2525D$D$$25ڎ1zA&t.25H 25LjGq A&u\KЃ w425H 25LjG; ÃЃ D$ u t 25׃Z 25H 25]=Gt/ up}tk25J 25/#@ǽh#tE%t@Ń:bD$D$$9&W¸U1#,W9ur1|$Nf|uf|t Ms@ L29T$ vNK؃|$ @11fT T3fTT3|3|t3ft1BfTft|=&fq fq ƋT$ +5H +5~+5H +5 rËFD\$D$$9&Q19&)G 25x?ʀtw 25E 25O?ʀtw 25G 25A ?ʀtw 25A 25H?ʀtw 25@ 25A?ˀa2 25AD$ ??25H 25~2G:25H 25~$_1c:B ˆB1==&nD=@&G==&tf|cf|.325H 25莿5L2Gf|uNT$ ؃t 4$t$nŀ>ts4$flT$ )B82L$H,L$H $վ82pM tΉ$1 Nu82xĨ^_[]1HE;H05} ;D05~D05>uxkjy1$&tu>tyu6EBE9E0E"EEEA 葈}82h$ Ή$} Nu=tuS$q:#$9#42 82A0$9#u$9#b$:#V$:#J$:#>$:#2V 82xt@@ ^Ãx t#/5$)82@ @8 42H0+5H +5~+5H +50Cƃ~0:=F $x8&փ t=u럃F~t\u^觃 42@42 82A0yt/5 K/5$(*;|u0d|82@=t*b4$D$D$=&Kuۡ82@1v u4282HH @1@Q&82@-82@82@&tQ;ub82@ 苅82@p82@82@ ?82@uҁ\u?ȁ u64282@81Ƀxɉ /5P&ڄjjhg!ل rVȋ 82y8~0 25Q25@ 82Q8rq8^USWV\ӉΡ82@D$ 1,$l*5D$+L2D$$UPt*5$~S"ʼn$S5L2PI  l$|$tD$$l*5 t*5u=x*5tOw42D$-L2P22582x t*/5P%82@ 8ǃ[~!\u9'ǃ[C tJ$Q u"4282HH s`un=ub\tX`tS42 82QQ NDt""u$25H 25~E\E \@ŋ 25A25@25H 25ٷEL2@|$t~Pt$jP% D$pŋȅut$ j轴E82xtH@1D$42D$jNǡ42D$Kt5 82At$ D$AEx82@t$ Ex P29ًl$踵 P29~=L225t1SUW )25t*5Uv $ t*5t\$=x*5\$t 82T$ Ql*5Nf|u%Du 25Q256@Vt$+t$ 25Q25@~.F25B25ȅAJ։ȃՃ\^_[]á82L$H0h:#W<$t 4$u /82@D$l*5jPjj#jjVtQu N^V 82d"ytA5/5t7t u(65P65542P5/57:#^USWVt$,|$0l$U5P21BW;L2u(VyG359w&25WVS Uڲ^_[]Áw: t9v$P525o tã25$35랾O:#뤾]:#USWVT$L$ -l*5jƊ*2*5D$1|$082D$|$ljWtJD$82*2V!-l*5D$*5p*5d"jU\$t$l$=l*51F5*5D$082$V\$Sπ zVh>&P 82A |$t|$t=2u ;#@݅u:T$1rIJ$JB *2VVRL -L2=82D$*2t$D$l*5D$*5؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV 351t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu 35tu(Mxju PQ.Ex P"Ur uF^_[]USWVl$ t$\$|$t|h@VSD VS0DDžt9u 9t S)"9u95D2}5D2^_[]ÅyD0y PVSh;#W!WVSh;#USWVt$ |$\$l$jMEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!jl@ 35$ 35M|$];H05};D05~D05Eu9] u35tX9X5 35t-pt 9^t6SLF9t S  351tF9Yt? 35tHt 9Y jjS-  PkD$($@t 9XjS1xt*535  b35 D059|AQjS ǃt;=D2~=D2x jjW jݫ$JBXxp t*5|$u=x*5tu35t$(WUN mC1O ntuK535jS DžD~8t t8ujjS DžS0興 PSh;# \$t 2t2|$t 2t2^_[]j G PSh;# 0 351tT$9Qt uÉVt$535j V! u 35|Qj V u8FPj V u$j j V ujj V t;D2~D2^h;# WV|$ t;G;35|.GPSƋG9tVPWww^_WV H2 A H21F |71FPWW7 y w;D2~D2Ppgfff  35^_USWV$$$~t*5 8k$9&n  35t9i V 35tQt 9j b Y<(O8=2tNnjUƍD$PVy#D$ =nhh]n$SU0oƅtjV!SjV $/nhh nhh U ƅV;5D2~5D2|'u" 29uu-jjW 9t1jPWV t*5uQ=x*5tH A1jPWUy v _0蔄 PWVPW  t*5t Ā^_[]Ã=x*5tĀ^_[]L hh j B PWUh0;# 0& PWhT;#{ 1F5*5V0 PUh&#Q 8Vd8*5j0 PUh};# USWVPt<xa|$\$;D2~D2oU = VUSH 1jSS t!t$$^_[]h,#4$1EUj Uj UU Uj Sj Vwt$  S VD$5 35t*5PV] 35Vh  t*5t^Ã=x*5t^1=35SWV5 35t4|$t^tCx PjV6u^_[SWV|$ D29|ȋt$|9}9| D29tVjjVW 9u^_[WcSց PVh;#+WV35 |;H05| p35t$ Pj V y2T8t J8u>35 jjV ;D2~=D29t V^_Vj 迣tL$ T$535035PH^á35tT$359Pt usPf aUSWV$|$<\$81D$ $D$1F5$;5_2h <#WSI !1tbhv#W:hr=#W$uo1< 35tEt*54 35^  35t jV t*5u=x*5tF@u 45>h}#Wthy!Wt D$1p@|MD$K}hok%WRt8D$D$he=#L j521CKD$D$u}h=#n v11 t=t8< 35u.u hj=# VaPhy$^  GF@uh" F@uu= 45t1uu莩ND$E11P@É|$t< 35tW4 35hX#Ah=#< 35t4 35 hr=#SfPh/"c Eluh>#52 Cu|$tE1F-t*5D$t P1< 35D$t4 35\ D$ 35t jS< t*5u=x*5tEt h"11< 35t: 358u.u ht=#VLPhy$I   GF@uh"F@ut h"i1< 35t? 358t3h=#D4 35gVPh/" F@u1^_[]ËE8-uxu1D$1FUSWV|$4t$0t1 <$45= 45 $t/1C=05tYuU~2t;tuA1=2/ 35t1ۀ8Ã@u1=2Cu1C$551t&<9t]t]u]1YD$PjV l$u=2d1E UVFt^u$55u jV׻1D$D$ D$D$N?r  1@ DD$jPj  $ u$45V^_[]À=2u=25u =2=21EVt*5 35>t8t6X  45r1 45*5 t*5t^Ã=x*5t^QSWVt$u  451ۃÿ 35t6 358t+t*5SPf t*5u=x*5t$35= 45ru^_[*^_[V1= 45u# 351A:t2>u  45r^WV|$ c0= 45u =*51=*5u0u+t =(35u"=t*5tW=d55uNx*5]tE< 35t; 358t/$45h55=2t)u$=t*5ujWW0^_ðPWV|$t$ $55uWV $55<rjVguƆ$55^_áp35= 45t1Åt8uUSWVd551Gh55<$45u@@uu$45= 45u΋4 35tãl55S-*5VϒjPVV t<$tS-*5m d55^_[]ù@rA< 45tøWVt$ 95p55t)1WjWjWj5p55^_ËD$t55x55USWVhD$=t55ux55)=d55tl55t D$D$*5x55*5=h55tt$,jVѮu 5l*5et$,jV賮u45l*5= 45u%= 35t?t1 35PWt*5jVju5l*5;jc|$wfs 5x55 1ۍD$X XXPj#SW\$\$ \$\$O?r 1@ DD$jPjg V{f52t$WVt$|$ ?t*FHN V>Qu952u V^_52t$WVt$ Nfu|55FNtF t0fu^~t*5 ?NQP躏F N)Nt*5v}F FF t*5u=x*5t V N^_Vt$F t-)t'VfxQPR yNFN F^52t$USWVP|$t$j'V1t~th.>#VI<k>t!ht:&V蜁1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=2uUWMGHO W]H"WVGHO W3H"^_[]WVht:&Qj'V3t)19<>^_hL2oh`2bUSWVD$~@|$l$1SWU" t 8tF r)~1H^_[]ËD$)D$t*5X2tPO 1X2P2 t*5u =x*5zPD$L$ T$$RQP XVPt$t$Vj tt$ P4$QO ^h3>#PD$L$ $QP52 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+75+55Pqq h?#jh75#75SWVP55:&C PVw u,$$w8CGσCGCuhT65Vh>#8 u*$ H65H65L65P65^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')<\65t>7t9^ uSUvi t61^_[]ËD$t8SV ,ƋL65`uP65$1M L65>#t>#$53#ta%P65㟉L65t$D$$6# ^[WV<5l*51$|$PW荦t $D$PL$LT$H=l*5PQR 5l*5$<^_USWVL$T$tHtA|$9t91A&Írjt/9t+1A&tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U[V?Ƌ $A$~ C@ $Q$f=t @UPWVp ^_[]SVh>#WV<5l*5*5$|$jW!u"D$LL$H=l*5*5PQ5l*5$*5<^_USWVD$ èu|$=Z2uÍD$PQW Ƌ@t*5Nt$݁ uF @SPуF`u vJ F~tuF1Ɏ! s%t É^~55t55u55t j'~ t*5uk=x*5tb[r2j[XxL$H @ $  $#`uWI `u WI fy^_[]vv h># D$@!|$$~L$( t 9-uD$@-=25u0@=25tc@=*5tf@=2ti@=2tl@=@05tp@=2ts@jPh?#,WVt$|$ t*5twyVP? t*5t^_Ã=x*5t^_WVt$ t|$Wv 6u^_USWVP\$t*5jڄƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFR菄SP}j=S芳SgUPu< ؉G@542542hT2P! ~ F1gjt$465uQG L$<=u555H552UjS $81F FF55465~75575 t*5u=x*5t^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ *5t8Q12<08uF=u =ut j=RF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWV\651tr:1҃Љu65r׍Pfƻ\65Nj+t7Mȃu%EttUЃuEmŃ65r^_[]SWV\65>tLGu% uwD Gu#WD @tw腁Gg;u65r^_[2SWV|$tfh ?#WW9uWh $V't*tUj'W/t8)WPh;?# h8?# Gh|=#Wh3$^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhι#tUhι#>=uD2HQP~ j( P 2j)n~=uGuth"EU2HQPP2Q ^_[]USWVP65u65 ho65T$ t$\$\651<$?tIOt !T$ ttуt݋ 659|QP5T$(65%65  $W> G t*5u=x*5th^_[]SWV57575~tFu7jwl542v hT2 v *> :DNtuV _ BPRуG u w= FGF GFGV= N^_[ËD$ *ÃuD$jpp 1h?#USWVP1$1E1h?#蛓e~ft&vtxu teuԃe$뺋-25Et=$ ˃1$u P ƄuWu ƋEu1^_[]SWVt$|$h\%6u"h?#tDO1@$\;&N19eNVTNVv IF~uENV F(t!u0P 1x8)uxu x^_[h @#Uh?#KWV|։π9!utN75tfxt?(u >)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP轵I1>?f u%PVW1u%#L$1PVV1t1Ʌȃ|^_1@Ow$t;&1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$ t$d19{USWVӉϋu 75fx@$;&$PW_U1ۅD$PVGUr$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PWT1ۅD$PVxT$L$$t$<|$@11$;D$D9t$ aZ$PWT1ۅBD$PVT,$3D$ $3L$ $$3L$3D$1 dVW1ۅTVW1ۅfVWVW1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]Q9-u1tQyt8ytBÄth;@#Q=&t1h, jjh<&Qh, jjh <&h, jj h<&RËD$L$  )VL$D$ 2)u AJ)^USWVPj PVn( lj8t"ځ8"u 11E9s:$9t( xm2@DQ@uuN9t ڃ^_[]VhO@#1Vh>@#&USWV׉t 9Fup  ^^9uM1PP~ōPqPU~ LH;NuSS5 #~^_[]ÐUSWVt$(hd"jK D$,^H $x?-Ok-u)sstdluu~xwGW'Åu"xm2DHt'1Ʌ SVكhz@#hxm2DH\ƃ~ƀtVٕtV+Vh`@#j ރ $h%S1Ʌt:S%u+$891V52}VB|-$K$8ʉT$hok%W]1Ʌ9ufمu$1D$\$ $,}%urU YDžl$UWu.@#|)" $4Ph%C 1@D$l$t jW[j D$PU( ljӋD$9t-ف8ur1u 8tQu"xd"UPh@# 1@D$\$ $4h@#1@D$F \$ t$PhX#j*5PPPPh@#522jWVPΉj WQA 9u=у|=}^_Vh@#jQh@#j52TjWV@p+5+5+55<>t)j=WthW>uPhf"j@VjVhA# Vh2hx" #VWh7# 53#ta%VQh6# j,hA#h6#q VWh#3#bL^_=p*5t 1+5+5>822512525259 35tj8= 35u2L22`22tP/ 2Vj215*5><25/595T2t\2@8@ujt*5jd55uƀd55@u t*5u=x*5t0^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$D&$C&Vw vVw d_ t"Vst Vw?wN@F1Vw q#w N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$uD&E$(D&Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t, Ã|$, USWVPu }$75(752f`|j%v茗m O1@ 0,75D$,075|$@t$(q%v>%L$ h B#VZ<*u C h"SZ1N .u{*u{ 1HD$Ch"SxZ1HD$  t$CD$'C`L$&~QF0 $D&. D$׋L$ jj D$tfL$tjWt$QPhH75TFu$D&,75l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$PhH75,75L$ Q0a|$,75H ,75T$ l$=(75uM|$L$ jL D$tbL$l$tf|$ L$D$$H75bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$H75L$\$L$$X8G,750,75E ƋL$ cjl |$D$VPt$w,75,75,75,751  ,75 ,75Wt$*|$$H75 \$$75D75t P( VPx D75҉D$xF\$wZ$LE&a=&t1"u@"*\\t#'u0'btnv fre\qFuZxm2AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~V75475T$t P& T$475875t P& T$158755<75Љ\$H\tF5<75X])P0tXM\$u/^t-u#F5<75벸^tic\$>T$ j5<75F5<75{ xm21:DYt 7GuF5<75\$DF5<75ȋ\$+1L$ jlD$t1L$t5WQg75L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hH75 PRQt$QP  %75FPn 875 VjxP1 7s875T$t t$L$ t PVRQh475WMT$L$ t1PRQh475V.VWhH751PQ*t$P PQh475V t475@75T$z \trB<]*<0tu$E& ?$hE&."'#Eu uShB#I$75 4$xm2D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu hQB#$75\),ҋ4$u|$ uWhlB#x$75 ^_[]WVP,750tp,75I1ɉQPV{ Nj xm2B#DQt$cDC#r& ,75+ 075VQP $751^_SVˡ@75H @75 u:2Prp~r0 P{2Q 밅u@75)2HQPPD2Q^[SWVP,750t",75<'t<"u1B^_[11f1ɉQPV lj+t:<-t6 xm2DAu),75+075VPhC#ƿ $75 $ڃ^_[SWVӉQlǃArVhB#}$75GPVhH75a D$E75F75ƇG75^_[USWVP׉1PPPq ,>U@PUQq x$tG9tC,75+075VPhB#,75+075VPhB#舾 $75$^_[]WV9t"΀:t9,75+0759t\VPhB#Z,75+075PhnC#kDh8"uD=,75+=075j"6 PVWhC#6RPhC#% $75^_USWV\$$8l$}h6H j jhF&U2ƅu!h6H j jhF&UƅH h]#uFj PV  8u$8u؃^_[Vh $j.WVhH#jUSWVa f]575 ]5ƒ ]575 ]5€ш ]575H ]57575hG"}t h;J#}t8ƿDP&_N#PV%tG uVhNN#j $$1ɉhzI#SU P6$K&75kj j5,; ƃuM8"57575v ,;f75Wj j5,;? ƃ _%75j j5,; ƃu谫8"G5757575751A5,;5,;h"V{tchI#ViK7575B7575/75#Ϊ8"tD575  9u75rCjhI#5,;hI##VhI#5,;hI# 5,;hI#j޻u hJ# 75t 1ҁ‰75]5փ9575u<975u2]5975u#]59 2t 27575=75u\1ɅQhHJ# _2=75t)ͅt=75ut 1jhh75P4) $yh75h $j螺=75u1D$(Pt$wu#D$0=u 75751N1$lL& $$h]"y7!t$h2T#Qhm$hVYV th""P$Ph $U75|=5 $=|=5=75p;5B=hM"ttt1@$$Phmdt$ hhZJ#h|tWQWhT# $=t<5u t<5 =x<5u x<5 4$h;5 T75 $$1 uWhPh;5 1<5<5<5 <5tjVh<56g h;5\ $RhS;5h75VW0 575VWF5 Wכl$t$D$ 1ɉHHD$UD$ Pjɨ 5Džy#8#Bjd5x߉DžVUx9ujUju 1|$nhM"$P.<hjh;5  ^ Wt $h?T#}he2@ke2H e2~e2H e28he2辛ljt9 t4e2H e2~e2H e2he2~ƒ߃NyjUja hm"R1;5e2h75VW4. 575VWj3 h;5dtd($Ph $Q$P1@PIjUjϦ PiPChk"tXT#tǍ$PWh%V*D$uh!Z$P2}$jPhZ"QQVƃu WB VWVθL#PM&PV訛t uVhL#j蛴G 75裰75G75G75O1]5t^_^_WV΃=]5 ]5t>75t49t0I#I#9t"9t"QPhUO# 575]5]5^_SWVX#M8R&4R&VShX#hTf2("ujuVPjj"Pq thpL#01Q1L&$ =uh jj"t$ Y1$4(F"u4$# 1@^WVκʅ u1H3 r1P^_V΀=75u6=75tw t41t)Ph;50h;5hedAV xk^Ã=75uw Jt=75t775t.h;5hedAVp th;5hrdAVY t=|=5ujhP#jJhP#jUSWVPύAPjhjS#he2Gw4Q&hb#PhS#he2 e2w(hS#V w,hS#Vq w0hS#V` w8hS#VO w4hS#V> W4O<W8eS#9tQheS#hS#he2d"OHtQPhS#he2d"OJtQPhS#he2d"OLtQPhS#he2d"ONtQPhS#he2d"OPtQPhS#he2jd"OTtQPhS#he2J<$f$1۽ae2PjjheS#_wVhT#e2PwVhT#e2PGtmÈJ9|6{u;[tVPWhK#jD$(ffL$(D$ 1ۉa)D$u!)tPt$hK# L$4 <)ǘ΋I<9vt$hK#$N<.”T$9vt$h"L#$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$hSL#[ D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( t<5x<5t$(L$QhV  D$ 1hdT#VAtG<$h5"VR4(1>tYj:WZD$AL$\$h5"S ,1tD$hJ%W芒tkh#WxhT#Wb\D$PhT#W' D$q;75efr<5ujhz%l$!U3 l$Q&1tUP QFQ&r܉1hD$ Pj <$WhhT#cD$ D$t$ <$}trÉD$h &"UZ t:h+&"UH t/h0&"U6 t$UWhT# F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhT#wD$ D$D<5FʼnD$uf5;5l$u D$l$l$hR$W`hC%WJh U#W4h+U#Wh9U#W hJU#Wh"W܏ThZU#WƏhhU#W谏huU#W蚏UhY1"W脏khyU#WnhU#WXhU#WBhU#W,<w ~W|$WhU# T1<$@<5jD$<$rt$Wh~T# D$f;5@<$WhT#p75fr<5jUh;5jUh<5V <$t$ht$0V[ J21jD$ Pj< D$<5뜉1jD$ Pj D$<5q1jD$ Pj uuD$ <5J1jD$ Pj uND$<5#1jD$ Pj u'D$$<51jD$ Pj^ tt$W|$WhU#D$<51hD$ Pj uD$f0<51hD$ Pj uD$f2<5a1hD$ Pj ^D$f4<511hD$ Pj .D$f6<51jD$ Pjc D$8<51jD$ Pj8 D$<<5; 75sr"jW|$WhU#W|$WhU#΍L$$ t$|<5|$]5L$$ L$<5t$]5rh5"Vl$}}L&1ۋ>t.WLt t uPUW Á@M&r D$xm2MDHu D$"91hD$ Pj t4$hhT#D$ \$"r)Ut$h#V# hRV#D$1ۋD$<5ND$<5W4(t$|t%h5"V L$1Ҁ<tʉT$D$< w'<$$L&L$ L$<5<$tL$$L$ L$<5|$]5cL$$t D$|$]5L$<516FL$<$C fF|$]5L$! L$<5|$]5t8L$$ D$|$]5tL$<511A<$D$ h;51D$ ȁ(^_[]4$h V#D$ WVPθWEV;5l<5fp<5h;5 fp<5=75u=75u#$}h;5hgdV 1h;5hfdV y8t 8uv$=75u(PhmdVn xX52hQ 諶1=75u$h;5hgdV2 y O#1G^_ùqO#hZJ#U 뙃=2tt$ t$ t$ r a1HVD$ t$=;5thPh;57s ^D$L$01kVt,uVh-P#-t"uVhO#Vh $I<VhO#VhUP#^h]5hmd52& USWV8 $RPh h=5Q_]5 75v|Pt$hP#e lj D$T$1D$ XƉ 11 ‹l$?5 ]5=59=5hWD$Pq $;D$d"=|=5t =}t=}uЉD$$Q#=75tȋ 75=WEVuT$tf975rD$Pftt=75%4$t$Uh]Q#3 D$t=VEW=75$t=VEW4$t$UVh#Q#=75|4$t$UVhQ#=|=5$D$PSt$Ut$VhQ#蹶=75u $h75Se2V 575SVI SGSt$VhVWp |=5D$ L$D$11t4$hP#P98^_[]USWV T$ $11F1Ń=75|Uh5R# QPWD$Pt$_9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=75tUPhR# Ɖ ^_[]Ã=75tUhKR#$8=75tUhlR#ċL$T$tPh;511@PhQ#X[t"j QP uI8"t1H751YhQ#j躛PhR#[t"j QPM u8"t1H751YhR#jqSWV։ϋ\$+75tItEu751tGtB=5?5]59w1=5 1tth;5QA1@^_[VhR#j覚L$1=75T$ PG1ɅɉWV]5~( WRPh=5Q覑 ]59u ^_hR#uQVhS#j\PQVh1S#jUSWVPӉ΋l$|$uj WV Eu苈"9"t:M";L$ w,O>t" t9txm2DJ@t1^_[]WV1t>΀9t7h5"Vcl<t#ƍFh5"P 1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)WhV#Wh V#1۹]5؃^_[]ËL$9/up <5D$\$A/jPU u$D$ <5D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.WhhT#]5!Wh V#]51 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uhX#4 D$$Th(X#Sut]I"R&WyPWSz} '> uۀ$U-$T14S&D$XPG tpC"uD$TPh]##$T$끹{]#S&j" $eFMu SQЃ {Sh3X#Юh$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$hY#$./$PQhY#R~$ $u ~ˍ|$@WV/9t"b&J~PH k$LR&1OJH w@$tR& %B(D$ D$$l$ CtGtngtbcB8D$D$l$c%ɋB(D$(D$,l$(B%ɋB(D$8D$<l$8%ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=]5uHr8jVSWQiD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph^#蕠h^#舠~USWV|$t$t$h%"VU Gw4DT&h>!Ph%"V/ GPSh&"VGPSh&"VVjjh%6GXtVjj h&"6GXtVjjh*&"6GXtVjjh/&"6Vj Lw(h8&"V苡 w,hJ&"Vz w0h]&"Vi w8hr&"VX w4h&"VG wu 1<1A71Au01<  $jj@PD$P$D$ Ph $肗C9u<$u4f2H f2~e2H e2 he2j o1^_[]hB_#jv~fUSWV $ $ D$-@1]5]5]5]5]5]5$]5]5]5t$ hS_#USۣ c~!P$8U& ]5˃PtdT]=,;?1AJ5,; ]5뒹 .,;]5hd"n ]5b ]5D$]5T$:@=]5l,;D$ Tnt uBxou D$ 1Ɉ ]5h'L%Vgt]5hd"`ء,;$j:WS+C-]5tWuoctm繰]5S c$ \W]5t]5t ]5_29$ 1ɉL$tVh$P菟 tj/Uu Uh(2"h$h$ U8VjDžuV@jDž7h$P Ƌoh)#WQbt(hb!W?bthd_#W-bpV 1QQ$ 4PU7L$9C9$ $ 9tUilj?,$u1QhD$PQVW h]5hzd@PL tq$ PhedAWL Wm|$ W\D8$9",(V&uW{m^5,$h h 5]5P Ġ ^_[]h_#jy$Ph $jyVhg_#jyh!h!ʍD$ Ph `# D$ Ph`#jyD$ Ph:`#롍D$ Ph``#땍L$ Q4U&h`#USWV։ϋl$j Va UV CCCOK G^_[]hV&Ph`#hTf2̓jŠUSWVP׉΋tASM[WB[4$4(VS Wh_#Vt$ P' W輢 É^_[]USWV|$1_h)#S[_t$hb!SI_thd_#S7_u\]5toU3_t[u=]5t .=]5t%]5toU3^t [u^_[]USWV$D$|$]5d"tW3^t CÅush#t$ y^uD$$D$ ]5t L$ mt L$ ^$D$ D$hס $$ t$h$hV薎$0|$D$4$L$h'L%Q{1G@΍K9|,SP Ŋt><-u(GD$tj=VJ%t>FD$ GD_#th'L%D$Pu|$1F1B,$֋$$$,$D]5tPd"t{!P$h_#؎ xF1Ë$4hy$輎C9uj ˍ蓋t2ƅ|$t t$虸 4$莸 tA710h_#|$t t$d 4$Y ^_[]ÍD$jPV$ x!L$ȃtuuh""묁tlP PUh^"藭 끉 ]5utD$P$uW$P$[u"t "Pv vvh{b#hTf2較6X$SWV։ϋY Wss ss҃ Lc5t~j Wss ssԅuA Lc5^_[ÐWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉm PQ40940<8<8D@D@LHLHTPTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,4040<8<8D@D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7eVw wRV Fww>VFww*VF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu SCuuSCu$u S$C EDȉCDu,u(S,C(E@ȉC@u4u0S4C0EHȉCHudh'd#VŋFNd5tbSQP d5x @e5~,=e5tffOfGG@ Չn,~$N()ǃ~$N(=@e59<$D$hP-@e5>N,ș)N,)n$F(teh'd#V$FNd5tbSQP d5HT$<L=e5tAf=e5t4f.<$ ^_[]c5@e5F,)F$N($fOt@ c5븋D$L$t$ QPQPUSWV$$$ $$$(hι#SV\1j oD$SVWUhPD؃r_t~1F=e5tf)9F=e5\$tAf)=e5t4f=e5t'fL$=e5fVT$Rt)f~T$JR>>fD>=d5tq1@1$CD$ƈCCEUL$ q/G9<$u1A=c5=e5\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=c5t Vt$t$Ut$h;d#RV1Ƀȃ^_[]1A=c5t1=e5<$\$ HfUSWV $8$4}tE1ɉM4M019 d5‹DT 9 e5tRP蝰M$U(E$f M$E$U( u ^_[]%=uLId5(9‰|ǃ=c5t<|u=d5tFNFh1 td5tD$hVP |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =e5t RP蟯 d5I0VQRP6։D$D$ ЉT$t d5=d5Q8k=d5L$$tL$D$ =e5t QP! d5#8t@DQL!!IT u‹$8U t#DT tE=e5t!RP躮D t(=e5t1҉EU}@U=}@|$c5EM QPQPh$3WWhd#聇hd#'uQ{u u d5y0ƃ=d5e5t:tMPW?UUlCD$T$NQt PW语~V ~V hg#v e5d5@ 뛋5d5F8E -d5T$$tT$D$ =e5t RP9v0 I)؉$ʉT$t*DT tZ=e5t RP$8D t6=e5tȋ$81҉AQSt$t$tv<$8}@ud<$D$|Wc5E$8I QPQPh$3UUhd#薅hd#<$<t7d5Ht)$|$-d5Cq qƃ=d5t0FV=e5|$$tJRPū)RP跫4FV =e5|$$t&RP蕫)RP臫)FV )FV hg#R e5d5@ USWV|$ \$t=e5tfPhif#>=c5tqPhT"}>1Ƀ=d5DT =e5t RP&RPhrf#G> =d5tF(F=e5tjP|tPh}f#>^_SWVD$H8=e5t3P PP0p4u'11C9}QBRQp< P0p4^_[USWV|$_8+t]Cw=d5RMT$=e5HRP蟈9L$0ơd5@0 T$D$=d5D$0T$T$4=e5t$$t RP=Mt$t$$=e5tȋMD(d5@0T$,‹t$(΃=d5e5t+tMVR؇uVFt$t$ 过7KVR詇MQ AD$:MQqD$T$AQ!EL$DT=e5t1ҋ d5q0RP耐 ƋL$ jWSQӃ=d5D$ t7~SPt$t$$NjT=e5t RP|$)~SPt$t$$x=e5tȋ|$1҉\$$ t/f d5q0RPݏ xËD$L$ L$0|ád5@0 T$ʋL$ȃ=d5L$0T$D$t!D$4=e5t)PQ6D$ T$8=e5t@ɉL$ D$ =c5t h]i#X=d5t h{i#Xhi#X/=c5u hi#WX=c5u hi#W3=c5u hj#W6=c5u h&j#W<=d5t=c5u hEj#WT d5|$Y8֋T$  SP5Le55He55Te55Pe5h`j#Wd,$kdыd5@DWSQPD$T$iщډWSURjj RPo&RPt$t$t$t$t$VD$Phj#B"$=c5 d5+8e5 m#*L hRf#xu/SU=d5hhe5P c5 Ǿ`e5|$݋\$ =c5t$@TD$,=l$$@hnm#9x*SU=d5$5d5F4 e5fQPq Ǿ`e5|$(D$D$T$0كD$9T$0Љl$(V Xj he5P2] D$ D$ {~hq닅t)fQPIqf $AQf $AQ F4D$ D$f9^d5D$@0T$ t$QPVR|ʼnׅD$,%1= ̓|$@%=d5$T$ L$um=d5td t^;9иrN $yhtEe5Q(=e5t=ʋ d57=c5D$ WUt$ Ph}m#ZD$L$Id5d5jRVP{ =c5L$$t$ \$ t(Ƅt$S$PVQhm#L$<VQjƃ(S$QP: =d54$t 1FFFhd5\$ T$ D$(x+9‹T$ʋT$ r=c5D$Xt1NPSWUʼnFظ|߃\$ <$w4Fd5<$t LX FuWFsT$ Pe5Te5$@=e5tfL$fAf|$l$$j ', hX d5d5T$ =c5t| $=e5t RP mRPh5n#l=c5gq$ʋT=e5t RPlWURPVhm#($DX=e5tPhn#c5hNn#Ehm#frT$ '|$@@u' T$t$SUt$A Xe5t$D$, F=d5=d5$@=e5tffu$@=e5tfft}SU{$@=e5t?f=e5t/ȃ=e5 $ApfAAt$f=e5t $ApfAA $AtfA1ɉ f5 f5 f5 f5l$T\$Xd5pt4$9 e5t ʡd5 e5$tt4$tʡd5 e51ɉ$dtX$t $D$LPt$衹=d5=d5t=c5u,$$@\=e5tȅSUhhn#C hn#,p~SUؾ19 e5t1ɉH\H`HdHhHl$f!B=d5,$(E\=e5tȅƄ$E\=e5tȋ d5I0H111҉,$L$ D$t ߋ d5Y8Om\=e5t͋ d5#8߉@DYL!!ÊIT u,$\$lD`Td t<=e5t RPiD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9d5H4 D$|$׉D$|$=d5t݋AQ=e5t-RP_h!Eh=e5tȋt$|$1҉11 ˉl$$WVRPSUhn#uA=c5tho#iht#m|$t;SU蕼ƃ=d5D$|t1$=e5t RPgFVc5=e5tȉFhܽ$|$jj$$$$SU z $A`Id=e5tEQP,g $plphg1$D=e5tWUPVhm#  $AhQl D\$C5d5;^,T$$L$ f5f5׃ƃ=f55f5 d59˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-d5t$| ؋T$(tu3D$1 Kl$@؃,Ut$H/ ƋD$9\$(s+l$ Uhl#>joSWUt$@hl#hm#m=j[sUSWV |$ ow@u Xw VUp D$t|VUh5u#w wf5 f5ʃǃf5=f5|$ |:w whl#= =c5hm#qjG $D$|$tjVU¾ 0e5<)1CVUhs#D$,p p*f5 f5ʃǃf5=f5 j o" hp d5tHd5 d59tDy1Y1 t 9u,He5Le5$|$ ,d5d5Q1I1 ы|$ td5$G0W4L$Aڃ]D$ p phm#J< =c5t)hn#d1C+c5h*m#;hm#h1Ct ؃ ^_[]c5jpjfUSWVP$T$1B@B 3 d5f5d5x,11=\e5t>Q:d5x,$kd1PWSQho#hTf2 \e5d51ۃVU聶tzljl$ t$d5pt=e5tʡd5 e51ɉT$HtttȉD$LVUz8tD$PWbu(Cd5;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$f5ŅtTM1ًU1 u3VShs#w wf5HPUMpXf5 d59tmu1 d5ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $W&ho#F9hc#eh.p#ejj聴=d5e5f@=e5fh=o#8hc#eeU1hPVPVҜ1Bhoo#8hc#'et21VWhVWVW莜1 tahTo#+7c5hm#du<tf@=e5tf @f=d5tjjxfh<= j5d55d5*T$1B@BO= -d5d5  $\e5$Wt>E6+5d5=d5kdPWVQho#hTf2 \e5uF$ho#vv 躑 @e5A1ڍF$h.p#cvv 6ǃ=d5F$ e5&jPR]1 @e5I F NQPQPhSt=d5F$ @e5t%QjPShr#ho#>6#c5QjPShr#ho#36=c5thd#^=c51F$@e5 I1)щN$uh%c#b-vv *ǃ=d5F$ e5$Wt jPC\1҉GW1҉GW }hjD$\P趺 =d5e5D$tt7fD$T@jv$[-fD$T@jv$[fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=d5$tD$\=e5tL$Lu$D$PD$PD$XPy\e5;,$/c5$W= e5v e55d5;4$]|$T{$AhjW薸 -d5=e5tt0fD$T@js$Y&tPfD$T@js$YFfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=d5$|$TtD$\=e5tD$L$|$TtD$\D$PD$PW٧;4$=d5;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h2p#ss QPTh.p#(^t~s sqf@fNCKK CQPh"ss oOCK =c5thp#ss QPCKh"QPss fN c5;<$=d5d54~^1ۋ/uu q]]8u9rۋ=d5/CK tS  StQP HKX9rjj轄`^_[]c5j&ejPho#/L$D$@, +A,USWV $0 n8$=d5ui=d5t`E=e5tȅtNE=e5t$;8e5}t8hep#v v贇 h.p#Yu EBc5F0N411G9 v vGD$@=e5tȍL$A=d5AAhh"Q蛳 e5 d5 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=e5t2f)=e5t%ffD$=e5ffe5 )fD$1fM$0 A0Q4MT$ tjQkfHD$=e5tfPjUư D$fEutEh"PEl$L$Aq $0 JR ωtljhp#RQUW݅l$EMك9v%}EPhq#*)q#hp#qWD$$0 T$ 3F0V4=c5h r#SڃD$=e5t΋D$p@ =d5X}$0 ~hp#v vڄ Eh.p#VJc5Bp#$0 1GPVtXD$T$ F0V4=c5h r#PRڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUVb D$fXSPU|b E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQUb $EtMw\}.uVV4~0|Juh;q# } .u8hKq#v v% Eh.p# U4$F0V4=e5tȋ )"=d5kdPWVQhr#hTf2[\e5}ww cO W $T$ WGO ƀÄ:1=c5t4=e5t+=d5t"uGO 1F9ƺw1 tbQPc8uS=Xe5xJ1v6KNj@ $GD$wOG tQPb8u E;-Xe5|E;-Xe5=4$h d5d5tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$# BVh 0#H-u hx#*ld5 h P5d52 5d55d52=e5td5PP"C5d5, d51=c5td5PhBx#Hd5tZe5u6t2=g5u!=c5sx#t,#PhNx#41OB c5uhxx#d58< ,e5(e5B,8e55d5 d5d5hKy#hpy# udd5ǀh P5d5- 5d55d5,=e5td5PP>5d5 d5d5@ d5HHщ8<=c5tho#=c5uh.p#u_h 5d55d5& 5d55d5&=e5td5PP75d5' d5Dd5d5D@RL҉111C QPhz#[ d5HLщ@D=c5tho#=c5uh.p#h 5d55d52% 5d55d5.%=e5td5PP665d5@ d5Dd5*HHPLщ8<҉@D1ۉd5 d5c5d51Ƀ,=c5hz#1L$ d5L9| 9Phy#d5=c5tho#T=c5uhpy#Ih 5d55d5# 5d55d5#=e5td5PP45d5 d5Dd5@hz#L$>d5d5ǀ,04ǀ(<HHPLщ8<҉@Dh P5d5# 5d55d5"=e5td5PP45d5 d5Dd5 d5c5G?d5L-=c5th {#:h4{#7d5d5ǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5d5! 5d55d5!=e5td5PP25d5 d5Dd5=Dd5t}=c5uth 5d55d56! 5d55d52!=e5td5PP:2d5ph5d55@d5  h$d55e5=d5VheLVjPl G011D$)9|ËLG8 $HLOd t1SRPV5e56t0|$u)h{#hm#s1AL$=e5tLSVV36 d5A8$HLId t1SRPV5e5U=e5t SVV5 =d5G0ŋ $A9,e5 (e5ʃƃVh0e5VjP'k jw,d5y9  <:PVQ D>/|)Ot$L$6m52m5$!D$h8Jm5$ D$tB?JL$h)PRQSWVD$t$ d51ɉSh#=c5thd#phXc#lt$" d5QP#T$1RQQD$P1Aád5;X0t$~~1Ƀ=d5T$DT =e5|$t RPL$ pL$QSRPvǍPfm5$|$1D$D$t1)ÉعF@jPԖD`r9w<$r$l$T1C @<$9uG<$;|$}d5X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡd5@0)ȃ`T$1ۡm5ـ#hA#b=c5tho#h.p# ع`֋,$L$t1ɉȉD$ օt$ tH d5i0T$,RQUt$> d5;A0l$,} $L$l$l$,d5@0D$Mt$ |1TT1PD$T$ ʃ=e5t RP L$(ωQM D$H 9tet$C9\$t$$hY# c54$F4$;t$SD$`1c50^_[]ËL$ ʋ d5f9u Sh#褤D$`,t$$h"#lj:i d5Ph#CUSWVT$L$D$0(D$ X=e5tSUʼnӉ OD$$d5@09ʼn} t$t$5D$PSUt$< d5;A0 t$~QPSUs~t$4SUWt$T$LtL$A L$ Q5e5t9RPt$ƉT$ t$1ӋT$1 t<$G RQD11 u5\$$9t ;D$t`GPD$ GPWTt RP$<$G L$;L$t9ta щʼn$;D$t`1h#辢^_[]USWV d5$d5x0UWt$0t$0Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PR m5T$4$1B srl$,$ ȈU1wX=e5t d5!9GX=e5tȋL$,1Ph##蚡 m5L$ $  h #y=c5tho#h.p#t$D$OPWTP1GTGP^_[]c51USWV|$,u#tu#d51@$d5sll$d5td5 L$  ƍD$1PQQVK9 d5;A0-T$zu D$`1]l$z$Ń1EGpD$hB D$ Pt$ u&xMt(T$hB D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWht#џ=c5th#Ih#Et3s ss3st$Vn[E;,$uc5b$tu"Ph"#0jcUSWV0\$T|$HOX=e5t1D$,D$(D$$D$ D$D$PL$Qs tPst$OGe5҉L$D$td$PQ\É׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQZC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h #{'h2#h#h h(#msPhr#^O4$V0Vh #h#h h#h܇#hWVt$ F,t@m5th)#F,P31~,>d9~8uv0^_hH#h_#h h(#rD$x,u@Pt P߇ׇhr#h`#h h(#yrWV΋I01t*N8~2IN8tPQP P茇N0G;~4vɃ~8u^_h2#h#h, h(#rhH#h#h2 USWVEH1Bx,T$1hvM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vS襆e^_[]hs#h#hF h(#:qUSWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]h#h#hK h(#*pUSWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]hs#h#h` h#h#ha h(#oUSWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]hs#hʇ#hq h#hʇ#hs h(#nUSWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]h#h#h~ h(#nfUSWV\$$|$ l$t$m5t5e5SWUhB# YUSWV5e5 1^_[]USWV\$$|$ l$t$m5t5e5SWUhs#XUSWV5e51^_[]V=c5th#Œ2j5m5Htah؉#腌hm#+tSm5xL~61 m5 s"@Pt4h#,X m5m5F;pL|^5m5vjPm5t'x,tPm5Pm5ám5t x,tt$t$t$t$P1WVt$|$ VW=d5dtX=e5ts,d5`uau33 u1@1^_WV c5t1 m5 d51!`u/aʀs2hlpx1Ph%#ԊPh[#hm#gJh@#蹊d5 ǀdƀah P5d5 5d55d5=e5td5PP5d5Ѱ d5d5!1111QWRPjhm5hhw#hm#艶lh@#ۉd5 ǀdh P5d5 5d55d5=e5td5PP5d5 d5 d5dPs+aʀu Ph[#Ph#hm#蟵h#d5ǀdƀah P5d5 5d55d5=e5td5PP 5d5 d5^_j0MUSWV1L$ AL$HAL$@AL$<L$ j&L$A j&Aj&Aj&]u }h#SV` ka~(bt@it YltAsttuJD$PW,5uVPD$DPD$DPD$,PW(D$HPWC# D$ PW$uh[&jƉe^_[]Ãu95_2ujhj&D$P襙 u1PPD$Pje95_2t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQRPt$8t$@t$8t$@W1u2h#R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]S^kt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ S t$\D$Phf"hV^D$@w ww7VPh#S 1hu#+hNj#WfUSWV1L$(AL$$t$@L$ D$ }] hM#WS\ aLuKVbtit'cD$ Pu D$(Pu3 D$$Pu udt AuZD$ 9_2u~]#D1غ$Phzd@ tN|$$tOh0[&j[t$ xt$@x1Oe^_[]h0[&j'11J$THPT$,L$(HL$x1VVVVV]PeT$4 @T$ƋD$(D$8D$,D$4D$$D$XUSWV \$$|$ hj+bƋD$(D$,(D$0,D$4$D$80D$<4t1jhVPW2` <QP($#D=$؃u E:j n1uaWhO#QhWV hd#hp#V7t P hJ#VVg1 ^_[]ËM)z G1SQWD$P9|RPh#Vy|$$tRPUQWh!#V؋T$RPV(# 8D$11WWPW1@PjPV؃$jS $jQUWL$f@ t$h֏#V Uhd@B tYMɉh#rRhd@ t4O tGʋM$8hL$h|#h#jV !tH h#VG1Ʌ A I$ 9؉$jQPVZPL$T$ D$$jPXUSWV Ӊ΋l$ jURQtn=Uuq1tu@ yyu݅tj ud1PPhܔ#Vih#V%tUSh#V;Wd\tUSh#V |USh#V1@PWPjPUSV} D$@\$4$1= uD$ Pt$h #t$  $|(1RVRUPQh(#t$] #(#PV1H^_[]ËD$P ËD$ P SWV|$ËL$T$D$@f@@f@փ|fp fx^_[ËL$D$@ @TD$ A ËD$@ @TD$A ËD$ @ @TD$A USWVD$ t$hx t11t0Vh#hTf267D$4C9u@Ph/#S(V#D$ td" V#d"$L$Ru0QSh`#hTf26D$<r31F4$t0t$hd"Shu#hTf26D$@ F9u1H^_[]ËD$j$,(USWV|$(jWujWth#W1Nڃ^_[]1VVVjW tSӉ$Ճ$ՋD$49L$0t$,s,11Ʌ,Eȉ h#s,$ʃЃ,$9Չ|ˉ$|$(W xt h֑#'HP ,$9|ډȃ u h#$jjjW>$\$SUVjPjt$ t$jjW: X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPNDE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q  H @AQ@A$Q @QHALh#S[h3#hS#USWVP\$|$tus$! $ "$jStQ1@PVSjPt$8t$8W E1u>4$h#W VtZSh`#W4$h{#W 1H^_[]UWV} uOʃ,;|RQPhu#VJPR"x& $T$W1ٹ|$5,;h# 5,;hL"VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhj&Vu 1OujV5,;>uW?,VQ>~Ih#Q1$VQ7 t1Ph#Qx 1O^_SWVP|$1N?u;j S5,;H 8u1u5,;hL"t$ ^_[WV|$1N?t5,;`1t^_hF#t$USWV 1O1;B։ˍD$ j P5,;;J уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5,; x(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,bjhj&t$r$ tjVt$r$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0wh̒#VIz1t^_[]1;BB  Fjhj&Pq 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hܒ#W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Ph#Q 1HUSWVt$|$ t)l$\$$jWUS). tWUSh##1h#V*l$(\$$jWUS- tWUSh\#V1H^_[]Ã|jWUSL11USWV\$1s3h'L%5,; t^1W_&tuWh#t$ 1N_&_& Ch'L%j Džu^_[]WV|$ _&_&Wh#)u^_USWV t$@\$D$ $t|$$L$|$t$,t$4RQ. L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh`#P%1D$Bh`# D$_$ӃD$DL$H(X,EP!t$@E X,L$H(u4$t$w7t$Hh#u1fUSWVPM(,|$8O] D$1h#uS sujsWVVuutqD$9_21t$ t h#hȍ# 1A AAt$Qhf"hVVh#h%#h3#oĔhl#Z|$uhusuqVhv#oh܍#2uuulhb#b#td"PRh$Ĝ;8jmWj$VzVhf"hWWh#Đ^_[]USWV΋\$$|$ ʉl$͍L$jj hd"UPjQ( yD$SWVhʢ#O|$tUh#:j P ^_[]USWVDt$`l$\\$XT$1 j&A j&Aj&Aj&B0k#` hx#VU k)Hw]r$uStJPSu7HsutPD$PS uh$h&jD^_[]1Hu߅tjhj&D$P9 t9-_2uPhGFD$PS벃luh7%1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uh#SW a~bt)iuRt7D$PV"uUt$D$PVtD$PV8uh8h&jռe^_[]Ãluh7%1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=_2d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H Pn5H Ln5@Hn5 Dn5hDn51Pn5FLn5FHn5FDn5F^Vt$|$uD$ hTn50`n5FD\n5F@Xn5F D$(vt$(& ËD$1AL$D$D$4|L$L$4|D$D$lPh#S P|$l$PhGS"S ($Ph#S` $Ph#S? $Ph#S $48VhJ%S $Ph#S $Ph#S `$PhƧ#S ?$Phӧ#S $Ph#S >u$L$4fL$fB$Ph#SE $Ph#S$ t$( Åt$(: $fǀU1PPPE蘔!ƒ[u$t$R ;$4t$8蚍 D$t$股 fËt$01 |$lD$PhJ%S$ D$lPt$WD$Ph$#S D$|Pt$#$Ph$SI `$PhQ$S+ B$PhJi"S  $D$Ph$$Sb tj$$Pt$ 蛔 D$DPh#Su D$D9M$ $ȃhL$pQPj t$ Åt$H U$61QQP詒!ƒ~t$ M$$VP] 9U]$|$$D$jRPK!ƒ=M$$VP 9E$1SP|$W2 GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$#-T$0L$4 tH)Љ|M1Kɨ8/$;诨81$;tyh)# VjhG#Ph @%hM#L$(D$, t )|1hG#Wh @%t$;|$tv vSj n6D$1P=@ ^_[]h#h# h6#hf}%jY USWV $Sh@l&U觋 Ǿ`m&󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAHT2qL1ATAPAXkiA\V#A`i Adf#Ah!i Alv#ApRhQ$0$0 ^_[]ËL$L$ USWVuE X8D$Phu"V# |$V V 'C 1Љً'L$I$1 sD$P 6D$D$ t2t$ ^ {uWvMu{u C $\$uoh#D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$ 苀 E0t!t+M4S9rQSPe 0t,h­# MHtU4uL9rRQP7 t$|$t%u@uhV} tI81tSul|$tDEM9rQWP u@u`V7 u@yu@u`V! teEptUt$8ЃtEu8uXV~ t, ^_[]h^#h:#Ah^#h#5h^#hw#)u\u\hح#udSh#j袬 wlh $jì fUSWVt$J 1tvt$K t[S tCPU Vt$M tPUWN uWf S轋 1S谋 WI ^_[]USWVu]Ph~#S t$f1j?1Nt}ǍD$ Ph#S td\$ t\hjD$P} jS\$S ShiWb} t$E L$Uf jQh~#P je^_[]PPh#t$J u1$YVPt$ t$t$V tPh#V u1$^USWVt$t$,K t Nj\$ Pf 9v=? 01N*Ƌl$Wf VPU} )SjU| ^_[]USWVt$t$J t?Nj\$ Pe 9s9Ƌl$We VPU| )SjUR| 蘘 苘?1N^_[]UPhSn"u t$Q1H]USWV@uPh߭#Vg ] hI#VI tPe |$ P\$$ShiV\@ |$ jSGc PhI#u K VI ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jPb t!PhI#SiK V 1He^_[]h$hF#hh#2WV|$$hI#WH t;Pc u1Vc jPVz VhiWQ? t^_hS#hC#jVh#hu#j4 V|n5h2V V n5hxV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh#hV5>tVhڮ#2V蹉FߋD$t$j7QPh#hV>tVh#VtF߁^UVuPh#V t3$L$ AQhiV= u h#B1e^]h$h#hhu#3UVuPh9#VE t3$L$ AQhiVe= u h=#FB1e^]h$h4#hhu#UWV}W#ƉPh<#W tZt4$P<tW@PV_ tGPhƵ#u SH t>V1e^_]h$hH#hhu#!h#hH#hW# hH#hq#j} h#t$E tPhƵ#t$G Hh%h#hhu#WVPt$|$D$PVW tKD$tUhm#WGE tPhm#VtG H^_h%hε#hhu#Nhε#hw#j轤 h#j聤 SWV$h˱#SD t]P_ GAsdWt^WPh˱#StNpxPhiS3; u?V1蝒1HĐ^_[h#h̶#h#jУ h"#j USWV 1CCj7Shxi Pu uh?#?,$PuhX##Ɖl$D$Shxi WXu u h~#jt $L$9~D$~*1t j Sh $G;|$|j Vj軴USWVH,x&D$@(x&D$<$x&D$85t5u#D$1D$11D$=t5D$(Pju h#|$T$(L$,T$։L$ ȉƒ\$06eĉL$T$|$|$ɚ; t$D$\$=t5u11D$\$W|$|$ |$|$|$ |$ ʚ;||$t$ L$ӋD$D$t$\$\$Ë|$t$ D$$P" u h6#j辡 t$ D$D$t$$1|$\$F = 2@O9t uGtMF L$u@T$(\$,T$ 3T$3L$ u L$9L$0 L$9L$ \$ \$} VЃuGt^VЃtTjD$ u Wh/#jV PD$L$AËD$L$AËD$L$AËD$L$AËD$ 2 21ËD$ 2 21ËD$ 2 21ËD$ 2 21ËD$H@ 2 21SV\$ Sh 2JuCЃ r"CrCr É01H^[h 2}H?r 衉 ؈ 21ыL$t s51ÍAЃ r)Aw AwÉK1HUSWV1t$ D$hVPl 2xs5t8u^s5ǁs5s5s5s5s5s5s5s5s5s5s5s5t5@wh 2R&uh#0h 29&uhԴ#ht 2 &u h#jЙ $5 2tvh2%61 t5 t5 t52tt 2$h 2$U= ƃV B~>CN t5F v/FwD$n&t5Au"h #$n& t5xu>Wu4D$P1VhVVj V5,;mV t59t$:*ƀs5l `C Lvms 22u$2t5t5rt5t5D$P1VhVVj V5,;U t59t$taY t5> t5Ot5CatTl5$2+wtz29t 2 2$ÿ2؉$2_2 t5$u =t5uB=s5= t5= t5u|t =t5u =s5uftu^t5uS$ttH)ŋ$L$ T$ RQL$QWPU%u$2 u&h!h#,5,;h.`%jJ t$PD$P & u h8#D$t,DtVPyDžuh!hE#JW WtS)uh!h:#Wuh!h# 2t H9t@h!ha#$@ t%VWЃ$WjhӰ#h!h*hu#USWV/0 uh#h#j; Ƹ 2jmPCd"d"t#jL 2PCt#USWh#hTf2苯 2t VSm##ud"WWWWWQWh#hTf2E$Vo j2V 21tT$q9t Iu^WVΉhjWsf D$Ph#V tZhwc$Vn4 tQPO L$PyRPQsf WhiV* u h$#/Ĕ^_h%h#hhu#=WV h.#Q3 t;PN  u1WN j PWe Whui V^* t ^_h#h#hihu#h4#j> hޱ#1ÃD$ 1ɉJJJ JJ BRhiP) t1h#j $1ɉJJRhiP) u 1Đh"#j覒 Qh 2AUSWV΅t R/ - - 0($D$P!\$D$1t$$tsVxsD$tVPxVh#W8 trC= t5D$uCt\=t5uCuM=t5uCt>=t5uLhj$Vc VhiWn( t!$uۋt$$4u=t5t ~ j he2s!GWt& 2ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhv#h$VVUh#* jl$U$V賹 Vhit$!b t$,$t!Ph#Vh#,,$jt$V^ Vh~it$a t$tPh#莨j 褧ꍄ$P$$ j:QPh5#h$P!$t'$Uh#UqE}uj:$$h5#h$PƼ$t'$Uhͳ#跧U>qE}u- 24$tVWUmuj|$W$V $$ DŽ$@Vhit$Vd` u$ hڳ#,1@Pl$U%jWl$0U諷 1@D$81D$^_[]h_#h?#j h6#Fh"h:#:h"hh#.h"h'#"h#h#= t5#t>#PjΉ USWV Ӊ΋|$4h.#Q) tPE 1EUhvi Vv j UeC Ph.#S+ Vid H ^_[]VD$tLd"t$jj QPRjVB V @#uzd"PVh#觡-у d"t@#QhWs"PRh "h#x ^WVΉhjWZ WhiV tD$Ĕ^_ÐSWV$h$V( u6h!#V( u$hZ#Vu( uh#Vc( tD t5 t5=$t5!lj= t5hjSZ {Sh7iV t Đ^_[he#j‡ Vt$V臣Ph $YtVtPhr#6t$V9t%L$ PQh$ V'L%uߋD$=rPh{#^USWV$WW1ɃtQÉ1 jVU Uh8i(SX D$ sjPQƉD$$Uh8i(SSX :t$ޡPhƹ#h$t$D$;D$t(h$h$t$ ej)j \$#|$h #蠞1Ay&9xu H uhz%st$(hjVW Vhi$ St$<\$8h #.#=x&Qt8u 9A uVh*# Vh#誽1#X4hd"h$踝 j Μjmtz D$ ~[11ۋ!9uIuU4Phҹ#fh#Yh#4j _D$ 1AC9|M rV2ļ^_[]Ph#$h#h:#h!h# h#h#j% Vjmu(t5hVV2^h#j hTf2jjHhB#Y3UVuU OPh#V` t!# t5 $ t51e^]h$h#hh*#USWV(ӉQtoh#U# t t5H1 Rh8i(U u q8uIjh#Sd t)D$ t5t(^_[]h#Vh̺#j褂 h#h#h#j輂 SWVt$T$;h$V" t\Ƌ t5P= V= PWt+Ɖ߁PW}t2 É t511H^_[hq%h޺#hh*#裯h#WV֋|$ QwVWPh#jŁ WVPt$T$th!#V" tkP9= V< PWt>ƉPV5 t5, ǣt5VQ1u t5$hdE#Z1H^_hq%h#hh*#ͮWVPt$T$hZ#Vp! tbP< VV< PW\tIƉPV5 t5脟 ǣ$t5V1u! t5$hdE#2o1H^_USWVt$T$1h#V thƋ- t5P; V; PWt6ƉPWt>V ݉- t511H^_[]hq%h#h2h*#荭h"fSWV|$ t]n1H>t$|$\$j_D PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$VK9 tE$$PwCt/$F ~G F1m zm 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QPR Ɖ׃с11E9r l8"t$8tl1H^_[];sC| C 9s} l"WV t/t$ L$Ps(,tD$$F ^C F1sl USWVuD$ tV} ]CtP7 tEC tP7 u/D$ PhSn"7J u$D$1$k1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$Vt|$,$h'L%WeD$%tD$1{tj/t$tAL$L$4yyyyy D$AAD$ PQt$ t$ htsË|$D$4t'u#D$XPt$D$4D$4D$ PD$8Pt$ t$ ÅuD$ xkj1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxri1X \$TfD$t7|$0j WP t9t1ۉD$=r{i"11HD$$P趽|$1OL$L$D$L$T$PQRh#VV 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$PRNjD$fVSP_L sD$ t Pj4$W3 W舼<4$uM S]s {te|$t^t$Vt$t_@PWN3 WtNVsE0 ߉Vu>T ۉt3EF ^C F1Vt$h#h#h#hW# h#hq#jx WVt$tV[r4g1H^_Vb t3t$L$|$ Pwt΋D$F ~G F1f USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'e<$t@1@>e.1-t P%R 1GG GGme1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7 t+{0t>-uUs\t>Vs\t)ud wd1H^_[]Ís s(CtP7 uCtP7  t1@뿋C$1$`z&4v6C !6Z P:  v6 tMtk $t$ 4$UQu jW- $L$ $+SjQhUPW1f|$0t,L$f|$ 0t,D$ t/#L$ T$QUR$6QPh#E, ^_[]hTf2jj7h#jhIit$  t1h#jIl WVt$ H 29tEtt#h#jh USWV$$$hjU: ]UWVjĜ^_[]USWV$$8sjjljP`\$hjS5: jVS; X#$<uٝ%$D$sVNk }EyPUD$(P: D$ED$D$PhiWT9 tjD$@:$<tkC 1Ҁ= t5R1RRh$3RQP^{u7$#t-$#Pt$hɢ" h#hA#$1P(^_[]h#h#h#h:# h#h2#jf USWV$GPRt\Ƌ$hjS8 jUS辏 D$yQWP8 Sh iV8 tD$,T8+t hf}%j f T81t T8/u 1Ĕ^_[]ha#변=t5tt$t$$Phq#z~USWVt$t9|$\$nUShLuF H9uPUfu 6u1^_[]ðfUWV u|$ jtRPh#V t($fD$Wh9iVl 1uh#}S1He^_]h#h#jd UWV(u|$j[D$Ph#V賱 tXjt$W8 D$8t!D$Ph#V4 t)D$fD$$Wh9iV 1uh#R1He^_]hݽ#h:#j.d WVLt5h 2VVTt5h˼V\t5hWVW^_VL$jNt*D$ $ut#tRPh#C| ^hTf2jj#h#SWV׉1B BBfBQt&jh#P>I uxm2KDHu|$t$1H^_[Wh:iVT 1h#jb Vt$D$PhR#V tPhiV t 1^h$h#hNhC#h#jb VPt$ D$Ph%Vɥ t!D$ Pt 1^h$hF#h4hC#踏hO#j,b VPt$ D$Ph#Vf t!D$IPxt 1^h$hj#hAhC#Uht#ja WV$t$0j!jW3 D$j Ph%V袶t$WhiV t1$^_h#h#j7a h#j[a UWV uPh#V t<|$WhiV t=$D$WhiV t)1e^_]h$h#hhC#ch#h#j` USWVx$t$xhVh]#W&^1@D$D$1L$8DL@uVh#%jVh#U u$D$ xm2DAt\~:uVЍ\$C1|$8+jPWh'L%Vƃ uր>$t^h#D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh3#jY_ M1Hx^_[]h#h#j^ WV0t$<|$jWhK#V萴t8W t7HfJBRhiV t!10^_h'#h#Wh2#j^ hc#j^ SWVdt5h 2VSlt5h 2W@VgW^tt5hV3|t5hWt5hSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW/ Whi$ U $!h9# v$HQPۍ\$4|$fGWhiU t$@#f|$*uJ#= t5t PufD$(WhiU t$S#f|$*u]#= t5t Pgu|$fG WhiU t2D$*=) Phh#/u= t5t hp#ufD$(IWhiU> t2D$*=) Phv#t= t5t h#t1Shi8U |$Dh#t1tPDL@uShi8U t$HuM1|TuD@uD$L|Cxm2L$P9Dzty:t|$jQh#P uVh#s11t j, sDLxPtT h#sv<u h.