08Pi'&<  'ie0\P''`'3. 3.i'&P@@<@T 08Pi'&<  'ie0\P''`'3. 3.i'&P@@<@TU i`'3.ppyAiiiQ$f iiiRAiiiAiiiAiii4AiiiGAiiiHAiiipAiiiqAiiirmKb$iiiX`hpx@$iiiS$Diii (08P$iii@HPX`hpxQ$iiiJAiiitCiiiuAiiivAiiilmiii (0\$iii5$iii8$>iii:$iii>$siii@$iiiEAiiiJm iiiPXI$iii`K $iiihAiiiwAiiixAiiiiAiiij$`aiii$iii@y$iiiHP$iiiX`$iii$iiiW$iiig$iiihAiiikAiiimAiiinAiiioAiiipAiiiqzMzLY?$5}p"GxřxHTT (087"Z819$0 D-H@L<: =%WE@+/ "[W.@8N  8C3. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4_$4 (Z4Z4P!!44#11 TTT,,#11Ptd(QtdNetBSDAPaXU SR ffffUSWVP[/-t$$ujPjjjjr0F $u0& Q/tu1\uk;,s,9rD$t PP;s9rLP軡$06v@ PUSWV [È.-A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]mUSWV[û,-;$s'$~*u.UE9r^_[]lSWV[l,-(;s9r^_[f$SW&,-5u1ƃ54tЃ$t $k_[SW+-4uYƃ4(t|$ <$kt8?t<$k(tЃ_[WVD$0tP>tKj/Vt@Ƹ!!(%PVot&uVh!h!hLf2k^_`SWVh!h!hLf2E 1۸!!(%PjCPrFhLf2j whA$hLf2 uhLf2j jݙD$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5,n2iY u$1^_[Vh!Vh! 5(n2h!jlwVh!j,USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S`%mtutD$D$$D$% D$t$@N D$l$h0n2h $踘D$ @l$0tD$Ph#蓘j 詗D$  |$\$4t$,s$L$)L >QPh!S D$  L$s()@L$L bQPh!%L$ D$  s D t 4Š%h!L$ D dtPh!ߗD$(@9XU\$D$T$T$9tt$N9BD$4Š%5(n2h-!脗 1h^_[]t$|h!9%WS$hA!h^!ju}Uh5(n2h|!j}t$|h!5(n2hq!3$h !jhc 5,n2P u15(n2h0!j4}SWVPD$Hw#t$>%Wdt ub%$h%!Wdt N1AQhc5,n2O u 1^_[5(n2hE!j|USWVP|$t$7K"hA!WVL fu $;(n2u _2)u (n2uhD!<L!t (n2hjQon ,n2u 5(n2hU!Ih+u3$(4%SUct uUh~!j{h^!j{$NPVS<% P,VFLf2PhY!V Vjjh!+8%4%h!hLf2 ujэ5,n2fnWVοV%btuVh!jzĬ%^_VPΉj PQ x $9u^Vh!jzWVοV`%fbtuVh!jmztd%^_USWV\$$1n2 n2xo2 to2sVj=P)x<$hjjh%U謍 o2H F H o2VP3uo2t;#=t%{ o2##=uthU! o2tttjut!tcuo2H o2^_[] o2jVh!W Wh !4$h!4$h%!jxho!h!D$L$01`1PjPjt$h#謄n2n2xo2to21PjPjt$h!|o2o2h!jax1hjPPt$h!Ho2o21PjPPt$h!!$,1tVjˊo2u$1PjPjt$h,!xo2to2ËD$o2h=!jw1hjPPt$hS!讃o2o2h_!jwo2u$1PjPjt$hv!tn2n2ËD$n2h!jOw1hjPPt$h!6n2n21hjPPt$h!n2n2fSWVo2t/ po2lo2 t5`o2)փ>8F u`o2n2do2 ho2 n2n2;n2 n2r*jUn2`o2n2 n2 ho2do2^_[áho2 do2 t n2n2h%h $j7vh%h $j&vh%h $jvh%h $jvUSWVt$|$6c"SjSVW֛ u=_2P]o2u,o2#/$o2o2%Ah!juo2%1QQPg o2y 5o2\o2 \o2 =,1r|o2uhQ!롡n2u#n2n2!o2%1o2Ho2% hQPSg n2yJ1o2H o2 hP5n2Q n2 n2y 5n2n2n2o2utS1V to2o2o29xo2rZ \o2t= o2 n2@ n2t# \o2) to2I n2 \o2ujgn2 `o2n2o2 o2t n2 n2t o2h`u;5n2 n2=o2 n25n2VP5n2W o21VhPo2&hjWhjW5n25n25n2n2hԲ_-,1`o2t%o2o2 o2 o2;o2 o2ss$`o2 to2tQj QjPE o25to25`o25o2P$ xd5xo2-to21‰1 lo2 po2=do2 ho2o2o2=do2 ho2o2 o2xPh $,|o2u6o2j5xo25to25o2P  t5o2h $o2 xo2to2 po2lo2=do2 ho2o2=do2 ho2o2Co2s po2lo2=do2 ho2o2=do2 ho2o2u@s)t8o25n25n2QP@o2Do2 o2$o21 o2o2T$<$t$ Ho2-Lo2l$13L$ (o2,o2D$11 n2t,n2u#n25n2h!DT$n2L$ AD$)ʋ$tЃ|1@|p9@|5o2 o2*n21 n2T$1 uK o2$o2I$T$ n2n2)ѣn2 n25n2-n29(o2,o2$ t n2)PQ5n2 n21n2n2 n2n2 t((o2 o25,o25$o2QPVR tjh%jS]$^_[]5n2h2!5n2h!5n2h!jl5n2h $j=lUSWVt$(|$,\$$Uhn2jK] C4WVs(P( c[8jUj'] O[8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[h!jkV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒuZ8u F ́Ĵ^v$h $jkVP9v V:VPQ\ t1$^fSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWVn2 n2t/jh"jZ n2 n2tjh"jtZ 1t$PVFȺMb׋ Xo2-։+Po2D$H To2iى tL$ 1FD$|$ 5,o25(o25$o25 o25o25o25o25o2h!jdW,WKPWjY =o2u =M=o2ui $XA0PhX#hLf2m h!'A0ɮPhX#hLf2m h!N^_[KA0蔮PhX#hLf2am h0%hN q2uáq2u tjwGjFUSWVjكƋ|$11K< @u=$p2t?jj50p2@ 50p2(p2,p2$p250p2UjW} A)߉n(p2 ,p2N F5s2q0s2s2-(p2F ,p2?0CPhX#hLf2l h0%Mrh!]1H,p2(p2?0PhX#hLf2k h!'?0جPhX#hLf2k h!LVȒ1^_[]Vt$5s2q0Fs2s2^WVL$ q254p29})=s279}>p2819~vRO9G9~-81p2~Zp2΋Nu#81)Ou9~81RN981 4p2u q2uu81^_É1jDjDVT$p2t=p21p26p2t@9uхtp2uh'%hK1^SWV1q2,s2j?`h]"6!tW1t|8/uWhD uh!h $$EGuȿ|w WjPl 1T L ш @u`q2hjV: P91Fth!h $De^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$% 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVPs2 t uhH!XC^_[]eC$ts28u@s25 s2Nj- s21;-s2M1WtÃ=,s2tj jwSVVVSt$<1Ʌ;L$uWwZ?E;-s2|1MVq215xq25|q25lq25pq25tq2薈5tq2 q2u q2uu ^j:jq;V5pq295lq2}tq2Iq2P5tq2袂tC5pq2tq2 q2u q2urufL$lq2r5lq2 1^40ʡPhX#hLf2` h0%A q2u‹ q2u tj:j9USWV l$ D$fD$p 1P lq2|q219tq2@u 9u|q2Sks2 t$$PPh,  $ r2| t %e2ڃuh"Q+Uuhy!Q+jD$P 4Ë $hq29}=dq2]q29|A‰T$R5dq2迀NjD$hq2=dq2 q2uq22$@PSW =s2?5ƅts2VPP,+ s28uK=dq2뜣|q2Gh"5s2z*t:jPDžb!x Q:? ^_[]Í|$10 PhX#hLf2] h0%> q2uq2utj8|!j&7WV lq25|q219}'tq2FىDuw9@u1=|q2^_USWVD$L$9tVlq2r=tq2~=xq29 t9|1Cxq2Mu9|1Cxq2=tq2 9u^_[]fUSWVl$}!uEhL"PUT1hL"PF]Åt*t$Sǀ}!u?S=n00距PUh%hLf2\h!=eS%x(=q2uWh+!hLf2F\ 5s2+t$000KPUh%hLf2\h!=^_[]USWV |$$Wơq2$,s2D$s21-q2-,s29-q2t\$=s2t$ gDž~w11q25q2Y6tss2PPjJ Å q2uq2t$ Dž|$$\$9t$utt !<$u=q2t!!9u ,s2 uhLf2P#9¡,s2Ƌ q2Ӏu1A9|$t $ q2 ,s2q2t )) q2u q2ut j4 ^_[]j3USWV1|$=q2t WrGHOHt uG `-q29}q2Vq29rFU5q2[{-q2q2 q2u q20u ,s2F8W#<1ۍF-q29~Nq2 q29wUQzt7-q2q2 q2uq2uhtkq20 F,0PhX#hLf2X h0%9 q2q2j2G @utLq20 Fq28<,0腙PhX#hLf2RX h!Y9-1q20=,s2=q2  )Ɖ^_[]js1USWV|$?!uGh""Pt$WI,VP?XÅt2l$t$ US NjD$8!u?S=_+0記PWh%hLf2tWh!{8mS x-=q2uWh+!hLf27W t D$ )@ʼn3*07Pt$h%hLf2Wh!8^_[]USWVPl$Uƃ=q2t1ۅtf;l$ `1V$th~;-s2u=,s2t =q2u8 GWPt$ F x4EEs @6;l$ |=q2tt$$$^_[]USWV|$\$l$19t[=q23t UPrUPuFy)0 PhX#hLf2U h+!61^_[]USWVP\$5s2FEx @u}|~PVq6tjq29~lq2q29SPvgƉq2q2 q2u.q2_tO5s2;^_[]Ë5q2W5s2V  . ,1xщǃ|$uEr2| /5q29$~Zq29V5q2.vcÉ5q2q2 q2uq2t q2W5r2U  ,$+HPS5q2D( |$tM1BDžhb!4'0PhX#hLf2S h0%41 q2q25q29} q2|$Nq2q29͋|$|MVPtt05q2q2 q2u q2umua(/ &02PhX#hLf2R h0%4 q2t1q2uj-j/,SWV11e2H e27he2)u8e2@%fe29ue2H e2ÍF=s29~Yq29wW5r2s=s2r2 q2u q2t r20u ,s2F r2C%0ݒPh=!hLf2Q hH!2%e21t r20r2s2^_[8%0聒PhX#hLf2NQ h0%U2 q2uq2u tj_+j*USWV\$ D$1tt$hZ!OD$ l$1uHD5e2J e2; f2у  e2Qe2;=D1|he2h$1GD5 | <\t<e2H e2; f2he2j\uSe2H e2\\5tjj Sh_!I tVG_!)Ȋh!e2J e2; f2Vу J e2Qe2\$ !0e2H e2; f2he2PRe2H e2D50 e2Qe2ɋ\$ ; f2he2PqR e2Qe2D50 e2Qe2; f2he2P*R e2Qe2Dhe2QR4 e2Qe2; f2~;ȃ t3 e2Qe2D$F9he2QQhe2P똡e2H e2~e2H e2 he2j pQ1^_[]fWVD$L$L$$$0| $ |r1q2hq!t$t$ X ot9EtzSq2ǃxtostypf$;r2먡_2  $)D$|$ta$8-uWq2D$|<_2bq2S q2Dq25$L$jjathj1Fh6VVjhWjhr2ƅux'q2|$t$8t$0|$t[hLf2hy!$8u h!_-ju$hLf2hx!vh|!--y =q2ths2hX#hLf2K r2tPh $Ihe2 xt` r2| r2x51gs2QPP M=r2=q2hLf2hy!h!:,j|%e2r2hb!,%e2΃t0hLf2hy!j 515r2hLf2hy!h!+VQ=q2ths25r2h!hLf2DJjrjkNPhL%hLf2J jA=q2j`unhs25r2h!hLf2If$j0yj t$8!$h0hq2 uhs2hX#hLf2wI jL$ ɸ!q2Phht@jx x#$r@1D$ rD1ËL$=q2t1@ q2Ql"L$=q2t1@ q2Q#WV1F=q2t9|$ ?!t!h"Wtj/Wth!)1^_s2s2s2 s2x>s2 s2 s2s2 s2;t,uQs29;us2빋 s2| s2s2t9t s21Ƀ USWVPpm2s2DJ@t t@s2@DJ@t uHH s2~Ã=w$x%=r2!hC!  !=s2" s2A1Qptntl  Ӊ s2A˃=s2FP”^ U s2@߈\$ ̀1ۈL$QuH s2H1KDB@,Aǡs2 s2  Pj  5s2j$1  ˣs2@̃=r2t=q2y=s26DB@jLǡs2@1Hptntl   ˣs2@̃=s2DB@8!h/!=s21Hptntl  ˣs2@̋ s21PptntlN  ӣs2@̡s2HQPN"s2@1Hptntl%  ˣs2@̍H s2 s2 p1Pptntl   ӣs2@̡s2PPv s2A1Qptntl  Љ s2Aˡs2PPH- s2s2=s2=s2 9=s2 - s2s29 9w ht! s2PP s2A1Qptntl  Љ s2Aˡs2PPl@ s2A1Qptntl  Љ s2ADB@;h! 1ЍrЃ sO6j hs25s2n $s2w8"% s2 s2:o t!gc ptrP  A s2< b=s2Ho1s2PP9  s2-s2 =s2=s2 9=s2 s2-s2s2@1Hptntl  ˣs2@̃=s2F1Hptntl  ˣs2@̃=s2h! 1@ s2 s2AQP2 s2<Pj hs25s2 @18"h!N@1 s2x w =s2s2ts20hV~% < s2x A =r2u;.5s2O1@ s2 s2AQP@ s2jPP>s2x  1q1ۃ=q2Ƀ=r2 ˃h'% s2x  =r2u-5s25 s2 5s2g s2x ? =r2uL-5s25 s2: s2@;s2?7s2-s2x =r2u , s2IQ Ts2x =r2u, s2 s29QPns2x QVP s2y F( s2y 1 s2y P5s25 s2g s2A1Qptnt lu  Љ s2Aω s2y  s2s2=@19|PRQ 1=s2u s2s2 ǡs2@1Hptntl  ˣs2@̉s2z !r2SPhAs2x  1@+q2q2uF%s2x $;u<1=r2t1r2s2x =s2hs2hX#hLf26: s2x }*x1Hptntlu  ˣs2@Уs2x 'q2G1s2 s2s2@Hptnt lu  ˣs2Уs2x =q2q2u"|$Wt""5s25 s2QP';s2r2s2x ==r2uJ)=q2q2u5s2Q5;s2)r2h_!h!h!$s2h'%$s21< *5 s2y qt(s2@P(s2@PW=q2hY[%+s2x )5s2j 6'(Y$i*tEEp $A8GMi s291s2)@أs2=r2t W6Ur21 q2u q2u u^_[]jjSWV=q2uj貽L$ɸ!q2s2Pjh""h!Hy|hޫ"tkP=Yà P<tGWP3|3/tf/Ved.hDhup5s2jh""Vj=q2ujL$ɸ!q2jhr2迧USWVPl$5 s2'Ƌ=s2 s2-s29ʼn) u)E1u1$q2E@q2V}tzP蘹t_s2PPj DžtOr2q2Hq2u q2u[uE6Ms2@Pi1,$l& q2u q2ut j1^_[]jUSWV$q2 q2th!ckjP~s2L$F$ tYlj-t2t2 q2uq2uyS5s2W 5s2=,s2tsj jSWmep0]PhX#hLf2 h0%1 q2u*q2u(tjh&6$h![1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17us2 uu2E#ts2 uE1^_[]8uPs2HЉʀπwRj hs25s2K 1w8"uh!1gu@s2ErUSWVs2H s2H%u,8Xu's2u2h!t18u=u29 u2L1}5u29~[q29V5u2;#5u2u2 q2u q2\t Yu2 s2Qs2 u (\t u^s28uTs2H s2 u21< u0=r2u't r2| t %e2ىs28q2u29|NWP:t8=u2u2 q2u q2uuuw5u20u2M1I0*ZPhX#hLf2 h0%1 q2u q2uu^_[]Hs2,j'jUSWVPL$s2 s219s2}%s2ȃ Eh!Kl$ s2PUVPt$$KǸ1$s2PP u2q21S̪ás2tP芬EPPjM Ņtl9u q2l$ uq2ue$s2s2+ s29}yFs2@s2P%Ut$ Pt$$hDž+9 q2u1q2uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=,s2tj jvS肮vލD$jPjSu%t1t$ED$$D$1E $A9T$ 4u29Ɖ $T$~cq2t$ 9V5 u27\5u2 u2 q2t$ T$uq2=,s2tjj RS藭T$= u2RSW 4$D$D$ u2 $9~bt$ q2$9V5 u275u2 u2 q2t$ uq2=,s2tjj t$(S= u2t$SW Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu.}&D$)D$u29~Vq2 u29SQ6u2 u2 q2uq2|$~#D$$ D$ ud$th!$=,s2\$tjj SV賫 u2SVP u2f |$%C<0TPhX#hLf2 h0% q2t e^_[]Ë q2u tjjUSWVPt$ =u2T$-u2E<\<&I,$D$h)u29~Yq29W5 u24=u2 u2 q2T$uq2%$9C u21F9uEEπ;D$$,$L$l)u29~Yq29W5 u23>=u2 u2 q2T$uq2ml9}C u21F9u,$y^=u29} u2_q29|W5 u2H3=u2 u2 q2tT$ q2T$M 0E+u2;u25u29} u2Jq2 u29|KVP2t)5u2 u2 q2u q2u^u`I0QPhX#hLf2 h0% q2u q2uu؃^_[]jjfWVu2 u29|ld u2j Qhu2i tJPlQPhX#hLf29 h0%@5u2R71u2u2ku2L$t$T$ =u2@Q葤 u2u2RDVuu25u2@LF5u2u2^_SWVu2u2r9 u2@<u|L19tWW69uu2s2H1s2L1^_[USWV=H1=L1=u2t r2s2$s2D$j荣q2u2 u2ÍS4R4nr@44v\1L1 [ u2\1l1sRt6,lmL)1 u2t)|?wt)LI1 u2t~l)}L1 u2,u44vL1Y u2l1}w4R4Ӆ HA9~Ru24@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=r2t׫H1s2$H1L1s2D$L11 q2u) q2u&tj\h8!$^_[]jlUSWVL\$d3hH!虱M!tNjt$`hX!SV fttu=$;߃u _2r|$L$ D$1%!D$PƋO9rPSt$  tu;_Յuͅu t$h!-|$dD$ Du$$1Fl$?uSt$ h]!j+L$j QP $;Fl$|1ƋD$8u&1zPUy!Uh $j D$ th!jNjC=m@!sHQPW xs{QPW x4$Uh!=  =muqB dut\$fCShmWj HefD$t$Shmh=m8@u֍D$Phm8@W( y?60Ph!ӍL$fqQhmW 3Uh]"D$ukD$Ph "hu!c T$D"h!T$!h!e2H e2~e2H e2 PhX!khe2j ) t$8t$8t$8t$8t$4h!t$Ht$Ht$Ht$Ht$8h!t$h!t$ h!j{薈Ph2!hLf2f  j\SWV֋|$t &!?t,!VQPH JB8e2H e2; f2he2j<5 e2H e29 e2H e2>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hY!Bthk!Pu u2ho!thk!Pfu hy!%jhk!ho!q$ iPyu h!j>0D$ u h!jPt$,)݉\$D$$D$11D$$h!SU c7~+Hr߃8tlH w&$%$;$뼃4t6맃dtket/1@D$=$;umWt$3Xh!5$;KD$71@D$$+L$ _2 _2T$uA_2$T$uȋ$D$,jj@R[l$L$ $tL$ $L$,1ۋD$PCEu S)St$PʼnD$$Q Ul$$T$DtIL$ىL$$U$E L$)QPR 4$BEuED$ush!hT$Iu]h!bh!XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh$u2t$ t$,QPR-6t$ +yj=$u2y h!|$$tQt$(jVjhSy h!҄jVjh5$u2y h*!詄h!Iǽt$(1CUVSwD$PiUVSw5$u2Ut$,I1L$XAAA @D$HPQS = u2u'l$hD$h8jUL% ul$u5fDžy hl"1O~fVS5$u2 VSt$V豹 |$h5$u2l$0fE<u1u@hWj u818tƉjjU tD$68Zt8tEVSt$ x )b~8#ThR$|$l$8fE= u2ul$0fE9EjD$LPj |$@f9fGfG$u2G$jVU tQf|$<tٺtf|$4t?$u2L$0u+fD$<= u2ufD$4 8t$>Nf|$Dt1BuNfD$Dh|$u%j t$h1A8Љ4DAtt;L5rSh!j:; 10h}!WV|$x$t,WDWHDWDW4Dx uWjtw\wX=19}5PBt851WVh!#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RPlÈ uCt1t RP,EL$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PU D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP4D$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph!,h!_&|$PQt$t$RhT!j)C$t&8$\T$XT$H|$RQt$t$Vh!j)$L$l$8h!h !hh!USWV u|$WLi1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h!j(NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWP6l1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hRj,PSSD$HPh% |$0hRj,6StND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWh!j&^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh7! 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ @u2@u2Hu2Hu2Xu25\u2D$v _2)hLf2jjjh=!L$$vL$$=u2x =u2tD$`k)&1PPqD$l D$TH Qq T$T$ t$t$QShd!j,  11KL$0t.]SPh!j V5u2[Su24u2t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1hljP88H H;1D$8<9u28D$D$ tD$tD$4u2ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP!PD$tD$t$t$8WSP!PjtD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPh[!D$8Phu2Vt$,V'~GD$D$8D$HD$L$PD$LPhu2VD$HD$8L$ $\$(\$(u@,(L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L Pu2Tu2tt94 S.84u2T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Ph!"¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVh!D$8Phu2St$,V~D$@s,D$¹tt;<FG;D$ L$?-Vh! Qh!j( $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP;;D$DT$@D$(4t$8t$t$t$0|$(WVh! HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhy!je1gD$4$DŽ$߬$D$D$D$@$߬$ %a111CƋD$|$8D$|$H|$LjD$LPhu2VL$HL$8t/u2ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh!b11ҋt$  t<=Xu2\u2$T$p$1߬$$$߬$@u2@u2Hu2Hu2DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP831A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=u2$t1J8D$<D$ۋL$؋u2k,L$1T$9|L$$)щL$ Ɖ$D$HPWh!W $PhD$(% yNإL$ L$tL$L$8]:u*t$ tD$Phg!jD ,uh+!j0 uhH!j M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$PgD$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RPS3D$ t(Gdt;<r61@ht 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWNJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP4$]0hVPy ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhZ!j T$$BRt RPmRPVWjt$$Vh+!t$$k,P D$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph!j D$,|$D$T|$XD$TPh% t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =(u2yh!j!e11t$ t$$k,t$TD(D$L(L$(}tTt  t1L$(VWt$Q](%[$t$ D$L$9Éʋ|$S=(u2tQPjWhX!jN]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh % 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$QD$XD$TPh]% |$t$t$kL$,9 $ ?t$N0PVh5!jD$,]|$t$t$t$L$$QwtXt$|9|$11k,D(t PG;|$}L$֋L$]t$Qt$D$,TD$, m4$yD$,`14tPP1hш%j,u׋$e^_[]USWVu2tWjjPo8 u29u u24t0jQ:x!=(u2h!jzt$u2xi8t<6PWh!Q%V`tPSh!Wj藮t8Vh!j 1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 1I 11u2Iu顀1Pu2 1~ t1@u2@9uUSWVD$911A9|G1S#Ɖ<$~ SjVm 1D$~Q1ɡu2t<1*tBEB(B$B4!؉B8<:tWBuA;L$u5u25u2$1^_[]V$u2 u2D$D$ %T$ t$ 15u2t$T$L$D$\$ $q!e$^Vt$FtN H N tNHNfr v RVI u2^VD$`sH) u2u2 u2HtP4BPQ@@1ҋu2v9tu2u2rh!jۘtp4F@u2^USWVD$T$#15u2tC=u211-u29| n-u29t%9P4uH$3L$X(3\$ t Fu1^_[]h !h!hh!USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>u2 u2 19|[5u2tFNu u25u2t5FNHNFy F4VPVu2@u21@j@P*U1@PF ~4D$F(^$F0^,n#1^8u2 u2t q4u2^G FtH 7~ F^_[]É u2=h"!h!hh:!h!hh!/Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP u2Hu2N^,H u2u2u2H@u2P u2 u2Hu2H4Iu2H89t;tprpu240u2t4F u2H^h[!hT!h4h!USWV}]uuu W@t u21@u21HCSuu WW KN0F,xNF4VPe^_[]vjv g fUSWVP|$g%s%G4$O,51w0VPww D$0^_[]USWVPt$ff%s%F4$N,=1~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j.8p u2HtƒQ u2@ u2^_WVt$ u2F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjve v^_USWVPT$|$:%4u2\$ u2$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^421ہ=u2| t Pt2u21t 98t@^_[]Ã^_[]`V15u252hVhu2d 5u2^ft$ t$ üj)SWVt$frLN4F,=1~0WPvv 1%t\fv4V1AN4F,=1~0WPvv 1%1;NuN^_[h!01HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRe׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h!h!h h! USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$FFqF ݈F F$|$0tfhjdljPLtLXt uB\I\$$|$ C$|$4Nh!<1ɺPt`tLtt l$,\$(|$0uej6ttPttPA 芇t u_4u_4_HoL_HoLUS6jjW'h^W>q$ 1=1lj1l$1 UPQSWVhjkË}Pw SX P G1PWH¹tTt 1߀<$u1 t1 L$QWURPVhj躮Njl$hu PSW P E1PUtA|$4t h!SzWb1^_[]u C4CHKL1}Mt|$4t7hl!t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPh!:$  $ V 19tQRh !/ 1@^USWV |$,\$$t$ tCPPt Ttt4RQht!N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth!he26D$(u KHKpStURQPt$DljT$t h !u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh!b 2VRh!K T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhw! D$L$9tQP$$h!t$Ht$nL$tI9ȋt$ tPQ$$h!襋1t$谱\^_[]h0!h"!hh=!1h0!h"!hPD$L$ $QPj1 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$!D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$;!nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$U!uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$!,D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D2uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWƋD$0T$UWƋD$0 u$$$UWljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPWERPG$GW #RP2ERP"$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPh!TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPh!D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh! D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPWt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP|$FV D$t RP|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP^$ D$TBL$?ttXLT$BtJ J T$$T$ QPL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPYي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVAD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv J0 t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h! D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h!hN!h h!h!h h!h]!h"h!USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p 軃A L$H SjQ+ ^_[]USWVL$T$ B2ulF1GD%Uh2"q,$e2H e2~e2H e2 he2j vu q1^_[]VLf2PPh!VasVjjh!/!@,%PhȢ"hLf2,s8%ujjUSWV׉΋*h!U"?h%tCt[PU?jhh2s 52覑2t222WVS52o^_[]jh!7jh!.uh!$h3!hM!$p hg!h!jU$052h]"j,UUSWV}E ph$V<Fh!V<h_$V<SD$(P52Z#D$0= M$L$A1yyy D$Phwd52'' D$tG\$ D$ L$|$j 耆ljL$ NjL$IuɉNjD$ D$|$uhjD$v1111O w+Ow?u$L$A1AAA D$Phwd52=&  \$tmt$ NL$,D$(2D$FD$FD$ FD$$~D$(P躉PWt$,t$t$t$h!l KuD$1D$|$Ynhxd 52%R521111VQRP52h9!Alhxd 52N% 2LQhj!lww ww52h!kw_G|$9w  jPQ52$!¡2tNSVPh!kWt$ 52C {P$9t[)"Q&he2)SVPh!wكT$;r ZƉ[|$?e^_[]jjgQ52h!lhB"h#!h!hLf2l jcQh!WV$u>$jvW% s'Wh{dЀ52# t^_jh!jP652h]"jPVPPhtd@52\# $t%t52h!j$+!u!52Qi2$$p!p!sc"QPhI!i 2$$ p!sc"QPhu!i 2$$p!sc"QPh!i 2$$p!sc"QPh!Zi 2$$sc"VPh!:i^52h!jOWV$u^Vhzd@52" tH$D$PWVh/!h$PwwwwVh=!h^_%52h!jNUSWV}D$Phd@52! tzD$Phd@52n! u52hq!f2$|$\$ t$jVSW}0VRPSWt$h!ge^_[]f52h`!j=NSWVP|$uX|$_h"S5ƅthz!S5u+1Qhwd52  t ^_[752h]"jMUSWV|$0t$,1@;_2$1ۉ؉D$h!WVZs qt\$te+$95_21|$7wWh|d52 D$ ;D$t-i9l$sUt$EƉD$l$묅h"hPV 2L$ c"t@#RQPh!Sf|$ t\ư1P`VvvvvQPh !f G;|$ ru52h!e$t1^_[]W52h!j.L52h!jKj^P|$u1Phd@52 2tQhG!eXD$ 0Qh]"jKSWVP|$t$^hx"SH3tDhL"S63t@h""S$3ttT$da3 D$dD$ tTj/StF1;tٍT$d#3D$dD$,t>\$:t$1\$(X%%h!!^ u1\^_[]hy!hR!z_2=2uj=2$222 2 2Yh*!5$;h!Ph!j$D2= 2u th!0"2 2t uh!t=1uh!t})ǃ|u D1j=02|$\G1PPL$lQPjW輝t2t$dut"1PPD$lPVjW萝t51=02u4$P51誢u#$=u02 2 2 $2 2=T2 ɡ1=02t&jQPI5 1u[51hp'#jhhd2QP9}1y"28hd2h"|1d2=02u'L$dQP51h>"h`2hrdAP 51h{"h`2hedA51 51h"hd2h+"$$t(hQP51hH".{$$ƒ 2>s1@![Vs ) ȣ2222? 2 222X22\25251=2=`2?w2 2=$2L[V$2? 2) 2>r$r$2 X2\2T2u 11]u1hQP2 1u25T2h $51e31jR51|VSrX2u Vh$"8 11h\2t1A1A1ۉL$@1h\22 2h2=2u#<22@2 2D2$2 t$\F|$LSSWSjVat$LqT2n 1QQWPjV/y5T2ځT251j/VRt@UUUU)ʹ3333!!