#sj r$PhiU tDh#vs$t$h#Xs h"Isj _rPhiUk D$tPhiUO t|D$ D$tTD$HT$lfJRջ Ph#r$=tPh#rj q$=tPh#r^_[]Ph#jY hTf2jhh#/ ÃD$1ɉJJ JJ fBRhiPm t1hc#jfY 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h3#jY USWV,$@$PhiV tr$A jjj" xgljj2 xi$-hSWJ xB$/uE$0uf$Ciu.h#K1H h#6h۾#*WqK 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'hB#ha$h>#h9#h#hm#hs#QL$4Qh#p(D$f($-D$](E!L$:!PS E Pи $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q t5t t5Et5tIAtcAtCAtPA tSA@tBAyAAT$ht5UWt$PVt$D$VPRRhG#n,l$ }"E!Ê<)\<${&= t5`Cs|$[VPWl$Phr#h#@n#<*<0<2= t5<$x#<t#sQh $mӤ"1L;d"y#QRPhg"mG'L%9u<]K%C=Ph#h $xm= t5S<$CPh#VmKPh#@mK s k t?L$D$F#PWh$m N]%܋L$D$(Mu} L$D$D$F#PtPtPu/## "#I"QPh$wl N]%D$ŋL$D$(ȉ</= t5%<C<${&#= t5CPh#= t5CKSRQPh#hſ#kC~@sFNuQPhٿ#k IRQPhϿ#}kMuj>jl$ L= t5?CPh#Ek(sh#h $*k= t5<$CPh#kKPh#jCk tAt$D$x#\PVh$j O]%܋D$t$)E}twt$D$p#ttu/## "#I"QPh$Bj N]%D$<t$)ƃl$ rPh#jj>i<$€#${&#rQ=PuJC<u;h#h $i= t5yCKQPh9#zi ]= t5Pȹ#6<"<(## ######## ###h#h $h= t5<$CPh^#h1D3 d"t#T3 ׃l3 URWPQ&hl#Qhuj>_gl$ <.###CPCHÃ)gj gEŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]h#h#jUN WVD$(1www ww7fWfGfGwWhiQ6 uh#1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQ! ;l$D$tD...P0^_[]Wh#Q! 1<$tɍGrD$X1.Phz"S E;,$sGwUSWV։ϋ\$Qh $fW/)Ǎ 9~)jd^_[]ø wl&øI"øSw&øI"VPt$ D$Ph#V苍 tD$P^h$h#hhC#yVPt$ D$PhT#V> tD$P^h$h#hhC#yWVt$(|$WhiV tgD$Ph#V֌ t7D$D$WhiV 1uh#1H^_h$h#hhC#xh#jsK fUSWV8D] y hz#6h~$y1 y h#jh#ht\=L$jQP D$tPh#jh#h D 21 VPh  VPUSWQRPh`$1EVRQUh;BVWhF. 1H\$(C CCVWPPUPP P P PPPPS8VSj; |$www wwVWj/ VWjs/ V< S< W< D$ @ )T$VVQRWPh1I9u 78tމ5t5 D 2tщ1@8^_[]h#j .jj,^ h#?^ u8#jVft#jh1#h#Vh!h}$ø j 9.j 2.USWV`~ZD$=t5tIt@ƍD$H@ L$1jQRRjPjut$Vh#< 1t$HFFF FF1G>\$SVj- l$ UVW- *ƅZD 21OjUj t:9uB$=h#jV3:  68uh D 29tttn1VSjC- VD$$Pj3- D 2vhK#@jjj 1VSj, VU6hz#1=D 2u$=|$ u'1VSj, VWj, `^_[]Ét҃t̓ u1Ht$8F FFV7 Ph#u1#WVOdt#D$8x xx8WPV7 !{jh#h;*#1~ }$SWBD Wh'#j: V+SWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP+ $H $u˃^_[át5H t5t$Vt$VNPh#ij V*D 2VPD$$Ht5t$ I?r3$ !P$Ѕuσ^PD$L$ $QPj סXWV1N=t5tED$@ L$1҉RRQWjP輞t4$ h#^_VQ8 jh&6 jV6 tPa_t^VhO#>j)Vha#)j)PD$L$ $QPj$ XPD$L$ $QPj ֠j XÐUSWV$$D$D$D$,1H$11D$h#WSbi f~/P w`1A$&5,; D$u[FtR=5,;D$,D$낃g,;8#u(@j L$ QP $D$8L,;Pm@$),;8#u)@j L$ QPq D$D$8,;L$QPK j D$ P5,;, D$D$8c1Fj D$ P5,; $D$85,;h#8_2<=t5u-t5~q5t51ۋtVP(uJVh $eZFtPh#OZFtPh#9Zj OY-t5C 9|?,u)É\$(k <D$jR D$PR Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0.1ɉQD$ P4s D4D$8u .8tz`Xt$7t5u t5-t5CPV&t Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP jP |$tt$ VUWR  UW3 -8C|$$8D$@PWםtD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWgt!t$ VUWQ #|$$tS9u$UWL3 RW#5 $D$utSPW4 uWh#1ļ^_[]Ë xm2DQuF|&1G1D$4hy$FF9uj )E1ۀ=t5$tD$PB u hض"9|$(t_ƅ$t Pot$o$u |$ $H$tt4$2hm"$t P\ot$Po$(t$ jj WSt$l ~)D$ u|$ jWt$D 탼$u$(he2P|$($(jPV t"$(؃tTu*tGh"1C؁^_[]ÁttPiPWh^"d 1ۃ$u1ۃ=t5u t5t$, Pt$,V; t$, Vhv#=t5uj$t7t$G 1FV; Vt$@ u hC#)%l&$($(SPhm$hWBt$W( 8tD$(PWh_#u u8u$(QD$,PQhc#GjUSWV ˁD$Pj VL$ Qh#B#+t$1&Gt6t =t5t#$t "FwPh$B G!Ņt G &rt4$t "Ud"t@#FUQPh#>B1tK$t "FPh#BJZt 0h $ hf"A=t5$t "FstspPh#A=t5$t "Ph $Asds`sTsPh#tAslshs\sXh#[A=t5|Ut$ 1|$$hVPPh)"Pt$u(|$ t!j VtVWh#@ hA?%谝"tjl#Ph $@^_[]WVt$t-t|$ PWtu領u54 1u5^_WVD$ 18nuxou u5PPt_1,tu@APYtCƉ8j,W1Gt@Gj,P'hp"h!Wi1^_fWVt$ |$7 WVUSWV$$l$WVSU$$hhU3Wh!9 uWVh4*"j& D$@t.D$t$QPht&hV`VΛj7USWV$$$1hWSG 8D$$81G=$;=_2D$ C|D$D$1D$h#UVK T~H wV$& $׃Gt!M5,;L$ 뱀L$5,;-$Ax|$뎃UL$5,;($At|$_ $V $M5,;L$|$0P$hԃ&5,;F&PbF $_2)ƃ|$|$t L$T$ ttL$ T$|$u 1AL$t$St$V$r$$Ap\$t t|$uSD$PVzt\uD$0$AtuD$4$Ax|$u#D$ L$ L$Ĕ^_[]hh("j# Vhh1$iPh7#hTf29> j/5fWVPt$jWV: 9u9t x^_Vt$h*"j!# Vt$VCNt@^hu"V^Vt$V?St@^hb$V|^WVPt$jWV豿 9t9u x^_Vh*"j" WVt$|$ VW{x t$?/tWhc)"$[Vh|)"[^_WhN)"j" fWVt$ |$7/ WVSWV$D$\$VPWS$,$,njS7Vh$a5 u$tu!D$("t$("j3s("R0~PVt$ h("j! USWV\$ l$|$t$1E1@$;_2h1*"WVbG ou%jSh&5,;7CtEPBǃuA_2)ރu4t$$V4Nut$(t;^_[]hh("j! պPh))"hTf2; j2fWVt$|$ VWv t$?/tWhc)"PYVh|)"BY^_WhN)"j fWVt$ |$7[ WVUSWV $$l$WVSU$ $ hU3Wh'$3 uWVh4*"j0 D$@tY$$QPh&hVDZV$$$$$h#8ji1USWVMu1} ]hD$ PV D$ FxD$D$D$D$D$h#WS&E L~)Hw;$&5,;Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5,;L$1@D$kjuhԇ&5,;x@P'@=N|45,;苬1@D$5,;Fp1@D$5,;L$ 1@D$_2H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ {tuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ WcW@$N|dže^_[]hh("j t$hh1$ǶPh#hTf27 j.WVPt$jWV蚹 9u9t x^_Vt$h*"j Vt$VGt@^hu"V^Vt$VLt@^hb$V|^WVPt$jWV 9t9u x^_Vh*"j WVt$|$ VWq t$?/tWhc)"TVh|)"vT^_WhN)"j fWVt$ |$7 WV1^_USWVp|$o$o\$WVUS$$jHSuWh$. uI 8KD$  =(v5%D$ Vt$S jHSt$D$@D$ $p QPh &hV9UD$tS\$O$oj j ShWt$ P.tP!>Ph(#3St$ SWh8#N3t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@hW#381p^_[]WVh4*"jB j+SWV\$D$@u+t$Բt;SP t7V\1 u5Cu5C^_[hp"j jo+USWVPL$$T$ l$\$1$1 2֍zh>#USY? @~7W$|&OӃ23=$v5(v5먀'룋 ,;DF@N@늋 ,;IF(NnOe ,;R2KF ? 20O' ,;aF8N v5O ,;gfP+D$ p4t$ N @OPt$(h\&5,;9Ƌ$t v5t'tOt@tOsO t=$v5(v5 s=(v5$v5g@tOy  2sg st1A T$ J shu"V7,v5$fyh$V7L$ A$I$shf#Vk7L$ A I$shl#VI7L$ A$I$shu#V'7L$ A ,;wF N" ,;xF0N=(v5uc$v5gu\5_2)uOht|$0WJ t$,tWD$(0t$(^_[]hh("j Bh#j SWVP׉Ήj SQ躱 9u ~^_[WVh#j 蒮h#h#hw#hG#h#Ph#hTf2I/ j?&fWVt$|$ VWKj t$?/tWhc)"LVh|)"L^_WhN)"jS fD$Htu L$fHQh#j SWVP\$$CxP< Cjjp 1Ox\ƉC@HtuMKfHjPjjV&ppV ujt$ t$ Vìlj^_[Qh#jH WVt$F1GyiD$ PWQ 9ujt$ t$ vU 1H^_fUSWVl$\$|$USW 1IL$$fG1AAAAAAAAAv5Bv5ʉQċT$0Aȋt$,AˉYЋD$(͉iԋ\$ ˉY؃č^<RSh(PQhx Wt5v%NɅuNɅt(Qh #h#* H1I^_[])V$o$$$ɉȉFFF D$pjPjVjjhR w2#0XnPh#h^"I* H1HD$pȁ^USWVt$\$l$ |$$WUSVt$$1N|I; v5u=OɃu3_˅t( 80Sh>#h#)Ɖ^_[]VD$L$ T$r؉1Jf^USWV D$jɬlj1111ɉD$ظ $}`|$Ӌ$$Pt$t$@t$@t$0T$D8jf|$ $ىNjD$)щ|$뎸9D$,,$Pt$,t$(T$0 t$||u3j)9}h*݃D$,|%L$,9QPhc#hF#H(<1H ^_[]fUSWVd$xj[Vhtv5J j@VϽt4$Fj:VH"A $$|1D$hhhhh hh(K H|$WPh$V2tP<2PVh#MG #CD$D$ @4$D$ UhD$PX D$,$Uj$lSt V9rȉ$`WVS jD$PW$lPjt$hD$(P t.2,$AuU=(v5uLD$D$ 1@D$( $t)ɋ,$t;|$ hl# F10v5$4v5,$ ,v5D$ @tL$L$fQP$|BDtv5D$ HJ@BB4v5u4v5ȉBB B b1Ed^_[]fUSWVUE1ɉHHH1F0HHH HD$ 5$;5_2\$ \$(ط%\$$} ]D$,D$D$D$D$ D$h#WS2 H$&P5,; 3$L$T$,Jjuh&5,;-P`-뇉=,;jh#W t5jh#W tZPW2 $T$D$0PW D$0t 8D$ D$(JD$0PW D$0t 8D$ vD$$c5ط%$T$$MA QD$5,;D$o5,;D$1@D$Q5,;tD$ 1@D$35_2)h4uM }WtD$0PWh|$L$T$t$ ut$HEpD$tT$LEP|$uL$8EHe^_[]]5,;h#hh(" 5,;h#j Wh#PWh#WhK# PWh#j` Wh#CPh~#hTf2$ j SWV$t$$$$\$VPWS$H$HTj S7Vh!e D$@t$h%#!t$t$h2#! t$ t$ hB#! t$9t0hc#g!jt$hS#R! t$4t0h#3!jt$ hq#! t$ h# !1$^_[Vh#jA WVt$ |$7 WV1^_U0E\$D$,1ɍT$ QQPRh# uUD$ L$$L$D$l$8%\$ D$L$ |$D$ fD$l$|$l$D$T$]h#j WVPt$jWV6 9u9t x^_Vt$h*"j Vt$V?2t@^hu"V^Vt$V;7t@^hb$V|^WVPt$jWV譣 9t9u x^_Vh*"j WVt$|$ VWw\ t$?/tWhc)" ?Vh|)"?^_WhN)"j fWV1t$|$ ɉ @4uyȉXȉX\ȉ\ȉyyYy9y PQ40y40<8x<8D@xD@LHxLHTPxTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40w40<8w<8D@wD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w71wVw wwV Fww wVFwwvVF^_USWV\$l$EffEffCEffCEffCu uvS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuuSCuuuSCu$u uS$C EDȉCDu,u(uS,C(E@ȉC@u4u0yuS4C0EHȉCHuh@#!=w5<$=,;h$W=u w5G=,;1V#PPjPPd21@D$$,;1S"PPjPPjv5m,;1#PPhPh<w5P9,;1#PPhPjw5 =,;=v5j:WAj/W.?yv5,;빻#l$0UU݋\$UW|$Pv $w5 w5sxm2DH,WD$hpR$Wh%Wv5W v5N16#PPhPj l2,w5 xm2DHWeD$<$v5h0#_2=d2_=v5tVh#z5,;h"#j5,;h#Zh`#Phh("j Wh #9Wh#.D$ =v5u1=v5@v5$1󫍄$Bv5Al$$+D$ -v5t1$ 1D$$$MljL$$ PW?t$h#w5l$Ul$RQP $׉ȉ w5=$w51| h#$t/$$T$9‰sQt$t$WPh#tFtA w5WPUx u5$w55 w5t$h#|$(F=$PUg uRt$h*#莍 A#$=`h(w5h#1=w5 $VhPu Vh>#al$VjD$PU w5-w5-$w5݃=v5~VUWt$hX# |>9|Pt$t$ )̓ }4$e3\$l$ v5v5ɋ|$  v5=v5 $w55 w5σ|,@σ|1ҿ9  w59|щ v5|$ D=w5Ejjh(w5( .h(w5h>#v5=v5tv5v5t&hQh#' v5v5t=|hPh#' =v5u1=v51@v5=w5u v5w5=h2,=v5t#jhg#h?#h4#a'v5=w5u=d2v5w5t$t$ t$4Ut$$Vt$t 9t V t U =v59$PtEnltƃh#qGj &Ph#jd$ Pa j2 j( j h$! ,{5$w5 w5ApQtv5@jxQP$Ph# g0)Vh#jd$ P$\ $|$8j踆U$P'c $PSu/jZ$P$dP u$<mfsjWV蟇 9uD$8%PkIP$Ph#h#|$D$D$4jP $u/h(w5hQ#$Phv#jX^ h"j R /dev3(w5 ,w5/ D$ -w5tD$ (w5<$~~l$4 $jWh(2" u ƃrl$Wl$$UMGWU:l$ ʼn\$4Ë$H$|$v5\$L$ u Dv5$dT$dž,<tx(=v5dž dž,dž(Ɔ l2p2u(jh#=w5-54{5u"jh#X=w5,54{5 v5N0v5F4Qt$Qh#=w5w,54{5F4Ht$Ph#=w5S,54{5F4 w59}"QPh0# =w5+,54{5F0=)hPh^# =w5+54{5F0=|)hPh#e =w5+54{5F0N49}QPh#9 =w5+v54{5;v5|QUUUU)ʹ3333!!сis{09\~\{0\\5v5sXș9}%CX=v5~Qh#4{5sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$h#=w5**4{5{4$=w511F9tA uPh[#jo $Kd=$w55 w5 u։<8=d2[ WVhH# =w5)4{5<$C4$8=w5`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPNjs8ƒPVRW)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh|#=w5'w5tm 4{5yxH1҉$q1ҋ8$$)$<$$1C$I8$ w5=4{5_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W1C1 t׉Ë$$QPV$$V]9s($$$V胿É׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRP[ƒ$$$$$$׋$$$RPVQP[$9wȃr$9‹$֋$r‰$$$$$B1WRQP跼Ë$Ë$ʃQPRS-)ÍC4$$W$$P$QoZ@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQVj$P$$^Y@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh# =w5 4{5B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d2$_|HL!ʉG41SSjhjPS]D{5N 4{5I4QSPe 4{5H H{5 D{5 L{5P44Q5P{5щ T{5`@#HL 9| Hh h2H< v5HX w5H\ v5PTXH fǀ$%=4{5O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d25O _(HLJ$v5$$$t!LJ^F=v5$$߬$$ڌ$ܷ%ݔ$ɊOd t1G0 T$D$\$t$ED$\$$# 4{5$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$#B=4{5O0 9| IУX{5\{5=v5u\Tu))У\{51VVjhjPVX`{5uX{59\{5\{55\{5jP =w5G$w5 w51ظ|(RQh:#r =w5$w5 w55`{55w5~ ș)dہ|4&GuȹC=v5tL1$PP$$5v5V1=w5VhZN w51u;1$VhjVu  =`{554{5h`VW =w5tWV54{5x\`{5hhPj 1@$=v5h#F=v5|o54{5N,I\Tt~!NȃN׊Nd1 t1WPh΢#RR$ f29u1H$Whht@PU PPftu!ѡv5t $ Q$=w5u$|&4{5H,$$DŽ$%$ 4{5I,$1$ DŽ$1he2I4{5$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ h#D=w5Y 4{5j58{5艠 58{5FU $F +$^4{5$~J`^p=d2uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=v5uFh$ NlK`ڍOȃ$ډFd;v&h#?B=w54{558{5F $11ہ~U uv`щSA4{5$~!ـ1@ 8{5Il 4{558{5F=d2Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\58{5N uҋ4{5B8H!tk)D44{5B8)Nj58{5$9sE)ȉـ1B~U uv`58{5F$CHu͋4{5B8$؋N9ȉ$J`~U uv`щS4{5$~!ـ1@ 8{5Il 4{558{5F=d2Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD458{5;Vs2р1@~U uv`58{5F$Bɋ4{5$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$L{5H L{5V$P V PV~x; P{5up=w5tT{5s4PP 4{5H{5@H{5Kd15T{5s4T{5L{5 4{5q4jP( 4{558{5{0 9 `{5PVQB =w5t`{554{5P58{5g 4{5y0`{5$ryxtG$\(%TuCl$AP$ 4{5Ou$ց\TtQ!QЃyId t15`{55X{53 54{5\TG~8^xN`1?9'\{5+$~0lj$Ɖ$)ى$=`{5$%Gl`{5\{59wߋ$9w$4{5$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=v5} $H$$$~A=w52$=|j.扄$d"t$ 4{5ׁ\TtQ!QЃYId t1RP$VhR#=$$;$$|W=v594{5H,t =w5 $$ DŽ$j DŽ$C4{5;X,/$~ j =w5 $hjP d2 v5+ɋMt@U@f$$hM$lCɋuM@EfDŽ$At$hX $ld2fDŽ$2tt2$_ lj$DŽ$4{5H4$ $ H54{5D@VL!! $`Nd8 fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t2@ lj$DŽ$ 4{5H4$ $l$h  54{5D@~L!! $߉$Nd t1$Sv4$j24{5@0p9w Au1H$$DŽ$1$$t ǡv54{5@05w5V$SQP$h$l w5ɉ$$$t RP2$CPKT$l$hߍ$󥃼$$tA$ȃ=w5CX$tFDŽ$PQ|218$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$1$pthj$PV 4{5\T$$i$$ $$$$DŽ$H0$$_$ 4{5@$D$@L!! $`$hc $l$  4{5Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h 4{5@$D$ @L!! $$_$C $$h$l4{5Hd t1$S6j$$V 4{5$ȔȐG$11F$t =v5$$=4{540=d20w4w+_1`{5$`SWPz $PjS =w5t$W\= w5t`{5ǀ\8 4{5=`{5x\hhP貌 w5QP芛WV=w5tD{5 4{5q4PP׸ 54{5HLNd t15D{5v4t5T{595L{5vG=w5t4{5p4VVx 5T{5H{5@H{5=4{5Od1Vw45\{55`{5&4{5@4P5D{5 e^_[]ÿWjV蔋 1=w5VW\h"Bhy#.j&j%j(,{5j jj'jh[#Lhs#Bjjzjsjljej^jWjPjIjBj ;USWV=w5ua΋\$=v5tw5,{5St$P> 4׋ w5UPSt$$5@{5T 9u^_[]蓦0PWVh4#j$USWV"=w5΅ d{5u4{5H4H X{5 d{5 =w5; w5$w54{5;}FWh &1I!;HtG#P;Pt;H uV9R_1ڍ_5`{5P=w5Wh De^_[]USWV΋L$l$=v5t=w5teUjQˈp׋ w5SPUt$$5<{5̭ 9t?0PWVh# j"w5,{5UPQY< ^_[]SI`wD$$&1C:Qh#hTf2 .  [SWV1ۃ=v5։ SjQć =d2@fF F)f ^_[USWV Ӊϋ54{5F Nd t158{5G=w5t8{554{5PP跳 8{5yU +y/\$|$y1U =4{51=U L$D$uq`|$ G`Ӊ $u щw*l$$ȑ&р4l$skPh#hTf2 =4{58{5D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah}# h-#hW#)11҉ ^_[]ÉՁ|$U u L$I` L$w$ؑ&ʉـ1@BPh#hTf2 8ʍ 6ʍ   1$54{5$~3%)1@ 8{5Il 54{58{5K=D{5Od$sC=d2CNdЋT$ t1҉t$VQPR`{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRlL$|$ щT$ՉD$ȋL$D$VW|$RP"ыt$ʋL$Vt$QRPZ$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D454{5;F8|$}X1Bσ) 8{5yU uI`1@54{5;F8|$|=w5t8{5VPP 54{5F Nd t158{5USWV$΋=4{5G Od t158{5=w5t8{554{5PP胮 8{5xU t)h}#%=w5(8{5xU ‹l$(H $t@\$=w5t8{554{5PP =4{5G Od t158{5w4{5D{5HC, $9r%UQh# =w5V4{5 $\D$jT$RPQ-D$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5`{5W4{5\Tud`{5jpxt$0t$ $<=w5WV1L(ɉL(@ u1LXɉLX@ul$`{5jpxt$0t$ X $,;=w5trUV胪1tttp TtDpC u1j Cu) % $D l$hVU c% $D9Pl$4{5T$5`{5p0^_[]j j WV։σ=d2ȃ@PQR~ =w5t'ȉGffF=d2u GffF^_fUSWV$8tWI ƅuWh8"j裫 $$<$4D$Phd@UX tj1OLVhedAUY} F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(hΝ$t$iK 1 Sh8"U CPhB9"U[ C Ph9"UI CPh9"U7 CPh&9"U% CK,C,Qh99"U C0PhN9"U $@D$t P蓅 1-Uhzd@$<W3| t1 VhedAW| hjUO| D$ P$4{D$, 9L$L$9u0$S11:68tx$0h8"Eb$11҉ $ƅ*ŰPj PU<} ^_[]$0h8"j) USWV81ۍD$4ShPSut1NtAljSPSWuW uMU D$t$$$Q1e^_[]fWVt$|$ VW[ t$?/tWhc)"Vh|)"^_WhN)"jc fUSWV|$$\$(SWt$(t$(] )jj`SWq'~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPgE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVy 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^#ljt$1=x{5 |$u ={5{5)j5|{55{55{5ף{5{51҉|`$$P$T u$$j5|{5QPǁ $׉ȉ {5={51| h#$t.$$$9‰sQt$t$ WPh#qt$VjZ$u Vh># |{5{5%{5ʼn߃=t{5~VWUt$hX#迶|>9|Pt$t$賎 )σ}4$ l{5-h{5uU-l{5uY5{5={5|{5@19lj| 19ǃ| l{5u h{5͋5{5={5|{5ˉjURP7~={5l$ {5uA@19lj$ $t$u h{5h#jPVW}v|$wext23$2fs3$ WhA%"h{5h&Vh{5h`#} 19ǃ} h# {5t$VUt$  UJ t 9t V8 j螭USWVӉ $]|$j W\$ S Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph3"1L$8ɉ׉u L$8t 1@׉׉|$l$ 耉8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h3"3QPWUt$t$h3" QPWUt$t$h&4" t$t$h3"jO WV84Tf2Ph#V 1GVWjh4"IVhܒ&5PWܫUSWVu} D$8jP;L=5555l{5%UUUU)3333!!щ%ih{5B|{59922T$u tv|$΍Q5555 5VT$ 55ډ5P…Ƅ!) 51f1ҁ‰t$$r={5{5\$9D$ 5T$51t$$ËT$ u׍؉)9H1D$ 1{5 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ{55552t$ƺQ=5D$5D$ 55D$551 555D$8555S555N55555[5蒸f5w f55 2f5\$H$SW蘆 93rWh5҃ 5p{5|$t"V[xYjVh5i 1 55d5`55D$5 5+ 5 1҃r1I155~σRVPW55H19w+55|$OL$)9r΅u 5f5f55l{555Voȅ5YVjP4g GD$AD$ 11L$\$55tn5tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 5@5t f5 5@ ȅ51Hȅ5L2 ȅ5D1\$;|$t5)áȅ5f\0 ȅ5D1 5u\$fT1 ȅ5T1fD1L$ G;|$tD$ 5|$11t$55=t{5~i l{5 i{5h{5Q5{55{5PRuh# 5 l{555PQWh2#5@5̅51QQjhjPQЅ5I 5̅5jPe =x{5uk{5 {51! V5|{5 1N1Ƀ *$%Fu  1@D$$=t{5|>hy#=t{5|(L$ 5 51PQh΢#PP舩D$$ f29u1H|$LWhht@Pc PPftu!ыt$t{5tL$QT$=x{5uL$L$D$ 1D$L$ 11T$he2 F=5t$tX5tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f55515 5Ѕ5D$ hh5PXc 555P5ȅ5Vt$6c =5=5 515|{5ǡ̅5)؉1t$ P =5Wjhԅ5b 5H9|$u_555 5)ʍZ9s1Gрԅ5B9r)ԅ5VhP,b t$ 1Ƀr!11ƃԅ5Cω 9rωp 9ǿs"ˀԅ5CI 9rޡȅ5L$  51Ҹԅ5Pt$ 55Vjԅ5Pxa ԅ5 5L$)QhPWa u1ԅ5@ uȅ5L$ D 51Ҿԅ5Vt$# 55jV` =5tb1=5t 12s85F;55rȅ5L$ D 51hԅ555 G;=5r=t{5t$|\tX=5te5t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=x{5|$T$T$|ʉj.荥t$몸d"|$|$t$ 5 5jQt$,PhR# T$;D$_=t{5* 5t=x{5u&D$ D$D$j 1h"軥~ j ˤ=x{5d=515$hjV^ fF쀁迮fFD$8FFF虔 fF55 ׉؉t$ ֍$fBt 5$,F܉VDF81 L$ F4D$4z 51CL$ =5W3D$(\WD$S55tPjt$0] f5 9`L$97|$0N5L$,ʋL$(T$51GL$ T$D$ 5D$5D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP\ L$ D$1t$V 51CL$ \$f5 5=5t$,9sD$()QjP8\ t$L$ D$41ҋt$(VW'V$Yj=5t5t 222@1=5à r t$hhjV[ fFAvfF5ÉFD$8FFFE 5fFfFV 5AFmlj\$r*D$p1ۋ 51zC9uߊ 51hԅ55555f52|$D$1ۉt$ 2x1ɉt$)rՅ5RQPZ Wh2ԅ5VZ 2ԅ5D$ f؅5 51Vt$ \9\$t552D$ CiL$T 1VhVD$pPZ 955t5t222fD$TAfD$V2ƉD$XD$8D$\D$`D$d聏 fD$lfD$n 51@D$pAD$| 51hԅ555iL$Tj f51ۃ=5 5Ѕ5<hh5W[Y 555P5ȅ5V=Y 55 515|{5ơ̅5)؉1WP5̅55Ѕ5 e^_[]h~#hV# #h#Ph[#Ph~#h#Vh*#RhR#PRh}#hVh#hVh#RVh#Wh9#VPhs#hX#vjVWt$hw#gh#`h#Yhy#Rh#KRQhi#B#1#'h~#h#"h~#h#h~#h# h~#h%#j- USWV5=5tr5tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(5Ѓ5t f5 5Ѓ^_[]SWV=x{5u0׉΋ |{5\$QPSt$ 55{ 9u^_[WVhS#h3#jv USWV=x{5΁ ԅ6u=51 5 ԅ6|{511;{5-{5ǡl{559v@1ShP&8!;HtH#P;Pt1A xVWh86h#  h#qhTf2 ̇71B p7܇7@̇7777777ԇ7 Ї7 uCء777|7 7 x7ԇ7 Ї7؇7 ؉+77D$HT$Ll$H؇7+7D$8D$85%v?|$ D$ fD$l$\$4l$ D$4Ӊ Ї7ԇ7P%wh6 77 Ї7ԇ77؇7ʚ; Ї7ԇ76eĉ؇711ۋ77D$T$ ؋77D$7D$7D$5؇7L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05%P%t$v Ї7ԇ75؇7=7|$(t$(|$D$ fD$ l$ \$,l$|$,=؇7ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5Ї7 ԇ7=؇76t 1A6y7L6 H69}(7i-@=B'6@9u7e^_[]h#h #jg USWVh7j  6%\$Du{'-7ȇ7D$hD$h5%\$Dݜ$݄$h7j讉 u{(-77D$dD$d5%݄$\$Ḋ7;6D$Dԇ7 Ї7 t]+ 77$$߬$؇7+7D$\D$\5%X%s=܇7uZ6tQԇ7 Ї7 t5+ 77L$xD$|l$x؇7+7D$XD$X5%wD$DD$D76 %w١7 7 t>+ 77$$߬$7+7D$`D$`5%D$Dw\$8؅6$fDŽ$jh7jV D$8 %|$&D$& fD$Bl$B\$Tl$&t$Tj$P@W SD$lD$lPD$,Pj5P65T65؅6V <h7j T6D$8<BC97)؉D$D$8 T$x&\$A9X7I؉L$A ̇7Iff9u܇77H77D77@7P7 T7u7X77T77P776 1D$1 R8 Q8l1A h#HhTf2A6<1A t$, PVh#{ ΍T$(jt$>Ph#{D$ 6t$؉T$΍T$(jt$F$Ԗ&h#΍T$(jt$JhD#z΍T$(jt$bF$Ė&hR#΍T$(jt$$Fft$NfQPh#rz ΍T$(jt$؉t$h#΍T$(jt$^؉t$h#v΍T$(jt$z0FT_h0#G΍T$(jt$9FPh#΍T$(jt$ ؉t$h#΍T$(jt$؉t$h#΍T$(jt$d؉t$h#΍T$(jt$9؉t$hB%T΍T$(jt$X؉t$h#)΍T$(jt$-؉t$h#xhF#xPhd#kxL$lL$AQ D$iPh#4xhc# hq#h#xNh7h#wt$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ7#L$dT$C;7u#Ph7QD$XͽL$$ D$L7PQh70 T$Ҹ7#u1G8#T$PvL$r |$ rIf2H f2~e2H e2 he2j {(  }T$A{^N2D$ˀ) h=#EvuPt$,0 L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPhB#uh!#u9 |$ sSf2H f2~e2H e2 he2j z  }KF߉Ήs(T$h)##uL$T$؅t%f2H f2~e2H e2 1I he2j zhe2ء7;6*؅tء6!^L$AQ T$Q=D7 @7 t+)|$L$p|$tl$pH7)ЉD$PD$P5%`7`7h7h72v27v7\$CfK%p7f!tp7 7T$ .KfKfp7D$ 7@1ۺ9T$t$,P L$IfɋT$8RD$4\$T$T$$T$ $L$J7@)t2(uK t76t1 t7h;# t7 6 PVh#r Ph#h#h#h#AfPh#h-#hA#hY#hr#h#h#h#h#h#wh#mh #c t7hf#q1BD$D$pf2@)f~\6tSωL$!ȹT$V!RPt$ h#pqT$ D$,6t1RT$D$fxf526ruTt$, L$IfɋT$8RD$4\$T$T$$T$ $L$D$41BH6C9D$=6 ؉T$5L6|$76)RQP  GD$9L$~D$8:6uG9u߅uQt$,K L$IfɋT$8RD$4\$T$T$$T$ $L$E5L6)6t$>RQPh#oL6;H6}0u hv)$oPhu#oCы\$1B\$D$\$D$T$jh#jV 1Ah=!WVE87~b77 f2Qf2; f2he2j.Ct7 e2Qe2.H 7by`)77 f2Qf2; f2he2js7 e2Qe2H 7|tN=7t4f2H f2~e2H e2 he2j us77he2 hTf2 777 777C8^_jj81A1=7PfUSWV׉E\$1AM6]E uWVhW#mt hu#smSh{#em6t5@D$ %\$D$$#)m6fyuhTf2j謎e^_[]UVh1AtD$86$#l̇7D$$#l7D$$#lp7tD$$#l̇7t9+ 7} $#!L$LD$L ط%D$Ht$H\$$#Pl$ dk 76 p7L$DD$D=`7@|-h7% 2 7\$,D$(\$ D$\$D$\$D$$$#k6D7 @7 t5+ P7T7L$XD$\l$XH7+X7D$@D$@5%7 7 t7+ x7|7L$PD$Tl$P7+7D$L> QPh#l6tkD>L> QPh@#F|>uGD>6ufPhv# ffPQha#h ^_[WV6u8jjVJ t'86 PWh#hh7qf"6ź Ph $hh7Mf^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h# $t$t$ t$SPh#%g UPh# g t$t$t$ h#ft$ Ph#ft$ ̹ Ph͹#fr0G9s'GPhz"f| KG9r߃$^_[]fUSWVƀ8-uFhƓ"Vm4u 7h"VO41u 7T$,11CD$D$h#Rt$0s Hw؉$&\$̃duE뻁뱀=7t\랉\$떁댁낃u1 _21;L$(uj~1L$ 1ɉT$Љ $P.L$Au $AP~D$t2ڋL$ PWJ W.f uމ$D(nuY|$uj01 Džu\ P|/#t8=7uIj VhƓ"誨 Wh#T1FV^Ph $VsK SUL@ h"=7Mj Vh"T Wh#VM \$d"#!'#VWS jjVWS\$u; 1GWW.Wj.Wjt.Wji.WVZ.Wj O.VWe= u h)#jJ jjH= u96#8j u; j j j= t)qtOQ| j j< u8L#8t1Aj jh"  ukWh#jhb#艂t$U> #QV80WWm< #td"VqPSh$WI SWh#j蓦AVT%=7ud"FVPh#hTf2dj [fD$tPhj#Ձ hd&Ph~#hTf2cjZUSWVPu } hd&WVn cR~5StET ܑ7͍Hw4$P&̑7벃Lȑ7ԑ7둃ftTdL 7tБ7e7Vؑ7G78đ7) _2(7=7tjjh$\: 7ND$ jjj" 7jL$$Qh@hPZ u h%7i )ލ<S H $t&=đ7t1Aj D$<1CPSQD$D$ PS:D$D$$PS#D$D$(PS D$ D$,PSD$D$0PSނD$D$4PSǂD$8|$ |$z |$o |$ d |$Y |$N F 7D$8gtj57: rD$ D$d"D$D$d"_;-7S t.H$1ۃ=Б7uWh#h#hW$L~ >h%S|,g =Б7uh#h#hW$~ 1C7FLCSS H3 VT$W$& \$@1ɍP$l&71A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12 7#7L$L$# 1AD$ PD$@PD$ D$<+7R D$ Pj$727272 7 7׋t$#D$ Pj7d$zT$ ED$ L$TL$@JL$C7"2-L$#d$d$d$L$׋t$(7:@7@.H7"0787 P7\$ `77 7 t 7t 71SSPt L$Y\=đ7j$)/jD$D$ D$d"D$d"7L$9a|$u q7 7ta|$  ‰4 D$=7T$tD$1@D$ /1ۉD$0/hxShh72 atgcuL$k7 p7j77@7|77t777 `7 7tJt$(~A|t17t|$ ObT77tPt$ tH@WVh7D 7=7t=ؑ7u#7tMD$tH@Vt$ W =7t=ؑ7uL$#7tDD$(tIAVPW =7t=ؑ7uL$(#{7tDD$,tIAVPWT =7t=ؑ7uL$,#.7tDD$4tIAVPW =7t=ؑ7uL$4$#7 tDD$0tIAVPW =7t=ؑ7uL$01#h7)f=h7=7tP=ؑ7uG=7t4f2H f2~e2H e2 he2j [h71=7IWhh757. u+O,87tE,t)7|$t+u-#/9|$Ph#!#|$# P9Ph#u+83u=7t"+1ۃ8=71ۀ?D$#1D$hPQj{PVhZ#Q) PVhL#*C Q>PSVhi#Che2^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV+D$  P/\1PPWSjVڃ|$dt$ \$hr# D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy92tE2P{y$L$t h#h#QQh]F%PPh#A C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lPr=#PPha#@ f2H f2~e2H e2 he2j ET$h9t$j hr#O L^_[]hH# jh#j' D$t'T$tt h#h#QQh]F%PPh# @ ËD$t%u#%tu#Ph###Ph2"?USWV|$<\$8D$4t$0~u/jU] u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhZ!0?Ph $ ?PWh#? ^_[]USWV|$4t$0=7uM7hh7t 7'j.h7t@hPh7 t"^tCt0Wv`rhh3$h 7 ^_[]1w)ȉPjQ SVU fEu jU~[ WUu&Vh 7Sh#hh 7|< 7^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh 7ShF#hh 7 < 7[SWV$L$4D$1G&t$"tZ@:t9rD$Ph#=,^_[SWV|$t^D$uFD$jjPH t1Nj0j.Vt@h7P u7ut$跏 3$hVh 7 7^_[VD$L$ 1Ҁ0QRRhh 7VP7 thhB%h 7 7^Au yuyt$Qtu ȃP Q APhj#hh 7: 7SWVD$ 7Q4P#R74P#R7ƄR7.r|I1AFL$ t tu=07,;07Ӄau1ʃut-_2)t+ta=07uX ,7tpE9uj*u6507t$h3g#Vth#V u91AƿTf2Ph#W2 Vh-#W2 j)WV迱ƿTf2Ph;$W2 Vhx$W}2 Vh$Wn2 Vh$W_2 Vh$WP2 Vh$WA2 Vh$W22 Vh$W#2 Vh<$W2 j )USWV|׉΍l$|QhU: PUuxsD$tVhC#OD$tVhh#O=7u $7tL$|=$7t@71C= 7u WUjE( yVh $蓲1ۉ؁|^_[]j:(SWVΉQhS9 t!1G= 7u%5,7Sj' yVh $.1^_[USWV 1t$ >WWVWht& u;D$ D$ PCHWWVD$Pht& tt$XĨ ^_[]h$t$  tԉ1|$l$Vh$PVSPHt$t$Wh|dD$PD \$tN1D$;D$ 2i9t$sVt$pRt!ʼnD$t$Wh|dt$ ul$$WhedAP f$a$>ukSt$h(2"hb\%h$W ,Ƅ$t,75 $ 9$tC$QPW$- $Kà9Éu|$$Py 1h$j8 Å~A1ۉh "PujVh(2"h$h$W5+Ƅ$|$t,7\ $ 9$tj$QPWK, C;\$ mUFV|$l$|$$PUSWV  uj$D$$D$<$shY$Vthx$V3hUc6 Ƅ$hx$sut s hx$VN5tt s h\$V.5t P^: ,7D$ hf$V5tHá07th3g#P(j,StZ SЪ,PD$PUkpxD$!=`ÉUh $輭 S{Dž?tG<$tSWUh$h!%h$V(Vl tEUh$IZhp$I?Uh$h%h$P(1507t$H# }eD$ |$< $ T$7jj hd"PQjR D$\$ T$2jj hd"PQjR a)؉L$ T$Ojj hd"QPjRO -D$,\$xL$L$|l$xt$p|$tl$p ط%$L$sL$L$VL$L$[L$D$ D$dD$\$D$$$$|$SWQPrD$D$ SWPVWt$$Pt$hP$!a<$ |$<t$T$7jj hd"QPjR[ 9\$؋|$ T$2jj hd"PQjR% )t$ \$Ojj hd"VPjS SD$6PD$?Phg$2D$L$,PQ D$$#D$<T$T$SRQP1D$D$L$ St$ PQ+|$t$$ St$ VWL$$QPQt$ Qt$0h$i t$ $ t$,t$ \$WSPQD$D$t$ WSPQ~ $)T$T$D$( WSRQZ$L$$߬$ $$L$$߬$ ط%$L$,L$ L$dL$L$LL$L$@L$\$D$D$$$$s$D$ P{I1Ge^_[]h?"j h!hx$USWV $ $ h $VW6, fu 87t R1ы _29<$$\$PhVv) &$UV[ tJD$PU0dt>D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h&$h$Sj\$ =87uD$+#D$ P$Pt X8\$t$Ph0$譠87PU uUh $膠1@$~#Qh $=1@$\$$$Ĕ ^_[]$Ph $jD Ph;$hTf2 jUSWV L$<7$T$t-@7*jh<7F @7š<7$T$1i E$48t!u6$t$PVT$ uF$t$P:T$ tEM<ǃ hU#21 ^_[]ËD$ t 0<7$4$݋D$ t 0<7$$ؾD7PhhD7n& uhD7h $j fVD$t.})zhQ8h\$5t7\ \I8T$%&PQh$5t7'2#u5t7h#V \I8^ËD$ H^WVθ%&PVt)uVh$5t7 \I8SGt8tPwh$Z wh$Huj whQ8 GQ8Q8^_WVD$ t;5Q8D$=7 7u 7&;pt8@uVh~$j* @u=R8thR8Ph$襀 Ph$蕀u5Q8=7^_Ã|$t $i\I8Ã|$t %H\I8Ã|$t $r'\I8Ã|$uhQ8h$5t73 \I8Ã|$uhQ8h$5t7 ű\I8Ã|$uhQ8h$5t7 蔱\I8SWV$$DŽ$HH$pƋ$ ƒtS!=HI8E$t@$;$atσ=TI8 =XI8 PSj $;rtr1Auu($$h$$PQ te$P$$h/$PQu t8$(1;BQPVW'VA.\I8^_[USWVx֋$$t{tp11@=xm2D_t1z\t r9΅t<΄t45xm2AҀ|Vy5pm2TVP5xm2@u΋$ $t`1HhrI8trʄt<$1ۊ`I8t8tCu 9sqI8B+$=FFu4$D$|$ 1 I8$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ M8<$؉D$M8$to\[$uvz$\$-xm2BDEJ<0HB,t ]tVрy$t[xm2BDC$G)=~"B $tG)=BJB5Axm2<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$5t7h$> <$?uhVW! x^_[]USWV0$Du%$H$DhJ$PQ\ y1E-pZ8h*j0UhH7L t$H4$=7I1VV$P Í|$0;=7=pZ8$H5XI85TI85PI8s =HI8E$t@$9ƒ=7RPSQ7y=pZ8uE=p7t<77$HctpZ87 pZ8VV$P Å 4$jpZ8Щ\I80^_[]Ã$D|Ã=7t=7;1 T$󫋄$HRjh4踷 |$D$=7ʉǃ=pZ8$H[L$05XI85TI8j =HI8E$t@$9Ã=7VPRQw=pZ8u9=p7t0577$H1tpZ857G=7-=pZ8$H$HL$05XI85TI8j ƃ=HI8E$t@$$H9=7PVRQv=pZ8u_=p7tV=77$H1tpZ8=7$$H4hV$.D$P E;$Dnj=p7t#t7@=u1Hjh"P jhH7荒 WV=pZ8t@=p7t757= 87 8157= 8u pZ8^_USWV1@=7S= 8Fϻ4$ͅtUShB$5t75t7}t$PhVhe2xdpm2L$DH?u"t57RPh<$Q[ 7#5t7jj6h$ 71\I8^_h_$h7t$t$ \I8hh$h7t$t$\I8WVD$ tZ}UuZt$~h!WBtOh"WBtBWy7vh$5t7 J1H_1=71@17 71Ҿ"t! щ 7PVh$5t7(1=7\I8^_ËD$uD$L$h$PQ tvD$ph$gu<=\I8u0=7t5t7h$ D$ph$Vgu+5t7jj,ht$Ԓ% u v1.褔\I8^_[]\I8USWV D$ #D$$L$ h$PQ[ L$ ȃ#D$$L$ h$$PQ1 D$ L$$|<$Dhr=#t$Qt3$8|t+4$$H$$ 3D$$h$0D$1E-pZ8h*j菰UhH7~ t D$$\t$=pZ81D$ H9=7""t"$9t$tT#T$$VVP4t$Q̀pZ8u?=p7t677D$$" pZ8tA pZ87E_t$j讯pZ8$9t4$#葒\I8 ^_[]SWV$tKjjY _tK~S 9uWj01uh$|1H\I8^_[þV Fujjh6#ҟ}$tj/Vl t@hQW2 =7t85t7V t7HQP~ Q Pj |j5I8hZ"WVO  jWVO Vh${\I8jUSWVPD$D$t&D$t$h $PV r\I8^_[ËD$ph $^u|$h $ tD$x|$Wh' $~^WGPjW uP|$h/ $ t D$x |$Wh9 $+^WPjWȰ 1ۃuM|$ Àu*D$p Vh9 $]VPjV舰 75t7hA $1 D$\I8=hZ8t =hV8u.=hV8t#hhV8hv $5t7 \I85t7jj%hP $KËD$\I8=hR8u=hR8t#hhR8h $5t7$ \I85t7jj$h%$ËD$uD$L$h $PQ蠺 teD$ph $\u<=\I8u0=7t5t7h $ے D$ph $C\u577uhs $YD$ ph} $Y57^VD$t$577u h $X%Ȋ\I8D$ ph $X57^Ã|$u|$t荊\I8Ã=7t 1PP)jW=7t 1PP jz|$u|$t4\I8Ã=7th $X鏽V1VVcV-VPD$ D$t}uD$p*Ӊ\I8h $W #t+h %W"t h $W"u7 1Cvtt7u7Xz1H!7P57h $5t7j1\I8^_[VD$ L$\I8ʃuCuD<"2tKD"2Vd"tQPj h$5t7 u^yjpp \I8^WV|$ W`tQƋ|$@tP FWծF=7t3|$t,P6h1$5t7{Wh$5t7e ^_WV|$D$ \I8uIwЈtAƋ@tPM F6hH$5t7  \I8^_xwh$5t7 ^_V|$t.=DR8t6577h$~F57(ox\I85t7jj,hY$bv^VD$Hr8x\I8`=LR8t$577u(h$F-5t7jj,h$uD$ ph$E57^VD$u5=DR8t=T$ 577Ju:Qh$E;w\I805t7jj,h$turQh$ME 57^fUSWV@$(@u$,@tw~!$,@$(@h $PQ tӋ=7~+$,@X1tZ8j USd t F9u19u2$,@ph$5t7 \I8@^_[]ÍD$h@h7P Z8D$@1ɽ $L$99` xm2OGGDA@u7ȃ$t \u_GGY xm2WDQuViuAG;$(@}/$,@ 8)Q4V] $,@4蛦1@$F?tG|1ۍҍBWGDQu苄$(@9|ˋ$,@ 8)QtV $,@t*踅d70tƃu5t7h $'5t7h $~ t;=7u25t7h $vy \I8D$@9G=7t<5t7h7;y t7HQP~ Q Pj j 6\$S d7d705 8V = 8t'~t!t7HQP;H~EQh@D$Ph7螖 胄 8$(@d7$,@Pj_븃<$JE1A;$(@t4fUSWV1$D$jh7^ t%=7t 1PPI<$~KD$@$AhjhhZj Y<$t(=7t$t 1PP$^_[]Ë|$ \$1D$9}ƋD$j:4$pt7=|7u |7D$ Y$-(7t+hr=#Ut}|tU (7<$~D$@$D$<$d-SWV։jh$QU jh$W= tlh$W{ tjh$W uYt F t8t4hI$Ut8tjh$W۵ t ^_[ (11VPP ^_[)WSh$j% USWV$\$@t$<|$j h$W% |$D$ 1D$D$SƉ$PJD0$D$d0$uV1KPi* F|$Dt$d$`t$hl$dt$lY$hD$d|$p$lL$tf$pOG8>h$P(t$Dh$$t$< $t|$@t$t$@ЃD$;(7t|$tt$D$L$d3.$`'.$c.$tW.|$Htt$HID$H|$Ptt$P.D$P$t$ DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=(7t;P譡D$HL$H+(7tD$Ej/t$L t@Pt$Dh$t$HaD$t$Q(7L$D|$D$814I80I8,I8(I8$$9,7t1$Pt$}u$\$` 4I80I8|$pyډ׋$$|$7‹$4$8$ <7ˉƉ$D$@1S$P]S$+$$$$+$ى|g@By)QJ:j$PR$+$$$$+$ΉЃ||$`t$@$Dt$$|$`tCt$57578 heT#57M|$`=$@$Dt$h{";Yhr=#t$茆D$8|jjj n$D$@h""PR D$@|$@DŽ$@%4I8 0I8 m!ڃt9}M#$H5,I8(I8$$!;$$=7t5t7jj h%$_ND$TZD$@e2x=@I8=747 07ƒ879}%t7HQP ;HQ#t7HQP<Q 8tB$ڋ$!t (I85,I81ϋ$H1 D$h"P h""t$D$@|$@tDŽ$ t$}D$@Ph$h\$Vh~$O"7)PSh$\9h$%Pt$Hh3$jkh$h$ bh8$ L$D$ D$8t$4D$ D$0D$D$,T$1@މPj ߺt$脛th $8ej ct$@GQ$= $#$1V$WN$$$$$$t$@Ѓt$@Wt$臭 u.5t7$PqP蟊Ph$V贶 47=07| jj,I8x& 0I8 074I847; (I8R14707!1\$  0I8 4I8PL$T$ T$8t$4\$0r\$ 71tt$h$5t7 L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Wh$Q D$L$ L$8t$4\$0ËD$D$,T$1@t$[Pj#x7tt$h$5t7 T$d|$MD$TD$L$ L$8t$4\$0ËD$D$,T$1@h$ D$L$ L$8t$4\$0h$ D$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$h4$$ $D$8$D$4$D$0t$,$$1@މjh$q D$L$ L$8\$4s$$ًT$ t$\$|$|ljL$xL$D$$$$ω$$${USWVD1D$ D$D$D$fD$D$0D$8D$4jh$Q~ t}D$V~ƉD$j@PFt%L$L$4|7@P~ƉD$j:VTF@P~D$ t$D$0|$0$jPW4 D$4t 8D$t{8tvD$ t8tj;P^ th$Ph$Wh$$WVWhY$w Vh$g 1C)1C>l$,|$ $tc?tTj/W蟩 L$9uut$@jh$V^j @L$ǃuC=7taD$t$uI$t>thy$VE+1Ʌ $t}thy$U#+1ɉL$<=|7=7t 1PP=|7m/|$DhPWi |$L$D$L$D$ tD$ D$$=77L$QPq=77t=ut$8t$8t$ Ts t D$,t>D$Pj 3D$T$I"tQPh$] "D$Pj跓<$l$,|$u'j/VCtG1|$t>tFhh%l$LUTh l$t$1l$ -uP=\I8uDhTf2jhh$aB)1D$Pjd8\I81ۃcÍL$%L$0d؁D^_[]1Eh,$ Ph$h$j. USWV օ\$ |$$jh$Qn l$t=jh$UV t;jh$UB t9T$(.C fCPC fC C 1}Gt$j/U@$t9lj)CSRyS\$$UPXe { uG<$W&xC Uxj@V?|$$tZ{ u |7w@PwƋ_j:S?t@PwG_Ot[uUnj]UC?$tYÊ@t<:uL)SUV V~,$}:1j:V>tEt$t$Vh$1ۋ\$ t3tHj PU }t $9ut=s fCt$t$Uh$z CC tWt_uk7KUVh$Q t$t$Vh$9 \$ n1HJ37(ud"UPvC{u{ $t$P.vC1 ^_[]h[$j WV։2vvuGvuGF G FfG^_USWVȀ%t u7Qt*5xm2|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdjw\=p7t<'Ph$jdVq~ t7Iu1IPVQ~ jhĝ7* Vd7j\=p7t<'Ph$jdV~ t7Iu1IPVQd~ jhĝ7e* V΋tP;FtP%FFtPF^WV΋AtPF~t,WUoPjW)_ FtPF^_SWV׉΋j:S[;tDSsP謄tj%S4;tSha$V蒉 SZShX$Vx G tu)GfPu G=tPh$VC heT#V5^_[USWVP։ϋ\$l$ 7<tPGZPUVWj-Z x.1tETw4s,I  $8 u@$Ph$* 1@^_[]USWVPӉRmlj4$6Mw sEWSU讀 1uCL=ʀw һru$wsME$(^_[]USWVL$d$`1@D$1ɉ 7 7 7 7 7 7 7 7 7 7 $7 (7 ,7 07T$(JJJJ5`7rBJ PRSWB t u x0$@t0hP.P萭 PSWh$ \I8hWh7] \R87<$l$\$HWj j UhSwwߝ t hI"VS] j VU] =7t*$xt!f$tz$USP5t7w jwh" x6ư=7uPwwVvyWVP| USh$$ #$d$dh$i \I84$d xwwh7/[ G74$< $7D$HSh7V D$H7=7uD$jUjjV( hM"Vzio8h""Vgio8=o8=7t5\R8h4$5t7蛢 j}^\$WSjUV蠚 WShUV菚 \R8c$d$dh$}# 1h $ o8t Pko8t Pzk\I8Vz 1L^_[]VD$xuGxuAHyu8y u2yu)Qq@ffqQ1҉Q Q@^USWV81ۍ|$447t7h>j-UD$(D$ hjUD$,D$D$x7D$D$$$\I811L$8L$\$0D$t$$ 7<tPTW5o8莁=W5o8tr&wW5o8PtPhW5o84tPhhhȿ#5o8]5o8/:Cà u $E7uw|$5uprk=7ub=DI8t&t uu5\R8hb#5t7؟ t7HQP;H\˃ PQ $wxm2DXt\I8CУ\I8\I8uss)5 $ ȸdtȃruxm2DXu 1@OuJ t$ tB$T$у)l$t=w7s=J\$\$$\$l$"$T$ыl$ދ$L$t$ dڃ( ʹtu-u|$t \I8D$ $؅t荌$79L$`L$AL$PPS藡=7\$0l$uE5u@=7u7t7HQP~ Q Pj H5t77D$x u@uhD$t@wuj׃=t7D$,t=t@wujփ5t7=47jaP$Lt o8@ u}1ۉ7Sg97t71@t14&hh$5t7u 5t7G6\I8t$ jPt$jP(t$ jOt$jO\I818^_[]Vo07j~O=p7t#t7@=u1Hjh"Pq 47=87u vo0^jh<7 V`o0jO=p7t#t7@=u1Hjh"Pq t7=87u o0^jh<7t WVP=o8|$47h>jNƍD$$PW5o8 5o8heT#.6 5o847h $Wf1ɅQǃ=47t @w3t.VjINhF$V \I81^_jփUSWVu} 1D$(D$ 87T$L$P $7|$ t<$t D$ 4$Ѓ|$t t$@D$87D$4714707e^_[]Ã|$t) 4I80I8 tQPh$ 4t;tSuh% uh $hM"vD$|$k}t1uu -w$<$t{D$  u h$hr=#u BtbE 8|ujj 6*D$ E @h""P $<$J177D$ @(u h8#i $e2177$fxt$xD$`PWt#D$h=t 177 77t9tP 7tQН79|ʉ׺9օt 7QB7j =@I8t87=7t ,I8!1ǡQ8Hs:|$ 4I80I8 r$fzL$RC|$0|$4I8 0I81PPPt$ i 4I8=0I8|N1ÉD$,D$Pt$-U t uR\$,;=0I84I8|1jPPt$ \$(|$0St$T  tti47 07;L$D$|Tt7HQP;H~0Q#5t7 87L$D$L$Pj#v̓0747St$-Tƃ u|$<t?D$Pt$j T tV$@ @uM @ t" D$ D$Pt$QIT t0747]447 07;L$D$t7HQP ;HQ#1JjQPR)L$1HfytL$I$fzt$PW5<75757 F8 t h$l 1H4707u h$J E @Ph$Pj#+ut7HQP~ Q Pj uD$@ @t2t$(|E0uE8 t h$ 1H4707]$@ @tt$AE0]u h{" j|$ tD$ 4$Ѓ$t$:1t$V9t$t*t$h$5t7q 5t7h3$@ 47 07|$| j$=7D$ = jSNBT$DD$@!у։1\$HPSs{ 1CSu f b5t7} D$@Pj+P DPWh]$V!p.USWV\$j/Syh t"$9tjP s/$t %jPrDžxx7hSh7( ƀ7.ue7G1dMt[G09tÉ؉jh7rx.0uO.u1GOtSh$~ 1^_[]5t7hG $r SWVd|$t1F57j"jdh!$SD( t7Iu1IPSQE W9Vh7 SWVo8 f$D$@=u1H$jjSP t h $ hh $5o8Pn 5o8" o8j Dž,y h $[ =7t \I8j9t+t&1ONthSPCE j2u=\I8(u jj 'hn $t =7t \I8j8^_[V7A07j 47A0^USWVP47hj |$ 7te$ܤ7d71@K$d7ܤ7177E7 \R8CthQP & E\R8 <77<77󥡴o8<<o8o8@@o8Q8DDQ8Q8HHQ87LL7HI8PPHI8LI8TTLI8PI8XXPI8TI8\\TI8`;`I8VQP$ VW`I8P$ q;qI8VQP$ VWqI8P$ XI8XI8;I8VQPb$ VWI8PP$ M8VPS9$ VUM8P'$ 4$Vj=47t47jփ^_[]7j&=p7t#t7@=u1Hjh"P@ 71pZ847jh<7 WV׉΅tF=u1H$fD$1@1L$tWu1JfD@iQPRJ ~%tD$t1ɅLɃ ȃ^_V|$u&|$ t5t7h $ \I8Q o811j1xt5V o81Vh, $ \I8jR4^5t7h $s fUSWV(1hd"S$@0 77$7$7h!$ !$t 71@777 77777 7$7(7,74707587<75@7D75H7L7P7T7X7\7`7a7h!$ tVPha7?! 9 Id7h]" 7!t h7h!$r h$P貦tFh %V蠦tJh#V莦t5t7h7 K=7th7hι#5t7^[ 5t70jh@h7he2'tEt W= 8kd70t&ƅu' $ $$5t7P) / $~ t $=7t 8j 6W d78d705 8V = 8t'~t!t7HQP;H~Q~ n Pj|]hj hZj ^_Ã=p7tt7HQP~Q fPj $]fV57u<<"2t!@"2h"PИtFuh#$j> 57#$tPhh7J3 7^SWV|$1t*<"2t!<"2WPdt Cuމ^_[V57u<<"2t!@"2hs$P%tFuh#$j > 57d"tPhh72 7^V 87I8 81I8 d7A 85P5d7:t 8^USWV1|$-2t}D$2111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,h#D$P#t uu ^_[]c9ơt7=7#tY$$Qh*$$PbW 2t72 7ttPl#PV^9 7uV-jVg D$E3Vxtǃu&Vt$ha$$ Vt$h}$$5t7VE|$tw7j h$5t7V"j 7t$V t$D$PjW Mr^_[]USWVP  8I8$t!uLI8t.u=I8A 89!"2"2I8 I8A t tu I8I8tu$I81BI8 I8$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5I8  8;$I8  81tu I8I8I8^_[]WVt$ t8<"2tD"2VPtuVh$$j9 G^_h$$f="2u / "2t7@=u1HP6 1;"2USWV}uCjho8 o8o8o8o8o8o80I8 4I8 o8o8|$(jW 0I807 4I8 47w+o85o8G1;o8)ʉT$t$o89o8s?D$0o8D$(L$, o8o8o8=o8D$7D$"7ʃ|;D$L$y =7`E\$ |$tY1${ {{;{{WSWJ ;{{{ {{|$$PS\$jU$C1ۉ___ __$PWj 1@G ____SW|$ S\$[J =7fDŽ$ 8I8t$Ph $hQN1F,I8 (I8ƒ\$x|$|l$x8%ݜ$݄$ ط%L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)Wh&$QP7N I89|ӡ8I8tPL$ L$ )΅~DQ4))hd"Sh&Rh&$QPMƋ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4&QPh&$SW?ML$(+ o8T$,o8\$0+o8x@BD$ډL$hT$ll$h|$@47 071G؃D$@5%vqL$`\$dl$`8%ݜ$ܼ$%1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4&RSt$Dh'$QPK ,I8(I8ȃ4707D$u݄$|9s0;T$ D$r$|$\$|?؍<)h)'$؍<)h'$QP+K N+0I8 4I8T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh7 VD$ B J1rrJVRV!D $^Ã0D$4L$8T$ 1ɉJJJ JJQRP@ x$1H0V0j0^USWVh=7u=7u }t$XjV+ +o8~=o8N+ o8y@BD$HT$Ll$HL$$D$$5%47 07Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ иd"t@#|$d5Hrr޸t1@D$))kd΍ o8HQP~ Q Pn ʍHr̃t"1o8HQP~ Q P% \t"u5o8HQP~ QP o8Gduo81G o8HQP~ Q P [~#\uEo8HQP~%Q'H wr? t:,u3PN t%o8Gdzh($|] 1No8=o8i3$$&ho8P tu :v2USWVՉho8QI~tDj.V1ۅt6UP(~u&)Who8V u1ۀo81C^_[]SWVD$=7t5\R8h($5t7> nD$t$h#PV` uA 77t7t$~Vt. l79PQ\I8^_[Pv|t= 7t"=7t5l7h<)$5t7= 1G=7 Sh%hQ8$ =Q8=Q8Shc)$hQ8 =Q8Shm)$hQ8 =R8ShD!hQ8 =Q8Sh?%hR8 8R8=71PPv h)$j`" WVPh7ơt7?snt$hc*$P= Ɔ7 7?)PRQhe25 x?t$|$  81; d7 ^_PhG*$ ^hi*$t$h)*$5t7w< =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=|7tDt W/dhQ#$.$t Vdh@$PD$D$ L$PQRSm:4$uu|$l$ 7t7tQSh*$P;Sh*$Pv; D$WjPUhe2tU57sƉ$t= 7t`VS<WFWt$PM Wh#V~ WSVs $t Pb4$Vh $莟uD$uqh $ t66h"t$h)*$5t7{:\I8kt$VD$VPjV D$Ph' $Ƌ|$WPjW u{D$ u?h/ $/ tt$VD$ V}PjVQ D$ 8Ph9 $肞Ƌ|$ WGPjW 1ۃD$  ˀuPh9 $>u_4$lZ81F=7uR7,=7tZ8Sh1#AOuh:*$V 1$tPa$|$t.WwPjWK D$tP`D$|$ t&WAPjW D$ t P`d^_[]h@h$h7 d705 8WhhhR8v uhR8hV8hZ8V57=7u 7h $軜t>ht)$hk8r1ɀk8.)hk8Phy)$5t77jh)$hk8@ tfjh#hk8( tN=7`R8tdR8j h)$hk8{ uh5t7h)$x S=7`R8tdR8Q8j h$hQ8? thQ8h\$5t76 1HXR8TR8PR8LR8HR8DR8\7h$g1Ƀu 1A\R8u ǀ\R8u DR8\757^Vt$txm2DH@tNFuhM.$VDutQjh$V tDhR.$Vut9h\%V ut.h^.