сisL212t!tt2Z2cԋ"2 ,2021&2‰ 4282@21 <21AhQh(2 i-(2=<2 / ,2ً02P+==w !r%1H$D$ ʀŸw1D$ $}ȹ"2yt2t  u<21I $L$9 (211O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj 21҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$2- 2=$202D$,2t T$$T$2=,2uu 1; <27=2l2_hP""ET281uh!"T2L8L$(L8L$$L8L$ L8L$48\$81=1Ɖڋ\$4PVQRePSt$@t$,t$4t$21K1Kޅ`1PPPPPP =18h4"128LFu=2uRh"%tajh"M1"WjWWWP+h"t҉Z2u 2= 2u2u $21g= 2T2D$tD$|D$h""谩21N=t 蹵@ 1n"WhVVWP+9tigfff։f52<2L$ȃjPnD$ u h!j2h"" 1HL$ Ajh"2L1۾2D$^2tB?t=kWUh!K b2L$ DD 3$ D$tD$D$ u2 <21(2|(.tq<(tk{PWh!K 02,2(2t (BD$,T(2D$ TL 3$3L$ щtT$ <2T$D$,F9u߃|$~O1l$GVWh"J T$ L D3$3L$ tT$FЉT$9uT$1۹"VWSSSP)T$ ‰ $DD$Rs2=ue2$@D$ $#D$u D$ %1$L$19;ta $Ȣ2=2u2u$2u  2=2t8\2~ h"i2~lh"wi]h "X=2u1Ih2 ̬2t h!"-h"t\2o2e$j)Bt1 2"2t 2t3$ D$ 2 u=<25(202,21|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 2|$E9u KD 2D 2D$2DL /X2 \2WQD$lP D-L21ۉl$(-D$D$D 2$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$02 ,25<2L2D$t$"152525`25\25X2hG"15\25X25$25 252hp"15<2h"t1Ph"e1h]""\2 `2515252RQP5X2h" 1 h}""Ӎ 2 $25\25X2RQP52h"05L25H2hr"0 USWVPˁˀ $2 2 21"22~t=u2t 9r u֋ <2~:(2”>u~t:t  Iu 2 щ $ $2t&=u2օ4$u 2G2tiP2Ȩuh?"h3$/P2tj 2=u2Ѕ$tNL2=2u"Pht"=O0h?".OPh"t P2 =P2uQ#$t"$t$1P2ti2х $t4$P5L2h"N=2u5L2hQ"1t"12=u 22^_[]VPD$ L$ $QP@h"s.e2H e2~e2H e20he2Ɖ t9tDe2H e2~e2H e2he2ƒ1Y^h4"jUSWV1=42˃y CS t 25211 uY1ɉNVt11@5C C!t "Ph "i h "L1He^_[]SWVP$1;1u+02u"QhmdP  y h_J# 11h\2<=P2u;5P2|- P21Puh"V=<2~e1(2111 ,202Pt,(28C;<2|hu"PSh"@$1;1u+02u"QhmdP y h_J#^_[USWVP։y1ɉQPU軯 1O}t#Ë$8uP8"u r1^_[]USWVP։ϋl$=2T+(2 \2túc"t;$76PSRh"T$+7St$h"*D$7UPS\$ Sh"*7PUSh"*77PUSh"*7PUSh"}*7?PUSh "b*77PUSh1"<*7PUShB"$*7?PUShT" *'1PPPUt$(SRh")^_[]USWVˉ1u=(2h""hT$$8$43|$͉)uhc"Wh-"$ |$Z)uhc"WhP"$ D$|$"2:!2 2 2l$M?>"2&2KL$ u}tGE)9H9^_[]USWV,։L$D$DD$]"tD$x"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h"(! $2 2D$HL$LVSQP]D$T$D$PVSUPAD$|$ D$@VSPW%ljӸ1=1ƉT$ L$@PVt$QRPSW|$LWVUl$lt$,t$,t$(t$@h"V ,he2jdh2B@ |h4"h2y2\$ $t < uC{ - pm2DAu<-j D$$Ph2 < D$$\$ h,%SK|$(@D$Ph8"S; $ϋT$ t։t=t$h"S  t't$h;"S ct$ |$@D$1=1ы5H2jVWRiD$ՋD$D$D$D$D$$t$t$D$$  T$L2u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th4"Sw< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhe"!2Vƀ2t$Vh?" 5H2D$,$t$P։ω,^_[]h4"jUSWV΃ twttu"^T$(|$$+L2уD$ ;,2"L$ 02|.|$,T$0 82|$9=42|=2u|$4u 1^_[]Ë-<2~} ʉ$9tw(2|(tk ,2t( T( (t1+L29\$ \$$}2;T$}#=2u6|$4ttD(OG1nF"t(n9Չػ}n9l$\$QAuƉ2tt  $tt ^"2 ,211 02t$ -<2t$|$$|$}(2] ʀ|(tP ,2t( ;L$T$|L( (9Ή} =2{|$(t ;(2KC 02,23"1$t=t ,2 02S"=2|$(5@25(2C1D2@2<2824202,2Ɔ2t$ |$(P29@2u85(2JC1D2@2<2824202,2(21Ƀ|$(T$3\$1 5<2n (2|+D$Nu (2[\$j5L2,2)؋ (2P|$(t$ hhj;(2VfǀU@2L$ 02D$,2ƋD$$ȉ54282<211<2u(2=2h""u "v"=21|$(9 @2u85(2A1D2@2<2824202,2(2Ju UPQ脅 <21|$(tD$,2D$02542=82^_[]h!j.WV(2t^ tڋt֋|҉tΡ(24 <2 QPV <2ƀ^_USWV T$L$<2@hPh(26  <2(2~C02,2$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR+ (2;UjP fDŽ;UtZF , M ;M;MU;; ,2 L2T$)ʉUL$  L21 EE=$2 2ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M<2 ^_[]h3"jWV1=(2Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5pm2<tD~t@ uB 1u€πr<r1@^_USWV 1D$Ӌ51݉t$މ$!!jVWt$|!1Kl$ 11uhUP8zQ5X2Pf ;1u[jVW51!1Kt?D$H5X2#$SUPp 51V51 ;1tÉ؃ ^_[]h"jUSWV$0$,1@D$l$D$D$ $1h""WV` suMj U5$;- á$;8=L$908"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-_2)1<$L$jhQP4%3hl2hedAPX =2a99l$| T9@f2UjDž\$ t|e2H e2~e2H e2 he2j jhl2he2 e2H e2~e2H e2 he2j <$ D$ttc"tV#"Ph6#"DD$f2l2Waf2gdWPV) xnu)D$PhwdV h%"h%"mV_1^_[]Ph""25$;h#"j4 h#"h%"*Pjp 苑Phc#"hLf2[ jQ USWV\T$2< $S(D$9d$ՉjRPt$ VT11 Sl$UVi 9 1U\$tL$j@PQ 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4%h$"TT$l$ 21ɺ 21MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$2t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf 2ŅtMaQ4%h$"=T$ t tuf f1112|$ 22T$ 2 2f2l$E<$g\$ttXaQ4%h0$"  ;B Q4%h^$"  <$\$t4%h$"r <$l$!F1D4 6\^_[]Sh#"hLf2 (h#"h#"#"|$t#"PnLjL$”19v f39rËL$D$”19v f39rfUSWV|$t$t$h%"VI Gw4H%h=!Ph%"V# GPSh&"V GPSh&"V Vjjh%ƢGXtVjj h&"譢GXtVjjh)&"蔢GXtVjjh.&"{Vj @-w(h7&"V  w,hI&"Vn  w0h\&"V]  w8hq&"VL  w4h&"V;  w=2L$r("$0mFPWt$h("jx2{<|$\$W4$C,Wh)"h)"S_4$u h!jPF j/P赘t|4$4$+jUSWV\$ l$|$t$1E2с%22h)"WV h~n3itVn2Ѓa~.btCd 2봃otBs2띃NuS$;221=22mjShD%5$; tHP EuA_2)ރu4t$$V41ut$(t^_[]hg("j茂Ph)"hLf2\ jR$)"=2uD$ D$@)"2t ~#P=2u 8%= 2u )"=2u ##@P0Oh)"hw|%j+WVPhL"Qt1ƉPjPW  Wut jPVP^_ÐWVt$|$ VW{=t$?/tWhb)"$ Vh{)" ^_WhM)"jfWVt$ |$7?WVUSWV $$l$WVSU$ $ hU3WhX!juWVh3*"jGD$@tF$j$h%hV- V$$$h<*"jjPUSWV$$$$D$1 h(*"SUE  $D$D$1G$D$ȃ 1$%N|w5$;Ft|$`N|Z5$;Fx|$Cj$h%5$;PG5$;UFp<$h(*"SUr  V_2H9$|U4n$W^.l$\$t <$tu;D$ PWCtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]hg("jWh`1$jG~Ph`*"hLf2^ j@TWVPt$jWVb 9u9t x^_Vt$h*"jYVt$Vt@^hu"V^Vt$V{t@^h7$V|^WVPt$jWVـ 9t9u x^_Vh*"jWVt$|$ VW9t$?/tWhb)"LVh{)">^_WhM)"jfL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QWbD$ T$M⿪t׋E4D$T9\$E0D$Ds h*"i-1VWt$ t$aP:1@PPVVu4u0u)OËPhh%P }D@u hh% hh%Sƴ }D@PE,CEh$V\$th$Vh*", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5Ph+"+%t9\$t h-+"+\$pD$p\$D$D$ 9\$~\$~tSh`+"+\$9|1} t h+"k+hW5D2h+":}4xME0;E4ru0h+" +},u,D$D E4t h ,"D$T 1u D$D5 t$ D$$$$L$$$E@$D$,D$(A$AD$|AD$0A $CD$4D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$uttPFx@HIt$81VRtRRP*t$ tPh!9QL$xtL$tD$8@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

Ƌ|$uL$,T$uL$( T$1 uFt|$\+GHG,$|$+GpWtG@WDt$ tD$0D$WGFD$(+D$L$,L$ ʃ{1QPWV*th>3"jL1F\$D1VPShD3"D$XWVPS %|$$u1Ʌ|$t1ɉAw1@|$Phr3"yD$tt$5<25025,2t$\t$dt$<582542Q5$25(251PWt$L@ƃ|$4tVUSWVӉ $輘|$j W\$ S Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph3"1L$8ɉ׉u L$8t 1@׉׉|$l$ ߗ8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h3"3QPWUt$t$h3" QPWUt$t$h%4" t$t$h3"j辧USWVLf21F/WVUhq4"@XWVjh4"/XWVj!h4"XWVjh4" X WVSh4"WWVj+h5"WWVj;h-5"WWVj$hi5"WWVUh5"WWVjh5"WWVjh5"Wh5"WWVj h 6"tWWVSh+6"dWV{fD$t1B9| 1I 11|2Iu顴1P2 1~ t1@2@9uUSWVD$911A9|G1SƉ<$~ SjV*y 1D$~Q1ɡ2t<1*tBEB(B$B4!؉B8<:tWBuA;L$u52w52$1^_[]V$d2 h2D$D$ %T$ t$ 15l2t$T$L$D$\$ $q!$^Vt$FtN H N tNHNfr v V `2^VD$`sH) p2t2 x2HtP4BPQ@@1ҋ2v9t22rh!jWtp4F@2^USWVD$T$#152tC=`211-l29| n-l29t%9P4uH$3L$X(3\$ t Fu1^_[]h !h!hh![USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>`2 x2 19|[52tFNu 252t5FNHNFy F4VPV`2@`21@j@PU1@PF ~4D$F(^$F0^,n#1^82 2t q42^G FtH 7~ F^_[]É 2=h"!h!hh:!h!hh!Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 2H2N^,H p2t2x2H@2P 2 2H2H4I2H89t;tprp2402t4F 2H^h[!hT!h4h!&USWV}]uuu W@t d21@h21HCSuu WW KN0F,xNF4VPe^_[]vjv 8s fUSWVP|$g%s%G4$O,51w0VPww D$0^_[]USWVPt$ff%s%F4$N,=1~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 2HtƒQ 2@ 2^_WVt$ 2F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdDF3hjvhq v^_ USWVPT$|$:%42\$ 2$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^421ہ=2| t Pt221t 98t@^_[]Ã^_[]`V15252hVh2Ip 52^ft$ t$ ?j襯SWVt$frLN4F,=1~0WPvv 1%t\fv4V1AN4F,=1~0WPvv 1%1;NuN^_[h!1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h!h!h h!USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP 3T$3D$M u1^_[]USWV(t$F|F|F a}F F$|$0tfhjljPLtLXt uB\I\$$|$ C$|$4Nh! <1ɺPt`tLtt l$,\$(|$0uej費ttP芻ttP`A 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=1lj1l$1 UPQSWVhjË}Pw Sc P G1PWH¹tTt 1߀<$u1 t1 L$QWURPVhj6Njl$hu Pb P E1PUtA|$4t h!SW1^_[]u C4CHKL1}Mt|$4t7hl!'t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPh!:$  $ Vx19tQRh !諧 1@^USWV |$,\$$t$ tCPPt Ttt4RQht!N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth!荦he2PBD$(u KHKpStURQPt$DljT$t h !u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh! 2VRh! T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhw!D$L$9tQP$$h!t$Ht$L$tI9ȋt$ tPQ$$h!V1t$,\^_[]h0!h"!hh=!譨h0!h"!hPD$L$ $QPj1 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$!D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt!|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$;!nu0|$ r]@hD$D$D$,$D$ l,[D$ p D$D$D$,$D$ >,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$U!uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$!,D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D2uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWƋD$0T$UW{ƋD$0 u$$$UW@ljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPERP$GW #RPERP$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPh!TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPh!D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh! D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWSNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPHT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP|$FV D$t RPx|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPc|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP$ D$TBL$?ttXLT$BtJ J T$$T$ QPkL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv ; t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h! D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h!hN!h h!h!h h!h]!h"h!dUSWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p 7A L$H SjQ-7 ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QPi1 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QP΀1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jDƉ t,UUFtf^81FFH1|$<΋t$ 2uN 2NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPt${$K\$tSD$ hD$@p$Fx~"1ɋ@ L;H|PHsu"l$ \$ 2{2 2\$L,D(Pl$ tttt$T 1¹pt Ѝ t$@F01FHD$Pt$.KCLLtPQ4$蓒Xtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(2y 22Py`P迬D$@2 2C9݋|$:"a VcT$M"V$$ h;"YaV 8 ^_[]1ىj=ߊ< t< uGjhE#W| k2$( aj2WPG EKu$( 8~y$( 1\$ىj(Sh$PJ u$PUh;"g` ;"j2PW E2$( ;(|V~b\$AM"V$( @VKbT$(M"Vg$$ hl<"h9"_uD$ $PUh:"SbuUe <Shh:"_ $( aPWh:"UhG;"$( x?$( Z1ىjPySh$PI uSUh <"_ j2PWg E2$( ;h||$jt\h<"@PUW $( ƁaD$ a9QPUh:"^$( ƀa$( ]UD$PD$ PD$Ph<"WeaL$\\L$\\ $\]u^E %Yt8u1҄tʋ$( t?r QVR VY q8uUh;"Ih<"Ph="4USWVՉt$hR] 1I t uFjhE#V  u<^Ft t u^F t tWPWV  tt$hU-] u1I1ɉ^_[]WV׉RhQ] t6< ~< t<#t< t >t< u6AWhV\ űD$ 1GtPh $\^_V31tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh8="+C< t< t< uhL"Sp>ƍD$$VhP[ L$T$\$PQRSD$0PD$Ph="D$@P^ t$$$ىh >"rC< t< t< uS=$<rLjShM>"Shi="jSh="Zh="Zt$<L$D$D$L$ oPStXljo 1tX L@uH~vCtTjhhw>"oZ V$^_[]V )UjS D$ D$ CD$CD$C D$C$Cl$Uhe"VQP u D$CVj)1$<;obD$D$PSh>"Y =USWV$0xjW\ƅ~F$0h$1jU[~4$hP C9uЋ$4hL"S;Ǎ$ىh[?"$0St| uƄ$ $0ph?"QUy7D$$0qh?"QPW7ىD$PU-PUS u׋$0EED$1ɍ$D$ $PhSSX D$PD$PD$PD$Ph$S[D$L$ T$ ыD$E L$ T$ D $A9L$D$uP<h ?"h>"}Sh ?"h?" Sh ?"h;?"Ӻ $02t$t$h?"$@t$Ph?"EW |$W}~14~`G;}|Vo`1^_[]USWVD$(}~;$ ~VE pS> $PjVWjSWD$11D$D$D$D$$D$ D$hEA"u VuB H5$%D$>j 5$;P Cr2밋$;$PCrj h"V ىVtS 1P++uE$ ~S4V^ $PhjSPt$VTuVh}A" *Wh2A"j?ÍD$LPSru $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA hG"Qhr$PPrr @r ,r .%r0B$PPh%r0BV ]8YShB"A*r'r)rzD$(hA"Ph)r])r9r rBD$>PD,r<r<|$$$PWS?$XAQj2$TPQ $PhwH"Phr<rr hA"jhr +rryt$$$PVWS>ލ$P|$xh=F"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP  $PhH"Phr "tVD"PSh(E"#- .1$P;$hB"Shrt$VUH"9;$PVhH",|$$VhH",hA"jhr t$j=2:$hI"Whrt$)I"?c.\$jhI"WhrS$d|1$XAA$Pj2PQi $Ph_H"Phr9rhM"蚇$`>ߋN8ד%w$%PVhaB"* `Ouet$$P\$ ZShC"*hB"$P\$;$PPh^E"N* V`)hNB"Sh*rt$  09rhL"ȆhM"軆$\>$Th$) V(hM"芆$X~:$\1j h#V ;"tQSC`;$X|j (~-h;M"+$`>V`Ouj k($X1~$1:t @`9u9u$\Ph|E" )1@\D$,\$H|$PS$hjV= L$,9F VhE"VhrW h"M"]F0PhE"(F0Pv,v(v$hF"n(j 'h/M"$ThF"C(PhC"hA"Fh$V=hD$0L$4$PND$8FhZD"Vh(r WM  FtsShyD"'$PtPh$'hD"'$Tt*Mbi)QRhD"z' j &$XqPShD"P' ]hSM"$X~n$1Wȃw,[)"$%L$7B"!B"B"ד% AM"B"PRhkB"& F`;$X|ۋt$~G$`>G8tu #Pד%w <%QWhkB"}& `Kut$hB"VhrP>^M"tsM"Pt$1 E$`$d $jj h#QPjVyjh.#V- V$`t$VhC"%$XMbi)QR$\VhMC"%$|$|$|$|$|$|VhC"b% $\uM@#1whM"L$!r)I"$PPV%t$hD"!11҉4hӀB9uc"t@#QPt$hC"$=2~S$h1h&y"$1PQhC"$ C uߍ_ j # rt$hC"Vh&r@t$~";$PtOD" "tVD"RPt$hD"$t$ USWV`p׉͋$tphI"S,$tÃr t1C1|L$PVQg Ou vu hu Z$1hoVW owt1$0 j2t W F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh9:"W Ƈ$L$h:B"Qh+rU9uhA"jhr U`p^_[]WV1VFF FFFFF hG"VhrQFĘ^SWV։ϋ\$1D$$jhF$SW tVjhG"SC tBjh"S/ t.jhH"S jh"S u$D$D$hH"PhrWhH"PhrW=2t?|$F"tF"PVh2H"  |$u$4%VhMH"  ^_[$oWVˡƿLf2PhI"W" Vh(J"W" Vh`J"Wz" VhJ"Wk" VhJ"W\" VhJ"WM" VhJ"W>" VhJ"W/" Vh K"W " Vh7K"W" VhXK"W" Vh}K"W! VhK"W! VhK"W! VhK"W! VhK"W! VhL"W! Vh)L"W! VhJL"W! VhaL"W{! VhxL"Wl! VhL"W]! VhL"WN! jDVRhQ) t^Vh $j_WVPΉ1WPhPPj PQ u^_VhL"QjUSWV։ωl$PU\$hjS8 E9C ShE"ShrW VhQF"ssss hjF"ss3hF"j{F"F"tF"t$(PhF"C t$4t$4t$4hF"*$t$Ht$Ht$Hh$G" D$8PhWG"$tF"VhjG"$4%h}G"$hG"Ę^_[]t$ t$ t$  tt$hA"jUSWVӉύD$(jPĶ1t$`FFF FFD$hc"V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVPJD$HD$PD$P ĵ%5%|$D$ fD$ l$ \$Tl$+D$Ty1%Ph $j($PT$D$ +T$(+D$0хyL$XD$\D$\5ȵ%D$XuT$hL$l+D$$D$ $߬$%ݜ$ܼ$D$pt$t$$߬$%ݜ$݄$T$xL$|l$x%ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|RhI"j$Pu DŽ$ <\$D9r<l$ 1  ut$)K2hN"5$;hiN"p5$;h#N"` $L$L$GȍQw[sV?PfPp--G A6P Gu$t L$-AGL$AL$$j=2us5=2 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h%S;t jh#Sg t ;/u f. Gf./WSu9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PSitH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 51 2H $s-t$$tHfHxt P2)1^USWV=2the2jjhU"Ijj9#tvƃ=2the2jjhU"21GNIIˋ^s 2 tVfV(2ޅu2=21WS"ơ2Krk=2tV$PhU"he2r ~uV7dV'%V`v v"2F$52vu;22K^_[]USWVPl$2M1t$"Džt.w w!ƅu hU"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=2tW"PhV"he2/ W_1l$$ttF9u t G9t$P%Qt$h2hV"hLf2<$WbWE&F~X|$<thV"V_VCbV&vfFt$ t$ t$ hV"hLf28EuFufFFV!|$WP`WV&N=21ۈ22|NIL2h2Y2ǀ2|NAMǀ2EFNDt$h2hV"he21N1@=21ۈ22|NIL22Wǀ2FNDǀ2|INOWĿ2ǀ2|NAMǀ2EFNDVdPt$h2h+V"he2C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=2#~VPt$h8V"hLf2R1t$h2h W"]a >W\Ut$$t$$|$$WX ƃ*VhpV"V%]1@KGufGfG1@=2$ WbPt$h2h+V"he2Ut$$t$$|$$WƀH1@=2ىV_bPWh2h^V" |$u V[v vY2F$52Ut$$t$$WDUt$$t$$W.PZN1@=2t-ى,VaPWh2h+V"he2؃^_[]S122|NIL2t!h2ǀ2APEǀ2|ONTt!h2ǀ2FNDǀ2|INOt(h2輼ǀ2|NAMǀ2EFNDƀ2t(h2菼ǀ2|MODǀ2ECHGƀ2[SWV=2the2jjh$W"萉2=21VWftmxtg 2W sJX tCf{u7=2tSPh>W"he20 S\S [빃;=22k52tc~ tWuLfth\W"W Z=2tWRPh>W"he2 Wy\W9 륋v$^_[SWV=2the2jj htW"L2tS21{ t$C$Su[SFuՅu52thW"VKYv$^_[USWV=2R2utDhe2jj"hW"过,the2jjhW"裇52t$G!jj#^ơ82;2<22,׋-2WV]Ɖ׋ <2829sAWV2ÅuWVhW"p\ SPhW"hLf2% c렉1‰1 u`WVÅu h.X"%\CuhDX"SXCt SZcSSPCcQPWVh X"hLf2:K29tPt$ ZU-282;2<22^_[]USWV=2the2jjh\X"f02jY9T jj\ʼnT$2 2PQ\D$5<2582J\Ɖt$U9\ʼn$St$p\Él$9$\$<2 829ˉs6f02j8DTk D$;82<2rM\$ -29sI<29582s9-2tS 2E9u<2 829\$ <2 829ΉsZWVÅu hU"YSCPhW"hLf2 cWV[Ɖס<2 82911 uU9t$D$ rIWV<Åu hU"|YSPKAc9-2u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5<2582fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=2the2jjhuX"cFtVPXfvu݃=2the2jj hX"!2=21ҹ$RL$QtMƋhtDEt9VP|$ W1ۀ~UiCSPW+W em븋L$$; 22r^_[]SWV=2the2jjhX"Y2=2rc11CWS5t:FfN~u %fFfthX"VYSvuȃ;22r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWhX"V ~u,|$ t%hX"VRWhX"hLf2 1^_[]fUSWV`=2the2jjhY"%525252h7Y"hh12 t=2uFFF%)Fu9rV9=2tJhe2jjh\"{F 2t(t$he2jjh\"{F 21V9vtRPh\"he2 2the2j "$ 9̓>t9߁^_[]á 2tPjt$t${uù1WVIAfF=,2|C02)f8252jQh42zu5,2F142PVQQ =02F,2^_ù1Qh8]"f88u"h]"h{]"52h\]"hLf2Dj:WVjh11t)h t 8@ W蜼^_V82 <2t7#42=@u%o>82 <2t42!=@t^USWV$$$ $jhWV,42tE1M1 tmjWVS$8jWVS$8t$Sh $hVV賫$ (2U Rh5(2DžtGh%PtSh Z"hLf2 5(2DžtGh"P軯tSh2Z"hLf2 5(2[Nj5(21jPP6謚+^^$DOGrhPD$Ph[Z"hLf2:hPt$V^ $(j7V@ (2u D5(2Nj5(2j1PP6+^^X^_[]SWV׉1jPP1ҙ+FF9tX\$)yWh\"hLf2] %؉jQP6葙~tF hP6裸 F^_[USWV|$_ OtGhS7u GO9}vDty)9|n4 ȉG.uFh$Pͭ;-22rv=2tUhZ"hLf2r \GP1=2t:PhZ"hLf2C %1=2thLf2jjhxZ"v1^_[]USWVD$$P'D$x/@th$Q1ƀ81Mbi)42H1ًP1 t (2P RV 5(2At\G9uGSVP螫 t5(2Džu*h$D$Ptƀ8MbE^_[]USWVt$!M1 tFjhRW8,42t(E1M1 tm`ƋU R^_[]ËD$0USWVX=2the2jj&hZ"(t2 ["V4 h1hI["V! Vjj)h["pe^_[]h1h["5]Lf21CWSjh["#h1hc["]Lf21CWSjh["pWSjh["+USWV$ $$jhUV42tC1K1 tWUVh@\"{E1hhW $ (2S R(20˵Nj[~Xl$9|VUWc =2uVUt$ WA4$61@=Lf2WhT"V} VTt<0Phf"VV 1^_[]þLf2525<2582hj\"V$05Ph\":Lf2525<2582hj\"V谭0Phi"V jSWVt$|$jhVW 421tQ1Y1 t ȃ^_[V'=1#t11PPV趴 V=1#t11PPV蒴 V^USWV|$\$1 tI;22s9-22QPWS_DtH1ًP 1 t@$Ɖ^_[]USWV|$t$ t;522rWVh]"B 22QPWV t߉^_[]USWV|$u h^">W!2u`Ɖˋ- 2UDžuh _"z>- 2)ً29w؉9vlj<2|$2WS.^_[]USWV։ϋ\$ t;=22rVWh`"= -22QPVW"{s LK$\=2t%[$tC1K 1 uh`"S9^_[]SWVt$f~th^"V9~u(~th^"Vg9~ th^"VS9FN tkQPDžuh^"V)99tt79uNH4~^ SW FtPh^"V8.>W3222F$52^_[ËAP 9ttЋR9uIHËIH h a"Qt8Vt$VΙ22^SWV|$t$Åuh^"V,8;^ty^C Fs j/WBGSd2 2W W?FV86P訝1ɅF fN^_[USWVd=2the2jjh$_"'f=2td|$xh""Wƅu00/Ph>["hLf2 Wh?_";t$ f 221؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6pevuݡ2$2؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(Wd[u2$52L$T$9΋$D 1$T$|2~L1\$2 tAD$t$ jjSdG29|͋ 2 $52T$|L$<q$Q Ai(2,2QA 22QA2A$t$ Vjj(QcF @t3荢0Phl_"hLf2 t$xhx_"8Vh^_[]USWV$=2the2jjh_"4ce1PPU Džy00JPh?["hLf2 Uh_"88D$,PWpy0迡0Ph_"hLf2 Uh`"7$jS%ƅu h)`"7SVW xD$j(PW y0D0Ph\"hLf2Z UhQ`"{7W2RrD$l$,2=(2,$1Չ1 9$hLf2jjhs`"jj5252o12jP22u h_"6PjPh%HĨ^_[]f02D$L$ ,2(2D$L$ 22=2u t$(6t$pPh`"S6D$ L$$ 22L$T$ 2<)2؅~ڋ=2n12 2A22 22~P1F 29|2=2t QPx; QP51 *H 22=2tPhek"he2^ 2u@ 2 2 222hLf2jj&ha"\=2tD=2Ttk222uI) 2=2u =2tuB 2 2 ,2(22 2 22Ph%0 D$hs11H=22u.=2t52hb"he2 ht=2tPWhFj"he2蔮 =2 22hQV 22^_[]t2 PUhFj"k s-2hh2U 0-Phj"hLf2 jUSWVE2f02T2 P2D$?SDžu#Sjj0SDPO/F^_[WV|$ thm"WWNƃ=2uhVx=2tn"VMFσfFV萿ƃ=2u VKx=2t8VhUn"he2˖ #j0PVhm"hLf2視^USWVl$|$\$u0=2uCWSny5@j0PSWhen"uuI=2uWSoxB1F=2t\n"tG"SWPhn"he26Uhn"2$i0PSWhn"hLf2ݕ1^_[]PD$L$ $QPhLf2ə =2uh%!=tXh}p")ur]j{WV|$ =2u1VVhW-x!1F=2t8Wh$o"he2: #i0IPWhn"hLf2^_Vt$~th8o"V.FσfFVqƃ=2u V,mx=2t8Vhxo"he2謔 #rh0PVhPo"hLf2臔^WVt$ ;52|$2s(WV=t xt@u;52Ή^_WVt$|$ r4VWt xt@u1Ҹ9r^_Vt$122|NIL2Ft,h2][ǀ2|REMǀ2OVEDƀ2F t,h2-[ǀ2|TMPǀ2NAMEƀ2Ft,h2Zǀ2|EXTǀ2RACTƀ2Ft"h2Zǀ2|NEWƀ2Ft$h2Zǀ2|KEEfǀ2PF@t(h2Zǀ2|EXIǀ2STEDƀ22^WVt$ V蜱1t%t 2P 9щrVh\p"hLf2p 1^_SWV|$Lf2Whsp"SN S%,2HQP~ Q1 P\ t2HQP~ Q Pz\ t 2@ tntyg1@1^_[USWV|$$\$ T$l$t$>.u Ft#h8#WTt9h$WTt'\$j SW  $ 9uy6hr"U$~h8#WdTt@h$WRTt.\$j SW>  D$ 9uyvh"r"j=lD$PhU53? u ^_[2h2r"j3lSWV |$t$ >h8#WSt9h$WSt'\$j SW  $ 9uy6hr"U$~h8#WlSt@h$WZSt.\$j SWF  D$ 9uyvh"r"jEkD$PhU53> u ^_[:h>r"j;kUSWVhm$(1hWD$ P> |$ |$ D$~P1ۈD$$,,jUh!Q tjUhPs"Q tG99ufD$u\$ tR$,4jVhF %`Q EjVhVs"HQ 4jVh[s"0Q 5\$ D$7f@jh0uht$Vj P53D$^ރ9tD$j@hds"P7= ߉tD$PLDaryDpriml$t?tD$PLD andfD D$PLDgrowfDnt$VLD defDectsDuViLjhs"P< V53535353hs"螂Et2tR}jhs"V$< H}j1hLt"V; B#}jIht"V; t6WhG"Sh $UփOut$ hx"^_[]1h1s"jgUSWV}\$j S53O D$t"NuD$Hj@PjSPht"jmg$j$Vjj53rF=tPht"D$D$ D$$fD$t$j VE 0˚ 9 1L$81qAQQ a A j QV53-D$t$ *jht"E pM  D$ @L$jhtjPjQ53ht"&he2D$t$H1D$`D$L'Ƅ$0VhQ`538 $j D$tPSo9 |$'y9D$(ȋL$;p%|"@D$PhVu"|he2?j D$$<JD$ D$ L$jhtjPjQ53~e^_[]ÄtH<t<u'53hu" 53h"u"hLf2 P53h5u"hLf2ƀh^u"~ht"jeE 0ht"`USWV $ ~($ 1j4hmu"K ?C9u1CCJt$LUPV7 CJjh'UVjS53~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P53535353hqu"} vL$D$$jh'hVjS53Ffȁw$VhU VhUn ƅtL$D$jh'h$PjS53]$f1Ɂw$PUhWhx"WhX#|vL$D$jh'h$PjS53$f1Ɂwhx"t$ t$ 1؃;D$ D$4ƜF>|$Ń %h%h${ ~y)L$"qND$P$D$\$S 1 $%D$KL$  S J#GBD$ @h%30( 30 3 4 3uh"h8 3PhN"fo2@ 3u^P#~.#t @ 31jPP,_ =3u' tu/hb"(jn_^j jh"!賩 MPhq"Xfj>_KAkdT*T$JKL$KL$ KL$L$ \$ KD(B\$ TH\$ KSAL$AKSAL$A KSAL$AKAL$AQ%< 38 3!уu+D$T$0 34 3hA"jeK@Phj"hLf2g j^USWVP=4 350 31,9|1C=4 350 39}`s%H-%E9ƉMm|)t6jju uL$,L$9ȃ}  $Q1F,MUۉu1;}E|uE EmubWV"VhtWj.Wj.Wj.Wj.hhV< x`j"h"P: h8 3血 jPV: jhg]$V: %3W-PWV: V=^_SWV։ϡD 3H D 3uhhH 3lH 3h"h"hSah""StZÉ "tc"hH 35@ 3Ph"SdY|@h8 3 Ph"Sd yh"Phɒ"j<|.i< c"t@#QPh6"SGd t Sjj!hZ" Sjjh|"( 3tSPjh%3hL 3u;hV,jUS1WUWV,^_[WVP"=3u% 3<u"3uœ"u"!h%35@ 3Wh"jäjh"=3uhܔ"=3u6hhh"9 xjh"P;8 V: 3Wh"jQV_ 3h"蘽jXVIj+h""n 3u 3ujj9"uœ""u"$=3u D$@ʓ"D$= 3u ͓"=$3u Г"=3u )"=3u ~#=3u }#n# 3uH18h" pWPV9 {58Vhӓ"j d58Vh"j=3u h"oj`XjhL 3hV"*fUSWVa΀-% plj\$ Cut$BT$ҋ $)|$4G1ɉQD$PSwa D$ D$ 938*8\$ L$ D$D$W|$h n"SDh%S;h#S7h9#S3hN"S'hS"SD$t$ |$@$1ɉQD$PST` D$D$ 9؋t$88|$1ɉQD$PS1b L$ 99։D$L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh,34t1hQ"v 1<==3 ڍt$81 D$ \$phjSh,3PVT$R$1BD$L4JD4`L$p$QRSRPV3  3u1$P.#w %Qh,3h"9D  31<=4 j=V9=3 j=VT$81 D$ t$ hjVh,3PRW\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP$h,3h8"D$49t 8Vhx"S1JD$ $$Qh%",=3D$t$= 3$D$D$,D$\$(V4 GC@D$p9Vh"70者Pt$hš"|$oQhA"=3D$WSt$h-"VD$ 81ҸD$ |$\$ Cj"$PsZÍD$pWVPSt$ $P\$ E $,3jt$tS7 $,3jWV# -"0kPh,3h" B3  3$Ph,3h%AD$ $u1@t$2|$ Qh"(11G|$1\$ tpupth#Q=D$ t$D$t1@L$ ɉ"%t"PQ^Q|$t 8t1j t$ Zi4$`St$hx"FQt$h"7.l1m1L$ L$ ف$K{8P|$W*:D$ t@j QS D$ ;$|$8tQtUL$4 T$hjRh,3QWt$螯 l1T$ gL$4D$ ,31ɍAD$4tT8`T$ Q$QRQPWxc3  3T$J.#w%Pt$h"t$L$ $d$ r $3 $tu¸9#tS"PQh"|$D$u |$u |$TF1@]"%t"Pt$h"$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0QhZ"X0血Pt$hu"|$L$lj% L$St$h"{D$$%1ɉQD$PSKY L$ 9t 9St$h"",D$ D$ D$D$0L$0RPQt$,t$$P/}tBD$tUtsD$ |$,3jVPM D$h|$t-811FD$&|$,3VVP  D$'$D$8|$,3jVP D$p,3jVP UD$1=3D$44$Vt$h؟" Ph"=3he^_[]4$hߠ"ًt$D$t$$t$S@9s Vt$ha" S@D$t$|1ɉQD$PS% T$tD$pD$ 9t8u8 St$h"Qh"1ɉQD$PSV ƋD$ 9t8t}St$hC"St$hZ"D$t$։D$4L$8`OGL$0d$ rxL$D$nT$L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h" j(2j-A|Ph,3h" hО"h"h"h,3h–"SWVPD$t$|$L$ $QP67>79w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVSx1Ht$L$ltT$d;WuT$h;W(u QP ŃtD$ppPU D$DGXHr PaoXd^_[]USWV$l138,3t 3/3Sh,3stW,3މ)ˉESQ|$ WB DW3VVfǀ3/SU u,3Uh3,^_[]USWVhT$D$d"%1Ch3D$ CL$;rjt$V| ufD$jD$Pjh3V2t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPOWt$hD"|$$j@WVPOWt$hT"jgWVPt$=h15PhT"W 8 3t5$3Ph՝"5h17D$$PV5h1; (3^_V΅tO Hw;s1 3 3te^ 0xPh,3hޝ"M Atʡ 3 3t"( 0qxPh,3h% u =3t^j%.USWV=3ˋ} 3 3 t u tthe2jVu}ti=3|}t j 3MO؃thD$VuP? t$UtuRhT"X4{5p1Rh$?4 bD$VuP tMD$PVh" 4 D$VuP t+t$ t$ Vh "3]D$ s*P? D$L$ r!QPh͢# rD$rIPhe"QPh.#xt$hܬ#{3}u h"h3j 2e^_[]Ph%USWVP=3u(ˋl$ D$$|$5 3 3 t u^_[]Åtthe2jt$W܅3| t j 1$^_[]uCuWt$h:"2 K4$~DN1ۅtPhz"2t#=3uPh*"c29t3C뿃u,h"E2't+ORhT"+21PPUVSW:ftu= 3u5p1t$h$% $ $ r/1۸c"WwwPh"x%C ";$rj $1A1AyVlN^_[]Ph"j UWV0EMT$1|$ VVRWQPket0M|$3 3tT$ jj1Ay= 3uQhT"$1D$ L$ T$$L$l$L$, $$D$T$l$L$(D$L$l$\$\$ \$$"G$e^_]Qh*"j` USWV@$ @=3t Z$ Vƍ$ h jUD hJ%V&  t}1ۍ|$1EjSWV= L$99=z  hJ%jƅu$ 11L$RUPQ$8@$8@ctIt =3$,@$@3 3t.1T$Ph X1Ʌ1ۅÍL$MP2$@SPUB U$@KtW3 3t$ jh V0$ PjPS SHK@^_[]8"tD$9t 8uVhI"Vh8"jh+"h $j4USWV \$0|$,1PPUPSW"b)4$H:1PPUVSWa= 3ut$ hT"e!>rt51t ttt ttth~"'! 9uЋkT ;$tl  1L$D$Sjh:"  {t+1:LtPh"  G,;{r܃TD$@TL$9uj VI1A ^_[]h,3h"+USWV }=3t D$ toh"W2tc1ɉt$QVW  T$$9t8u8,Wuh" =3j11CL$ t$PSQVuu_tWt =31=3u?=3u6L$1J1ыT$1 u#MUPj h"1ɅRaMUPjV tK=3u-=3u$1H3$3|$ uMUjj h"MUjjP e^_[]ÉSWVtpm2q~FDx@uAFX@ut9vpm20Dr@tH^_[USWVPω11s6tUVh_"SzUhV#Sz t9V:G4$Euuhc"Ɖ$t^_[]hk"hf"j-hk"hy"USWV\։ύD$ jPj P 1u0D$F|fD$Y|Uh"j D$ P$L$D$ L$/Phz"j D$ P[ $fL pm2/LA .sD$ L<u\$ SyjPj Sr E9[|$ t D$ PyVh"d^_[]WVth΋u\~8tU~4~`N4F8 I9rPE1F0F4F8FXHr PEFX^_fUSWV\$33hS"sP\su 3*h!Pu 3jG3Jmx &蹶'?c.53芓h!Pu DM3=DM3^"t"l$PKrt Pu|Qߋ<-t<+u{uNhMi%S<tGSM16khc"q3t8u)hj"q3Pqt 3`T#hq"}q3Pqt 3z"1=3tjh"~FP7֛j觛N=3u0j_`ujjB=3t!=`M3u=3ujh" C1FVV7=L3uhq=#501u\~jhʣ"B jM5L3f:0BuK@33!Ѓt4M33Bzu=hM3t0譚|hM3jS=M3u T3=R3~jh"u j j 6GWVt$ y5353 3ut[<|=N3t= 3t|1'V1Wu=WSBV8WV|$ W@jP:tWP@^_t$t$i:tjh"jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@9$3<(3U5[3=X3u ,3X3U=v====,=XAf2 ,3i\3`3d3F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff fĩ;D$\3D$L$d$ `3 d3D$D$fD$ D$5[35Pj5[3B2 $3,^_[]VPhht@j t1h$"ktP$t$uչJ$~h3h"rkt(P# h3 h31 h3 h3u.h/"!kt P菉EM#Tƅ~5l3h*"jtP[# l3 l3 l3 l3P^V[tP=3t1H Vr^PL$$p31Qw$%7"M(uMfp3 x:"4="+@""C"F"I"L"=YÉO"/ufp3R"ufp3p3WV׉vu1=3u WV跄^_SWVPhU"iPi1Ʌ 1hO$uiX%t3Qh3pt3h"t3Vy B"3k"3n"3ك%3u"3q"|3!y33333333~ 4N33H$3tƩ;#c"c"t 3"gtlj=3t"O3w">"t 3"!"t 3=dM3t8=3u/湯"3%3=3u 313c"u 3c"#3t8u33c"È%q3=3tt8u33c""":3t8u33g]$湲" 3t 8t1@ 3c"1 3c""p$VWWh 3h 3qq"B%V5 35 3h 3h 3H"$V5 35 3h 3h 3"$V5 35 3h 3h 34#;tlj=$ 3FF#m( 3'}%⹸F#c"c"tơ38t,<$1QQPH PW<$WR@$h", 3%=1c"uc"uc"38t2<$ h3IQjṔ PWr<$W@$ڔ"S>0 3EG# tÉ4 3%#c"tƹ!=3uc"t‰hc"Ɖ58 3>u +3^_[É(=$( 3z8{lV t<0 1=3u V|^USWV׋t$$\$l$;Et*+u($c"t D$ L$M^_[]USWVր9tMτtC1H 32U5h3W4{ H 31H 3U5h3V{ ;H 3|ut$3^_[]Ë 3h3USWVL $։ύl$ D$?hѤ"W()?SWU D h VUtz $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$ext$4h VWy L^_[]Ë 3h3V=hM3t =3=M3uF 3h338t!38t=3u 0 31B 3=M3u 3h3b=M3t 3h3H< 3=TM3t!=h3|1Fj 2F;5h3|^Ë 4 31B^ 0 31B 4 31B=< 3ug=hM3t =3uN=M3t 3h3=M3u 3h3=M3u 3h3< 3Ã=3"< 3Ë , 31BY 8 3h3Ht$j53} 1B)=LM3tË $ 39th3 =HM3jË 3h3 31BV=M34 3t0 31B5@ 3t-F=33t31BV^Ã=33t31B^_~$@ 3t  31B>@ 3t 31B'@ 3t  31B@ 3t  31B@ 3WVD$ #=$1 lj Ƌ 3j"  3j  3j=M3ttV$  3j5@ 3^_WV|$ 1Ʌ<+u OL$ GW-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$T%1@ÃQ*A wO$$% ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$1 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th~$VtrL$PQV t4uRL$xؤ" $x2P ؤ"T$x ޤ"$x "w^1JԤ"^aD$# $1  @ 39uVD$ T$5$1! щ щ! ‰ 19^Ã=1th"Ë ( 31BSWV@΃=1ttD 3tVsctx1Cj S*VGVSP_GVh$Pԍ D 3=D 3!Vh"j@WWZ@^_[ËD$H 3WV91t#֍|$RQjW@1B$51^_Ãw%ÉfUSWVPt$ P!уtRPtt jh"jh"l$$\$|$Q t^tY9uE}㽙4u y<Ճt(ˉ $19u tC ;$u~2KՃujhP"t jh"jh6"D ^_[]1ۅs IQRP踒fVt$t=1tjhd"51^á1xy=L 3uE P 30@#4@u.L 3jhy"?t [3t1P}153*3V1N=P 3t9t/ P 3,@wB$@(@1҉,@Ɖ^USWV=1P 3@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh"1@$qQ51  9D$}P 3럃^_[]USWV-P 31|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5[3(P 3@9@S P 31JЅt8=T 3u/@u1u0@4@ &[WVP 31t[@t @4v P 34@0@{!уt RPF1G)t [3t^_USWVP 3t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHP 39t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë P 3t$@(@ ,@1HUSWV5P 31H(@$@9t#H1ًP1 u,@;Hs DN3%D$z9tG1؋O1 D$ ~9 $tG#G=M3t @t1x9 @}lh jntH @1HGG7FGF8~FNOG Fx ~,@;GsN+M3~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@Z!ƒ5P 3@@1tOD1Q@u;G  )RQ@w u&P 30@4@0%OD1@l$1tʼn$yjhƥ"1=3u 1x~OUQPi 5P 3@@o<$t0@D$4@=T 3tU=N3u#L$ Qh $ N3j2=T 3t=M3u q=[35P 39>tOOHOP 35P 3wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jh" +31H^_[]USWVP 3ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H1áP 3@u1I4@0@Ë9t1JQQ 9u@o P 34@0@1@@(@$@,@PPP@!ƒtjh"81PPjt$轱!1WVP 30@4@!΃t@@9} 0@4@^_SV\$t$ 53({P 3h8@jP 3@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV̰!ƒtP 3 P 3@P53vzP 3@u@^[SV5P 3@  ˀuH9tPQP P. dž @vv Hu5P 3@uE u@S5P 3dž@tV1P 3P53y^[áP 3t@1fWV|$t$ t=X 3ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVtD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV hc"j5h"lLh!3h!3h!3h!3\$ -uF :tjh"]jNbt'.t5!3bt0:wtptcu+!3F&jSh!3 !3jSQ ,uF!3!3!3!3!3!3!3!3!3!3!3!3!3!3!3!3h"J1tPhj"J1F$1Vhu"Wh\ 3P(h~"dJVh"Wh` 3P ^_[h">JPJj3T31B th"Jƅu&h"Iƅuhª"Iƅt]h"Vu6h"Vu$h"Vuh"Vt1B"w1 pm2TA ruƀd 3ƀd 3ƀd 3@=u=X 3D$d 3SVt$ !3M1ۅuD!3;1Cu11(u!=\M3u1 1ۅÉ^[D$d 3ËL$=r!=X 3tP5\ 3j hd!3='d 3u d!3e!3ud!3ESCd!3Ãw@d 3uQh"VPt$ u !3ESCuw d 3u;Vt V5` 3B$!3xPV@,@d 3uPh"V5\ 3j h!3g!3^WVD$L$ =X 3=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$%F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=X 3t'~3P19wKS>~-19s2C,9r9v)CK$SUuF8AUVo ɋl$u9tSv Ƴt1|$jjSOF ~.EFE0uE^_[]V *3t";T1t1FVh!3P/ *3p^USWV\$,=X 3tV*3tgفuH*3J *3*319*Qh*3~-*35*31E4*3J*3*31E*3=*3u *3 *31҅; <1t҉օt1PS;H*$%= *3+"(*3Шu*%=tS *31*3]^_[]Ét$ *35 *3 1y)3!3)É 1n1|$ l9} SWh!3踰 uԉnc"t)3!3VWS=)3=!35* )38u!e0 *3$*3tP $*3%MD$PY-)3E˨ -)3E *3  *3? ǃ*3^_[] *3] v *3e *3)3=!3v!x ux ;|)3=!3w% *3)3< t )38 t *3 *3  *3)3B5)3a *3)38r  *3)3=!3wx u )3=!3\x tQ )3=!3.uD$ L$PjQ课 $T$e^_]Ë *31; *3|!3á *3t @@@ 11[1PPUSWV=3׉΋$$L$ D$1AyōD$PU!#D$=xhL"UyU7W$ShU 0jhl"UX" ShU D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(1D$ $X1D$D$ $Uj $Pt$Wփ ShU S1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=3o=81u=h1u =G3P1TAP賣@PjVP+W蒣|8QZtQL8h""WEÉ4$pu1ND$PV[~x#D$ =uhV h_"a0tPNƅdո(1Ex uָX1Fx uhl"hX#S/ T$Z]VUh"S:Sl4$VWWVĀ^_[]SWVh"/P/tt;^_[&hq=#V赦1ۅt+h$V衦tV<1AÅt^_[SWV|$\$t$t.9tFtVaF(1tX1u%"+"QhX#P tWh"v Y=81t"h"hX#v V(1=h1t%h"hX#v VX1^_[^_[USWVPӋl$D$ $uSPSS1tD$ t}t8^_[]StV믉h!3jPN SPuSqWV)38L$ Ƌ)3 l39}I9u)3xtWD$)3$)3V)38t,t$<$PD$)38uڃ^_SWV !3)3$ l3+ *3|51ۉ|$8tZO\$l3+*3$9|Ӏ8t-t$|$D$|$D$$8u$!3)ȣ)35)3^V^_[V5)3!3tR)3)Ɗ 0@u 15)3A=)3!3"*3=!3 1@^À=!3t8)3)3 15)3*31@á)38t AUSWVPQ_$1;t.߉WjU $)ډfu $;uƉ^_[]USWVhޫ"O+h"@+Vh"P@ Åt^_[]jhȫ"Wz@ t Vh"Pe@ UH uhի"*Vh"P:@ ÅuVh"W%@ WV9G t'փtPh"V G?G uG^_Ð@*3i ËD$u5Ã<1Ph"USWVD-3ÅE\$9uz$1ۀ|tisljDDs9u>rjjx D*3D*3$t,tV#hj:} =[3TeuYÃ=[3e4΃e@*3~o6/=X*3u #=*3 t t =^=X*3;*3Ct}.CЃ jS&ed~hh*3 T*3P*3=@*3t @*35=@*3u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=@*3i@*3ih$jjS\Fc`$t%=3 Y[%t43#-l15@*3=ES[jUY  xS@*3H݃t =M3-H*3>!(Ƌ 1ķ>tjVUP t j=1u J[\ 1jry C$(% 5@*3 h"9\39(39`3=X*3SX*3C1Ƀ *3|*3ῃ5X*35X*3@*3/U]VsWWr!2@*=3%I*3@*37N3@*3hgS#jj|*3*3n=3 5T1@*3 }h"@*3 _gh[%y1PPvN31; P*3H*3 T*3HT*3P*3/=3 @*3%h"1PP9\39(39`3؉ك u. u.S莍i*35l1@*3%aihY[%{jVy|*3*3 PZw H*3 *|*3уBЃ@*? !1҃ ƒ!D$Z=X*3,9\3t 9(3h 9`3W jhJ"j#t$(V8OVrlp1BsRtM&=3=@*373H*3ЩuH*3Mj5<1ùe=[3Iv_*-t%+q1҃¹) |*3*3S\B D$t1< *3D$ D$ PD$PD$ P萪 X*3tjD$D$-<{|Q<`ʃ=*3tR D$HL$@븃@|*3|$ ^s 8eB@*3emhǬ"1PPL!ùe9\3e9(3e9`3e e 1?PS1FP@/|*3Phc"5*35X*3虤 1;5P*3T*3|T*3P*3n蔰VVA 1;P*3T*3  T*3P*3|3'M1PP53 =lM3 *3 t|7ػT 1;P*3T*3|T*3P*3蛻=M3P*3u' T*3|5d*35`*3PP*31QQm1;P*3T*3 T*3P*3|3|C=M3u5d*35`*3P1PP53A T*3P*31҉3P5M31;P*3 T*3|T*3P*3M3聺觮5T*35P*3DT5M3J@*3NVh߬"h1PP5 ùe9\3e9(3e9`3e e /йSE*re|褹ʭl.3l*31l.3 \M3 p*3\M3 (N3 t*3(N3h"CjjhV"T*3݋5P*31ɸd9 jhz"=3t>t5l*3l.3p*3\M3t*3(N3j)eD$t Pj{@eJr蘬 L$Qh $1;P*3T*3|T*3P*3)O=M3P*3u' T*3|5d*35`*3zMP*3jjP1;P*3T*3|T*3P*3跷ݫjj蟷ūD$<1D$Ph"=3jh"VR T*3P*3M3 T*3P*3M3P*31ɉ T*3|T*3P*31@Pe(ejh"e1;P*3T*3|YP*3T*3 諶Ѫ=M3u5d*35`*3Ljj- T*3P*3ʃEݣM3c T*3P*3M3x*3  x*31; P*3H*3 T*3|T*3P*3q j5<1?P*315x*3"5x*31;P*3 H*3T*3|T*3P*3 j5<1RCiP*31D5x*3=M3t5d*35`*3J1=W T*3iP*3me53V?P/V$P*31ɉ T*3|T*3P*31@PuGjh"P*31ɉ T*3|T*3P*31@Pk 2V_e!ֹe5M3RPyJ1A诳է T*3P*31҉AQPcMl.3Nnl.3@*3>X`hҬ"r1PP?ùe9\3e9(3e9`3e e S賁+̲1PP5M3n豲צ1PP5M3jP#'P*3T*3ؽy蟦=M3t5d*35`*3Gjj5P*3d:0ؔP*3T*3艽*Pjj5P*39; eS贔D$D$Ph4"{豱ӡP*31ɉ T*3|T*3P*31@P"etbt3tFu j11A; P*3T*3c"|c"L$Qhk"11%P*31ɉ T*3|T*3P*31@P'"e11A; P*3T*3c"|c"L$Qh"je53<hq=#P531=tjh+"o5l1@*3nvhY[%1SVUh蠻Ag53rSPx]M3 l3݉P*3 T*3l.39‰}P*35T*3)‰l.3+3eM3 l3P*3 T*3l.3+3i1T*3P*315M3QPHFjh"H3D$Ph"d ։u=h*3tP*3 T*3h*3e,5h*35P*3tI~V8Jjh"bUSWVP趮ܢGVD$1Ƀɉlj щ t.3p.3T 3=[3uH9ljD$u21xUUjn6 9-[3u;=p.3t.3D$tT 3 [32t8teue^_[]USWVPӉơH*3uH*31 r4$0utV4$#H*3H*31ESWPO áH*3 H*3 x*3tu1Fx` sKu j]j%u0SW5H*3 áH*3 H*3 x*3ujh"t 4$4$^_[]WV=1u=hM3t =3u袬׮t 33!ʃt]53QY+3u =1uP5TM3=T 3TM3T 3u _BLE5TM3=T 31jPPB ^_SWV|*3߾%tq=#@*3/ V+=*3u V@t h˭"t uY[%[%P1+3PP^_[V蛫ơ@*3"~S.#V$^%=3*3VPujhj"  tY>!t *3t P` V!*3=3M*3.h^"qF<+t< t 3t Q V菛3/7E=3V蜭hd"Pt% =3V^XP*3^(N5P*3jF5P*3jQP軯^5|*3V5*35X*3X*373H*3H*3PV3h^"hc"r^SV H*3t s7@*3ZbH*3shp"iH*3 sh{"QH*3 sh"9H*3th"#H*3 sh" H*3fyh"H*31Ct$‰sSh"jV胰VH*3CuϹI"t$ s"Q+3^[fD$=X 3t@WV|$ Wjeƅ~WhVj ^_USWVt$0l$(|$$t Uz,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD X 3H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t W WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f *3 *3 *3 *3USWVi $AD$)< u?FP貛^tPx9~"ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp1hhh1hϭ"htjPV jh"h"htjh"h"hjh("h"htjh9"h1"h^Vt$ t:j jv tL$HΉp *3*3jh?"荞^Vt$ t:j j1 tL$HΉp *3*3jh_"H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃVz 1H^_[]h" t8tMjQP[ ƅuhޫ"t98t4jh"P/ ǍEjPW W iUUUSWVP1F=3jt$RP#19jV n1PPPSe!ƒJVWS豄 <$SÅ11 ?$:81xM'x+xG1O|E(|n|dȃ|$*3t*3Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW" S耄1N^_[]4$ |t|uVP11xtɉSWVh*3t$b<ƅui\$h*3e5*3PSh*3I5*3P|*3t*3h*35*3p^_[ËT$ *3t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=M3ÃB1ۃ=M3ÃCɍH9 h3~Pj#|k+3SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=M3ÃB61ۃ=M3ÃC%|$mu9h3~HPj#j+3؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PnV0ʼnPnD$X9vpG$11Ʌu2~>9sWt$Vr t't1:%11F9r':$1u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWmV19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQAt1=$N3ƃtEuG%t|Qh "hh"AVh $6 Eu ?=u QhT"$ u 覣!ƒtVHQh2"^Ã=$N3t$3tPP&t53ËD$t53PF$1PUSWVu1953O3t_jP%=3tJtWg%W"=3u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =M3uID$xAP Ft4D$8\$Ph"FًT$WVt$j 1@t=3jWd$53t$V$t$53g$53$h353#3t$ t$ ۨ8N3= N3111[3D$4PD$,$jUuWPԅWԶ U2Wڃ,$C^_[]SVt$ hq=#V[1Ct'h"Vl[thۮ"VZ[1ۅÉ^[WV$ VtVWV#tWt^_USWV 1=M3]=3Pj\hM"1Ƌ|$ 11@L|uM@-u)Fhq=#WZ)1%tuQ%t s@AAۃ\$WVUWU؃D$jPtWVt$P裊W# "S 1tXt^~u1O\$$D$jPW+d uQD$P4D$(0q=#^jh"4|1 ^_[]ÉOVn);t;V\)1|$rɅuŋD$(ۮ"1O;PrSN USWV=3t^_[]j荈h"t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh&"U{PljD$UVTW TS\$S,8jUHrS\$SVUP4$f S] \WK V( V|V$#N@ |^WV|$=M3taPWe1=M3#D$=WS*jP`qWP臁hP1LPWx#D$=@{WRjPqWP9h@1Vm WoƉ|^_V|$PV-x D$XT$\1jPPVB|^UWV蒊lj53# QP<t1GL$ T$3*33 *31@ u,L$3 *3$3*3 u!tL$\9|$X}e^_]øY"Vt$VQ9vHx/uAΉ^fVn +31ы5+31 u^ã+3 +3=HM3t^6~^P~SWV1ۃ=T 3t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=+3t+3USWV-N3~ON}=N3~Q111SWuljӉ:}qF;5N3|؃=N3' =N31=N3|=h3111;5N3| V|ljՉ!<$=N3FD$1;N3ál3D$ 3D$l.3D$$l313l.3PPSUt$ ljՋD$ l3D$3D$l.39pt$j pF1Mh3H91Z{1@^_[]Vh 2F;5N3uj{ t j2^USWV\$,=+3t+3&|$$t$ l$h3t  $9~ |M3$x 9} H9$!tT=4N3t M3tC8+31҃=T 3TRQPWV脘WV Ɖ1ND$(D$<$=TM3t7h3H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=TM3tzmz1@D$/1@D$=|1uu=1t h"\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|1 3t)!u =TM3u=L3u+3=L3t Xm+39l$"h3HPj-|1Ot1E1=N3~1VV|{~ VVVD5 -T 3t <$tw y|1j@ ^_[]USWV=+3t+341=+3u!xM3y=TM3t h3'|$t$;D$||$$t D$9h3~ =N3É!tF=4N3t M3t08+3,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=+3táxM3y=TM3t h3ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]Åth3HPjytm=T 3tPay1u11FUvUVRPVjv!уu [3tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V h3~&111RP!уtF h39| 1 h319^fVt$tsVGF953u#1=1tu1Ɂ1tщ 3AF=1tH +3v = v2 ^) ^ËD$1tQ11tЅtË 11tËD$1t 11tËD$1tI11tá+3USWV\$S@Nj511tv WoL6Ws |$j4j'fSeFSF 1HF$F F1FFF0F,1tFq0@@F=1t@+3VEESKGËnU=G9Ë\$sUŦ SKeFW谦 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t Pۥ w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=l.3jjPWV^_USWV,T$Dl$@ظBӃ=4N3t  M3t08+3 @1)ʉ|ЉjSUQP虊كQP4v=pM3tK uu|| t u+| t u[3tt[3}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+t[3ǃ݃ tkwRPW v=M3t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N l.3 CfN =l.3=M3ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1hM3l$t$1E1!1M,^_[]Ã=M3t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy51=1H~y@wr 1N51=1^_[ÐSWVstjh"c^_[uƉסh3HPLi11 u^_[8iWV!Ӌ h3It*QRP4 h3HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhC"bKy1V[hVjRPUo=M3jusj'hD$ jhD$T$l$ !Ѓtd9}\h3H94$SW!уRPvlj9Љ $Ah3H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$h31VVjt$t$PY95M3^_[]1K16-+3-+3h3H $)QUjSWP(1K[6=TM3tf"g15+3SW=gh3HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9,+3">$4,$tt=t|<9,+3|wC^w \$D$Shĵ"jWi$4,$c"f9,+3u+9,+3}9,+3t9,+3hu_G t t1"~#ut|\tt t tL@?3~|$j=Wh9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEu "c"6$4t$ t t_G˵"c"$40tUP6tu"dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVF3$+3^_[]SWV׉Ή5(+35 +3h"hSHf=w )WVRQ+f$+3S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl1 t^0+30+31+3JtGtO GO 0+31+3l1 t0+3u0+3^_[]ÍZ w6$&tEGЃTZ$ &btPeu>f0+3랄tGOm>"놃>ڔ"w>%h>'}%YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]0+31+3d   >0+3 0+3 1+32+36+3Rhĵ"jh0+3c"0+3_t>c"vVh/"<-3P+t <-3!h@"蹻@-3Pt @-3Q"jVLD-3jVLH-358+3h-3h-31-3PҎ $u.3^1|$á.3 .3SL-31-3P-3 D-3H-3 P-3P-3@P-3;L-3|1ۉ.3.3.3.3 .3$.3(.3,.30.34.38.3<.3@.31H .3.3h-3#h-3-3P $u.3[USWV\$0l$,1=M3uSUƉסM3 N3SU\*@u6 11!ʃt'9݋T$0|1@9-1T$0| @.3=M3tU t@.3-3Z-3T-3l-3M3 -39}Q-3ƁT-3 l-3ك=M3WV^! tt$j VRP)NV+1 M3)~$-3r5-3ƂT-3 l-3Iu܅~+1ɊT 5-3~=-3T-3l-3A9uס-3H -3ƀT-3 l-3-3.3^_[]Ë M3t M3=M3t1M3@V5L-3P-39}9 H-3<u"D-30Ph-3 H-3P-3F9|Ӌ5L-35P-3-3.3^SWVt$\$u$D$0j?oP*/=X 3t&v!Ss1҅ SVqt1҃Pn1҅t$StP-3~- H-3Vt[uH-3 P-3LV3Zt P-3t> H-3VtV[t'i=X 3tVs1҅ƒK1JFVY# 3#3#53#3‰^_[QY# 3#3ʉ# 3#3áP-3D.3.3H.3áD.3P-3H.3.3ËL$1wQ5<-3 1SVt$ 1ۃw)V5<-3uV5@-31ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJj"9u!B1@uDA;1A+u%uVt1@^ÃwV5<-3u߸ع#L$1uj jE1ɉHH SWV=0.3 u|$t$\$t-1 |15T.35P.3tm1@Z ug0N3t \M3uU=(.3~+\.3 X.3\@`.3(.30.35P.3=T.310.3=X 3 (.3%=ua`.3P`.3d.319Rhd.3bmhd.3md.35\.35X.3\.3 X.3H `.3(.3u"`.3d.3x,1WV=X 3t `.31At^_[ÉШu-%=tS0l(.3=\.35X.3뢋\.3 X.3`.3(.3USWVӋl$,|$( .3=M3x.3uBu>%j jzC1҉PPx.38.3 .3 .3twQPl'UWS x.3xt<.3Ph-3蔅1x.3 .3u+(N3t\M3A\$l$͉=X 31؋5P-3D-3 .3Rk5P-3UWS% 65x.3g x.3-3PV軄.3@-3VP诅V荄 .3AVUUUЍ@@.3.3 l.39}oh-3藅ơ.3 l.3Y$gQVlu&D-3P-3PjVPm$.3$#5D-3-39|P-3l$ EVjUek L$ )v %uh-3蚃5x.3& x.3 P-3; L-3 5D-3|tq=H-30jf jH-39u"_l$\$u4Шx$_l$\$u$5D-3 _ ‰$ u*,N3t =\M3uKuG ڃ^_[]X 3m_uiud1UWj.3+-3 t18+391J$;<+3} qɉы4@+3)t _D-3\$ PjSi 1EL$D-3) P-3PjS`i ǡH-3 P-3tW4V).3~Z$.3t\ [5x1)Й)֋$F UWh$ N1 .3E1- .3$_PdtUW ]X 3t6=M3t-QdtQd UWl $UWS t1@1^_[]SWV=`.3~4։1d.3Pd VW u C;`.3|1`.3)^_[Ã=(.3~\.3 X.3(.31WV=(.3~\.3 X.3m(.3|$t$ =0.3uu 15T.35P.3itb=M3tY.3l39.3|.3.3.3P-3Al3 .3H9.3}M3 j M3M3jf=N3.3tL@.3tBx .3 l39}; j,.3P .3 l39}@.3ы .3 l39|L=3tC3„u0=M3t't4|$t- 1j1j 1j5P-3958+3 uD-30H-3^_V=M3uajm5<-3vtMȺj9ؤ"Fu=<.3u"Ⱥjw"Fu^SWV։ˋ=P-3GP-39=8+3 uD-38H-34D$ .3; .3~~ .3P-3.3 .3^_[SWVL-3 P-39}1T$5H-3ׁtu Ӊ P-3@9|^_[ËD$L$ T-3l-3VD$ L$=,.3u=M3ttNI1҉ tK1G-39~l-3T-3+5L-3)΋ H-3 D-30 ~^,.3.3USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8[3u/8+3H9| Qu@D-38GO1H^_[]cS D-39t D-3Mtۉ>?SUSWV-8+3\-jSs jSs DžtVtRU5D-3V  H-3UPW  Uz 5D-3 z 5D-3=H-38+31t Wy 1Gt Vy ^_[]USWVL$D$ʃQPO1H…t$=8+3D-3D8OlV tn[3uc~D-3>-8+3u@D-3 (I=8+39rHŠIJD-39s=8+3)\8OVà uQL$ t D-3t=8+391H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= VQx 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15l.31Kl.3|EtESSP tl.3@ԋ=P-39=8+3 uS1Hte1ɺ|1:tWAuN1|11I:t?