$Vtu'XR8HR8LR8 PR8TR8^áo8t P1o87`R8dR8=|7u |7$7T7X7lZ8t Py]lZ8=7t77j=p7t#t7@=u1Hjh"P% jh7& WV0jk=7tpo8t1@=u1HjP; 5o8 o8$7x#jP 5$7 $77|$ j =7tDo8t1@=u1HjP 5o8o871DI8P8u 0^_Wh)$j D$tPѱt h-$j h#.$j USWVt$ \$l$|$WSUQ tU| u;HDO 1 t,$ t,$fO gK9uX e2I e2~e2Pe2he2 e2 tuÅt,$g t^_[]Vt$V^Jt^Vh-$j hhhR8wp thR8USWV=pZ87t`=7tW$twLt8PhhLp8NP j hLp8Lp8tJLt81PfLt8Pt8tNjwtPt8Pt8t$h5h7V |0/thh$V hhs*$V V?5$$P  7L$7@I8$-71@I87$ t1=7PGt*""1SSQPVh$a"u8\I8d$$r tk8$ t1=7PND$7$@I8-7hM"V0Lt8V>Lt8t2*$75Lt8Lt8Vh*$\  h*$M 1^_[]USWV,=7t8l$@11 SjhU tUhV$M ",^_[]<$tދD$0S ,^_[]WVP57=7u 7|$=TR8tft$h*$uqj hk8@j WP\I  =xm2LO@1 5t7jj(h*$ru=\I8u=TR8u TR81HtJ=7uA5t7hk8 t7HQP~ Q Pj 11H‰57^_USWV457=7u 7\$L=\I8=HR8!t$Hh +$Ғ+j hk8t|$j.hk8thk8`k84$uYk8519 k81f u>hk8h,+$5t7- fk820hk8hh+$5t7_- k8t$1 UVh{+$U) D$(Va !у $ 75t7jj(h*$u=\I8u=HR8u HR8tj=7ua5t7hk8 t7HQP~ Q 0Pj /# 7tUh+$5t7G, 4$|$57=\I81Hƒ4^_[]t$h+$j2hTt8 tTt8h+$j& USWV\$l$jWjh#WjUh+$S>( Džu&Uh,$S)( DžuUh,$S( Vjkj^_[]SWVhZ857=7u 7=\I8h*#hV8u_j hk8tL8tGx"uAHt.1Ҁ"ux"u"@hV8ZHt@r1ӍhV857=\I8^_[SWV$h$V V} h %P1Fta\$SWe t?|$/uH$VPVS 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh%P+ ƅu 4$V+ 1$^USWVHu\$ $Cj j ShWuu  t I"hVWT j VSH 7]t/M I9Nt vuvvS jjS ƃPjS \$fD$=7~%|$@jW 7O$Cuu S VjP^ 1D$ PWhp! D$ PWh#h-$< 81\$@jPPhSvvR thhI"S  8Sh,$ -D$ PWh3-$Y8$\$=7~N1PD$P T$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,8t8#tj}ud8AuZku<FD$ t:D$L$ PQhhu t\$ ۋEu Y VD$ PWh$贠 1He^_[] t$ SWV|$GHO~H0^_[Ë\$1NWu4G `f@u8t 8#ug GHO~막뭅tUSWV|$\$GHO~H^_[]1M;G~ uWS!u4G `f@u |$_ $ؠ&Cىt KDP@uD$ xm2|$1 ,,C t ^DH@ujGt-Ê xm2DA@CCu 1OD$" 8xm2L$C CDP@uʃ;K}/ K>C<\W O Cj$jGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E8ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$~8$$ D$ PhWZ  h)G1$C<\  Cٍ$ j  H$$ j  Êtxm2DH@tKCu$ D$VVD$PV7z Ǎ$$ D$ VVD$PV7T 94$ =j21@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$~8L$ QhP ~811 |$ 1 $R6t1BuڋD$8L$ Qj PY6 Ǎ$Pj t$86 ^ŃuuD$ L$ }D$HPQ4xWt$ Pp $(4$hUt$PN L$l$ ȉD$<9 ɽ|$Xxm2CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't xm2DQ@tVFu$$  Qσ s[Ej $( PSo %8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A xm2CDP@t Cu;|kwxm2Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VvE =8 hh V EKCDH@uٺ\4$yG=8 GKoCDH@uٺf4$KfCDH@uٺs4$ GQC t _DH@uC%ƋD$pW踾@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVSƍ$ jhU0 uG1,|8t!9}uEpV*mj |8xt$p@ |8>GWVt$F1Ejhht8f Å1|$څ,5858h5$|$t5858h2$t8 t811<|8t6 uGp5858h8$y W߅uFu<8t@Py@8d8P`h8(^_[]R5858h23$jT 5858h3$5858hA4$VQR5858hS3$$P5858h3$$P5858h4$jjUj 5858h6$lV5858h5$UP5858h]6$>5858h6$(5858h%7$Q5858hn7$5858h6$5858h7$jjQ 5858h4$5858h7$5858h8$5858h@8$n5858h4$X5858hz4$B5858h3$,$P5858h3$Sh $95858hR7$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u<8_NSFJ1<|8tJ9ouwvS能t?G $pSh|$698^_[]Ë$@S5858hs8$j7 SWV׉HЃ s%j SV G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S'2 uC9d8sd8؃^_[]Ë58=8SP PWVhG6$jH USWVP׉΋$1m~ w]$& 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x "2"2>u)jH1҉P5"2 "25ojnH@"28 "2>u j5t8he2色u Ć8P h!jY hPPh9$hTf2 j USWV\$|$t$ Ȇ81EtB5̆8WV 885̆8188Ht8hM"p ̆8 8I 8Kph+"jhԆ8 rf8"8 ...8Ԇ88@І8 Ȇ8 =8uІ88#uxnu 8  І8W1 t,E-І8@J}Ȇ88R)ʉ1ɉ89‹\$k81m1 8Q8u>#u~nu 8t̆81B C1ɾ8f 8@І81ɋ\$u8\$t1A ^_[]ÉrQh $j USWV| 8uN 819u:=8u 8e2e28+/$8e28!81NHQPP} 8=e2P3=8tC8S S58 th858v o8=8tM8t=e2tPŮV858h8 88=8t88 8@88=8QP )rf|$󡰆88t0W588V W58V` =<W58$V贝 W58$U蝝 V$ bUR PWVhx9$Wh8 9h8b8޻t=e2t PRh""h8@ 8rH9tt$t$P 8H9tȋL$!QP 88=8u888e28!hM"P  858h $Ud Ć8 8$@1Q5 8PfX 5 8h8h8^ ƅttb8|0 uNt$@ $@ $QV58P81@|^_[]58h $j 58h"h`9$hJ9$58h@9$jC h.9$h.9$Bc =8uh79$*c h8=j h 9$벡 8@ u:HQP~ QP2t5 8PW 1=8t 8t SWV8X1t^hM"3 t&Nj@HOW輫uW莪[뾋HWPV Wl1F^_[Vt$Vt^Vh:$j/ Vt$ D$tVPIuVh:$j V^WV|$t$ WVt^_WVh':$j SWVP\$|$8t P}D$jPSW PL8VPSW 8^_[USWV8jh 891FD$(8t8D8JBtOz T$R uW|$+;A 8$8l8ыR L$y th|$ 8)щ;HT$7D$t{T$A 8$8+l8. 8;H@ 8$8|$tol8u1ۉ81;A81;AT$t1~T$ l8=h81ۉ__ WjWSQPzG|$t4JT$B8 8;H`D8T$l85h81~>~ VjVWQPF1FT$1l8=h81ۉ__ WjWSQPFT$t tCsBtt$u 8;HrD8xt$t81BtȉÅQJA7$&=(85$8$= 8FPj Ww @) $8QPWG t8Ҿ5=`8 `8R҉Y = 58h+!58 u 1Pjh" 8S1P5L85H8)1Pjh"H8S1P5$85 8S%1Pjh" 8S1PS =(8 T$ 8=$8GPj Suv ƅ ,8D$4)أ$8,8 588<89a@8j5L85H8h 8j5$85 8hH8 4 58ru  T$ 8$8D$<=8e2="211 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;5"2r58jjh$n58j$ 58j s 1-RL$ tKQD$ ;"2r58jjh$]n158WjSInt$ tsQUtejPh&~t tQF;"2r58jjh$m1&)y:$Phu:$58 Z;"2r58jjh$m1t$ D$13Ph:$58 F9ut$ t$L$)4"2F9r58jjh$:m58j$ 58j 8@ @9  ֡8 (8u5585$8j5 8l=,8t58j n jh 8Y (85 =(8( 585$8j5 8jl=,8t58j ! 볋588<89@8+ 8T$JQl8T$ut Q;P $8T$Il8D=(8yBu%hh r芮 F 5$85 8P ;$8 jh"rŬ  _ T$=H8ujjhd"hH8 (8D$0$8D$, 8D$(,80848 8H8,8L$(t$, H85L8L$0 P8T8\8X8=(8_ $8QZ=j29 8 @ 8 $89r @8֍<8@PQ@8588 tT$\$ t8$8D$D$@nD$\$ h88ɉ\$ uHP1p L$$1 u\$LjWShp84D$@P T h88XP \$$1Ӌp1D$ ً\$u=;|$T$$} |$ jjWhp8h88P1AL$)t$Ӊ\$\$ L$t l8 l81҉PP T$Pd8BjPRSQ<L$uD$ظD$fu85 8T$\$D$8L$tjjD$@Ph8t$ tF@+6vFt P^ uF6^_ËFp vh $j USWV ՉL$t8p8щT$Љ$ xm2h8E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B 89r7 8P588p8t8$h80D$SPt$V>5 it}ŋ4$L$]\4$L$t&uE\89r+8P58ƣ8p85t8F1C4$t8t8\$D$ 89ȋ$r+ 8Q58;8p8t8 ^_[]USWV`}$111D$h:$u W uu5,;>ut0Gtg,;;u,;$8u _2ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1h'L%S t+8ttDGh:$j 1E L$3V th %t u3h $j tD$PW uh:$ۃ|$ tt$ uh:$뼅tt$d uh#렋Cu/h6#k}$tjh:$VV訪 VeSP% QVh:$ EPh:$hTf2 jý UVQt@t $e^]Vh:$j豫 WVP։E1ɉQPWs V?t$8t1H^_ 8"u #Ft1fUSWV\$t:{u4PD4ƋD$pVtD$0pVl Cf{~a11C404t?L$qPt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPF tvPzv ?F vv"F^USWVP1k<j02~4j02$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ùp pUSWVPk<j02j02$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùqGq8r)rhTf2jjCh5;$#Xj9 V1=8R"Y}t*jjj VV肄5`;T85`;a8j5`;@8jP8t#1ɺX02A<.u81 1@^USWV D$0f 98Z 8,I fEE!f ufE(Mt!U1f~ t @9ufE,$i\t0E,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPPy/tCÀ8t? xm2DAhTf2ju W@$&MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$&E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuLV=m$ 5\;¢5\;Ң1QQPS4rt$V5\;25`;d1U#*19}1ۋ$p$ *ŊEt9}1< ˊEE5`;h>$1VV5`;nUVj5`;\Vj5`;; 5`;M5`;/4= pm2DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&hTf2jt bxu+=8 8σqt$VcVVzw5`;IhTf2j ,$,$fUuE 9|)BfUhTf2j ,$T$4xut EfEuGza|1x(| E9}ED ufMhTf2jP !}Eu)uE t uP裻uf;}]D; jtSD; tt$4UЃF4; ~ttt$4WZu9E tuPu uE uIuuE8,Et)uE t uP覺uEtPEEf~3M1tRVMEGЃ9|׋E4t t$4UЃutEE tPtE ^_[]>Rt$58t$t$h>$hTf2護 ZR$@ t$St$t$ t$UPhG>$'Q $A It$U58t$SQPh=$hTf2Q $jG USWVT$qЉD$ qlGud$ T$T$ $P%%ǽ)j PJ)1Ƀ QWl$ U|$ WD$ptS;tNt$Cj SrJ)؃ QSVWD$p߀t G}uo $ $l$Atl$|$q豜KL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W !L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SC G΋<$9Ƌt$ufth>$VSw|$Gu1PPw@|$ GL$G)VQw_ wt ^_[]D$L$8 fAËL$1x9 8~8USWVl$0.89}=8DP58Ǎ PjQxk =8ۉ8t @tFj8/ú58!h81=8P Ã@.tgzPjjhËD$wL$$X&h 8#ú h8h8 h8J Ã@.tgzPjjoËD$wL$$h&hp8;ú h8. h8" h8h8 h8 Ã@.tgzPjjpfËD$wL$$& h8#ú h8h8 h8` h0xVD$ t$$&1=8)8  h85h8qh8c=8ftp8t=8t h [2h8%D$<$058pdP~^hPVD$ t$$&1=08)8 Qh8h8z=8ftp/8t=/8t h Ih.8<508c$h81=8P^D$L$ttu* h8h8 h8CWVL$D$t$ $ԥ&1Ƀ)lj oh8b8Q8h$POxt*t!h O8 W^_hËD$L$ttu*hp8h8 h8;Vt$ hNN As'T$fzufJvPhY$huhhY^ËD$L$Q1Ɂ~t't%u'f!tKu1Af fffHËD$Ik@ltH@1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH 1@ËD$Ik@ltH1@&013161h;$I 1@jt91h;$+ 1ļ1܏8jL1l8j1U<1h;$ݐ 1@jj1jj1jj1jj1ËD$@1@ËD$@1@ËD$@1@ËD$@1@á48,jh@1 1@á48,jh1 1@á48,@QjPq1 1@á48,PjPV1 1@ËD$1@ËD$1@Vt$ 1@^Vt$ j1a1@^Vt$ ja1@^Vt$ ja1@^Vt$ a1@^Vt$ W1@^Vt$ 1@^Vt$ 虩1@^ËD$1@ËD$1@ËD$1@ËD$j1@ËD$jџ1@VD$ 1F0V躟^VD$ 1F0V裟ͩ^ËD$119‰)Ѝ8hPPQQj jh  1ø81hPPQQj jh  1ø81hPPQQj jh  1ø81hPPQQj jhk 1ø81jPPQQj jhJ 1ø81jPPQQj jh) 81Á=8ftpthh8hd"h!81hPPQQj jjd 1WV81hVVPPj jh =8t#1GWVhI$A WVhS$2 hI$裋 hS$薋 1^_ø81hPPQQj jhE 1h81܏8jXH1ËD$@1@SWV|$YRW~PVh;$S^_[ø81hPPQQj jh  1ø81hPPQQj jh  1ø81hPPQQj jh l 1ø81hPPQQj jhH 1ø81jPPQQj jh' 1܏8jOG1ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@8'$1@8$1@ø>81jPPQQj jjet 1ø81hPPQQj jhP 1h81ËD$1@ø 81jPPQQj jje 1ø81hPPQQj jh  1ø81hPPQQj jh 1ø81jPPQQj jh 1ËD$1@ËD$1@øp81jPPQQj jjel 1ø81jPPQQj jjqN 1ø81hPPQQj jh * 1ø81hPPQQj jh  1ø81hPPQQj jh 1ø81jPPQQj jh 1ËD$1@ø81j$PRQ^vrh$PRQ^|$ Ft$uMh$vU;FVx$9tكaw~ ـb(Qh>$P t^WPS\$\F8tt$SVЃ F9u vq^_[]fUSWV|$58ti=8WyWkyG-89v1Wtuá8t Pۺ8=88ď8^_[]SWVt$E2t5ȏ8PUE21SSVj 1NtjSSPIȏ81ASSWQQPS8E2Wj =E2t@h$W!^t5ȏ8WE2W6 ̏81^_[WVt$ w?=E2t-t)95̏8r!P t;ȏ8slj4\;2^_588ď858|o58oVt$58y8ď8VLPh $^PT$D$ $1APYXWVPt$|$588ď8D$$WVP1A4$^_USWVt$R5858 >-8Exm2\Jك@to@uwt uDZ@t< ty< =ԏ8u =Џ8tI58vtj 58=ԏ8uj 58g8ď8Џ8ԏ8?=ԏ8u"58utj 58j 581ԏ8Џ88ď8ԏ8 Џ8f)ď81ۈD$u8C58'ut$L$4 58u9Ƌt$|258vuVUUU9}j 58T|$uCj 58:KVW58T\ E߃ @ Ȣ8ď8=ԏ8uW58btt7j 58%5858WЏ8ԏ88ď858ے ^_[]t$Ph $VPt$D$ L$ $PVP1A4$^hd"t$t$t$t$USWVP|$ \$$l$(t$588ď8D$,$VpUP@1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GWjj58Ƽ1ɉV,$E|$@t[D$@8tRD$u:h$58Vt$@58Uh?#58UWt$Dt$E h$58U4$S58rD$ 58 r58r‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US58U58 rth]%US58U/)PS58 5858Ã~0L$ZD$  "%  L$X1)<(x1 xm2~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQPw QtRD$(υ~] $9I\$)RPQ" KOuLuH|$@tAt$t$D|$WB W QhTf2j D$z19Dzf tN;L$$} xm2DXuhTf2j軨  $9A)RPQq $8GED$t+)j Pt$58L$8ď8D$t8ʋL$ u|$@t$;D$@u  $L$t$t$PA 4$舰0^_[]hd"t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(58n58n$tKۋ|$,;SkO|$0L$Dȃ19AD$LD$Ut$HP1t$PQQ Źt3;|$,t.D$DE9}SNŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j PtC@j PuL$$)݃} 9WUQS583ƅ|$ ͔VƅtV5\;耈4$58PW58LPW;H1PPW螿 WD$E|$ GWUPS58蓆Pŋ=8VPW=8VKPWG588ď8#WUt$ Sh$581$|$<\$HD$LD$t$(SPST$t$t$Ht$HWtIVe4$tWV4VAW肊UPAWA^_[]hd"t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]hd"t$t$t$t$USWVP|$ \$$l$(t$58u8ď8D$,$VAUP14$SWt$(^_[]hd"t$VPt$D$ L$ $PVP1ɉ4$ ^V58i58i^fUSWV $$$ h8158588'$58W˚8WVP: &Ft(= 8tvvPG< vh 8>B>vuɸ088888hq$c'6$|$ h $SU豍 e~o~1pMrtCID 8붃fi5,;hM"V虂 rPhW \$h5"Wv D jPhdT# t \$Sh|$Wԟ u4 ?$&WBIPWV% t }u몋}tED$th5"S <=u̍4@h5"P FhB$VH90t$VWv: Fl8h8h8h+$5,; `SWJ$$$ Dma,;$.K2jh#h#$ VB5`;fǃ5`; g1FVVPWg|8t95858耝58h=z 3VjHVjHh[jH5`;(蝄hh8D$D$@VBljD$ V3D$1ÅjPv  $t|$ o u*t$ %n ut$ $n j|rjU`tc1L$ <:B "@9u1PPPPPjPPj jUVP{4t(j{t$WFWZ11V账|$ t$~14蛦4萦C9uW肦VyjtPjjVh"y u\h8jJ8j";8duո=l8t j' jjl(c0؏81 ^_[]Ét$ h1GQWP PhX#hTf2y} V蕥Wgt =hTf2jj,h$/jEt hTf2Vjh1$V%t V1FhTf2VhEh$Vt UWVV` h߫"!Pzw j}Z\3=8t>VƚPh$W| 58v58E8=8t>V~Ph$W\| 58.58E8=؏8uhTf2jjh+$e^_]Ã=8tá8tt$Pp jr jr h߫" tPgv t h$Vv F;[jihvx hjUSWVB L$Q+  P1S Ń j h$U贿 ~ uF t$|$ W.q WBfD/UW^ WIjŋ>7PFtn,$n ;nu:FUW%t^FPv tFljFn ~D$Pq 4$c UV S/R ŅS$ ^_[]ËD$L$I4x1@fUSWV1t$l8jV t$t$ t$t$4$jVP<=l8Pޞ#t$Vj >hj]jYjjV9sh#$_ VV,jj^4?15l8}48VPX~Bjhy48jPmXyjhy= 8VVVu%48ǀ$jh1yupV}48Ph $jXG j@tO48)tTP8Du2PKu#PuTjhxP^_[]Ë$l$ D$jPtщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UG9u1PG9uUU$tG10L$9 t.T94t&zt T98t4t9t9`$El9rۉt14U^tG9uV蠞fV蒞SWV1t$t$t$ t$t$4$5l8jVMjWYs4PV8 48$*tKuKt!Pуt48$P48L$$Q] tXD$t$VTV x)VOuG$uR$t*Vl^_[À)ujhcv Vt5\;y1WW5`; 5`;=5`;ySj q9;xhj_jZjh]jVJh#$_Z G$R$9~dUSWVο$WQS- Wh]$S WSU}- Wh $U S21tGU#t0VVVVVVVVVVVhQ"h41PPt US^_[]SWV$SQV, Sh]$V SVW, Sh $W Wt VW7^_[WV1t$t$t$ t$t$4$5l8jV1tkj?Ap4PV5xG48*tD$$tL$PQ{t$VLtVǖ^_ÉWj 0?t1hj`PP*u3|^fUSWV$$$$1EQt < tEBT$BL$ Q9D$l$1@$4Vw99D$pPt$V= Z$DaD$|$ $%t umxm2DJ@tiOGPXhg%dj D$(PWK L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5xm2t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8uxm2DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV҇ \$ 9tOL(tu(D, $ $ rt04( Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW 58t@WPh$Vn 5858G88sh"h$)o 8t*W踌Ph$Vn 58h.58HB0}tPh"h$j[s1e^_]Ph$hTf2V 1Ph$V 5858P758wh""h$6n 8t81h+$W讅V跋Ph6$W薅 58g$MA0肯PhO$h$j[|1e^_]V1hhPhpPjjPj jjhE2hݸ4xjP赪Vɹ^hTf2jjhd$8tPjjhd$jc SWVD$x1|$8t8 P1; PPVh^"W/^_[USWV$$$L$$QPhVh $hM"V $D$W覃1K4$誂 1G9r6|$  WUAŋ$(\5F4$P ÃugD$ PV9uH|$dhM"Vk $t:|$G=8tVh$hͿ$P-k 1KS1D5$$t 4$ 4$b4u8tVh$h$Pj 1ۉ؁Ĉ^_[]Uޒ$$$1KQ USWVu ED$l|$(PVW  ED$8D$1ۉΊ<'t  j Fj'Vu V1ljt$ t$PS蓌 D$ t$ )VPh:"L$Qh hp$Vq t+9s'T%u@u @Qj*P! ;'uC|${*1\$$|$D$8j/Wa tW É@/ W É|$PD$0SA ND$+D$D$ .t Vt$WS4 tS@ Džu]D$T$L$;ȉD$Pt$ ;SD$L$Wt$t$ hs$P 뒋D$L$T$;t R茐SN |$\$$h$Sȿ G|$\$1\$L$< t$0Vhht@WA fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=`;jP|$ Wj 5`;|l:5`;̠j5`; ^5`;^&l`;D$D$(D$$1WS D$ L$VWSPQ51N|$p$ 8h8hptt$$ =E2\$hE2hbtt$( us=E2ujjhH%j< hE2hf@t$$ =E2t0E2hE2hbtt$( $\$E28t P8t P£81t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@58L$@EL$D$D$9}?D$hP*!@lHwf|$u9Mx{;5`;tVGjP|$ۋ|$t h"F*hP0*fe2H e2~e2#he2+9Nj|$tej~ ;5`;t V|$ t E%u15`;5`; j5`;KWset$(迈twP譈uW蛈D$td$8u-e^_[]D$t$ h[$jE Vh$P1W 1S8 1FV8 Sjh$7 VSZ kt$8 $ D$pL$|PSt$({ t$ `8t*t$h$P_ 58)88t*t$hX#Pn_ 58(8h%D$ 0c+u.h$D$ pK+ut$v t$e s h8nEt8tP: u%t$V6 6h$ j)OL$1Ph$ USWV։5`;ԗ1@P5`;U5`;d,ch1PSU`( <hhP'<hMPS1CS%( ;Wh $„Z<ho]$&FPUbb5`;C@)VUPRQ5`;S^tcjP2t05`;˭PVѬ5`;S#PVy1PPV V3b^_[]hTf2Sj+hz$ST fUSWV-1@=܏8$h[$Pjq hvtD$1D$ $ $?$VF$9$VWPWt$ Oy VWG|$$L&xm2D$W#PWt$ ' uD$L$DAu >uD$ |$O 4$ ))ht$P4 FD$ |$$ ))Ƅt$ȃ$蹃8 }? jS| ƃ $NfF;Ju1ҹhvRRRRQRRQjSD$DPjuԦ4D$D$D$ D$ jtD$ Pt$膘kD$ p ܏8 )) hPh8 14p&jVh8% t1GuD$(Vh$j@$SW 1PPD$0PD$XPS? t|$Lub4t&h8h$h.0jsk"D$L1QD$PPQQS Sh$u1=8su=8luxm2 8DH$D$$Ph$̴ u5$nfsu( $D$1@D$ |$$tD$$D$$i jvh1Wt$TVz j!W|$0Wj iW*]hhG$uRCh88PPj=88 h88PPhh"h$X Ph`$jKp h$W=ph$W/ph$W!ph$Wph88h$Wp =88t!h88h$Wo $9h$Woh$Woh$WoW!h$joh8h$h DŽ$h;8VVj~j hK$Vӛ ;8defa1ȋ ?8ult1 j hE$h;8薛 ;8manu1ȋ >8ual1 ;88ne>1 ;8none1 ?8 tlf=;8 tb=;8t`h;8h8hU$jtCh8hp$Sj~$$c~;88hh,$Oh#igh8h,$h9$hL [ 8 8h+$D$ Pj3 ~ht$ h8 t$}j h8Vth$D$ Pj ~ht$ hV8 t$Z}j hV8t=V8t 8h&$D$ Pj ~ht$ h81 t$|=8u:h$D$ Pj@ ~ht$ h8  t$|j h8ct=8t 8hh8 u=8t 8D$1@$" h78S$Wh  V8PPjx5V8PPjw# SW t%8|$$|$ t |$uj8PPjy|$t j8PPjz^h8 =8u=*$=r!ƒ5$t@$=ujQh8  j8PPj{Wh8PPj}A8u4D$D$Pj茐|$uhV8PPj|T=V8##tV8=;8K$t;8=8t8|$ti=8##t8=8#t8=8t8SVWQRh8Ph8h8hQ"h],$L=8##t8=8t8WVQRh8Ph8h8hQ"h(jjj8 xPK* :8U$Ph $h hb}<h8h$hSN S"jrj!R$H1WWV$Ph$ t( ;$P$Tsh$jPbt^DŽ$ 1WWV$Ph$ ? ;$0$4&h$jPhauq58U1H t$t$rx1t$t$Sxhe$j<$t$j܏81@$F=V8h""h$FP h$jgt$(V VmPh$h$Wg=8th8h$Wxg =V8thV8h$W\g 1h$VLgV"W=85|$tk1h8h8h8h $Vu98jh)$W hWWVjFj jh{ NtNjjSP% |$ =8Qh8h8h8hQ$jDŽ$ch DŽ$attaDŽ$n/slDŽ$/sbih98S1 |$$h$We D$Lt$t$L8th$We ut$LD$LPV' =8t8VPVV |$ u/=8t&h$V"h8h$V |$ t1A&h褿h$h1Ʌ ܏8j>܏8e^_[]h8h8hv$jt8tPjj"hy$1FhTf2Vjh$VC 58th VP, h hTf2P jC USWVL$,!ij u!D$@tP蘝 jPh8 L$,%ij u!D$@tP` jPh8 jPP ƍ\$1 jh8SU Sh8i(V& V{$ ulD$PMhPh;8 WMt;Ƹ#;8SPU* SVU WMƸ'L%uցļ^_[]VPh8h$Pj"Vt$/ Vj/ tfjh$V| u;h$VS u&h$VR ujh$VA u"h"j./ ƅu4$r^Ét t t@hVh:8 SWVt$hV uT|$tMƄ$j.V5t#GSVh8 SWh8 hVh8k ^_[SWV8Sh8hSh78, =8tO)~!8.u8Ph8Ȉt(78Vh %W# Vh8W ^_[ËD$w&ød"USWV$Vh$du $1퍌$Uh$W :HUUW f@$|$$jh$P 9tx/uG/$N~/vt$jh$Pa d"w&1҅‰)ˍL$$QSRPh$hUD ^_[]Ƅ$8USWV΋l$M9vb׋D$tU|$t /u"t)|t<8$1ɀ=8/8QPhm$hh8 D 1^ËL$1Bjh8WVt$=܏8u jG7Wj 詄u1@l858艶1ɀ=8/8m$QPVWh8mC W1ɀ=8/8QPVWh 8EC 1^_Vt$V'eЉjh8$^WV D$Ph8菡 u:$nfsu-Vh8h8v Vh8h 8c tWj 蝃1F?t[h8h8h$jLu>88$h8VWh8aB h8VWh 8MB 1 ^_SWV=܏8hV8u(h %m]u5h78hA$V=V8t h$=88t h$Ͷ|$h8hN$hWA h""WƅnWPh_$j\h.|#V\=;8th;8h$V\ h$j\8uGWPh_$jg\=;8tDh;8h8h8hq$VA\=8tCh$Uh8h$h8h8h$V\h$j[h"h$pPh$j[ $SW[h$W[SW[=8th8h+$W[ h8hC$Wl[ =8tLh78hι#WK[ h8hX#W8[ W h$j [h$0[uh8h$T=88th$tTh8h$bTt V7 j^_[USWV։ϸjPP tCËl$hjW ojh8W WVS S 1H^_[]USWV T$ˋ$ Ph$?u d"$$t8h$ jPE t&D$h$蓳$D$D$$S^\$ PWS. 8|$u8PVSUh$t$ƀ<$th$rPO1 ^_[]ý$+T$L$t$!u/Átu#Ãt6u8h6h/u uhB%!wШ&hhV D$L$FFhpV~ ȃ ^SWVP1ۉSSWSjhx&t{4$W1ۅtjSSWPjhx&tEh$V~$ t&|$\$PS׃th$jX$ uVh Vh1ۉ؃^_[USWV$p&\$|$jSP ƅt Eu$wS7 wh"7 G^_[]WV\&|$ul&t%|$ jWQ t u1^_ËL$E24USWV1td։σSPSWQ  t u6P1PhPPj D$PU3. D$t΀8uɃ<$uð1^_[]ËL$E2w4USWVl$\$1}$hnW6StOD$SWPHDWWRt.ljFt(V$'E$EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQp $V1VP\ 95l8D$40$X@h&P@tt$45`;fAhe2,R 5`;#9r l8ɉt$ =1MD$Ni8D$$11t=i8,48tǍXUS(N݉|$|$l$$848ƀyH1ۉLPTXVUQ 48" .hQP VUhp8 ,48L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQPs48$()1HD,048Ƃ(1 l8<58W8|$c[ 8P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً l8ɋD$L$ӾV Wd"QSPSl$GU9 48$H@ VWd"RPQSD$BP 8t% 48QUHDRh@$P 9 =48$0(ơ48$pL$*QUPVWjj:XD$ D$D$ Pj?vD$ t.-l8L$QP548 u<548h`tS$Pdž$l$48()8 8 8VO8VjPR L$ D$@D$9 l8yuƇy$u4P4 44S$똋D$48$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$;D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4;El$L$),$|4xfDŽ4DŽ4;T4E,$DB8t$ 9zt$D$tj$Dx[fDŽDŽ;D4B=ND$?P1D$ +D$D$$|$y+DxYfDŽDŽ;D4B1hPPPPjPPjjR$Pj4$1K|$$8h $j? D$Wt$rD$tvl4u^u3h1PPPPQPPQjt$,$Pj肀4ÃtCD$WSRrD$lxSN1H$^_[]1M4$0$<t4u/h蒢hPh:F2 48F21@멃=l8yul8l8s19dL$w BsÁt1USWVD$$48*t1G.$ )$Phz$hV0 $jt(hgkNVh$h j$ $WP48$Ph($hV/ WVh$4 ]h$Vjj\ R1PP3Ahjl1q@$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$SΠt$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$&hS$D$P _$D$d$X3|$0tPh$hW- Wh$D$P趋 $D$$zh$D$P{ '$D$-$i3|$0tPh$hWh- D3t#Ph$j\$SK- S\$W= D3t#Ph$j\$S - S\$W L3{,"t#$tWRh$D$ P迊 D3@$t$D$$D3|$0tL3tQh$hW, Wh$D$P` $D$$Q|3k$t$PD$P0 $D$$!h5$D$P A$D$I$D3 $t!t$PQh%ht)$j4$>WtQ,Wd3U$ Ҳ=l8t$ $QD3$t<|$t4øSS$PW$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRh$UȈ EtjPF1 t4$  9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uh$SVUh$S$ Pu1Vt$h$P4$CU$ l$Shf"Uմ h"UWVjP5L1PG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQ^_[9rwًz89y8rw19HUSWV 481G*ZƄ$h$Wh""ha#'蠛Ph$jC 58t聛 48QPh$V+ 5h$SC48)\$J$WPZx$L$@PQ! $d$ PV! D$@Ph=$SBC D$0PVY"D$0L$8L$D$h "P w\$D$H$194$h "WFuށǐW$W SR;t$$ *hF8tPjjh$D1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7>#td"$r$\$t7ȉL$7 T$wX'$D$ $D$$&d"$uht$$P w$Pt$h{$t=uD7L7qQPh$u/#$>#dD>#t $D$ $ $T$h$RT$ D$L$ 1@D$h$T$A$D$L$ h$RuD7>#t$$D7d"@t$d"y$d"t$T$(d"t&$T$ |$$d"t/$L$,d"t6$d"tB$ d"tJ$t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h$t$D?@غRPh$t$?ClE;F{Pp\$CPW SOt$0|$4hi茕L$0QjP. P8WOOtVhT$t$? S.O= 8u#D$@ 8@@hpPihR$\$ S>hk$S>h$S>= 8th 8h$S> $ 1|$@VVPWh$o ;wd"r53#t53#Qh$SB> h$qh$dh$W= 8t h$Ah $41h$W=SN W赿e^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ &h$Ue UeuhA$h$U> U>FjVF1Ktljt$(2"h!$0 G_$$G$G w(2"Gh3$ G _$${$$C(s4C8&hE$Ԣ C<{@$CDsP$sT&Sh$Us UstlShW$UW (2"Ux F_$$F^ FShk$U# F&UC F _$$F$^(F48ihA$h$Uޫ UtlA$WhW$U轫 (2"Uޡ F_$$F~ ^Whk$U艫 F&U詡 F _$$F$~(^48+4$iƷm۶|$981Kh$Ktzha#tiD$ha#Pj@ Wl$UVt$蚰t$K6KOu4$J48Ph $hˑ 1PP}#48)t5Ph($hU% 鋔$ 1$ 91AP膑uDFl9Ɖr:48Ph $h 1PP"ѕ69ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhch$h$hh$A4 L$T$jt$oËL$T$jt$XWV׉κ$jujWhd"VhL"0 ^_V881ɾ 9r^^VD$88tU@8xtlIuAH1FVVjjhh880QRx tjh88j^ t88^À=88tjh88j7 88USWV 1WWj &iP7SPj  t$ áxm2D$1/dev4$D$iƋ1N/ u1FSt$$P5d/dev uDL$DAt|tER|$$t.jVj? t xm2L$Nj4$D$/devG4$D$M[1O4$1O1V1G ^_[]USWVPD$tPpP11OFtFh$Pt.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T$w $PhV"hm$Vx ^_[]Vt$D$QPLt(D$t%t!hFhPQ诩D$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$58.@ujP>D$1҅D$t 9tL$BuT$ЋT$P]1hPPhc$h7$jjAPjQQhE2w h4WPuZw DM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h&PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jP#=D$1҅ӅtwUt\P,40Ut5L${|$P]>$tL$ST$Dځ8Nut/$E t$:CЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$WR;ŅjW=;{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ 2D$$@$;E tL$ A;L$tI1۸hSSh/2Shj^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6Y>^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVh$h趪1^_[USWVu $`&jVPJ uh8j}wd jVw& E2OE2Ot 5D$PQCG1*QP'D$,W D$($D$$(D$ ,D$L$40$VR+C$$(QVPh;$hS Z8^8PG@$QPB'$HffsWBD$BjhF$ 1ۃt$D$ ha$hR$W'F Vhp$SF Sh|$W Sp$Ph}Dt$VW8W}GV^ۻ$Ph$$%; 1ۄ$h$$h$PL$LQhJ%PD t$,04t$jj hd"RPjVٰ |$LWxm2r \DZ@uWQVt$h$ht$ v 1C}$!.1ۿ88PSW t$L^^^F~ FFVhQt$ ? t |$dJSjV $1BfBBfJB rZB'BBL0$VhQ`t$ )? t$pT$,ȉ04jj hd"RPjVf VSh#ht$. }G8@É؍e^_[]88=}t'fy"n8 o8NuEt FuXt1€1ɾq8( Ӏu A'w'p8 ' Àu A&r  uȃsƄ\$,04t$jj hd"RPjVH $PVSh$ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj hd"RPjS衭 W$mPSVh$ht$ ` -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ h$q Y|$h$u Džtoh&6tkDŽ$v/rDŽ$/dev,$$VuP҈ D$/devf@/VuP赈 QP낋E\tu xt@@AED$58$ttt$PуuN48덬$WPU t$/devfF/48WPV [S\as(a9aO$CQPU觇 {PWV48$t(tt$Pуt Nj548,$1D$0$h@h&P5tt$G48PUtTP,40Uܻt-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVS $WD$pV l$ Uh'L%V\ ǰD$hb!WYhd_#WCtyh)#W1tghY$WtUhx$W tCh"Wt1'L%D$t)$tD$VPSA VWS6 Uh'L%j DžED$4$v PS} t"vh $j{x jt$t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=h8SWt$t$$$1PWt$t$ |$u1@G864t8m$VPWSh8% tVPWSh 8 1^_[USWV |$ faa@D$>$1Cd"=8th$j肙8VrPWh$h"vD$PU{AD$h>858h$j$x87sW5"8u8QWh8Vt$D$PWh$SΘ$'D$D$ =mdt2Vh8h8I Vh8h 86 1$hVSI t$t$t$D$ 8jVVY\ ~;Ƹ PV"D$i jQP.\ e9]D$|$h0`Wwr)o ~#u4h8h 8_ 21jio 8ލ$8Hf@;tJu1SSSSSjSSjjUVjlL4jm|oPVH>V\Mkt8Ph 8 u`~*=8t!h$jѕ18Pjn)D$Wj=\$tt21ۅ1C؁ļ^_[]h8$h&$h0hY$ USWV|1ۀ= 8t}h 8hZ$jA ue8$m$8h8VWSUO h8VWSh 8: VU>C#N@1 É؃|^_[]ËD$L$I1@Ã=8th$j褔8Vt$ D$t PmVj<m58^USWVPWj{<1F?tihp8h8h"$j*uL88$C$h8VWSUh83 h8VWSUh 8 1^_[]SWVPVj;>u1@;8E$h8VWSh8 h8VWSh 8 1^_[ù1@t ]8It1ùtAG8t 1ùD$G8Au<8ËD$<8SWVhNlhy1$hWV 㹜G2WSChWWh>Wj658WjWPVWH4SP:VIİ^_[USWV|$1i/t\1tW<8tI1r rr2*c0u&1q1ur1ۃ0݃ucr @뜃|$tB dBB6d^_[]USWV|$D$L$BJ 0uQ=81۾z%-x8B0t#1urF<8tu89u'Cϸx89t0<8t8tp80 5|8|$QjVPh$W{#^_[]WV|$t$ Nt tuhL$kL$V$2t$jjPWV^_USWV|$=8t h8k;WxW8u8l$}QWVh$hU 1PP8 ơ8t3ЃMPU>uu#D$=ueߋ$$$td8Pkۉt{uh[$j$tjPUh$h׏g=8$th8hvhSjP jPW?"V6"nUh$hn V V"$tl8Uh $hh jjS78h581@|^_[]Ë;hj%Wt(h|$Wthm$W=Ч8uZЧ8htgSjP jPV=!"=8t=8tUh$jc C<81$<p81Vt$hӋ$VtV8t 88^t$28u8USWVt$,VD$j$t$V2to1\$l$t$GSVhVVj UP L$Vtu(;D$0s"L$44褿L$|$)L$OGj$WŋDžuD$@PsDžj$t$0虋|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$V( 1D$44Ut D$44վ$D$D$ j$SŅm<$t$ >tV\$S' V莾$|$);\$u ^_[]h$h$hE hY$ SV5G21/t.T$ G29u9t <8t q/u^[V1ɍt$QQPVh$R y1t1^USWV|$(1$PPWVh$ $D$(1PPWVh$֥ Z$LF13$>$&hFdo]$Urdhgh$XdhggUBdW(:58*D$hjU58P &PP0qhVjU58w'V~t PVW= ׊WD$ P,>St$58yP 58+58}Sjh$- j D$ PU Uh %c D$(SSWVh$* $j脆 h %fMuQ1A tCjV u4Vh$"1ɉtjV uVh$j D$(SSWVh$舣 u$~h$jTԈȁĐ^_[]1USWVhh$178tPjjh$1t8p8l8h8d8`8Ч8G2/u D$8G2ڃ9t<8u@`8Q/uD$/u.p8`819hGaj G21@|$>Z<8M d8L$ l8L$j5\;5`;5`;=8th$ja8t8p86P5`8h$ja`8Wj O/D$ttRN1ҋ0t1t /u oBrg<8uƃ<8t81<8uAuVwD$u,D$ d8D$l81@<8t8^/ l8F`8p8QR5d85t85h8Ph $h_ jjI.._58]1K8tvh-$hޅu>h-$_t$FVj-~thf$j蛅h$j茅h$j}1GH8yH8tfh$jFh$_L$QP|3u{h$_$QPZ3uYD$3$L$3$ t?h$h"$Ift!h,$j辄h"$hm$a裩1=8th$j舄8]$1L$VVPQh$ }t|$ th$jT'jSe^_[]1F]VD$FVj,F^SWVPD$$h"h$wat@Ƌ|$]1Phl$S9 4$WV V蒷 h$S^_[USWV-I2ta1FI2t&U7Fd1tUh $h\ 111Fo u1tjh|1@1^_[]Vh$]t$hPV hhѧ8V x(ѧ8ƀѧ8h$Q? j/P@ $|8^SWVh$"]Ш8hPVE V茴Щ8K5|8j ԩ8ة8PVh$hWe jWh?" h.PV]j 4$0PGP$4V u <.=tSh $t$t t$ hSo ut$ 软 t$豯 4$t$ t3h1Tt$FVj#~t$t$ӿt$t$趿3jPD$t P D$t P Wh $h4T jj #S58G1N^_[]t$ 諮 t$ 蠮 V跽11N4$v t$j t$# t$ 4$ VD$FVjf"F^SWVPD$$h"h$Wt@Ƌ|$2T1Ph$S 4$WV8 Vܭ h$S_^_[h$h$.S$)1ۅtH!t]! 1ۅÉ[USWVh;*#跈Pa D$1Ʌ$l$hhS#U ti\$WPS 9s?hh$S$_ =w%hVS_ =wjS t@hhS#U u4$p 1jV\ 1Ʌȁ^_[]4$B 1AVt$V說1|TsrLc1f ^Vt$hӋ$VtV8t 88^WVt$ D$wǃr9t\-tSPQj<3 V5`;1V581V5`;ZV58K5`;585`;58^_WVt$ V u.>v蠵0#PVWh$hTf2 @$^_WVt$ 0OpOGt$>FFVjF^_SWV=G2/t/t$G2GtPVSt /u?É^_[USWVj$t$ t1ۅtKƉ|$\$FUShSSj WVK $Vtu;D$ rj$Vtƅu1؃^_[]VPT$ D$t$4$VP ^USWVӉϋl$jUtMƅtPt$V  SNVUP tP׃SLVC^_[]VPT$ D$t$4$]VPv ^À=ت8uaت8g!X8$8$\8#8/#x8&!8SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW<$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP蠗 $LL $UT4L$ L8L$T$T@Lƽ$$hVWU uD5<w |5L Ku1PPD$P )ƍD$Phd@Vu |$D$|PhedAVM V袲f$1 GaD$P$,hI$t$Va 1PPVI $C]su PUhh8t$t.8CD001 81 u=8tZF9|4$賱ja$,h$$0u` EPP jOh8D$4P;m D${O1ɳ$$uƒrL+1Ht$,D04$t$$,h$uP` EVPh#P:` EtE @E w-G$9@  V躰؁^_[]1D$L$I@P<8wʀuG8Au<8 <81USWV$$1$hWV E jSyhWWh>Wh58Wj jPVW#4SPV$1Ĭ^_[]ËD$1ɋ0t1ur<8A1ËD$1ɋ0t1ur<8A1USWV ։D$ $D1$ U D$$ ,$D$$i^ $@E$u$D$$$$u"$PE\$$8o \$\$$&HD$\$$)|$=p8=8=8$ <$D$D$F$r<$ q|$4$D$ 8D$m$V] |$D$ p8D$8D$t$=܏8u$$xD$1Ƀ O2\$xJ2C|$D$$$o]$C\$$({|$!<$D$8D$xJ2]=O2d"|$l$ D$D$-$$jljl$4$ K=܏8u $HwD$|$D$$.$o]$9C\$$'|$u1=8=8=8$ <$D$D$F$褋<$<t|$4$D$ 8D$m$[ |$D$ 8D$8D$Z$$huLl$ t$<$D$$h$ \$<$D$*$h$ l$4$d > ^_[]Á=uM2ftp]$=M2PFSWV|$tyԩ8GO4VStRVP t{S5ԩ8ة8VhШ85Щ8hs$hSA jSh?" fGtJ2~"PptVT{V;1^_[ËD$ Щ8ƁШ8 8fH 8fH1SWVt$Щ8Ш8V~)S4:Q; F8F8F1^_[ËD$L$01؝SWV1ۉShPS$ ctD$$P襈 t V+8V81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6u61^_ðt$hzd@t$  SWV$1ۉShPSWvt/S$SPW03Vy C81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=h81SWt$ t$L$ T$xD$T$SWt$ t$^D$ ׋8t$ t$(蚍y$L$\PSWt$t$,t$RPPQR $h81WSt$t$D$T$WSVt$É֋=8t$Ht$H'$PWVSt$t$y$PPPQ $VD$`Pjhs1@USWV u C(D$|$8hjWa wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@Ǿ&|$D$u$d&B `&B\&BX&QP׾h&B@ tu Ǿ&pЋ$+L$L$8L$9Ǿت&HQQQQRPRPjD$;8~8h.8P;8~8h.8P;8~8hn.8PƇ-89~8ŋx$t;11ۋ@(481.P莇-89~8C ;X$rɃ-8\$h|$lCD u9kwi$&N4F8hv~4l{8F FN$Nj5h8QP T ttt8v[v*u5f|58Uh$sFH@Hth$seFH@Hth$sKFH@Hth$s1FH@Hth$sFH@Hth$sFH@H th$sFH@H@th$sFH@Hh $s\;T Yt8t,2w rhd"Uh$s\d{ 81F( {8FH@LP+PSUh$W{8j5h8vv{8j5h8v$v 褃58RPSUh$WpT{8FH1@LQwFHpX58PQ{FHp\58Uh$FH@`L$Ph%jQF h*VjP P5858h$sVzbu+~V|$jPWRUvPQd@( m4C*WP58h$sT1hh*P5858h$skh^_[]Ës=8h)PWUh$VҋFHP58UUSWVP $1jlv D$~ 1ɋT$RL$ QVPL $@L$T$t$(t$t$4t$ 4$vP|$,|$~1ϋ^1 u)~3|$u|$ t|$ ;>t~܋\$;;tlHu\$klT$<ư\8L$A$0;N @4$vD$F@ F58Jme^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|94$ukGllPw{GX FPvUt~C $i)ىQRP% 1D7D77rfD7 D7 4$~Efn'  V)RQP$ fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jP>L$ A$W t׉\$ A 3mOu\$ 8fA |$tArfAA 1AA tAfAA5 A AvfAA) 91jEVVhh hrjJVjVQPhH84C(OL$<@C,SP`{,BD$$4D$+{tR[L11HD$Cu5{t/t*Ch$P蓃uF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0O%ƋEp?%PVjWSUFƃu4UtU)ƃuEtDjUуƃu:C(C,SP={,1s$C$10s$C$s(C(1ۅÉ؃^_[]h$h$hlh$ USWVt$ kFllPvNj\$FFi )tkllklPRQS! ,$kl11CPs8Nj$ /L$s)RQt$  1/D/D/D/ 3m{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPhk, WP1^_USWV48t$ 1$VŖ/} VC$T$GD$ pjVD$D$ 1ɺ<t$r%t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$ )Ɖt$׉|$}C;\$$G\$Pw}Ɖ} w$pfXGklPwXڻUG$D$klD$щT$E@ډT$)|$T$ω$PVQ E @D$\$ )vkL$l$klPRQ 1WSVg t$klPSt$g |$,taE $L$T$уhT$r0qЋrq؋2qԋr qrqrq܉A $ẢyCl89ut$T$;T$ L$w1ɋEfHT$M Qf@ P1K&L$t$ 1L$t$ QzV跘؍e^_[]ËD$@,1@USWV$u}t(M01B1 tǀ9s BltNf~N( $ L$VWd"Vd"RPPQzM EHemL$ U UWRPVQJM tD$8hL$8jPPQg $l$P tRmL$8jPPQ) Y0LƋp;Ǹd"<$u h!L$8T$ RUQPWVSjjA'$jB# L$+58PWVQR jCL$58PWVQ2 j-L$58PWVQ jDhVtŃw-8Wtã 8~$Uj-Pd ň$E Eۉ4$~Sj-PZd +@$8Ph$jPSf -85 8j.SPWVt$UD$)PD$:PD$KPhQ$hhH8! 0ho]$(^_[]USWVUu @(D$=$8ujc$8]zklD0 t|8twF9r=D80 $ |$ WPQRLUL$  ;H8D$0BD0 Cfd0 j5h8t4qLdI9LhD$$r1CExhPSt$t$h}$WMA9H8D0 tfMCfL0 L$ D$$h81RSD$PL$QRqD$T$t$,|$(1PSVW4qD$T$ t!|$ t$jSVWqT$ D$1L$0]D$ uuut$@t$@+ij2j3j4Nj $Ut$TBDL|$D$uCD$0 t$|$W, 1P15h8ssjRP΢#W$P+ CKKV5h8QPSjRPW$V+ 1P5h8s3*jRPW|$dW+ $D$Ht$L|$P8D$TD$HPjt$( ƸPD$P$W PVW V`L$wA;L$D$4|$HD$0G8GjR4WjPx D$1Ex tjS WjPN Ã|$tjTWjP/ jUWjP ۉt$t2t.$L$ PRVSƋ|$Wh_$Q t$$|t%L$ PSƋ|$ Who$Q t$St-$L$ PRVƋ|$Whb$Q t$ "L$ PƋ|$Whr$Qo t$PSVWh8D$D$] ٹ}$L$ |D$ L$L$<1jPWSgRPh΢#j$P t">tt$ Vhr$D$DP D$8D$ D$8t$XjVt$(1IQjFj QP D$89D$ t PV$Pl |$YtZV$ MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWVr )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơh8}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQP^dVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋h81щT$1)΋EM M1WRQPcljT$1Pt$uuvc)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VS6cD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$h΢#jV C `L$rL$DPhO$uL$DPhT$jQ˜ D$D---D$D$s8CjO SjPd ƋEx tjP SjPC 1jQ SjP' ÍD$ tSWVho$P SVhr$P VWSzh8D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`h΢#j$Pr t"?tt$ Whr$D$LP2 D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t P$PWsf{{ t|$uuxD$t HL>@D> >jhU> wE%rhD $uR1jPPPhߦhPj jjj%VjM94x!t$PW#V胾1@^_[]h$h$hh$ WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ 8&N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; X&tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$VhV#jSُ t$]EfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PrW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjxu t1@t=D8t@u.1}hju tEx f$rtP$t>$M u@=Uu,>t'D$ L$48;\M`|ˀuK(Ѓt tu tPjfjWUƍD$(PV $1 $$QPV U $V V9$ul$`=u]tP$PS5 $5fǃU'VUWh $ht$" uSe^_[]SWV0\$@1҉1 F FFF =@8tjP4D$VjRRS,0<^_[USWV48(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$h$jOt1e^]USWV8=@8EM 0~klP1,ËE E8؃lklQSP ߾&48$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C u |==l$UhV uUc< t$V|$Wh$j 8VWh$Pr 58 h$eF0蚴PVh$j[1PPJsvV:D0$ t$t$Vh$hWn t$; 8tWh$Pr 58 Wh $h$l 1 ^_[]SWVt$|$Fpc1V$t$;J8tSh$Pq 58f Sh$h$\l WV1^_[WV1|$hVW( hWVhd?t[he舂8<$jj觮8$t$WPQhTWh$hA 1^_z1' h;$W1hdht$hUSWV\$p|$LhjW' t [1$P2D$D$tt;un蚂|88P2+txhg$D$ Pj t8t Pnh)$ht8jU FPH:;4PSh$D$Pj8t#D$$P7Pt$h$SRo \$S6$S^<$s `P2>0`P29$Ph$ht8jt8LP2E;h8h8h8c% 1P21Ctu 07xt"L$o oo/C G FL$5\;cs1WW5`;1 5`;裧5`;5sD$LhLWWhhj&jFWjWVPWӹ4ƍD$PV謫V\^_[]l8h6jP0xVHumhK{SWV|$D$L$pƋSVPh$W&^_[fL$1SWVPӉh$kh""Pm tǃuOWjj1h7$M=8th$/Ph$Wm h$Ph$, *Wjj(hi$Vh$Wl W06 @th$h$Pj(8h$Ph$Qj h$Pz 8t 4$Vh $PPl 58"4$jhl!V7 1ۅVD؃^_[ËL$1Bf9"Vt$=8u!w v|81;59s 9k4ȃ(^Vt$=8ueN1wP&P^ËL$1WVt$|$L$ ȉ1<ɉ^_WVPt$j Wt$T 9tthuf1^_1B^_M=8u8ËL$USWV|$=8u1t$USWV D$ =8u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h4$h$heh$x USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]h\$|$ $T$ tuR|$Nj\$QPSWg L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$9u 8q9D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$|&d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth|e1Ot1L$D1 L$8ɋT$]t"9tjQP?T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(9u Vo9D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$&t$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh|11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQI |$ƄE C ^_[]WVt$ hjP/ ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut$1^_[]Ãt ux(tthԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPV[ >uD$ D$iousD$fictO4uQG4 t51ҋ5xm2D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuD l$(Ph$U; h""U] [Ɖ$Uh$j1u D$Ph$Vu wXw\w`h$VuPwdh$VtwTh$Vt f1ۍ{aE4&WuWuWh$Vt E< t<uEMPWQWh$Vvt$<I$9|"PVOtC9z1h$W,tV% D$PD$Pt$\$4Sh8$h"$WkSQj 1(^_[]h$h$hBh$h$h1h-$h$h hE$h$hh`$h$hh$]n USWVhj|{1O1ۍD$ShPS$4{9+ōF,PhedAUE l$$4$0$($<$8у|1҉$$ F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$~t98t4 .jPL$Q- D 9D$ u D$4$ ,$F n$9Љ} 1F$F )ЃF n$,$G9t$1$$hH$jP r=t31>t9>u 9>t0uk9uV"VOVUt11@19$,|;ЃVՀt$41؁^_[]USWVHD$1Pu譇Rhjy;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^dĬ&u FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h$hX$jg6h$hX$jh(h-$hX$jihE$hX$jj h`$hX$jkh$2i D$T$ L$DrRQP ËD$Djt$ P USWVl$j/UrN 1NtbNj\$)CDWPUE! uHD/h D$ph}$j h}SWV181CjVG w$&>t(t+t!u GF "u^_[USWVPӉ΃=8ui"sv<|8 99tx(9w4Ju1AQPvã99H 9k4+$1 4+Vh%jRP 1D+ <+ ht<VPh:2%jWP 1D+'<+(D+($D+,t+0^_[]V΃=8un|8) 1t(@"u9t 99t 4Hu1^USWV|$4L$0Rt$`VQW]R ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=9u \9~V19|(1@@89|~@w1A^_[USWVP=9|$(L$111=Ĭ&"\$uӀt0t u@tӋ;l&tPt$(t$(t$(UUt$0҃|$(u8څu1u&1hĬ&t$(t$(t$(PPt$0l& 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVnhhĬ&h8 8l811KjyeƃwDx&DtGCuޅtH=9P;e9t)1ɀ<t t&AuVu^_[1V 9t(91t ҡ9 9F9r9PDu^fUSWVPt$D1h34$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$h$jQQWRjjh$L,1^_[]USWVhu}WWPHD$T$48L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv48@u ǀ@>1t$(F F>D$,Vt$|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44WC3D$0F;trԋL$4T$B9rwP82|$4r!1FD$0P2F;t$4rD$0=0̶D$p軶D$6譶D$v螶D$  d"1ۺL$#PWVSh0RQt$kPWd"PShPV48VL$'Qt$t$t$ t$PPh6g$ho]$48$0$48$pеFt$uD$D$\$(1t1D$pT$xPRVу t\$8CfCCffC C "CfCC0=9rC fC*C,>G1ۍD$(hvSSSSSSSjjWPhw48PH@,ut$VW7WKFuQ1K58nt P{nt$58an1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h$hq$hyh$P USWV$(E]0ƋEpЫljl$E@ t P跫d"PWVSjh\1U5h8|$ ww$t$R58RPSQV9 U5h8w$w l$458RPSPU9 G\$skhSjPXD PVd8j!h$Vu V<hǪYB%L$58PRUQ9 h蚪$58PYB%PUS8 hoPSD$Ph$hh88 1҃9Q8A \߉$4%PWhҠ#j$W8 hWh8O Nw@EƆ8 Ft3N$t.1@Ƅ8-H9s Nr,Ŝ8$EBL$ ;QU8Vh$Wֶ Vh8WǶ ho]$Jİ^_[]USWVX] E81hd"PPPPh$PP7 9_ vSL$QSWPL t@D$ tWD$8uN 8uh 8D$9H*hd"VhӠ#Ep.b+D$8u RPt QPVW҃h81VSt$t$D$$VSt$t$L$8QRPt$ t$h$EpaD$V9p1h$YQVu WPTtY$UtOwGD$VPV)vVQj P W@ )Q$YQP H LCF;puD$VPh $Ep` e^_[]USWVLt$`T$d\$1*kvs0C41GPjh|Q2  9u vEL$QVUPL 1hPPh h hj6Pjjt$(SPf4ōt$ VP6vUJS`~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 58W`|$.8L$`ʉAfAD$ 1Ƀx fJ1O S`1L^_[]USWVpU t$01^F4jj Y1AǾ&D$ǃ@&SPHD$ $48L1OًP|T$|$`1 |$0jP4D$DD$ h8|$ 9ϋ$|$1HPPVt$t$WRQjD$ ;8~8h辝8P ;8~8h薝8P  89~8x$t911@(4[P  89~8E ;h$r˃ 8$F89~.wy$&C 88v-v*)NjVl$hURWv4PQd[=8@( I4谜UPWh$SV{8-8j5h8vv{8-8j5h8vv 58RPU<{8FF NN58j5h8QPP 58RPVSh$WpUDC 88~?u 8F u87r=#VRQh$P*U^_[]USWV$$x+~8P(TjsNVUl$URWv4QPd@(1ɺRUUQQjj4覤 UWv4PQpu Wv4QPh 1^_[]SWV\$P,ǃjPNƃt Iu1PPPhPhjPj j WVP/x4ǃtSWjC=WyVwT1H^_[USWV8] C4t VPQRL u s ss3, SCt$t$PQ| $t$+Ks;K C}K s1e^_[]USWV8] C4t VPQRL u s ss sst$t$3SC 1e^_[]ËD$p 1USWV$@t$ HPQ0ƅtw1@^_[]ËGtL$hpQC D$\$1hSSVVjjpo ;tUSP@u54$1hSSVVjjp/ |$u^WVD$ t$tL$ HPQ0vtpvhhqPh $VQ ^WVPt$$F4t'WPQ u 4$fF<1^_ËD$@<1fUSWV h$ՙ1jx$$xtD$PVAm H$$KtD$PWm 1yoh$ZhPW D$PWdm 1u!h$*PWh$jo1EWh$j@ hWl h$W艘$hPS D$PSl u"h$WSPSh$j1Eh$蓘hPW Wh$jʽ 0l$Sh$h $j詽t D$$PVҗ$SPWS h$V譗$1PWQUQhF$V茗SPW h%$VsPW$PU$PVSPh8$U ah$V.Ph8$jռ ;hE$jhPW hF$VPWh$j蒼h$'hPWO h$V詖1BP$hV$V芖Ph8$j1 hU$ƖhPW hV$VHƻ$Q2Whm$hU# 1tVUh$j軻uŃ|$tjh, '$Ą ^_[]USWV ։Qj 1Ht L$ L$$W $f} r= jh`$U u&UShm$D$P uh#辦 We Ņu>L$4t&t u$Ut$ t$ hd$j詺t$SMW $ ^_[]USWVՉfD$/D$jh %D$5耔t&w8tmSPhm$hUi! VSU 991j/U t5ÍD$9tK9vH8/t@P CߍD$ PWh D$%= h$PW] FƄ$/u&茓$QPh$hU /h$PU hh %U e=@uW) x*|$VW$P 9r>. ?