@u21|11I:t%@u1|11I:t @u^ËL$H1Ʌx 1USWV։Q@@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=M3u1@$5.3+5.3~1; l3^USWV։L$|$0\$,Ѓt$.3!t6tC؃T$RjQPWSQ=N3=8.31ۀ=4.3tw4$4.3 .3ىȺVUUUЍ@)I-3~4,I-31E 8Vt$0j* G;}|Cu4$SG @.3tf t.3p.3!Ƴttt$,9} 5p.3=t.34.31ۃtQD-3 P-3T$ 1ۅ~&L$ PjQ\ P-3~H-3\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E.3;l.3uX.3# .3uD$,.3= .3=-3~01-3 8jG;=-3|h-3t.3;.3~<$~.3 P-3 .3$.3~1 ;j_G9u.31;l.3uD$Ph-3tP-3 L-39~~51ɋD-34*1 H-3444A; L-3|١P-3) $ .3P-3 .3; l.3~(M3 j.3H.3;l.3؉^_[]WV|$t$ =M3u1WVP PV WVt1@1^_Ð.3H ȁDG3r1DG3G3.3G3dG3G3 G3 G3G3G3G3G3G3G3USWVL$0D$,l$$G3$G3G3t-9Br }$r1z3|$( HG3u$$rG3t :=G3G3G3<$:rBJ jl$(jWG3tC:G3t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?G3t_ )ϋ,$]}G3tG3tV+BJ NF=G3uW-G3MEu$9ˉ|-G3],$ϋ=G3t sKӋ$JHJ^_[]USWV1=M3tD|$(T$$!t3|0G3G3=G3t'9PH }=G3u11CŋE1ЋM 1 u ]u,G3G3G3EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}[3!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[[3u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVStG3 11؉^_[]Ã=G3xÃ=M3u +31M3Phw"4VG3xNH G3d|@G3* G35G39|jh"z5G3^USWV|$ l$1ɃG3G3tKC9⻌G3G31 G31 5G3v vB1IʅI~nVv 4$9ʼn1I1PPt$R9[3 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$R[3uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=h3~%GW8É!Ѓu O;=h3|܄u<$<$US111 )ȃ^_[]USWV1PP@uejh"2.31111ۉu WVSU1PPWV+[3u Ɖ!Ѓu.3^_[]WVT$D$ = N3t 5N31)|щƉ^_fUSWV t$ >-uF(s7hY[%+V+h"+艣D$1S6]+S)S\^S Sjy Wh6#À8t>tkV聪tmSʼnD$ $U  $ȃ$jP'袷t$PSh%t$U`>t$h  Sa'Ņu>tVh!F'U'Uh jWW1FVJ]V'D$$t*P*h"y*/j ))3+3t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjh".1N\$h""S4hY[%Q)SH)h";)3(1S|&S[jj 1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSBjh׶"1KtL tGf;t=ËFHN~ ;F~à tQu VS BV1Vj 1GWZWg%e1=+3VZ^_[]fSWV1G31K4t 5u'#ar'G__ _Gt Pze GF6u^_[ËL$ 1ɅV-$t:L3'W.t7^uM3L31L3L3L33 M3L31L3L3 L3L3t Pb L3Fu,~1S薺PW豺FvUb ^F~ ^v;3t PNu VSWh ^_[ËL$t@;3tjh"x)1HËA QUSWVD$T$1ɾG3=39~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9L3u L3L3uUSWV\$SκƋL3t@PPV#uL3L3$a DžL3Wa u^_[]USWV=M3|$,t$0hX#W9 l$L3L3!ʃtWj UQP"L3uL3 hq=#VqtL3VUL3Ph"W/9u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=h39Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P_  $FQF^_[]V=3tjh6"&dt$D$tt/uKV3;m?u7=1xCjhl"뵃=1x%3Qh"l&^jhX"jh"{Vơ3t P^ VޣP3V^ 53蛙 ^33VD$$L$ t tC8.@L$$Vhs%Q 1>jh"1xxPh"j Vs3VZ||P|0tB D$0Ph";D$$Vhs%P >t.jh"1M3L$Qh˷"$^ãM31V1x$ h31Vh@BVPRQ_M3^VD$$L$ t tC8.@L$$Vh43#Q 1>jh"1xxPh"j V:2V!||P|0tB D$0Phd";D$$Vh43#P >t.jh2"1M3L$QhH"#^ãM31V1x$ l31Vh@BVPRQ&M3^V|$u%t$jVt0Ph"N#^V|$u%t$jV؇t0Ph"#^SWVD$L$tPL3p=3tjhɸ""VP>PR Zt V踘)X!ЃtV谕5M3SW? ^_[VD$L$tt\uoPe01_Pơ01t=(1t PZ VӟP01VZ 01Qh"!^V|$uJt$ =DM3tV3-L3h$_V_h@^^WVD$t t0t$R3l7=tDMtGhuXF 1PXM3R3Qh $5!Emtwt su!FF1FR3FR3F$17zY V^_D$u5M36Ã|$"7VD$Hs^\jh"7<1V)h$&Ph"h"V-;1xu'h<"hv"h"hι"h "h@"hu"j^^WVD$t$ʃc"y$| &m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=M3utjh"$FVPMy0Ph"^_ÉPh"USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;8+3~<+3A9s } uE9u9t},u E&| t18+3+4+3x1 ^_[]WVD$Pt t*$TVMPVLD$ps D$ stopD$Tab =t1|i1Gt$rVfD,V4<+3he"P G;=t1|VD andD theDen t$V5x1h"P˵ 0Ph $D^_à D$t t+uyL$tJQtQytWjh("Mà$1L$%1AAD$PhL"!%1%1$1$1%1 $1%1 V D$t t]D$t$jh#QVP46hq=#Vt5>t M3 $M38M3tP9M3q=#L$QhV"O ^ËD$Hsjhn"/Åu 3Ã|$u=M3D$u =M3~GTM3ÃD$ u)=M3| Ph"M3ÃD$ u)=M3| Ph"M3D$u"=M3t=3t*!ƒÃD$ t t%uCD$ 1^u2@t+$1"1P7Qhۻ"V D$,L$(t tC1ɉ N3 N38,uT@L$,t$Vh#Ql >tejh "Ot$5N35N3h$jVh'0Ph'"#t$D$,Vh#P >tjh"9 ^ãN3N3D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$!&d~&s wR$(!&s wU$ &gRtFWt4^tXBNIAt-u#13rtwu!uրπي@GN31 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh_"1QZSN3^[ÍD$PhD"҃=M3=N3=N3Ë M31 h3+N3t$4Ph"hL3D L3USWVl$,H M3t&AUjQD$}ol$,7F]$P!&|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph"hL34 L3FVEŅ8D$EH$!&E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=DM3nAL$,9 ItIT$uWoD$,7L3j+o2Ph"L3V T$jV%D$,|$?+3t PM GP 3CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WL |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jhM3P M3IM3^_[]É|$|$ u D$Ph" D$Phռ"͉-M3ōD$8Phr"uA0h"j*hM3I!ËI1Ph"j*hM3.!USWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph"=j UQ xt-u)%tt0Ph"1H^_[]SWV9toӉQg@jP ljtG\$=M3t <\u ~t F <$t)\tPS[t GFFuD$QhŽ"1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$M3Ph"|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hQ"3rtP衐~11@USWV\$(|$$1E= 9=[3t [3t, [31C4$$N3u V WSCu ^_[S=R3tR3 \$1=R3r 1H 1R3[V51N3t(N31VP51  9t +3^Vt$51^Ã=R3tR3r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVيk"O u݃|$0xG-Wt$8J  ^_[]USWV\$8T$0t$,11|$GUSRVTيk"O u݃|$0xG-Wt$8  ^_[]SWV|$(L$$\$ 1Ѝt$Fk"NuxF-VQ ^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$Pq ƃ^_[]WV t$RVQ t|$P3GuV^_9Hw @sÃtP=USWVPt$|$R3V<$=M3uԇTh=3 "Vt$ P]Eu 348JMp;5l3| +3^_[]VWj .^_[]ËL$T$c"PPh|" USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFuR3^_[]WVt$|$ zt!1Ph"Ph"c"PPh|" ^_WV|$t$ t%WVra7ft=l3 +3 j Qu jF^_fUSWV\$l$=M3u<؉%t1Ut1GWP?[PW1WPPUVd[1 jj1=31Ƀ=[3HPVWIR Åt!W5 |$t8jh"'D$ tPb3D$ 0]5 D$ 89t VF5 ^_[]Vt$tP"36!5 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQv ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u }D$E ʀ[} M3@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø:%fL$tt"u$ h3h3HI h3IR3ʋTUSWVD$T$ h35R3|1Gll\G9uTD^_[]SWVD$L$5h3R3|F|\\|N B^_[áh3~Ph5R3M USWV h3; R3R3th!t 1G31K;)1G1I4:tl!GtˉP1  h3jQJƣR3h3R3~PhV !t\l^_[]USWVPL$\$As h311H$(uh31@$1R3<#|tZR34ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$R31H; t$z|#=h3|O1;Ll |C9u^_[]USWV h3~.R311F1l9޻r G9u1@^_[]USWVL$T$9~1@+5R3A1G1֋l9߻rB9u^_[]ËT$h3!х1A9Hh#&*R3=DM3$&t#&P R3ha$&R3h"&1hD#& 1h#&$1USWV \$4Z3R3|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$"&=M3EQ-s4C$ىË $Fw$4"&#Fw}$!&X!уj WRPBBtDt L=M3!153hq=#P1sTu~-#PuYQA tLу|=RP螽1 $1=Z3R37f1=l.3u ÊCCs|,v, l,uȡ3!ƒtظ:,u53资j W5l.3QTу h35N3n9|$ V5353蛅PtmƉV, +1+5Q ic+Ɖ!уRPUVZ3=R3H8 Z3H=R3wA53kP豄 !уRPaٹ N3 h3VQRP*g 353,Pkyփr9RPٺٹ}"RPOj WRP$I"QD$ tOՉr6UPlٹ}RPVt$!j WP( I"/153Mj WP j W1P9C!@|R3c"9 Z3t R3c" ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5M3Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^51~V5XM31=DM3tȉt 1R30A3^5$1'SWVQNjZ3عZ39r ЍZ3WVSP ;Z3;^_[VQ!уu$x h3H9}FV!уtt^^Ð1Z3Z3Z3Z3WV|$ =+3t5Z3tZ= 3ta=h3|<1W!уtRP虆Ws@Gh3H9|vuZ3覍5Z3^_USWV 11D$L$!ȃ1D$1D$ 1H1111= 3=+3t4$=h3|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$h3H9|u $u^_[]Ã^_[]鍌^_[]TZ3K|$thZ3m=Z3t1=Z3Z3j jh""V΋At P% FVC^hZ3SWVt$>t_w T% WK% ߅u1F FF1HZ3Z3Z3Z3^_[hZ3SWVQ1u(\$|$Z3St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-Z3Vt;xH|p$x Hȅu^_SWV|$t$u;Z3Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=M3uH 151!ȃt3191|$|$ !@tp\$9ϋ\$(|$}^Z3U1tHt$ !t Q9y}1I(t(t$=4N3tT$$1=Z3uȅt^_[]hZ3Z3=4N3tUWVjW7!t"j]jRPWV je^_]Ã=Z3u M3[3Z3d Z3Vj5<1t2Z3jVx 1F=4N3u=Z3u@11N^USWV(U ]1Nt$ t$tr:tm1Z3PSi( 4N31 M3t)1V5Z3hZ3 4N3M3ttxq @3Z3 4N3t =M3tj)4N3u=Z3tZ39Z3J\$tP1ػ&!Ѓ1ojh"D$Pj@t$>SD$$PL$Qt$Tt$V>[3$u:Z3 Z3!ƒt&9L$L$|D$;Z3D$Z3t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$dZ3T$X/ t$ t$  \$(T$_CtN4$jjD$xP$Pt$4t$5Z35Z32$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$ V T$1H#E t0E t L$PL$THD$$e^_[]Ã=4N3u?hZ3L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ l.3L$l.3L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$l.3}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8l.3+3t$ t$  }tEL$L$H1USWV8=Z3Z35Z3Z3D$$8u=[3u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}Z3 Z3ȉT$!Ѓtsu!9t$ƄuYZ35Z3;t$T$$|@Ut$ 9D$ЉʋD$4$8+3@EhZ3hZ3}!8+3 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># Z3L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=Z3Z3!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$Z3 Z3!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ Z3D$Z3D$$Z3D$ Z3e^_[]1JЋ4$|$9ωL$}@D$ 8+3 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=[3 USWVt$hZ3tH>tC\$1EjU1GGGUSxL[3G=[3-5[3t~'V u[3+3^_[]W USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5Z3jjSt$DPV5Z35Z3s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@c3Ph[3"MUSWV T$(\$$t$ 1`1PURSA)ˉ<à uVh $t$|$u u)u%u!1ɃtsQl1Pha"wt DhN"%^_[]SWV \$ hSh"# uP th"$ ^_[v-xEhSh-"o# 4$mt t$]j V負h;"뙿 hFm Wf51t$S jWH|$WL[9uR1Vt$4$jFSh"#VWV|$ 51j/Vst@jWhY"QVH^_1@c3Pj袑ÊD$e2J e2; f2~{у ts e2Qe2jPhc3h"" thc3hL"Pt:j51P? f=1u58a35he2Qfhc3h""USWVt$81GWh!5a3/ 1-c3hno S褐D$ha3SD$U Wh\d35a3% tLtFPFuf=18a3tjQP P_jYt$4l$0jHD$T$1D$EHM~EHMU虑ڃÃ=c3uf=|1u0Iڃ% tM 1f=|1@ ЈD$P D$ƒ t|f=|1Qq f=|1uf=1tT$j \$Ct,j Cu\$T$f=|1x댉\$ 넻 $f=1tD$ @D$ Phd"ڃf=1c35l1轷jW58a3, c3 c3 u61=c3#$ |19ujs5$t h"& jLڀ tf=|1u j ttFPFujyFÉUlt$j辍f=1t'+\$|$f=|1h"t"WSP jh\d35a3 hha3jj(^_[]USWVP\$D$jP58a3 f=11=c35l1NjD$P58a3蹚 W09=c3ttػ1FU Ph"KtMVhX[358a3- =c35l1ٵVD$P58a3E W輵9=c3u^_[]WVjPh d3h"% t ^_h\[3h d3Hrh#",ы \[3u `[3Q[hL"PtAf=1`[3"t"PQhW謿Wh"V \Wh"Lhu j蓋c3USWV$e2J e2; f2у  e2Qe2t$hVh" 1GWh!5a3r WSWjha3SjH Wh\d35a3t l%x>jICƉ׉UzD~*9u$he2QEh;"p11f=1tjB)RPh" jh\d35a3蠖 1hha3VW WVWj^_[]j58a3誺W1SjωSWʼnVVh"SշUSWV$e2J e2; f2у  e2Qe2t$hVh" 1GWh!5a3蒕 WSWjha3Sjh Wh\d35a3蔖 #x>jiAƉ׉UB~*9u$he2QEh;"11f=1tjA)RPh" jh\d35a3 1hha3VW WV0Wj%^_[]1W58a3ɸj58a3蹸S+WjWSևVVh"WUSWVPhH"1GWj虇Wj莇91"tDƅtZWNA9uhN"X1VjKVj@ ^_[]hLf2WjhdT#6Sh%"Z1SjSV-1j/U蒶t@SQUn hLf2WVhdT#Rh"W\WVPjh#5a3 f=1t%51>t=a3VSPVW 1FVh"5a3ђ |$VW5a3 ?nu51h0"u ^_VPjPVhB" t=a3u.5 1V۶yVhH")hP"P^Vt$j5a3VtVh\"hS"Ej軳WV5,1t)>t$=8a3V>PVWӑ j Oj{VhVhj" V1t$1jh#5a3p 1u1$1%1t$1t$1f=1t51t$$51f=<1"t!Pn1t$11d31t$1j1t$$1f=1"t!P^WV,|$8V58a3^h!WJt! $#ha3 $ ha3ha31GVW58a3* hha3Wj8^_WV,t$8W58a3]h!Vφ1Ʌ#G OWj58a38^_V1Vh{t 58a3q jLVhzt 58a3q ^S\$1u8jP,[ESWV|$\$1FtCWPt1^_[fUSWVl$$1td3`d3$`3%PhP1h"t$4Uѹ1I~1L$$D$=_38O>HЃ sX 4HЉ5$`3jhP1h"t$4Ug߃ufH1K$D%&$;td3뷃EF$;jhG"SQ jhH"S9 hx"SD$QPuV$;hO%S賄hG#S蝄zhx"S臄$_=_3$;(a31@D$<$XD$d3=`d3$;j/SK`d3k<$$YxD$ P1PhPjPP5$;Z $`3L$ !P5$;h0"Q90a3d34a3=$;W~*Sh$h`d3 1@1H1HD$1@$D$~1HD$$_2)t5|$L$(4h$VÂt5(a30a3d34a3 Vj<Vj1Vj&Vj_35$`3h"j VV4$jhe2TNx"w%&P_ D$tu1=_3 1A111ɣ<1 111=d3t 1=0a3t5$`3 uW6uB=0a3u5$`3 u3^_[]xVhd"Hh"Ah":h"jX5$`3h"!h"h"h" h"h"j#hLf2jj@h"IjƫhLf2jhh,"Ij覫fUSWV,|$@h j]}W^1ۅ_3=0a3h_3E6u.j G1=4a3ȍPU8a3j8a3x3=_3u?jPL 8a3teQ艋8a3Uh $5_3WŅ?1GVjs|=_3t1O,^_[]ÉVQQV=4a3uL$ @Vj58a3 1Vh t 58a3|j Vj|1@_3jh_3V5fWVP=`3t 5`3t$uh"Wƅh"Wt8/u11" P艱 Vh1PŲ I%1%&9uQPt$E %&uڃ=$`3u%h$`3h#t$蟾 u $`3%hd3hw}$t$z u d3=d3j:h9"t$謱 1Ʌuǡ`d3u'>/5`d3jV`d3td35d30a3d3=$`3u $`3%d3Y1ɉ d3`d3t=td3utd3t =(a3lj:h}#t$ 1Ʌ d3=0a3u6td3t=d3tP5`d3*}10a35d3j:h%t$耰 t 1j:h%t$_ t 1j:h~"t$> t 1j:hG#t$ t 1j:h{%t$ t 1j:hB"t$ۯ t 1j:h4#t$躯 t 1j:hQ"t$虯 t 1j:h%t$x t <1j:h%$t$W t <1j:ha!t$6 t |1j:h}#t$ t 1j:h=#t$ t4a3j:hN#t$֮ t 1=d3u d31=d3u d31d3tPhF",d3tPh;:"d3tPh%d3tPhr$hd3hm"t$Ϻ u d3hd3h""t$誺 u d3hd3hz"t$腺 u d3 5`d35`3`3t%j,VAtA1ɉ5`d3 `3^_Vh<" VhT"h"jttu$Vh"h"h"j藤fSWV t$ |$67ע `3͚`3賢`3ɴ`3o,hs"Pdy`3VW8=4a31hu+t$c3t P Ve'ƣc31hx"V[utsc3hG#V?utah)#V+utShϧ$VutehO%Vut1Lf2Vh^"WϨ WBc3$11ɺ10 ߈c3Bu^_[ñ1WV,|$8V58a3@KWV越WV輊#NF=4a3t L$f=1t D$#$d$d$ wfD$ f=<1t $Vj58a3$8^_hha3jj SVPf=1tj8:t$R 10utztD$=`3„u10u1f=11몈D$< t< u>jV58a3z f=1t|$ ڔ"tc"P`u 2 <1tu 1tt A8u1f=1t pm2DAt dm2DAD$jV58a3 f=1D$P迣/hWUcأd3NI$$&&Wh(#蘙d3@d3N Q1f~ @d3e2H e2t; f2lhe2j!mld3v Wh"" `Wh(#d3@d3N tEPPybd3Ve2H e2!6h $d3#|d3hڔ"_^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n"L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh=$SeuW 1@W ljR1^_[SWV11t8ϻ1WPhet!CtWPSet Cuމ^_[USWV׉A tS^؃H$D&&n tWUetjPu U WF tQfB t th"n*N 1?!9~ t~ N 9tF N^_[]h"fSWV,1f=1t h"G|$Wh("w+t%thy"Z|$ D1 SUAZft$fD$fD$PSU`1 $T$l$GD$x|$ hhjD$$P0 \$ $ sh".wsh<"ws h_"wsh|"vsh"vsh"vs h"vs$h"vs(h""vsHh;"vs,hb"vs0h"~vs4h"nvs8h"^vsvsDh".vsLh9"vsPhW"vsThx"uDhjD$$PR/ \$O $C= 1lfD$1 1|$hjD$$P / fD$@1fL$@1h $ju $'th"Hwq$8(&af|$"t"PDC:\$j[t1FtVh$tFuh?#tj sEm4 1>Xf|$rL$I"fw (&L$T$ t$"VRQPh"kth"h"jZD$f=111hjD$$P- fD$|$<1fD$ $T$1h $sH$T(&L$f|$"t"PsD$=ufD$L$IL$}1|$D$L$ tpm214/Drt#E9uT$ЃDPh"#s~|$ujkjPP jt$t$ V VhiW+ u h"D$(|$ u,$PD$D$,$|$ 1hSW+ GG?t$>hSD$$PS+ G$0hSW6+ jl$UW wh"qhe2i Wh:it$V* uO j.phe25 jGWh:iVa* u CwF8)|$""P$rkLPD$$PQ* $<1|$Vh)"pt$kL4t4p(&hn"ph"p48~1D=PoG9uh?##4 D$4!4"4#4$4%PSWRQt$h"p4(h"p444,40k<SWPRQPh"o4`h@"ohe"o4\t ht"ot hy"oh?#:4d6|$1A t$t&u/7t$t nu Qh~"*oFL9Mt$ $t$qVHP$t$RVqHhq"Ph"hLf2p jgUSWV։1hUS( jWS sUPP t'Sh9iP' tVGĔ^_[]hD{%h"jTUSWV׉1hVU' jSUl }VPPY tAUh:iP' uGPh"1FSPGĐ^_[]hD{%jTVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Ph"?m^WVh",mf>r1D~Ph%mGH9|j]l^_WVh"lf>r91D>Phz"l 9} j:kG9|h?#l^_WV$fGjRW WhiV% t Đ^_h"jRfUSWVu }6Lhc"j h"VWhc"h$"he2h f2@t>$@$Ph"he2hڃ f2@ t_  =f3e2H e2; f2he2j$k  =f3xe2H e2; f2he2j^Ok:=f3,e2H e2; f2he2jMjڃe2H e2$e2H e2^e2H e2!; f2he2jIj e2H e2I e2H e2Me2H e2%; f2he2j-4jڃu!e2H e2-pm2DPuWe2H e2; f2~ƒ te2H e2he2Riڃe2H e2"; f2he2j^iڃuve2H e2^?tЃ@Ӌ e2Qe2; f2~ ȃ t e2Qe2Vhe2Pi=F @t5f3h $f3f f2@uie2\$t V.(e2%e2Wh $f31;`he2.uf3e^_[]h!jIh#/$fUSWV$$0)hc"j 11E1D$D$D$D$$׉jh 1hY"$VdQ~Hw@$(&ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$j$;$ىY1ɉPXuG _2$T:-u"j9uzuI _2 u _2)t u <$u|$uM1ۋD$Ã<$D$ ptD$ $4u9>WuTWh"D$u5t뢍D$PWu!Wh"Mhj"j[G$1 |$ $jSV- u h"P1u68VY1CHHf wy$@)&|$uhUBÅu뼋ss 謣 PVh]"] |$u.jSU  ss u PVh]"& 1F $tCPpQ|$t KP;AmPsT$Z|$Osh $*1F7h%jCFPPh"hLf2ajXfUSWV$$61hc"Uy -j3-j3-j3-j31ChA"VWk e'H wu$t)&j3-j3-j3Ńo'filj3뙃prvj3oaj3j3j3%j3-j3-j37j3-j3-j3j3 j3j3j3j3j3j3j3u _2)ǃ=j3j3u-tX1Ƀ=j3=j3tL$H=j3=j3=j3=j3tʉT$4Tk3j3Uk3P%Ut$lVUhH1 9rUh"\hH1&H1 @1QT$/u>t$|9A@1A @1I1vy/thN"h"jCt$ D1Dh jy'=j3u$PhH1K$PhH1跢u@:28uT\=j3u=j3t@j3 j3t3D$ P61#$=@txUhH1D$ P6>u6h $jXB#D$=@uj3 j31ۉ  t1ۀ|$/uhH1h".t9U6%r|/u (IHr IH9/touɉt$POTk3USWVT$juQX PD$1t$CHfw?$)&ss PVt$ h]"z Psh"z>|$(5D1C,H1)=|5TShH1h "Xz t$V 1Ga{DuO|$u C(D$?Cj/D$ PTt L$)@L$D$h"Q,(T$CS(L$)ʀ</t ~/t/FD$щT$H1)rPhH1h."t$PVl L$@1@1=I1vx/u H@1=j3tD$PhH1褟D$PhH1T$KP3Qt$31 u@T$(3Qt$$3q u.shH1hO"x CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH1hu"x 1Gt$#KPqt$1BD$ $)&=j3L$ QP T$ j3 j3sHtbffM {3Q {3T$  k3t$/D$ !=@8fush"wjSt$ V$ 1G)=j3tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=j3t$tjQ\ {3H {3<k3tICPphH134sh"vD$ PhH1蟜1u=j3thH1sh!V V Åc1G1,8uFVe^_[]h,"h$"h6hF"h?"h?h"j7h $h%jh<+hH1fWVt$$D$(H0JH(x,z H4x8J z@/uD$PV"X$hSWf W8t?$ VPh]$hWFD$PW蛍"t VQD$PWÅ({4WV/PVAt@\$L$/PWAt@L$ Q\$Sgu)D$ )=|\$={4u={4he2Wh"hLf2H e2H e2~e2H e2he2:É؃t9 t4e2H e2~e2H e2he2ƒ߃Y={4u#D$=@uW?WVu8=({4u WV {4 PWQVQZ!tW#1ۀ=,{4$-{4VPWh "EhLf2jj h"9D$t$QVP^ Ƅ fDŽ$.$$PQ"\$4$9|$ t#t$WP $ D$Ƅ fDŽ$.$PQɊ$3$$3$ $3$$3$  WVh"d fD$L$TTPQËD$L$TTPQUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP0^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQPd^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP2^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP^_[]USWV |$87hc"jK jt7D$Phht@ja uD$tL18{4<{4@{4K8u D{4t$41۽h"WVM HσG$*&@{41H{418{4l{4p{4<{41H{4@{4L{4P{4`{4낃w{4{4^{4O{4@d{410{4"{4{4@18{4l{4p{4X{4\{4t{4d{4h{4 D{4=T{4t T{4L{4{4{41Vx{4G|{4{41C+L{41H{4@{4P{4<{4T{4H{41@{4L{41@{4L{41H{4@{4P{4<{4{4{48{41M{4{4r0{4c\{4X{4J18{4l{4p{44P{41H{4@{4L{4<{4_2D$=<{4u=P{4u =H{4th/"ztP L1=T{4u T{4x{4 L{4L$$ ȉD${4 `{4{4 0{4L$D$ ыt{4 T$ L$u1 T$ ={4t ŋ$u|$u|$ t+uh|{4j |{4 |{4={40{4tL$t*t,uw kL$t;t=u^F R K =\{4u==X{4H t/ ( ! =\{4u=X{4 tz {4)θ =@{4u/ =P{4u!g =L{4u=H{4 t {4t1AT1U44{4 ^_[]Ph"hLf2= j4USWV΋\$=h{4M t1PSR ~jPG1ɉ=t{4tW L݉t$=d{4D$WÉL$ CHHf$0+&ks (~ PUh]"Z 4{4{Dt{T.u =D{4tw={4uL={4u%sh1":1TSh"ZL|$|sh2":{4VW6ʼnى=d{4ut jSW WÅ0W08u ^_[]jh%js WVD$ qH1ftYT$zHftIf t$f tf9t=t{4uyDt,RQ{41f Duf u RQ^_fu1@fu1HUSWVL$dx{4D$ L{4u ={4D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$P{ PSl$$h]"kXt$X 1@F F4{4Z|$dt~T.u-=D{4t"fu=t{4uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=L{4t-T$$L$(={4t-sh%j $WZ5$D$\l$t$0KjsjDžt={4tsh%j $U5jslŅtщ|$W‹L$@D$9ʉT$@l$ UʼnD$<9L$<={4t/hq=#sl D$TPT$ 9щL$ 1|$PtN  à t$P- Ct$ P-={4t +Cl$TUP-U^ ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p={4tD$|t$ |$ n|{4ʃQPRW$RPh!jV.3VD$|={4t$ |$ tHVUUUȉD$|$D$<$$SWh͢#VU2U$t$h%VU2U$={4tDŽ$Mt$4t$"jYUSWV$$8jA{4{4={4u;t$G  GoP=x{4tuu s h7"0={4={4t?E`Md jj hc"QPjV[Vsh$40 O={47"tN"D$|{4U`‹ud΋[QPVRZRPSt$/t$Vuc_u$<p$V$DhV"/=T{4u3v,h_"/ svh_"/ ={4tsvh#d/ E@ %=`u6E %  1QRv4QPv0hf"/h={4t:jj hc"u\uXj\$SSv(h$. %={47"tN"u\uXv(P.=\{4tE(=X{4tE@E4P^l{4 p{4t =8{4t =`{4tIME!=$#Dt;GOTQph]$hV,3={4tM%=@t룍GTPh $hVs,hD$&PV t+D"h"-l{4 p{4t1D$"P; 8H0p PVh"hLf2]/=8{4tYD$"P e2H e2~e2H e2 he2j Q2$8t$SD$"Ph $,렁$^_[]h>"j;WVxDtPL{4 {4tC={4t@AI t$jj hc"QPjVdtZVh",^_Ã={4"t"|{4yNjIуRPQWҒRPV7,h>"jUSWVD$PPHt"tƿD> e2J e2; f2~у t e2Qe2Guhe2Q0={4tXD>e2J e2; f2~!у t e2Qe2Gu7he2Q|0L$D$ ρÃ{4T$9{4}`;L$}XD>e2J e2; f2~!у t e2Qe2Guhe2Q/e2H e2; f2he2j /e2H e2 1D>e2J e2; f2~!у t e2Qe2Guhe2QU/e2H e2; f2he2j */e2H e2 e^_[]SWV΃={4t vrh$c1TVO^_[SWV΃={4t vh$1TV^_[Ã={4tATPqh]$>) ÃTQh $,)Í` f w5$L+&e2H e2; f2he2j@I/e2H e2; f2he2j*e2H e2; f2he2j=ke2H e2; f2he2j%De2H e2w; f2ohe2j|!e2H e2g; f2_he2j/?-1@áe2H e2@e2H e2=֡e2H e2%áe2H e2|밡e2H e2/1áe2H e2*USWVl$(}=x{4tE G={4t={4t(DG`{41 {4Í4^69L1} ^_[]{E ;\1~*P5{4J tM \1{4{44FMt%$Q  Qt $ B$Iu$ L1șƉșD$$t$D$ D$|$1ۋt$={4t( {4 U tt$ ;4$}Z;D$}El$)še2H e2; f2he2j ++e2H e2 MuC;\$re2H e2~e2H e2 he2j *D$@D$;D$ ^_[]j诨LUSWVt$~=x{4tF G={4t={4t(G`{41 {4Í,C L1-9} ^_[][Gșljș|$$.1E  E;|$|6e2H e2~e2H e2 he2j )1V ={4t(41;$}D$)áe2H e2; f2he2j o)e2H e2 KuGm=e2H e2~e2H e2 he2j )^_[]USWV|$=x{4t_ C1ۃ={4t={4t(C=`{471F  Fe2H e2; f2he2j,(e2H e2, +N,e2Pe2; L1} 0; f2(he2j 0(;~&e2H e2 "e2H e2 he2j '1W ={4t(4_ŋve2H e2~e2H e2 he2j '^_[]fSWV|$p{4Wt pSP: t81PWVS Vh $!VK ^_[h"Wh"jUSWV$UF4(F$$1 |$1 9$)덄$PSUD$P ] tXǃt-tat$N_ ?tL$T$d$.?T$O$E1 $ ;j2r9vL$?T$$$^_[]SWV ΉRQS\ 1t4u t|uHthe2PjS]t V_ lj ^_[fUSWV$$3q1hc"W)` W%$ D$D$ hƸ$SV@, mu05$;tChPɬ$WI 뼃pu D$ 뭃u _2,uk5$;h"j#D$=@u.$VtP_ 9r*th"j8|WP ty/t AƄ/@L$M$D$SI|/uH9tx/@tj/Sޅt@VL$rSh"4<1A $'@PVt$ 轉 ٍ$Ct1@$Mg4$+PPh"hLf2j{4USWV։π={4ujV t~VWt9{8uR\$@SVat{SWa9Wh $1ۀ={4VWh!l VWh #舞 w={4u=jWO uWh"H#D$H=@Vo={4/jV D$@PV`jWuD$1Pt$LGD$2x c"t$D$1Pt$\N1Pt$`PVPSt$D$BPh#"hLf2Q#D$H=u}1PPW t$HhV \$D${4{4VB*CVh?" 1C؍e^_[]ÉVh^"hLf2 e2H e2~e2H e2he2ÃtH tC e2I e2~e2Pe2he2 e2 tuÃ߉1ۃYM@Vh $;'${4S1 {4t$|$SPt$ = Å11S5{4t$ 9x߉={4t{\$(t$,l$( %$$L$$D$ l$ |$T$ fT$l$\$l$T${4RQPVSt$(t$(hr"hLf2 $5{45{4t$ o Å6|$W\$S+t$uVhm"SKD$hL$l$JD$pBD$tB D$xBD$|BRWtVhZ"蟚t$\t$\W 8tVhh"n#D$HD$Ht$\$ \$D$t$Ph $6VM'tVhO"t$oSf1V5{4t$Dt$ЋD$HPWtVh|"辙$Wt28-t$Vh"苙 WtV|$W&t WhO"H1ۀ={4DVt$SWVP׉jWP t$t-h"h"5h"h"1@^_[%tPh"h"h5 jWP} t$th "h "%tPh "1돸"={4u""jWVhMi%Ph!SklSh $=j "jVhMi%h"h!W6lWUSWV8`1t PY`11{4{4{4{4{4P42it$L$x+&hjV `1Vh^"0jG`1hhV `1{4hjV `1Vh"0jͳ{4u11`1{4d11t~|4ttja`1{4l11@5`1{4l11@DVhx"0jE`1t|4tj`1 '5tQ`1h|4P茷xC |4%= ts=`=@5{4h"j許 ]5{4h"0j膲5`1 `1{41HPhm8@5`1l 1ɅA {4-`|45\|4{4ˋ 2u\'5`'51v$+&=\'5=`'5>1jSS5`1!ƒul8f{4-`|45\|4 a1H 22=l|4Gt =}r t~=`'5`'5q˃u#=\'5tPWUV ~jWUV tw߿(=`'5u `'5~~=1|118^_[]111RSWV։ωS7 u1D$t,t\$W3 4$t$ctjt$y Y"1@jt$a <#1PWP 4$Ut$IjSVVLx^_[h# h-#h@#jVP=`1x=(5 (5t}={4ut=(5tD(5HQP~'Q &P41{4{4$Pj I5(5h"5(5 5(5ª={4uKh|45`1vu4# |4=u"`|4 \|4u5{4{4=2w=(5t1~ jPh5`11~jQPS (5 (5t4={4u+5(5hfu"j(55(5`1={4u {4tP1{4{4x(5t1 (5 (5t'=(5tG(5HQP~Q P4Pj (5x(5tZ5(5h&"vuC5(5 |'5x'5 u l'5h'5jhQPRPh+"V1V5(5֨5P4^USWV=2e2tLf2D$W*O+|4 |4 u1@1ɉ$L$=x(52\$5|'55x'5hO#hS <$t$W5|'55x'5$h\"RPWhZ#hV $VSh#hW }WPW}tf=4t]t$5454hO#hVc $Vh4h#hWC W*PWj 2u_5P4<$t$WjV$h*$RPWhZ#hS $S]Vh#hP x(5D$=1OP4D$ O#D$5|'55x'5VSP $5l'55h'5VSPg l'5 h'5 x'5|'54$t$VPQ$h\"RPVhZ#hS $S]$QL$Qt$Wt$$h%#hP$t$VPVjX "$PW5(5h]"t$ e^_[]V~={4u(=|1~h~V5`1= |1~^V|41={4uE1jVV5`1xRP5`1A y5h8"0jd 1N^Ã={4uhX"jI&1={4u5(55`'5h"j!1HUSWV1|$\$l$WSUo ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5|1={4t$t$5`1 ƃu*~3{4;5`'5tc5`'5tU{4L~ {4?5|1x51h"j, 151h"0j^_USWVP5|1|$l$1ۡ`1$WUt$ ƅ~)tދD$9u|4{4!|1{4Hs-98 uc1h "Vh5|1:~\%tS1jPP5`1sx})RP5`1 yPb8tD8t:8t0Ty:8t 8u |118Eu |1xt |41{4=|4uh4"j腥`tx>x(5Ht)t h"51h"jL 1%h"j51hi"0j^_[]USWV1N=|4=|1 2uh"j٤{4<u{4-{4sg{4l|41jWW5`1׾xXͽuWURPq )jWU5`1藾yQu t#{4@{4=|1:h##Ff@Phm5`1& x|1hS#j1^_[]USWV \$$|$ l$(1uu5|1{41jVV5`1载x\D$ljT$Ӄ={4D$`|4\|49L$ujRP5`1qx+D$T$EU,={4u#h#0j |11N ^_[]USWV~=|1$(~$$~{4t)h#j蔢I1u)1ɍ|$h~W5`1 0|$fGWhm5`1Z fD$D$Whm5`1/ \$h~S5`1_ $h~S5`1@ GfD$D$Whm5`1û |1t1<$uzfD$D$Whm5`1脻 f $ `'511F$$~jQURhы$ʉD$ ʋ$$~) hY#b1F|?1jPP5`1xg)y11=1|!h#11Fs1oghv#RjRP5`1Ѻ1yKCh8#.7hV#"+h#h# h#0jB 1N5|1~^_[]fD$D$ D$Shm5`1* yt$h#t$h#0j٠SWV Vh(5jO ysh#0j袠 jVj# yGh#0jv 1N=|4|4=|4=D)5u5(5h#趟={4hl1W/hd1Wo {4aX#ta# 1<#t#QWPA S8 2#t"P5(5h#h#h#hG#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5{45{4h#sWhx#T5(5h#Ah#4h#'hG#<=D)5th#j{51h#5(5h#ҝh;#ŝ|$h Wf|$.|$t+D$5..L$f tW= r@h# hK#hg#Y5(5h#Fh;#9sWy\Wh#|4|15(5hj#(5 ^_[h#М|4t P_& W-}|4t {41|4|1h#j|52mtt$11Hfhh|4<th|4841Xhq#0j臜 1Ht$ )h#0jX 1HVt$VuVh#0j*^\SWV|$$WAƃu[1~tHNtt 9 tu/PWwAt#D$=@t j1N|^_[USWV1Fx(5PH{x(5P kj~Ɖ+L4Hw> x(5SPh4Q@ 84$ <4L$QPh4\h4Cjuh4[jh4^uH=4/u+-Bu"4PPh44Pg he2WVh4M<f2@ub84@4 <4 D4QP.t x(5P(jh(5j xsZ1e^_[]h#0jՙ USWV (1x&,1kL19|׋yM1II1T41PQÅy19}WDu=2h #j.hhT4OÅy1ۉ9|(1x(,1kLShT41y݅u=2teh #j迗T41E$sVhU4T4Pe )؍T41Eh> #ji1IkFL1x(5ShT4#1ɉ^_[]USWV D$x(5xGD$S4$1F1T4SQ291Cx(5hT4h4P$ x(5Qu*D$PUhT4Q8 T4tu=2h#j耖t$hU4hT4d $W1CttUtB:x9u=2tFh#j,WhT4Q19uhV#j1H ^_[]h|#th4Q<t P41h#USWV1Cx(5PHx(5P yjyƉ׃='5t/52th#0j4 e=(5t Rrx7t$t4x(5P(jh(5j lzbV1ۉ؍e^_[]Ít$\$D$L4Hw5 x(5VPh4Q@ 84D$ <4L$ h4kWeh4duy=(5tSh4x;t^(5 (5tSh4Y;h4Ujh4Xt@h4Em84@4 <4 D4QP=4/u+?<u"4P#Ph44Pa (5 (5tSh4: (5tp(5|NPWt$h4)6Q=(5(5D$L;4D$P4Ph48(54t@t=(5u Pl=2t1L4Hr@tZ tUh4l'9D$X;4D$\4?uD$Ph4$Ã|$=(5ut$h4Åx(5VSh4P@ =(5uSh4/!؃=(5\$C=(56D$(5HQPQ (5=(5D$L;4D$P484@4 <4 D4QPDy h4j=(5\$^=(5Q(5HQPQ D$L;4D$P4D$X;4D$\4OPj (5D$u84D$ <4L$ QPp4x525(5 84@4 <4 D4QPh4ji\$=D$L;4D$P4Pj (5USWVj/h41Uh4-t>54h|4Uǽ /tOGh|4WUh4h#jjO1N,K|/t1Nuh4h#jj^_[]SWV=x(501F x(5t9t71h#jێmQHbx(5P R=(5t i<x(5x t `m#(5 (5t#5(5h#5(5U (5ujh4^t(84@4 <4 D4QPu1=(5th4hxuth4lyx(5P(ljgSW, xa(5 (5t&=(5t5(5hfu"2(51G*ƃuejh(5j ^_[USWV $x(5xu d?*1Fx(5P,x(5@0D$ j]qD$T$=(5jSh49]jh4Q$=(5th4~gh4+th42dL4 w's1PP54 $jh4Pƀ=4/u+4u"4PvPh44PBZ =(5t4$h4Z' (5t:(5|Pt$t$h4s.Ph40(5P4h4T$t8=(5=(5(5HQP~dQ cx(5L$Qt$4SPD ƉPS?&=(5tc=(5tZ(5HQP~3Q 2Pj (5Ph4%dPj (5D$L$ʃ|QP  <484ʃ|QPxnh4*1C@TPh4Z%54h#0jh48ch4)t x(5P4 jh(5j2 =(5tn)11Fe^_[]þ4PV$Vb뙉Ph4$뇃=(5t cxIxx(5PHx11@USWV $$h 5(5S- = u$ /,4ŏ4/t EƄ4/FED$P5(5L/#D$=@`1Gxv%xmlxd=(5t exRh4!(ttjh(5j Gm'15(5h&#j 1GĐ ^_[]詾5(5hD#0j҈5(5hk#뻸 )D$ )D$$h4 X(5 (5tV1=4/4t$PU解 ;D$vh4h#jN _D$PSm.E4WT&W^jh4Kt'h4K`h4&'VSh4NR xơ(5 (5tD$Ph4-I=(5t5(5h4+(5P4=(5tEh4C=(5(5D$D;4D$H4h4{L4Ht 1PP54舿 $jh4#Pt$h4 Wh4D$P;4D$T47wD$ Ph4;(5tk=(5tbD$D;4D$H4Nh4h4^^D$D;4D$H4D$P;4D$T4l54h#0j蕅P4WWWh4!Ph4=(5e=(5X(5HQP~ Q Pj K(5 D$D;4D$H4UfX'5X4\'5u x(5@\'5=~| h~Phi #thPh #j蜃1Hã`'515{4y x1l'5h'5 X'5\'5ʉp'5 t'5X'5X4=2u=\'5t4=~| h~Ph #thPh #j1H5{4 y xX'5`'5p'5t'51|'5x'5X'5X4~1`'5USWV=(5th' #j艂1I^_[]Ã=\'5`'51u\'51IxՋ=p'5+=t'5|$\$51UVSW.)9|11UV$)݃X'5|Jt'5 1p'5~H5`'5Pt'5t'5;p'5r֋ X'5 1p'5t'51)ȉQPx[X'5Ɖ5t'5 1ȣp'5)=x'5|'5 `'51l'5h'521hX #jWV1N=1=2uh #jy1|'5x'5515X'5Z11~9} G{u'Ph #j~ xI1=|'5=x'5515X'5~ X'5 t'5x'5|'5 p'51^_ËD$L$t'5)ʉt'5QPRŚ USWVu ]1D$ D$ D$p'5 t'5)ȉ9؉| t'5)։ `'5QPVS)ЍT$RPQ 1ID$L$ )x'5 |'5|~ p'5t'5)ЅqxUtX p'5t'5D$9ؿ|‰t'5)ظ|D$L$ 1H1@D$D$e^_[]V1='5515X'5~# X'5 t'5x'5 p'5|'5V1xC=x(5t/x&5|'55x'5515X'5~'51 (51H^Vt'5;X'5v*5p'5)QjPg 5t'551^USWVt$'5 '5ƒ|]; h'5l'5}O1h #W}=l'5=h'5$-X'51 ( p'59)1 -X'51ۡ11PUK;1tS1l'5h'5SX'5 1p'59)QP륉h'5 l'5Nj-X'5S5p'5U肗 +t'51)USh'5l'5X'5 )VQSF t'5x(5Htt(51O1^_[]É-t'5USWVP\$1~cl$p'5$5t'5<$)"513x3ǡp'5$5t'59|WUV謖 5t'5)11H^_[]USWVPD$~Z\$ p'5 $5t'5ŋ<$)Dž~9p'5$5t'59|WVS: 5t'5)D$^_[]ËD$)USWV\$ l$؃|~p'5D$=t'5t$)#514x\ơp'5D$=t'519|VQWD$ K =t'5)Éظ|$1H$$^_[]USWV$  $x$|$D$|=(5t7P$y# $ h"0j.{$|r t'51Np'5)ȅ51  t'59غ|PQ$B ~|)à t'5 t'5ظ| uXP$6$3D$8$3L$4 $ h #jUy hx$ h #j5y L$ h #0j z'ů$ h"0jy111o^_[]USWV$$x$|$$D$x-D$PQ.~t"B4$hC #0jny L$|L$1$p0L$1p'5 t'5)ȅ\$^ t'59|4$ST$ RT$RPQ$P~R|$ =(5 t'5tP;CJ t'5)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=(5t% u!$9$t4$hk #jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=(5$4t1PW|y#(h"0jQw1HD$sD$$P$<{4$tVhC #0jw $l$ l$\$ 515X'5WP lj\$11ËD$ 9D$D$D$X'5}$4$t$ L$ QL$,QWP$PWP$@ ى9u1515X'5$<Ʈ ljޅz11 ͉$03x$3|$ uRD$$P$8z$3D$\$3L$X $0<$\$t*Wh #<$Wh #jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]$0h #0j8u1K<$<$W$4h #0j uUSWV|$7t6|>/u/1N='5MWhL #js '5.|$tjh WZ V? $='5'5_Sh #VP$ƅE<$8$S x<Sh #P$${yw迩0=(5t5(5o$h #Vjs15'5$ $mQh #0js1N^_[ÉdUSWV|$?/tGj/P2iƳUWwu/Fj/ViƅuhW=(5t$$W jWy3UW u%D$ PW)jUPWV/Fj/Vqh1ۅA4t*PW-t1K#D$1=@ۉ؃|^_[]/WVD$t$ $P迫yu~ܧWh #0j r$tDPJy讧$h #0jq$ 1$'5^_USWVD$Et$$^߅tPyBWh #0jpq=(5t<$8$W 1 (5tt)$($u7='5uj'5P'5'5!UW2 2t%1PPL$H$X$T$W$tJSW藫y![SWh #0jpW$ 1$'5^_[]WV1uA|$ t$t$WЫ t(5(5kWhx#0jp1N^_Vt$#D$ PV觫t%5(5k蝥Vh#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=2t =2D$PVtVh1#0jKo_=2u&D$DL$HL$$Mbl$L‰T$=2u'D$PL$TL$D$ Mbl$X‰T$WVt6蕤8Nu} u&WVcuvVhM#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVht%#D$=@uVh #jm 1HjW |^_[USWV׉L$]D$PSt6St$.thr0wwS tՃ} tL1@_1=(5uTG3D$ 3L$ uKG3D$O 3L$ u9t$hP#jUl 1St$h#Vj6m1He^_[]ø#D$=@u%h%S tSc0S@} D薢Shn#0jl댋D$$u1@Ë $jPUWV}wPV1@xN=(5t1A$$3L$ $3$ u*0$3L$,$3T$ uVhN #j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $+&5(5hs#覙uu=(5tlD$PUuZD$ !=uHhWU覣 ƄD$PWguD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUUt$: 4$UmL$ t uu$UFD$y)Q8=(5us<$8$U xZL$ A$ t$Uh} #0j3j1H=(5t2<$8$U Uh #Wji1ɡ(5tt1Ƀ$ !($t($t$$5(5h&"裗jUxN1=(5=2=2Uh #Uh #j7h 1OD$PUPx=1$ ?#D$ PU1@=(5u;L$ ($/藞t$h #0jh$ PU1@Pt$6UK21 2t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PWg1x1K=(5t މ|^_[]ø#D$=@u5h%W 1EtXWKyĉ#$t Wy5(5c #lWU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5X)5T)5 P)5L)5L$T$tI AQPr DUVP 9t_L$ xZjPUQҋT$0y@oEP@ Džt<$\$MQVP軁 D$8+$T$0)+|$$>h#jJe*t$8h#t$8h#0jf1O ^_[]SWV1|$tQ\$1OjWWS0xjh'5S  y%##\$耛SV0je^_[Vt$ xFP)=(5t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(膝 ~H111Ã1T |A9uV$P$(Q ǀ$1111틴$(3x$3|$ uUP$(;ixLX$3D$8T$3L$4 uF1VVV$(}xE$($\h#h".h#j%c #ڙ$(h6#0jc1N|(^_[]V=(5t'5=(5t'5=(5t@'5='5uh D '5t01x&=(5tDyh#jhb1N^WV'5tP`1'5'51N'5t '5tqA'5uj1e2H e2~e2H e2he2etN;41u1tB '59G= |+'5xx'5 PW1t-'58j5'5h'5X '5&1^_SWV|$tR?tMj tSƋ\$W迋H~ </u>ۉ^F='5t%'5p!h#j`1Hh#5'55'51^_[á'5t@=(5t'5=(5u0=(5t'D$$u'5tjP5'5k WV=(5tB5'5t;11G~u)uh #jA`6hX#hLf2 vu^_USWV ='5u%'51N'5u'5}$ $ $L$PD_'5t#HHf w=$+&ph##"ph7#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$pI 評 '5qh#0 phU#p j_e=(5t\@PL$QL$ Qpp p09Bx8'5jjt$t$t$t$phq#p j[_ '51N1 $+&LJ$Ƅ  LJ$LJ$=(5twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G '5 VqPy  '5VqPy 5(5h&"B1u'5@e^_[]fUSWVT\$tl$h=(5P($rT$L$X$1V8$V<$Hc"c"t4$tVjQjRD$Ph#Sb $u2@$%  RPh#UhX#^|$x$h#SEPD$Ph%S$Hs Uh#u# Uh!S軾 SXX^_[]Sj RUSWV@L$E\$CD$PSz{3j?95#|+#L$QPj@t$Vmue^_[]SWVT|$dT$t$X$hS($蔡WVSh#t[d^_[SWVt$F=u1H|$P`t6t)G\$QjPSHVSXGu܃^_[Ã^_[XUSWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V(5~1F1u(5h#j9W^ÐSWVL$D$t$|$$;'5t'5tt\^_[}\1KZ'5teSPMti:tdx:_29}j $;@_2sPVW hV'5:-u/'5È'5n'5'5`S6hA#_2=S6hX#hLf2$?^_[f1Ã='5u1áx(50h#jV '5t"H '5p0h,#hLf2ɸ5(5hs#Ԅu_sUSWVd|$|j/7(5t@l$x(5hs#Pj(5s#1C|(5D)5D$ D$1D$$jh1h #WUHЃJw$l,&;t$$@$,&$;|4묡2t 2(52r2t c2P=28#\$(5! $;k\'5 \'5|4#|4$1(55$;R2t 22\$(5t{42e|(5(5L{42=(5.(5 Pt$ * NL$ $; '5$LF{42{42{42{42'5$;'5|4#(5q5$;[Z 2@K 28$;8-u x{4D$ =`(5u (5(522|4#(52'55$;WO (5D)5s )5d2U(5`(5?{41@D$ )2 L$ ƒ ʺLf2te2 _2(5ƒu 9u , l$D$kL1x(5'5 (5!1$jh81h6#WUdz/~HЃJS$-&41ƍHw$-& )5뫅!$;|42D)5||4#m(5@X(5ˀC(51|4#"(5 $;@Ƀl~mtKotRpd(5SatDeJ1A (5 (5 2 2 2"2(5 2@{pe$;{4SH(53 $; '5'51ɉ5$;"](5(5$;L$he jLjh1QQx(5bl 5$;Vhx"/}V^$14(5 (5@5$; i@(5|4(5|4$(55$;9i $;E \'5N(54(5 $! $; }(5(55$; =(5@(5 1%=2(5e2 0akG1A11|$<$t(5D$tGNutNj]]h#Sz1t[h#SzuE'5'5j5'5S^ 1AL$y#$]1'5<$D$hq=#S.zl$\$thL"SdDžu e21 ðt5h#Syu3'5S I 1urL$tP؅uAJjh#Sx uP'5D$t t P CP[+ىQw ؉D$1ES#jt$ S 1AL$"1ED$\$t t P hq=#Sxt W8v=d(5<$l$S|$;'5,21ɺ G1Fmفt#u41A 02<1A 02!521ɺ.1!# $ 4u x(51=rnFr0s9-_2D(5PM_29}j4NxP_2@_21_29 1VV4b x_2@_29| Qh#j?H 1FPh&#V(H V5$;hi#h#jHj5$;h#hh#5$;h#jG Lf2Vh#EA$51WV蕪 51WV腪 Vhg]$E5$;hi#0h#jjG!jJmhH#jCGt$hI#jjP$t,(XN8@tUjP$yFD$8Uh#Wu1D$h.D$1$hq=#UuthL"UDžu Je2tkðtAh#Scutjh#St tj1ujSðuhq=#Uut WCr=d(5Uh#l$}$l$h#Wt]tjWB\$rt D$W1|$ td^_[]á{4t8uhH!L{4t8u{4M!Uh#j E USWV|$$UWsUV_NJ00ht$跩tAtZ/UV3UW_488ht$vuM{t$h#0jxE1H1^_[]á'5t H '5hLf2h#Bj0WVLf21FWVhh#;WVhh#;WVhhV#;WVhhP#;VНUSWVPˉjPQn` փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Q#$1>tj,Vv9Åtj=Vb9tmj ( tdAE0H@'5='5t \(5s\(5uhp#j6B1O^_[]h#h#h#j B4$) ɋD$L$01pWV5(5h#hLf2轤 t(ο#Ph.#$hLf2蕤 !uءTf2H Tf2~Lf2H Lf2 hLf2j 蝧^_SWVPωPQt4Ƌ$| tC$S t'ǍCPVW[ DG d(5 d(51^_[USWV$t%t_݊M\tS8uEEh#j@EjI UEƃjSVQ t3l$hUVPWUh#j\@S{ $EE<\t:uCCU! $AStRC1fGt,PtStgtstp1B ы$J@u $A=h(5tZl(5HVV4$ Wh#ji? 1H^_[]VoVo h# h(5 l(51VC4$A Wh/#USWV\$tK;tFj藸 tLNjl$1pSgiG woD$G95p(5t%t(5x!hT#j>1Nhi#=p(5=t(5^_[]WV5p(5t;11GFu)uh#j^>6hX#hLf29 vu^_USWVp(51 l$$=(5Kt(=(5t!9t)@tB9uKKt8?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=(5tGtlD$@1G8D$@1D$\1GEt$ he#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh#j59tNjE|$tDD$@t:$t$PVh#hLf2ŗVh#hLf2谗 $t+Et$h PVP 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVhK#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7 (5Lf2WVVjRuD$L$ L$$Vj贌Vj)uD$L$ L$$Vj苌VjuD$L$ L$$VjbVjuD$L$ L$$Vj9h4#|:(51)5)5)5P (5t$,NFF FFi |$WVj` y|$ujWj` WVjv` y|$ujWj^` WVjJ` y|$ujWj2` WVj` y|$ujWj` TWVj_ y|$ujWj_ (D$,WVj _  WVj_ 0=2t3i=)‹1@?9 tR=)5t3<$/>3i=)‹1@9 tR )51QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=)5ujh=@ )5#t\u#uGW: tjxGj jW蟨 ɥ />3i=)Ë )5,t 98t#@u $j t!8h $1(Wh#j9- h#h#j!-^_[]USWVP|$1N=)5ujh=C )5#t\u#uGW tjxGj jW袧 S />3i=)Ë )5,t 98t#@u $j t!8h $1(WhF#j<, hn#h#j$,^_[]USWVt$totij/V\1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉh#j+1H^_[]1j! ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjgS CS>tKt^?tYڃCKt6C;C C})VWhP#j*S踴 h#C=)5t$)5X Vh#jW* 4Vh#)5)51Wh4#j** SI hs#}VQh#j*USWVPϊۉ$tspm211JDhu.e[YAuۉ4$GÅt>V6T,FN4A1RG113WS1J 4$$.&G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSIV!1҃ډЃ^_[]fV1= )5u*jh 諫  )5uh#j1(1N^USWV )51Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj" Ël$EPb $$$KCs{ D$C $C1^_[]Ët$ h 3PIC  1$$CHC1FwCE3 S S h#j&1NwUSWV )5t"t$4$r$ ws^_[]Ë,$qvщ i )‹3V3F UW52p| 9USWR vuj tj1jPP52>WG x[US52D| #9uG$ T$X$OG/$)5$ O<h #j#D #ZV0j$ W "tZhP # hZhh #0j$ 1H ^_[]Ë$ T$X$V9F} FN11@USWVPT$D$@~T@Ɖ1r2w1F11ۉ1/,Eu$C/9u͋t$ t$1:CK 3i=)ƋDt1ًP1 tD@|$t6j* tx@ LHDh"#jY 1^_[]USWV,)5CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj J1ɉHT$, $$$P HN HF F t$1 H;@u ,)5-4)50)50)5-4)5Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@0)5=4)5l$T$s}ډD$0! umщjt[4)5=0)5 tIj t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph!#j  h!#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=8)5u*jh= 8)5uh%"#j1N^WV8)5t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(耖 t^t$tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W衦 h["#jj ^_[]USWV 8)51Kt$/>3i=)‹tjhq#W> t1H^_jh$#W> u(=D)5u\)5u\)5h$#jjUSWVl$hUh1N\$1h$WS=* K$ǃ4$Yt"Yh PQ+ Ǎ A/G<rH )UhP)5hL)5o   PhX)5hT)5G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VP蘨yEtQQP  ƅ(8$VPryElQQP˳ 1D$@$$$$$ȃJ-σwY$&#L0$p x$|$ف$dž$$A19r.$ 0I9ݻÍ$r19rD$)Qj0R## I6$$f@ 0j j0P" DK$A jdPQ$ `)51$$A9r'$ 0I9޻Ér119rD$)Qj0Us" $ hF&#$B L`)5فME1$A9r+$ 0IՉ9޻É׉r119rD$)Qj0R! $ thO&#jF UfDŽ$ rDŽ$usta=D)5t fDŽ$  fDŽ$ 00($1l$hL$nA9r'$ 0I9޻Ér119rD$)Qj0U! $  th!$8$1l$pL$vA$9r'$ 0I9޻Ér119rD$)Qj0U  $  thl%<$1l$xL$~A9r'$ 0I9޻Ér119rD$)Qj0U,  t$ hm&#'5 '5$ t(5T$HIrm$1$A9r'$ 0I9޻Ér119rD$)yQj0U $ t*hq&#h '#j1G^_[]1GWt$W<$Zƍ$ c"c"tٻ SQP $-tSUP 1L@=uL@=u1퍔$$A9r.$ 0I9޻ÉՍ$r119rD$)mQj0RX t&$ hw&#h '#jhD$Pf1O$ jj ?d)5tT5`)5P( `)51҉d)5`)5j%)jPA$  %USWV$׉Ήh$jS] $l$h h/&U E t u4 d)5 Fd)5@`)5Sĸ$^_[]Wh&#jIWVt$ V-=rVh~&#j[ ^_USWV̀| uJt?5pm211\=.*t?u.L^u\L@\@G9u1D}/tP\$$Sh7'#h WoaW1NxtShB'#h WKaWxS|$$WhP'#h VaV~x$WhX'#h V`V]1N^_[]USWVPt$>-u~t6hL"V|dDžu'70 PVh&#jHe21FUW@t5Ë$rt$Vh&#j$_Ft1N1e2t W,^_[]fVjh.a"':xKh""P)h)5t)hL"V)l)51u;5h)5,V:=(5th.a"hc'#j 1H1^WVPD$$|$t (5t$(5 (5t"=(5thLf2j ^(5Lf25(5hT"Wb 4$VWf Wj # ^_Ph)5t$L$T$ $RQP`f 5h)5"XSWV|$1N|5l)5t,\$OPWS( t;j S1t^_[SWVPD$ $|$t (5|$t$(5 (5t"=(5the2j ](5Lf25(5hT"Sa 4$WSe ~V萢 Ph#hLf2]a hLf2j  ^_[fUSWV} u7Xhc"j \$1h $WVBk LtPt߃95_2D$h*#ƀ8/h'#Vhush#Vhua$PVCtKD$Ph%,t4$3D$ $3L$ u$3D$$3L$ t1PPƅu j02Vߺhe2f2@ujVh!jSDPh'#hLf2_ jVUSWV$$6hc"j莝 11Ch'#VUi e~%q~3كrtރvt_x)5ŃV.PtrكRtwftAit)5x)5뒃Wt6duqp)5z)5lt)5x)5W)5I|)5;u_29|=t)5u 1Ĉ^_[] D$h j]'$D$,$S & I9v9/u؃@]9v8/@tj/SVt@À;.uCt<.u{t0\$u h$(#{C\$)5EHu]j$8u )5PTj )5a$8tӋD$t$ VWҡ )5tRtD$W5=t)5u)18ts18?ti18t_Wh $uHtjG PWh]"z +D$@uDp)5u;Wh(#z)5;;=)5uW萷ڀ=t)5utV/tD$%=@t/==|)5u uWjWS t)5 x)5х ˉ4=)5u Ő=)5t@jPt$2 u h'#7Pu/8VNNjGHHf wO$/&=t)5WOwP"{jWV GG \=t)5uWOwP:GHftIfgft9G =t)5u P* PW}G  Gw\Rt)5.8=t)5uG ?tow 諛 PUh]"\x c=|)5uO1zuSwht)t)5t .8t1 .8?t'-8ut/wh $W)5VDž6=)5u =)5t)5w衴w$2h%j#>ww Ț PVh]"j=PhD(#hLf2Y jxP)5USWV΀=x)5uLVh'#hLf2OY hLf2"e2H e2e2H e201C=)5l$$#E=jR\,8D$Pu^<=|)5uvVh'#v1Zhe2&#Ɖt9 t4e2H e2~e2H e2he2"ƒ1ۃYÉ؃^_[]ÍD$x c"t$1Pu]1Pu轋VPWSD$Ph'#hLf2WUSWVAӉ΅:#K1jhVl. $ǍD$PWC.D$3CL$3 D$(3CL$$3K #D$ =diD$WZ.1PPPWt D$$h PQ KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PW+ D$L$D$)T$T$ 9D$t;$SVǚ)5Vh $)0*)5Vh $W-1@e^_[],+WF-u1PPPWd  uh h$Pv  KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW* D$L$D$)T$T$ 9D$t1*W,1PPPW  h j$P  KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW>* D$L$D$)T$ T$9D$t)W+j1PPPW  Th j$P  CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW* ;D$t$$P$!P襘 L$)L$L$L$ |$D$ h(W+|1PPPW  fCXK\D$L$ȃ|oer \$9ËD$| S$PW( 9D$)؋L$D$ظL$|4(W*1USWV\$l$UEtMƊAuA)k')l*5jUGG S G)5<)5 l*5t^_[]Ã=p*5t^_[]USWV\$tKƊAuA)k')Ƌ,)51Gt?uS;tmt&uS"u4)5jVJ1^_[]ËD$t @ъ@uA)k'))5WVt$ >tVG t|$u G?l*5wx wx Wx  l*5u=p*5t^_WVt$ l*51<)5t)5VPs8uG'u l*5t^_Ã=p*5t^_:USWV|$tWBuA)k'))51t(l$sWtu tC uމ^_[]jt$ }t@1ËD$L$ pqbSWVl*5ƍ1P轶1 )5tQ:t @ C'u9 l*5u=p*5t)h jVWk~R1ۋph}(#)pR42HQPPx%2Q C9uWŶ^_[hk(#WV11 )5t))5Q:ujPuFȋ G'uƉ^_USWVj258H 25(11C}t$Ej=Pt)AQUkh(#52o(TjUt_Uh}(#(w(32HQPPN$2Q 25H 25(S Uh(#52' u1^_[]Vh"tauj425t$1Pc ơ25H 25@u1^fWVP5@*5pm2DBuF?&ut t- 8*5]$/&NF밉jWV L*5H*5 ?&j8*5P*51D>G?&uGP莳H*5WVP H*58^|~u$PPh(#P~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5@*5^_ÊVF|uܹո ѹ Ǹ É)B$:@B?&uVPQh(# fUSWV|$,t$(S輲=8*5jLVt:xIuxNt@jLPj V1tE@j P)=8*55<*55@*5"1,=D*5uƉSs^_[]ù&)#V=D*5)u ^5<*5Qh)#*WVc"|$ |$wL2 P2 25>t'F 25Q25芳N@>vuڋ7 25Q25t^ @뭅L+L2@Pi575VrƉRPh $# 1 ^_USWV8׉ˋ H*5L*5D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh!jVEjVt$ #& USWV Ջ\$$St$$tƉ׃=D*5%up1҉  ډD$$=D*5&uU1ۉ D$H*5 L*5ME \$$L$SPy t D$$ ^_[]ùB)#SWV֍Qȋ\$L$|$$<0&  u !ڃ SQWVI99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWV Ɖ׉^_[߹)#)#)#wSWVP=75P*575Qm)Ɖ=75=2ttxt>uo%}1ۉSPVO Ɖc9u$8t*R8u+$t@?