# 0|$W W 01Ĉ^_[]hU` t}/u }$$tcD$U Wv Ɓ`|$tVh$U; 9=VWU# 9%|$W x(W74 >1F1S 0jh+#j- SWVύD$ PQe 1xVD$)tOjWx@ljj PW[ Wp u $=rɁ uƉĜ^_[USWV hҏljPhW@j \$hjS jhs$D$ƍD$ PhW@Vg t$1hUS ,$&tWP u-8D$C E,$ !u1L$PPPPhjPPjjj!Qhel4t$t%jat$VW+^W?m6V ^_[]VD$@t(L$ 4@ &VhW1p F81@^ËD$ 8fH轏 8tPPQQQh$joUSWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj +]>D$48T$y:D$ػ˺#L$~D$<P t3d"D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$d"t$DRQPh$jV` D$ T$Bj5h8QP d"t]%t$DQRPh$jV D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o58t$h$jt$hVD$XP1WWjjj0ה,h8|$4D$048L$QW<W,D$DPV-~ljӍD$DPV |$߉څu D$$H؋Pٸ"D$<hV$t$ |$,] {t+[1h$Sr t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#Pt$h$jt$hVD$XP1PPjjj0c,j D$DPV  D$׋D$@txm2@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5h8PQ} |$ RPh΢#jW ;8CVhSjP jPPh8` V,A(^_[WVt$ 5`;?R5`;~$uFjP):F$1O~(1h8QQhb%h7$hRjFj WjPv$h8@d4F(x;F,VPVv(&ev$@F(F$~,v$b@F$1^_USWV4ˋA@Pjq$ C{$t%K0 u G DfG lJu&fG G5G1G G,2G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPb+{$4^_[]V$j)軅Nv811Fu >tlIut5t.j+j,L$PVhW$jPQ@ 'u tEj,j+豄L$jPPQ h"[j*芄L$QjP*6 ho]$4j-ct$R58Ph#jFV j.>h&PVh$hh8 İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5h8RQ L$RPh+#jQ G<(\(|(Pu#]j#聃L$>PSWh$j&Q%j5h8SW L$t$>QRPh$j&V $F|(,u)|$hh!Ph$j(W <$1e<(Ou*?D(Ltۍt$hڂPWh$t$t(Tt(PSPWh#j(V! 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPh$v;t 4$4<|$|$upd^_[]1؍L$>PWh$j&Q  $L(4RttD(8tPQ҃lj$uFt(Tt(PZlj$FD(Lt&h訁t$PWh$j(V 4$h肁VjP lj|$D(dphQPVh$j(W *USWV48$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá48H1WjHDWWQZơ48$1$ 48@u <@TX uDHXT=l8tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W Wd"WRPPQ1ҍD$*W Qd"QRhQP软D$$W Qd"Q1Qh0QP蕯&)ߋ480~D$p~L$$QL$.QL$QPt$SPW/ 480~Njp~L$$QL$.QL$QPWSSj'0 ho]$>0O~|$p<~G$DŽ$$T$0<$tT$@BfBB4ffJ B 4BfJB 5B fJ*B,5=9r~(uB0fB:B<)5@1L$0hvWWWWWWWjjPQhZ4t8PZ@,u$PSLS[$X(؃u 48TXK$&V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VP.D$0VP].VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u h$P T$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV548Q t@D$4D$8GD$*NjT$\C$BCHfJkllPs*ʼnCD$DklL$s)Ɖ)$ى@RQPr T$*lklQt$Pr 1DDD $1D50 D58j D5dtIL$ HL$T$PD=hD$PSL$`D=4(D$P6D=hD$PL$`1|$DT$\fBA.1NH^_[]ËD$@1ËD$@1ËD$@1ËD$@1ËD$@1USWVxˋuyD$1 |$$B9T$Ju UD$})Ɖߋ] ˉt$w\$_ }}} ދ\$CKT$,9‰|$}+D$,L$D$L$CK CjlP&CtH{hh&P L=rID$$t?x,u xPtlIu&58t1IHH Pt$$VW548 >|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!t L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Oh$D$ P t5hV$t$ u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0`8)ދd8\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$ L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$(6 L$)։t$ t$A58 1Fh$h$h]h-$ L$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4Si tt<1^_[USWVGD$58l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 199ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX;AL$D$~@ 1ø11OT$LhvQQQQjj PWWSRhJ549tBƍ|$WP'V36x#9}h8k<4LE1UЍe^_[]USWV19T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=\8t*=0 911M<t9\@u 9DDMHEr=X8tO 9D$PP1ipt$1t9 :ut$P9t:,@uލEpr=8 9J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@0 9D WVu)y8u.q$t"y8uqxu Hu^hA#h$hm h$ D$x8u@hA#h$hm h$} V 8; 48tD8t99t‹9u€82t 8^WV΋$tRttyu)89tЋ9u80u1H|$58,1C1҉T TTCD k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D $k"PWhp$uD4\@xt 1ɍ$4jQjQhRVSЃ u fDŽ$4-L$QVSPL tt t 9uP*>t$$t$$讎ƋD$&$4WVPh$hSc M$4jt$t$8u"DH $4jj hd"QPjS2nSW"?D$5$4wh$PW w01k,Cy uC,1uSPQD$=PJ Ph$D$=PvJ 10u?x@t$5w 9$t8ntyPh$Ut$%V PV$ P> 5 9$,8U螊 t4Uh>$ht$%V蒿 hV$ P\> 5 9$,88UO t4Uh$ht$%VC hV$ P > 5 9 $X8l$~4Ph$hU hU$ P= L$ 5 9\8~~Ph$ht$%V踾 hV$ P= L$ 5 9`8~8Ph$ht$%Vr hV$ P<= L$ 5 9h8~8Ph $ht$%V, hV$ P< L$ 5 9l8$~pPh$ht$%V߽ hVU< L$ 5 9p8~1Ph$ht$%V蠽 hVUq< L$ 5 97 878h"$ht$)V` hVU1< 9t$PUh,$hUD$ 9ts $|$|$ u^ 0D0<4t|88uL$81ɋT<|Dtsu|$ $D$@¸Ѓ=8@D$1HD$$D$1i8 9$P58\$ "$x 1ۋWSPQL $($0}U$WS W躆 |8/tW誆 fDŽ/ 9 $< R臆 P$PW5 t $L|$$t0|$t)$PC t$5 9Ǎ$vl$t$؉\$C$;X |$O|$\$@|$5D$tL$4= 9,$V贅  PVhm$hD$)P褺 5 9.d"tL"PS >tiD$Pt>Sh$hS$\$  9$DL$4L$0 90|]t$V0Ph8$WR 9( ( PQVh?$W~Rt$\$ CCa5 9.> >,>(>$> D$)Pt>Sh$hR$$(t$,t$(r 8t P:V h81`8tWWh$CVWh0$hTf2 8t8Wh0$P 81Ntjh$P ^_[]1N=8tt$h$jP(Q SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ 48V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$诿$ytPhptYWtDžtFE tWPV u WV<jVSZ E t VPoVi1HPPSw ƃxh80^_[]hA#h$hm h$ USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4̴&jP8 D$$tIL$QPVh$W ^_[]USWV$@1K $ $&_ 1hSSVVjjh?#  /t$l$ WSU e Uh=$WSp SWs |/D1l1_48, 1@WV<VH /11 11$A t1$B$J1$C( 1tiu`$D,\$ D$4hf"US 1USSVVjjt$! S xL$1^_[]WV|$ 1uOG Pq t/1; }OR("h 9x 71^_WVt$ F1hWPa dž dž dž$dž(dž,P40^_USWV$h_Qt$hPVTb $$$&D$@{tUh$VO$ USVD$ 8Ouڋ$xhNuhOSPh<$V}C(~Phf"hV }hPHC,~Phf"hV }hQ#C0~PhF$hVȤ }hRBVPh<$W^_[]USWV$$R2u*11IhvPPPPjj PQQjhR2Pc4$R2Nw'$T($$&WP1N1jWWVVjjhS lU, V0D$4hf"QPѣ 1PD$PPVVjjU D$PW x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP] 褚Qkd)QhJ$V- ^_USWV$h_|$hPW_ $$$<&{hX VPh<${hYvvPhQ$W[hZ1~,t[h[r1~0W[h\Uǃ4Vl uh_6V0FT~Phž"hW艡 sh][h`1~`{h^vXPh]$WF\~PhF$hW% sh_mFd~Phf"hW shaHFh~Phf"hW۠ shb#Fl~Phž"hW趠 shc0WPh<$V/[hd1~pPPWh<$Se^_[]USWV$@1N R$hT$p& 1jWWVVjjhe|Gl=Ol48,1۹fWS<S1,G,10G041jWWVVjjhg| 1`G`iX"j\kd lhD$4hf"QP( 1PD$PPVVjjU D$P x1pGp1^_[]1wwVt$F~|F Pi t1@1FF^SWVT$1ۉZBr 1Bl@Zp;Qkd)Qhg$Vw) ^_[Vu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_h1$h$hh$ܪ SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F &tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$8uh18s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IO sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPWcM &Ow$$$ش&@21^_[Ã!t*Wp1@<QkWPVvN rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Phz$Q D$D$uPh$jt1ۉ؁^_[]E@USWVx$ 8U $=x8$D$d D$`t$0Sh$jP Sh$D$dPjjDjVǻ"St$`;kSj0kD$0D$XD$(D$HD$D$D$4D$ D$L1D$$D$TD$PD$8D$<D$DD$@|$\$D$y1$D$ D$D$1h5"V̝ -À8tt<L$D$j jSo lj$h#SQ L$ ٹL$ L$Xuj jSPo D$D$(|$t#D$(^j jS.o D$ T$G|$,|$,D$D$(|$y|$ythh$W hSW |$,E1Wt$4j WSn lj$ teD$ʉ $tTD$ D$tJjh%#$S? tOjh3#S+ tdjh#S tp|$uh"jhD$0wT$ ׋ $L$BD$DT$@|$<|$TL$P+|$T$D$P|$D$4|$\$|$ $D$D$$j hc&$Pv hj4$ۍL$ytȍJ@j`PQT$(< L$( $A0y,D$A8D$ A4D$Hu6|$d\$t/ȃt$`PwO L$$uD$H\$ȋT$Lt D$ D$8D$ L$L|$ظD$$D$Xh"jSgD$0T|$\$JD$ D$8D$<D$DD$@D$D$41D$$D$(D$ G,D$8G D$tPvfWW߅uvF^_[;hY$hP$hh$ݐ D$phg$jY iSWV=|858t^s3ߥtr=#$t$j(PV4 4$蝣_u9ht|$0VPh#jxWw WVV &t Ĩ^_h#h$hh$ USWVσ=|8u h 1t0?t+|8t!-8E WPF tt/|$thh'L%S !hvS u4$$$$$St$hl$j ^_[]SWVD$Qt$Rh$Pjh"t$[Y$jhP&PH@ uWh"j2Y$tAt$h5"Ww 8tjt$2h"jX$ut$補1ۉ؃^_[USWVӉ΋|$|$tBh$Sp@ h$SZ@ h$SD@ h$S.@ h$S@ h$S@ h$S? \$h "Sr ǀ?t( # &WP? uE F@j`WVu, -j(W tj)P t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU4 |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3hf"WUZj WUUjU H>wѻPD$x0hf"SU"j SUUjU H=wˉ48DD$H1Ƀ|1M1҉$PVRU3 1Q\$ SRP}3 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á8tq.8Vt$ 8u W. 819vFt=N 9wu1wD 9(:9^ËD$Hs-s ļ&.hA#hm$hh#$~ Vt$ =8u-(t;u2L$ rȃs&$tu091 (:9L9^WVP|$t$=8uI-j PV[ =v1t-hkt H 9t4D 9^_Ë $9u։^_-=@&9t<&9ù^-D$1ËL$T$t$ hw5.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCShB-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh@-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh~-^_[]VT$L$D$ NFA0F Vh',^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Phwf,D$Ph H,1\$}UM;t;Gs} Sh($q} ~Sh$yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPWS L$D$ T$VQPRt$Vh}$h$Px`WhydP D$V?|$t;jWS \$;MU}h$h$h h#$y 1e^_[]RSQE Sh$RQc ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVS^\ )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋HD 9)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV~e )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SU @$\Cǃ1:k0hWV D$4WhPW$XlD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(i)tÉ|$UFd#D$0jPUQt$(1)1 Ⱦu#\$,hPt$ ' Wnt|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,Ph P蛡D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjjtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14pFuUpt$D$l$x P&!tn{ C K$;}sL$4QjSPL t_D$HtWD 9)1ɉAw Puu2S"j@jP fdžUS#p1ۉ؁4^_[]h$h$hh#$Z USWV4D$L D$PhjiƋl$X\$T|$H&W F|11Kn^؃N$F Fdž?džjh>US @džPWTvt%D$ D$D$D$F114^_[]h$hC$hh#$Y USWVhED$$11@D$hQL$ t $hV^L$ }*|t =.u PWV螾^_[]ËD$H0QPcUSWV$-01I$D$h1|$ t&1ɀ8>@,19Q艦vPW D$vP6r 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h+$h$hxh#$zB USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D715LQ95HQ95PQ9D$D$ D$1D$h[$WU9 pu ,;PQ9e~ft$lt*zD$ƒbtCeubD$벡,;D$ ChjVV5,;hf$ELQ9HQ9zVhVV5,;h#D$Vu=_29}4D$$D$l$ t%1PPUb D$yUh $IL$ tHt$(Uhq$V hM"6uRh|$fD$0Pt$ #D$8=$$ LQ9HQ9jÍt$0ShVJ u UPV UjD$0t LQ9HQ9Sy h$t$(T1|$PY'y h$ y h$vuWjt$&1St$&4$t$$Sh=#PPt1h$t$t$m&4$rt$f5\Q95XQ9`Q9e2|$tTf2dQ9 f2tbf2=l$u1HL$(Qhht@P PtL$* hQ9t$Buh$lʼnP!&yhE$T讎 D$ yh$@$uBL$$4jP%4$t$V66h$j8Pbh#j j|$WUt$ x>tq1.SPt$  yP 19u2XQ9\Q9)u- 8t1FVh#$1FVSh1$Vt$D$D$L$D$ L$ D$|$tvD$ P荭ƋT$ уƉǃtωÁtt؉D$ u 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj > UQL$ɋD$tPN Vh P hd"PVhQ$hTf2') j V jV jR] VP^Ð=(R2u (R2dQ9@=u1HP 1;(R2USWV}uCjhQ9 Q9Q9Q9Q9Q9Q9pQ9 tQ9 |Q9xQ9|$(jWϿ 5pQ95XQ9tQ9\Q9?X+=Q9Q9@1;Q9)ω|$$\$ |Q995xQ9T$s;D$0Q9D$(L$, Q9Q9xQ9D$|Q9D$$D$ =`Q9EtQ1$w ww7wwVWVV 7www ww$PWj M$1~~~ ~~$PVjR 1@F ~~~~WVW =`Q9B5fDŽ$ PQ9t$Ph $hQk# 1FLQ9 HQ9ƒ\$\$xT$T$|l$x8%ݜ$݄$ ط%L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Wh&$QP" hQ99|ӡPQ9tPL$z L$)΅~DQ4))hd"Sh&Rh&$QP<" Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4&QPh&$SW! L$(+ Q9T$,Q9NjD$0+Q9x@B‰L$hT$ll$h\$@\Q9 XQ91F؃D$@5%|$vqL$`\$dl$`8%ݜ$ܼ$%1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4&RSt$Dh'$QPE  LQ9HQ9ȃ||=\Q9XQ9݄$|=s4;T$D$r(|$$\$ ؍4)h)'$؍4)h'$QP ƃ}u 4)h"QP ơdQ9@=u1H$VQP e^_[]+pQ9 tQ9T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppr"u%h$TF 8t< 8#u$SjV腷 tGtV $1E48FB$)Ex t$7@[h$h$, h$h$ 7h$h$eS^_[]$Vj$A3t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVh!jPEuh$h${RÉhPKt4Vh!jPMEuh$h$-R1H^_[USWVp $$$!19L$PVW1Hl$U ƃU( VD$PW tb$U)tM$dtp! $dPU t$jWP tu)$-j4'WNU( 1Hp^_[]Ë$j-UP D$L$PjD$L$PjSVt$ t P닆t>PDdžW1ۃ1ۋt9PlD^dž- t^[Vr V& 1uU 19^SWVlT$|$$VPC1Nt/ǍD$P PSW t Wl^_[USWVӉjh0jQ ǃt{jjjVe L$ F"td"h"tŃ7$d"d"t /$؉d"t %|$ud"SQRPh?$jhV' ^_[]USWV$=~ 71Ha~B11ۋ$4V <(Gs@ ,PVQ C$9u1$WQ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)m jj7ƅuƋNtHNO N uFF9sSP8tVF^ St$P ^GNON1wOWhq%Pw {@v>V=1H^_[SWV$uSh\$h$EM $%~GuG$O1@G$GD$GD$ JPRv X tOt;HO6 8  89hz$hp$LNF G8~ ~u3FVhq%jv S?uhz$h$3Lt6hWv  t%uh$LPWVu  s V^_[WVp׉$ftPh$h$K jL$PQW jjP0 PjW tnjjW t\PjW tHD$|PWV t2Phq%jp >u6h$h$J"h$JW h$Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Sbڃs tAt1t% t&%S@ su^_[]USWVt$48`ځ% t0ty@ !ȉف tV @t !ف tVat ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jW jW 5^_WVPt$4%@5@u^t8tW%Vy $%8Vh_+j?#45@u`V,2<jP, u h$G,dž,sh$|Gj?3 t1t3u5y $0# $1Ph$F # $1PWh$F^_WVt$ hu"pG8r4@84^_8t8t uh$W譬jJ>^_USWVD\$\t$XFtt+NQT$PQhj@Ruh$FD$n D$SPU69Vt)ǍFxۉ,$t1j@SPH SUh $F SUh$E 1KNދl$Xue^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uVr'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j$(ǃ,f@K(1ɉHHH HrF>rD&>C5F $P; w_ǍCWt$PS ;)QjP h$Cu^_[]ËFUSWV |$8t$4l$Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQhL$d> SWVt$~ t^_[ËD$|$F @PWDr( ~ t͉^_[gV6uYhw$Q肣~PtVAt(t NLtM"t5$PV9^WVt$ >~Lxw16tЄuOF$uItV@u h$4=jjAV? u h$=^_vF$ljjVz? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph$;G$C$G>C>>-ك**PWQ| WtHAt[ƃx t Ph$p;$KFNtTHNUh$; 1O 1OOWt#QWtJV<1V\$ GtIO9tA t1Uh1$:@1ۉSSD% 1G|$ ~UVt$$H? { t S^\$ HPtQPV P-<uV[+US?^_[]USWV׉΋A Ph$6:11BU$tPVVUU1n 6ujn1^_[]USWV $ D$PQhht$hT$hE$9$1Phh$91F\$ MbihS$(b EuVh$?9u 87t 8 uF띃tVh$9D$$ \XPW>&Ƌt8t* SV>uSj$( ҋ>$ 1GOtHONG Pt=;uFGGtIO9tA t3@UUD" 3;WQjj.>jV(t0<t$VtSB< t<=VS= hT$7 ^_[]Vt$N Qt<tv$vLP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/ 7 Vh$h^"!7T$1|$`F(f9t(~ tωӍV QPRh$6ڋL$tf~(^>8u(F*4$QPωC ~ tcF D$F*|$ <UWSPωT$ P\$Sh$6 <PUt$WPSh $5T$ V>t*4$QVz H^_[]WVt$4rDD$ tN8tCt;D$ jP, u!h=$hp$5 j-^_Ã~+ajjj!~ ̓kh~$hv$hN$5 1m9h$h$hN$4 <6Rh$5@he$hn$hN$4 111dh5%h$hN$w4 @+X1BWDPU he$h^$hN$14 11G1=Q9Q96u P9W+Q9zh$h$hN$3 t0S vPh$44WVP1PPPVCD@PjVlN48@t @ sfyt ‰48WV{K^_USWVP$t8D$ \$9}$w ŋD$4V tE9u݋D$ 9t9 u~<$h$Wm1PPt$$ sUVW s W@W;9t>G 1PPt$$ UWD$$ W42D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1G@8u^_[]USWV \$@l$8;h$W" .h$W !h$W D$$D$h$$W |$t$<t$ ǃt1Fl$<4 GF9uW$t$<l$U WUD$Pl E t=1FߋD$@D$P Wt$U3 EE F9t$@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[]g |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tW1 tFt$9t$V_Ѓ с u VXV{^USWV$1t$t$($|/xhA$W h$W \$,hVS< jǃ0Z$,R21O$$0@4jVq9u11@PPY$u1Ajj9 uD$l$(D$ D$D$$dl$tk$Uh&P$V?u$duiM)4tQ6uD$ 럍Hv H w?$D&,;$\w$ &D$$D$[D$ PxGD$q$D$2 $d 1@D$D$D$$h5,;n $hD$y$D$D$$1@D$x ˀD$D$FD$9_2t$bS{($h($$p$l_2)$艄$\$,Su1VVVS6$U$PjSA\$h%VJ D$9_2$4$|$0W ?_21VV4Wo6&$$Pjl$|$t\UHrBPt$h$# t$\$ SrgB 8$U $`$d$`$d_2T$ QR$4 $$`h!h$l$,<$茄D$ t<t,<ulh%F D@Ug uDh%bF LHUL h%@F TPUCs D$1D VhT""4$h!h$"D$1Cl$,$bu Uuh!h$d"D$PU'$tCt)QqtrqpQ#$PDŽ$WU':$t P׳ $ }$nUqq$VU# U+A$;,R2t P%$dP@1uh$ !$dt3$Xt'L$jQP uh!hp$#!$j"$hhe2P $$d ؁^_[]Ë$r,u'_2Qj$4 $u*$`1PQQw $$c@u h=$$VUI h`$$`5 $d$`$dUh `jj$=t'Uh0`j$($}h!hy$h!hh$D$L$Ph"$U$"hF#(蔻 8th!h$3$`q L$aG 8 S$`$d$dl$,hh$9+ u! 8th$h!h$ hh$+ u!ĺ 8th$h!h$^ U肺tUh!h$Uh$1k$`r;$d@ щ$`$dU"tePh!hk$KD$ Pjh0j,I hm"yUPh$ U$`$d҃ ց uK$`$dr>1r_2$L$ QPUM W$`$d$r _2$d"d"t$ t$VQRh@%spU{\$,1D$WhPiu h$Sh\j$$nuh!h$N$u($`r$d$d$`L$$PQS!$"$1l$,~O$4P t x u$$$4PF$$9|t$t׃z Ru$dh$P_S[$bh5$JhX~%yD$ L$$$XPUh[j$d$ uh!h$F $dh>$$1Ʌt z uRl$,<$$l$,<$$u@u0$d@h\$PJD$,PB't#%@tD$,Ph_+Qj$dWD$0P"0$01~ tVh35jj$$vS WVjh$ַt*VPuVh$MW艸h$h0#0^_Vt$V4t$pApdr$Ph$NjjtVha[jdj ^WVPt$D$uPh2%h$ jP,蹶 tuIh2%h8uM, ,薷dž,>wt=D$|$ffN(ffOfujdY ȉG_1_F*N>QPS蜏 F>)^_[USWV$lt pvh%PWj t=wM$lD7 8th%h $h$u)h?%h%hh%% $$l~>1ɀhL QSP ƍl$hUPt$ ͵UX =wfD @PUhh%W=udh?%h%htI{>tA,$fEC(ffEEK*S>RQP C>4() PR1pČ^_[]ÍF PhH%n tt {>u[[ht h%? ~>t$fF(ffCCN*V>RQPy F>4)mC Phk% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#Ҩ 1HXju V >8t~L$ T$pFhf@H X@fPFM1^_[]h%h$hGh*%h$hHh%P D$tFL$tt 9Jt    1HBH@M1@h%hG%hh% USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;vB 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$h%h%h h%h%hh%h%hh% L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]h%hZ%h|h% D$t L$HH@Lh%hq%hh% D$t@Lh%h|%hh% 11WVD$ t!L$T$t$|$x0p4P8H<1^_h%h%hh%j USWV(l$<\$߾&1|$ |$|$<$E4t.1FM0 I?r E4  G9rՉt$@Pj衦 1Nt91D$ D$D$D$9E4t$1E0jS4 t G;}4r1(^_[]h%h$hYh% Q9tD$ Q9QQ9Q9WVjPj1tMƃPjt/1vN F NN F N$(F(N,FH VL^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t PANSv@1F@FDFMF t@PtQPV P؋PtQPV$ PjF uPtQPV, PBF(uFN^_[jt$USWVu-~L =Q9t'Q9H Q9Q9N8tv|x| @t,'\$$Tf2SVU Uj l 0V2 s SVW  ^_[]PL$T$ D$$PXUSWV։: $VhU SV PUh^"W ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXá4V2ËD$4V2r SWVhS$  1OtFƃ ||t +D$HP8V2Ph $Q] 8V2^_[á0V2ËD$0V2@P 1V2 SVt$ z hjh0R2hTf20V2 s1fà eF jSP  t V1H1@^[_ fVt$tNVV{VcV.jVPVO6v^^SVt$ V1Kt=jhj E t!jhjD 1ۃۉ^[D Vt$t'PǞdžtP詞dž^靄D$t$t$t$} SWV$hjWH} C jPW  Whi| 1NtF$$T$ !fD$f9t hWhi| t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv Ϙ 7 ˜ V1H11Ʌt $BD<IG9uލ|$$ ^ F>L$jPWVt uF>*PWV5| 1T^_[]VD$0tVUjV v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8`VGw}uM ufE O $PJt $jSVPUQt$4Vjt$8]$?=^_[]ËL$1t$VËD$t 0, VD$0tVBVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjVz Fjŋ$@V& $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP tًv\$~;1$D$0Pt̍ tF9u19D$$"$8ЃD$P1~11TjT$4R4~ t GP9|PX~11\jT$4R4C t FX9|XD$ 9D$H$~11LjT$4R4 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$WuVh%t$ 0|$w$H;D$t$\hjSKlj$w jD$4PVy CG$C D$ jt$ VUx C yQPD$|PZw D$lD$ @D$pUhi$v l$D$m@t$ FGF<<y<$l$D$0P$0 R`~/1djT$4R4 F;`|ӰD$|$0WQe~t$\yWh,%e$_w ɺ@r <t5<(<$L$ 1@ut$h,%$1@fG(FG>O*VTPRQu $t$6@u<$tW{tmWqG@WfGDGȉGHW~t GPGH$G sW}GLGMO9EVh%W%$7t)|$ jVWu w_ jVSu r 1N^_[]j:SP t/@1UQhQQj QP_ G8mtЏ (G8GjSP4u O t xm2DPu:pKCu1l$PVhVVj US^ G0Et=it.u1@1QVhVVj VPm^ <$ O4G4SWV$WjSr F jPSht WSh~i1r tD$Đ^_[USWVP6!D Q9 Q9 Q9Q9h_ %FQ9 Q9 $<  O+VQPp 9v1 LJ\$ I;<j,jU@t ǃD h7 %Vj,j&Ht ǃL h7 %'j,jPt ǃT h7 %t$$Whh&Vo D$9rh7 %hC %[H$|$ 7D$PWD$t$h5"D$P ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW螖D$u?\$S.} J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0WAqD$t|#t3=w&AL$0h7 %h^" HD$1D$S0Wq 1ɍD$D$$D$ 01D$ύD$PD$$PD$h5"D$P ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h#U h%U h3#Uq $D1)h%UE 1Ʌ<$t$Vz H9t- t u!H\Ht$9u1@$D$$<jPSՇ 1Ʌ $1@D$S$@tXtT$@S~ $1B*$Dt,t($DSS~ $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPdC t6ʼndt$/ `Dd<t A`Nh7 %<$Dt&u"t$ $< 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U&| tu;uHUhn %&D$uuUh0D#t$$t$$P&t$$^_[]USWVt$ t-tQN  8uP5|$t-tQ uPtt*t$1PPUd t xTuXTj卆jPW5 $@DtW,Du싾@WXHLtW,Lu싾HW&PTtW,Tu싾PWX\tWg,\u싾XW(V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(_2|$$t)`#L$# $ 1CƋl$ \$18l$sk$Sh&Pt$ujt$\L$,1VSWPUAjt$\t$ VSWUkU#jt$\t$$VSWUMUjt$\t$(VSWU|$Xj=|$\W; Ê@tC< t< u CCu1j h %W=s j h, %W%s jh9 %W s jh` %Wr jhY %Wr jhO %Wr jhL %Wr jh %Wr jh %W}r Pjh %Wer 8j h %WMr ?L$P1T$XPfL$T$t$XVY(1Kj/V: uD$|$PjP L$r L$rL$T$t$XV'1Kj/V9 uD$|$P jP XL$ r  L$ r  |$XDD$Pi4$PTt$X'TCD$P@3|$X D$P$;,R2t PB11j|$\W6!ƉD$V茼yjW t>th$Vp V$ǀl@F |$X L$P T$Xj #' D$X |$PjP^ <7h %h %OD$Xt$P jP h%|$Xx D$P$<t$X!  $<PU D$PX|$X h"|$\W{o t$1VWjWWWWP誒 L$P9>t$Xh % |$X t$1VWhWWWWt$tE L$PA 9>t$Xh % |$Xt $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV"$6?mjt$\D$ 0USWVcO jt$\t$$USWVEOjt$\t$(D$Pt$P1t$X#džD$X= 84 j/P5 1|$Pt@j/P5 tƍt$X.#t/PF1V #6 |$X t$1VWjWWWWt$t觐 L$P9>t$Xh% % L$P ЉT$jt$\# h%~|$Xq j,|$\W4 * ƀx 9l$Ps%ƅ |$1WShSjSSt$tMC ,9h %T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFuu냃|$X0t$1VWjWWWWt$t܎ L$P9>:t$Xh % |$XD$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1Vl @jP H  L$j ZP< t< lGG|$Xt$P$ft$XE $h %|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P&$Ɛjt$\V3u7D$0J|dq 8Ut$Xh %011IT$P  =D$P-D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hPhT fFPfFSfFVfF^fdžƆ D$P f$6l$Ptu|$Xt h? %@D$X  y@Uh% %D$P |$X D$P D$P D$P |$Xn$6t$PvihG %fl$P@Dil$PPTT*BE$ E|$X.E$$(i1|$Xl$PX$\@D$P` D$P D$P D$P" D$P  D$P D$P u |$X4t$XVڪ@@ $dD |$X|$XG\$PH  @D$P D$P D$P@ D$P |$X$; l$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV|Fu8jt$\t$ USWVbFujt$\t$,USWVHF t$Xhn %l$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tV 9]Vh %'D$PG D$P7 D$P ' D$P D$Pƀ D$P@|$Xt$1VWjWWWWt$tb L$P9>t$Xhy%|$Xtut$1VWjWWWWt$t! L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$t L$P9>At$Xh%Qh% %P C t$Xh %W^ à \$S螮ƅ|$PPh %SV茓  jvVj/t$\* AL$1|$P# KD$ɋl$t t OGuh % N|$XoE1j:W) l$t2At$1VUhUUUUQR 9.Mh % j=W)  ED$(@1 t H@Whe %+D$Pƀ 1K1t$P # $D$P1t$P D$X.U$ D$L$t$X3d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu `XNul$P(BjRQ Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/U' SGJVhn %>nT$P   xUh %=D$(h %J h %Ɔ <h % D$Pǀh % 1K$dVh%D1DDD DD.u h % 1D$(1h$Wjh%W1xh&%Wh#WphhL"WZPh%WDJh%W.h9#Wzh%WhWs"Wh%W hy%W> t$ h%W h%V h%Vs h%V] h%VGY hGS"V1Z h%VT h%VE hCc$V6 h%V' h%V hr%V h %V h%V h%Vk hdE#VU Vht%  t KC  t KCWh %Ɔ  xt$P1$ƀhuh %XttC< t< Cuh/%0ǃh %D$,Kǃ%1CƆ 1CL$PTGt$P jW l 륉h,%WZ t-h,%WZ thh$WZ t hd%WZ t@Chj%VuZ tho%VcZ D$P@ tsFH t t@@1 t H@ttC< t< CuhH%Ƈhh/%wsF< < F1$SUj tUh %1C CC"$f8l$1USjxSjSSW| $D9]$ƃWh %ttC< t< Cuh^%Ɔ L$P1S=flF D$PVe+` 7Ƈh'D$Pǀ 1'S #؄  H@เsƇhD$PǀFt< t< u GGu1L$l$S$ L$1W F 4$VÍD$PSN#CUPA#؃8L$QP.#D$PVSP SL$PT$Xj 6t$PjPja 1Ӄ  (jVtZl$P  h$" 1F؄t  H@h%1K؃<^_[]ù@D$PǀǍ0PVj] whO%F -{]< < Chh %G11|Kh@ ыD$* * h % C{K< t< tC C{< < Cht$1VWjWjDWWSx L$P9>sSh %8l$1S 1K;4$(ƍ|$WPQ FWPD 8UP5 D$P4$VP L$PT$XjCut$PjPFCt+j/Sw tIGC1L$P4 1D$PVSj u7tb\$1SVhVVVVWv L$P93tQUh %tGSh %1F FF@dD$PƀMG=6 @/@(!  t$ %|$(t u$Wh%t$蜽t$1D$( s$t %@uh%j?suh%ItF1tC< t< Cuh2#Wt)W Åu"=1rWh%31ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP[ t(t$Qk,1҉T(T$T T!h %S螬IVD$0D$ FD$(F^ t8UK ljD$FWUP< >)QjP; 1FFL$TT$`r|$\s72USWV׉ˋt$$V_K >"u y"uIFA $Vj"ct*Ń!9 VSb ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=xm2DWtCT41Fu|$ D$ |$jjD$PX T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v:U 71M^_[]USWVՉϋRO j=P  ,$|$D$ VH 1ۉ\$t?t9D$ 1j=S )9uWVS7L D$\EuVި4$ t5ƍEjPt$ 6 4DL$h%Uh%h% |$$t#4$L tzSRD$h?% D$tHTMPR' hb%h%hh?%݋ Vt$t#1PPVJ- t@Tt$ V0 ^Vt$t$Ƙ^h %h%hdh?%w SWV1SSQ, t&WV) W蔠SSV, Džu^_[WV|$ t^ǘ1PPW, tPW) hƅthjV/ ^_h%y1h %h%huh?%越 D$t L$tHThb%h%hhx%h%hh?%x Vt$t61tpT^hx%h%hh?%C WVt$D$ L$zVP% 9tVJ 1^_ËD$HTt1Pt$ h%h%hh?%É USWV\$tF+1PPU&+ t.jVU+ 9^TuVU#( V_u^_[]SWV D$4toHTty9|$0uPLjPW# t<Ƌ\$8PW' Sh%j Wr VNV ^_[hb%h%h h%h%hh%h%hh?%贈 USWVa$c$L$<D$ VPU }W D$]8D$HVPS SVËET%t EtuuE 8Vt hK%跨ňjjU% jWUk% Gt ;D$TG9t ;D$TWU[" WV1 urGTL$tIѺ!! tD%WWj03u!DD 8t:D 8t h%ާW߅11SSV$ tLWV! WU 9t!C h4%舧WSSVQ$ Džu1VD$PVD$ PD^_[]t$ t$ hËT$11;T$ tэ HUSWVӉ΋BTx tt /4u$SGtCP7t1Wl$SV DžGT;CTuQGt ;CtuFSWnu8GttCtuGKQPNuG8K8QP:%tu%SGtr7tCtt-SjJ1XB 8t h~%Wj1u21B 8t(h%ե%tu%ScSj0uA 8th%菥1ɅtWVz W^_[]ËCT@$u Cx;Gxm%Wha%hZ%h;h?%耀 D$t%@<t <u øLA /1h%h%j;h%= D$t%@<t <u ø A /1h%h%jQh% D$tBHttu#xðÃxux uxux@ /1h%h'%j}h% D$t>Ht4t uxjh&P M@ /1h%h9%hh%; D$tEHt;tu&xÃxu x uxux? /1h%hG%hh%~ USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^j? Wo1=u!GB9r1ɍ|$0+7? /1NjB1ɉÀthAu_1ۀ=Q9uD1FFFF FFGFQ9SVrVW_uPQ9މ^_[]Åt 1u19[:Rt1h%hV%hh%} hb%hV%h'USWVP|$G<t<$ $ l$W)Ã|WhV! ۋ|$t(ٸF\$$)؃|PjV! 1=Q9u+Q9W9u!Q9= /1N^_[]h%hz%hnh%| SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQǭ ^_[h%h%hh%h%hh%{ USWV|$t$)Ã|UhVS t(ٸFx)PjV$ ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQaGSKWVPQ{ ^_[CPhj#WVd 1t߉h%h%h{h%h%h|h%z D$tL$tf Hh%h%hh%h%hh%z VD$t&L$ t/fqPp QPI H^h%h%hh%h%hh%+z fV#$&Ph%Be u^USWVD$t$V1Ij0V1|$/ooo WVJ5&t-1C t&I?r :   DE9u֋-&t/11C &I?r O:   DF9uWt$V$: 1ɉt$\T$\RVQ2Pk\Vpt 9 81I $ȃD^_[]WVP|$D$L$ $QPWj tWj蔅 t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP tbL$1tHhy%hU%hM8| /IG?uWG9rD$^_[]he%hU%hh %w USWVl$t$|$t1ۅu>t7NL5$t%M"tÉS1ۃ1Ct:tV>tXtSh%t؉8txt@HtPt؉CjV.t.Vt!th%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPV|L 1H^_SWVD$1t^|${t6 1NA~0jh%Wo. uWϽW* G9rhe2 ^_[USWV |$ 7u ;l$$Ujh%U- \$C UPWh%NS$t^DžtnjSW? 5 8th+%h"荙9h%~1HzSlt$h+%h^"R tG11CGt0WJ ؃uh%h% ?Ņu1 ^_[]Ë$t|$u%tPWhM%h6% =mQ[PWhM%h[%辘KUSWVӊB D$ L$$t W *QPXnNjD$$7@uMh;*#l %tQh %W  Ph/%We |$ t$h6%W@ {D$ D$h@%$U8, t$h%U, U' |(6h%U+ 1>hw$Q+ hM"$U+ 5h5$U+ h$U+  h%U{+ h$Ue+ h$UO+ 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C PhE%W I4P&hR%W +7$@D$o|$L$ uMD$@tBL$qPShN$W"AN$D$ E|$tShN$W <$tBt88t/SQt"D$pHpDShN$WAM|$ tSW3D$ t7t1Ph $W D$ 0uW W؀ǀ|$ WD$(P D$ A#t%Ph^%W; vKLr$t>$z%tRho%W AsHh|%W 'CPPh%W  s$h%W SmPh%W {Pt;CQt$(stPhhV tVh%WT {xtCxPh%W3 tr7@OǀD$(h&PS t0ts~ t!V^t&PD$,P9uvh%Oh%B1OĨ^_[]D$D$D$h%WZ t1PPt$0V tc1PPV 9th$h $WDZ oET Ph $W&Z QjUt$0Vm Ņu1UVWUy h$$V% h@%V% hw$V% hM"V% h%V% h5$$% tzh$$g% %tn|$"D$<u D$xuT|$t Su@|$"$<u D$xDu'|$ tjSu%A#(A#A#D$ A#A#t%Uh%W Vh%Wv S,E%tPh%WP 3E%t= t1tVD%u vuPh%W ?Q@th%W|$"D$<uMD$@tBL$q PSh!$W0;!$D$ S|$"$<D$@LL$qPPSh!$Wtl{USWVl$t2E1Ft/׉˃PWh%%S tEu11N^_[]USWV\$l$|$ttUPW! 1tk<.tgh"W" tUh$W" tCj hf%W! t/tj.WY tUW 1t^_[]D=|Vt$ 'Bءf2H f2;f2he2j WY e2H e2 Fut$f2H f2;f2he2j Y e2H e2 Fshq%S Fsh %S Fsh#S F shL"yS Fx%%%%% %@uwxn%rhFS"r]%rRBc$ rG%r<%r1%r&f9#r%r%QR F sh%R F sh%R Fth$lR Fs h%VR f2H f2~e2H e2 he2j RW he2 ^ù%TVT$ L$\tX9t(,Nu2l1th9t,Ju^USWV$$Vtg$$QPVh$h$h%US P 1N@t+9w');@MQP'At9w :)߉h$h$h%USO ^_[]USWVD$<P t$ $h "Vj ]NjD$@HD$?1jh %W ujh%W u|$D$4Njt$0tNF tA.t;\$SPr D$P1U1HPUUUUSA 9l$u9t[,OuD$,Njt$(\$Sv  t-D$P1U1HPUUUUSPA 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ h "V.i Dž4$~y14$oy% 1H^_[]4$Ny$ USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQU t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$" V " "1H|$0t1rЃ^_[]" " 7{" USWVT$$D$ |$\$,ۉ$l$(1\$]fsuyxm2DHesxm2DH@O\txxm2DH! \\$ $2f\\ $$P#T$$P#O$sZ/t uP4! tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1 T$$t4<$t s%|$$u1Fi 71N^_[]USWV Ί xm2D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMEl~ 1 ^_[]ÿd 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3Vc 18 1H(D$ %t0%L$QSPWVG Ą^_[]USWVt$HD$DD$L$UjSS C@G jPS fC $4CCD V$4Pd UShip C O*W>RQP- UShips   1N^_[]WVPRQ} ~u~uF $`19؁Ĭ^_[]h*%{oUSWV(ˋl$uG*SVPn tu4 1^_[]fD$fx(t1ËL$ D$fx(uD$ V1ËL$ D$fx(u D$ V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS |$jjI`Ƌ$(@h@h0%ljFuJ1ۍl$Sh9%j U$ h@UFuC 8tǍ\$($PhqB@W f<$f|$ jUS ShlBW txD$PhpBW tZ$$VЃuBD$PhfB@v{ t(D$FP>F u+ hD%^Ft PV)O1ĸ^_[]USWVt$fFtV)vv v< AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$  FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP ^USWV L$@T$ "USWV$ vS$$AKtGu4|$QPhW1Nt8Wh $S u!" 1t 1F^_[]0rPh $V! 1Ntҿ9tB$Uj BA t$48rPh $Ul! u$jA HVPL$ uEt9BSu3 PVjp] t<$uffDw D1^USWV(t$@1ۅ@hHL$@D$E_l$u$D$T$Pjyt$  td"3EoD$T$Pht$  %L$T$ s 1K41ۉL$$$ s09t$@XōGD$ t=VPǍD$P 1HȉD$ 7΋IL$uEtD$D$|$@$D$ PU艷EL$QPx8L$QPeUt$@*t1CL$$9΋l$'1#"t$@1Kt$@l$t>*@h t$ Vh%U $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@莦ËD$D$ PSCL$QP ؃8L$QPSt$@车9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PUNEL$QP=8L$QP*Ut$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $PmPVhm%S1I/ދ$0$4Wj$@U t|$r $,84$GPlP$0Vh~%WwSYGPVh%WR$0$4|$WjU $,t|$w1Ћ $ Q%lPVh%$4$4#]SkPVh%$4轴T$ }ltE$u?ClhPhhWWVh%$4i{,t=u8C,j@Ph@hWWVh%$4$$0t1WPC,;r鋆Dt%@1W"C,;Drlth1WC,;lrF $'1|$TPÀsE,$0;rT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$Ph%Vt$$@$@$L0 >}k|$`$0PDL$L$QWh%Pt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$Ph%St$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ V t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$  V1(^_[]ËL$DtD$L$tPVQR D$ƅu: SWVD$ L$tT$$w .11t$|$X+9s "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p @v\F\^VF`t# P?v`F`^SWVjh0jM 1NǍ\$PSPhW3 trjSjjW t]jSh@hW tBD$$1ɉ $L$ L$L$D$fD$DtD$jPWU t W^_[USWVt$+VjUAChu,$t#tVh)Pj@^  r5%s6%PSh%cPSh%I 1Bh0) ^_[]WV΋tF>rD&$ GTt tB9tt9BTtI䋆tÀ~>r QVh%I ^_ËD$$POL$1Bh0)` SWVt$tgw]VhG)j @^ w$bPSh%H GLhuV ^_[USWVhuD$D$G$D$GH t-wa9GGGG G _G_1ɉO OG_T$SPwD$@tGH%_0wF SPh%H _0G89+\$8D$<l$8 %|$ D$ fD$l$|$Xl$ D$XG8N PQh%G w$Law(<PSVh<%KGG0GH[% w$ aPVhb%G G0GH%c1HG8G4 w$`PVh%F 8\$0D$4l$0 %|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( Է%|$D$ fD$l$|$Hl$D$HG4N PQh%xF ?G0D$ D$$l$ Է%|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu P_w0PVhI%E w$_w0PVhI%Et$6u$HujGtGht:?m%tPt%I@%GHPuXj<c@O;Au<t o%?uf%GH0ts]ShG)w4Q;She0w8P;Sh0w0Py;C w8w4Phz%yD 1HG8G4]@uPD$u>C wiVPh%8D wwhV3uVh%DOhD$L$u2wHS3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;th$CjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h%h%hh3% SWVt$^ Sh %'BG0+G8PSh/%A VhuVj81G?6u%EHPV Vh %|? ^_[]WV։h,j")t/L$ PǀcSc tfǀ 1 ,^_ËL$h3VD$tF9tAtIdtI;u D$ th$P^USWVPt$t1t+l$$# uVjj4^_[] GiP6mVKAtAt;<t5^ w$WPSh%= j1VUjt4/w L.o ow;.GOGO oo_H,$uGdGhSV VU=w-1GG G$^_[]USWVxT$΋}D$t$(HL @r@t‹D$PLih D$ɀT$wȈBBV*QRPҺ T$(  D$tz tA<t]<tYD$PPj D$ 1SPD$XP. 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Ph%9t$*]tVSt$Dj/e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ KD$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSP耱 ǃL$D$؋L$؋T$B)Á+),PjR ,L$1OAhT|$ 1|$CD$PjsǃSt$ Pڰ G D$G D$ GGDCff_f_1ۉT$SfGEh} fGG@D$ffGSf f_ t$WhD$ p\W F Ph<%/ ΃]w'6uh%V VjjA&1gydA$jD$PVo$ D$D$uD$HwK*PQt$R8 u)C Pt$h7"%* ىt$ t$ [u^_[]WVt$ Vt>wwvw k ]WT6ttt9uq@苆t'P{mdžtPOdž1^_UWV}tuPG><r 'u#r G(ftf u  s% u`hq ƍG 4$D$,$5%D$\$$#%u(WhIVjde^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0jw* u&h4j@`GHw$GP_iVjhStSE0, pLJ  twAQ \ BjWhNfjP[hZ"%h$7'sY EX>@P, UB( A J*R>RQP  ]rts4 t*Mq @T$hRQPPV]h"%2C>t2Mq M*T$hRPQPV]h"%% Pjf1wLw w wL$u]rruG XixiF SPh"%F% D$h$PS6ΪNRhZ"%%@u3EpCP t: @ NH M plYhj"%(%u Vhf"%%h"%v$e2=u1HL$h$QP t=w:F h#%Ph"%$ w 1Ƀ8tmF SPh^"$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQP衤 h#%C$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6hL$ <G cSc{ ni;`CLsu%1C &cMScq s$;PVh'#%! M1C1G G\$"O0)G4)G8uL$YME Ph$ A}w s$9PVh #% WuWVt$ VhIjtht j66t^_USWVt$ ~3E(L$tW9ud G N Qt$(PhG%>W0Edh$WWNttxV1ɄutZE tS@;FuK_ P8PShz#% uWt W+8#4 uE$;FuUhudEh>t ^_[]Ër^tuMEEVF $PE}t\$G$u=EH[%j7~ruHWЃ댋Et {WZtstـT$sO$tPЃ8u)ʃAr N@H@USWV׉΋D$$E t @9u ;M$^ P6PSh#%L EiP6r$u!}@uHhjjWV Džt jWVjj|$$tD$EHPVK#8#4 u2j1Vh'jj؃^_[]ËL$huVWVP֋T$D$WPt$ 1Ht<$u 1t ɉ^_ËL$hVSWV1{\t^_[ÉjhQ蟻 C\t4WhWjpuh%h$ŷ 8u"5 1NcD$T$ PUSWV$$($$$$_\ftPh%h$ ch$USY t'sPUV`t3_\t,Ct$?tF Ph%h^" V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%h$  t `jW0Z tD$ WV h%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ% t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r P1PVh %$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@s %n1ɋl$ T$Et*u4 %& VhZ %" %L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$  %t$\$SWVStǍF WPh % WQ} /6uh %VEiP6ΛVh'uPj EP' t$\$SWVD$ڃ\$ unudL$/!%Pt$WV4$L$T$t,D$F QPh %t t$&L$T$tSh$ViU6謙VjW Vh't$WEEPG @w"G@D$wÉкB!%SPpjt$ V t@uۋD$T$t5}E@GE$ED$D$ Pj6t$F |$ EuD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S蜈 t$@(4$teSPheR"Vt$Wh!%t$( eR"ۋD$t$0$ P'4$L$ t/PUVt$Wh!%QSPheR"t$Wh!%t$$7 $PUt$ Wh!%Q  h!%V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EPtUWP +މ^_[]SWV(΋6ulVjj3K AuA jQV_ t=Ht*ub 4$&PVh"% OVD|$ss D$L$ q qQPWV8  >(^_[VD$ Ph!% v B1F FFL^L$h7fWËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Ph% %GHPVq^_[WVt$ F PhA#%g OhGL^_D$ȅtȰ (1SWV\$C rç 1H4t${GPhVI ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0h&D$(P} Edx t]SXƀH|EdH #HL$|$WVrhEd@ D$WPYhF9VD$(PY1VVPv VVP[ ƍF8Pbuz3WMhVP莇 SWWG| WD$(PXjVP ƅuSD$(P臮C$t{tlSWD$|$WP@gFWP3gF8MdQP gXMdQP gVD$(PWS蔭1PPD$,P* toVD$(P3 ~xF| uF|FXMdQPfVt$|C} 9tV;UVqT1PPD$,P轂 ƅuC$t$xh&D$Pw{ 1PPV节 ƍC D$~dV`Sn8U`?1PP$7 9tC9t?UWd T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$} D PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u&踙 G訙 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ u#L$( Ʌt ѹ )QPh-%jW ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]h$% VD$t:t0t!PtQPV PuVj^WV|$ 1u7jt @1H1N^_USWV $ yr誗 t$ $ q>YtiDD$ \$fl$Ӌl$ h%%WU_ 9 8th%%h%%t$@s"j@{Dž@77 D>1ɨ1QSVv PQFRC F CFKN\$l$ ! F ! F D$(t8tjVW uʋu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF ֑ oUSWVD$1tW8tQ\$l$G@tjUPY u8u@$Vu4jjt @H h&%1^USWV0hjdƅT$PL$LD$H|$D~Ӄ^dNdžu`P VLPVH@FDV@PQ5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUtNj.PUjt:NhVRPh-%j.Q; @jPW t&@`F`Nd#hW%%Vy1F`F`uNd 0^_[]WVt$ 1WWV# t1@WWVL9 1^_USWVD$$t8tb\$(勇tK0tEFPU#t.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]USWVD$t81t7\$t(tEPjSP tmu^_[]SWV|$\$L$Ƌ@t9Xu9x t)jtXx N HF 1h=%%K1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP_ t&hPt$ hd%%t$-H1Ƀ H1ËD$1t' t!1Qd(u Q` uSWV|$uuu jPW t$H:u @`PUjPVWTtaQPAHd1IH H$ǀMjPj781Fuh%W0J1N^_[11SVt$ ^d؃ FdF`u uhF Ph&% F NhQPh#% u2 tQd s((th%PI^[USWV |$41G$ujjWT t ^_[]ËsWt׋trNf(@_>t .o*Sh<&Uf ShD&UO TD$ 1L$A AAPj@QWj1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU~ U~ V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS t=m<$hj.PSjz1T$ JO9zPWE`t.tRD$@D$,$KU5E hUPh&%3 4$} f4$n} 1SWVt$\$Gt!PtQPW Pt1jPWtt2jP4%W51VPj4^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPU tKd(1tD$ @`C`|$u%CdtC KhQt$(Phv%%C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JSN0t4${ 1H1^_[]SWV\${C KhQPWkƋD$džluC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUy?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPt t u"GPt$,h%(% GdD$ D$1xG O4SQPt t $tsOdtYG %twc$OhQRPh<(%hWj[u!e 81te 8t hN(%Sw$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPwYs t $t8$C O0QPh^(% OtHO\$u4$FTjPS NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$d D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRhQj螽D$ t;t$(hs(% j6Qh%V,e^_[]SWVt$Vjj艽tj11G9quƁjmمuިt?5j6  sh%V+^_[USWV] D$@Cxt$rj.VL$0Qj|$,wVh(%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh<)%h(%e^_[]T$rRQPh(%ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQ t8D$ L$rQPh)%h RQh])% \Rh)%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVP L$  uhj/ËD$CNC KFCF CCj.L$vQPE Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph)%T$$RGTD$0Pj蹓 $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h)%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h*%<<tj<uŃt$hP+%|$$HL$Xpx jP$PA D$<t$h*%|$rst$hg+%$p΁Vt$ h +%t$$C$x|$D$ƀt$h|*%B1|$t +D$(t$( 4XPjQ@ Vt$D$`PA \$Zt$h+%t$ 訾 $A D$PAD$LIL$HD$DD$xdt4D$t!t$ut$h,%赺|$$t$L$U@AH|$u D$&D$6D$t0t$ t$<t$0V)j6t$ \$1ɿSQWҰV1QW轰h@%t$D$u%D$6j D$@`L@O|$ut$hP,%몋sLߋD$,9CPut$,t$Vr VGPD$$t$,XGLtbt$,Vt$Pm9 wPD$(À|$$.&D$$h)%ø|$$3WQ%t$4q t$h+%Etk,΋D$9t ,JutVt$4q t$h8*%U|$u/j |$u$jt$ut$h@,%$t$et$4t$t$hZ*%|$$tL$11BL$jSD$(D$$UWV}u WYhИ ƍG 4$D$,$5%D$\$$$-%ԶWhٻVjíe^_]WVt$ VhWۭVhٻWĭVhW譭^_SWV|$G Ph\-%聶ujj蛠Ɖ6GF_>tC FPjTt.t+@JAH *RWP6 tF F^_[hz-% ^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh-%袴L$jQWT u h-%$BHJAWhjj*G Ph-%+WhW iSh-%|Yjt7UhbjPs@h-%h$O)h-%=d^_[]USWV׉΋A1PUSͪFVUS跪t!NtHNVJFxUUt$Pt$PtQP P9vL,V#^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUh#%! t#@uUhp,%' S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h,%j봋4$VUh%%. WjDu!N 81tN 8t h,%QL$o@G WQSRPU踶tDD$GdՃGdD$ j.PUjt'OQPh-%j.Vw h,%ر)h  WhSPj)8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW` uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPw{ Odt Od tY?uŋFuh%Pch%PMt-u~`?w#F0gF Ph,%^_[]jt$趾USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh .%h$ jSWXO tD$ SVk h .%詯p^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh.%u PUn!D$C,9r|$t"w 7h.%u PW8!,Nu^_[]WVt$ tqwgVhj胥1GGG G XGft^_# Vhg/%h^"w ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUWh u?u^_[]USWVD$t81t9\$l$tp|tSUV u6u1^_[]1USWV$.FX|$ j.WUj=\$wWh%.%腭$$tXjVWr ÅFD$Pjt$ L$QƋ ulp|$NjSW: tL$9uPWV޹ t0 D$ PShS.%+ ^_[]hE.%蟬jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PShs.%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh.%$ WSh.%藫 F PSh.%ت t){4t#D$} t*tu Vh0% Vh0%蔪jjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]Ef0%fX&9t Qf9Au<< <\$H $\&|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh1%oD D$ PD$p Vh1%% D$ PD$p Vh?1% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPh1%wD$`$T$B"pF L$ QPhe1%P 1Br&$F  $QL$$QPh 2%<$tD$x%$l$ |$$ PD$$PVh1%蓥D$wYB 1L$ T$t$QPR SWVPjh0j 1NtKljjSj hPWft $jSjj)W;ft WF^_[WV jh0jt ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW达D$jPV,_ t?jWj$j)Vet"$jWh@hV]eu%h/%螤VE h/%艤1N ^_SWV\$|$1tD$&1ۃ ʾrft1ۋhDj͍H(H,| t1ۉfǀ<fǀ?WjhP jjW t W G Ph+/%ߢWhWW購 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ WhJ7%P E]1@EEE,E ]$z t(Vh6j jWhl7%h^"t^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$&D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPShljPh7%h$Ġ$1ۋ6<$tD$D$$t;F SPh"%Ο D$$hPS6V%Ch7%6Jh"%蘟e2=u1HL$$hQP? Ã37@$:VL$QRP% \$\$TSjojD$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Pht"%~T$E|$wD藏S GDtL$$SQP# _Hbh7%Ğߋ$t|1QhQP芰T$R6#\$sD$1CDCH%-ۅt}u2: 8tn: 8tdD$ Ph7%h^"6 FD$ u9H|t;A`t"ftftAdu y  Љe^_[]1ɉH1BPP@ H~ Wh 8%\ot/[Vhij jۓ1Wh+8%h^"b vF Ph7%h*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjPwcE <$L$ V諟txEtptk8] 1ɉHH@H HH$7E0%$P67!11Ӌ$PR*uLjEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 ti8%tPV"ELPu4 u<Udž6ttFtu7@t'P<dž ^_[]à Vho8%h^"ٚL$1jSWV|$WhWjdtxWhS>WhiS'WhSWhSws^_[SWVt${Du ?~ Wh8%P 1@1ɉKCCS(C|S KtHd sHdit xti^_[Wh8%h^"k ^_[ønL$xtiBL$4SWV|$t$_u~G`ux{ ur 6ugtXuG@Psmt3O WhGjP迋uhN/%h$蟘t|t$WPV6^_[D$T$J P&)USWV$1@|$D{l$Hw4 C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1WoC,$;lrD$Vh^/%P蕺 D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P. D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hWt$$t$$t$PD$\0 t0L$ D$ PQhVt$$t$$t$PD$\0 D$ L$)1H62 t$|1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s 1 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP贅G4 w$&:1   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP  D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUPP D$Ãx3 t 11A9r1Ë71$1 $&D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ Phx/%虐1l$S3qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N 'H 'H 'H '|$ t*G>r!D& D$H<D$@k VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh% D$P4 uOt$ pffBfBpɋ<$tXQlR ڃ p7t$ffBfB<$tD$WVPR ڃ L$t3D$fffBt$tVWRωy ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQP |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHP dtKWUP& D=l$_D$ fǀ< 1fw &)h2%葃R|$Qho2%j WH D$l$ f9<t1}~ QWh2%PEt$sf<j fu.Wh2%z'Ex'Et'Ep'El6tj!zD$0^_[]USWV΃|$$w Vh53%躂1H׋ 1ۉt$$S1ItU $]h]d]`\$,Džu\$SjbRƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ VhP3%&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph4%蒀k(UPh4%& ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh5%4},WVh!5%Ȁ ^_[]V΋QhijFw1ɉHH@@ @ @$t 4^D Vh;5%h^"* ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth$VtP6jVjj`v-wx9Dths5%Vu Vh|5%<^_É1jVUSWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh5%Q|1s5%8WjjVuD$$PjN<$w$&8uJ6%=ǃ8q6%8u+0%8u0%8u 6%8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h&6%} ؋?ut$u {`<$uhs`t$ hH6%{} 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h3%u:fD$D$D$PjUVD$0T$4)̓w! t$h 4%ufjPD$DP D$LȉD$LD$PȋL$LD$P9v) t$Pt$Pt$h*4%ul$4D$h|tjD$@PUF upmjhD$DPt$<ǀfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h3%]s t$hq3%ws|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPh#%r wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF PhO4%rt}u^_[]8V6)^_[]SWV΋y Whh4%q 1CCCC CC$t^_[Wh4%h^"q ^_[Vt$F Ph4%q1B^L$Vt$?N QhN5%Po 1B^jL$4WVt'׉΃|jt$RPKt j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV1t:ǀL/艈L/f$HC;,T^_[]SWVt$Vhjg1CC C XCC~ ;u Wh5%p Wh5%ot^_[Wh5%h^"o ^_[ËL$Vt$VhjifF Ph6%o1B^hVt$?N Qh~7%Prm 1B^2L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh7%h$n tjS0& tD$ WSV h7%vn`^_[]ËL$[aVt$?N Qh>8%P?l Vh[jd1^L$L$@h;%P1|$L$8jQj*j)5XR;e!u h;%Q;rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5XR; y h;%QQ;t+DŽ$j$Pj&j)5XR;[ uK1ۃ|$$@V2D$,tD$t3S?pR;uh)<%h<%ƣQ9Q9|$$tF1FFFFF  F)F.N,Q9Q99rF t$ƃ|$t.t$ՂL$Aut$hF<%+@V2D$,|$,tF)F/@V2F Q;@;DŽ$jjjj y ha<% R;DR;R;HR;R;LR;R;PR;R;f R;'uTR; R;|$tjt$ j.j)V=@V2ujhR;V yPh<%UPh@V2Pj)VxuY=@V2tjh@V2j j)VWth<%$PhR;Vc} yh<%hl<%h<%VhD$ DV2 | h<%C$jPhh5XR;t$8jVj$j)5XR;y h>=%虦jVj%j)5XR;ty h[=%sQ;H H r8r DV20 s~|9~ h<%Bt$jVhh5XR;y h=%jVhh5XR;h(=%d8DV2PQhy=%^" Q;Ѓ1۹r;PSSQVRhR;r;tI"Qh=%" Q;ЃPSSPVPh%u8 t$&T 8,h=!? 8hK.%蜛jҬQ;h}>%D$h t$dt9t1~)u~,u ,< 19wΉօuɋt$|$D$h r[L$dL$tOL$L$ L$ȋ9t9y)uy/u 9 19wΉ\$,t$uh>%F7ءR; R;t 9 ؅Q; FjhDR;P] u!F$ TR;9Q; Ѓr;P1PPhWjV:tI"WhU>% I L$L$ t;|$)u .u tj 19wωt$t$\$,uh>%F(=MEQ;t$Ph=% <Ff9`R;FfR;R;=\R;'fD$FȉD$(F ȋ|$P)lj|$PD$HL$Ly@B|$P+D$(D$HL$L$$߬$%$ڼ$(R;H7ءR;HR;% t$h?% Q;1$@$T$P$L$H$DfDŽ$@\$K $XK $HN KN SVЃr;PWWhVj$XP tI"Vh&?%# t$|$\$,=\R;u ݄$\$$.?% D$D$(t h@%P K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( xm2D$0LA :$sV$PQ F9uEPhIA% h@% hA%h$A% |$ FPhWA% 6Phx@% |$ "h(F%hF% h#h#hL$$ 'j.$Pt$ jYVF$Q4&hOB%ThjB%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"P $@D$@|$ Phd"h$c t$ 9|$ohC%hwB%< D$$$T$ $@WjWh# %P Ft hE3% f2H f2~e2H e2 he2j  )L$|$$t1 q΃j.PL$QjTuj.hI"$Px $Phx$# |$u"tVho@%  hc@% f2H f2~e2H e2 he2j t$GNjL$+{hE%^eih/# Q;t$Nh$q Ntu?% %PM 1L$1΄u j,L D$H?%x?%?%sVQ D$9D$t$uKj, h?% D$4L$:D$tHj, D$4WPh @% $D$4D$ uj, h@% f2H f2;f2he2j) ne2H e2)hB%h/#0 Q;؋ f2Qf2~ e2Qe2 he2j  Q;z|$h ot$dc~)/F1#ty1hC%n2td3hC% ^ F N t$~WRQPh% R;tI R;9~h# 0D$D$L$d$ ط% \$$#P f2H f2~e2H e2 he2j L R;\R;tzR;$$R;|-R;HV2R;$\$\$\$ \$$>% $he2\ he2O USWV $$919gՉ $t$ $;8t$hh %$,誀 =&GШu+$ ؃?9?)9K9si xm2LA :$sV$PQhVX =hV$, =GC~ 9r9$$ul&hh %$,V =wDG$8:$ t-؍L$VSthV$,y 1 ^_[]USWVP։1|$4$u9|.HPh_@% %wS$&W )1@1sC9uÅu.Ph%h t$߉E1 `^_[]USWV4)ȃ'hB% :։ϋ ˉ hmF%]ˉ $Wf_oUSRQt$PhPC% Gl$j.UPjKuj.hI"U» UhrC%t Gj.UPjKuj.hI"U菻 _U]()|c؉<+<'uehB%0<9#<,uthB% '<+ughB% <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5v;t$PV;hD$$HL$L$ 1x1PPPW膵 jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$; ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$7_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$v;D$PVPHL$@D$D$ 1 G|$<$D$=`V2$TD$j=hъ%|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hъ%S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSPf SVUe |$|$t$ "+Hj=hъ%P Ņt$,] 04$Q" 0D$$&߈FHGNm&Þw$&:܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4 "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=v;u t11jNtv;1w;v;t P1@hM"hF%Sv;1USWV1=w;MT$ l$(L$DžD$5v;hh w;  |$t$ z"j h w;E D$ w;h z"V v;tUPT uTWVv;WVt7j L$QP  x#L$9uv;;D$ D$uL$us v;8 v;APQ~ PQ<  v; tuQhh w;  |$uw;1^_[]w; {; {;1Ҋ+~,u"1t$L$t' t" t΅tAL$=(~;u(~; t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=w;u#w;v;tP׸ v;t v;1^w;v;tP裸 v;VtJT$1Aj<ƃ=w;u#w;v;tPY v;t v;1^t w;t D$w;1@1USWV D$,L$(l$$~ )$1H$`t w;1A\$9|ωL$ tgp9tX tt$ PH t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$w;v;tP8 v;D$,L$$ ^_[]f11f11Ã=,~;u /t(0~;11hh`~;PjNt0~;1d;,~;t Pa 1@hM"hF%,~;1USWVT$1=d;+\$0L$ D$D$|$(D$5,~;t$8S  l$,D$ D$D$t$j S芀 \$1 h z"VEE|$tt$(P莸 u~ z"WVEWVt^j L$QPJ xJL$9uAE;D$ D$<u/h z"Vtj L$QP  x L$9t[ ,~;8 ,~;APQ~ PQL  ,~; tuQt$8S  E hhS#V@EthhS#V+whhS#Vah z"VEHh z"VE /h z"VE$j:t$ ~ 1@|$ ud;1^_[]WV=,~;u et3t$|$ 11t$t$Wj1tЉ^_1@PPhh`~;h0~;t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=`;u+d;,~;tPL$m L$,~;D$$tˉ01C؃^_[d;,~;tP* ,~;PPhh`~;h0~;t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=`;u+d;,~;tPL$虲 L$,~;D$$tˉ01C؃^_[t `;t D$`;1@1fUSWV\$l$t$VV PVW־ U= PUW¾ S) PSW设 t$ V PVW薾 ^_[]WV t$uRt>DžtA=j;t ^_Épxj Ph! ؀=h;u1F1=i;t輻 1맋5dV2f d"QQhF%Pփ谯 USWV1ۀ=x;t ؁^_[]i D$ |$GSSPhl;jW&u l;K |; ;r1H;d"1ۃt2u3hWhG%[ D5t;~ȍQ2w$&;PAu ;?$D$-dV2e h"L$QhG%PՃ;hV2@;lV2 ;I9@pV2 ;I9@j;h;i;;;y;p;ghV2 ;A9~WHhV2O;FlV2|t%ƍC!t2)É$)t*;L$ ;$)PD$p xPhȂ; =;=;WjD$hpj Ph!) 5dV2&^ d"QQhF%5dV2 ^ d"QQh G%PփƦ 111{PZDWhV) ESWV 1L$ |$ ru\95Ă;s(>tGǀ=;u.;=؂;rN;=;rDp; DžtVjW莕 =i;t^ɱ 1ހ=j;t& ^_[À=h;u1Ffu]pxj Ph!赶 뺋5dV2\ d"QQh@G%Pփn NUSWV|$4t$0Ë Ă;9s&;9 8Ս1ʅ/;99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95؂;95;H_ŋ ;!9r؅ ;9s9s_; 8!9t.M9wI9rE;8! lV2!9u!=;=;p;Rf ʼn9rPVUj  8!!ōD$p Ȃ;PVL$ň D$PVt$8ӌ ;Pt$jUV thŋ$L$Ai QhȂ;؉ =;=;u=i;赮 1=j;tM^_[]t$hȂ;| O=h;1GDu3t몍D$0xhj Ph!~ 5dV2rY d"QQhmG%Pփ+ 9U7)SjZP)MPjS蓑 :9/ $)QjZP)PjS` tƉ111USWVˡ;!9ta)‹ ;h t u9=,$)<l u=;OE$)ÍFu\wlW&xD$X Ȃ;PW荆 PW衊 =;N V;5;w(& wW&1É;GsG1B TGHO;Mu9}tAtDEWP 5u%E9tt9sMxt MPQ }-E $ut=;tGV^_[]ÃWUԆ VjZS膏 vjZv q VjZS` V t$=j;tt ^É01ɉHHj Ph!豰 ҋL$SWVȋ;!9t+)֋ ;| u 9t%)D @A QhȂ;襄 @D^_[USWV=;t^_[]þd"VVVhG%dV2Vh"h "hH%dV2$"=;u"^%=;u7u%8"=;u!RQPhH%dV2%=j;u7H%$"=h;u̓"b$=i;u߬#:H%=;u+$VRQPdV2dV2$ l;|$gfff̉ҍ4މ劄1"GO wһd""SUWh=H%T$t$|$f4SUWhDH%dV2dV2$ ;Ggfff̉ҍ<߉劄9"FN whd"h"VhSH%T$dV2$ ;|$gfff̉ҍ4މ劄1"GO whd"h"WhbH%T$dV2$ ;|$gfff̉ҍ4މ劄1"GO wҸd"PPWhsH%T$dV2$ hV2|$gfff̉ҍ4މ劄1"GO wҾd"Vhjl#WhH%T$VVVhH%dV2USWV΃=܂;tPt ;3!1P.ǡ; ;!)ȉ9r1U.܂;9tEuótP-;!1PPjhjUP> t(;t;=;=;-;1ۉ^_[]V΃?; ; ;v$1u;Ɖ ;^USWVP;;; 0trƃh&P0 F,=|;=;4$t|n011FEEh&P ـEEC;(9r:5dV2Q d"QQhH%Pփ=;p;11;9s[ $,0EEh&Pi s+;C;]ǡ;;(9r;9$sj,Ѓ0EEh&P ; ;s ;)ÉE;ǡ;;;(9r$^_[]Y L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡ|;D$Ă;D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9;s$5;!։Ņ9;v6J Љ  ȉ  F1r{@p9;sBJ Љ  ȉ  F;; pV2u%1I#5;!֡; lV2HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU6 tPUF $Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=;t=;uVj1^_[]VhU蛄 USWV5;1!-;t E;1-;E@;;v@uW-;E@;tE3t,ÉE uUhȂ;[{ =;t"=;t!;E-;^_[]VhVjS܃ USWVΊ ;T$ T$FD$t$V$D$9Btr$u$…;ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S} ~VSAz SD$x,t @,KZ ;tjNjD$G G; ;)ʉWOT1Nt TtWt$y -;T$ ;^_[]1USWVȋ5;!) ;L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ;94$1PPh;~ Åk jS;W~ SW{ ;;;-؂;r ;-;1WWjhj\$SU5 t\tV9tRSP uE螝 j@\$S0谣 -dV2H h"ShH%PՃ=;1lj1;4$9v(; 1QQjPjVQd4 @wg1=܂;j!$ŋ5;!Ɖ)tP$܂;9tut݉<$/;u1]4$D$x Ph;v tA<$;C 9r09$v+jSV} SVz ;;uɉD^_[]f Vl; p;r!1F<u. p;l;F9r^USWVP $1N=;1!׉) ;D$)ot +t=;;;v|u+HL)͉ll+;;s| ullD +lD;G,$vuWVy DGWVIv ;_s_u.G WPx =;u.M,t ;-},^_[]jPRY 5;^_[]USWV@׉9 ؂;95;j!;;u >9uP!;;FjWV *1ۡ;t  ;8;H@; ;v@j;H@ ; 3H ;HPh;u ;9rWV u= j@S0 -dV20E h"ShH%PՃ=;9=;u];t  ;6;H@; ;v@u,;H@ ;t=;p xPh;Pt @^_[]9܂;u)܂;;Z ftV2øtV2ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[áj2D$t$P|WVL$T$ ‹q~y ;q~ t 1~9 QP^_D$ xm2DAD$ xm2DAD$ xm2DA%D$ xm2DAD$ xm2DAD$ xm2DAD$ xm2DAD$ xm2DA%D$ xm2DA D$ xm2DA@D$ xm2DA%D$ xm2DA%D$ xm2DA@WV1F|$ 4&W芎 tF u1^_ËD$t w$&1ËL$1t9t1ҍB|uËL$1t# t|$txm2LH1H rËD$t xm2DA$H1ËL$tT$At9ut1VD$t$tPt$V]y ^D$ pm2DAD$ lm2DAWVD$ d"d"tƀ>t$ 0DPWVh-%hTf2#^_Ð1|$w L$t9tøV2f|$3"td"fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[]: 1۾$$T$$IwL$I`q|$ \$߉t`r&j`PSw `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ Pv t F;&tm&D$&D$$&1FthPt$$V^x V襆 Ft$N tVD$PSv |$ut$`e|$ \$|$u,1F|$uu1;&t$`=u-L 01H^_[]Ë& r ,$&t u‰,$&,&<$t9rPQt$u 1t/<$t9vё |fL$NI%9 4'vhm2fL$cI%9 h'v`2føÃD$L$L$ L$D$Vt$ t$VhTf2 h!Vrt"6 0kPh#hTf2L Tf2Vj VW ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP tp 0 g 1$^ÐWV|$ W4&茇 tFu1 ^_D$ftL$QŔ&1USWV$п$$ u V蜂  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#֐4$Y(I111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$;L$L$ tU?|$$1Ĥ^_[]USWVt$~X>3܃ V$D& j F H @(N]_?[\;^r~uFF;;C><% ^q{t|~F~F ;^r~uF;FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF;F^9րրw t$rI{i9s <$=xm2]D_\,<$t~uF F;;Au~uF ;F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=Axm2IDJt"m9~~uF ;NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF ;F"{u@9s xm2DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup xm2DAu f'tf`uW~F=@9t8}@u~uF ~uF ;FЉL<$USWV t$ ^h.\u/;nr~uFF;;EMŁ'$~]$p&|tfύ]Љ8S dBt@SB*@.[Oω\σ~uF;FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF;FωωD$$xt~uF ;.n~EFx xm2DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s2xm2 DJt"r 9~~uF ;N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF ;FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF;F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! ljpm2TXL$21@u"lm2TXL$1t$1ɅtT$T$1=j2E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8u;F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 xm2LAtx lm2upm2f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQU F^_[USWV1y19sC11-xm2D]t#=k)CB9u1Bt=|yuA ;Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$&)@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' F;FUSWV\$1=j29v1@(ϋF,@jPv(j t|F(N,QV,fH~<t}pm2Dh j21҃9v1B j2lm2Dh1҃9v)1BuG ;G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF;;;^_Ã~uF;NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF;F1^_[]É؉D$I%&t$t$Ud u U` t/uՃt~uFG롋$USWV 1=j29v413A8 $A,tI pm2L$ lm2L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS͔&uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQ{O o^_[]SWV1G9Qs7ӉjRq$ tF^~uF ;F1^_[USWVP1N׉$1+t{`tswsK$&@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=j2|$ r3GtD$WT$ou]t$S] |$Qo ]GtD$wt$wt$wS]] |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋O L$ |$ tM1PVh{t$Vt$pL$xtEpt$t$4Q= L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf xm2>|$u l$`\$\z xm2D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" xm2T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA xm2D$¿!DQf_֋D$ !DAf|$$_8tV|$uxm2L$ DHuf|$$_u3|$uxm2T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$H&$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4. L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ n ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf xm2>|$u l$`\$\z xm2D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" xm2T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA xm2D$¿!DQf_֋D$ !DAf|$$_8tV|$uxm2L$ DHuf|$$_u3|$uxm2T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t Va @wj/V 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPhL%jPh;I;ø2%Vt$1Ʌ1t э^fffVYT$ws^ÐUSWV[Xl$,D$(u1T$|$;D$ T$$75PW E>PW PW FPW tNPW |$D$ tHѰPWy YPWa ʰPWI iaPW1 tiPW |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [u$ @$ $ ,1H79r 胼$ t+$ $$ FhPW $D$ D$jD$$ xfD$4D$dz /$$ AfAfIQPRhWZ:rt$ VPj $D$ $P1:1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ VhPWZ j:W D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVP5t Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃK7D$ $t1L$ L9s ዄ$ @<C8L$|IAt$tjhQPR*D$4 rqPh$Pf7$$9s|$$$9s$$[1 $L9s D$HL$H P }RQt$ Ph$Pg6$$9sD$4rqPh$P5${$_9sD$hI$/9s狄$ @rPQh$Pr5$$9s獃t$Ph$P5$$ o9sD$ tWrQPh$P4$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ 0$$$9sD$dL$HL$PiL$pRt$t$t$$h$PT3D$L$HL$HL$HL$,HL$(HL$$H @ T$0PQt$,t$4t$p 荬9u8jj tt Pa< 1 4 0ǃp gǃƃt t 01^_[ÐUSWV[E$01t uut!j/VH uSt tƅujƍ|$iTVPQhW)=r ?h@VǍD$ jPWS D$$WZtLD, L$Pjhjjj QD$(P Ƌ<$t'Vu D$8 tO 8 A L$^_[]ÐSWV[t uPP&6ƃt $tj/V uAƉ獃iTVPQhW(=r ?t"t VP tEFu7hh%@V- t hVP 豩p jj  t=jjjs !ƒt"D1p P!B 1u 0 0^_[ 8#uVt׉ ƐS[N>[ÐS[.t$[ÐUSWV[u } D$<$ t$u$$D$Pzut=k<T$JL$|D$x$L$x$PQ$$$Pt$OlH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$`1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$h D$@j PW襩 K 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $S \$ 8u$$>$0։ D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6`W8G4jjdv6 jjdRP;WPGLjh'v6 W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$,%r L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$t9u1^_[ÐUSWV[ËL$tEׁu$C t+t9u11ՉL$!։1^_[]ÐUSWV[ |$GtB#l$%t$P><t!G t7t9uӾ^_[]ÐUSWV[ÛtC#l$ t$P;t!G t7t9uӾ^_[]ÐUSWV[+tC#l$ t$P^;t!G t7t9uӾ^_[]ÐUSWV[øt$0t$,zǍ3VP6‰t$D$(%D$1퍃D$ <$l$tg|$ !RP:tG t@/t;L$uЃt'D$ t$j…<$uNt$0t><$9tR PUWf >&t1<$W#^_[]fUSWV[{t$D$hEt'1PV9t%D=u1x u`KVPjD$@ 8^_[]ÐUSWV[~|$ D$hEt$1PW19t%D5ux ^_[]ËD$@ 40tM D$jPt$V{ ŋD$18tu r"u##x u B"tt$x a!4$WPjуH`KWPj^SV[}t$ v+!v !V!^[ÐUSWV[È}D$,8tD$,1퐐8@uj@HƋ|$(WvF$"jUF D$ D$,F>3D$Pt$1}nu1ɀ}ouL$D$j=U tǃ|$D$,t1PU6tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8x t 4$|Vs1^_[]Í`KUPj`USWV[{$4$, 0:jPU uj:UNJ _jPU} tKt$}/3t$UhV jVEPU Pt$UD$P,(|$ |KjjWjjV5mt$ jjWPjVh5t$/$D$PV?ǍD$t$jDžjt$W uj$4$4jWMtƍD$Phzd@V蓬 VD$(Pt$` uP$0>4r$0VPW] FD$ GL$ KjjQPjRP4tqVUWep R 0o$0X 0eks 8uj/UŃt$ $0UWǭ : 0@QPW設 111 0o$0P$4y 11,$j$4V$4WjUP~,PWt$t8HPQ& 0e$0P$4 1,$D$PUM 0^_[]Í,$UPVW 1 (+=WP$8$8VfffffffS[ûwD$D$ $L$T$jjPQjR92yD$[fffffS[[wD$D$ >$L$T$jjPQjR1yD$[ÐS[vD$D$ ?$L$T$jjPQjRy1yD$[ÐS[Ûv$L$jjPQRyD$[fffffYOvT$u܉ÐS[vt$ZSWV[u|$Wt$t$ 9r ?WVPj^_[ÐSWV[ìu|$Wt$t$ol 9r ?ۚWVPj^_[ÐSV[]ut$ nƅuPj^[ÐSV[ut$t$nƅuPj^[ÐSWV[t|$Wƅtu%WPj ^_[ÐUSWV[Ûtl$|$UW0ƅttu?UWPj^_[]ÐSWV[Lt|$Wt$ƅtufWPj ^_[ÐUSWV[sl$|$UWt$= t 0UWPj^_[]ÐSWV[ìs|$t$WSƅuWPj ^_[ÐSVP[lsD$L$T$$RQPH ƃuPj^[ÐSV[st$t$t$qH ƃuPj^[USWVP[rPt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1 (̛t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[ZrPt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1: (t$,t$,t$,t$,t$,t$,Pj ^_[]fXqL$"w ÍpffffffUSWVHXqD$0T$ht$\L$p|$d1ۈD$4<uЋT$`l$l4$T$l$D$ L$D$D$D$ D$$D$(D$,|$L$d tt t$\ %ju%#jo%#jxt$\l$L$t \$0WPURV \$0WPUjj~D$ |$4R|$D$811|$<,L$4L$0KGD$ 8 O3L$8 `|$4=RL$ ;L$s$=D$L$ ՃL$ -O? G<@ |$4fu  t$ T$։t$81 tl$81 u<@* '  |$%O?1ҸGD$ t1#T$#t$ |$,D$ D$(;D$s $,D$ D$ wӉډGD$|$,L$ tL$(;L$s $,L$ L$ ;L$s $L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ D$ D$$D$(D$,T$ |$)\$<$\$0WRT$ RQP ؋\$0Pt$ $ڋ\$0Rt$L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ t$)$\$0VRT$ RQP;D$s $T$L$ t$$L$ )9v" 2L$ ;L$s $#L$ L$ D$9l$Ds$D$L$ ݃L$ L$$D$(D$,T$ t$)R $\$0VRT$ RPQL\$<L$D$(T$$)9sqT$@f\$0WRD$ Pjj\$Pʅ~D$ |$\$0VRD$ PjjkT$4ωD$ ;D$4s $>L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ |$)v>$\$0WRT$ RQP;\$0VRD$ Pjj1҅l$D\$0WRD$ PjjwT$@~D$ t$ t$ ~!‹L$ s1|$,D$ tVD$(;D$s $,D$ D$ Xt$ wx;D$s $l$L$ \$$L$ )9v" +L$ ;L$s $#L$ L$ D$9s$D$L$ L$ L$$D$(D$,T$ |$)vH $\$0WRT$ RPQED$ y|$Q ;D$s݋ $L$D$ ͋\$0WRD$ PjjyD$ u|$,L$ t@;L$s3$ >"\$0\ L$ ;L$s$#1L$ 1L$ T$t$$)9v" 2L$ ;L$s $ #L$ L$ T$9s$ T$L$ L$ L$$D$(D$,9s$ T$L$ L$ 9v_r $D #T$r= $D /T$9s$ T$L$ L$ 9vr $D #T$t $D uD$ H^_[]ÐS[ejt$t$t$t$t$8[fS[dL$T$ Pt$t$t$[ÐUSWV[Ød|$$t$|$0t$(aD$ j/Uzs ,$t|MUPt$ WVt$8IuU< 8uFt$ t$Pt$t$@t$6t4L$ʁtPDDt1t ʁPH^Ë6u吐V^5D$t4L$ ʁtPDDt1t ʁPH^Ë6u吐S[~5t$0[ÐUSWV _H5D$ T$$сtHDD t16|$t сHHPT$~YP$1;|$t<<$~P,R4$Z! ˉZfBtBtXDۋ\$jP/Z1 ^_[]ø񐐐WVZ]4D$ t9pHD?t;:u@D ^_øS[3t$0[ÐUSWV0[3|$D:D$Hx,pL$L|$DGDD$GHD$ fD$$GLfD$,D$(G|$D$Pw|w|ut EGDUWjWwV1^_[]ÐSWVZ¬0ttL$pH9D?t;:u1PDQAP|1t$:^Y|Rtqv^_[øSWVZ 0D$txL$pH9D?t;:u1PDQAP|1t(:^Y|Rtqv^_[øfffffXo/ƀ| ÐSWV[L/|$0 20 2 2| 2 N d N$ NTh NX N\ N`d Nl8 Nm Nn822022|G G$dGTGXhG\G`GldGm8GnWG1Ƀ2QP辟G GlWW ^_[ÐUSWV[Ë-l$u}:P|M Ņh4j1ƋD$L$dž3Ndž2dž2| 3ƃ| fFddž2dž3 hӿ3,V*5VU2@xpu xhdž2jjjjjjVVFjjjjjjV6FVZV耐jjjjjjVF tdjPVGVNV% VlHIt 3t VdVk@Z2t PDf2tuc29ʼnu3V1^_[]ÐSWV[<+t$2t Pe2t7Uc29lju2VBZ3I3;90uV"^_[fffUSWV[Û* t$@+@+@+@+@+@+@++ uǃ, >ǃ0 <ǃ4 ^ǃ8 vǃ@ #ǃ :ǃ 'ǃ #ǃ #ǃ$ #ǃD -ǃ< -ǃL _ǃ` |ǃx oǃ@ -ǃH -ǃd <ǃh >ǃl *ǃp !ǃt f2Ot^t8tjtfx ؋tvQjPW 1 QTpQTtQTxT|=u^_[]ÐVY(1 T$tpqttqtxqt|1=u^ÐUSWVP[j( l$j+GG(ujjYUQPo upPj4j3JQPNej>0@ j< h j^ jv j# j: j'x j# j# j# j-0 j- j_p j|`H joP8 jp@ jr0X jy p jz j{ j| j} ǃ@ !ǃ, +ǃh !ǃ0 ,ǃ !ǃ4 -ǃ !ǃ8 .ǃ %ǃ@ 0ǃ %ǃ `ǃ %ǃ aǃx ǃ fǃ ǃ gǃ %ǃ hǃ &ǃ$ iǃ %ǃ( jǃ@ %ǃ, kǃh %ǃ0 lǃ %ǃ4 mǃ <%ǃ8 nǃ0 %ǃD qǃ #ǃ< oǃ #ǃL sǃ %ǃP tǃ $%ǃT uǃ 4%ǃX vǃ ,%ǃ\ wǃH %ǃ` xǃ8 ǃx ~ǃ #ǃ@ pǃX #ǃH rǃp d"ǃd yǃ e"ǃh zǃ ǃl {ǃ `"ǃp |ǃ ǃt }2NthtBt'zxÈ Â ϋtuQjPVp 꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVX# l$+4+ع x( PPu^_[]fffffffX"L$fǀ ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[n"t$0[ÐUSWV@[8"|$TED$G8$u!O9OuO9Ou 9u_uWEt W|$XE3t:d10{Eǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3d/1j ‰PD$<x-.D$8|$AG $tJt PwW W~"G @t;n 8u1E3t%d10uEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u*E2$t L$Xu$ L$Xt$AsiSV[0t$t$V tt$Vj^[ÐSV[Ít$ t$t$V tt$V^[ÐUSWVL$[D|$0D$(T$ 2D$ED$4D$D$ f@LtW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃ ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4 ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃ D$4Pjjjk 4449)4L$ 4QWPt$%4;4}2Dž4t(D$4PVt$ t$ 1|$0f 4)Ɖ4fǃ ff9t |$ u |$ t)Q)Rk* t$VUF @f|$tg&D$@ 4444H44L$ 4QjPt$e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4f f1jD$` `4rփփ19‰4 4f fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f f1Pjj!QY' joS[t$j[ffS[0t$ [ÐUSWV$[ø|$u!G2t P:Q2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍ RPQUY|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(ĜPP5 tjjP ,GT͜P&5 tjjPu GX!2@@xGX GXO <W$d OT h2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$VV P蒦D$$<$$u$P" HuǐuU#V PD$$鐐<$$u$}P" Huǐul$Ut$V V$U$|$~"14W;>|BV9^_[ÐUSWV[å fǃ hyu$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$XLj T<TV$2@TL4tVO =wlj<$hVt$ VA VdO 1rNj2Z1퐐T,jj L,LNp9u^_[]ÍFPjA~S[ 0[ÐUSWV [ |$ EG8$u%O9OuO9Ou9$uxWo/t W蒋`8tUEHAIL$WW9uOO 9L$u-O OQRt$ PGGMIAG GAE3t4d10xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R*G4$=u8 $A @11 $<x=D$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a U"X 8uE3 $tԋd10vL$Eǀ3뤐SV[í0t$t$V t V^[ÐSV[mt$ t$t$Vp t Vr^[ÐSWVP[+$t&T$t$2PWj $^_[ÐUSWVP[1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[ T$9D$PI 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[%1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[ØD$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9  f$t|$u!|$t'QL$ )RWŃuRG @tGS 8u=D$3t.d10yrD$ǀ3G @|$tmG  f Hȃ  fftVW=Vt Hȃ 9 Hȃ f9ufǃ f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f D$DhhA Qʃʃ19 f ^_[]ýG @tBrQ 8u8t$3t)d10 pǀ3g 룸hPjj Q# j9tSWV[|$WדƃuOG @tDP 8u:3t)d10boǀ3^_[ÐUSWV[[tt$339}3AP3t' 333343;33PQRP 33t331^_[]ÐUSWV[Ëtt$339}3AP3t' 333343;33PQRP 33t331^_[]ÐSP[ý$tT$ 2Pjj $[ÐXo tT$QT1øUSWV[6TAx43fTFT$P輜j 趑+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhh$to DHDHDHDH uǀD$ FF^_[]øPjjF,ݜPjjQ joPnjoffffS[n0[ÐUSWV[H|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQ<uF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|t1fF9vʋGPt$wW&"W1^_[]ÐSV[0t$t$V t VN^[ÐSV[Ít$ t$t$V t V^[ffSWV([I0Wt$<3WV0^_[ÐSWV([ t$8Wt$@2WVt0^_[ÐSWV([0t$[ÐX3ÐS[0z1[ÐS[13t)PtЁ3QP [ÐS[~13t+PtЁ3QjP [ÐX/3u1Ês3ÐX3u1Êu3ÐX3tD$s31ÐX3t L$u31ÐX_L$31fffffffSWV [)D$ D$D$$ t$VWj9 XD$D$D$ $jWj9 jj:jVj9,^_[ÐUSWV[È13PtЁ3QP\  u jC+ ƃ  ~:Pjj- $; u jPja- 1 }t&jEHjjQpp@|t4QjP@ Et"@:t@4Qj8 @4Uj @UjX pHjjjpłǀ3Qt43PjQc| ^_[]ÐUSWV[è3 uPj)  ƃ  uRD$D$D$ D$D$D$ L$PQj+ ǃ @HtȍL$Qhht@P^ tBL$t9D$t0d9 t ǁ39tǀ3d(8$9hu9xt WUPwK 9hu9xt WUPZK Qt43PQ? It3PjWz $6@$0d^_[]ÐS[þ uPj'  ƃ [ÐS[~ u j}' ƃ [ÐSV[J@HtȉQhht@P t!$tL$td Hwtǀ3^[t$ЃS[ë uO$D$D$D$ D$D$ PQj( ǃ [ÐS[; ~:Pjj( $; u jPjx( 1 [ÐS[3t[ËPtЁ3QP[S[ÎQt3PjQw [ÐS[>Qt43PQ*[ÐS[^[ffffffSV[|$ ta@|$t|u7x1t-4QjPM 3p1^[þfffffffUSWV[KT$2tt6usRRt1u8]RuARt'24PjRz p^_[]ÐSV[Ý2tt6uq IIt1҅u8[ Iu? It%24PjQ p8^[fUSWVP[t$tF8 t V_F8@u^_[]ÐvtF$~N,19$t؋~^(,ME9~߃E 98}։8ҐUSWVPD$@tGH $~P,194$t؋xX(,MM9~߃M 99}։9҃^_[]ÐD$tL$9H}1Ë@,$ðÐUSWV|$tfT$x[L$q)~P|$xH9|~<֋D$@,9}*L$yY(,MM9~߃M 99}Ӊ91^_[]ÐUSWVPL$T$q)|$ 9|։4$ ';$}o|$$u.yY(A,,ME9~u 9}ˉǐY(A,t3tt$P[ø[ÐS[t3tt$ t$ P? [ø[ÐS[þt3tt$Pc[ø[ÐS[~t3tt$ t$ P [ø[ÐS[>t3tt$P[ø[ÐS[t&3tL$ t$Qt$P&[ø[ÐSV[í0t\Ɔ43t)2Fpt9PVPV袾(3tP蝊3V^[ÐS[.t3tL$jQP [ø[ÐX1t T$~93|4 RDÐS[ît3t PgV[ø[ÐS[nD$t3t P+V[ø[ÐS[.t3tPUt^[ø[ÐUSWV[0Ɔ43t)2FttrPVVPVܼa3tR3~>11;3}:tt3PT^_[]ÐS[.T$t$t$ [ÐUSWV[93|$0t$,T$ $up`MDH@utl$4D$ UW 鐐t$ D$PL$ QD$ P<x)t$舋tL$9D$)<9u AT$)RUt( $4T$4R7D$0D71^_[]ÐS[þt3t P[ø[ÐUSWV[x8D$ $4VjPjVtSʼnt$UeƅtMD$ $t$UD$PVtT$t$$V VFu^_[]ÐUSWV[û|$3t P 3~/11퐐440t0;3|4t3ǃwwLJ3j0jm4tW2Ht<@xX3~3\'PL72@HX3@$4Ƈ31^_[]ÐUSWV[Ût$3t P3~/11퐐448s0;3|4s^_[]ÐUSWVXt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$WQ 1Ґ$t$V|$(WD$0P-t$$耆ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V^ $4D$)Džu |$ $tR1VT$ z 4$)tWj V T$L$ (^_[]ÐUSWV`[14t `΋43t42NzRЃPWVrPVhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<WI PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DPy;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$PD$T$3;4}D$PRjQD$PRjQNj$D(P貃D$$L$ ;47&ffffUSWV[|$$D$hjjUp t)ƃ|$t:L$tVD$ tNt*T$D19tL$  11fVUl$ U* D^_[]USWV[k|$$2t$XƋl$r:D$0肂D$4auX9uE$E EEEEE EEEuDE$E EEEEE EED$%ED9tL$ ft M}Wt$UC 1^_[]ÐWVY D$T$ t$w4  p@^_fffSWV[ìt$V~~tyы9uv0jv,j9p9p 9pt P jVj1^_[v4zj9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PiffffVXNt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[þ|$ uT${[ø[ÐS[Î|$uT$ L$O[ø[ÐS[^|$ uT$[ø[ÐS[.|$uT$ L$[ø[ÐSWV[|$u<t$D$9% ƉM1^_[øSWV[Ü|$u8t$D$|$% Ɖ81^_[øVX>t9|$ u2AX2#Q@Q@p1~8tt$ Q@^ÐVL$t9|$u2AX2#Q@Q@p1~8tt$  Q@^ÐS[ÎT$R[S[nL$T$ 6[ÐS[NT$[S[.L$T$ [ÐSWV[ t$8tCGX2@TtgAWW@x8tg@1^_[ÐSWV[Ìt$|$tCGX2@TtgAWFW=@x8tg@ 1^_[ÐUSWV[΋AX2GTt tNA t tNA t tNA@t tNA@fy tNAt tNAt tN@t 4tN@ t tN@ @t tN@@t tN@t @tN@t(tt Vdt"G8tt V1t$׋NX2#N@N@Rz8t N@^_[]øSWV[l΋AX2@Tt{ @f @tf@t Vt V1t Iy8tf@^_[ÀfA =fA9fA@5fAf1fA-fA)f@%f@ !f@@f@f@RD$t@@øÐXHTtG1 u<uA uFuKuP(uUa1(uHT t  t @t t (tt 8tt tLt ÐXHT1  4@(1( S  N @I D ?4<9 6@3@0(tt 8tt tLt ffSWV[üt$8VPVW ^_[ÐSWV[|L$|$t$x"1t%<t9u W)PWVN ^_[ÐSWV[t$|$WPWV ^_[ÐSWV[L$|$0x1t!<t9u WPWV ^_[ÐSWV[Ì0t$t$V苑 t|$WIPWVn ^_[SWV[<t$t$t$V? t(L$ |$x#1t&<t9uWPWV ^_[SWV[̹t$t$t$Vϐ t|$WPWV ^_[ÐSWV[|0t$t$V{ t$L$|$x1t"<t9uWPWV7 ^_[USWV[$AL$I,D$$|$@1 $D$HL$D$ $[UT$1 |$@T$ D$D$jD$Pt$t$D$$Pt$$)~"D$@PVUD$PnxNjT$u$^_[]$USWV[$$AI,D$$|$<1 $$HL$ D$$hUT$1 |$<T$D$$D$$D$Pt$t$D$ P$$)~"D$$PlL|$Ll$Pt$VD$XL$D$ D$|$LG@D$GXpX);OTu%G8 uD$P .G9|ƅp|$Wt$P薸ouAt$L;NTxF8 |$P#$VV _P ktUl$PE|$Lt$L$X L$T;GTG8 $Wr D$TDl$Py T$T$L$XD$\pt81$j DL$\LT$J HB 9uЋM t$LF(T$XQ;}I ;T$T$~D$XPP2VD$Xt$$щy194T$l$ 9ŋ|$L~cl$ D$TO,WDx77fD7Pu|fD$ EHD7ELfD7D$XT$щy1뎋l$PʋM G(T$ЋI;}t$$D$\pixL$ GL$X+9D$ ~D$T;GTuZG8 uHEL$X)VD$T|$PD$X $WJ M D$XG(Ћq;}D$XG9}Tދ$GDVw|Re[GHFGLfFfFD$XG9|MW(‹I ;~G$Pt$ t$\6WD$X;GTtO,pED$O(T$X @;}F t$PmeF L$\Af W@ %uыWH ȅtL$ ‰VfND$\@D$rGD$11$j@#L$\L pE 9|$uӋD$HD$X|$ |hD$ p}$$@D$\@GE!ȉGGfGFfD$X~GtPSdG맋|$LG9El$ l$9}dG,L$T 4p$f~y9GDfFVw|cGHFGLfF;o|G(L$P I ;~$Ut$ D$\0WL$T ;OTl$Pu3G8 $88u D$XW1GO(UR ; ~ G$Pt$ t$\6WD$X;GTtO,EOW(у@ $W18^_[]ÃO, MO,L$X 4pUSWV[e$F$$$$AQ11ɉFXhXș)Չl$$;FTu0F8 u*$1D$F9|ȉD$|$FD$FD$1|$HL$ D$FN,D$1 $l$ ^UT$1 |$HT$(D$$D$ jD$$Pt$t$$D$,P$$)~"D$HPVUD$P_xNjT$u<$D$;D$$|$H.V $͋tp $E;FTu;F8 HV`$E$σEN,1 $n@ƉׁuQHb$H($$P; } $P ; ~ $$xD$ t$H$ u$$fd $xHt |$$B9u$R1^_[]øfffffffYt0 I8t u tHAøÐYD$t0 I8t u tHAøÐXO tPtaAøÐXL$tPtaAøffffXϦt1HX2I(t u tHAøÐD$t1HX2I(t u tHAøÐX?t @@øÐD$t @@øffS[jt$ [ÐUSWV[ȥ|$tyG8 tsl$ 1tiWD$W$jwPW| UW4$t$W| 98uj z88uG^_[]ÐS[t$02[ÐVXtT$xt$ 9q~ 9~QPqT1^ÐVL$tT$ xt$9q~ 9~QPqT1^ÐVX~tL$ T$pP2@T1^ø^ÐVD$tL$T$ pP2@T1^ø^ÐXHt t1ÐXߣHt t1ÐS[ît$0[ÐUSWVZx|$(QL$,CDD$8t98t #GHD$ɉT$}_;_P| wT9w)9|ʃ$)9݉t$ }h$؉щT$9\$t$ 9GPjVWF;wxًo;oP| GT9#G9G\$Prqw _9ZG,T" !uW,LЋO\$t$ l$U9ʼnT$5~11$G,ODT$x7 7L$L7L7fL7\$Pu|XHfD7$M9ȉ|G\$t$ l)ڃ9unD$)9|ȋL$‰D$ )ȉ $9}WD$ 4\$!WRqp; ;,$}%W, 2 !uȉ O,Ӄ|$ G\$$щ$;T$}i~11G,OD$@( (L$L(L(fL(fD(Rw|VtG9|델Kwl$9\$}!GPjVW`9uGt PW1^_[]fUSWVL$09AD$)‰T$ 9S~CD$A,$K(\${,1T$t_D$D$ȋL$ $4L$,1\ [ˋZTJTJ9t$uΉD$L$0\$YD$+D$$PP/^_[]fffL$t QtA+BÐL$t QtA +B ÐD$t@øÐD$t@øÐD$t@øÐD$t@ øÐD$t@øÐD$t@øfffffffS[0[ÐUSWV[ȝ|$$98t#GHD$D$GDD$ oW,4u,$W/19E|$$GGt1҉$G9}^N4T$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZ^L$1~t$ ~9J$u9r ^ÐUSWV[D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77>1^_[]ÐUSWVP[Út$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux lQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p d912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [8t$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV$1 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[ݍT$L$ Aq D$t$jVPt$ ^[ÐUSWVX$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQDE;~} K(t$몉SV[ýT$L$ Aq D$t$jVPt$ ^[ÐUSWV[{l$1t>19)Rju uuu0tPU^_[]ÐUSWV$[t$D1Sl$HGL$G:uo~G,D$ 1fу9~ƋD$ 4t',$E,D$G+E݋\$t$C,W+S&륿\^_[]ÐUSWV Y8w|$4t}\$\$4$Pjt$8T\$ D$ L$H HD$8;Hϋ@,L$4p8 F4 fFV@ !k4 D fND 49D$8;H|%T$t$t$ǃD$8;h}pD$$p|$ OoL$AD$$jG, 9;t$u 9l$ut'9L$D $jUt$t$V$T$ BL$$ ABAc9dOfɺL$Nff|#udt$T$։D$,)jVD$ PRPfL$D7$|$T$t$WL$΋D$)jPWVW#t$_D$@f|$0ut$It$t$,Qp4QjP-ɋ$Rd4PjQQ f~$~gD$@u]D$$t$Fh2u&D9u%$PD$<0l;\$6>v t6>vuD$@tt$ t$tNFy$j=D$@$ $4jQ Btdt4$PjQP D$@|D$<@1fl$<΃9T$$u뎐l$;|$ ,0t$l$,L$HT$4;|$  E;l$0ŋt$ T$4D$D$(l$@}D$D$(@L$|$ t$9T$9|$D|$T$ЋL$ 9ȉD$ D$ AD9H H H $Pq|\$I\ BfBD$ ALfBt9zAD$Rq|<\$uD$DWD$D$(T$D$(x;H uL D$PD$1r.1H $Ph V\$ ǀw H $PQRX\$ D$@H L$PL D$ D$T$)։t$L‹t$ )T$()l$,7|$LD$ pPD$)ŋD$@H0t$T$l$ xpuHt2t)|$ "T$t$>l$ ;WT$~Hqt$t$$Qf 4UjPG jjjWVdt$@UjppG jjt$jj9@t$ QIfUjP}G t$D$(T$L|$ )T$t$T$L։t$TI,T$DD$D4|$0|$4|$D|$(D$ <D$H49;|$;t$D$ @,\$ D$hx6ƋG 鍄H $h QPg\$ ŀ=rv4l$GH $h WP E$h Wl$ P\$ w荋H $PQw迏 D$PGD$H$Qjt$HVP訂\$l$,KD$@, /D$H$QjVPf\$L$09΋t$HuD$ @,tϋD$T$49ЉL$0D$4D$ H,et1L$|$ t-L$ $jjQRVt$@$U4b $4$QjP'D\$ D$l$ )jjD$Pjt$0HUPbl$xpuHt2t)|$ "T$t$>l$ ;WT$Lt$|$$WQ"b 4UjPPC jjjWVt$@Ujpp)C jjt$(jj@6D$ PQaUjPB |$YED$4D$<(jjWRVMD$@ɉ|$0tT$t$9rtK؋$PQ8a4QjPfB |$jjl$(Ujt$@HtlL$ QP`l$*L$l$t$$4WjPA D$l$|$ l$ t$L$$4VjPA |$4ll$l$,|$$@VjdA ul$ t$-?$jjt$(RV$4t$@$Wj A\$ ul$,ŋt$$@Wj@ ul$t$UjH@ |$ t$|$,t!|$@UjH@ u@L$ IQjp0%_ UjPY@ jjjjt$ |$$4$VjQ @\$ |$4l$l$,@$Vj?