& t$@u^_[ù)#\%USWVPՋ\$St$gƉ׃=D*5uKh$H*5 L*5MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաD*5HwSjP ljաD*5uND$H*5 L*5N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THH*5 L*5N"ىWP1Eكra$"ى=D*5#ÉD*5݅~hD*5 H*52É׃'1HH*5 L*5NLىWP1 1H*5 L*5NىWPÉD*5LH*5 L*5NىWPe$É׍EكwD*5|$4t;~l-D*5b1A1Ǎt$WSh!jV?jV5H*50't1I1@1l$QPh!jU?jU6;  ؉^_[]ù^)#TP)#Jy)#@USWV֋] $t$ơH*5 L*5L$ D$T$uPV֋=D*5Ww,C&8C&}uPW ֋=D*5ȃ}tً$VPt$ ֍GwC&;E Qȉe^_[]fUSWVb2$D$ h)#=etuD$ j250hT*5GVStI?S U@PáT*5)QPS T*5)١25pQH7VPS#$jhޫ"#ƅ<.u 1~.D0t/ua$Ph%~tGPV~t6$3D$$3 $ u$$3L$3D$ 1e^]Sh $mt/h $Zu258Ltj258j*5T*5uj=T*5522f`5T*5k2HQPP2Q 52C2@u1[h*#[f 0z Ph*#Ah*#7SWVWWP=wu2\$V襠 8"u6W՟WP wtV脟T*5Vi^_[Åu 0z Ph*#jT*5tjPh*# h*#ÐUSWVD$ 2fa1Ƀ|$‰tpыLh ~#S$th"Su 1t$.4NJ]taM\uNEU\rw$|0&\0u!11ЃwxAunjt$>2HQPP 2Q t$.PN    ȉš2HQPPC 2Q<$t*2HQPP 2Q 52 2Hu 1^_[]ÁfHh+#jfd*5uL$ h*5jPV=l*5t p*5K15p*50ppp VPj  9505t =2ujV(VO^jpPT$=*5u *5D$ $1APVp*5l*5t1It$aVPL$T$ D$$PD$*5jWVP|$t$D$$y 4$ WWV׉ΡX2t L29ty u hL2 =*5*5umPhT"h`2 =*5t5*5hT"h`2 t*t$ Wh`2 x4h$h`2xVv Ph $h`2 2HQPP 2Q h`2# ^_SWV|$t$\$MSWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$WY^_PT$D$ $1IP>XËT$1It$)Vf0&T$ L$9upu'0fuQh#%j ht*5 t*5@^1*5*5*5*5WV|$ |t|$wL2 P2 25>t'F 25Q25~N@>vuڋ7 25Q25t R @*5152+L2@POơ*5PV *5^_USWV\$0t$,|$W575jVi j:=82thƉ؃$1t7=2u.D$0t f $uQVi=*5u"Wjֵ=82u11EiW蛙u *5D$0u^_[]jUSWVL$,|$(206̓V $1&Uw1ۀ=2_=*5Mjw1ۀ=21=*5$=*5jwH1ۀ=2=*5=*5uQ=45tjw1ۀ=2=*5=*5t  u8Vk1tu *51l=45tUW_j\$0SWh a=45tWD$,E=45tt$,WK_=45tt$,WE\$,SW=45txUW=45taUWyPhs,# hL2k=45t'www. *5@jw1=*5*5 jwa=*5t *51VV譖L$,=`55t =r2t *5tu u^_[]PjUSWV@|$T5d*5D$$w=*2tttn 65575P$P%h,#Gtj P52 Kȅuh,#52l$jUth5d*55h*5j<$t&4$h,#525|$*5\$Xl*5-d*5j wD$ l*5u=p*5tSwl*55d*5j l*5u=p*5t]<$t&4$h,#52p@^_[]j5d*5USWV\$;s3=*2{ 65575PP_h,#Rstj V52 vh,#(u h,#2HQPP2Q 52l$l*5ttu |tF1ۃjU|Sl$SPQ~ tuQV|*5Ju l*5u=p*5tjsUsV*5 l*5u=p*5ttJ=*2tA{t; 65575PPh,#52q^_[]SWV|$*5jw1=2t *55*5^_[Ë\$1*5u/? *5ut΅tSw5*5*5t"u8*5H *5K*5jw=2tru+*5H *5*51 1@65*5+USWV1=2t5*5|$0D$PHm[thUS- =*5tiD$*5,$\$4>G75=*2 65PQPh;\"w 2HQPP2Q=u2HQPP2Q 52Fjuw  Sw5*5=2uZ*5t"u**5H *59*5m"u*5H *5 *5 *55*5D$Pݏ ^_[]USWV|$0t$V芏@O 75jPw+ _1=*51{t'G75$pWCWuuޡ*5[tZtT1=*5uI=2u@l$41; u{C75Us t=*5u =2tʋ-*5-*5V ^_[]USWV\$K1t@ l*5PSwƋk1OuD$}t 1{PuVGy uR l*5u=p*5t~ jW|$x4$ jt$jux W<$t$mE{t Vv1 V{*5 l*5u=p*5tA^_[]Åx W0f Ph,#USWV$$D$1t$ 55D$$55D$D55D$Ht$05*5$P5*5E75L$XIEtH1F\$XljtwHuG75hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjG75wtjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P $D$XtH$r4$ ȅu$1ɉL$@=2t=*5u|$ ~ $@D$@D$ )$=*2 65575P|Pl$41dz=u)2HQPP2Q9}j=W茷Ɖt>u[2HQPPh2QFP$U 1Ո`1t$XtOË$t)2HQPP2Qv É΅u$u t(PV52; مt ȋN΅uء2HQPP2Q 52 |$ +t$4~jhX2&W u|$$ƅuf|$# L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$8 fD$D$# f=45t*fsD$= t= u ft$}u$D$@f%u D$l*5jUqD$,ED$D$tD$L$` =z2u f|$t$Ut$4 s t@*5|$D$D$`t$dD$,F L$l*5=p*5tYD$t;=*5ul*5=p*5t.t$`ujt$h-L$D$Hs*|$# toD$ t$,#u*5.u D$ 1@t$,ol*5=p*5  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]65D$(65*5<NjD$ d*5w D$(65=*5*5Y1PPW{ 1ɅȉD$PPV25\$pf25D$ H25$25125l*5 65L$( *5L$L65D$D$hP l*5u=p*5t$jV趞0d*5D$ 5d*5|$t&D$1f|$tH 5555$*5h t$8"*5H *5=t$L$QPy *5l*5t$ND$(65D$D55D$H55D$L*5h25:25t$pD$ d*5|$Pt j l*5u=p*5t=*5u 1*5*5D$@z$jWcd*5D$ =d*5h!t$85*5t$Ut$8&oWt$Ut$8pD$ffD$0fD$8D$L$D$u#x22t2|2@L$D$*5D$pSD$ld*5D$ 1D$T$PW]t+h*5D$|$D$*5=d*5D$$ 559t;D$=* t=8 u)65D$(165D$TL$$PQt$u R|$ uD$0ufD$D$4*51f|$ˆQP $*5$25251@;_2D$*52f`4$t$T$$L$t*5D$ d*5+2L22`2|$TtD$(65*5D$tD$p*5D$D$tFD$t D$f|$t$lQl*5=p*5t|$# t j0D$u2F t2)N2|$@tht$Dh% $P΀^_[]h,#5*5t$1=*5ȍPu K=*5u"D$4thB pȅu25*5t$ t$,Pt$=h*5uSɕ'h -#h25谕25t$p|$Pt jt$haD$(65D$D55D$H55D$L*5D$ d*5jP90 l*5u=p*5tVX Ph,#xh*5u*5j}*5t*51gWVt$tr|$w$42&j Wv M $@Fvu;Ftj WP( $jpV蟫 ыF @v 빃^_V t$t8>u3Ft,pGtF 55QjRp ^SWVQt1OS jjP t6 >F1"jjP tv^^_[USWV|$41GGG =2l$0\$S}l*5AjUfjUP{h uAl*5=p*5t 4$U1CSt$ SU\$t$+$w l*5u=p*5tS%}^_[]h,#VP*5u1PPVPjh2S tF$PH{*5t.1QQVPjh2wS t*5@=PATH5*5< *5 2 2^á*5SVhc"蒔258ujj1^[1ۈ22T5*5thB v6525 55SSQPV*5á*5ËD$ *5*5PËD$@*5 *51*5*5Vt$ |$|v萉Ph+-#1@ *59~1Ҁ8cB*5 *51^WV15*5V|2590t\W{250PjPH5*55*5*5@*5jw5*5JWz*5^_USWV$55$j/Wt@D$PWVD$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UV[VuD$ %=`uVyjWS ƅuWh %Wh=-# Wh(#L$*5x *5V|$|D$ p辇*5*55*5uu~9} ~ *5*5^11@1USWV4hc"蛑|$$WT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$hS-#52(14^_[]UWV׉΋ *5uj' jk< *511D$ T$l$ ̵%D$ $,$<$\$ D$p-#D$z ?6u0uFjh#W %WC|80uHx.t x0@te^_]fUSWV|$7j/V@u#$jVP uaK$$WV4 PuS 1@Ɖ$m=*5ud$$UVuGr8t8c8t.Y8 uPV;St 2Vvju$P OfSƒrtt~ *57PSCPVh]"jSWVt$|$t$VW5 t ^_[Ã|$u0,jWC6u25*5VՈjUSWVPD$tnt$ t%1;t <:t9tGt$,89-P2}xv,; L2t,WSQL$ L$ |9/u 1xAA/D$PL$Q*5E9u,;E-*5L$Et <:tEL$<:t1ED$(Q9 $+ L2AQ"t^_[]USWV$1C1D$ 1D$D$D$\$hu-#"Hw5$`2&\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ 259A2593t$$1CjWtV@wM$2&|$t&|$ t4t=02x'@ |$u25H 258u55PVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿ*5/tPEȃw?$2&|$u/|$ u&u |$tf<u t$Um묃@+5r522$@th-#1@$$$$^_[]SWVt$l*5*5t5Hftfu9502| P2 9p}Ëu̓@+5r l*5t^_[Ã=p*5t^_[USWV$G$$2&o55EjWS PqM䃼$$twh-#MVh-#~GPh $l*5wvPQ^ l*5u=p*5t h-#-D$P h-#/th-#h-#GPh $ t*2HQPP42Q*2HQPP 2Q ^_[]ÃPWh-#SWV|$tWȊ Bu%iC)ʾ!)!*53tFWPtc6|$tTl*5W PnƉf@@ WPn l*5u=p*5t u1@+5^_[l*5@+5Q7/  l*5u =p*56USWV$$$j/$蘛turfEE^559tth.#V{t $j$q1Ʌt@@t`tm$umtisD$ P$JxfE$K88$ u=02x $u  \u =02y& u $MƋ$1Mtfyu02YL$$j$P 1OD$VmG*5tAPh.#{t$t-'5*5h.#v{t>/u19}-9j$$PM ƅvvD$ PVpIx3D$(!D$ =u8=*5$Nu$A8t78t -D$}o$E$\$|$$t$t'52jS\P$h%VfEo$T$pƋ$$l*5|$ÍD$ uj$HfxT$ ufBuω7 l*5u=p*5t ׅt"G GfEG EG fEGE fEEĜ^_[]l*5T$ Éuj$fxE$ufBj l*5tbiVtC+L2P]jV\ij$t3fxu*SVLm$=p*5V$h.#SWVP@&1t8|$@&L$8u%tWPKL$ t us^_[SWVPA&1t3|$ A&L$8uWPL$ t us^_[VA&t% A&jPf@NHu^V*5 02trft fuxB =@+5r^USWVP\$=551N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh.#kwt1<:CG럡02y x5021Ʌx $y $Q502^_[]SWVl*5*5>t+fuwW( ߉?u׃@+5r l*5t^_[Ã=p*5t^_[WV|$D$ l*5jP+@ft*fu v8fFGF GF GF l*5t^_Ã=p*5t^_WV t$D$L$ l*5fO 2fOPGWVU l*5t ^_Ã=p*5t ^_jt$itfxup}%1USWV t$811G$1D$h*.#ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШP25:KB25*#$1\$ D$4$߅u U=7&t,]7&7&8uUPtujUNƃ<$t0vhX#94$25H 25(t|h.#ej v輒tuh.#GvhX#2584$t2HQPP2Q l4$t%UhX#Ph.#+h.#,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$2&D$j/U諑jU~i0> Phʞ":uhh#/#Yuh.#Bu h.#7t.UhX#k+55 t$|$tJHh/#t$25H 25(ouh# 돡55D$ FjUD$PK PdN<$uc"|$t.#Ph.#ShX#t$ct$1 ^_[]h@.#x.#ctc"RVhc.#Vh..#1PPt$  5L2@PbUSWV|$D$\$=2tD+5H H+5 L2 L+5 P2 251ɉ P+5 `+5H 75Sp25tH 25~L+5L+5dH L+5L+5+L2Pah+5d+5u%Vjap h+5h+5sd+5UVh+5-h+55d+5x=tEd+50va5h+5΅u!1dL+5252V6_h+5d+5t Oh+5G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t55t D$2 55D$L+5+L2D$?~uЃtRWT$4$ D$1@D$ wy< 25H 25L+5$!PVVT$0/>u!y@u=D$ D$D+5$25H 25L+5=D+5utL+5+ L2;L$~axu[25HL+5625H 25 L+5 25H 25L+5$ |$D$/ЉD$$ 25H 25L+5aT$,H L+5$t)Ut$ RtL+5+L2jPHPX T$,>~=u|$ D$ }RV"T$4h| u7525H 25~#L+5%J`T$,H L+5 .`T$,H L+5$Ut$ yT$4L+5+L2jPHPuT$8 _T$,H L+5>25H 25~L+5 _T$,H L+58 t75iw_T$,H L+575HV_T$,H L+5$&4_T$,H L+5D$$ |$tu^_[]USWVt$,\$(=`+5t55t$D$ 2&j[XNF55D$ P+51oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=h+5l*5l+5u(Qº9P7Yl+5NQP5l+5$ l+5 l*5u=p*5th+59t31Ʌt AuQP!u=h+57v  h+56^_Vt$t"h+50v5h+5΅u^V5P+5t1l*56P^ 5P+5 l*5uۃ=p*5tV1`+5P+5^USWVt$(PnYL+5+L2PmXL2Gtr}t  KvC#:t /tQ t7=2tAL$,u8 25Q25ZO@랃tPY^_[]Ã=25u Z25L28t!P tx PXu$hޫ"ljPXGËD$,tÊ=&$< t< s4< w*25H 25~L+5ZH L+525H 25~L+5YH L+5Gw/u}/uEP USWV,D$DD$L$@9A|$$D$t1?&‰T$D$D%D$ j=L$Q跃D$pD$$L$(<$ L$ u:|$L$D$ PQ 1ڋ\$L$ 065T$)11GL+5+L2D$D$<$u \$H l%t$l$UPRTT$LQT$L$ t,1t}y;@ڋL$ uD+5L+5+L2=2\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =25t1C L$@11ۃ9|$t$ |$Wt$T$RV WUL$(/<$ }D$1|@uD$25H 25~ L+5ՍQL+5VL+5MPL+5EK1ۋl$$]|$ D$EÊ=&$< u.25H 25~L+5 tVT$H L+525H 25~L+5 FVT$H L+5]EuKl$ u% L+5L2)L+5 25\$\$L$ D$E< w.25H 25~L+5 UT$H L+525H 25~L+5 UT$H L+5]Eu1L$ }D$n $Ip$ 3&|$t25H 25~TL+5R1G>L$u0L$ QVw1>t5L+5UL+5ۋ\$uhT\$H L+5=L+5+=L2t$ t$(St$ WV-uL+5=L2L+5)=25Sg1GL+5+L2t$PS <$t[1@Ftuրut܋ H+5 H+5̀tuŠQ1ۀ؉Hu,^_[]ÉRPhS/#,W)Ѓ575hk/#׊t!#u(HL$IQWP575h/#D$ƃHQWP575h/#輳USWV5L+5+L2D$l*5P+5D$ T+5D$$X+5D$(\+5D$,=`+5H+5l$0U+Q+L2P-PD$ P$2U3QD$,\+5D$(X+5D$ L$$ T+5P+5=`+5H+5D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 l*5u=p*5t.hWt$O y蓼8tl*5HD$EEt< uD$C낉$L$}1A925} RL$ƅ~N$ 25 FK1:25H 25Q FK1Ƀ=25 Q1ɉƋ$|$t=&$< t$< s< w 25F$ 25Fl*5D$ x PfD$t P D$tP5=*5$u+L2jPt$$ 5L+5 l*5u=p*5t诰^_[]USWV D$4L$@-L+55L2l$)hPD$25H 25~L+5qPH L+5=L2UEWD$ P[NL+5+L2PZM575WeljӍD$ P]NL2 L+5L+5) 25 25 PL+5SWh!jPL+5xt$GF9Iu|$"tjVU0 L+5A L+525)25D$ ^_[]SWVt$|$\$`+5t#9Xu 9p ux2jK `+5P+5`+5`+5Xxp ^_[WV=`+5t$ 95X+5~?=P+5l*5?P =P+5 l*5u׃=p*5t虮P+5`+5t?9p|l*58P[ `+58 l*5u=p*5tR `+5u9q~)q$95T+5~ `+5`+5P+55X+5^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) t`25H 25~L+5TBH L+5552*55L+51L+5^_[ÃЃ w]j PVZ B8ű$<=tuw~;52525b55D$525ØD$D$‰؃AD$$Z|$ T$L$T$|$,=&$< u*25H 25~L+5AH L+525H 25~$H $ L+5QL+5 @L+5 $Q$ PL+5$eØt2L+5 $Q$ PL+5$eØt2H L+525H 25~$H $ L+5QL+5 .>L+5 $Q$ PL+5$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-G25P25~=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rl+59tH9u $8/t F%QтD$;5l+5tF/}tEEGXـxs@<$uokt$tdǀx .u.uN jWt$G t8tG@u@/UPWV5l+5=p*5tt${tWE/Q l+5߀xruX@8tB@9tD$P5l+5x5l+5,Ą^_[]ËD$1Ʌt AuQPFWV|$ W軘@P7WP5j7p h+5h+5^_USWV\$D$|nOʼnmIWP)|$SUÉps譜x 7u߅u҉3D$^_[]SWVt$(\$$W7C H+5L2L+5P225`+5js25H 25~L+5h9H L+5L+5+L2Px6jVP W7^_[USWVt$FPhe"ĩ2HQPPu2|$Q1ۃ|11E4E9uShV#j2HQPP2Q|=1C4膤2HQPPޤ2QC9u1^_[]Ðh/#膘h/#|+5H +5~+5H +5#=~u+5H +5USWVP82H +5t+u y+5H +5~xhL2蛤h`2莤 +5182~PX+5hSpO {e苡8t_82xLr8#>WjWФ !Pjj诤  h0#682p+582@1ҋ+5  +5@@P t 1++5+582{tXAˋ-+5M +5~ @لt+5أ+5=2t$5+5D$p52D$+5H +50~^_[]ø+5+51+5+5h/#USWV=82w l*5^t)kU豓~D(< t< u 82Hc F+5F+5F +5G $9t V  l*5t^_[]Ã=p*5t^_[]V +51~^Ë82r t ~6u1@1z+5 +5SWV\$t$|$l*5 82y tja1 82I  82A$A +5H +5H +5H XtK =+55+5 l*5t^_[Ã=p*5t^_[WV$l*5jWmƍD$PVEmuT#D$ =uD1PPPVÁ u2jPV u <$ELF1PPPV葁 uZV9t:$Ph l*5u=p*5tWĀ^_Wh 0#賓V荡hT0#蠓VzWh:0#茓VfWh0#xVt$l*5h2o VjjVՠ |$ t82H~Q82pxuh/ 82A1+5+542 l*5t^Ã=p*5t^n82tL$T$9PuHuá+5 82A +5A+5A42Aj8. 82@1ɉH H$H82WVt$|$ l*5|$t=+5W&+5+5542 l*5t^_Ã=p*5t^_騑V582l*5Fx PϊFtPg ~ u82VJ 82H +5H +5H +5@42 l*5t^Ã=p*5t^82Vt$ 829tp+5tPu^hl0#V=82p+5t-Ã|$t=82p+5ux+5~P82@fWV|$ 9=/5=05@2t P袉jh.a"@2MPȈ@2hCs P=5@2 /5B賠9t jjֹ1Vj莕Vj胕Vjx{ |059tQj1|05P5@2\ 0T h" /59tQj/5P5@25@2m@21Vj躔Vj诔Vj褔=/5@1VgtVO@2Fuh0#J2^_,0u hPh0# 0V h0@ hPh0#͎@2;D$u D$@2hc"D25SWV=/5jQEƋPh $Ǟ|-1GPhޫ#蠞G;|ۡ2HQPPB2Q O5@2;tJl*5V[V l*5u=p*5tC^_[h1#裍h*1#虍褗0 hPh0#zVt$ hc"C^USWVhc"vC=/5251FjPlj+/5i5rO@QPhL1#Q |,Phޫ#+E;|ۡ2HQPP͘2Q ڛW258tH 25@(1^_[]h*1#Oh1#EUSWV\$n;%u(sVd8V7HM2#KS?8M2#dS7 /5M5/5At#~i9:0#I {/5M2#4$D$D$=/5C1tQ~H$8?uEt$PhuUt$6t M2#tlM2#K\$ueZ*t%tS-tU+E]2#D2x+;/5}#5/5it |2#\$1|$ t5^_[]áD2t /5il2#뚽l2#SUFUSWV/5)i5rO=D29u=D2)/5~9ut Ku ]t]tu`ǁTtCiu3itit0 5D2^_[]SWVt$l*5~X1tttG9uމjQ聲u19}q~5@tu ƆH l*5t^_[Ã=p*5t^_[&+5/5i5rO@PhT1#{+5/5i5rO@Ph1#`P Ph{1#LWV11Fh1#_>kt!Zu忀ރlt puԉпɁu25tg8tbPh $kHm=2u =2u@25tA52jPvW:25H 25@uj HW52 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPhV~%Wߖ\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th$y"jD$P ] /5)i5rOC-D2+9tti-;)t RPhJ3#jl$ Ue\$D$P賃$t+,D$0hS3#jS0S\$肃ŋCt:tBuM ,%PhX3#jQD,ingD,Runn}=tQ l$ ,j SP0 D$xxl$ ?Sl$ ō,@)QPha3#w0 h?%jQR ݍ,P蠂WD$P}݃FD$ ݋\$GHO W謐H EuݍCWP2$u/1M|t؁Phޫ#W@ N1MM|FGHO WBH GHOl$  WH|1GHO WH ~T$KWiD$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =2$tCt>5@2誚79t%5@27PVZ$=/5~y\$t$1=/5tEt*t t.<$u u/S0=/5u WE;-/5| $^_[]x0 hjPh0#NUSWVD$4\$,tl$0|$WUS ƃu#8=`55tl*5/5/5D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o/5D$ /5$iD$ 9T$tcu tQ=05t 1=2uL$,uP9tPtu 2P l*5u=p*5t^_[]Vt$l*59tP\ džƆ1z l*5t^Ã=p*5t^7WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h1#5t$ntpu25D$D$D$t 258D$t(1PPSȑ EjS==/5u|$1/5-25~6@ /5D$u}t!AH Et{1jPƅt9u ED$u :u G Eu25t Dt111D$uD$/5L$L$t$D$\$l$|$ /5@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$/5C$jU9 L$tc|$tNuJD$1rȋi4he"jD$(P"l$D$D$L$D$u U D$\$l$t0~Ot)D$/5y\$l$D$tUD$tMjPSD ?jVDžtjuS# =2u V 4Ń퀉0^_[]h1#Y{Sh1#N{Sh1#C{USWVP1$1C11h1#J1it"gu$ڃjt puЉ̉( 25t yjPƅt,1t/5)i5rO@PhG2#H$t#tH~1i0 tPhV~%轊11G^_[]Ã~1i4h"腊2HQP~G ;| Z %PG ;| 2Z;|lh2#yh)2#yV1=/5ujt$ St1+^V1=/5t. /5~$A/51F:uI}^V=2tO=05tFD$t+ /5i5rOA1ɋ2u0VQh2#R^USWV=/5u65/5~%=/5Ft WN/5l$/5~"5/5HI}l*5tfiPƋ-/5=/5iPUVRf ~ ;uKuU l$hnƋ=/55/5i 1҉AJw)׉=/5 l*5u=p*5t5wl*5fdž=21/51B|iP l*5u=p*5tv^_[]SWV\$|$ƅtt.VSt$W\$<$D$ #^_[0, Ph2#vUSWV|$ 05tWdW~*1505d*5D05V>V}5/5l$t$t%t =2ttttk0hWj~Wj~t uu`mul1VVh$tOh$h 0#uw*Vj轢uV5@2 tTWjzWjzt*=2t!WjzWjzWjzu/5^_[]i0 hPh0#?uUSWVt$ l$|$1ۃ=05t/t*=2t!ttSVu5<2tEL$ji4DDt QP ^_[]WVD$t$ N /5=2u=22t=/5jP=/5~/5>f@..@.^_WVt$ dl*5NJujVj 瀾tW5@2><u%+/5i5rO9D2t mjVt=tu  ρπtt=ttu jsu VK l*5u=p*5tr^_6}0 hPh0# sSVD$L$ =2t1ۅ SPj2) ^[Ët$1҅tހu1=/5u2/5u) /5~/5:tzt Iuh2#~/51@SWVt$$1@=/5|$(1@>${j"$3&Wh3#bjvu hm"h$tjjvjv 1~ h,#21@^tjs%;th2#h$jvh=%1Wvh2#1Wvh2#Wvh2#jvu hm"xh"kjvm~ t+u hm"Gh2#:jv <u hm"h2#2#Rjvu hm"h2#7h;\"v hz"jvh2#jvu hm"h$;h2#kFp]hz"P~tF1SwJh".Sw 1> 2#t2#P uh2#h.#vh2#v 3#'1Ҥ"13# 3#3#13#N9tQhe"jWWSxuF x%Phe"jVRVjv S hq=#51^_[h2#h2#jvUSWV fD$ /5 /5l$ 1D$U$u1!" $4&]1x&~'t!=\t_"t $Q\$ \|$ B]ڃ 23# t63#,$$׃߻%!$}D$93#?3#} uG3#$=%)4$<$zT$tvӃux<-4&t ur>u<.4&_pE~FЃ r3# ,$t)3#\$҉Ӄ9uG8,$"2D$1&<,4&:,4&$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I /5/5 ^_[]WVt$ tG|$t jV~t'h$h$jVvu^_USWV$t /5 =/5D$P 55t 5555 $=/5z1jh5&S< `P>;Hx@u8/UD$PV7x D$pL$t 1D$tD$p1ɋ/59/5*5tH1 8t:tGt89=P2Z 9=P2~*55L2WPVX >?3#<=25l Vnh: fiDle cDhangD ged߉V~v2HQPPvv2Q D$pL$t /5/5E;-/51-/5D$PĔ^_[]hfUSWV<1UjhD$hhh UPju @IR9u 79È805j Uw <05j@05hc"U h3#HD2,$UhD05n t$T|$Pd*5D05|0505@HfD$PVWVW~=805 Àu {=2n$h3#h*5ttQu *5 *5<$B=25=05(ȃu6|050525$h*5u7=h*5u72HQPPt2Q h`2tD$Pl*5=p*5t+g$$=805u>hޫ"J5&t1Ph3#QPP[V$=2u2 805t N=805uEt$(Vh3#t8t$PTPV$75=2t =25tj4&kuD$P25u/jM=2tFh"|rh`2s*1ɀ=2ˆQPi=2u=25t42755*5+p$$#uSWVD$8t^l*5jPrƅx jVO l*5u=p*5t>ex"1=2t=*2t*21G ^_[11=2t 21jdV3VR=2tt*2u2^_[USWV|$(V11C=`55tn1=2u4t0j52ujh`2q2P=82t.te=2u\1Ƀ=/5 /5jPi1;tW1R=2uIu=2t7=2t.h3#hpEVu=$u\V#^_[]Vt$l*5jVqx1jP l*5u=p*5tocj^Vh 0#ct1Ã|$|D$pPmmft$聰 th3#yct$t$N th3#ZcWV|$ W.a@P: tWP褏^_h3#"cSWV|$P29~b9l*5؃P tr H2 L2P2H2 l*5u=p*5t ?bP2l*55L2>L2)P2 l*5u=p*5tb^_[h3#gbD$t L2) P2L2j h3#jm e`D$ H2 L2H P2H 25H 25H25ËD$l*5H 25P l*5u =p*5^aVt$l*5H2;t H2P$ FL2FP2F 25 l*5t^Ã=p*5t^aUSWVP2<kl*5-L25H205t|F9uuH2PV  H2H2+ P2 25L2=P225tG90uC H2 L2H+HH x@WSUPN 5L2=P2 l*5t^_[]Ã=p*5t^_[]`h3#`D$l*5L2)P2 l*5u =p*5_V5P2P2255L2^V5P2+525P2)255L2^ËD$ L2) P2 P2L2+D$ȣ25USWV(L$@D$D$@t-΍i11P]wDGÉ,$Eu1ۋD$b USWV1\$@<uPƋtPEu1ۉ]h2525=2552525^_[]SWVP\$t$t2uh$V.Q1C$"h6#^Z$(,2u*226#02RQPh6#^ "uȡ2HQPPtZ2Q (,2t"22"t!QPh7#h^ u.$(,2tPV=Ptu6#VPh7#M<$u#12t(812uƁ22u숟22h7#1 [2t$Y2t(812uƆ22u Z2@uă^_[V(D$ T$029tu6#RPh37#Lt#12t(812uƆ22u숁22^WVt$ ~t)~tP辩 uv誩 ^_USWV jA 25t_y 8-uUD$$25125P  25y8-@P1F Pơ25)l*525=25~-25Ft7 251N࡜251ɋu25 l*5=p*5J1F525P)ƅ2599Sl*5 2525lj4$މt$\$)1*C/5259rL$ 9v!\$ۋ4$ P; 25w4$ 9vQ9w25 l*5u=p*5tIW1 ^_[]hX7#IhG7#Ih7#Ih8#ISWVT$ 25tstm8u'1z:trrD8uAÀ~:u"9u 25Q25 tf 251ɉ 25D525>1t6?-u1t+O^25-uta5251^_[Ph7#IPh7#H|$u1PjPPgel*5jw258t PI l*5u=p*5t2H1ËD$Ѓ w#j jP u2525ËL$~ND$tH  25=25u 252525h25h25Qpphn7# HUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjhc"h7#Y J|$:uUD$8@?jPh7#Y ^jUh7#Y 1|$D$0)@<Ph7#h`2V jh7#f1?\$D$01@11T$4*l$Phe"j UVhUh7#Y D$EEjUt$0X u0^_[]À|$:uD$8@:Ph7#K1L$0L$4@UjVEfVD$ 821qqA1Ʌ /50PQ82p ]t u 1%8282@j* 82 u^qqh8#\EPD$/5/$aQXUSWV'ơ82@tu'tƃ 82 x,$@D$t.$x#18uWP/GtG7&uD$tKjD$p)t6NjpVtBWPVl E$ht82@^_[]USWV82@|$u 82A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq82@@|$Fu6|$uD82@ 82Ap8 u|$u82@^_[]jjX 82ASWVƻt u j pxʡ82@^_[USWV82kE1͋ 82x t*/5,PqN82@ C1Ƀ8Qs s j@82HOH O oKy K9t?U1CSpt ^Sh<&P= 82HO@ G 蝯82!^_[]WV@t$P 82A uyWa? wWh9#46&h9#j"Q Wh9#j"PQW!?uL$Lx46&h:#Vh9#jPQWUSWV82@1u 1=2tMtݡ82@xuUj @jtÉGpj`aC+t82@tj,(pƉ^_[]h8#82t$p0h!:#@USWV82@$ u82@$EŃCߡ82@$<5&$ 82APUj já821Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt82xJjG B u082x,u%@?&t@/@?&uh8#jÀ=2tjjj 82H0+H8O U 82p0j^@ 82QPI H pGu582~ h %v?m|$F82xujD$ 82Hu 82H L$ qx0j@82HKH K {@;u.82x }82x|$ T@0GjG 82@t(HS u 82@82x\$\$j 82HK @0Cku82x ux,uh %p=jP@<21ɉH H 82Q0PCAHrAAtejC9t jW\G @:82@ u82@$EŃ!ߡ82@E<$t!t;tj pXÉ{؃^_[]/ uS\$|$82X0j2x@ 82QPI H X t\$|$D$C 82APsVL 82jj 5jj,jj#jj jjh %jjjjWV82x$G Hs82jpW$ uq82p(x,u~ 82At8 u @A8 @tHA~րxru\tuՀhS9#82p0+p8j@ 82QPI H pG .Pnt82@F 82t1^_jjVt$&9u^jVVL$1?&tA1B1t A?&u^uVt$j@ 82QPI H p^USWV |$$tD$ D$$D$l$E1$82xc 82x0$t $j\ƃF 82QVI N ~ut. 82I?&tAt=t A?&u1c82H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc42 82A4FA~րxruwtuՀh9#BL$T$$@ 1}D$8j(82 $+H8N~L$NL$$N @0FEPqj/v%uG42 82+A8FF82@4 ^_[]jjjjh39#L$1?&tAt=t A?&u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;@05}X;<05~P<05I;-u{tBuG82x0+x8j@ 82QPI H xF^_[F hE9#lUSWV|$42D$=u ?vl$$5L2P225G$|$ t u Ǜ t19uD訛 $ tC9u?,$ u4282HH }yMt9t u>u:<$ t=u葞$)jWP萞 |$l$$uS\uN25H 253\F u%25H 25  F42#á25H 25ƈF t詚=v42菚=t hT7& u4282HH 25H 25r=L2)FV,82x42+D$^_[]USWV$$1҉T$ T$$D$(54282r0=<&t1$|$ fw|$1/fFn D$j8fNL2 P2 25=>&u ƒ=25‹nD>  $5&=~;&u f|>z 2542Bס82=~;&Xf|>LCD>fT$ T!uhЃoĘ0N,諘05,/L>==&fu 25Bn׍MN|$=@01fD T.fTT.fTT.fTD=&fD1AL$!(ljƒ(M 25FD 25BvNO|$s@81ɃfD T7fTD>&DfDfD> 0 = 25\G_T$ t$>Hff 25T$ Bf|>D>u6t$藌 nMn 25}f|>  25BFfL D$$D$f|>tD>t 25Bf|>u D>v 25BW 25B*Ã{t ?& 25}E+=L2 25E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $F nMnD.=~;&u 25 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD<&fD 25T$ B1AL$ I) NjFfL 25B) 4282@8xt /5 /5$8W Nf|F\=`4" $"}f|  25T$ BFu6$茉 Ft$HFuЖD$$D$ Poſ1۹$5&D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD<&fDu6t $y FHF 25B赕= t]H\t 'u 4 t =u 42821Ƀxɉ /5$6 25T$ 'uF|~;& 25F$ =&$< u 25T$ BT$ 25 cʔ,t$@  4282xD/5??&L$ pm2DAD$D$E|$}~=&f|t 25 25B\=& u 25BNf|t 25B1@D$ 25 25B݉ý {"XŃ', D$0$ nt$T$ Mn 25B1@D$t$C/5$4#U ̏` Ń< ?\u袏\ 0 \$1CHЃ w&Hw ÃHÃéOu M 25vNO|$@81BfD T7fTT7fTT7fTD=&fDőL$ uk%=I =25 D$ wF 25P?ˀ 25@ww 25 x?ɀtw 25@ 25W?ˀul 25GXT$ W 25x ?ʀtw 25E 25O?ʀ 25Gw7 25x?ʀtw 25E 25O ?ʀtw 25G 25A?ʀtw 25A 25H?ˀa*2525D$D$$25B1z?&t.25H 25LjGq ?&u\KЃ w425H 25LjG; ÃЃ D$ u t 25׃Z 25H 25]=Gt/ up}tk25J 25/#@ǽh#tE%t@Ń:bD$D$$s7&¸U1#,W9uڍ1|$Nf|uf|t Ms@ L29T$ vNK؃|$ @11fT T3fTT3|3|t3ft1BfTft|~;&fq fq ƋT$ +5H +5~+5H +5 ډËFD\$D$$s7&bQ1s7&)G 25x?ʀtw 25E 25O?ʀtw 25G 25A ?ʀtw 25A 25H?ʀtw 25@ 25A?