\$ ujL$ ɋ|$t$y8UjL? D$ t!t$,@UjL? u@L$ IQjp0%^ UjPY? jjjjt$0@@p1t$4QjP%? L$$jQVjU\$bHD$ $jjt$RVh$4t$@$WjH>\$ uL$L$ T$9Q|$4$VjP_>\$ |$4l$l$,@$VjL->\$ ut$˝ĝPQhtRd$lUSWV [UD$41\$t$LL$H\$DT$@|$ PQJ t*NjD$9 t#WD$~ 1ɋ$4PjW+ ^_[]Ë0D$4L$ d;> MIIlttt$ jQh+ j D$uǃ USWV$T$ [tB D$PBpL$ t$tIT$$d t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$lPjt$) ǃ ǃ 11ҋdD$8 tlj)D$8>$0D$8 $<t$u; } t$Ћl$)$t$@@9 9<$lPjQ0) @x H$L$T$ t$dՉL$)4/L$T$ 9~L$T$ <$lPjt$( ǃ D$ ; ;T$ 9<$ to j P:x) @ltlQjP%( F t3 j P9x) j |j m  ǃ 1;  $ll$*ǃ ;  @@ltWjPV' yA t`j t$8x )ȉ }u D$8o@@lU8 LQj `u ;  l"UjP& ; ~U   @@xuă tjW8x) j띍l ; ~- @Uj% yxD$8 )ȃ,$D$ D$4$jP% D$(19 ș)Љփ< 9D$@u t!j t$6x) j t D$@, @D` D$,$.  -; !D$P, t$j<L|$ tv ufL$L!;H@L$uSDuLf~54t t L$ fu-@t!,$UjP#  t0j t$j5x )ȉ j ǃ tD$ D$ $^_[])ȃ|,9t$,$,@tUjP# <,$ t!j t$4x) j f ; ~nUjP" ;  @@xu̓ t!jt$94x) j룉PS[Î9D$ t# PQ3x) P1[fffX?9Hy8~DyD~>Hlt htðuu냹tt u1ÐX8@ xÐUSWV [è8AP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t4PjR MAҾt.4PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21ClD$L$ /jt$ZD$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVP[3L$9 ft$9|$ 9l2uCUw$-4$t$skbQw4Q|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVX22lT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVY0|$xv9{`|iT$t$p"fr"f1l2u@>_w-s ybQf>2~w-s qbQf ^_[]ÐUSWV[0L$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 74QjP8 1^_[]ÐSWVZ\/L$x?9J\~2D$t$|$ Irftf>vf1^_[S[.ǃǃ9t% DŽp"DŽt" t 1[ÐUSWV[{.T$L$l2uI~w-ssbQw!LQff ffffǃ>t* f0p"f0r"DŽ0t" t 1^_[]ÐX-h2ÐUSWVP[j-t$ t@@1EHd9l2p"fx fr"yVRt6$4PjR{ , $!A@Ep"f@dfx0ɋ2@Ql34QjP* Er"Zfp"fx fr"yVRt6$4PjR , $!A@Ep"f@dfx0ɋ2@QC34QjPq Er"]fx*ҋ2@R434QjP2 Efxd#H@ H@^_[]ÐSWV[<+l2tu6@t!|$4QjP ,!G@f@d^_[ÐX*f@dffSWV[ì*D$ yOQW~ ;O~ t Q WPW?^_[ÐSWV[<*|$D$OQW~ ;O~ t Q WP舨W?^_[ÐSWV[)xWt$1W>^_[ÐSWV[Ü)|$Wt$W>^_[fffffffUSWVX[)tLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j xL$h( $ș)l$T$ $L$$$D$wcx)ʋ=T$P;xl$tD$  dl$lыUE)Ѓ9~t$7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$HQD$g1fT$t$j .xŋh0L$ș)L$4$T$ l$lt$mD$$Յ $$vx;l$tl$l)"Px‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ k(T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ KQЙ~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ KQЙ~ ƃQWT$H ^_[]ÐSWV[ü|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[>  jt$t$t$P1[ÐSV[  jVjt$PJ1^[fSWVP[û|$t t9t QD$PXL$QjPW!L$N|$kK)l$kK) `a;`ai)RPU\t;y t0q$t~fuUv\u1 q R^_[]ÐUSWV[D$$L$t@1D$D$>D$PWL$QjPWL$kL|$kC)l$kC) a;ai? )TPU[t7q tAy$t+nuUwi[u A Ty^_[]USWV[D$(L$1҄t@1D$D$8>D$D$PnVL$QjPVl$-?L|$ ) i)ʼn) i)ka{alj*SiŠ)ǍUPD$PdZt1D$HU<tzp t:h$D$t}suPu ZD$uދ} مt3l$,t+Et$WPuVQUEЃ^_[]ÐS[>t$ t$t$ [ÐUSWVH[t$\TlD$PԤND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$USL$QjPUYL$ȿNt$kK)kK) `a3`ai)RPUW$D$$RED$j=UhtƉH$$D$<$|$WRL$QjPW[L$Ƚ-?Lt$) i)) i)KasaƉ*SiŠ)ƍUPWVD$5tcL$f <$|$W/RL$QjPWL$ȽkLt$kC)kC) a3ai? )TPWBVtD$EUE!D$ TD $$D$PUURPUUPUUPUUPU}Ut PUiUtr PUUUtePUAUtXPU-Uu^O1<5.' D$UBPNj$tP0P 1L$;D$v==wL$L$Qt$۪L$uD$ 9D$ tf, UQC~,$t'UW0~|$BU4+1t$ 1 t]|$uf, FM $QP}4$.O  $LD=uVQ}VO $4D$ H^_[]1|$t4$]1USWV[ h賞WT$L$ $L$`1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃGQM=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$蜪?V 1Pʋ$H $$$H $<<$Rt$W /$//$H $>$D$^_[]ÐUSWV]Ũ2~:^^t@\|,$n*^ÍxЃs.ÉD$$`D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%`Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[ 1l$E<%uEpuEπ r?Sуstlu~;|$~,|$tS릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[ML$ T$D$$Pj [ÐUSWVX$1h ։ͅu4$ u'$h͖ 5 @0t$E4}0u"$h蕖E, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$Qσstlu7D$ ~ ~$QDŽ또fЉ9N1ҍ$1$$u>D$$hjP5 l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,oE,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $hȉىӉl$ |$uGD$1l$뀋$`DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $|i$t"A$|t+H$D+$N1$uՋ$N1ڃV$j!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,ҜRE,}0M4T$$V$0PRQv1$E4$M1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$P@P=D$π$O6\`D$TDl$H$th$V{?9r‹E0M4ʃ9‰\$WE,y$H$|T$`t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$DJ1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$I1L$ ʀŸw Dʀ¿~4r$fI1ۋu0M4A9s E,u,߃$Vu,rE,u0M4tڍqu4 $I1$P$H$H1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,ΖtRE,}0M4$V$0Pt$QpE4E,M4},$G1^_[]ÐSP[}T$ D$$1Pj= [ÐS[Nt$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[ T$ D$$1Pj [ffffXL$ ÐUSWV[ø|$(t$ l$u}:Pƅ>l$$ujhjL$tfjVP NjD$uj(P/D$@ x |$(uΞVqE\1F4@9Pk1D$tGuP|$(ox |$(tF|$(mV|$(Phht@U( t$t$tL$t RB(J tR1PtjjPH IA(p1\$91\$-4$7K\$qP5D$PD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$2 ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q ^_[]USWV[XD$t uyp}|$ 1퐐/t <,tQL$%$Put2ƃ$UWP 4$t$P 11^_[]ÐUSWV[Û|$ t$FN,9vtU6JuCu;UGut.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[|$ l$PWJ)uLt}D$x@ȃǃtVot$ U))Lstƃntfuă뿐1ɋT$z Hf0D$8l$|$ u)1|$WuPt$D/W#prWuPt$D1TL$4xT$$s$tntfuσ1} t WPV l$ E|$f>t WPV }t0EfEfF}WuV f},t&E(fE,fF}(Wu V_ f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[|$ t$FN,9vtU6zxu]uUUwmtHnNT$l$f,Ninf|FFWRPg  ~F 1^_[]ÐSWV[t$FNy9vtW6wuCu;Wlt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[Øl$D`EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1bGj|ULD$tL$j|Ut L$U=r6UPt$P 10^_[]ËD$tPrL$ =rП"D$t+PNL$=rQUPt$T^jjPttt$ $@ 1D5t <,tFPjD$4 VUP  D5$(L$tSD$HtJ11t <,tFPj Vt$P  D5$h|$t+D$Ht"t$ $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0m$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p Ym$D$t$HjjjPjfWjQKVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[J|$ $ ftGt D1DWG(f hwUs =wb, Ƅ |)ƋtVPU? 9vD|ŃƋGtVPU 9s D|ŃE$^_[]ÐSV[Mt$ tavhvhvhv hv${hv,phVgh19 uǃ ^[ÐX @ÐY @upUSWV[Å$(E$$4D$$0j:Wyt4rjQP  t0V$0W NjE;$^_[]Ã0u 1tM8ut6@u$tHx,f$O:t @t@uS4$l$w$D$j@UP <:t$EF<:uEl$4$D$D$OtuP90P8耡ǃq4bD$O$$,PQhWZ: t" ǃtM輹jj404)3P4+3PPtƠj/V5t|$uW$jPRQV'WT$*$jPRWUQV跑ӠVPj!SV[t$ j:Vt4rjQPm tt$V?1^[ÐVYT$փ1ut^10^USWVH[Xt$dl$`L$\D$Dȃ=u0<$yL$VPj@Q7T$tLT 9 $ƅtID$\WU0b ~*)NjD$\u $dVUQB ;L$Dt[a1Kt$\0A2DŽ0DŽT $;D$Du ЃH^_[]迶USWVT[|$pL$ll$hD$P=u0 $t$ uL$WPj@Q6t$t$ T$Ijj D$Wt$ $t$j ^9<$u-;D$PuyL$T^_[]WQU ;L$PtNT0DŽ0DŽ ;D$Pu T^_[]`USWVD[èL$`T$dt$X}|$@uMu 0t9ƀRQt$dPj@WI5 tRQt$dV M;L$@uD^_[]詴SWV[|$=uju 0tVw}tL!0sdDŽ0DŽWA^_[ÐUSWVP[HD$hT$dML$LL$pL$t$lуucu 0tOz=m8@tW=mT$ vPQj@R3x. VPR$ b<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l0  4()uT$ff׺r$σߺfDfu,$tу$$1c E;D$Lu^P^_[]Ët$d0  DŽ0DŽ ,$1,$|S[þD$u&u 0t-[Pv[ÐS[nD$u&u 0tY-[t$ P"[ÐSV[ t$ j:V&t4rjQP tt$Vw-^[ÐSWV[ì|$t$j:Vt4rjQP( tWhVe  WhV ^_[SP[MD$ L$ $L$ƒu&u 0t--Qt$Pu  [ÐS[޷D$uu 0t1[PT[ÐSV[Ít$ j:Vt4rjQP  tt$Vvb-^[ÐUSWV׉[$Rjj %D$UWt$l t$j 19tG4$0  DŽ0DŽ^_[]ÐUSWVL[vD$D$H1,<jU0 u} t @u D<@u^0  DŽ0DŽD$;D$HL^_[]Íl$ E< us{UC8|$jW01 u|$ u}Fu0+  DŽ0DŽIu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:x# D$t$DRL$Dx# A @`? 19<$|# D$D@ @`ƒ?91{# D$D@ @`Ń?+9z# D$D@ D$@|$`D$?;|$  ՋL$y#  <$‹D$Dp}# D$L$ D1 <@4$T$<`Ń?|$_u+19QL$ T$D $L @`ʃ?|$_u19 l$ D$L(D$<_D$$D @`Ń?+19 ՋL$ T$D |$_$D @`ƒ?9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t;D$(Q,^_[]É<$t$D$# VRPQT$T$L$ t$ ?3|$D/? D/ ?D/D$/T$T$L$ t$ ?3D/? D/ ?D/D$D/D$L$ < L/ ?L/ D/D/ x# <$<$bUSWV[å$D$$  ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# ȣ34t2tkƷ< sԃ1@tt# tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ɣ|$| t!qtAD>1tBD>׹@# ȣD,|t.tkŷ< s݃1@tt# tр‍ x 1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ɣ|$| t!qtAD>1tBD>׸@# ȣD|$t=2t$Fi%I<<fw1@tt# tlj瀍 ;x 1ttD~t#  fAB? w~4AB? w~4AB? w~4AB? w~4AB? w~4A? wʼn41 @tt# tlj瀍 ;x 1ttD~t$Q?$A# ?$B# $u1 @tt# tlj瀍 ;x 1ttD~t⍃# 0pQPQPQu# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فр3ʉрUɀʈǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ΀# D$# D$x# D$t# D$p# D$l#  ʋD$h# ыD$d# D$`# D$\#  D$X# D$T# D$P# D$L#  D$H# D$D# D$@# ʋD$<# D$8# D$4#  D$0# D$,# D$(# ΋D$$# D$ # D$#  ω D$# ɋD$# ? ? ։? T$ځx $T$ 1# u# E# Qu# ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  x | J΃  x | J΃  x | J΃  x | J΃  x | J΃  x | J΃  x | J΃  x | ݅ 4$l$T$ L$ Ń4x x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]USWV(]XD$<X%UUUUʁUUUՍ4P᪪x | x   x x | x   x x | x   x x | UUUU $؃x | x   x x | x   x x | x   x x | T$H l$ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $yp $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3x 3x 3x 3x 3<$t$3~3x 3x 3x 3x 3x 3x 3x 3x 3x 3x 3x 3x 1#t$t$D$|$811t$3=x $3=x $3=x $3=x $3=x t$$3=x $$1L$t$|$l$3l>l$|$l$ 3x 3x D$35x 35x 35x 35x 3x 3x 3x 3x D$t$D$D$$7֋T$ Bl$l$l$$xl$ x | $x   x x | $x   x x | $x   x =x =| $x   x x | ȃx   x x | x   x x! |! x ! ! x 5x" 5|" x " " D$@P1(^_[]ÐS[ëD$1ɐȊt tT Tt t t4 uP1[ÐSV[*D$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[ MD$$D$DD$@D$9\$6D$L$T$@jjPQjRvOqD$HPj zZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVW6tD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP#$jP#D$0Pje\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]跉USWVd[$|D$<$`# hjD$@PiQ DŽ$@D$V$@8$u H$@D$ԡ$@UV|$ljD$PMt;uH WPWPuD$WP}D$UV $ljD$jPW D$,u:|$$@PW#x$@L$,UV#D$l$03t$\$UV#D$ D$D$ D$$$@&D$ \$UV@#tt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWb"D$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V11$xUv$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-[PQRs_h$DUt$@V* j jWL hjUL hj$PL D$@hjPrL D$<;$`u`d^_[]D$RWD$tMT$@PQhRml$ $fffffSV[=D$ h`rƉP' )Ɖ^[ÐUSWV[l$0ojD$PU thh`) $)D$j PU $l$1}$K1D=t<$t h`tt$,Mōv & 4$t$L$QWPjbV4% L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃t$ Wt$t$Pjbt$(V & % %  % jQPR ;& % %  % jQP ;& % %  & jQP ;& & &  & jQP ;& & &  & jQP ; & & &   & jQPS ;$&  &  &  % jQP  Ƅ;(& jjt$H ^_[]fffffUSWVD[(|$\w 12t$`tD$@jPVT NjD$@9t8tD^_[]8"u trD$ D$ D$D$D$<D$8wD$X$2a$WQjPI0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ C~*4$PWU: F~|DŽ$DŽ$DŽ$DŽ$<$t1$!j$Ua: v ƨtjWƃ' $fǃ ' $1 ' D$' Pt$Q ԡjxPl$U$j VWZB1ҍl$?4$$U9 UV&BT$iȓ$T$) L$i<@UE9D$uj$P4$$U@9 +t$D$fǍl$tt$t$U9D$ fƍ$t4$$U8D$  jVD$' ' $$ $ jQP ' ' $$ $ jQPk ' ' $$ $ jQP. ' ' $$ $ jQP ' ' $$ $ jQP ' ' $jQP ' H' @jjVa0 D$;$uD$^_[];hfffffUSWV[up$ $$D$$AO$WLPVUWP W$$l$ U\QD$\6666D$`6666D$d6666D$h6666D$l6666D$p6666D$t6666D$x6666D$|6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$|6666D$x6666D$t6666D$p6666D$l6666D$h6666D$d6666D$`6666D$\6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\t{E6L$\4\D$tdF$tB$ڹD 0D \0D D 0D ]0D  u$t D 0D \0D $ViMD$\j@PVM $$VM VWhNV/MD$j@PV_M jWVSM VW9ND$;$u ^_[]wdfffUSWVP[úl|$l$t.jPU Ƌ$9t8t"袻1^_[]耻8"u t7ސUSWVPX:lL$ |$t$Q̓t2$1ې?9u)ދ$r`??V ?V?V^_[]ÐUSWVPXjkL$ |$t$Q̓t2$1ې?֡9u)ދ$r`?֡?֡V ?֡V?֡V^_[]fVYjT$ t$tt1ut ^Åt'^Åt^Í^Í^Í ^ÐUSWV,[(jt$@VcL$DV,~09rЍ,1V8T$$V(T$l$ D$D$|$F4D$L$ 9v|$VWuW$u WVf 1,^_[]ÐUSWVH[Xil$|BU'ƋD$h4$l$D$D$lD$ D$pD$D$tD$D$\D$D$D$ D$$D$(D$`D$,D$dD$0D$4$D$<D$@D$DD$8$PctUV |~D$xt UVP臛 $tL$tA$D$PW$5t!UV W$  UV 1Vq H^_[]ÐS[gjjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$8@4[ÐS[Îgjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐS[>gjjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[fjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$8R4[ÐS[Þfjjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[Nfjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[el$hU˨ƉD$ D$PljD$VD$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$\D$ tKWV(tD(1t$t$ UT^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[8dt$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[^cjt$t$t$@[ÐS[.cjt$t$t$[ÐS[bjt$t$t$[ÐS[bjt$ [ÐS[îbjt$ h[ÐS[Îbjt$ H[ÐUSWV[hbt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Èat$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[è`t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐX_L$Q##wÍÐUSWV [Ø_|$(l$$t$ D$4aD$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[^D$ hPt$谑 [ÐS[^ht$t$ё [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[=^D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[X2D$pML$LjPt$lv D$h|$df$D$VtL$)L$D$PVWdD$ |$$v=D$,t$.D$lp8L$ QjjV*Vqt|$)cƃPD$2PL$Qxd ? $ $$m=|$D$lp,t$ jjt$>V辔Vt|$)Ƌ $PD$2PL$Q d  $ $,t=D$D$lp(t$ jjt$>VOVs|$)Ƌ $PD$2PL$Qc rg $ $,p=D$D$lp0t$ jjt$>VV+s|$)v#Ƌ $PD$2PL$Q5c sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7#L$R)уtuÐWVt$  r!̐cw^_fffffSWV[ü+t$|$G@hjPT^ Էj@PW^ g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[Õ)$$N$@r8hUtE\EXETEP$t$tAsE@hjP[ Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV'[ h$$V[hVU< hV1;$u Ą^_[]USWV ['l$(16t$ %T$$NP NT  ()`N`L$$WRPZ ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWPY 1 ^_[]ÐUSWV_~&$hRP~Y RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$PL$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ WK hj$P|K g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQEJ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PVI D$hWD$$hPD$;$xu D$e^_[] ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[è|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[ D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]Ũ$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$$FQ? T$‰ً$|$D$G<uD$ $; $ou T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4X8L$ |$ )t$)t$$t$,)wD$ L$?? n{ T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4EBT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N 0FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q2 l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj T&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?ፅƻGPGX GTG\GG?$L$u aD?hFQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  FL$Q? FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$b$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v'txD$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$F~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=oզ$FL$Q?P$'$NL$Q?D$T$ ߋ t$զ$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $%USWV[fiE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP )t]D$)WPu8 }43M(U,E4E09w)RVP E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[\t$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[L$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU F4n0)Pv8U 1tN0^_[]ÐUSWV[[t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[8L$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXED$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@vD$?? u)D$(FL$(bÉ$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+T$D$tq01t ^_Átփ*tUSWV _8L$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[l$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPH )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[ؾ|$$ $w9>~NQǃ8wHl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw  o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw y o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~+ Nl$("xFx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQ F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw  o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQAL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw  o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw m o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq ~ $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq h $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$XȢ$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv  n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv  n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv n n on)n)ouGGD$8xt1$^_[]ÐUSWVX$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu 5 } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu  } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu  } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu " } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XÐUSWV^hL$4t;T$8\$0Ӄs3I͉у1&Ӊi913ƒT$4zR13ƒT$4zR13ƒl$4M1ʉ3xT$  1ϋL$ 3Ã1ؐ\=13\=139uЉЉ̉D$ ,׃}l$D$D$D$11|$ $333.3 $3Q333 $3A333D$ $3A 333|$D$ $3A33Љ3|$|$ $L$l$11D$D$333333W133333G1333ȋT$33W 1‰333\$33_1ˋT$ )333É3ϐÉ13W13W13W13W13W13W1Љ3O13RЃ^_[]ÐS[t$t$t$ [ÐUSWVX$D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX$D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPX*$T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐUSWVPX$T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[^t$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffXoÐUÐXT$J r <ù)ы<ÐS[>D$D$ P[ÐS[t$ o*[ffXL$ d $ x, | 0 8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_[T$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P9L$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVX8D$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$tPP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YroL$ 1 fщ;)t)T$l$L$ 1t\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +l)9~P fHpnh1pXkh (f  fыt$r t$t$ t|$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +,)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVXk\$T$L$o>o4>o>t>tfr t f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[,et$舰ƅt|$7VG  ^_[ÐSV[dt$ 9tt$P覧F1ij 蹳^[ÐUSWV[Èdt$tLƋ|$$l$ $PJD$PWUƖ 1uR(Vu 7(^_[]ÐUSWV[c|$GtE/D(U8]wU"t#V轡=yarau D$0Vc軲1^_[]ÐUSWV[{c|$GtE/D(U\wUz"t#V==tcidu D$0V;1^_[]ÐUSWV[bL$A1t3)D(U6\NjD$pU!t D$8ұ0^_[]ÐUSWV[Ûbl$M1tMuD1V[uV!t(WZ=yarauD$8e W1^_[]ÐUSWV[+bl$M1tMuD1Ve[uV'!t(W=tciduD$8 W苝1^_[]ÐSWV[ùaPt$ t$  t6D$t7<$D8WZt$W tD$ 01{r^_[SWV[9aPt$ t$ 螓 tFD$tP<$D8W`Zt$W! t,V=yarauD$ 01"V聜ٯ^_[ÐSWV[Ù`Pt$ t$  tFD$tP<$D8WYt$Wt,VD=tciduD$ 01"KV9^_[ÐS[_L$T$ jt$t$ [ÐUSWV[_Q%Ƌl$$P苢D$PUW tgVD$tz<$D8WXt$WtH|$$t@V<9t7V6E 438Vu 댅t D$ 01^_[]ÐS[^L$T$ htcidt$t$ [ffSV[Ý^t$t$u_Pz=tciduL$1=tcid^[ÐUSWV[K^t$t$#_P(=loobul$VEloob^_[]ÐSVP[]D$Pt&Pt$t$` D$VrD$1^[ÐSVP[Ü]t$t$Vt$t$` D$V.D$1^[ÐSV[M]t$t$t$!^VP8^[ÐSV[]t$t$t$]VP9^[ÐSV[\t$t$t$]VPg9^[ÐSV[ý\t$t$t$]VP9^[ÐSV[Í\t$t$t$a]VP':^[ÐSV[]\t$t$t$1]VP7:^[ÐSV[-\t$t$t$]VP:^[ÐSV[[t$t$t$\VP:^[ÐSV[[t$t$t$\VPW;^[ÐSV[Ý[t$t$t$q\VP;^[ÐSV[m[t$t$t$A\VP;^[ÐSV[=[t$t$t$\VP<^[ÐSV[ [t$t$t$[VPw<^[ÐSV[Zt$t$t$[VP<^[ÐSV[íZt$t$t$[VP<^[ÐSV[}Zt$t$t$Q[VP<^[ÐSV[MZt$t$t$![VP=^[ÐSV[Zt$t$t$ZVPg=^[ÐSV[Yt$t$t$ZVP=^[ÐSV[ýYt$t$t$ZVP=^[ÐSVP[ÌYD$QP0t&Pt$t$\ D$V D$1^[ÐSVP[,YD$QPp0t&Pt$t$)\ D$V謔D$1^[ÐSVP[XD$QP0t&Pt$t$[ D$VMD$1^[ÐSVP[lXD$QP/t&Pt$t$j[ D$VD$1^[ÐSVP[ Xt$t$T/t&Pt$t$ [ D$V萓D$1^[ÐSVP[ìWD$QP.t&Pt$t$Z D$V-D$1^[ÐSVP[LWD$QP.t&Pt$t$IZ D$V̒D$1^[ÐSVP[VD$QP0.t&Pt$t$Y D$VlD$1^[ÐSVP[ÌVD$QP-t&Pt$t$Y D$V D$1^[ÐSVP[,Vt$t$t-t&Pt$t$-Y D$V谑D$1^[ÐSVP[UD$jP.t&Pt$t$X D$VPD$1^[ÐSVP[lUD$jPd.t&Pt$t$mX D$VD$1^[ÐSVP[ Ujt$.t&Pt$t$X D$V蒐D$1^[ÐSVP[üTjt$-t&Pt$t$W D$VBD$1^[ÐSVP[lTt$t$d-t&Pt$t$mW D$VD$1^[ÐSVP[ Tjt$-t&Pt$t$W D$V蒏D$1^[ÐSVP[üSD$jP,t&Pt$t$V D$V@D$1^[ÐSVP[\SD$jPT,t&Pt$t$]V D$VD$1^[ÐSVP[Rjt$+t&Pt$t$U D$V肎D$1^[ÐSVP[ìRt$t$+t&Pt$t$U D$V0D$1^[ÐSV[MRt$t$%SP*=gntsuVj!t L$1^[ÐSVP[Qt$Ht&Pt$t$U D$V脍D$1^[ÐSVP[ìQt$t&Pt$t$T D$V4D$1^[ÐSWV[\Qt$t$4RP9=atadu,VImt|$L$tVl1^_[ÐSVP[Pt$t$tkt&Pt$t$S D$VpD$1^[ÐSVP[ÌPt$t$jt&Pt$t$S D$VD$1^[ÐUSWV[+Pt$t$QP=gntsu?VŃUt$UPVi t D$8 W71^_[]ÐSV[íOt$t$PP芍=gntsuVt L$1^[ÐSVP[\Ot$t&Pt$t$aR D$VD$1^[ÐSVP[ Ot$xt&Pt$t$R D$V蔊D$1^[fUSWV[ûNt$t${P蘌=loobul$VrtEloob^_[]ÐSVP[\ND$Pst&Pt$t${ D$VD$1^[ÐSVP[ Nt$t$Vt$t${{ D$V螉D$1^[ÐSVP[üMD$Prt"Pt$|D$VFD$1^[ÐSVP[lMt$t Vt$|D$VD$1^[ÐSV[-Mt$t$t$!zVP(^[ÐSV[Lt$t$t$yVP(^[ÐSV[Lt$t$t$yVPG)^[ÐSV[ÝLt$t$t$yVP)^[ÐSV[mLt$t$t$ayVP*^[ÐSV[=Lt$t$t$1yVP*^[ÐSV[ Lt$t$t$yVPw*^[ÐSV[Kt$t$t$xVP*^[ÐSV[íKt$t$t$xVP7+^[ÐSV[}Kt$t$t$qxVP+^[ÐSV[MKt$t$t$AxVP+^[ÐSV[Kt$t$t$xVP+^[ÐSV[Jt$t$t$wVPW,^[ÐSV[ýJt$t$t$wVP,^[ÐSV[ÍJt$t$t$wVP,^[ÐSV[]Jt$t$t$QwVP,^[ÐSV[-Jt$t$t$!wVP,^[ÐSV[It$t$t$vVPG-^[ÐSV[It$t$t$vVP-^[ÐSV[ÝIt$t$t$vVP-^[ÐSVP[lID$QP t&Pt$t$v D$VD$1^[ÐSVP[ ID$QPP t"Pt$-xD$V萄D$1^[ÐSVP[ìHD$QPt&Pt$t$ v D$V,D$1^[ÐSVP[LHD$QPt"Pt$mwD$VЃD$1^[ÐSVP[GD$QP1t&Pt$t$Ju D$VmD$1^[ÐSVP[ÌGD$QPt"Pt$vD$VD$1^[SVP[jt$t&Pt$t$_l D$VzD$1^[ÐSVP[ì>jt$t"Pt$mD$V6zD$1^[ÐSVP[\>D$jPTt&Pt$t$k D$VyD$1^[ÐSVP[=D$jPt"Pt$!mD$VyD$1^[ÐSVP[ì=D$jPt&Pt$t$ k D$V0yD$1^[ÐSVP[L=D$jPDt"Pt$qlD$VxD$1^[ÐSVP[<jt$t&Pt$t$_j D$VxD$1^[ÐSVP[ì<jt$t"Pt$kD$V6xD$1^[ÐSVP[\<t$t$Tt&Pt$t$i D$VwD$1^[ÐSVP[;t$t$t"Pt$!kD$VwD$1^[ÐSV[í;t$t$hPy=gntsuV t L$1^[ÐSVP[\;t$t&Pt$t$h D$VvD$1^[ÐSVP[ ;t$Xt"Pt$5jD$VvD$1^[ÐSVP[ü:t$(t&Pt$t$!h D$VDvD$1^[ÐSVP[l:t$t"Pt$iD$VuD$1^[ÐSWV[:t$t$gPw=atadu,V Vt|$L$tVU1^_[ÐSVP[ì9t$t$4Tt&Pt$t$ g D$V0uD$1^[ÐSVP[L9t$t$TSt&Pt$t$f D$VtD$1^[ÐSVP[8t$t$tSt"Pt$hD$VttD$1^[ÐSVP[Ü8t$t$Rt"Pt$gD$V$tD$1^[ÐUSWV[K8t$t$CeP(v=gntsu?V8ŃUt$UPV t D$8 WW1^_[]ÐSV[7t$t$dPu=gntsuVt L$1^[ÐSVP[|7t$t&Pt$t$d D$VsD$1^[ÐSVP[,7t$xt"Pt$UfD$VrD$1^[ÐSVP[6t$Ht&Pt$t$Ad D$VdrD$1^[ÐSVP[Ì6t$t"Pt$eD$VrD$1^[fffSWV[<6|$t$jWVz tt$Vowt WV{1^_[ÐSV[5j ƅt%PVqFF F^[ÐUSWV[Û5|$tzj s1tcPVpFF FW;xŃP/tQP諦~n Vp1^_[]Ím)PQh/RSV[4t$ tVwP4^[ÍȨ)PQh}RSV[}4t$ tVTwP^[ÍȨ)PQh}R_USWV[4D$tfL$ L$QPjj«1x@ƃ$Pt+ǍD$ D$Pt$ t$W苫1ɉV.ʼn^_[]Í)PQhURUSWVP׉[v3 TPQXj @t}ƍPVnn~L$N uq$' U3' VP]9tBPtnU $u vOVF1uW1Uԋ^_[]ÐS[Þ2Mt$Pc[ÐUSWVP[j2t$t 9.t 1^_[]Fu VmF $Pt͉NjFupPW脣 TPQj t!UP$mF~$F qW+aUSWV[Ø1l$1t 9}t ^_[]ËE D$PPtߋMupQPD$迢 TPQ)j t'WP_lE$ED$E y4$^iZ0L$1t 9tËA ÐVY0T$1t 92t^BBtup^ÐS[n0T$t 19 uL$ tB ;D$v1[ËBupPQ裡[ÐY0D$t 9t1Ê@$ÐUSWV[/l$1t99Eu.E PtNjEupPW^_[]ÐVY~/T$1t 92t^ËBup^ÐUSWV [8/|$ 19t$$9Gt{o F D$D$Pt[$WpȅtЋT$ՋVtэ+QPRt$t$V蛦Owo tQ1 ^_[]ÐUSWVP[j.l$9EuwD$tyEti} P!q$PtFUup+t$RQt$ PM}u tQM1^_[]Í)PQh;RػS[Þ-D$t9u L$ t9t1[QPzk[ÐS[^-L$t 9t1[ËD$ IupPQt[ÐS[-L$t 9t1[ËD$ IupPQEt[ÐSV[ý,D$ t9u L$t9tf^[ËppЅtItRPsאS[^,L$t 9tf[ËD$ IupPQs[ÐUSWV [,l$(|$$}(t*D$ @tt$Pq[Í~)PQjtR-SWV[)D$0Fu9' W~tWق6' VPzVWFuFt PV1^_[ÐUSWV[k)D$t$x t4hjWV0m tUVjt WV4n1PVo^_[]ÐSV[(L$T$ 9t9r 1;q u4rpЅtItRP+p1^[ffUS[Õ(EM L$$D$e[]ÐUSWV [V(tPQ8' WI' l$UVPtPcW ^_[]Ét$Wj κthʼnPUc|$GEOM,$EVÀW|$WEPt(PcV蝀4$p1l,$UWlQ9uVMPQhMR`US[%'EM L$$D$e[]ÐUS[&EM L$$D$^e[]ÐUS[å&EM L$$D$e[]ÐSV[m&t$ 1t9u Va^[ËD$@$ÐWVY-&T$ 1t 9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZ~%L$1t91t^1^ËAQ^ÐVZ>%L$1t91t^1^ËAQ^ÐVZ$L$1t91t^1^ËAQ^ÐVZ¾$L$1t91t^1^ËAQ^ÐSVPY|$D$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY#D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY\#D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY"D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y?"D$t9u@H@ty1ËT$ BÐSVPY!D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYl!D$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYL D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YD$t9u@H@ty1ËT$ BÐSVPY|D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPYD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYmD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVY D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXT$t9uBJBuy1ËT$JÐSVYmD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPY D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPYD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXT$t9uBJBuy1ËT$JÐS[^D$t9u L$ t9t1[QP:Y[ÐVYD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY~D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVY.D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [u t1D$D$ D$~N~(DN+t 0tV-ushD$WPv T$ D$1ɿ9Th8"yxu2hD$j\hD$WPv{ T$ D$D$9T$rFg8"utHjPVl tu L$e^_[]ÐS[.' jPq' PQ@1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[ D$0' VPCV[1^[ÐUSWV [t$4NswD$8t@t@ud*ppQj WwjUVUZ tWVgWt UVY[1 ^_[]Í;"PQhRKWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[þtPQq' Pn[ÐS[~' Pn[fD$w sÐS[.D$ ;D$uPt$t$ [1[ÐUSWV[D$ t$tPWD$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋L$qD$ tL$9QWPN 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋH vHN1 =tP w싔$Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]ÍҪPQhRcUSWV ](D$ \$$p1}<"$N<\u< $1ۃރST$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍPQhR;USWV0[ $Du w<j0負11<o<$ou}u $hD$(P Y|$0D$D$@@@@ @@<$GHws 琐HOP} w$B8"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BP$B\l$(D$RD$ PUу L$T$ l$UD$D$jQRUW%Xt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUyWu҉pdD$jD$Ews 搐<<}jt$W9Q tfjt$W&Q tSyjPWQ E $AEtLt@<-Eu<-u}>u$h\t u94$f10^_[]Ët$t[$NjH<w sO9t1V\ED$"} D$,$t$UڬD$m$hōsD$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VuT,D$DD$ PD$l$$@T$$H9trueD$9dataD$ 9dictD$W$@arra1Py fals1@e ȍT$8q$@D$stri1D$@5ng hA$@D$$inte1L$D$$@eger1 D$\ T$D$4$RVP D$D$jD$PD$PUVSt/t$t$t$UVT$ D$D$뿋,$t$t(jWt$1 t t$,$VB,$fjD$PD$PRVzSt1jt$t$l$UVT$ jD$PD$PUVISu1{롐S[Þjt$ [ÐUSWV[u$j$hjVIY t5ōD$ PU4$t $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPj;UYtjVU/^ |$t'jjjhjt$P|$t-$U~jWU] WUTVUCS[>jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[j@譖ƅtCPV>jP^F,F0F4F8F<^[ÐUSWV[Yt3Pjtjj@DžuU葦Oj@1t=PWH>GjPZ]o,w0G4G8G<1^_[]ÐL$WUSWV[èt$19nU]N4 Džtbl$~4<$tC1퐐F,PQhRc1[rPQhR=USWV [l$ 19EL$$9uVMX}4t$tcL$$E,$1L$)ωNjL$r1$tFPQDt1Ʌ~Ã1 $tt5t$W ^_[]ÍrPQhR(S>PQhR USWV[t$$t 9t 1^_[]ËF4;F01F8u$FD$PWv4t[D$$x,1)Ήr=υ+ $Pt$,C1Ʌ~$j봍PQX' UU' t$(VW$D$PI7UT|$$o4;o0w,PjJǍMUVW. D$$x,ljh0V֞,$tD$,P6D$,DV6|$UETV >ǃ,wj,<j<t$6$D$$x,ljH0l$,UJ6w,4t2$ƅPt$,By& $'L$n@4@<C $΃̓)WRP" L$$A,T$TT$,T A4A<$D$PT$mhQP65Ft$(PVkt$ ~URt$(|$We"tmP&5URD$ x|$$t$P$<WVV) L$$A,T$h t$ VWF#9Ƌ|$$usUERD$ D$\rPQhR&˫PQh RPQh2RPQh\RɆPQhR誆S[nD$t9uL$ t 9t1[Ãt$QP] [ÐUSWV[t$$t 9tFD$ PRF8D$$P4D$$@,D$1׉T$4$)ωD$4$ƃPt$,>t1Ʌ~믉t$9vwL$T$ )VQP D$$@4@<W24$2t$ Q^_[]ÍrPQhR L4PQhvRS[îD$t9uL$ t 9t[ÃQPS[ÐS[^D$t9u L$ t9t1[QP:4[ÐYD$t 9t1ÃÐYD$t 9t1ÃÐS[þD$t9u L$ t9t1[QP3[ÐS[~jt$ <[ÐUSWV[[l$}t^_[]j@*tƋ|$PVn0jP~OF,F0F4F8F<}(t7hƇtL$7PUrVp0bUSWV ։L$[Ò|$ *?u-wG"}MG]jjWU -~jPwwt,ut$$腗jPww,(Ox"OD$ $QPht$0Wv$D$=L$$?u%8"uh׃P8:uQ'jPWX t4jjWG t#<jt$(P6t$>t1t$$yU. ^_[]Í_PQhRS[þPt$ [ÐS[Îjt$t$d; [ÐS[^Pt$ [ÐUSWV[+t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPj-D$(Ct(PQhjRQGPLWє1^_[]É.˫PQhhRX3PQhyR9PQhRS[L$A4tPQ4I,Dt*Pq,[ÍPQhR~PQhR~USWV,[XD$@xl$DuVJ}4tS|$(jWl$HU4 tjU3tD$D9(t9$VJ$,VnJPt$D54^_[]jjYtt$ < At$DVL$*L$ql$$9.|$FPQhRz;ѬPQhRzUSWVP[Z|$l$9L$$T$ 2;1u29r $PF$PFL$$T$ E4;G4uT$9tPFD$(M,LD$,O,LE,t9uO, t9t3$U+FWF4$^_[]þQPl)$tڍPQh!R]yۭPQh7R>ySV[t$D$ PEVuE^[ÐS[þPQF' PC[ÐS[~' PC[ÐS[^' jP5C' PQ1[ÐS[D$L$ PQn1[ÐS[D$ t$PB1[ÐUSWV[ûl$}tQ97uGW2DEtS90uOH<1;M uM;H4w\t @,4ȃMWC^_[]Í0PQhRew0PQhRFwPQhR'wSWV[|$wVqCGt$9uG@WUP@ jxDžt!PWN Gwo 1^_[]ÐUSWV[l$19}EuBM1tDm $t: $Urwt^Ut$D$P U;1$D$j6wt"WP$ED$E E^_[]ÐZL$1t 9tËA ÐZL$1t 9tËAÐSV[íT$ t19 uL$t r ;t$v1^[ËR1ttVRQ ᐐUSWVP[JD$1t 9t ^_[]ËHh t( $tDUut؉Ut$P ąt ˯PQhRpC ˯PQhRpZŸL$1t 9tËAÐS[nD$t9u L$ t9t1[QPJ [ÐSV[-L$ t 9t1^[ËT$19Q ut$tRVqΡ ֐USWV [t$(>t~(t  ^_[]ËFjQvPgt҃~$t0D$jPv t ʼn$u ~08"tD$N N$9u8"t=j˯PQhRWo1jPj N,$Us7ǍFPD$PU tcD$;$uZjPV tD|$u W"1,$jsƅt-PVF~n Wt WӃD$$0USWV$[Ey11T$G=w T⍋LjAPQ u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5jPB2F,F0F4F8F<^_[ÐUSWVP[Øt3Pj)ttrj@\jDžuUzWj@Aj1tE,$`UW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[|$1tv`9uloUP1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[Ú*։ $|$?uwG8]u<GcjjWb tC jPwwt,t1\:jjPUt$t1U^_[]ÍePQhRR[S[Pt$ 賾[ÐS[Þjt$t$t [ÐS[nPt$ [ÐUSWV[;t$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%WPQjmRYQoGP=&W o1^_[]É.hWPQjkRY3WPQj|RwYS[>D$H4tH4[ÍPQhR1YUSWV[D$,hUt$0~Wp%~4tR,$jUt$4V tjV2t`D$090t9$W %$W%Pt$0\ ^_[]jjft89AD$0t$PL$T$rL$9Al$ F9(u:G@j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ð;wPQhRJSWV[ìt$~ t 1j Vt ;~ r^_[ÐSWV[l|$t$t0t*PVtuj Vm^_[1SWV[ t$F|$uLPVujVm1^_[Í;PQh$R#ISWV[t$F|$uEPVtiu]jV}1^_[Í;PQhER3HUSWV[t$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Í;նPQhdRFUSWVP[ÊD$1ɅQh Dt$7jBK1Ƀ#h)K$GGG wtHt$WՃj W=tjW$$<PWtiu千PQWq tDj Wt5D$h VPW`tj WZ7ZWZ $ȃ^_[]ÐUSWV [$($$WtEPx=ŋ$$t$t`?t[Wt.H|/t+1]$,9/;9sfD$ .t$ V?H r\?fDXDXXXXDistXD /.plV?ttUt$ VPD$t 9ujt$D tYj'P'Ut$u t*l$ WU $t1$t$2$l$ 8t$H t U ?s8l8VX\8$ ^_[]É,$9tG9t iy/t)rD$ UWP D, ,$S[δjt$t$ [ÐS[Îjt$ [ÐfffffD$ǀǀÐUSWV[;T$$L$ |$l$t$u2jFtUhxL$ H L$$H*s3uFˉ,|\T ^_[]1PQjARA PQjBRAUSWV[kT$t]D$ |$L$tKutUtMtM L$$tEUqVL1Ht t L t L |$$t L2 ^_[]ÍcSPQjZR@ffffUSWV[xD$8t|$4D$0u4HL$HL$HL$H L$H L$H $x p PHl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dV豇4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[Ht$@|$t1 @u~1ɍ0( >t 9u#;T$t$L$T$ t$t$n[ffffS[L$T$ pPt$ [ÐUSWV,T$[җl$DD$@L$D$\$t?D$@|$"v/1t$\$UP]\$u+t-tD$D$@tN1D$D$@u90u4 L$T$ pPt$(t$(t$(t$(t$(t$([ÐUSWV[t$DuT$D$0ut$t#r 11ՉD$t$Ht$4l$U|$W衿D$T$8t |$8l$4vL$u $T$ 9tF\$9T$rl$<9݋|$@s uL"Du$8tV݉*WT$9L$rl$<9Ջ|$@rωՉ^_[]ÐS[þL$T$ t$(t$(t$(t$(t$(t$(t$([ffUSWVh[xL$|$>|$d$$jjdPWU$$|<$u;L$duh^_[]ÍMQPj譊S[L$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV[è|$<vQPt$@t$@ ׉L$`ODH@umD$j PW' ƉN8"u+D"90nOjPt$ QIT$91 ,$ .,$ ,$ ,$9,$dT$9މH1,9'T$,$xt*unD$<L$Pt$1ɐD T 9uD$L)̓|$DD$L|$11ɐT 4t T tt TT tt TT tt T9ul$t$DL$ D$HD$(‹D$LЃD$T$$1&T$,L$ D$;T$(t$DD$T$,D$$\$ |$LWPU T$tC1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$L'D$,D$9ŋT$L މ|$9s>$\$ t$TPWT$\ $x NjT$Lt$tB1ɋl$9u)σ|$_Ѓ|$C1ɐTTTTTTTTTTTTTT9u|$ $T$Ll$$|$\$ t$TWUT$\ t+1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$q1Ґ  LLLLLLLLLLLLLL9u\$ UI-10^_[]ÐUSWV0[èL$H1t$LL$Vj\$ D$D$DىL$ )D$D$HNL$t$T$14T$4D$H9wՉ݉L$L|$9s2$\$ PWT$X$x $NjL$L4$l$\$ UWT$XD$Ht$$ft21D T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$t$DL$ D$HD$(‹D$LЃD$T$$1&T$,L$ D$;T$(t$DD$T$,D$$\$ |$LWPU莺 T$tC1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.$\$ PWT$X$x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ $T$Ll$$|$\$ WUT$Xt/1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u\$ U9'10^_[]ffUSWV<[ØD$u T$PD$8tǃܟǃT$(9L$(l$XpT$0sT$4\$|$ /L$D$,)\$ǃܟ|$ l$X1L$u؟0D$8;L$(D$T4؟>-u FD$0؟t$4蕢E<+<-mL$ܟXT$,))D$ $t$љȅuD$+D$,\$؉D$$1L$T$ /t$T΋T$ D$L$9~D$<0D$TuT$ ΋D$tNj$9|D$롐T$$t$Tt4$9|t$l$TD\D,$9|ȋl$=p؟ܟ()ȋt$()։D$4$t$֙uD$(L$$)ș\$؉D$1t$L$ +T$T < L$ D$t$9~D$(D$T<u#ދL$ D$tˋ$9|D$말T$΋L$T<<t $9|L$t$T<4$9|ˋt$ŋD$D$0 L$$ $\$|$ Vtܟuܟ؟<-u ~؟4$<:tkE$<4$P蝎L$ tEH<$W;:&L$A;D$PʋL$TTD$:uH8t}:t`4$P! $? tǃܟǃȃ<^_[]À:uL$:tVL$D$X:L$u^Wp؟H8t}:tujWPWx:L$~T$0؟L$ $_D$h/p؟:t#j=R'ʼn)ܟ))ωD$<$t$יut$$)\$؉D$1|$T$ (T$T  T$ D$|$9~ΉD$<D$TuT$ D$tNj$9|D$롋T$͋L$Ttȋ $9|L$l$TD\D,$9|ȋl$1V躿D$\8l$ pD$D$1T$ $\$" $>T$tbQWR uWH $9D$t0ϋNT$\;LuN;Lu N;L tD$딉l$뎃|$t`\$H8D$X8:RQP $L$$D$ \$\$D$\T$l$ t$\$D$\l$ tyD0H8|$Xt?:tRQP 1L$\|1uD1 <-t<+::_yH8tD$X8:tKRP%? Hl$ t,L$)l$XSA;D$PʋL$TTl$Xu{D$L$ D$TL$DL$D$\uLD$8uCH8t}:t)RPm1L$\|1uD1 L$ aL$\D1L1 t1ɋD$`<85p؟H8t}:tu4$P $E<-t<+u:}:1<: :fffffUSWV[{yT$l$t$0+ tlǃ0+ 9}@L9-u7yI4+ -uK-?p^_[]Ët4+ ::ur??t::tsUPQR듍pj-R裇mǃ4+ --QR~tRx:ue?u%1x:tH9}gL$|鉻8+ pT$?(ǃ8+ ?tp:D$8:?q ffffS[nwj jt$t [ÐS[Nwjt$ [fUSWV[+wt$l$tyjj1trj tkNjD$oGG E܉PjQRjW+tKjP 1^_[]8l$uE}8t(W|$7P(릐USWVP[vt$ l$ME 1҉s9r J9sAEOQ0t`U)ƒQjRD$ 耨 E $}E T$)9w΋MVRP褨 E E MU9r‰^_[]ÐUSWV[KuT$L$t$ D$t0tUyyt1PQhR+pxA)9}8Ti t?t1PQhRx3rH HPp 9r@ 1^_[]䐐S[Ntt$1[fS[.tXt$ t$ Pl [ÐS[sXt$t$t$P([fS[sL$ 1t$PQt$g[ÐS[Þsjjjt$D[fffffffS[nsL$ 1hPQt$[ÐSV[=st$ jjjjV0t^[ffS[st$j t$t$x[fffffUSWV[r|$t$jWˍ~G0t ujW谏^_[]fffUSWV[{rt$|$ttft7Wt9fh L$f@Hx$p,L$ H(L$$HDL$(H 01^_[]ÐUSWV[qj1L$,l$(D$$t$ T$wGo Ouu u&t,t+$,ttڍuft?$L$ut: $fH f@xp$L$H,h(@DH MW1^_[]ÐS[qL$ D$T$rRQ0P [ÐUSWV[p|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[npD$t$t$t$0P [ÐSWV[vt |A 1^_[ÐD$xtÀx|$ÐL$ytI .wuÐSVL$ 1yt^[ÊY u.wT$~9|ԐD$xtÊ@ u<.wL$9Ð|$t1ËD$ÐSWV[Ìf1|$u:T$D$9w&t$PjV% FfFF^_[ÐWVL$ yu/T$Az |1z|1:RT1 |1A1^_ÐUSWV[eL$(yQ׋t$,<$PQVaL N1<$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ËD$xuHuP9røÐVL$1yt^Quq9rt$ x9v1^fffD$ ÐL$ QϸwD$T$B)J 1ÐUSWVP[*d|$ L$$T$,r 4$9u+$1!)1օҋ|$t$uEEFEMPjQ] 7D$8t pVPU臖 7+$p)t&uFA̓PjQ 7+ $O 1^_[]ÐUSWV[bl$$1L$(T$4z <$9u+$1*!)1ׅҋl$t"uGFNPjQ0 D$ }+$x)t.u$GAL$L$PjQL$ }+ $M ^_[]ÐVt$~)FσwyrrF  9r]T$  t9tq9w<q  9w! 9s9tQ9wQ^ú9^ÐSWV|$)OσW 4 9L$ 4:t:tz9w_z  9wD9s.D$9t7tz9w#z9w9rָ1҉^_[1VL$t"T$ tփuQ^ÐUSWV[`|$ T$$D$(<9D$|$,Ѓt)։Ѝ4*T$$t9wY|$tOL$,|$t u D$ (GPjW0L$8T$0D$, W9^_[]ÐSWV[,_|$L$1uLwt?;t$w6)w*t$uQRjQ蔑 ^_[ÐSWV[ì^t$|$D$Vt$P訑 ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWVL$tkʃudT$t׋t$(9}GT$\$ א?tW9w)o/9w 8t9r^_[]ÃD$$(>+T$吐SWV[\t$|$D$VPt$  ^_[ffffffS[þ\jjt$t$t$t$[ffS[Î\jt$ t$ t$ t$ t$ t$ [ÐUSWV[E\$$$$ft$tPQj VD$0D$4D$8D$<D$@$D$(D$,D$$D$L$$PQVu2t)6PjPVQ <$D$@t@+ hPV u$%PQt9xuP){tUWL$$U$$Ƌ<$t$;$?Ę^_[]Í9D$$T$DPhQR$|$D$Pjjj$t(D$ PjjjD$ $8x}D$ t$$<$t t$ܭjjt$(LU t$XC$PQ X` XoPQ(V6Qt$]jt$?xjj/yXxPQUjkt$$ujjx*jt$xt$ جt$̬7yXuYD$p4uMQP6uR$$u8D$@$8j蠞D$XpQRj/|$ W L$ $t$$tx%f%jPQ *$t$u+tjU6$PQt$WĶ NjU6$Pt$W訶2j/WctfjUPQWtXWPQS j蓝USWVdT$,L$[MWE$`PD$HD$LD$PD$DL$D$DQPjڨ l$$D$D$0D$ l$lPBSmjuD$P Džx ul$d $t$pt$pt$pU4$;D$Du H^_[]HS[NPjjt$6 [ÐS[.Pjt$t$ [ÐUSWV[O$$$|$1 tuMD$tTD$BD$ UD$tDD$BD$BD$BϋJ L$D$"肞/D$D$L$ jjQH Ǹ4$$tu1fD$ D$PWxpD$ f4$l$ffD$ UD$ PW˻ yϝ80u==uWv讝#"衝0WY葝0 WG4$;$u Č^_[]EUSWV$[8ND$8D$D$D$D$D$D$D$ D$ T$QRVPduS<$t5t$@l$4$N$\$D$PjL$Q$"PB\$D$]$4$֋$ߋ\$Ut$//$$$ߋ\$$PNT$NJ<-td<+$tHɋt$@$t؃L$Q$jPr!$tHɋt$@$t؃L$Q$jP؅\$VQ%$$$ߋ\$$PDT$uYoP$U1u5Ku*@P$&t"tt]tXuto$WhhU^'1D$ D$7,1D$;$uȁĘ^_[]1<USWV[DD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP#;L$u^_[];<USWV4Չ[qDD$$0ƃD- D- Ƅ$/jjjhVRQ1Ʌ(t$$/jjjhPUWиt1D$(D$$D$ D$D$GD$D$D$ $L$ PQRl$U"4$|$.vt:D$.jjjhWvvuW$3P訊u,$@$/uD- PRQj14$;D$;$0u ȁ4^_[]:USWV,[BE$(Ƅ$'$'jjjhPRQV1$@D$ D$D$D$D$D$ D$D$OL$D$ $T$QRV1Pux<$1tdt$&tBD$&jjjhVww荶uV$+Pu$ $11PE;$(u ,^_[]9fffUSWV[XAt$,|$(n L$N\$ PjQs F1l$,$1D$' $ $‰ЋL$9 $ރш̀Ѐ w ЉT$d̀şw©T$M̀ſw ɉT$-tuʀ߀¿k w:T$ lՋT$D$> $ $T$- $ $1 $+L$T$,J $ $T$,BЋ$)J)Ӄ!r^_[]ÐUSWV [è?t$ ~Nƃ1 V҉$t`L$FшT$?r?鍋E1 $j@UPQv\$+E1 ~t0|$>L$:$u E1 uL$>͍ >T$1ҍ1 -9si$:U;L$s>t 9sE.9r9s34$h9s맋 $1 9s$E1 ^_[]fffffUSWV[K>t$|$tULF \>LFuF ;D$u ^_[1-USWVp[5$E$lD$P9hh@V薈 1lj,$t$\hVW4 Ņ~UVD$ P u0W-e0,$xj$uj!ƅth$\L$QP*1\\>F \>LFuF E;$lup^_[]1[,USWVl[Ø4$D$hU$$U uj!?ƅtVD$XUPY1LX\>F \>LFuF ;D$hul^_[]1+ffS[3t$ t$ [ÐS[þ3t$ t$ [ÐSV[Ý3#1 jPVh D$ jVPj^[fD$ȉty!fSWV[)3t$,D$uj)ƅtZt$(P>1 \>F \>LFuF(;D$u ^_[1G*USWV[Å2$ $$Pwh@VI1$|$$ $ u#D$P|$WPP|$`l$d$$ʃ|&jQPt$ yd|=P$Pt$O ƅ~.V$P$P |) us84$)a8|$$uj)ƅ~$$QPJ1\>F \>LFuF(4$W萄|$;$u^_[]1H)3(S[~0jjjjt$t$[ÐUSWVt[H0$D$pUB$$Uk uj)ƅtVD$\UP91L\\>F \>LFuF(;D$put^_[]1E'ffUSWV\D$pL$tpxH 1!t$T1ȉ͉L$PʉT$LL$p L$DыT$pZ\$XÙyZ|$H1T$D!1L$tIɉL$yZ1!1T$tRʉ$T$H,$ʼnyZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1͋T$tRʉT$ÙyZ1!1ŋT$tRʉT$́řyZ1!1T$tRʉT$8ȉyZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$<͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$4ƉyZD$1!1ދT$tB8ȉD$0t$ǙyZB<1ʋt$!1ȉD$,ӉyZD$@D$L3$\$ 3\$411!É؉\$1\$@فyZD$3D$ \$$3\$011D$@!1É\$Չ™yZ$3\$l$(3l$,11!1ʼn,$މށƙyZt$@1!1ÉƋl$ 3l$3l$<3l$ʼnl$ ߋD$@߁ǙyZ11ÉŋD$3D$3D$3D$D$މށơn\$@11l$8D$13D$43$D$ىˁán3L$@1D$3D$ 3D$03D$ D$ʉсn113l$$3l$,3l$ʼnl$8D$@Љ,šn11ʋD$ 3D$(3D$3D$D$ ׉l$@ׁǡn11l$$l$(L<>4LuŋD$;D$u^_[]Ë$YffffSWV[Ùt$,D$uj)eƅtZt$(P1 \>F \>LFuF(;D$u ^_[1USWV[$ $$Ph@Vo1$|$$ $ u#D$P|$W:P|$`l$d$$ʃ|&jQPt$ N|=P$Pt$n ƅ~.V$P$P  |) uj84$oj8|$$uj)~ƅ~$$QP1\>F \>LFuF(4$Wo|$;$u^_[]1S[jjjjt$t$[ÐUSWVt[ø$D$pU$$U uj)_ƅtVD$\UP1L\\>F \>LFuF(;D$put^_[]1ffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[út$ L$A͉?@)ύ‰Ul$P19wct,B$ WUPxL 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUPL ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [|$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jW5 ;D$u ^_[]zfffffL$$Yai qyD$A(tQS[ØRjjcT [1ÐT$D$ Zbj rz $z(t RPS[HjRjT [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[óRjj~S [1ÐT$D$ Zbj rz $RPS[njRj9S [Xt@ffffffSP[=D$ L$T$$RQP;[fffS[jjt$jR[fffffffS[jt$t$jr[ÐS[îht$t$j_r[fffffUSWV [xt$ D$D$$|$jjUVjW1D$D$ $jjUPjW迺D$D$$jjUPjW舺D$D$$jjUWjPOuN8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjRŹ1u ^_[]ÃtOw OsҍHfUSWV[Õ$$$D$|PhHtHU0 t'$WP$2 19r4"-$PU@tPUt#M;$uRĴ^_[]Í4rWP$Uv2 "9sǃ#D$WUPt$0t$0 OSWV[Ì1 hVt$ t ~L81^_[ffUSWVh[C5 uj'h5 D$Pj5 L$@B1lj1L$ED$$1t$ƋEpD$Pjxw5 L$@B1lj1L$EHD$$1t$Ɖq jP:u(5 L$@B1lj14$e^_[]ffffffUSWV[l$jPUQ u @t tQUmu7jPUQ t 1^_[]ÍuojPVQ DžtHMjPVsQ 1uú!?E1u<-ut<+u`MDHt$}D$j PW L$9e9$YQH}+t؍ ߃/Љ(!ffffVZ¾L$?w5t<t#΃? ?9tA|t^1^fffffVY^T$r1>w ^ffffSWV[)t$(WjV@ xqN|$,t?r$Id$D?r'H- d$!L$jWV@ ^_[fffffffSWVP[{t$tB5 PQhRJqx>L$ $¼5 )QVWRpM5 PQhRq5 = t@= ^_[fffUSWVYD$t$D$I@t ~_wˉ"+t҃-!ЃÉ^tu/u4u?t#!tu>uG{Pt̉#.!t,#.!u븉# t# )#>  ^_[]ÐUSWV\[èD$pD$$8D$HD$DD$@D$|$$t8"u0s%1>0W>0\^_[]ÁsWD$9r8l$8D$8jj P' g>0`>8uD$)l$8D$-@@+x @/>Z|$!>`EL$ȉqpS+t Xt-u111#Y Y+tXt-uY !!ݐY !!̅t f-xt f+p}fXPmffffffS[+D$L$$D$ QPjjjR豨1Ƀىȃ[ffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[T$(`1<}t PDbt6D$)D$(8rl$ udPt$r-ŋ$t$_:0}t PDWҎ4$2?t$&?^:01UPt$-ŋD$G6>oD$G = = D$ 8t P DG^_[]Ët$$T$(,{fjVPQRWXj0USWV׉L$[Â2jeVj+Vt-1~E|$WjPj\yFu<$|$1jrV]tYb $UW]t1j|u%807=w=801^_[]ÐUSWV׉[×= tuX=mu?ru<6B=FtjP_v$=+u4jj_&v=tjP^6<^_[]ÐUSWV[T$0P1<}t PA_t1D$D$08rl$ u_Pt$l*ŋ$t$Z70}t PAWы4$1<t$%<]701UPt$ *ŋD$G6;oD$G = = D$ 8t PAG^_[]Ët$,|$(l$$T$0#VWU[; j-USWVP[ê<>t P@= tD$9Gt7?t9Gu(>t Pp@h6k1P+u= E>t P0@吐jUw U ƃu 68tWPt4$^_[]fffUSWVH[øl$`t$$WVUt$hBstUVt$Yǃu.58uj螺~;$} VPYǍD$9tLV證A$jD$Pӂt&WPUt$hr{D$$oH^_[]ffffUSWV4[T$`t$Xuptuut덫tŋL$\toD$0WD$HK|$T|$LtD$PT$0xKD$(Gz9G|~dkd׉<$T$`D$L$D$=SQ|^)k׉<$T$`D$(D$L$D$S<$D$dD$D$1D$عD$dD$ $D$(D$Ѓtp$L$ V' 8T$L9v NjL$\0l$$t#)D$ D$,D$,rAD$ jt$t$t$b%t2jt$RPG%tjt$RP0%d$D$ ɿt$t Љσs1dt0N,1 9tDtPxt$FPnxF^_[]ÐUSWVYT$tht$1BtBظkw+tրztЃːt *u1^_[]ÐUSWVՉ[BD4B tv:#EVPq}$uMtQjPD$ t$ L$$l$E1퐐f$NQV$r$@ E/%f}/L$@Ɂ1O tgTO tWTO tGTO t7uً$$$VPV$t@uD$$$PQOD$$$PQV(u%#D$=@u;$s!E/F$$L$ ;$u Ĉ^_[]Ë$rUSWV[ó$T$ f$$9t$<L$ D$,D$D$$EfR$t%=LEu⋔$B @D$D$PQ9j=*uA=*uA=*D$$AD$9$L$ K D$$);L$ 4 f? G D$D$PQR$1 #L$L@ Eft:$tK=LEuJ$hPQw $A @u$Pj $PQ t#$A @1 $p1ɐDM CDM /DM DM u~ID$4PL$DуP$L$8\$l$0XL$0\$$$W$W$6t$4T$D$I t#$Wrw$v ux .u$f:.u@t(x .u"Pt.uxw T$ ;$w'0jf2fu;$w9;$v%$f8tB|$,tY|$$D$ fD$fËD$;$f|$E;D$8f/D$ fD$f9$r f|$91ۈD$D$ $|$D$D$D$D$D$D$7ڐ\$u=*uLw*t;$OL$ڋL$d$t=?t)=[uBD$G=!D$t?w=D$uyt$f9t$uYt$$w1T$ЉFD$ЉT$(|W]uZD$D$;D$(;L$ $tڋ|$9|$D$(D$T$BD$=]zr-u%D$f9wf;BwD$z뾐f;|$tD$랋t$$|$t$fT$f9ljf|$1t$0FTFTFtTF`=u1D$ $T$D$D$D$:ЉƋD$D$uT$=*uI~*t;t$NL$T$L$؋D$t=?t=[u1umF=!t,~*uU|$։‰}f9|$u:g~1ЍWD$(tF]}D$D$;D$(u6;L$ \$$t$tT$9vT$D$t$fD$f;T$f|$D$&މD$׍W=][_-u+D$f9wf;GwD$wf;t$tD$랉ŋ\$$fEL$0$Wt$($]$D$ fxD$D@uP$PvP$P$P$AD$L!=+=D$ f\$$ 1$A @D$4uPPQu 8t$A T$ $$t$ W$$Y$$0Qփum1ɋ$B u^ZH JD$ /GT$ $$P$tL$< ;$u0^_[]ËD$ fD$,ffffUSWV[%$$$tu1|$$t D$3|$ ;h@PD$(D$$D$ cL$t$L$\QP|$tXD$D$0t$\ |$d$<0fD$PPj7Y D$ $D$1p1$D$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$tVPVw $D$$uh`UND$$D$iD$,D$ 1҉t$Յt6D$D$0D$4At$,jD$8P .jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9L$~<r9gL${<r9KL$z<r9)L$q<r9L$p<r9sL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9t$u4$OD$^D$ $GL$m <s9u9tL$n <sI9uD$$$9r4$tzOD$_WY9t븉t$ypd$i$`t+t'|$SjPw u1Wt$\Ƌ$>xt$`D$|Ay DAD$$uD$*`ՋD$DJtDHD$D$"$@um  ` DAթD$WjPD$pt$$9jPD$py D$ t$xtG$`L$tZSjPq4@̉jPD$p -1ҋ$tWjPD$p1҃ t$D$t$$D$ $D$D$ D$(D$$1GD$ 1PD$1D$ D$D$8 < Y1D$ D$|$t, D$D$\Pj7*S |$ 8|$|$ t"$%tjPw |$t!r D$7%|$X 8|$ $t t$|$H|$tu V\$ t$jl$ U 1$u UN_;$u Č^_[]iS[îjhjt$t$t$Y[ÐSWV[|= t-= jhjVPt$$t8= 0jFs= = tP N= u^_[ffUSWV[= jjjې = |$= tWQ= 讐 = th1i = 9= wHt Q] = UOM= t$WUPH = u 1T$ Ɖ^_[]ffSWV[(W%= u= jP;.xƃ= 1= t = 1W^_[ÐUSWV[ë(W= u= jP-x5ƃ= = UP";D$wUt$*1Y0WQ^_[]ÐS[t$,ƃ= [fffffffUSV0[D$D$L$ hjjPQjRmst_E rT$,$$t>Ut$ t$D$l$tt$$t$D$l$Zu L$(L$D$ l$Ze^[]fffUSWV [YPpt\ƀ8tUT$D$j PVG tŋT$t|zt)cVPP1ɿpkP&wA[@pʹ`&LQup@9~ $yjPEP,$VP%PT$t$$D$ t = RUPjQ.L$ t>= ^_[]ffSV[Ý> u*ǃ$> ʡPV,2> tt> VPѲ1^[ÐSV[-ǃ$> > tPxQ9ʡPV1> uVPZ1^[ÐUSWV [õ$ǃ> ǃ > ǃ> ǃ> ǃ> ǃ> ǃ > (> > hhU)ND$ 1Ʌ$t$A#L$ $t$ > L$l$<ǃ> > hhUMD$ $> t$P蠪j\WVK t8t剃> 8#tj\WVK t8t뉃 > j\WVK t8t뉃> j\WVK 68t牃> ǃ> ǃ > j\WVGK tD8tP腢> j\WVK t8tPU > h> |$$W' |$3j\PD$ PJ ǀ8tWEu͍n>UWthpUWtTiUWt@e@UWtt, UW`t!GUWLQ> E5xxMf l$<$j\WVI 8t牃> 8#j\t$VI t8t艃 > j\t$VI tOǀ8t扻> !GPW"> e@PWetb`> D$ʡ$> PQJ > l$tэ!GQPuJ> <$j\WVH t8<$tP> j\WVH X8<$tPΟ > t$t$1ɋ;$u ȁ ^_[]藨SWV[ܰt$ǃ$> > t P#L.ʡPW[,> t2t+V> u䍃> WP߬1^_[ÐSWV[<t$ǃ$> > t PK.ʡPW+> t2t+V > ;u䍃> WP?1^_[ÐS[Þ> tPCǃ> [ffS[nL$T$ j@t$[ÐUSWV0T$[4D$H$D$$E͋T$D`D$D$|$\$9EtL$|AyL$DAMZe*?$0t$t$ [ffffUSWV [} F FEFUVzRu)ʃԉF:FJFx9uRuqN ;Nue^_[]USWV [Q} F FEFUVzRu)ʃԉF:FJFx9uFpRum N ;Nue^_[]effSVP[ìD$L$T$t$4$VRQPUffSP[}D$ L$T$$RQP+EfffffSP[MD$ L$T$$RQP[EfffffYT$t :tD1ÐUSWV<[D$PL$8DPQR=Z t$(B hjD$Pg 0B D$ $?B D$ t:t|tD$ 9r@B տPQt$g DB PQt$g L$ VQPt$lg xNt$ ,fPVdt"ؿPVPu 1 B V/A#j:Pt$X tB l$UPt$Bj tL$PB iUPt$j t D$XB *UPt$i t D$TB nUPt$i t D$\B D$ PVt$Mf \t$ PVx(hPVF,hPV91hPVo,IPVW9hPV?>hPV'DhPVJhPV PhPV WhPV ]ePV ^hPV bhPV CPVg PVO uaePV7 e{ePV UPV EhhPV 5PV %nhPV PV `1DQV>UVt$;g tD$1f,B |~vnf^VNF>6.&)f,B t$ =QUPt$8f tD$ XB TB `B ɏUPt$f tD$ \B `B dB =UPt$e ftL$fpB svUPt$e ftL$frB AUPt$e 1tL$ftB vUPt$Ve tL$fvB RUPt$,e tL$xB UPt$e tt$|B SUPt$d tL$B OUPt$d tt$B fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$&B aD$ `|$4L$ qL$%L$)L$-L$1L$ L$5D$ PWt$d tD$ UD$,Pt$c tD$FUD$0Pt$c 1ɃtL$Nt+D$PD$4Pt$c t D$1vF UD$(Pt$c tD$ 1L$ F L$ D$ PD$(Pt$_L$ L$ t$1|$ PW9t,Eu勃`1DJtW˄t$F t$ v9L$ L$ l$|$4cD$ fB fD$4dxD$6D$50UWt$~b 1tL$B D$51UWt$Ub tL$B D$52UWt$.b tL$B D$53UWt$b tL$B D$54UWt$a tt$B ǃ(B WEVǃB WEV4$g8t$D$;L$8u<^_[]肌fUSWVP[ʔ|$JL$Wك</@t)9v"9vH8/u)t\9v N8/@tvljC 9thUWV!Ƅ+C ^_[]À|$/tJÍ;ffffUSWV[øl$UtNL(`1DJuK4$D$j PU( }t֋L$9tJ9tEi^_[]ËLJ wӍ<( @눉"8"u rL$ <$։q1늾=3ffS[îj t$ [fUSWVP[Êt$JtttnL$VLtH|/t|$/u;29r9vzz/u)ρwG hUPVƄ+G ^_[]fffffffUS8[õED$D$$D$ D$D$D$PQj tD$(|$0e[]ffffffSWV[<oƃtk|$|$u;P1uPjjP t8jPjWjW|W^_[jfS[ÎD$t=u[t$ P[S[Nt$ ht$1 [ffffffT$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[Ԏx[Ḯ̀rS[ôx[ḭ̀rS[Ôx[̀ffff̀ffff/̀ffff^̀rS[Dx[̀rS[$x[Ḥ̀rS[x[<̀rS[x[̀rS[čx[ḇ̀rS[äx[̀rS[Äx[ḓ̀rS[dx[̀rS[Dx[`̀rS[$x[R̀rS[x[2̀rS[x[ḩ̀rS[Čx[P̀rS[äx[ḷ̀rS[Äx[Ḷ̀rS[dx[ḉ̀rS[Dx[̀rS[$x[Ḛ̀rS[x[̀rS[x[Ḩ̀rS[ċx[1̀rS[äx[Ḍ̀rS[Äx[òrS[dx[ìrS[Dx[l̀rS[$x[t̀rS[x[s̀rS[x[r̀rS[Ċx[p̀rS[äx[j̀rS[Äx[m̀rS[dx[̀rS[Dx[Z̀rS[$x[ ̀rS[x[S[x[ᐐ*̀r׋L$Q1fffffỲrJ!QfffffS[ÎSV[mK tFK Pj%tsK 4+K 4K K R; ^[ËK HK jjjhjPjFo1tȉK uPj$Pj> jS[îD$K );K t P+[à QPG[ÐS[njPK uP][ffffS[.pPt$t$t$ [ÐUSWV@[uD$4$8M D$(D$0D$D$,\$<1UB|$D$D$ ^D$L$$RAt$y`DP@t$T$%7D$D$ OL$ۀU|$$ɋtuL$ |$$1룐|$$|$ODH@uT$ EHhL$8D$D$8WVPt$WV ]D$xW.Pt$W. FD$xWPt$W [D$x WPt$W GD$xWPt$W D$xWPt$W rD$xWfPt$Wf bD$xW>Pt$W> AD$x WPt$W  D$x$WPt$W D$x(WPt$W D$x,WPt$W 1D$D$\$T$ EHL$D$D$8W?Pt$W? D$xWPt$W %D$xWPt$W :D$x WPt$W &D$xWPt$W hD$xWwPt$Ww QD$xWOPt$WO :1D$D$\$D$рD$ G H:D$/D$(҃ 46"T$(T$ Ѓ |$z D$|$GDA@ut$D$  N:D$/D$ 4 "T$T$ Ѓ |$ODH@u|$$t$ |$$D$D$L$:|$P|$Ѐ 7 O:D$/D$ 4d"T$T$ Ѓ dL$ KL$ |$ODHut$D$  N:D$/D$ 4<"T$T$ Ѓ HQot$D$  N:D$/D$ 4>"T$T$W ЃU > |$D$ O:D$/D$  46"T$ T$ЃEt$ʀD$l AЍ~Ƀ 'w~N0rv:sqɍAAЍ~  'wNN0rF9wAɍAAЍ~  'wN0r9wɍAЃ='v1lMAD$ L$oEL$|$D$ O:D$/D$  4d"T$ T$Ѓt$T$ ʀD$ T$ w~AЍ~Ƀ nwVN0rN:sIɍAAЍ~  n0 N0T$ r9wɍAЃHmv1MAL$8t$D$ ;N:D$/D$ 4"T$T$Ѓ4|$Ѐ O:D$/D$ 4 "T$T$Ѓt$ʀD$ F:D$/D$  4 "T$T$ЃT$ ED$VQPt$VQ D$V&D$Pt$V$ 1ɿT$ ]D$IEt$1 \ЉD$8D$<Nt$ʀЀ ws119º !ɺ D$T$ы\$;L$ |FD$8t$EFt PF t\~tM1퐐t(0|F t((mF t( ^;~s F @ƋF PBF,t P2F4tPF8t P V^_[]fffSWV[|^t$PW職L PV:Wh^_[ÐSV[=^PVFL P'9V.^[ÐSWV[]PWL $L PQ9W^_[fffffUSWV[ë]l$UuPUt$VQ1tmNjt$l$Ut$2QDžtqV7t^oEtЃVP虤t Eu릉l$}uEtP轡E^_[]É1ffSWV[\t$lWTL PVOWȵ^_[ÐSV[Ý\lV覵TL POV莵^[ÐSWV[\\lWeTL XL PQOWD^_[fffffUSWV$X\t$8T$`D$ 1ۀ0T$u,N 3i=)Njtt+~%L$9N$ut1Ƀ|$tΉ|L uj(ƉDl$Utwn$Nj 0Q\ 1L utjh=DʼnxL 0ƃL LtMjу|L @1t*n$F,UQj PA|$z^_[]Ë|L )USWV[PL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉL uj(qƉDl$Utwn$Nj 0Q 1L utjhʼnL 0ƃL LtMjуL @1t*n$F,UQj P|$z^_[]ËL )USWVP[ÊOl$UXNjL $tOs;1҉vL ljh=L $uƃL D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$ܕt0|L tuR:t!jу|L tiE$S|L uj(ŋ$,tIEj |$WP葂 WtE@E$L$1E^_[]t$t@ϐUSWVP[ÚMl$UhNjL $tOs;1҉vL ljhL $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0L tuR:t!jуL tiE$SL uj(ŋ$,tIEj |$WP血 WtE@E$L$1E^_[]t$t@ϐUSWV[ëKt$|$ tЋxL t61=tDtPǃxL D$L$ƃL L t?1=tDtPlǃL D$L$ƃL ǃ|L D$ 1^_[]ÐUSWV[ÛJt$|$ tЋL t61tDtPǃL D$L$ƃL L t?1tDtP\ǃL D$L$ƃL ǃL D$ 1^_[]ffffffUSWV[ÅI$tA$1uhJƅtcD$E/$tt$$9ux/Ĕ^_[]J?$9u/(>?USWV[Ft$tD$tdPVxaa1ɐ΍,?UQbt&UPy.w耕8"tV g1^_[]ffffUSWV[+Ft$VL PL ƃL ` tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t PǃL ǃL 1F ^_[]ÐUSWVT$t$L$~ 9tS1tT:u>8ut}Y8uuuȀ@t:utȀ:u 1y@t^_[]ÐSP[}DL$ jt$jt$ [ÐUSWVP[ED$p$L T$8L$4|$ $h$dʼn\$uL tu$l|$th8|$t:|9v,t:t|u싌$lh[$ $L$1xjjjUu|$`PQhl$XU jjjh@U赊jh@6ܕ D$1l$t$(1ɍD$L1Ë$L$AD$$Љ|$L9rB19r0T$\$hWt$0 ƅ4LT$< u|$tT$$$1t$#tT$$l$t ߍX8؉t*s:j|a;$v<t:t|u싌$l덋$$$L$t1<9< t+< t'#<:t <\ut111;T$l$ \$$L$T$$L$)\$QPT$)ʼnl$‰$L$\$$l$ '|$t t$蟔t$(D$l$tEFH4$DD$\$t$(l$L$T$$pL$T$D$$1L$,$t$(l$D$֊<:u>tuk{D$؊6U8u Xuuu@=uUt @hƀ:t FuFT$L\$t$$Ut$t$4-\$,L$Lt&]u%F:D$L$,()D$ tD$)T$ D$t:u)ʀ| :D$@t:\$L$ ыD$)9L$ |KT$<,$D$)\$D$PU))\$)D$Ɖ$T$<*)׉ڋ\$QVPN% Wt$DU@% t$ t$t$,/D$L$, \$D$T$l$1ҋ4$t PЋT$ЋL$89T$v6)RV|$ u(Ve|$ |$ L$41׌04$"Ō0jL PCt$PL L$<$ 14$$lD$,P"|$,\$D$0jD$HPWUU t t"t$D<u/t$,D$HȾ\$UU|$ <D$\$VD$xWt_WVPk# UUxx1ɊD$D$8T$D$48B\$W |$t$+UUZ |$ ;$LutP^_[]00WVƃ|$\$t t$ҏ4$\\$UM|$t\$t$衏\$t$,&jW3X;L$ÐSWVL$T$ȉ֊t~8t1t0:t+|t&9vt:t |u^_[ÐSWV[ ;|$t$L tPǃL ǃL ƃL ƃL WV]^_[ÐS[î:L tPSǃL ǃL ƃL ƃL 1[ÐUSWV[U:$,E$$L uL ȋL u!Q0µL L t1L  L PQ,t $D$uz1L WMW6~ǃL L HL @MQPL u<`1DN@u:t#t L 8|\L L L $ƃL l$L$L$ $Dt\uUL P+uًL t:tuT$ T$WtfW}ǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$W|ǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8&ƃw5L tP|ǃL ǃL ƃL ƃL GW{ǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$u,^_[]À|\u ƃL ƃL [.USWV[Ø6D$ l$HU:u0U8u't#ϐ7U8uuu@=uE<@}D$jd0ƃd$L$ƿd$M]d\u}M:ȉʀ0E€0 ȃE€0 ȃ,^u"M:t ts:tn[<$)FdPW7xу¾2w/x:뷃벃뭱멱 륱 롱 띱 뙉,$)u %FPUt L$$WU^_[]ÐUSWVP[z4D$l$HU:u0U8u't#ϐ7U8uuu@=uE<@D$jdtWƃdNJD$ƹdEt#<:tu)FdPW|u4)u袂 "FPWNtL$ W^_[]ÐUSWVL$t$T$~ tB:u>8utމ}Z8uÃu뺀@#uZ@tỳ0uB 8/>9v$uPc FN8D} .~ wF F Pk>uWv $ tŃD~?:}|@uH)ƒVԍF F BBQWP"c uvv 葃 ?~?:uF:~t ~ ~8u ~F,;8u e^_[]>'S[~/0t$t$ [ffUSWV [A/} F FEFUVzRu)ʃԉF:FJFx9u0Ru] N ;Nue^_[]S&fUSWV0[Ó.D$(}PQfL t$M L$ML$f|$ L$T$|$QRj WPuOt$ rF|$j WP u0O L$FD$D$ PjL$QrD 79_t$} urP tgM9uWM % :sWQPR}Wuz19r"y";L$(L jjP< PED$t$L$ WDt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V\s uEPVu5a ;EsD$t$WKCL$%D$"T$ ;UwRPuv_ 1ɋt$;D$(u ȍe^_[]#S[.,$jPL h PK:P [SV[+L hVt$t$t$%t1^[fffSV0[ê+t$DD$@t2D$D$ D$HL$ $@D$1L$)jt$t$\ [ÐS[)jt$t$t$P[fffffUSWV[($$$$DŽ$DŽ$$jPo$8jPDŽ$PDŽ$TDŽ$XfDŽ$l$`$pUk$d$t<$$$`W$$P;$u ļ^_[]|1ÐUSWV[å'$$$$DŽ$DŽ$$jP?$8jPDŽ$PDŽ$TDŽ$XfDŽ$l$`$pWi$d$t<$$p$`U$PQ;$u ļ^_[]LffffffUSWV[Ë&t$|$l$jU|ApWVPUjjUmC^_[]ÐUSWV[;&t$l$ |$jW,AUVt$ WjW C^_[]ÐUSWV[%$D$D$F0u ǀ$D$$D$,D$8D$ D$(|$ OL$ $P9dtRF$&D$ FF V5kuWPcu뉐%$1틼$% $Bz ,HЃԃ $˃ $‹$tU% @뛁 $룋$z| $넁 $u $ fJT$ F%D$ FF VjuWPbu˺%~Vi9FD$ T$ D$~;%T$ $T$ $7T$ $'D$0<^ZBD$0T$ NT$ $ $D$~T$ T$ D$D$(~D$8 $0@RD$T$ T$ $D$D$(~T$ $D$D$(~T$ D$~T$ $D$D$( ~T$ 1ɉl$ύ$hPQoT D$004D$T$0‹L$L$ T$"L$$D$D$$A-D$ D$0-<]tL$$D$P P D$P P $WU[I h1qD$P P $WUI yLjP D$P $WUH D$ 뒄tT$0]tD$ L$ $ D$l$~ VZf$ ui$WP_WP^D$ t:FHN}Ve?$$D$T$  t $ȃVRjD$0+L$D$ b1 D$ $D$^8|$teFAOL$D$tF~V e t L$FPQT$D$uD$)ϋL$ȃD$, 1 ŋ $D$c8|$Q $P4]u3FHL$QT$t~V1dtL$D$ȋL$ )L$L$ D$, E$L$=r $C ՀM0 ɋd |$(  $$? L$(K L$($$? $@  $T$(S  $$?L$(l$,$ $9L$m ,$D$(l$W$с|$(tѺuu?tT$(t? $T$(L$QT$FHNV[b E=r$D$ ,L$V2]븉l$WPU11!$PUNQV9l$V\`D$ $!V\L$WT$9F|$L1 󫋼$$WL$PQT$ RPt$ tt! $u*G $~oQ $u D$uD$D$D$ D$~3D$HD$D$0D$V[|$WT$9jFT$L1 󫋼$$WRl$,UPt$ tt(QD$#D$$D$~kUD$1WPtWD$0$uD$D$$D$ D$D$0D$~D$HD$WP;S$D$D$,|$L$9sȐVP9rG$)X $u0u8L$$QP(; D$D$T$ -L$$QPy9 D$8u|$|$0$D$D$,D$W9D$l$T$jFT$L1 󫋼$$WRl$,UPt$,tl$t%)D$ D$$D$l$~UBD$1WP?$uD$D$$D$ D$~V~XWP7Q)ЉFL$$QP菔 D$P T$ t 9l$D$D$,q|$cD$T$ u^?|$#L$,|$$L$0 VP]rD$T$ |$ GL$(D$<$Hʀ߀X$uD$VQ $uD$fxWt$,jU,ID$eWt$,jU< $u&@u(u-uu||$|$ |$fD$,T$ L$ )L$L$ m|$[|$$:|$<VP7rL$׋T$ c|$Q||$|$ D$T$ D$D$8׋T$ fD$9I^׋T$ L$Q׋T$ @݉T$ @L$D$,N @1|$8 D$,D$D;$u6D$,^_[]Í$9v׍HL$@VPsRfffffffUSWV[|$l$ 8unnjU)}0u LJE T$uGEt-U$/E EE}0T$fE ʉ $7to9h};8%fE EMtY9vU8PuPEEi@9tgWVƉ|$UPWA l$ E00L$HcMM@(@ )@$|@({@,}@0]@4\@8$@|$T$L$pl$L$T$ jWPjU1xL$ȋ;L$u^_[] USWV[K|$t$t V;1pL$1jUWPV ^_[]ÐUSWV[|$ t$t V:1pL$T$jUWPV^_[]ÐUSWV[ë|$t$t Wx:1p1jUt$$PWy^_[]ÐS[^pL$1jPt$t$t$C[ÐS[pL$T$ jPt$ t$ t$ [ÐS[pL$T$ t$Pt$ t$ t$ [ÐSWV[Ü|$t$WGuGكs^_[!t_t$t%<DFDF ^_[ÐUSWV[|$ u ^_[]l$ t$Wlt t- t(WUtWPu뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[h|$0t$,Wt$@[D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv <$|$Dփ 6D$4)D$4@u \҉L$x MVt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ赫$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/`DPg%0W$\P$D$4@uW辪u#`DxuGws>4$$^_[]ËD$4  !rfUS [%E$D$D$D$PQED$e[]fffffS[t$ t$ [ÐUSWV[å$$%= uRl$4$Zƅt1fFH0F D$D$D$0t$T$j6,t5D$"D$<u 0G OJ0D$,L$T$T$D$,D$D$D$1D$HGW(|/uL$V7 }t!v$3v$3v$}V}W..^_[]fffS [;pPQt$ t$ I ,$ [ÐS [t$Pt$ t$ ,$ [ÐS[L$T$ pP[ÐUSWV ׉[ÔT$4 |tb=t= T$4t=uD T$41 L$ L$ L$ L$ D$l$ L$RPQUWVs=u("كTw" # $T$сK1 $  ȉD$D$ ^_[]ÐS[~L$T$ t$[ffffff̀rS[Dx[̀rS[$x[ ̀rS[x[L$D$9tt P9u1fffffffS[þt$ t$ [ÐS[Þt$ t$ [ÐS[~L$T$ pPt$ [ÐUSWV,T$[Bl$DD$@L$D$\$t?D$@|$"v/*&1t$\$UP\$u+t-tD$D$@tN1D$D$@u90u4 @$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[tx[USWVT[XL$pw_<l$l1.t$h D$ʼnD$4\$P^[D$,D$M؃|$xD$ JL$!ϋl$ t$hT$p $dl$ щʉ $9wѐD$ ŋT$;T$hL$xv֍<\$QRW$$\$( D$ ~L$p|$t61ҐD L9u֍*|$p)׃|$rσ|$q1Ґ ,, LllLLllLLllL9u ?D$l$ ؃OL$$L$xD$ l$(\$T$pl$(4$"\$ύ ʉ $9wҐD$ ƋT$;T$(L$xvՍ<\$QRW$$\$( D$ ~L$p|$t61ҐL D9uՍ|$p)׃|$$rσ|$$q1Ґ l,LLllLLllLLllL9u|$4l$,/MD$4|$,4D$ t$80t$h\$QPV$ |$ X\$ىL$0D$D$p@D$<|$ʼnߋ\$9)L$,D$L$D$4L$,|$t$t$(9/9$}D$<4(L$ \$t$xVR$ L$8AL$ D$;|$(r0$t$hL$,\$|$3t$h!l$ t$hD$4;,$=D$/)ʃT$D$tӋD$pt?1ҐEL5MD59u.)֋L$,|$$r|$$u1ҐL,l LllLLllLLllL9uՋL$,L$  $9ыt$hD$ T$  $D$|$x\$t:D$ $ȃL$p U0uuD$0L$p9rދ,$;l$(D$ \$WUP$\$( L$8D$ L$T$ <$9׉[ $<\$t$xQW$ L$0Ȩu$)D$,T$t$0t,L$pU7uuL$p9r<$D$D$ L$ދT$ ct$hD$4<ȃ98IT$pz|$<T$8D$‰D$4t$H9t$h ωp9׉t$HtՉЉt$D͉L$,|$@D$L&D$DBD$DD$LՋT$P9tl$ŋ)<|$ 9t8|$P+|$@9D$09l$;l$ 9\$ |$$\$t$xt$U$\$ L$ L$\$~L$0L$ىl$1҈ډT$$T$p<;|$ L$(l$\$t$xWt$ $T$| ;D$$~7u$?jUTƅtF PVW u$*jU!t@ PVW 18t u $tD$ 81^_[]fff̀rS[tx[ḃ̀rS[Tx[SWV [9|$D$ D$D$$.0L$jjPWjQe1u9 u 01 ^_[fffffSV[ýL$D$T$ y9IRVQPi6Q4P 1^[ÐS[^D$y%9IP PQj@R  P j@4R P [fUSWVXL$tCt$81ېDWl$llof9u1t9u1)^_[]fffffK̀rS[Äx[USWV [ht$ ؠD$Pi7$|S_ NL$ 9t6ʉi)iAi ˍ $ 4L$T$ o9s9s}$?9r|t$^uA$t209r9r։ t$A^_[]É݃t209r9r֋9s9r9r봐USWV[ø|$8ؠD$Pt)1ҋP1L$4T$0 s7ǃǃǃAQ1@Չt$sAs(11ҁ¹)҃L$ $‹D$4HL$|\$ÉhT$r1L9t;Ⱥ_ Nʉi)iAi ō 뺋D$0 $Dl$S9w9\$rыT$ҍ4)tG109r9r΋9s9r9r봋9t$r9rʉ艃 )D$ L$4t$_^_[]ÐUSWV[(t$.̉׋D$)ōؠ$P t)1ҋP  t1 4$D$^_[]ÐUSWVP[JؠWStI 010$9r$9r$ i0mNA900W^_[]ÐS[ît$t$t$ [ÐS[~t$[ffS[^D$@ @@@@@@D@0@h jP [ÐUSWV[Q (R h EGGjWE8jP,EǀPǀTǀX`Xu\aǃQ ЦWĦŋ@~*uf~ XEuh?45l$|$h @ h$Ɓ| D$ 1u0dždžjP\E08jPE0ǀPǀTǀXD$ X`zD$ $ȋ|$F FFFFFFDF0@h jP WF^_[]E1␐USWV[{(R h EGGjW!E8jPEǀPǀTǀX`Xu\aǃQ ^_[]ÐUSWV[øĦjsƐ+w?uiƸPb2l$x pxkX$, 1׉j0DžDžjPG08jPG0ǀPǀTǀXX`l$$1E^_[]ÐS[Þj輳[fffUSWV[p$j(j:$hj:ljt$V6Dn u<t1^_[WVctGPVxgtۍGPVctʍG PVctWVcVZD$ L$qtu0qwY ^ËQ tu*I IH^QPI;@P^@p^^ QPI H^ ^ ^ ^S\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ffìrS[tx[v̀rS[Tx[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWVL$D$utdT$pא?t 8uلt&~Ր}8t ut 1119^_[]1fUSWV4[%$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋ4 l$1 r$Xt$\t $X1$Pf$TWՃiriQVPؾ ,$$XtY$\tOFl$0PQjUU$\9ȋ$QU$`m FfNQPR$`U$`1Ʌ9$Fx$P$T)PURQW*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LQPR$`$`l$ 9+ t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`^~$PEDL$pPQ|$W$`UUt;$Tg$P$T)D$D tP|$Wt$L$QRL$)D$D Pt$t$t$RL$)D$D Pt$t$t$RL$)D$D Pt$t$t$RWL$r)D$hD Pt$t$t$RL$9)D$/DPt$t$t$RL$)D$DPt$t$t$W19D$F$PED$1$1pD$ tD$D$׋D$ tD$ $ 1QPt$t$U)H)D$>Ń19t$un 1f$PL$$T)fv fD$ VQURt$L$ ;$T$%T$0L$RQPWst(8WT$\9vpD$0PY_;fǍ$0PQhW#W $\9v QW$`菸 %1QW$`u D$0P^Fl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF M u)L$ QPtPŅ$y+8ET$ PQhRr=$w*;$(v.L$ UQPY $$1%D$1;$ u ^_[]vffUSWV[~$8$E UPwZE 1Ҩk4$$4$0$,uRUW-VUWt9~uۋ$0tPv u*ft#Q&$4ƃ1ҁD$D$ƉffD$D$hVQP t$D$L$ T$PQVRu0g9t$D$ ff9|$$0$4t*G9D$D$u_GRQPP= uEt$WVUHZ24$1E u UU;$uЁ^_[]1ҋ4$E ttfffffff̀rS[|x[USWVP[|P[xT$1tJT$ t4i t}um9ujqt$$V 1$11Pax8^_[]ffffffSWV[<||$jW5G=tjW(^_[fffffffX{L$rÐSWV[ü{t$VtF~tP^_[ÐUSWV[e{$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ $D$8D$4D$0D$,D$(D$$D$ D$$\$$b$xuxuxu x$ $\$PT$1t2\$WtGotP܋\$$$0$;$ЁĨ^_[]$k$@$QC$FD$8FD$4FD$0FD$,F D$(NL$$vt$ T$t9t5T$ t tu#u u$ D$ D$D$\$$PWWti$t$tf1ۺD$11 ߉D$ŋ6t>N tFtI1л t̉1$1D$\$ \$t$o\D$ L$8L$hL$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$T$ T$PL$LuD$ $L$$Pj$rD$hD$8D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$LL$PL$ D$\$D$8D$hD$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$L$ L$PD$L$4\$ N3D$hD$8D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$T$P1T$ T$LT$ t1#D$! ttD$ 9tFtll$$V9t$(\$[$9މuL$ ȅt$utT$$ۋ\$$u <$t$T$(oL$$$PjL$ 1T$FM@t$Fu \$ =<$3\$ t$iEjjPn x P8wL$$\$$PjND$ 1ҋL$T$Du`xl$\$j%$UwD$UmL$)L$D$H$PUl$U$i4$\$t$HS$yL$Du`gl$D$$u&JB$L$$\$$PRUJBD$L$dA<tY<uyYQuy uyuyt{wqhQ)t9uGIuuA>Qs9@0n$l$t$Wͦ\$t$(^_[]ÐUSWV\[øVD$PD$x8hD$8D$4D$0D$,D$(D$$D$ D$El$ |$uHt$W$T$ RT$RPWQVƃt,t$D$t$D$EML$@ML$XML$TML$PML$LM L$HML$DD$;$$(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$T$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$T$L$ ut$t$$LUv)1ffffD$@@#Eg@@ܺ@ vT2ÐUSWV[89l$$|$G? OW@)19w_WT$Vt$$PL$ k T$]$19s'D$ 0L$>@9r|$1T$ )URPk^_[]ÐUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [0|$$D$O $GD$?17l$ )ȃ8KPQWH jPW: EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWb ;D$u ^_[]'fffSP[/Pt$1Ƀ $ȃ[ÐUSWV$Y/t$8D$D$ L$`1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$|$$xt$\$l$t t$ t$v$1D$ T$Dt$ $u U<V誱WjPrQ |$t$$|$ 1ɉt$!1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W-Q Pt$l$UQ t l$ /D$$<F\$hPWP |$ l$(D$D$ l$L$ff9NF L$\$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$D$P$t\$|$WUROT$ \$WjRfOT$ |$L$F t\l$Et Njl$U \$Wt$T$RgO E xu D$L$ H$l$L$~ xl$>Et Njl$U\$WQRT$ OT$ L$E ED$\$l$PU/1t$UD$L$$9sD$DQ1ɉȃ0^_[]D$D\$^S[Nt$课[ffUSWV|[(j$n1tGljPW8t)l$XD$\|+Wni Wn1|^_[]jjWjjUjWxnt҃|D$ l$<$D$ƅuUW뚐USWV [H|$$(rl$ NBCD3EB 3M t9i1 ^_[]Ë|$,j<Ɖ8D$0FMNUV } ~$E$F(L$w F,w F, F,$wF-T$$ T$$w F- F-nV U(V|$Ǎ<((1t)lj~$BF9r\9rXD$9rPl$$9wHҋ|$1Ѻtr1ҁD$sD$rgV5s@sщʉѺ u׋ $)jQWj[F0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPjF4~F:F:t1F;pS[~t$t$[ÐD$@ ÐSWV[LT$|$9W v#wG,ʃt$<u0 Ћ0,fL  )r;GveD$Ot$1^_[ÐUSWV[Øt$,~$ED$\$Pv(t$Q 9quJ9_$kD$D$4$It$rD$<$L$HL$D$ l$D$$$$`$ttl$$;W%`t %)l$ $D$D$pt$L D$0^t"l$ $D$D$0t$L D$0^t"l$ $D$D$t$L D$0F^t"l$ $D$D$t$L D$0^t"l$ $D$D$pt$L D$0]t"l$ $D$D$0t$L D$0]t"l$ $D$D$t$L D$0F]t"l$ $D$D$t$L D$0]$t"l$ $D$D$i`tX6~.&V_m^_[ÐSWV[|$[ƁYjVW[ yWPV ^_[ÐUSWV4[è$D$0D$IuD$HL$j.QPjT$PQj.jR^$tEL$PQV  D.0;D$0u 4^_[]USWV([t$L$-uAD$QD$ +tD$ +u AD$Q`x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍlщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍlщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$lщ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$`8D_L$u D$(1ˍA^D_uk*… )хt 1Ҁ|0.щ^_[]ÐUSWV[} LD$|$D$ D$P%lHHPP,0ppp RQWjVd$r D$ƀe^_[]USWVP[Êl$JPU^^VPUF^PU.^KPU^ PU]PU]PU]jPUA 1uR`MDHt?:j PU~ :8u$8 L$A.&L$0t9^_[]ÐUSWVP[l$0PU\txF u6VjPU@ 1u[`MDHtH9j PU} 98u $8 6D$t8^_[]fffffffSWV[|$t$jWGHO~;G~ t H WRYhjW^_[ÐSWV[ìT$L$Bpr~ ;B~ t 2~: RQg^_[ÐSWV[Y|$(D$$uQ$P#,D$D$D$D$ jW"G0u ǀD$PWjW^_[ffSWV[lGHt Jt @t A?t/t5Gt9E4'P$ +Pu0) E0M0)u40E HM @PWjdj$+Pu>9E4'P$ +Pu0  E0M0)u40E E PE PWjdj$+P>9E4+'P$ +Pu0w  E0)u4M00M AE 9L$Pt$ jdj$+P=9E4&ƃP$ +Pu0  E0M0)u40E E uEE ;D$ }0L$[\$$E0 E0E4HM0@E ;D$ T$ E4PW'1&E E ;D$ sɃ}4w\$d(&}4u0E WVu,P &%}4%E0 E0HM0E4@MU \$WVu,E P}}$u E GPQjdj$+W:<9E4O%PWu0  E0M0)u400 M t$ )΍VUUUЃ=T$XPRVQ@0}4\$$ʋE0f (E0E4HM0@D$E HM 8HM @D$QE t$T$Et$Pjdj$+P;9E4-$Ƌ\$P$ +Pu0u \$ E0)u4M00twE L$\$Pt$ jdj$+P:\$9E4#Ƌ\$P$ +Pu0 \$ E0M0)u40E E uE4w#t$M0fA  QU0E4A|$XVWt$u .F9E4\$##VWu0x  E0)u4M00L$M M E4;L$ s]}0u \$"M0fA  QU0E4AMU E4PWu,V""E4L$ 9M r\$"}$ u4u0u jP}$w u 薽E GPQjdj$+W99E4("PWu0{ E0M0)u40}4u0E MU }$ E PQjdj$+W89E4!PWu0 E0M0)u40E  E ֍;T$  D$dD$`D$\D$X)XVPQT$ D$Xu4u0Pj}0W?lj}0)E4u u |$C;D$ \$ }4 E0 E0HM0E4@ E4u0} PVu,W  }4 E0 E0HM0E4@E E \$P誻M ȃE P蓻E E u0P~rPQV E M E4u0T$ PV!  E C*uPjdj$+W6v }$ u4u0u j脗u0VƉu0)E4E HM @PQjdj$+WW69E4lPWu0 E0M0)u40E E ;D$ M11 }$< u4u0u ju0V7Ɖu0)E4I \$u +E E \$PM QU IT$|$0\$QPVRj(jW5\$ 9E4PWu0 E0M0)u40M t$ )΍VUUUЃ= E48M0ArintAto pA ong Aoo lArd trecoM0E4I }4u0E WVu,P#}4E0 E0HM0E4@MU \$WVu,E P}4E0@ f (E0HM0E4@E L$ )p\$P衸E M4;U0B  ru0M4B\$,PQjdj$+P39E4Ƌ\$P$ +Pu0A E0 0M0)u40}4E0D$nr3)M0 M0E4QU0A_}4sڋ\$E4u0} PVu,WgM ;L$  \$AE AE IL$1$+E ;|$8t1ɉT$|$਀t^L$ P#PQjdjV29E4PWu0 E0M0)u40T$|$L$lE 8D$E ;D$  |$XWu u$u, E4u0} PVu,Wy:E L$ )o |$ 1ҋ\$L$$+р਀tJRPt$ jdjV19E4PQu0 E0M0)u409T$ ыE \$냃}$\$u 褵E E \$P苵E L$y|$X\$PVQj2jW1\$9E4PWu0f E0)u4M00M u4}0T$ VW~\$E }4E0 E0E4HM0@M T$ VW7\$E }4vE0 E0E4HM0@M T$ VWQ\$TE }4/E0 E0HM0E4@E MU VWu,Pz}$E GPWjdj$+P/9E4P$ +Pu0 E0M0)u40E HM @PWjdj$+Pg/9E4|P$ +Pu0 E0M0)u40E E ;D$ L$L$\$Pt$ jdj$+W.9E4 PWu0^ E0M0)u40E E ;D$ r(E4u0} PVu,W}4E0 E0HM0E4@\$u ڲE PPWjdj$+PA.9E4VP$ +Pu0 E0M0)u40u vE P9PWjdj$+P-9E4P$ +Pu0D E0M0)u40u E E PE E PޱE vPWVQjdj$ +PY-m|$XWu W 9E4PPWu0 E0M0)u40|}$9u XE E PCE E P.E vT$XPWVQj2jR,9E4PWu0 E0M0)u40E4u0} MU PVu,W}$E H}$rb\$]T$XPRVQ x?D$ }4\$E0f (E0E4HM0@ \$[D$ +E }$tUpkVQPRjdj$ +W+9E4PWu0 E0)u4M00t$ 9u iD$(D$t$(jdjW0+M )Ήt$|D$<+t$~;D$ƃ\$T$t$PRWo |$}\$5\$-E 8\$Pt$V8\$ ƃ9|$u؍$+)9u4VPu0 E0)u4 0M00\$}4mE0)E0HM0E4@}4E0.sAD$.)M0 M0E4QU0A~*}4sf E0HM0E4@ߋ\$sPjdj$+P)4+D$$D$} \$`D$1҃|$|tL$ L$D$$4+1 D9T$t> ..x\$DK.ẗ$Lx̋D$DH.t뻋\$/֋\$L$ t xL$DA.t.$+)9u4VWu07 E0 0M0)u40D$E E t$ 9PM0+L$NjE ;D$ HM  ɃtڄyL$u2E4e׋M0A  QU0E4A D$T$RPjdjV(9E4PWu0j E0)u4M00D$T$L$Z*D$$D$D$L$L$ \$t$\$9E4Pt$ u0 E0)u4M00D$ ƃ0|09u4\$^|$$ +rz4w|$7$ +r|$7$ +rz4|$7$+Rt$$+2|$7$+2z4|$7$ +r|$7$ +Rt$$ +DŽ$ +====2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +Rt$V$ +Ƅ$+=fDŽ$ +==2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +rz4w|$7$ +r|$7$ +Rt$$+Ƅ$+=U4{ u0$+$ +^>~}0U4FU MU FD$$D$D$D$D$ \$t$;9E4 Pt$ u0P E0)u4M00D$ ƃ0|09u4\$|$E M4U0B  ru0M4B\$QVP2 u0Ɖu0}4)lj}4>r3)E0 E0E4PU0@+}4sڋ\$}4u0H;T$ \$BE D$BE JL$d$D$T$E D$щT$;T$L$t1਀t\D$T$PPQjdj$+Wy9E4PWu0 E0M0)u40T$dE L$D$E ;D$ \$u4u0Pj|u0VJ)E4u0E X\$u4u0Pj|u0V)E4u0E )E4u0} MU \$PVu,WM ;L$ t$ )΍VUUUЃ=rE4\$8kT$X\$PRVQD$c|$|/}4\$6E0f (E0E4HM0@|$[D$$D$D$D$D$ \$t$9E4Pt$ u0# E0)u4M00D$ ƃ0|09u4\$|$raT$$\H @>rET$$H @>rT$$"H @+<$+D$$L$D$ ^_[]fffffffY_T$4D$#@DÐUSWV[+|$ l$t$~Jt$~2UVx(ƃ|$tލF9wȉ9v(+t$^_[]ÐUSWVP[Ú|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }/(^_[]E ffGftC,$RWגxǃ9w,$)xD$ hHGftf,$RW腒f 8 9Xσ95,$)5|$ oGwtc,$RW 8 9σ9,$)|$ oGwtc,$RW衑 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$. ^_[]Ð~34$UOx(ŃtߍE;$wMȉ;,$v ;(+l$xD$ h,h,L$H(ht$0Quus]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5@(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[È|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.^_[]Ð~34$U迍x(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu苛U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWVXT$4|$0$D$ D$11ɐq;t$<_T$WT$t$,$?t$8D?‹T$DD$?l$Dc D$fD$Bу1T$r8Ѓ17T4T7T4T7T4T7T49ut41Ґ9uM;L$<T$D$0 4$|$|$l$8T=T5=|$tT$$D$808=;L$0}V xn^c|$8XD$4D$~D$`D$‰<wsBքu1L$ˋ|$?|$ $LOL$t)L$<$\{<$|$ LOL$L$D$<$1$ r $L$t|?TWT$T$ Dzt]$؉ÍF$и rT$ӋD$T$<$t%D$ЉT$;T$8D$^_[]ÉUSWV[|$t$$ u f0x<$|$Vt$~p$ƃ|$ 19tG,00r7 $ r7jB؃u;$}B.뵉ED$^_[]fXOs ÐS[.s ht$ P. [ffffÐ1ÐXߠt ffffffUSWVX[øl$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMn9^L$"jWRPj2jQŃ9D$"PD$tPD$pD$)D$iǓ$))ŅtUT$ 9^T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ 9^|$"jHQPj2jWH9W|$WD$D$lj|$)ƋT$ D$kD$p` txҋ9|Wy>TWPڋD$+D$pyXffffUSWV[Ûl$Uvƃ;D$v(`|$UW1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[$$$hWP! x3l$hU$( xUW|1Ʌ;$u ȁ^_[]ffSVP[\L$t$D$T$ $xRQVPx9rRQP) ^[USWV[ |$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[Ë|$t$l$tt$$PW%to^_[]VW t W LJWVUF ͐SWV[ t$|$jW1Ƀ PVW ^_[ÐUSWV[˚|$tt$O#PW$t0l$VW/ t WRLJWVUM ^_[]ÐSWV[Lt$t5|$r#u#jV#tjV$F1^_[S[D$tL$ ttu H1[[ÐSWV[Üt$t_|$G?wS>1RjV"t3jVU# tۃtjV"t jV/#E^_[ÐSWV[ t$tAjVq"t2|$jV"wsf~ 1^_[ffS[ÞL$T$ pP[ÐUSWVT$0L$@[XuD$\V*ND$ Pǃ|\$D$t6"=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$ $$$$D$D$D$\$$|$,Vt$8PQRWyǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q& t$\$W$PQ%\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$d\$t$,PVD D$,\$PV蠾uD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$NLD$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[Þx|$   >L$s*D$@--tr0twPu@-g[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[üwD$Hr %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[ wt$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[NvD$ L$t9u[ÍPQjpR9S[uD$ #L$t9u[ÍPQjpRD$t&L$tu1u 1tÐS[nuL$ D$Qss)ǀ[Ãuu ǀ[ÍPQjpR5S[tD$tL$ t 1[[ffUSWV[ûtj 1tQ@@jjP (8t(Wu(^_[]ÐSWVP[;t|$OGQ9u0$jQPl "08t  G $GT$pw1^_[ÐSWV[üst$tRtC|$t3~t-0~r4;~rPV^_[ÐUSWVP[JsD$H $t.(1tt$V肺t 9<$u1^_[]ÐUSWVP[rT$J $Ћ*1|t$W"t94$u|$ l$tWE$F;$} $)Qtu<|uprP $كU|qt$jt$t$PUSWV[q$$$$pЉՅtA$ tL$RUPW$,$<QhVt$t;j.l$VPQhUJPUj tWD$ hjP D$D$DŽ$DŽ$ ML$VPQj.$;$^_[]ǃPƏ҃¿+w狔у̃ǃƒ舲fS[>ot$jt$t$[fffffSWV^ oL$D$˃w\T$|@,t$:8#z0C pu(*@u@tH^_[Ë20RPu됐USWV [hnT$Dt$gL$T$ t$t$[ffffS[gL$D$ wx9wt$Pt$= [_fSP[fD$ L$ $QPP [fffffUSWV[Øft$$l$ jV荁F0u ǀ|$萐<$~Vn~.9~ƅxqD$Vj U| u0)D$$ʼnx1EVQ|$W  D$)uM))L$$͉yVR|$Wژ 7#ʴt$$N @1<$;|$t|$jV蠂^_[]1fffffffSWV[\e|$_PQV tt$WV} Vj ^_[fffffSWV[d|$t$jWGHO~;G~ t H WR9jW輁^_[fSV[Ídt$ jVjjV f jVz^[ffS[NdD$ t$QPt$+.[fffUSWV[d|$$藳thƋD$L$F t1ͺWt$$t$$PV\ŋD$t V觳/Wt$$t$$PV-V肳 1^_[]ÐUSWV([sc$LD$$$t;$Hv;$H$@xT$P j.Q0rl$u"D$$hPU$H.tD$`(T$DE$t_ЉtM$u<.uKBt(DMu.t!E茱/x.$u<:t#gj:RnqT$ u<:uNЉtu!Ǹ1>u5~u/~ -t/9uqL$Dl$@|$<|$ l$L$L$HL$,N,$l$l$PRVQt$t$t$ D$(P*k 1t781L$H^_[]Ã~MF @USWV[]$0$8 $ $L$HJ @BLt$FNV6\l$VRQPWhUWh<Ȭzōt$hWj jVP ‰$0u uuuVj PWTt$}w$0+i@ ;A7T$ B@$0p t$ V規 $0xD$@ {$0;h/t$&|$$uD$)L$L)ʃQRt$ PW~/9s)u̍|L$hPQR =t$0@ W%$0@  $ ;$^_[]WUL$0@ V,$0@ tt눋GD$fFFfGD$GD$ @@ t$辪$0@ )lRUSWV@[èZD$\L$<(px ux P踇t"D$j.PUVt tD$$x D$PL$QRPD$Pt$U貇 $tQiL$TA 'l$TU4$9tɋ;L$4$D$L'11UVH1(^_[]Ë$D$ L$@T$HD$A D$As |$L4$먋D$DA4$D$ )D$ )rD$D$DD$AD$9v |$Lgt$t$t$PD$PVΉT$訉 FL$N FL$)L$@WQL$ƃ)]L$D$ D$D$D$VWPL L$@9|$ tsL$L$wD$1D$$D$ PݘƃD$)D$Vt$t$ L$@AT$9|$uAT$D$LU4$ZUSWV[hU|$D$$0PQt4$ 4$A h荤hVl$ Ujl$UP+‹D$p pp0Wt$UVWt$ zuBF tt$ G VD$@ ^_[]VWUSWV,ՉL$ [T$L$D$(tt1 G D$Hj(1 ‰\$D$ ʼnhfHf |$9f׉t$\$$T$TPt$t$06Ƌ$Hfxx\$$PT$LwD$ D$;D$t$`$@D$L$DD$$$PtD$ $@$Du5\$P裕=$L$P9D$ $LP$HDŽ$D$;D$\$|$Lt$$9ubft$ ff $L\$Vt$Pt$3LWt$@Pj%9 돍Ef$w rM|$jPD$D$D`OUUOPVt$Lt$HQj% T$L$ t$|$$1ˋD$l$9T$0|$V$PuпtLVuPj%a T$09U |$$f|$Du D$8x|$,t$\$t$0Wt$t$t$00Ƹ1$Hfxx\$t$ x1gD$;D$$|$,t$L$(D$89r3l$8(\$PR l$8L$(+ $‰$ȃL$(L$L$t$u\$V芏T$4ƃt$ t$l$D$ )D$ ;D$4D$@$ 9s'D$@|$0WUQ\ 1l$_l$0l$+D$xzD$xil$ (\$UՎ=!Ńl$ 1$D$D$t$$|$,L$ t$\$R 1\$ t$$ t$$ˉ\$|$,t$D$(D$@$Hd|$,$D$11T$ ;t$,tZT$ :/1$Hl!9ht 9uf|tP݅uT$ tDtN9|1뚅tb;l$,}\M ;l$,tK~TlPΐ|tLf9~fTtLf|tN멋t$$L}t1L$W\$t$<ƋD$4L$)9ƿ\$Pt$@Qy~L$ Mt$$H@ }} EE E8tr˃T$4)ھ)9|P)ˍKT$PC CCT$PSx@t$ut$$ $-t$كʋ $l$()̓D$4)9s\$O$LP\$UQRT${ 4$BL$鍄$T$@)ƒ͋D$4)19s:Q赗$X;$(u@,^_[]Ë$LoR$PUp{ 1뿋t$ $1>?\$hUSWVX[H$l>Wt1T$ T$G j(¸D$$D$ D$(D$A#$1ɉ|$ D$ l$L$Pt$ Vf=ǃt$Vt$ t=ꐐ< t쐐D$$D$ t$l < t< tZPW<t1ɀ8 L$L$D$D$L$ t WPtT$$9s=ȉ\<$.u)$T$rD$09wL$s>$t$$;L$0u?4^_[]$D$09uڋD$,T$PB D$(BD$ L$$J$4USWV X=`8D_u$$ ^_[]ÉD$T$ T$0u+Y t E<)׋$$x`<$1L$D$ D$}T$uUsL$T$E ulD$;tM UE=t܉t$L$8QPRt$ T$u#D$@=u$ELM D$|$uIt$MtȍL$8QPQL$t$$D$$ʉD$|$ T$4t-E uEjjjuT$ $!у‹4$$t$E0D$ E0D$D$ u?|UPuTE)΋M0E0D$ D$ L$tKE<)‰T$Ή4$Et$ $UE8T$,))Ɖt$ƃE<$D$(14$T$uED$,))t$ $E$D$ D$(E D$$ T$4uPD$+D$D$0|>$0D$9D$}&D$,L$0ȉE)Ήu|$(T$$21+ELt$!!jRVuT$ !ƒt`EME0MtU@9tQYD$ e ߋD$)D$Uwu E+D$UGtjUNĴ^_[]Wt$t$ uT$ !ƒtˋE0tU@9t QE0EEEe jUJN1뙍E@L$ 9D$T$$tQE0U fU 뼋L$MEfUSWV [0t$4D$@u8HL$@D$\$jVK1D$D$D$E1;|$,v`\1WtztLEtD$uWjD$$)Љ$D$P1D$$tt)ȉ$  $EWt$UP $ERQUP x$EWQUP t"$tWEԸ RQUP 1D$u7}u1u-WmD$$1ZPQd  ^_[]ÐS[þ#D$ hPPt$[ÐUSWVP[Ê#|$t$t!t2ujFQVtZ$$FQVPt=T$$D$ Jt?9:t t j9zuL$(t PVу1^_[]ÐUSWV ["D$$L$ 8͋1t1uOWe<$1t0t/ƉD$EL$QUPt-EL$QUt$1;t$(MtQЃ1 $u"Pj迾D$$ $t|փt )ƋEtot`t$ERt$UP |$t,MԸ [14$D$$ ^_[]Ét$ERt$UP t$|$tϋM t$PU 1u%}uDžu4$vD$$1눉넍ZPQi1gS[þ h(#t$t$ [ÐUSWV[È |$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[(|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[x|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]fffffSV[mt$t$Vt$t$t$~>.u^[ÐS[.t$t$t$t$t$:[ÐSV[t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[t$ t$ [ÐS[þD$t$ P[ÐS[Ît$[ÐS[nt$Z[ffYOÐX/L$T$ ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$PQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$w;t$b\Gn߃^rxo;l$1\,, $*wkdT$Ɖ*t$i $*wi (Ћ4$Wm;|$Yȃ|$ U(!