ˀa2 25AD$ ??25H 25~2G:25H 25~$_1c:B ˆB1=~;&nD=>&G=~;&tf|cf|.325H 25莿5L2Gf|uNT$ ؃t 4$t$nŀ>ts4$flPT$ )B82L$H,L$H $վ82pM tΉ$| Nu82xĨ^_[]1HE;@05} ;<05~<05>uxkjy1$&tu>tyu6EBE9E0E"EEEA }82h$ Ή$v{ Nu=tuS$p:#$9#42 82A0$9#u$9#b$:#V$:#J$:#>$:#2V 82xt@@ ^Ãx t#/5$@)82@ @8 42H0+5H +5~+5H +50諄ƃ~0:=F $X6&> t=u럃F~t\u^ 42@42 82A0yt/5 K/5$S(*;|u0d|82@=t*ʆ4$D$D$~;&Kuۡ82@1v u4282HH @1@Q&82@-82@82@&tQ;ub82@ 82@؅82@82@ 觅82@u:\u?0 u64282@81Ƀxɉ /5P&Bjjhf!A ځVȋ 82y8~0 25Q25@ 82Q8rq8^USWV\ӉΡ82@D$ 1,$d*5D$^+L2D$$UPl*5$~S"ʼn$S5L2P l$|$tD$$d*5 l*5u=p*5tw42D$-L2P22582x t*/5PL%82@ 蠀ǃ[~!\u9菀ǃ[C tJ$Q u"4282HH s`un=ub\tX`tS42 82QQ NDt""u$25H 25~E\E \@ŋ 25A25@25H 25ٷEL2@|$t~Pt$jP荅 D$pŋȅut$ j轴E82xtH@1D$42D$jNǡ42D$Kt5 82At$ D$AExK82@t$ Ex P29ًl$踵 P29~=L225t1SUW )25l*5Ult $ l*5t\$=p*5\$tW 82T$ Qd*5Nf|u%Du 25Q256@Vt$+t$ 25Q25@~.F25B25ȅAJ։ȃՃ\^_[]á82L$H0h:#W~<$t 4$ms /82@D$d*5jP]jj#jjVtQ%s N^V 82c"ytA5/5t7t u(55H65542P5/56:#^USWVt$,|$0l$U5P21BW;L2u(VG259w&25WVS Uڲ^_[]Áw: t9v$P525l tã25$25랾N:#뤾\:#USWVT$L$ -d*5҂Ɗ*2*5D$1|$082D$|$ljWltJD$82*2V艂-d*5D$*5h*5c"jUk\$t$l$=d*51F5*5D$082$V\$S7 !{Vh<&P 82A |$t|$t=2u ;#@݅u:T$1rIJ$JB *2VVRdM -L2=82D$*2t$臁D$d*5D$*5؅tȁĤ^_[]jKL$1jRfL$1tT$9Qt uÉV 351t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu 25tu(Mxju PQ.Ex P Uo uF^_[]USWVl$ t$\$|$t|h@VSA VSADžt9u 9t S9u95D2}5D2^_[]Åy0 PVSh;#W_WVSh;#oUSWVt$ |$\$l$jMEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!jl@ 35$35M|$];@05};<05~<05Eu9] u35tX9X535t-pt 9^t6SLF9t SH 351tF9Yt? 35tHt 9Y jjS PkD$($@t 9XjS_1xl*535  b35 <059|AQjS! ǃt;=D2~=D2x jjW jݫ$JBXxp l*5|$u=p*5tu25t$(WUN mC#1O ntuK535jSh DžD8t 8ujjS= Dž0 PSh;#\$t 2t2|$t 2t2^_[]j Å PSh;#T_0 351tT$9Qt uÉVt$535j V u 35|Qj V{ u8FPj Vg u$j j VU ujj VC t;D2~D2^h;# WV|$ t;G;35|.GPSƋG9tVPWwCw^_WV H2 A H21F |71FPWW y w;D2~D2Pgfff  35^_USWV$$$~l*5 8k$|7&n  35t9i V 35tQt 9j b Y<(O8=2tNnjU ƍD$PV#D$ =nhh]n$SUoƅtjV!SjV $/nhh nhh UU ƅV;5D2~5D2|'u" 29uu-jjW 9t1jPWV l*5uQ=p*5tHj A1jPWUy v 0 PWVPW l*5t Ā^_[]Ã=p*5tĀ^_[] hh j 辁 PWUh/;#N Y0袁 PWhS;#3 ^1F5*50V0 PUh&# 8V8*5j0a PUh|;# USWVP9xa|$\$;D2~D2oUv= VUS 1jSSQ t!t$B$^_[]h,#J 4$"1EUjDUj9UU/Uj$Sj Vwt$ g S VD$535l*5PV]35VAf  l*5t^Ã=p*5t^<1=25SWV535t4|$t^tCx PVjV6u^_[SWV|$ D29|ȋt$|9}9| D29tVjjVW 9u^_[WSR PVh;#WV35 |;@05| p35t$ Pj V8 y28t 8u>35 jjV ;D2~=D29t VE^_Vj 迣tL$ T$535035PH^á35tT$359Pt uPzd USWV$|$<\$81D$ $D$1F5;5_2h<#WS>G !1tbhn#Whq=#Wuo1<35tEl*5435{\ 35t jV l*5u=p*5t_F@u45>h}#Wthy!Wt D$1p@|MD$K}hMi%Wt8D$D$hd=# j521CKD$D$u}h=# v11 t=t8<35u.u hi=#v VaPhA$  GF@uh"A F@uu=45tk1uu莩ND$E11P@É|$t<35tW435hX#Ah~=#<35t435 hq=#{SfPh." Eluh>#52 Cu|$tE1F-l*5D$t P1<35D$t435Y D$35t jS< l*5u=p*5t~Et h"11<35t:358u.u hs=#aVLPhA$   GF@uh"/F@ut h"1<35t?358t3h~=#435VPh."m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=45t61B=05tbu^1Ƀ~7t@tuH1=24 35t1Ҁ9ƒ (u1=2B1ɉσu1B451t)9t`tbփub1^։PjSe $u=2d1@ָ& PSt^u45u jSJ1D$ D$D$$K?r k 1@ jPj ^_[À=2u=25u =2=21@Vl*535>t8t6MV 45r45 l*5t^Ã=p*5t^-SWVt$u 451ۃÿ35t6358t+l*5SP l*5u=p*5t35=45ru^_[,^_[V1=45u#351A:t2>u 45r^WV|$ 045u"t$=l*5tg=\45u^p*5WuS = 35tӃ<35t>358t2t-`45`55=2tu=l*5ue0^_WV|$t$ 45uWVj45<rjV.uƆ45^_áh35=45t1Åt8uUSWV\451G`55<`45u@@uu`45=45u΋435tãd55S-*5V.jP)VS mt<$tSy-*5m \45^_[]ù@rA<\45tøWVt$ 95h55t)1Wj;Wj0Wj%5h55^_ËD$l55p55USWVhD$=l55up55)=\45td55t D$D$*5p55*5=`55tt$,jV訬u 5d*5et$,jV芬u45d*5=45u%=35t?t135PWl*5jVAu5d*5Bjc|$wfs 5p551ۍD$X XXPj\!SW\$\$ \$\$O?r 1@ DD$jPj> VPuf52t$WVt$|$ ?t*FHN V>Qu952u V^_52t$WVt$ Nfut55FNtF t0fu^~l*5 ?NQPF N)Nl*5vՏF FF l*5u=p*5t V N^_Vt$F t-)t'VfxQPR yNFN F^52t$USWVP|$t$j'Vt~th->#V <k>t!hT8&V\1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=2uUWMGHO W]H"WVGHO W3H"^_[]WVhT8&Q~j'Vt)19<>^_hL2oh`2bUSWVD$~@|$l$1SWU t t8tF r)~1H^_[]ËD$)D$l*5X2tPM 1X2P2 l*5u =p*5PD$L$ T$$RQP XVPt$t$V* tt$ P4$%M ^h2>#PD$L$ $QP52 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+75+55Pqq h?#jh65!65SWVP558&C PVw u,$$wCGσCGCuhL65Vh>#8 u*$ @65@65D65H65^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUvh t61^_[]ËD$t8SV V+ƋD65`uH65$K D65>#t>#$43#t_%贡H65㟉D65t$D$$6# ^[WV<5d*51$|$PW]t $D$PL$LT$H=d*5PQR 5d*5$<^_USWVL$T$tHtA|$9t91?&Írjt/9t+1?&tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t UV藈Ƌ $A$~ C@ $Q$f=t @UPaWVp ^_[]SVh>#WV<5d*5*5$|$jWu"D$LL$H=d*5*5PQ5d*5$*5<^_USWVD$ èu|$=Z2uÍD$PQW Ƌ@l*5Nt$݁ uF @SPуF`u v]H F~tuF1Ɏ! s%t É^~55t55u55t j~ l*5uk=p*5tb[r2j賆XxL$H @ $  $#`uWG `u WzG fy^_[]vv h># D$@!|$$~L$( t 9-uD$@-=25u0@=25tc@=*5tf@=2ti@=2tl@=805tp@=2ts@jPh?#,WVt$|$ l*5twхVP? l*5t^_Ã=p*5t^_WVt$ t|$Wv 6u^_USWVP\$l*5j2ƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFRSP}j=SJS迄UPu< ؉G@542S542hT2P ~ F1gjt$,65uQG L$<=u555H552UjS $81F FF55,65~65565 l*5u=p*5t^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ *5t8Q12<08uF=u =ut j=RİF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVT651tr:1҃Љu65r׍P辂ƻT65Nj+t7Mȃu%EttUЃuEmŃ65r^_[]SWVT65>tLGu% uwB Gu#WB @tw݁Gg;u65r^_[2SWV|$tfh?#WJW9uWh $V't*tUj'Wt8)WPh:?# h7?# Gh{=#Wh#$^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPh͹#tUh͹#>=uD2HQP~ j( P 2j)n~=uGuth"EU2HQPP2Q ^_[]USWVP65u65 h65T$ t$\$T651<$?tIOt !T$ ttуt݋ 659|QPT$(65%65)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP}I1>?f u%PV?V1u%#L$1PVU1t1Ʌȃ|^_1@Ow$T9&1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$? t$$19{USWVӉϋu75fx@$9&$PWT1ۅD$PVTr$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PWPS1ۅD$PV8S$L$$t$<|$@11$;D$D9t$ aZ$PWR1ۅBD$PVR,$3D$ $3L$ $$3L$3D$1 dVW1ۅTVW1ۅfVWVW1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]Q9-u1tQyt8ytBÄth:@#Q:&t1h+ jjh:&Qh+ jjh9&h$+ jj h:&RSËD$L$  )VL$D$ 2)u AJ)^USWVPj PV.' lj8t"ځ8"u 11E9s:$9t( pm2@DQ@uuN9t ڃ^_[]VhN@#AVh=@#6USWV׉t 9Fup  ^^9uM1PP~ōP@rPU~ LH;NuS'3 #~^_[]ÐUSWVt$(hc"jI D$,^H $x?-Ok-u)sstdluu~xwGWÅu"pm2DHt'1Ʌ S&كhy@# hpm2DH\ƃ~ƀtV詓tVVh_@#jރ $ho%S1Ʌt:Su+$891V52VR|-$K$8ʉT$hMi%W1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWu.@#|)" $4Ph%S 1@D$l$t jWXj D$PU ljӋD$9t-ف8ur1u 8tQu"xc"UPh@# 1@D$\$ $4h@#1@D$F \$ t$PhX#j*5PPPPh@#522jWVPΉj WQ 9u=у|=}^_Vh@#jQh@#,j52j(WV@0+5+5+55<>t)j=W裛thW>uPhe"j@V@jVhA# Vh2hw" #VWh7# 43#t_%VQh6# j,hA#h6#q VWh"3#bL^_=h*5t 1+5+5T?82251252525935tj=35u2L22`22tP- 2VjB15*5><25/595T2t\2@8@u jRl*5jD\45uƀ\45@u l*5u=p*5t@^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$xB&$A&Vw vVw d_ t"Vst Vw?wN@F1Vw q#w N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$uxB&E$B&Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t) Ã|$) USWVPu }75 752f`|j%vLm O1@ 0$75D$,(75|$@t$(q%v>%L$ h B#VY<*u C h"SlY1N .u{*u{ 1HD$Ch"S8Y1HD$  t$CD$'C`L$&~QF0 $B&. D$׋L$ jj D$tfL$tjWt$QPh@75TFu$B&$75l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Ph@75$75L$ Q0!|$$75H $75T$ l$= 75uM|$L$ jL D$tbL$l$tf|$ L$D$$@75bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$@75L$\$L$$X8G$750$75E ƋL$ cjl |$D$VPt$w$75$75$75$751  $75 $75Wt$*|$$@75 \$$75<75t P% VFPL <75҉D$xF\$wZ$,C&a=&t1"u@"*\\t#'u0'btnv fre\qFuZpm2AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~V75,75T$t P$ T$,75075t P$ T$150755475Љ\$H\tF5475X])P0tXM\$u/^t-u#F5475벸^tic\$>T$ j5475F5475{ pm21:DYt 7GuF5475\$DF5475ȋ\$+1L$ jlD$t1L$t5WQg75L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ h@75 PRQt$QP  75FPB 075 VjxP 7s075T$t t$L$ t PVRQh,75UMT$L$ t1PRQh,75U.VWh@751PQ*t$P PQh,75U t,75875T$z \trB<]*<0tu$tC& ?$HC&."'#Eu uShB#Y75 4$pm2D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu hPB#75\),ҋ4$u|$ uWhkB#75 ^_[]WVP$750tp$75 1ɉQPV; Nj pm2B#DQt$cCC#r& $75+ (75VQP 751^_SVˡ875H 875 u:2Prp~r0 P{2Q 밅u875)2HQPPD2Q^[SWVP$750t"$75<'t<"u1B^_[11f1ɉQPV觮 lj+t:<-t6 pm2DAu)$75+(75VPhC# 75 $ڃ^_[SWVӉQ,ǃArVhB#75GPVh@75_ D$=75>75Ƈ?75^_[USWVP׉1PPPp ,>U趻@PUQvp x$tG9tC$75+(75VPhB#$75+(75VPhB#蘿 75$^_[]WV9t"΀:t9$75+(759t\VPhB#Z$75+(75PhmC#{D(8"uD=$75+=(75j"]4 PVWhC#FRPhC#5 75^_USWV\$$8l$}hF j jhC&Uƅu!hF j jhD&UƅH h]#uFj PV 聬8u$8u؃^_[Vh $jWVhH#jUSWV1 f]575 ]5ƒ ]575[ ]5€ш ]575 ]57575hF"|t h:J#|t8ƿ$N&^N#PVtG uVhMN#j $$1ɉhyI#SU P6$pI&75kj j5$;\ ƃu 8"57575v $;f75Wj j5$; ƃ _%75j j5$; ƃup8"G5757575751A5$;ߺ5$;h~"V;tchI#V)K7575B7575/75#莩8"tD575  9u75rCjhI#5$;hI##VhI#5$;hI# 5$;hI#j讹u hJ# 75t 1ҁ‰75]5փ9575u<975u2]5975u#]59 2t 27575=75u\1ɅQhGJ# _2=75t)ͅt=75ut 1jhh75P4 $yh75h $jn=75u1D$(Pt$vu#D$0=u 75751N1$LJ& $$h]"Tx6!t$h1T#Qh]$hVVth""Pۙ$Ph $nT75t=5 $=t=5=75p;5B=hL"t4t1@$$Phmdt$ hhYJ#h|tW!WhT# $=l<5u l<5 =p<5u p<5 4$h;5 T75 $$1 uWhPh;5耉 1;5;5<5<5tjVh;5e h;5\ $RhSԫ;5h75VW0 575VWF5 W藚l$t$D$ 1ɉHHD$UD$ Pj虦 q4Džy#趤8#BjVcN4x߉DžVjSx9ujUjE 1|$nhL"$P<hjh;5 ^ W辙t $h>T#=he2je2H e2~e2H e28he2~ljt9 t4e2H e2~e2H e2he2>ƒ߃NyjUj1 hl"P1;5e2h75VW4. 575VWj3 h;5dtd($Ph $eP$Pu1@P jUj蟤 WP豧9Phj"sWT#tǍ$PWh%VD)D$uh!Z$P{$jPhY"QQ&ƃu W V]WVθL#0K&PVht uVhL#jkG 75裨75G75G75O1|]5t^_^_WV΃=|]5 ]5t>75t49t0I#I#9t~"9t~"QPhTO#w 575|]5]5^_SWVW#LP&P&VShX#hLf2I'"uj5VPjj"P1 thoL#1Q1J&$ =uh4~ jj"t$ X1$4'F"u4$ 1@^WVκ u1H3 r1P^_V΀=75u6=75tǂ t41t)Ph;50h;5hedAV xk^Ã=75uǂ Jt=75t775t.h;5hedAVp th;5hrdAVY t=t=5ujhP#jhP#jޯUSWVPύAPjhiS#he2Gw4tO&hb#PhS#he2X e2w(hS#VB w,hS#V1 w0hS#V  w8hS#V w4hS#V W4O<W8dS#9tQhdS#hS#he2c"OHtQPhS#he2c"OJtQPhS#he2c"OLtQPhS#he2kc"ONtQPhS#he2Jc"OPtQPhS#he2*c"OTtQPhS#he2 <$f$1۽ae2PjjhdS#^wVhT#e2PwVhT#e2PGtmÈJ9|6{u;[tVPWhK#*D$(ffL$(D$ 1ۉa)D$u!)tPt$hK#L$4 <)ǘ΋I<9vt$hK#$N<.”T$9vt$h!L#x$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$hRL# D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( l<5p<5t$(L$QhV  D$ 1hcT#VK@tG<$h4"V4(1>tYj:WRYD$AL$\$h4"S,1tD$h(%WJtkh#W8hT#W"\D$PhT#W D$q;75efj<5ujhX%l$!U} l$tO&1tUP QFO&r܉1hD$ Pj <$WhgT##D$ D$t$ <$}trÉD$h&"U. t:h*&"U t/h/&"U  t$UWhT# F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhT#7D$ D$<<5FʼnD$uf5;5l$u D$l$l$hR$W hfA%W h U#Wh*U#Wގh8U#WȎ hIU#W貎h"W蜎ThYU#W膎hgU#WphtU#WZUhX1"WDkhxU#W.hU#WhU#WhU#W<w ~W|$WhU#| T1<$8<5jD$<$rt$Wh}T#M D$f;5@<$WhT#075fj<5jUh;5jUh;5U <$t$ht$0V J21jD$ Pj< D$<5뜉1jD$ Pj D$ <5q1jD$ Pj uuD$<5J1jD$ Pj uND$<5#1jD$ Pj u'D$<51jD$ Pj^ tt$W|$WhU#D$<51hD$ Pj uD$f(<51hD$ Pj uD$f*<5a1hD$ Pj ^D$f,<511hD$ Pj .D$f.<51jD$ Pjc D$0<51jD$ Pj8 D$4<5; 75sr"jW|$WhU#W|$WhU#΍L$$ t$t<5|$]5L$$ L$x<5t$]5rh4"Vl$}}J&1ۋ>t.W谅Lt t uPUW Á K&r D$pm2MDHu D$"91hD$ Pj t4$hgT#mD$ \$"r)Ut$h"V#N hQV#AD$1ۋD$<5ND$<5W؄4(t$|t%h4"V L$1Ҁ<tʉT$D$< w'<$$lJ&L$ L$|<5<$tL$$L$ L$|<5|$]5cL$$t D$|$]5L$|<516FL$<$C fF|$]5L$! L$|<5|$]5t8L$$ D$|$]5tL$|<511A<$D$ h;51D$ ȁ(^_[]4$h V#yD$ WVPθWEV;5d<5fh<5h;5 fh<5=75u=75u#$}h;5hgdV 1h;5hfdV yߎ8t Վ8uv$=75u(PhmdVn xX52h~ k1=75u$h;5hgdV2 y O#1G^_ùpO#hYJ#) 뙃=2tt$ t$ t$ q !1HVD$ t$=;5thPh;5q ^D$L$01+Vύt,uVh,P#-t"uVhO#Vh $ ;VhO#VhTP#^h]5hmd52& USWV8 $RPh hx=5Q/x]5 75v|Pt$hP#% lj D$T$1D$ XƉ 11 ‹l$ ?5 x]5x=59x=5hWD$Pp $;D$c"=t=5t =}t=}uЉD$$Q#=75tȋ 75=WEVuT$tf975rD$Pftt=75%4$t$Uh\Q# D$t=VEW=75$t=VEW4$t$UVh"Q#=75|4$t$UVhQ#=t=5$D$PSt$Ut$VhQ#y=75u $h75Se2V 575SVI SGSt$VhVWn t=5D$ L$D$11t4$hP#88^_[]USWV T$ $11F1Ń=75|Uh4R#r QPWD$Pt$/9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=75tUPhR# Ɖ ^_[]Ã=75tUhJR#6=75tUhkR#nċL$T$tPh;511@PhQ#Zt"j QPV u 8"t1H751YhQ#j芙PhR#Yt"j QP  u8"t1H751YhR#jASWV։ϋ\$+75tItEu751tGtBx=5 ?5x]59w1x=5 1tth;5QA1@^_[VhR#jvL$1=75T$ PG1ɅɉWVx]5~( WRPhx=5Qv x]59u ^_hR#uQVhS#j,PQVh0S#jUSWVPӉ΋l$|$uj WV EuK"9"t:M";L$ w,O>t" t9tpm2DJ@t1^_[]WV1t>΀9t7h4"V#k<t#ƍFh4"Pw 1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)WhV#Wh V#|1۹]5؃^_[]ËL$9/up<5D$\$A/jPU u$D$ <5D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.WhgT#]5!Wh V#]51 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uhX# D$$Th'X#Sut]I"P&WxPWS:| '> uۀ$U-$T14lQ&D$XP tpC"uD$TPh]#$T$끹z]#lQ&j" $eFMu SQЃ {Sh2X#萭h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$hY#,/$PQhY#R~$  U$ W PhiZ#S& Nt/Vh%S tShZ#藧$fw(hZ#S t*Vh%SM tShZ#J뾋$G(w,hZ#S t*Vh%S tSh[#뾋$G,w0h![#SI qt*Vh%S tShF[#躦뾋$G0w8he[#S )t*Vh%Su tSh[#r뾋$G8w4h[#S t*Vh%S- tShZ#*뾋$G4w덡e2H e2~e2H e2 he2j 蘦l$E;l$4$w ^_[]h3"j蚇D$L$01E USWVH֋] } t>$u ~ˍ|$@WV9t"b&J~PH k$,P&1OJH w@$TP& е%B(D$ D$$l$ CtGtngtbcB8D$D$l$cе%ɋB(D$(D$,l$(Bе%ɋB(D$8D$<l$8е%ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=]5uHr8jVSWhD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph^#Uh^#H~USWV|$t$t$h%"V Gw4$R&h=!Ph%"V GPSh&"VנGPSh&"VĠVjjh%5GXtVjj h&"y5GXtVjjh)&"`5GXtVjjh.&"G5Vj w(h7&"VK w,hI&"V: w0h\&"V) w8hq&"V w4h&"V w$#a0QShN'"$S<.Ǡ!w4R&h\'"Phd'"S  w$Q&5h'"_<t$uM55hc"RPQhk'""555WRPQh~'"Sm7hc"h'"SX "55RPQh'"S4M8tDƔF1Ph'"S F;Eu 1<1A71Au01<  $jj@PD$P#D$ Ph $BC9u<$u4e2H e2~e2H e2 he2j /1^_[]hA_#jF|fUSWV $ $ D$-@1]5]5]5]5]5]5$]5]5]5t$ hR_#US諡 c~!P$S& ]5˃PtdT]=$;?1AJ5$;s ]5뒹 .$;]5hc"n ]5b ]5D$]5T$:@=]5l$;D$ Tnt uBxou D$ 1Ɉ ]5hJ%V't]5hc"`ء$;$j:W*C-]5tWu/btm繨]5S c$ \W]5t]5t ]5_29$ 1ɉL$tVh$P_ tj/U܍u Uh'2"h$h$ UVhDžuVhDž7h$P Ƌoh)#Wat(ha!W`thc_#W`pV 1QQ$ 4PU7L$9C9$ $ 9tUQglj?,$u1QhD$PQV' h]5hzd@PYK tq$ PhedAW?K Wk|$ W[D8$9",T&uWKkx^5,$h h3 5]5P Ġ ^_[]h_#jw$Ph $jwVhf_#jwh!h!ʍD$ Ph `# D$ Ph`#jwD$ Ph9`#롍D$ Ph_`#땍L$ Q4|S&h`#USWV։ϋl$j輡 V1 U& CCCOK G^_[]hT&Ph`#hLf2茒j肉USWVP׉΋tAS ZWZ4$4(VS迡 Wh^#Vt$ P W茠 É^_[]USWV|$1_h)#S^t$ha!S ^thc_#S]u\]5toU3]t[u=]5t .=]5t%]5toU3]t [u^_[]USWV$D$|$]5c"tW3\]t CÅush#t$ 9]uD$$D$ ]5t L$ mt L$ ^$D$ D$h觟 $$ t$h$hVV$0|$D$4$L$hJ%Q;1G@΍K9|,SP辟 Ŋt><-u(GD$tj=V $t>FD$ GD_#thJ%D$P货u|$1F1B,$֋$$$,$D]5tPc"tz!P$h_#蘍 xF1Ë$4hA$|C9uj 苌ct2ƅ|$t t$m 4$b tA710h_#R|$t t$8 4$- ^_[]ÍD$jPV x!L$ȃtuuh"묁tlP PUh]"W 끉 ]5utD$P$uW$P$WZu t$V^SN pm2‰D$H9rHDQtD$=8c5t*wt$SV`R u D$<tQ?1Gj轕 S2 GL$G 1ɉO GO"t "Pv vvhzb#hLf2|6V$SWV։ϋY Wss ss҃ Dc5t~j Wss ssԅuA Dc5^_[ÐWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉmM- PQ4040<8<8D@D@LHLHTPyTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,4040<8<8D@D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7%Vw wV FwwVFwwVF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuSCuuSCu$u S$C EDȉCDu,u(S,C(E@ȉC@u4u0mS4C0EHȉCHudh&d#VŋFNd5tbSQP d5x 8e5~,=e5tffOfGG@ Չn,~$N()ǃ~$N(=8e59<$D$hP-8e5>N,ș)N,)n$F(teh&d#V$FNd5tbSQP d5HT$<L=e5tAf=e5t4f.<$ ^_[]c58e5F,)F$N($fOt@ c5븋D$L$t$ QPQPUSWV$$$ $$$(h͹#SV\1j nD$SVWUhPD؃r_4e5950e5rPSV Pt7=e5tf%]"=@tm"WQh$d Whb#T^_[]USWVP|$\$s s@=e5tf9uRe5t=c5t=d5tj:D$1PPPs sQs s6OLc53C Hc53K u 2&=e5tf%]"=@tm"Qhb#胣s s/)SUhb#m c5u =d5t:yj lhc#c5thd#m=c5uh$c#u=d5e5t7t;f5c5D$e5jhb#S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=e5tf=e5tGf]"@tm"Ph+c#/SVz.=c5t)1=d5L L hd#Ch5c#$p$l tRQf@ Lc5Hc5 1VW 2L$@D$DD$ t$|$ d5pt95e5tʋ d55e5T$Htt tɉL$LL$QPh?c#=c5uhWc#5152PPPjLc5Hc5  52RPjjt:d5=c5hd#D$L$ Lc5Hc55Lc5=Hc5 tYjj=d5He5tt,fI=e5tftfI=e5tfIfHVW51Lc5Hc59c5t-j i Lc5Hc5 djjQP Lc5Hc5 AQP=e5tf%=@5Lc55Hc58,$t$R=4e50e5 t# Fjj WSJ9ݹÉrFND$P9|$P$d닔$hjj RS )ˀ0^N9whc#訞hc#Ntf5Lc5Hc5152WWWjLc5Hc5 CRP52jj_h^c#hc#1c51P^_[]Ë$d#Hc5 Lc5$tҍt$PtV$lSUQP4$SUfH1G@u5Lc55Hc5h"SUu.$l#$pth"5Lc55Hc5SUq5Lc55Hc5H=d5e5fA=e5fh^c#c5hc#h"Pjj5Lc55Hc5D$DD$cM t$\$ VS@@PD$PQVSf@5Lc55Hc5tfA=e5tfA$l$p!fHG5Lc55Hc5qf@5Lc55Hc5SU5SUhc# t$p$phd#f =c5j eUSWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡd5@4 1WjPQWWRS 9=e5f2 8e5ff2=e5twf2 8e5ff2=e5tjf22f2=d5t2ȃ=e5t]D$ Yf2 8e5f2f2 8e5f2f22f2=d5t27D$ G UV=d5l$$tApQt=e5tRP跿A(=e5t1ҋ d5I4-d5teQRP d5xtt$V/11jWp =8e5=e5tf=8e5f2d5;x4})}jh2W =8e5E d5A49rE =e5t<$fGj \$l$u6_=e5tf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=e5tfUVfXW|$$Wf@t$$W=d5He5tt,fA=e5tftfA=e5tfAfH ^_[]UUSWV$$1Q 4e50e59;$$߃9։$PU$T$L1 B(B $BjZr1B$J$=d5pt$ =e5t ɋ=d5e5L$xtt tɋ=d55e51L$|1ɅDT t$t RP<58e5UVRPZ tE{[|$t}SWljUVSWZ)SWڻlj_{[ |$t]SW轻ljUVSW;Z)SW蕻lj?UVSWZ)Ӌ$xX#UVSWY)Ӌ$xX D$4PS $$W$VWVhPWV d51ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =e5t SW豺 d5L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =d5<$\$T$|$(t$,DpLtL|Dx=e5RSƹTtDpd5D$0X0vv蟹RP葹VFvv} RSlVFt|tx|$8RD$T$Rl$$D(D,=e5tFB\pTtd5B0FN FNDxD$L|׉L$L$؉D(MU =e5t]RQθ d5I0VP貸U EMhɡd5@0 ȃ=e5t3ȃ=e5EhD,t($d5@0MU EhEhD,=d5L$ tL$D$D$=d5,$\$ 1QOP\$  t19}#8@#pLp0l$$ d5ɋD$taVt$P= d5x4ƍ$58e5pS d5@0fPt$t$ d5x58e5SpQ 8e5=e5tf؋8e5f2d5B09}+^jh2S 8e5d5B0N9rF =d5tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL d5taPt$t$$ d5x=d5t$,|$(DxL|DpLt1҉TxT|FN=d5<$09e5QP1)RPVF^vv )RPL$(D,D(D,EM =e5\$QP輵 d5I0)RP蠵U EEhhȋ5d5N0 )ȃ=e5t^ȋ5d5T)FN^FV )S\$L$4$*5d5V0)EM Ehh )ЋL$Ev8QS c51Ą^_[]Éjh2p~ $Phod#k=c5thd#裶hd#߻F & d5@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(F ^nFD$hF$D$pFD$lFd5pt =e5tɡd5=e5L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=e5tf)9F=e5\$tAf)=e5t4f=e5t'fL$=e5fVT$Rt)f~T$JR>>fD>=d5tq1@1$CD$ƈCCEUL$ q/G9<$u1A=c5=e5\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=c5t Vt$t$Ut$h:d#U1Ƀȃ^_[]1A=c5t1=e5<$\$ HfUSWV $8$4}tE1ɉM4M019 d5‹DT 9 e5tRP]M$U(E$f M$E$U( u ^_[]%=uLId5(9‰|ǃ=c5t<|u=d5tFNFh1 td5tD$hVP  |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =e5t RP_ d5I0VQRP։D$D$ ЉT$t d5=d5Q8k=d5L$$tL$D$ =e5t QP d5#8t@DQL!!IT u‹$8U t#DT tE=e5t!RPzD t(=e5t1҉EU}@U=}@|$c5EM QPQPh$3WWhd#聇hd#'uQ{u u d5y0ƃ=d5e5t:tMPW詬?UUlCD$T$NQt PWo~V ~V hg#6e5d5@ 뛋5d5F8E -d5T$$tT$D$ =e5t RPv0 I)؉$ʉT$t*DT tZ=e5t RP譫$8D t6=e5tȋ$81҉AQSt$t$tv<$8}@ud<$D$|Wc5E$8I QPQPh$3UUhd#薅hd#<$<t7d5Ht)$|$-d5Cq qƃ=d5t0FV=e5|$$tJRP腪)RPw4FV =e5|$$t&RPU)RPG)FV )FV hg#e5d5@ USWV|$ \$t4e590e5aTc5 Pc5 ‹-d5t9ˉrux9ˉ\$؉jL$QWP:ց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$סd5t`v0WUL d5d5pxjV|$(WSTG)Љ Pc5Tc5=d5jVPS,G d5A^_[]WShe#d5@ USWV$׉ν# y@tnVՃ2v vv $<D$$8D$d5p0vv_ $G d5y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQP219rÃ=e5$t$ \$ti=d5t,ۉ~A1_t41T\$F9uۉ~1O ɋW @9uG W5e5萲t$ D$xG- d5;Xt|$#=d5t JًL B tmt$v vhg#hWWJWVt=d5t$$B1ɉL c5t$ $$Bt$ B Cd5;Xt`R5e5踱T$\$1ۃ=d5t%JًT tN=e5t#RPۥBt/=e5t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tbc5L$AI QPQPh$7W]Whd#hd#|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=d5t+FV=e5tGRP¤+D$RP貤1FV =e5t*RP藤+D$RP臤+D$ډFV +D$ډFV hg#Ne5d5@ 1@$5USWV\$41F~3|$0l$,|!$e5 e59|)S9у} ȃ^_[]Éދd5K89}=c5tOI.A!1‰9)=c5l$,|$0t!t$4PWUhd#Hd5PVWU Nj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=c5!$l$|$ T|$0tN# $ND$T$RPWUhe#G d5<$\Ttq!qIVPt$ Sh.e#QG$@l$19=c5tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUhNe#Fd5t$Shge#F1Al$,|$0USWVD$,\$( dc5`c5փσ5`c5=dc511 J lc59hc56 tc5pc5Xc59xc5@D$ xc5=d5\$jD$ PL$QT$R苬ց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =|c5c5tc58c5T$tc5‹D$ȉpc5tc5c5WUS5c55d5贬= e5l$$-pc5+l$(=d5|$`5c51VV=e5tf%=tjvdv`hVdF`vlvhTVlFht4:TCut4TCuG9a=c5t< d5(1c5SS=e5tf%=u1=d5u(x$CS =e5t RP聞9Ƹs& ɉ @u ɉ @uG9wt$t$t$5c55e5襬c51Ƀ=d5 Xc5^_[]PShe#awUSWVl$|$d5jVUW_< 1ƒ hc5lc5Tc5Pc5=`c5-dc5=pc5-tc5xc59c58#{H1ۃ=d5(=c5-c51|c5c5ډc5t@|c5 -c5=c5WhQ c5t^_[]UWhe#Tvhe#Jvc5t Pk c5USWV l$ =d51ɅDT =e5t RP腜 d5Y0މD$ʃQSRV  wÉD$4t,PZ 1ơd5$d5QPt$0t$0:$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ d5; d5u3P5d5c =d5t-d5d5d d5d5Qd54 ^_[]hf#\tSWV|$t$d5d5QPWVX9tH 1P1 t^_[WVh:f# tVd5tR d5~%d546h ;5d5s롬d5Ph 5d5h 1d5d5^SWV\$t$s sǃuG=e5tfL$%]"=@tm"RQh%t s s=c5tfhg#講He5Le5{@t1H1PPQQsHsDs su SW=d5t6hhe5WU -hQf#葠u7=c5{놹 Xe5s sd5H c5^_[WV|$t$ WVhWf##> C4e5950e50WVh`f#==c5t7=d5pt=e5tPU t 0h͹#'=d5pt=e5tPh%z==e5tfPhhf#Y==c5tqPhT"==1Ƀ=d5DT =e5t RPRPhqf#= =d5tF(F=e5tjP|tPh|f#<^_SWVD$H8=e5t3P PP0p4u'11C9}QBRQp=d5RMT$=e5HRP_9L$0ơd5@0 T$D$=d5D$0T$T$4=e5t$$t RPMt$t$$=e5tȋMD(d5@0T$,‹t$(΃=d5e5t+tMVR蘆uVFt$t$ 7KVRiMQ AD$:MQqD$T$AQ!EL$DT=e5t1ҋ d5q0RP耐 ƋL$ jWSQӃ=d5D$ t7~SPt$t$$oNjT=e5t RP軅|$)~SPt$t$$8=e5tȋ|$1҉\$$ t/f d5q0RPݏ xËD$L$ L$0|ád5@0 T$ʋL$ȃ=d5L$0T$D$t!D$4=e5t)PQD$ T$8=e5t@ɉL$ D$ =c5t h\i#X=d5t hzi#Xhi#X/=c5u hi#WX=c5u hi#W3=c5u hj#W6=c5u h%j#W<=d5t=c5u hDj#WT d5|$Y8֋T$  SP5De55@e55Le55He5h_j#Wd,$kdыd5@DWSQPD$T$iщډWSURjj RP/%RPt$t$t$t$t$VD$Phj#!$=c5 d5+0e5 4e5He5 Le5He5 Le5 tQPhj#  =c5-d5KC)s, @e5-De5Ջs4HS8\$ ډD$$+ e5$T$$e5 $ $ډ Љ @e5De5tRQhj# =d5t8hj#5d5tvvhk# 6j =d5t8hk#5d5tvvh;k#y 6j 15d55d55d595d5tmj蠢 d5405d5h QV艌 5d5Vʍ=e5td5PPҞ5d5zd5=e5t c5j d5y,t+d51TtRG d5 d5F;q,rd5PG d5=e5t =e5thBk#Sk51=d5=c5u hrk#S=e5t hk#SGRtgD$Ph$"{u1D$t)L$ jQPh$h$at-=c5u hk#S  ^_[]1USWVd5D$45d5~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B (e5l$9؉|5d5|$0G;~,$LHN4H~KT$މ)1@ (e59׋T$9|5d51҉t$L1FG- De5@e5Le5He59S,SދD$4HxL$HD$81ۋjV d5ׁ\Tډ\$tQ!QЃQ SPh@d5Ed55\d5|$D$Xt1NPSWUgʼnFظ|߃\$ <$w4Fd5<$t LX FuWFsT$ He5Le5$@=e5tfL$fAf|$l$$j ) hX d5d5T$ =c5t| $=e5t RPkRPh4n#l=c5gq$ʋT=e5t RPkWURPVhm#($DX=e5tPhn#c5hMn#Ehm#frT$ '|$@@u' T$t$SUt$A Pe5t$D$, F=d5=d5$@=e5tffu$@=e5tfft}SU{$@=e5t?f=e5t/ȃ=e5 $ApfAAt$f=e5t $ApfAA $AtfA1ɉ f5 f5 f5 f5l$T\$Xd5pt4$9 e5t ʡd5 e5$tt4$tʡd5 e51ɉ$dtX$t $D$LPt$衹=d5=d5t=c5u,$$@\=e5tȅSUhgn#C hn#,p~SUؾ19 e5t1ɉH\H`HdHhHl$f!B=d5,$(E\=e5tȅƄ$E\=e5tȋ d5I0H111҉,$L$ D$t ߋ d5Y8Om\=e5t͋ d5#8߉@DYL!!ÊIT u,$\$lD`Td t<=e5t RPgD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9d5H4 D$|$׉D$|$=d5t݋AQ=e5t-RPg!Eh=e5tȋt$|$1҉11 ˉl$$WVRPSUhn#uA=c5tho#hht#m|$t;SU蕼ƃ=d5D$|t1$=e5t RPsfFVc5=e5tȉFhܽ$|$jj$$$$SU z $A`Id=e5tEQPe $plphe1$D=e5tWUPVhm#  $AhQl D\$C5d5;^,T$$L$ f5f5׃ƃ=f55f5 d59˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-d5t$| ؋T$(tu3D$1 Kl$@؃,Ut$Ho- ƋD$9\$(s+l$ Uhl#>j/SWUt$@hl#hm#m=j[sUSWV |$ ow@u Xw VUp D$t|VUh4u#w wf5 f5ʃǃf5=f5|$ |:w whl#= =c5hm#qjG $D$|$tjVU¾ (e5<)1CVUhs#D$,p p*f5 f5ʃǃf5=f5 j C hp d5tHd5 d59tDy1Y1 t 9u,@e5De5$|$ ,d5d5Q1I1 ы|$ td5$G0W4L$Aڃ]D$ p phm#J< =c5t)hn#c1C+c5h)m#;hm#h1Ct ؃ ^_[]c5jpjZfUSWVP$T$1B@BY1 d5f5d5x,11=Te5t>Q:d5x,$kd1PWSQho#hLf2Te5d51ۃVU聶tzljl$ t$d5pt=e5tʡd5 e51ɉT$HtttȉD$LVUz8tD$PWbu(Cd5;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$f5ŅtTM1ًU1 u3VShs#w wf5HPUMpXf5 d59tmu1 d5ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $U&ho#F9hc#eh-p#ejj聴=d5e5f@=e5fhE6+5d5=d5kdPWVQho#hLf2Te5uF$ho#vv 躑 8e5A1ڍF$h-p#cvv 6ǃ=d5F$ e5&jP\1 8e5I F NQPQPhSt=d5F$ 8e5t%QjPShq#ho#>6#c5QjPShq#ho#36=c5thd#k]=c51F$8e5 I1)щN$uh$c#b-vv *ǃ=d5F$ e5$Wt jP[1҉GW1҉GW }hjD$\Pv =d5e5D$tt7fD$T@jv$Z-fD$T@jv$ZfD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=d5$tD$\=e5tL$Lu$D$PD$PD$XPyTe5;,$/c5$W=e5ve55d5;4$]|$T{$AhjWV -d5=e5tt0fD$T@js$X&tPfD$T@js$tXFfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=d5$|$TtD$\=e5tD$L$|$TtD$\D$PD$PW٧;4$=d5;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h1p#ss QPTh-p#(^t~s sqf@fNCKK CQPh"ss oOCK =c5thp#ss QPCKh"QPss fN c5;<$=d5d54~^1ۋ/uu q]]8u9rۋ=d5/CK tS  StQP HKX9rjj轄`^_[]c5j&ejPho#/L$D$@, +A,USWV $0 n8$=d5ui=d5t`E=e5tȅtNE=e5t$;0e54e5s&E=e5tjPo@E$F0N4 utEh%P)$0 F=e5tȍL$A=d5AAhh%Q d5 e5tD$D$L$L$D$h{p#v v薉 E=e5tfM9v%}EPhp#.p#hp#4[4/E=e5f)=e5f=e5fEtf=e5t΋$0 AI 1 hKp#QP辈 h-p#Z$0 F=e5tȉE$p#PpZEL$fAWQUe $)fEPUVe =e5tfD$fXWPUte $0 G0W4w wmfH$Xc5$0 =d5t>}t8hdp#v v贇 h-p#Yu EBc5F0N411G9 v vGD$@=e5tȍL$A=d5AAhh"Q[ e5 d5 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=e5t2f)=e5t%ffD$=e5ffe5 )fD$1fM$0 A0Q4MT$ tjQkfHD$=e5tfPjU膯 D$fEutEh"Pl$L$Aq $0 JR ωtljhp#RQUW݅l$EMك9v%}EPhq#*(q#hp#qWD$$0 T$ 3F0V4=c5h r#QڃD$=e5t΋D$p@ =d5X}$0 ~hp#v vڄ Eh-p#VJc5Bp#$0 1GPVtXD$T$ F0V4=c5h r#QڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUVOa D$fXSPU)"=d5kdPWVQhr#hLf2Te5}ww cO W $T$ WGO ƀÄ:1=c5t4=e5t+=d5t"uGO 1F9ƺw1 tbQPc8uS=Pe5xJ1v6KNj@ $GD$wOG tQPb8u E;-Pe5|E;-Pe5=4$h;r#b"h5c#ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$Dd5pt =e5t ɡd5-e5L$Ltt tȉ݉D$PD$PRmu hbr#!D$TPv6t$t$~tyD$ o v6ΜL$QPt4t$t$af@jw wt$t$~t Lc5Hc51JQPFafpd59)T^_[]fUSWVT1ۍT$1BcM d5x,@=Te5t;d5p,kd1PVSQhr#hLf2Te5d5 d5<\$11ۃVU衛VUm`$t$l$ d5pt<=e5tϋ d5e51҉|$Ltt<8tϋ d5e51҉|$PdtX 8Džtɋ$L$HQ$U&xtCVU誓tV=c5VUhr#^1=d5L L tOjhs#sd5tuQ1y1 t6 u_VUYdtl=c5tHVUhr#7jhs#$PxyQ d5P jhb#D$P Cd5L$;JWD$ Pd5d5tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$ d5ZRJB$V$S c5tdu`jVp  c5Jh0 PVhnv#P0 PVhv#z 1Ĥ^_[]ád5u"$T$TQRjPVDt|$\=d5=d51Ae]Džt<$d5\Tu nt1d5!=c5g5hw#jVG e5c5 g5Vhv#k1=c5=c5=c5$L$ PQj5d5SCuSh#d$$8ffs1$8j h1|#VV  VSh=# BVh 0#F-u hx#*ld5 h P5d50 5d55d52=e5td5PP"C5d5,d51=c5td5PhAx#d5tZ e5u6t2=g5u!=c5rx#t$#PhMx#41OB c5uhwx#d58< $e5 e5B,0e54e5J0T$RtI,T$T$ ,$ȋl$L$ ݋,$߉Nu݉|$,$ d5c5u@,$\$D$=c5hx#?,$\$`L$(l$85d5F4$*T$ l$\T$11|1ۉ‰CwD$FD$ FD$nV8<8D$ d5|$T$D$DSh#hx#"ed51XǀPh P5d5. 5d55d5S/95e5td5PP\@5d5fd5 d5c5 d5=c5thx# Shh#hy#"d5PP.=d51@L1XP\hhPy hd5W76h 5d55d5, 5d55d5-.95e5td5PP6?5d5@d5d5 Ph'y#uhQf#!udd5  h P5d5X, 5d55d5-=e5td5PP>5d5d5d5hJy#hoy# udd5ǀh P5d5+ 5d55d5,=e5td5PP>5d5d5d5@ d5HHщ8<=c5thn#]=c5uh-p#u_h 5d55d5$ 5d55d5&=e5td5PP75d5'd5d5d5ǀ,04ǀ(<HHPLщ8<҉@Dh P5d5! 5d55d5"=e5td5PP45d5d5 <:PVQB D>/|)Ot$L$6m52m5$!D$h8Jm5$ D$tB?JL$h)PRQSWVD$t$ 4e5950e5r==d5 d5jSPV)޹294v t^_[PVh`#CWV|$ wu$(V&1XD$@uPw w Ph $*=c5th3#bh<#t ^_PhD#趽Te5USWV$\TM@$ 5uh`輡h`VPm =c5t h?#= e51ۃL뀃=e5t\,L$UPQfB DPPz$\, e5L$L$UPQ4B |$u $PP@1LDffLD@9u=e5t8PP\e5L$UQPA t"PP\L$UQPA  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h#(USWV\$t$=d5!ߋ,t9Xt6@u|$t&jNt1ɉH HHXh1^_[]h#VD$ L$5d5#p9tыR9u @^USWVt$|$VW/d5!t7^Fu+11 33 1u{ d5tqt$0|$,\$(l$$T$m5t9PtjRQ m5(Xxp L$ m5t9HtjQ5d5 m5(Xxp ^_[]WV d51!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$X&$1Aȋ$sY9UV&J: Ou\$ |E tÉ\$D$D$ D$|$$D$ PS1@$D$hh SdT ƅ%D$ PV< D$3D$ 3|$$  D$uH$0PS$8$P$TRPVD VT D$4@D$1$Vh#jSyVjSS ƅxc1GD$ PhFV3  P8u;VGT Wh#jSFyjjSIS Gy HPD$t P蝣<$t t$貊1Ox VS e^_[]D$(%= tn=@u$0ShӃ#hPxSuƉ\$1@$D$:\$ D$ PS脿B$D$jS_R }tStN$PhF|@V2 x4D$t P蒢U$$JhF VX2$USWVP1hUU= ƉRP)9-e5t1@fCM+PUUSF d5;A0u $ytWVC^_[]Ë\$-d55e5SUqRPX$@ `d5ؔؐh P5d5 5d55d5 =e5td5PP5d5d5[USWVt$(~Ohole5tUQՉ 1=d5L$$t| tWVƉt$$H$ád5@05e5QPWVsUC cMhml=e5tUQ(Ջt$( }d5@0ˉ9Éʉ\$4$rQPUt$xpLPDTGlOh|$ wL$,=e5tȋ|$d51ɉSh#=c5thd#0hWc#lt$" d5QP#T$1RQQD$P1Aád5;X0t$~~1Ƀ=d5T$DT =e5|$t RPL$ pL$QSRP6ǍP:m5$|$1D$D$t1)ÉعF@jP訔D`r9w<$r$l$T1C @<$9uG<$;|$}d5X0l$ot$|$oh\$ىh$ PU -l$($|$ t$ t31T$ph$ WP $@$9|$|$|$(1L$t1ɡd5@0)ȃ`T$1ۡm5ـ#h@#b=c5thn#h-p# ع`֋,$L$t1ɉȉD$ օt$ tH d5i0T$,RQUt$> d5;A0l$,} $L$l$l$,d5@0D$Mt$ |1TT1PD$T$ ʃ=e5t RPL$(ωQM D$H 9tet$C9\$t$$hX# c54$F4$;t$SD$`1c50^_[]ËL$ ʋ d5f9u Sh#褤D$`,t$$h!#ljg d5Ph#CUSWVT$L$D$0(D$ X=e5tSUʼnӉ OD$$d5@09ʼn} t$t$5D$PSUt$< d5;A0 t$~QPSUIr~t$4SUWt$T$LtL$A L$ Q5e5t9RPt$ƉT$ t$1ӋT$1 t<$G RQD11 u5\$$9t ;D$t`GPD$ GPWTt RPf$<$G L$;L$t9ta щʼn$;D$t`1h#辢^_[]USWV d5$d5x0UWt$0t$0Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PRE m5T$4$1B srl$,$ ȈU1wX=e5t d5!9GX=e5tȋL$,1Ph"#蚡 m5L$ $  h #y=c5thn#h-p#t$D$OPWTP1GTGP^_[]c51USWV|$,u#tu#d51@$d5sll$d5td5 L$  ƍD$1PQQVK9 d5;A0-T$zu D$`1]l$z$Ń1EGpD$h D$ Pt$ u&xMt(T$h D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWhs#џ=c5th# h#Et3s ss3st$Vn[E;,$uc57$tu"Ph!#0jbUSWV0\$T|$HOX=e5t1D$,D$(D$$D$ D$D$PL$Qs tPst$OGe5҉L$D$td$PQÉ׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQ.C;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h#;'h1#h#h h'#-rPhq#R]O4$V0Vh #h#h h#hۇ#hWVt$ F,t@m5th(#誹F,P1~,>d9~8uv0^_hG#h^#h h'#qqD$x,u@Pt P賅髅hq#h_#h h'#9qWV΋I01t*N8~2IN8tPQP P`N0G;~4vɃ~8u^_h1#h#h, h'#phG#h#h2 USWVEH1Bx,T$1hktM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vSye^_[]hr#h#hF h'#oUSWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]h#h#hK h'#nUSWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]hr#h#h` h#h#ha h'#QnUSWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]hr#hɇ#hq h#hɇ#hs h'#wmUSWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]h#h#h~ h'#lfUSWV\$$|$ l$t$m5t5e5SWUhA#WUSWV5e5 1^_[]USWV\$$|$ l$t$m5t5d5SWUhr#WUSWV5d51^_[]V=c5th#Œ2j5m5Htah׉#腌hm#+tSm5xL~61 m5 s"@Pt4h#V m5m5F;pL|^5m5vjOm5t'x,tPm5Pm5ám5t x,tt$t$t$t$P1WVt$|$ VW=d5dtX=e5ts,d5`uau33 u1@1^_WV c5t1 m5 d51!`u/aʀs2hlpx1Ph$#ԊPhZ#hm#gJh?#蹊d5 ǀdƀah P5d5 5d55d5=e5td5PP5d5Ѱd5d5!1111QWRPjhm5hhv#hm#艶lh?#ۉd5 ǀdh P5d5 5d55d5=e5td5PP5d5d5 d5dPs+aʀu PhZ#Ph#hm#蟵h#d5ǀdƀah P5d5 5d55d5=e5td5PP 5d5d5^_jKUSWV1L$ AL$HAL$@AL$<L$ h&L$A h&Ah&Ah&]u }h#SV^ ka~(bt@it YltAsttuJD$PW,5uVPD$DPD$DPD$,PW(D$HPWC# D$ PW$uhX&jƉe^_[]Ãu95_2ujhh&D$Pe u1PPD$Pje95_2t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQƶRPt$8t$@t$8t$@W1u2h#R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]S^kt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ S t$\D$Phe"hV^D$@w ww7VPh#S 1ht#+hƋ#WfUSWV1L$(AL$$t$@L$ D$ }] hL#WSZ aLuKVbtit'cD$ Pu D$(Pu3 D$$Pu udt AuZD$ 9_2u~]#D1غ$Phzd@ tN|$$tOhY&j[t$ vt$@v1Oe^_[]hY&j'11J$THPT$,L$(HL$x1VVVVV]PeT$4 @T$ƋD$(D$8D$,D$4D$$D$$\$S)TjPjt$ t$jjW: X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPNDE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q  H @AQ@A$Q @QHALh #SXh2#hR#USWVP\$|$tus$! $ "$jQtQ1@PVSjPt$8t$8W E1u>4$h#W VHXSh_#W4$hz#W 1H^_[]UWV} uOʃ$;|RQPht#VJPR x& $T$W1ٹ|$5$;h# 5$;hL"VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhh&Vt 1OujV5$;>uW?,VQ>~Ih#Q1$VQ7 t1Ph#Qx 1O^_SWVP|$1N?u;j S5$;qG 8u1u5$;hL"t$ ^_[WV|$1N?t5$; 1t^_hE#t$USWV 1O1;B։ˍD$ j P5$;H уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5$;Tx(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,"jhh&t$wq$ tjVt$]q$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0wh˒#VIz1t^_[]1;BB  Fjhh&Pp 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hے#W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Ph#Q 1HUSWVt$|$ t)l$\$$jWUS, tWUSh"#1h#V*l$(\$$jWUS, tWUSh[#V1H^_[]Ã|jWUS 11USWV\$1s3hJ%5$; t^1W]&FtuWh#t$ 1N]&]& ChJ%jV Džu^_[]WV|$ ]&]&Wh#'u^_USWV t$@\$D$ $t|$$L$|$t$,t$4RQ L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh_#P%1D$Bh_# D$_$ӃD$DL$H(X,EP!t$@E X,L$H(u4$t$w7t$Hh#u1fUSWVPM(,|$8O] D$1h#uS sujsWVVuutqD$9_21t$ t h#hǍ# 1A AAt$Qhe"hVVh#h$#h2#/Ĕhk#|$uhusuqVhu#ohۍ#uuulha#a#tc"PRh$Ĝ;8jmWj$VzVhe"hWWh#tĐ^_[]USWV΋\$$|$ ʉl$͍L$jj hc"UPjQ yD$SWVhɢ#|$tUh#j  ^_[]USWVDt$`l$\\$XT$1 󫡨h&A h&Ah&Ah&B0j#` hw#VU k)Hw]r$uStJPSu7HsutPD$PS uhf&jD^_[]1Hu߅tjhh&D$P8 t9-_2uPhDD$PS벃luh%1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uh#SW a~bt)iuRt7D$PV"uUt$D$PVtD$PV8uhf&jռe^_[]Ãluh%1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=_2d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H Hn5H Dn5@@n5 u$L$4fL$fB$Ph#S $Ph#S t$( Åt$( $fǀU1PPPEX!ƒ[u$t$" ;$4t$8j D$t$R fËt$01 |$lD$Ph(%S D$lPt$WD$Ph##S D$|Pt$#$Ph$S `$PhwQ$S B$PhIi"S $D$Ph$$S2 tj$$Pt$ 蛔 D$DPh#SE D$D9M$ $ȃhL$pQP* t$ Åt$ U$61QQPi!ƒ~t$ M$$VP- 9U]$|$$D$jRP !ƒ=M$$VPԮ 9E$1SP|$W GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$\$uoh#D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$ K E0t!t+M4S9rQSP% 0t,h# MHtU4uL9rRQP~ t$|$t%u@uhV=~ tIњ81tSul|$tDEM9rQWP~ u@u`V} u@yu@u`V} teEptUt$8ЃtEu8uXV} t, ^_[]h]#h9#Ah]#h#5h]#hv#)u\u\h׭#udSh#jr wlh $j蓪 fUSWVt$G 1tvt$_I t[S萉 tCPS Vt$K tPUWL uW6 S草 1S耉 WG ^_[]USWVu]Ph}#Sj t$f1j?1Nt}ǍD$ Ph#S td\$ t\hjD$P| jS\$S ShiW"| t$E L$Uf jQh}#P je^_[]PPh#t$ u1$YVPt$ t$t$V tPh#V u1$^USWVt$t$H t Nj\$ Pc 9v? 1N*Ƌl$Wc VPU{ )SjUn{ ^_[]USWVt$t$H t?Nj\$ Ppc 9s9Ƌl$Wc VPUr{ )SjU{ X K?1N^_[]UPhRn"ur t$1H]USWV@uPhޭ#V7 ] hH#VG tPb |$ P\$$ShiV\@ |$ jSa PhH#u I V ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP` t!PhH#S9I V辁 1He^_[]hr$hE#hh#WV|$$hH#WF t;Pa u1Va jPVy VhiWQ? t^_hR#hB#jVh#ht#j Vtn5h2V V |n5hvV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh#hV>tVhٮ#VyFߋD$t$j7QPh#hV>tVh#譾V4F߁^UVuPh#V t3$L$ AQhiV= u h#wA1e^]hr$h#hht#UVuPh8#V t3$L$ AQhiVe= u h<#A1e^]hr$h3#hht#UWV}W#ƉPh4#W tZt4$P<tW@PV] tGPhŵ#u #F t>V_1e^_]hr$hG#hht#h#hG#hV# hG#hp#jM h#t$C tPhŵ#t$E Hh%h#hht#xWVPt$|$D$PVW tKD$tUhl#WC tPhl#VDE H^_h%h͵#hht#h͵#hv#j荢 h#jQ SWV$hʱ#SB t]P] GAsdWt^WPhʱ#StNpxPhiS3; u?V1]1HĐ^_[h#h˶#h#j蠡 h!#jġ USWV 1CCj7Shxi PYt uh>#?,$PuhW##Ɖl$D$Shxi Wt u h}#jD $L$9~D$~*1t j Sh $貺G;|$|j 边Vj{USWVH v&D$@v&D$<v&D$85 t5u#D$1D$11D$=t5D$(Pju h#|$T$(L$,T$։L$ ȉƒ\$06eĉL$T$|$|$ɚ; t$D$\$=t5u11D$\$W|$|$ |$|$|$ |$ ʚ;||$t$ L$ӋD$D$t$\$\$Ë|$t$ D$$Pu h5#j莟 t$ D$D$t$$1|$\$F = 2@O9t uGtMF L$u@T$(\$,T$ 3T$3L$ u L$9L$0 L$9L$ \$ \$} VЃuGt^VЃtTjD$ t-P,Y fxPV5t'Pf1^_h%h#hht#h#jp WVPt$|$D$PVW\ tTh#W= t)T$#tŵ#PQV? H^_h%hܵ#hht#mhܵ#hv#j SWV\$,h#S= t`P X GWt\WPh#STtL@xpPhiS5 t5V@1ˋ1H^_[h#h#j h#j< USWV8}D$Ph#W u \$Sc1OtjL$D$ x L$, D$0!1҉ƒt$u !L$,T$ !D$0j SU t$Ph-#V"> D$Sv |$Oe^_[]hr$h#hfht#USWVuPhį#V tg|$ WhiVO4 t$L$x f D$1H01҉ʉ$T$Hf!D$WhiV4 1؍e^_[]hr$h#h0ht#2UVuPh˯#VW t,jt$V 4 1u"h#h $I7 ω1He^]WVPt$V't&ǍD$Pt$V> u Wh.#j& P詬D$L$AËD$L$AËD$L$AËD$L$AËD$ 2 21ËD$ 2 21ËD$ 2 21ËD$ 2 21ËD$H@ 2 21SV\$ Sh 2HuCЃ r"CrCr 胈01H^[h 2A|H?r a ؈ 21ыL$t s51ÍAЃ r)Aw AwÉ 1HUSWV1t$ D$hVPk 2xs5t8u^s5ǁs5s5s5s5s5s5s5s5s5s5s5s5s5@wh 2R&uh#0h 29&uhӴ#ht 2 &u h#j蠗 $5 2tvh2%61t5t5t52tt 2$h 2$U ƃV B~>CNt5F v/FwD$l& t5Au"h #Q$l&t5xu>Wu4D$P1VhVVj V5$;-U t59t$:*ƀs5l `C Lvms 22u$2t5t5rt5 t5D$P1VhVVj V5$;XT t59t$taYt5>t5O t5CatTl5$2+wtz29t 2 2$ÿ2؉$2_2 t5$u = t5uB=s5=t5=t5u|t = t5u =s5uftu^ t5uS$ttH)ŋ$L$ T$ RQL$QWPU%u/ u&h~!h#,5$;h ^%j t$PD$P & u h7#D$t,DtVPyDžuh~!hD#JW WtS)uh~!h9#Wuh~!h# 2t H9t@h~!h`#$@ t%VWЃ$Wj٥hҰ#h~!h*ht#USWV-. uh#h#j Ƹ 2jmPlBc"c"t#jL 2PIBt#USWh#hLf2K 2t VSm##uc"WWWWWQWh#hLf2$V|m jV 21tT$q9t Iu^WVΉhjW3e D$Ph#V` tZhoc$V>2 tQPaM L$PyRPQ3e WhiV* u h##.Ĕ^_h%h#hht#WV h-#Q1 t;PL  u1WL j PWd Whui V^* t ^_h#h#hiht#芿h3#j hݱ#d1ÃD$ 1ɉJJJ JJ BRhiP) t1h#j赐 $1ɉJJRhiP) u 1Đh!#jv Qh 2?USWV΅t R- + + 0($D$P^!\$D$1t$$tsVwsD$tVPwVh#W trC=t5D$uCt\=t5uCuM= t5uCt>= t5uLhj$Vpb VhiWn( t!$uۋt$$4u=t5t ~ j ѧhe2sEWt& 2ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhu#h$VVUh# jl$U$V胷 Vhit$` t$,$t!Ph#蠧Vh#*,$jt$V. Vh~it$` t$tPh#Nj dꍄ$P$$ j:QPh4#h$P$t'$Uh#ҦUYpE}uj:$$h4#h$P薺$t'$Uh̳#wUoE}u- 24$tVWUmuj|$W$V $$ DŽ$@Vhit$V$_ u$ hٳ#1@Pl$U%jWl$0U{ 1@D$81D$#j‡ h5#Fh"h9#:h"hg#.h"h&#"h#h#=t5#t=#Pj螇 USWV Ӊ΋|$4h-#Q' tPB 1EUhvi Vv j U5A Ph-#S) V9b H ^_[]VD$tLc"t$jj QPRjVf@ V @#uzc"PVh#g-у c"t@#QhVs"PRh "h#8 ^WVΉhjWY WhiV tD$Ĕ^_ÐSWV$h`}$Vi& u6h #VW& u$hY#VE& uh#V3& tDt5 t5=t5!lj=t5hjSX {Sh7iV t Đ^_[hd#j蒅 Vt$VWPh $tVȡtPhq#t$V t%L$ PQh$Ҟ VJ%uߋD$=rPhz#褞^USWV$WW1ɃtQÉ1 jVU Uh8i(SPW D$ sjPsQƉD$$Uh8i(SW :t$讟PhŹ#Нh$t$D$;D$t(h$訝h$t$ ej)譜j 補\$#|$h#`1Aw&9xu H uhX%3t$(hjVV Vhi$ St$<\$8h#ߜ-#v&Qt8u 9A uVh)#觜 Vh#j1#X4hc"h$x j 莛jmtz D$ ~[11ۋ!9uIuUPhѹ#&h#h#4j D$ 1AC9|M rVļ^_[]Ph#$h#h9#h!h# h#h#j Vjmu t5hVV2^h#j輁 hLf2jjHhA#2UVuU OPh#V0 t!#t5 $ t51e^]hr$h#hh)#误USWV(ӉQtoh#UZ! tt5H1 Rh8i(U u Fp8uIjh#S4 t)D$t5t(^_[]h#Vh˺#jt h#h#h#j茀 SWVt$T$;h`}$V t\Ƌt5P; V; PWt+Ɖ߁PWMt2 Ét511H^_[hO%hݺ#hh)#ch#WV֋|$ QGVWPh#j WVPt$T$th #V tkP ; V: PWt>ƉPV5t5 ǣt5V%1u t5$hcE#Z1H^_hO%h#hh)#荭WVPt$T$hY#V@ tbPa: V&: PWtIƉPV5t5T ǣt5V}1u! t5$hcE#m1H^_USWVt$T$1h#V thƋ-t5P9 V9 PW{t6ƉPWӛt>V ݉-t511H^_[]hO%h#h2h)#Mh"fSWV|$ tm1H>t$|$\$j/B PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V7 tE$$PwCt/$F ~G F1Gl :l 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QPQ Ɖ׃с11E9r k8"t$8tk1H^_[];sC| C 9s} }k"WV t/t$ L$Ps(,tD$$F ^C F13k USWVuD$ tV} ]CtP7 tEC tP7 u/D$ PhRn"7 u$D$1$j1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$Vt|$,$hJ%W%D$o%tD$1{tj/t$討tAL$L$4yyyyy D$AAD$ PQt$ t$ (tsË|$D$4t'u#D$XPt$D$4D$4D$ PD$8Pt$ t$ 跞ÅuD$ x+i1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxrh1X \$TfD$t7|$0j WP t9t1ۉD$=r;h"11HD$$P芻|$1OL$L$D$L$T$PQRh#V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P&NjD$fVSPK sD$ t P*4$W1 W\<4$uM S]s {te|$t^t$Vt$t_@PW1 WtNVsE0 ߉VuR ۉt3EF ^C F1Vt$h#h#h#hV# h#hp#jv WVt$tVYre1H^_V2 t3t$L$|$ Pwt΋D$F ~G F1e USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'sd<$t@1@>]d.1-t PO 1GG GG-d1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7a t+{0t>-uUs[t>Vs[t)uDc 7c1H^_[]Ís s(CtP7 uCtP7 t1@뿋C$1$@x&4v6 !6* P7  v6 tMtk $t$ 4$UQ WhKiVb l$(EPƀ}u jU8 $GL$$*SjQhRPUu jW $L$ $+SjQhUPW1f|$0t,L$f|$ 0t,D$ t.#L$ T$QUR$6QPh#, ^_[]hLf2jj7h#jhIit$  t1h#jj WVt$ H 29tEtt$t^h#D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh2#j)] L1Hx^_[]h#h#j\ WV0t$<|$jWhJ#V萴t8W t7HfJBRhiV t!10^_h&#h#Wh1#j[\ hb#j\ SWV\t5h 2VSdt5h 2W@VgW^lt5hV3tt5h*W|t5h+SVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UWv. Whi$ U $!h8#t$HQPۍ\$4|$fGWhiU t$?#f|$*uI#=t5t PftfD$(WhiU t$R#f|$*u\#=t5t P't|$fG WhiU t2D$*=) Phg#s=t5t ho#sfD$(IWhiU> t2D$*=) Phu#s=t5t h~#s1Shi8U |$Dh#Os1tPDL@uShi8U t$HuM1|TuD@uD$L|Cpm2L$P9Dzty:t|$jQh#nO uVh#r11t j,qDLxPtT h#rv<u h-#hrj ~q$PhiU tDh#6r$t$h#r h" rj qPhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR襹 Ph#q$=tPh#zqj p$=tPh#Qq^_[]Ph#jfW hLf2jhh#ÃD$1ɉJJ JJ fBRhiPm t1hb#j6W 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h2#jV USWV,$@$PhiV tr$A jjj" xgljj2 xi$-hSW}H xB$/uE$0uf$Ciu.h# 1H h#hھ#WAI 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'hA#h?$h