Ћ$PQV xuD$ ƋL$$QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$c(^_[]Ë$ncᐐS[>jt$t$t$[ÐUSWV([|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ X0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[ÎL$T$ pPt$ [ÐUSWVT$[Rt$4L$|$0\$t4D$0|$"v$?Q1T$\$VP@u+t-u!$$l$0tC$l$0u20u-  PQS[fffffSWV[ t$|$HWV0 ^_[ffUSWV[l$|$3PQVs t"t$UVw VjjPW׵PQVs ^_[]fUSWV<[U$PE$8FNl$u @QP4N$TolȃFFD$$L D$$Vj P!k1Ʌl$t$ D$D$ D$D$P$\Ǎ8t$8jWPhVIo=hV GD$t~ƍEPV&GtHL$ T$RQWЃ D$t3L$ t+tCRjQP.l$V D$;lt PFD$ u QPctj 4$|$|$|$|$|$ l$l| |$||$|4 l$t t$ jQP 1B4$聙D$t*L$tt$ t$ уD$;lt PEE;$8u ȁ<^_[]dS[îD$ L$01g[ÐUSWV[xt$,NtpRQPWn~1D$D$ D$'D$D$$t$Gn;~F4U,nFDtt$nFDtu&u8tMt$ mFDt4$mFDtt$mFDXt$mGj l^_[]ÐUSWV[ t@11 t5D$0etz 9rԋ u(1ɋ I `QP茑t6 Il$u}ml|4 t d_<.D5t>ot'1t P踖9tGGP蠖GT$JRWO1^_[]ÐUSWV\[|$x|$|$볅t V螑ǃ ǃ 蝗$02 t\Qj P D$HL$L  t$aHt$FĔ^_[]ÐS[ÞD$ L$01r_[ÐSWV[l|$t$wv4u 76._^_[fff̀rS[$x[USWV[|$ <$D$l$$pt$L$T$(PVUWt$<9t; $+t$ ;"1^_[]ÐUSWVP[zt$;8$l$ L$T$$t$,PUVt$8=9tL;8+t$ ?;"1^_[]ÐUSWVtՉL$^$D$ D$p$$D$t$$E<%t#P$9HE֐D$D$ 11ɃuۃU|$ u1ǐ u1ɺD$D$D$D$ D$ uXl$$yqQi|$)Ÿ +AD$(ml$$ƃ|$ Qiʐ)mu;i)\fɁf=mD$( 0$Iʉ) i͓$) )҉)у}9)l$|$ OQi)l$$mi)\fɁf=m$@  D$̉ l$$IʉЃ|$ g$ V L$ \$فt$DPQ$j V`$99u\$bk $@ D$̉ $@  D$̉ l$$hQkd)<4 kd(  $l$ \$\$D$\$t$D$qP$j V_$99u$H*R )tȋL$ \$فt$DPQ$j V:_$9<#9uD$\$t$D$qP$j V^$99u\$HQ;D$\$t$D$1P$j Va^$9cS9uB\$ $H+HA$I ȋL$ \$فt$DPQ$j V]$99u$@t)$p$IЃȋL$ \$فt$DPQ$j V4]$96#9uD$[l$$hQkd)<4 kd(  d\$ \$$l$ $~  \$<3D$ ~ Wt$Iu 1\$Pt$- $$9\ \$  9u<$N $@ D$̉ D$DD$D$\$t$D$q P$j Vx[$9zc9uRD$\$t$D$q P$j V[$99u$@L$ \$فt$DPQ$j VZ$99uD$\$t$D$qP$j V?Z$9A39u"$H*R )tȋL$ \$فt$DPQ$j VY$99u$@L$ \$فt$DPQ$j VJY$9L39u"$9 9 $91$y L$ 9uD$L$\$7$D$DAD$HAD$LA D$PAD$TAD$XA D$dD$D\$Pt$,t$.RPQjVW$9)9u$9 9$Htȋ\$rt$DPQ$j VW$99ur\$YL$$$Wt$ $ƒ8\$rt$D$qP$j VV$99uD$DD$D$DL$\$$PWt$ $H‹L$Dtȋ$;t$f$$xQkd)Ѝ4 kd(+dF$z  D$D ljNj\$Pt$!ƒ $\$މǍD$DP!ƒ)L$D8$9_ C9u2$Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$`Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$6L$D$9 9uL$Dh$9 9u1 t$l$u7y3$9a-B9B09<\$gt$DRP$j V S$9 9u1 „tÜ\$ \$$l$u2|$ y+ $9-A9tfA09t[ $gt$DRP$j VNR $9\$D9u<$5L$$9 9u1fɋ\$hebf tƜ\$u7y3 $9-A9A09 $g|$DRP$j W)Q $;$9$u䋄$$i$$$$\$\$P1|‹$1‹\$gt$DRP$j VoP$9qc9uRHx1gt$DQP$j VP$99u $L$ 1gt$DQP$j VO$99u $\$1ƍg|$DVP$j WTO$;$s.t/9$u苼$*$$ $W1$z 8-Є$$t9s u75\$]\$$n%L$ $<$~}\$t9u4$<$Ήƺųʉ kdk<)΍\$0VP$j t$TVM$$99u<$D$ ;D$pu t^_[]Ë\$USWV [t$ XD$P/8$$D$l$$pt$׋T$(PVUWt$<9t# $) #"1t$ / ^_[]ÐUSWV [ht$ XD$P.8T#$D$l$$D$T$(t$0PUVt$<9t# $) #"1t$u. ^_[]ffffUSWVP[úL$y~X$T$GsY11t5iFs0hFށdN$t$>-00t!t$t0J$1ɋ\$+dF$ >-00uȅVaFs0`FށdN$t,>-00t!t$t=J11ɋ\$+\F$ >-00u D$T ^_[]ÐSWV[lhRIaƅt(T$j!tVqJ81^_[USWVP[D$tBՀ:Pt=ǀ}:ju1ɉPDžF $1퐐9}h.dNPnŃ=~߿TFFF fFdžhFdždFdždNUTC><$~81퍻 9,$t".dNjEPW uƄ.dN_1^_[]ÐS[t$/p[ÐS[ît$jt$t$[ÐUSWV8[sM 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtfL9| }Z^FD$ 9߉D$ T$|$\$#)L$ #11uj+DPH(4\$tg;~N|X1Ƀ|I|$T$ 9}'4}t$;tt$t}։9|كu>L$dFL$(uV*T$iFH hFdNP(}j[1+dF GыV+D L\$jhY`QPz ӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U|Rut]9D ΋u}\$%1kD$ \$uuPVftML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐSWV[|t$W$KPbH$ PjVP W#^_[ÐUSWV[ l$t$W#T uKPUjVP ;WP#^_[]ÐUSWV[Û|$t$U#X uƃX U#1Wj(t PH(^_[]ÐSV[-t$L$t$j'ttDPH(^[ÐSWV[t$Wa"X uƃX WH"$ 1PjC't PH(^_[ÐUSWV[kt$|$U!X uƃX U!$ Pj&ttDPH(^_[]ÐUSWV[t$|$Ul!X uƃX US!t$jQ&ttDPH(^_[]USWV[{t$U!KPaGP t |3jP.U X uƃX U 7jjƉU ^_[]ÐSWV[t$D$t |3jP4WL X uƃX W3 7jj/^_[ÐSWV[lt$D$tF t |3jP4WX uƃX W7jj^_[ÐS[D$t@ PN[ÐUSWV[ût$tF |$U1X uƃX U7Wj^_[]ÐUSWV,[ED$$$(=ΉT$y |F 'D$ D$l$jP$LP$LW*|$t ֋|$ ωjD$P$LV*ʼnր|$t |$ |$G $@D$G~$(PjQ* G>D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU(|$u|T$jD$P$L$L(|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ USWV4[XL$HD$AD$ AD$A D$AD$AD$A$D$,D$ D$(VX uƃX VD$|$7L$jWjj'|$uL$jWjj~'|$t1ՉNjt$0|$ xt$ |$H4^_[]Ã|$(xۿ뿐SWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[$PpT uKPl$|$P tABR lP~;yQq|1)͋$P^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[kUT uKPL2|$t$P tWVP ƉU^_[]ÐUSWV[D$D$fBt π?:t  ?:u$,?/4$\$u(\$jW:\$ WS?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrD$\\$hWP8 j.W5tU\$j.Pt59tx/ux.uHt/uэ|$H4$$," 4$\$h@ WǍD$HhPW8 +&y \$~ 0\$W2D$(W gdND$4lPD$0T$LD$D$T$#D$ D$`T$a |$b L$cy ρ D$\T$] t$^ L$_y ΁ Ήt$D$dT$e l$f T$gy Ձ D$hƒt$i L$j T$ky с D$lƒt$m \$n T$o|$y Ӂ D$pƒ|$q t$r T$sy ց ֋D$|$1T$1=y\$$ZL$ʼnL$,ȉ\$@ÉӍ/L$‰Ë\$$[B,9D$(/D$ D$tXD$t‰T$4$\$T$HЋ|$)L$(hL$,QWR5|$#D$ {|$t9D$t9$T$,HXp 1D$uT$1l$t= $Ƅ9>l$ $\DT$ՃD$ 9|$D$ Mȃl$uAT$j ŋD$X l$EÁy] ËD$h ݋D$X T$j ݋T$R l$] y M  É $Ƅ9>t*l L9݉9@1l$l$~iD$9T$$4$1><t >nm^9};|$ |$ 91L$tL$T$14$|$\$$L$ L$T$|$F1\$ ʃ{ s {y $dFJ|$,ӄiFRN 9hF9q\$T$N 1ۅQ΃1rY̓1$\$;8dNT;8eNT;8fNT;8gN9u\$1ۅt"|$41D$(/9uD$4$T$|$1ƄfNfDŽdND$81L$0L$<1ۋl$39l$l$@L$:.>unM߃$iN$\D$1. $tDA)>ii;T$tyl$lp $ Y I|$0,~;uM}|1ۉȋl$p{<$L9t }`$@\$ ۋ4$.S؃1Ƀ1ɋVr<$w̼  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF4$91tA ́ 1ҋ4$v~$x<ыl$hF$dF4$9ũ~ 1\$jUSWV։[átK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR $Ec\$zjt$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0V] >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$iQL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$t1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށh1i4Q9uB ^_[]ÐUSWV0T$ $XAD$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$ED$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$)ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ %麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$})jhUt$ }T$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP|)Nj\$jhUt$|L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ jt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPz)jhUt$zU\$T1ڽT$\$jjdURz)jhUt$zt$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$h|$ 9|ځl1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$4X D$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jPn~ e1^_[]fUSWV[Ût$1tGl$)Ήv,|$ Wt$T$,t1Ʌ~|$ 1^_[]fffffSWV[,t$d W1t1jt_L$T$PHp  1A"  xuxt%txu8u롾W^_[Ã눐USWV[xd D$ P}   $ L$ L$ǐ|$$tD$$9G t GtO  tGwЃ GЋ 9t DžuZ u';|$r$;|$s<$$<$C<$1 t$ n u#t7W-u^_[]ÐSWV[ t$d W"  xuxt&t xu8uju $p@@  1W^_[ffUSWV[e$$$D$$DŽ$DŽ$$ jP$<jPDŽ$TDŽ$XDŽ$\DŽ$pr$TK1D$$d$t$l$x$dU$$P$d;$u ^_[]S[.pt$t$Pt$t$[ÐSWVP[D$L$T$t$ 4$pVRWQP]^_[ÐSWVP[ûD$L$T$t$ |$$<$WVRQP^_[ffffUSWV[{t$}XjWkE`HM`~;Ep~ t EXHMX WRjW4^_[]ÐSWV[L$B`pr`~ ;Bp~ t rX~zX XRQA^_[fffffSP[ÝD$ L$ $XQPR[ÐSVP[lD$L$T$$XRQPVp:^[fffffUSWV[(T$(|$$t$ t&t"T$(qTN @1tVt$jRҠL$0A <$uy‰Ņf1qyQuE)ljuދl$$1$)1t$ ōACAAAjQdxՋ)v1WPVOL$4 9l$QHu0}T$RPVΉ )~>jV l$$jU$+D$1t$ ʼn^_[]ffffffSP[íD$ L$T$$RQP[ÐSVP[|D$L$T$t$4$VRQP8^[fffffffUSWVP[:Pt$ 1ht$t$ x=|PfF FfFfn vF$F,F(F $tjjjVx^_[]ffffSWV[l|$jWew jWa^_[ffffSWV[,|$W;D$w+t$9w 9w9w 9wPWV  ^_[{fffffSV[͂D$;D$wt$ Pt$Vyi ^[\{VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[Äx[USWV[kt$F0u ǀFFF tVu"V]tA aV);F|V0u?1FT$i.;Ft F t uVu^_[]fffffffUSWV[Ût$|$l$jU茛pWVPUjU}^_[]ÐUSWV[@u}D$d$G0u ǀD$?$u 5$G tu)$Wt 3G Mf LfA$`$DŽ$tDŽ$x$|$jPR$jPDŽ$DŽ$DŽ$$hh jP G f$Gf$G$G,$GD$$`$$DŽ$DŽ$DŽ$$Vuu WBƅxW賓1Ƀ ΋D$d$@M42I @+2D$,E$T$tT$D$D$D$DŽ$D$`D$XD$$D$L΋$T$ L$L~1Wt%t됐t\L$L)L$T0T$ً\$ 3KT$L$)Ɖt$T$r/9u8D$T$tT$ L$TZ\$ T$C$D$Pu3\$D$D$T$tT$ T$0/D$#Ƅ$7D$LD$01҉|$LƉِAσ s&1)y1ɉL$0T$to`, $' $L$4D$#L$0L$Dt$T$8$8|$@߃ЍT$t\$@مD$D D$0tD$0ȃ|$XD$";D$XJ9D$@@1D$PӐL$H11Ҁ{D$D$8t|$@)D$8T$PD$D$Hȉ|$@9 $L$4%D$D$@D$PD$HD$(1_)+$9 \$Ѻgfff)À0eT$|D$D$T$ t1ɉT$ uT$|$ D$1D$D$tD$ T$҃\$P)ӃT$H)‹D$X|$4ljT$H‰\$P|$HD$D9NjL$ w}D$XD$4D$( D$0u1$$`$`AϋL$D$D$L$rDW$D$PR dL$|\$D$D$T$0b$jj WQL$2׉ T$)ʀ0$D$4$D$XD$HtA$D$Pu#aT$|\$D$D$хtM1 D$ы$D$0))ˋL$|$|$ D$ G ~r$ȪCD$ D$L$rD$ t7$D$PuZ`T$|D$D$Ӆt1ɉ넋$ȪCT$ ‰T$L$r;Ѕt?$D$P}W_\$D$D$L$tt#ً$T$t$D$ѐD$(%|$8ˋL$|$D$8$Clj|$L$}$$D$PWC_\$D$D$ljʉ|$8G ωщD$8l$CD$L$r1\$tt2$D$Pu^\$|D$D$tZ1z|$$}t-$D$PWb^\$D$D$D$T$t=}t$$$t$$|$}t$$$t)$D$PW]\$D$D$ucD$u[bD$TD$T}t$$u <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZ4 t$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v PpE|$8E|$8|1 uT t$ 9wS$w닔!wl$Pmt t$T l$PU\ / U| 룋$L$19u $P+<^_[]þUSWVP[Ø?D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$蒁USWV [F>D$ 069rljT$D$uj$jWPhv (9$T$JHJHJHJHJ H JH RPE$jWPv 踌(豌8t!觌0t$蔌0*)4$PjV%p $L$D$ 81 ^_[]ffffUSWVP[#=EET$@t$DT$$pU }("jjD$܋,T$\$8t$<EΉ7tƉP1t?D$|=WjPo )jRPA1 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]}USWV׉[g:l$XtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[S9m|$hE t$p |$<$_ MM$U<"jjl$l$܋,|$Xt$`MƉ2t|$D$QC-t?ƃ|$|=FWjP4k )jQPe- o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[] yffffUSWV[ð5E|\$t*\$4u=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$msNjD$L$ttW% ?L$@\$D$4\$j؋E\$ju P") mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃(܋4܃<$ۄ$܋D|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wx"D$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ R&D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃,ݜ$$$$$݄$D|$<ػ|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$*bM |$ ؃0D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃L$T$vثv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋4|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jqbwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$PcWD$P3bW)^VD$P؋|$ |$(|$ |wD$0ufsD$\$t$W_c\$ Džja|$|$l\$WP!c`؋L$1ҋD$DD$4D$RS]D$t/L$4t9t\$Q2]D$\$P!]\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$t_ )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$;\T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$ncD$T$|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQNt,D$$D$H~$Pt$ND$T$ u 1T$ |$tr $t$Q"PT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ O\$L$ʅ|$@'D$D$8|$LD$D$0L$PRMDž~#T$?؋L$؃T$$jj QF |$@c΋$jj t$F ‹D$8 |$Dt$$$/L$|$D$D$t$QVED$ t.L$t9t$Q6ED$$P&ET$%T$$1|$D$Ȁy0ItL$RDL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QRD jt$ LM|$D$ D$$t$|$ W_D$,t$W^Mt$ t$Mt$t$,k$jj PD ljD$ D$L$L$D$D$QPƉ|$Wt$ Lt$ t$7Mt$,N0L$ x $tPbCL$(T$D:Pt$ LV9CT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj PC D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VB D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$RJt$t$z|$D$ jj QA D$(jj t$A D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPH\$ht$D$ PxIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ GD$I$t$t$ |HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[< D$1r 1 9vW<t8Ɖ^_[ÐSWV[ D$1r 1 9vW;<t:L$T$8ƃXt𐐐Xut^_[ÐSV[M D$ PHpR<^[USWV X T$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RU%E|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[NSVH[%D$0hjP: D$(D$,DŽ$@DŽ$DD$ D$D$$jPjY ML$(VPQjD$$D$ D$D$D$D$D$jPjM jLjyMS[>S[fffffffUSWV[D$|$1tt (h1^_[]ÐUSWV[À}uuU\$D$4PDFD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$\#ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ"t$(PV'T$4D$(PV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQ( D$p '3 |$4t$N  D$0P QVR\( t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP" 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}!"P"L$D$ffffUSWVt$F98[Ý |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[óu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[t$D$T$<n~,D$9r9s#L$9w)QjP. ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXǀ ǀ fǀ ǀ9 fǀ= ǀ fǀ USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[üD$H~( 1u 9r1$PƉ^[fUSWV[[L$P`ƅD$t/Fn?t P&FF ^_[]1?t P&d )ʉʁ oΉoUSWV[[t$tbF!r VpO<}t3 W=&}Fܽ ܽ tW&ܽ ܽ ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[Hl$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR= E!r&UnE!r\Ukn1<} $P#}T$,Bܽ ܽ ti4$#\<}th $P#1}Fܽ ܽ t14$}#$ܽ T$, ܽ D$TG^_[]Ëܽ ܽ 1␐T$1Ɂsrr@r"y(6s@sރx @tS[Þj,tL$H@[ÐUSWV$[hD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rUg<9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [E\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[$| 1P$1jjUA ʼn$tƒ9t t)D$P$vts#D$ =uXitZfx $tu f~ $fFvF$F,F(F ! OĀ^_[]fffffffS[޼t$t$jt$[fffffSWV[ì|$jWGHO~ H0 WSjW^_[ÐS[ND$HQP~ Q[P[fffffUSWV[ L$atrt!w 11Qt_tGҍzw$@ؐ+u˽뿁뷁 L$) p 1^_[]fSWV[<|$f jW*G0ǀǀ 1G t WƋO twуy y w<^G0tW@9t Q#^G0 ^G0ǀǀjWG GGv  ^_[ff̀rS[4x[SV[t$ F0u ǀV"uFH^[fSWV[̹|$8u-GG Ⱦ uuL O @G0taW@9t Q\G0GG81t&W@G GGfG u WG t'HVGPVpGOQPwW$ GO fO 1!t Gf@f  fG ^_[ÐS[nD$H u P_[1[fffSWV[<t$t@1mT$ |$L$D$t#t8uӉ6@VRQWP26@VRQWP趀6@VRQWPL^_[ÐXL$HAA A AAAÐfffffUSWV[U$uThjS1$džt.%u%D$PQu1t+8$u!8u $t4D$P$UQ)VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQt|$=|F P/#FEt$P#FV EtF4Et UMtЅBt N&tEu  hV VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaF@j P ;F@NF(șdžHF DDN ȃN艆8hPjQMPV-$$0$tNCOz(1VUh(1^_[]14dž$j$EtJpPH QH|QH QH RHRHUH88oUSWVՉ[äjq>Nlj1&NL$jPN$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u1{8"m8^_[]ÐUSWV[)4jQ! t $81t>0`SrPt.S/t u8~)1 9}8tQR݋t P<VRtg81^_[]ÐSWV[,|$tOW~R^_[ÐSV[D$ p|$s t.jt$ 1dž,dž,^[S[~L$tAt[q[ÐSV[=D$ p|$t?dž,1t$t$^[ÐSV[D$L$ qtdž,&t 1҃ƒt$t$a^[dž,빐USWV[h|$(D$p$xudž$dž(dž 11Ʌt f9 tSHt ()9bf|Qf9udž $뢐V($19jjUV/ Hf9uxV(9vo(f|Qh QjPQVr Hdž(fytV($9 (tdž(f|Q댺f|QRu(f|Q^dž $dž(Ckdž,^_[]Ë(|iw&jt$(t$(PVJuƺm tXiD$$ËD$ ÃrLi#dž$뀋n tD$)K$L$$)A(1ESWV[l|$tu^_[ËD$tx4t&jjW uЉuLJ01뷐USWV[|$(o(o(OG0!D$;G9} $wD$D$ P<$L$L$D$QPt$= $L$QjP( t$L$D$ GjwE $tNG(PxO 9~ LDLDG G,9vG0 G,Ut$WY ^_[]ÐSV[ýt$ t$t$ #F,;F(~#F0^[ÐSWV[v4aA@j P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>N 7l7\7|7<7\7l7L7L7f\7ff\7fL7Php0hPHHPfhfPhHHP h p ph P H H P hpp h PHHPhpphPHHPhpphPH^_[]Át1f9v|pff|p<0f\0ff0f|0|0f\0ff\0f|0D0t^ ~ N n n N ~ ^ N f~ff~ fNoUSWV D$ D$(|$$GHL$H hd$Z1f!fDp9t$1\p<ɉ LflfflfLLtÃtID$CcL$K cCD$CKfkffkfKL$V ;L$L;L$L;l;,;L;L$L;L$L;L;fl;ffl;fL;Php0hPHHPfhfPhHHP h p ph P H H P hpp h PHHPhpphPHHPhpphPHd$1ffDp9t$|p 8l8\8|8<8\8l8L8L8f\8ff\8fL8D8tO o _   _ o O O f_ff_ fOiPɉʉPHɉHH ɉH f@f@ ^_[]ffffUSWV[۔|$oEtjPu觢 EjWu蜢EtP7E EtP7DžDžtP7DžDžU}7Wt7V^_[]ÐUSWV[ؓ|$0D$,pFtjP6衡 Ft^_[]Ë 1uʃtttjj6g t$b1D$L$T$ |$# l$hxP H@b1jP6 6gY 1KfffffffSV[͒D$;D$wt$ Pt$Vy ^[\ffffffL$1s!t11҃9rfWV_]D$tL$ P14%1^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[ØL$4T$0t$,t#D$8yt9W t11҅1116n!ՋN σu1҃01Ʌt3OHOOG8^_[]ÉT$L$D$l$ D$uTD$,FuBVQV N u€thV:l$4|z<$jj-1hƋD$,p j,Ft.t D$,l$4D$0F Ftu1V31NT$,NL$N1jt$Pt$f u-FPt$UW7fnsD$$Bt$ u| TD$Pt$@V= d|$1{F(u^Qjv6[ 5@%u^jW6 FL$ QD$ PV= ;FjQ6 jv6 DžFPWjVG% Fxj16w uj_jt$D$BtjR6I 1u:/ujt$t$6 u 1$^_[]1PWpF,D$D$ijQ6Џ gl$;l$tn1ɉ $Eju6諍 UHɃ9u6jP6j $;l$u|$D$T$,D$fP $tkωʋT$LJt 0f@jRu jVu rD$1D$T$D$|$jP6蚎 jW6蝌 ;F]OD$ Pt$ V_: a/t$ |$jt$6+ jW6. .;Fy jL$Q6 ;l$t|$$Eju6΋ Mfu%jP6融 $;l$u|$2ʉD$T$fQ<$t$ L$D$LHljP65 jU68 t><$H*fJ<$uD$L$USWV[~T$0l$,t$$F( :N;M.N9"$F(  D$(ƅt$,$BfD$PVWm`T$< $E9v$,$BfD$PVW4`T$< bE9uUEtNjP7 $fD$QVWD$_  jt$ 6蚋 T$0,$fT$|$(u -,$fT$GjjjPPQW^T$L{O(,$fT$wjjjVVPW]T$LEO(EjP7 $HfL$QVWD$^ t*jt$ u賊 T$0l$,O($l$,L$F(jQ6~ T$0$FD$fFDU<(DtG PVatjGt PVatMO, F)WPPb fnT$0DVNft>uf+9f9sf9L$,|$0fugT$,zT$0)Ӊft~ft$ty\$ 1f1f9t9Yf9r1ᐃft9f9sf9yf9sfy)|$t$$\$ frR\$,t$$t$$fs>\$,{T$0f{N( 1uN; uN9vfN^_[]1fTYf9\$t|Yf9r1fY|Yf9r1fTY|Yf9r1fTY|Yf9r1롐USWVT$[RzA,D$L$\$ ;t$dFjvu $FD$Du<(DtG \$ Pt$ +_E%\$ uI}Ut$ VUV}n@$} ‰$E)QPP ` $fEDufD$ftZ\$uWً$t$fdfEt$fEE \$ jUD$0 Zf%Kt$f9$sffuwUf 3fL$1ff9tIO$f;L$r1ސftf9sfWf9sfW)D$$L$frD$$fsUfUt$\$ jU6赅\$ D$8ujPu蘅 $.PU$ut$U{l1Ʌ $$^_[]1D$"f\Wf9T$$VLWf9r1f4WLWf9r1ftWLWf9r1ftWLWf9r1뜐USWV[vl$|$Et$jP7跂 tBMHjP7萄 E1t+jP7节 tMHjP7c ^_[]f1̀ffff ̀rS[Dvx[SP[-vjjjPt$ 1Ƀ $ȃ[ffffffUSWV[u$$$ T$$xt$%Gudt$ $1|5vuN| v?2+$ $<19rj/P^tRB1ɋD$;$ȁĜ^_[]Ðj>T%9r?Xt|$W$)$hPT$RQL$$ $t 9vϐ?/(9w$)L$L$  D$T%D$$tht$U+ t*$hUS31Ƀ89t$1$8j?Pt$M tWH0tȋ $9:<D$ND$19ubD$PU3um9t$uCz3D$PUQ2/1Ʌ#D$$=@L$411Ƀ8jfffSV[rD$;D$w.L$t$ 9w9w9w9wPQV¥ ^[UkffUSWVx[ÈrD$tD$pD$lD$hD$dL$$T$dP:D$@FD$ uƃ<PQuƃƃ$;$uĠ^_[]8ZS[b P@j$jPt" [ÐS[îb P跻[ÐS[Îb jPe[USWV[kbl$j6ƃ#j61jr6j$jU! WUF!^_[]ÐUSWVhL$$D$|L$4Hpx |$8x|$9wL$T$ LJ D T$Éх҉u\$ K1ɉL$TSL$y<9|E+D$fEL$fDMD$DENɉLL\$l$pD$P9D$,D$8L D$ |$T$WPjjt$ud jVud D$ t$ \$l$pD$jPu~d jVupd u՞5jt$$uMd jt$u1ɃYh &5F,jj6X Hʁ@ TP|UfMjP6>Z jW6AX u\F,jj6!X =H+@ )H| fBjP6Y jW6W uǚbN(NPf9$fL$N,L$;|$^OjP6 Y jw6 W COPf9t$&$fD$N(uNftx$fL$N($FfD$1fOLH|jP6=X jW6@V 1Ʌtz@ t닁$fD$N,L$;|$t7OjP6W jw6U t OftjP6W $(|$FtPF FF($nf~ F(jQt$4Pt$8RV)!@u$Fjt$6(W ^_[]H@ nfOLH|jP6V jW6T uxjP6V jW6T 1xjP6{V jW6vT HUSWV[KH|$l$t$FtPF FF($nf~ F(^_[]USWV[Gt$,VT$RQ ǸD$(>  .,$OfL$ D$ŐM;tjUD$0kU /GfD$ wfteL$A ;Mt jl$l$UD$0$U El$ jPD$0S HfOD$fOWt$t$( ulHHf9Ou8pjPuT thjVuR fGOT$(‹OJ/L$;EtjQD$0JT D$((fpL$ fH1^_[]ËD$;MujUD$0 T иfffffUSWV([Eu~,jj6Q )|$FD$ VƋʋfqDBtjR7oS jV7rQ D$ L$yftZ1ցϋD$ t@t$΋Mfq Pu Q"' tKOT$뵐1ҋL$A uN1f}%L$A }ED$ 1}  fueL$ItZjQ7jP D$t=@fD$D$Pu WN& Ljt$QR D$ L$If9uYL$ItNT$ jQ7O D$t-fD$D$Pu W% t,jt$QQ D$ T$ MfW e^_[]j|$WQzQ D$L$N FE;t$1ɋ}L$Fjv7BO tVHɃ9jt$V}7P L$;t$uD$1ҋt$jt$VQP D$L$O GE;|$1D$Gjw6N jPu6D$WP D$;|$uL$1}fVL$tgL$}LHLL$fFjP7O jt$7M L$rL$1룉jWE0O D$ ufzD$tguD$DA|jQ6IO jW6LM tFP9fyD$uujQ6N D$ Ufff̀rS[@x[ÌrS[@x[Ḉ̀rS[ä@x[̀rS[Ä@x[ḹ̀rS[d@x[S[N@t$t$t$Ѓ [fffffSWVL$T$t$r ;uwt1>:8u 9u1)^_[fY?D$h'Pd'P`'P\'PX'P T'PP'PL'@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^>L$<A$iA D$AQT$QT$IL$1t$$l'l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$;L$T$ j [ÐUSWV[;L$l$~ v$W V$F ?t.GD>(77)(QjPxm F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPl <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjV7l^_[]ÐYO9D$(P(P(P|(Px(P t(Pp(Pl(@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[^8t$t$t$ [ÐS[.8t$ t$ F[ÐS[8L$T$ j[ÐSV[7t$ tA(j@PVj FPhjPxj F@FDFHFL^[ÐUSWVXu7$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8(D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojP` FP3nPtPWjPo` UVj~jUX` FPNHVLN@VDPV^_[]ÐSV[=-t$ tAL+j@PV;` FPhjP_ F@FDFHFL^[ÐS[,t$t$t$ [ÐS[î,t$ t$ [ÐSWV[Ì,t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjV^ ^_[fffffffT$D$fUSWV[ð+MD$$&yd+Ḱ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <h 1D$D$ D$D$L$8T$jjPQjRytD$8h D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$}vL$\L$pL$FL$L$L$L$hjjjPQRD$L$8T$jjPQt$R L$81 u4rjPI _UiK1D:0D$D$D$ D$L$8T$jjPQjRxt$8|$<7QPWVD$D$D$ D$L$8T$jjPQjRD$XL$ L$hjjjPQRuMD$D$ D$L$8T$jjPQt$RtD$8se^_[]fffffS[î$^ [ÐUSWV,[È$l$@D$D$ D$$D$(L$ D$QPjx WY}1|$D1҃|$H1‰|$l 2t |        t t} t{ ty tw tu ts d1`YRKD=6/( !    s#4Áp uH< |$9T$vQ׋ jjjhjPjl t+f@ fɉ9sfэ4fxtnF|$DtL$DHH|$HtT$HQ|$ tu|$Dt1|$Htt$zjWj} ,^_[]þ |$ $ t-jjPQjR#<$ ȅUSWV[+!W4ztV6u pP7ƅt3tUmuWy0tUmujWny^_[]ffS [k  u?D$D$$ T$jjPQjRt [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[kl$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQP貼OV QRP ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRPt,NQW QRP FEE1^_[]ÐSWV[D$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [ØT$0|$,D$(L$$)q092sVPG$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[èL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[Ø|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[x[̀rS[ôx[S[Þt$ t$ jt$$t$$t$$t$$t$$  [fffffS[^x[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[è$D$D$huܫET1}8XM4tI$P8E8*$$E4E0|$ 1D$L$j`QPu8VRƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$ |$ WFܫ$Ƅ$D$T\PWt.$Ƅ$8u$L$ThPQP $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$UpF !`jD$$PUF ʼn`D$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PvXt_`u|$ <5$h$PW h$PW U|$|$Tt$h$PW_ |$ u9nuqF$hPW> nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QPmD t$|$"$t$|$t$PRE$$t8^ltC$($,2D$XP$0C $0$$t?^t$t$'h;$r^_[]Ë$($,kc7$QPZC t$bҋ$0t D$TPQ$,$ $$t%(tPD$(PQA $$(1?7$($,91$u$QPB t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QPB t$|$ t$$tPBP$$t T\"$($,uWPA t$l$$t$|$t$POE$$8$j`藟t@8@P$i$t$|$t$PQOE$$t8f[&t$l$tWO$,$$t(#[?$($,t t$7$QPj@ t$$t$$tPN$$tL$$s.SWV[l tM΋uA~8t:~4~"`N4F8 I9rP菮F8^_[ffffffS[ D$L$ AQ jQ0 [ÐSWV[ì |$t$t+jP6 tH  W6,^_[ff̀rS[D x[̀rS[$ x[USWV^ $ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWV[ T$D$t#4׉9t u|$))t6t'Xt u) WK^_[]ffffffUSWVLXxD$ L$ht$dl$`1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$UPT$)rx,D$GD$\$ D$pPUW|$x׉ t$pt$ l$ Uу x=l$a\$ t$pt$ |$ WT$x xA|$;l$<l$x$\$ t$p|$ Wt$ T$x x|$|$D$؉D$)\$ D$pPVL$DQ|$x׉ t$pUVу x<\$ t$pUt$DVT$x y!!x\$ t$pUt$DVT$x x|$+L$l$\$ D$pPUL$$QT$x D$t$pWUT$x |$x%I\$ t$p|$Wl$$UT$x x,(x$\$ t$pt$|$$WT$x x|$l$|$\$ D$pPV|$ W|$x׉ t$pUVу x+T$|$\$ P\$ t$pUt$ VT$x y--T$|$\$ x%\$ t$pUt$ VT$x xT$\$ |$,tID$tR\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$L$HD$h9L$\$ t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gqD1pjPQwcM1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[,t$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øPjj%Q7SWV[lD$L$Pt prxxp| pPxtz xyV芗1^_[ÐUSWV[|$ l$9v`wDt9xtNȅuT$81$Xq3B<B1*׋PtIQPEjPQD$ pD$,@KL$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~yAObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p$ D$ L$Q$ЈA1ÐSV[t$ V P:tHP tQ P V1^[ÐSWV[Ìt$>gthGt tww$Ѓ gpNjPQwH;u<tww$Ѓ RD@^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[<D$t$tA|$1ɐt 9u)tPjQ" ^_[fffffffUSWV[t$0|$,ttq>TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P\ Pt$8=t +l$1jt$8? 1^_[]fffffffUSWV[D$(@x>T$$B tzu?Rt*= =F \$L$()}u(D$ $L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj W t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$ T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RDT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QP3T$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP# D$$ $t$$L$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ffUSWV[|$tpjWG 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;HWD PHWD89 jW%^_[]ÀO @1USWV[t$N 1tT~tM.)>1uFFtUWvV, ~)uNDtvу N @1^_[]ffffVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[t$8u-HN uRt8F0t~@9tRF0N FFfN ~u VCN u1uVVF11+NN^_[fffffUSWV[$$G G$=tUL$QPxC#T$ L$xt+OLuo(1; $1D$G u9tiU6z. Go,$̀|$t)OtPt ,$́f o GfxET$PQj@R^1ɅD$PuNP1҃/w,|-D$1T$` DQt$L$ QjhjjjjPv |$ t:L$u $O GCGG;$u"Đ^_[]ùT$tщ1vUSWV|[ø$$$F=tYQPxI#L$1 ED$ht1FLu*N(1; E|^_[]fffffS[jt$ [ÐUSWVP[<8|$t$F0P=F0P)A9tnPjAF0Pt8PQ>jt$bA@N0PǁTt!ǁXN0TtXXu\Qj AN0Q=^_[]ÐSWV[<8tR|$G0P<G0P#@O09t,Pu' @O0PǁT 1T1Q{<^_[ÐSV[M<8tJt$ F0PE<F0TuǀP8PA=F0P<^[ÐSWV[<8tn|$t$F0P;tF0Xuj\?F0TuǀP8P<F0P{;^_[ffSV0[JD$<L$,QPF1;T$,uȃ0^[ff̀rS[x[S[t$ ht,@t$A [ffffffS[îL$T$ pPt$(t$(t$(t$(t$(t$([ÐUSWV[ht$DuT$D$0ut$t#r 11Չ90D$.0t$Ht$4l$U|$W!D$T$08t /|$8l$4/L$u $T$ 9tF\$9T$|l$<9݋|$@} uL"Du$8tV݉*WT$9L$|l$<9Ջ|$@|ωՉ^_[]ÐS[.L$T$ t$(t$(t$(t$(t$(t$(t$([ffSWV[|$jWt tVW21^_[ÐUSWV[Ûl$jUtt=ǾqtUWU6t1l$UPt$  "19s#[.D.8^_[]ÐSWV[ |$1t,PWJt |$t=t=tƉ^_[ÐSWV[ü<t$WQtPWa V^_[ÐSWV[||$GPVqtƉx @<VPW1^_[ÐS[.<t$Pt L$ 9H [1[ÐUSWV[D$01t:>t41 |t$t$ t$ WW$ uD$ <=u.|$$  9ttD$0 M9u; s|9v9tfP蓀ǃ ǃ $jWPU ,0,8uyPD$0t$ )$jWP +0+8u4)  $PjQK $ L$ ^_[]ÐUSWV[H t 1t0<DtPVt Hى|$<jjD$P tE t5jVt$^ F: tVt$cV~ŋD$ 9tP~ǃ ǃ  UjP  ^_[]ÐUSWV[+81tR/tL,t4t$t$U! uD$|=uօt D$1^_[]ÐUSWVP[ê|$1|PW tfƀ<=t^tR)tI1 $ $lt+Vt$U u|5=uمxD$8.1^_[]ÐSV[LP4ƅt(0^[ÐSV[ýLPF4ƅt(0^[ÐSV[}LP4ƅtx(0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffSWV[t$D$L$~tQPR+ x FPVTf ^_[ÐSV[ít$ F tBNtjjjP !ƒtF '8u;F %T$L$%fF vtRQP) ^[øUSWV[ t$D$L$|$ ntWQPRt !N tfN FPVT fN ^_[]ÐS[ÞD$HtPV+[ÐD$L$AAA USWVP[JD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[D$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[hD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[L$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[(T$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$L$$t6 ruLQU)e$t?$L$Uj$19L$^_[]þT0ېffffS[T$B=s`DP[Ín[ÐSWV[æ$lRQPhWV W] PWj t;$uĄ^_[{ S[.T$B=sD$ DP[Ív@[ÐS[T$B=s`DP[Í[ÐS[ÞT$B=sD$ DP[Í[ÐS[NT$B=s`DP%[Íf[ÐS[T$B=sD$ DP%[Í[ÐS[îT$B=s`DP[Í[ÐS[nT$B=sD$ DP[Í[ÐS[T$B=s`DP[Í8[ÐS[T$B=sD$ DP[Í[ÐS[ÎT$B=s`DP[Í[ÐS[NT$B=sD$ DP[Í`[ÐS[T$B=s`DP[Í[ÐS[þT$B=sD$ DP[Í[ÐS[nT$B=s`DP%[Í[ÐS[T$B=sD$ DP%[Í.[ÐS[T$B=s`DP [Í[ÐS[ÎT$B=sD$ DP [Í[ÐS[>T$B=s`DP@[ÍX[ÐS[T$B=sD$ DP@[Í[ÐS[îT$B=s`DP%[Í"[ÐS[^T$B=sD$ DP%[Í*n[ÐS[T$B=s`DP%[Í4&[ÐS[þT$B=sD$ DP%[Í=[ÐS[nT$B=sDP[ÍH[ÐS[.T$B=sD$ DP[ÍPC[ÐS[޾T$B=sDP[ÍZ[ÐS[ÞT$B=sD$ DP[Íb[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[$x[D$t8t9@€tuuuuH+D$ffSV[úD$ D$D$$jVjd  uƃ tjjjpjVj# jj_fffffffSVP[D$L$T$t$4$VRQP ^[fffffffSV0[ڻt$̀rS[Ôx[S[~jPt$t$t$)[ffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐWVD$$|$t'L$T$t$1~961Ʌ21^_ËT$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐVD$L$ t|$tT$ t121Ҁ9 11^ÐD$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fff$D$4̀D$̀fffffffT̀rS[$x[PS[ [fffffffS[ް<8t3[Ë[ffff̀rS[äx[S[Îj1[ffSV[m u# V<u1 ^[Ðfffffff1ÐÐ1Ð1ÐXϯÐ1ÐÐUSWV([È|$@t$< xf HwL5 uҋ Ȑ 밋 t5 t* 9s8u+h ƃ D$ D$$D$ D$D$D$D$ $ D$ fD$  D$Wj(Pփ4^_[]ÐfffffffUSWV[$E$ l$@$D$$$D$1D$8t$$σ EF <%tL$9sL$א$D$D$ |$0\$Eȃzl5M*.Q1 w#1BMQЃ rx뫐T$ 1ېAEȍQЃ r\$T$ \$^ L$ tȉD$ C $:L$L$D$!\$ $+D$ $ $@ $1}lu $ $ $ $D$yD$$x.uu uu@u0L$8L$T$ A9T$L$f8͉L$ L$у $$ҋ|$x;u'u u&@wʱ-L$xL$ L$11ιq $D$OK $D$UL$ l$,L$L$D$LD$cWL$ $ɋ|$ $u"u su @tD$11l$,l$muQERjU :)9 $lj-L$ $ɋ|$ $u"u u @tD$1)L$D$8 $ɋt$u"u u @tt$1l$,L$L$L1ҿl$L $~|$D$ $L$8D$x1{wD$1gOL$ փD$t$ F~NL$T$ u $ $ʃuʹD$$T$ |$҉l$,|$T$ x$$ u$|$ !tU$>T$8 MÉ19Ɖȉr$򐐐t$ À019t$ rӍi$tz0tu0n $rFNj\$jj VPo4)0M1ɾc9ىr0E$)T$ 9‹t$$L$ǀ|$tD$ D$<p $F \$QU $1҉Džy1D$D$s $tD$ T$ D$9s 09r9s 09s9s09r9s0붉L$L$(ʃ.D$9tfTFl$@E;$u ^_[]ÙfUSWVP[ 1@$t5h$~xX~f tWT$ ^_[]ffffUSWVP[ÚD$l$H1 m \$D$H1yt9~u~f;{uًv;suD$t~u밉΀~t뉋t}u ~vD$$*jt$P` tAt=}txuHT$f;Ju׃xux uxuxu1^_[]ÐUSWV [5$,$Vf1f $$0~ )$,$0hL$ QWPV?x[9wQW葇GP肇;$$u;$(u$ D$ PYmȋ $ $1 ;$u ^_[]іUSWV [$ $q if;$$$(J ;$,Ѻx$ #ȋI(ux(u ff9<$|$~hWV$0W$0ЁxS 9wIV'FP$,$,PW|$Wu11<$<$;$u ^_[]iUSWV[àED$} D$0$u\$ jVY=~ t$t} D|$ d|$ QL$0 ;$e^_[]ËKu at8\$ X^VjjP Vt$Wu蛋]KCD$L$|$D$|$ D$9C y{1K ꀉL$9Otr:L=t&/Of;L O;Lt<Of;LOЋ\$ jPQT$ [T$ ] L$]DŽ$\$ $Q$QPT$ T$ ] ut  L$}:Hu[t"uQL$~f;HuF$;H4L$~f;Hu)\$ jP$PZT$ ] |$ u}<]fǃC ~lvr‹9‰}FfDŽS| tًt tȌt tȈ4 | |Ȅ|$ tȀC fD$ D$D$@L$#=@\s t$t|$| t$K$K$KS$$L$fL$<މt$vZuDD DDDLLDVfVL$уutt4؍<؃ǀ 뗋t$Vtȍt$| t$$]D$D$$LDD$D$$4$4$4$4U$0R&UG=r,j$ a;$u;^_[]Åt|.u|$UPQhWfpffffffUSWVX[x$L$p|$lGtG ,t$x6zt$|yPVt$|UQ$$E$ 5BBW(fG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$F[xnNj$L$|PQz_$L$xPL$Q]_$ǃ$fB$) $W 9$A A L$|PQ^$L$xPQ^$Pj^$PQ^$ztQ$Wt$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPYƅxՍ7Pj ^7Pt$]7Pj^7Pj]$ 1۸$IUSWV[{ul$ |$t$D$@tPnK) l$$FPj)E]F|PQ(]fFD$@ u1ftPJVP\Vj\G fffG )^_[]ÐUSWVP[Êtt$0|$$T$ l$D$@t%PxJT$$׉)Ή $9|bL$(B9wW9vSD$,UP7\EPt$V&\EVt$8P )WP[+t$ ^_[]fffffS[þsjt$ [ÐUSWV[Õs$ $D$0$jU1[Et U uEEEj!U U fE@$hjV̥ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžh}tkǃhpjP< EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jUYD$ djVU APƅD$$}`hVW聁 ƅ_EH}DM\D$ 19s( w X71҅tމ8D$ Ϲրwr tt$$D$ P$tPǍ$WhhP E`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$Ph A$<#t<;t΋$doma1$in $sear1$ch #Mj P$P/ $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P5 $< t< 0$< w 7A< vhQt$~ ƅ_ZPt$dD$ kc$< t< H$< w&`8A< vhQt$VU~ ƅ_j V}tuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< tXPV$< D$<@@@@ @@D$@D$8j5Pj j$PD$PD$;t$ s E$EtJBP,>EDt%uHgPWIu퍃hP=nP҇t]V[ML$0 ;$u ^_[]/_USWV[kgt$xP&džft91 9s)tQDŽͅtMtt|`9ut覺xt P蒺W džtP džf^_[]ÐUSV[dfEu0 jP y$D$F$F_fF e^[]ÐUSWVx[fEL$ L$pu0 D$jPxD$3D$fGt$V@,jWVd, VW4GL$ ;L$pue^_[]*]USWV[ket$xP,dž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[DdD$Atzt$0UPx EO $L$(T$ L$L$L$ F< t< tjt$Vf jPVL j PV2 vjPV &j PV j PV jPVʩ  jPV谩 jPV薩 j PV| jPVb VjPVH &jPV. .jPV 7j PV  >xjPVݨ KjPVè $`FPP5d$/FPP|Gt^GddGtAPt$'F P;P|GGtPQ7< < {$H׋$ut$0UP~ $sP)7뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]A#PV ?r?D$PVt$Qp D$L$Ƅ|$A#PV输?r?D$PVt$p D$L$Ƅ($H^_[]ÐUSWVx[`$$l3( h3$ p;, t|OY9h@t)Y|x$D$D$%D$ D$D$D$l9PjjjQt_tt.l9T$F( th 9tF F$FW( r R   ^_[]19u뫐S[>QPR jSWV[ì>t$8 t3 9t^t, z t$[ÐSV[=t$ t> t7 9u ~t vV^[19uΐS[Î=t$[ÐWVXm=L$ tsAQQBQQAA, tD 49u4 4~ v  ^_19uSWV[<t$trT t/<t) z l$ E)VPP f}T$$DUMft0uf1f9sf1Kt$$fums)̓fftg,$T$1f)f9t9Qf9r1ᐃft1f9sf1qf9sfq׋T$),$fs$\$ sl$fs1^_[]1ftYf9tljTYf9r1f4YTYf9r1ftYTYf9r1ftYTYf9r1럸ffffUSWV[K)t$nEtjPu7 EjVtE 1t u1@u|)vm1Ƀ V“t^_[]ÐUSWV([È(t$@l$<}GtjP7Q6 G ujUj0 81qujWjjjZ 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$Px L$9jD$PD$P밾L$jPQUUu*t$t$x ;D$uTjD$PD$PˋL$O$t:jjj~Y!уtRPi u !1(^_[]fffffUSWV[Û&|$ t$tGw#jPKdžL$G|$$1D$@DA,Du!@Mu:O}GQWPUVF u^/|$$KQ;v RPt2MQUQRPd EG/1^_[]ffUSWV [h%|$(l$ E,D$jju<1 $1\$>\$LHQPu2 jt$u0 @ )HfOTH9t,y;l$$vًl$ $Yf_T$|$(<t\$M)1ɋ\$+Ps$tg;l$tY1<Eju6/ t%MLH<jP61 ;l$ur $1MED$$)fE ȃ ^_[]fffUSWVP[Ê#|$ L$T$iD}w QR jM $uJ t t})Ƌ $9u>EDEf $fDMftMftMfMB8D$H1^_[]Ë $LM))PRQ T$$ fL}1fD};<$L}D}ftfL}fD}ِUSWV\[x"t$pF D$=tD$jjt$|V襐D$4-jj$V耐L$4I H Q*f\$D$<@D$01D$t$D$T$$t$$D~ L$ ~)L$t$0D$ DF)D$D$ Ut$HPL D$ L$ f FD$L$)ȉD$.Qt$P L$ Af,FfɃًT$уfLFflF $T$$tz*9 $f|zz t$)ŋ\$UL$HQt$x x ;D$tT$$DzL$f+L$tH)ЉL$ *\$VPQW ~ff+D~t$frflrD$ $ $t$t$D$9|$1ɋt$4L$4yf $T$HCT$$D$,8蓶뿐USWV[T$B =t $|$ t1|$,t*|$$|$(tMj<tuW"T$ D@aHf=tfWtfO1 ŋJDHjWPV&t`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPV{s+l$͉ $l$,t$0t$ED$9G u*D$G4$P L$,1TSGDHjWPVr t&dž(@f8u$dž  ^_[]ÐUSWV[6zA =tl$$G)B fT$L$D$ uf͋t PY,$Uj腠|$(todž(dž $FDGjRPVqtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$4R^_[]DGjt$ PVMq t׋@f8u$dž wSWV[ü|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[fT$$wA =tF)G D$ *$Ffu^L$t P胥4$j谞L$t$,t$,jWQPt$DFjWPQ ptjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $aPЃ^_[]ÐUSWV[l$0|$$D$jPj t{t$ ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-11-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/netbsd-11-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/netbsd-11-llvm/i386/20260627201257Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/netbsd-11-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndstrdupO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)destroydescribeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotestildeshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openUsage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/netbsd-11-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.File%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALLeq!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %spgrpbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20260627201257Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-11-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/netbsd-11-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260207%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldWriting to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.0_RC5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.The set "$0" is optional and not included on this distribution medium. This is not critical and installation will continue. You can add this set later, e.g. by downloading it via https from the NetBSD CDN. Optional sets are: debug/debug32 containing debug information base32 containing support for running 32bit code on 64bit architectures test containing automatic test programs manhtml containing man pages in html format Some architectures offer different CD vs. DVD ISO images, the DVD images are complete and contain all sets. All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.0_RC5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.0_RC5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlolo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %spkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1134: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1181: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %sgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemptemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtopbuf != NULLlen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initaddr != NULLsa_in6_init - %s /home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/netbsd-11-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist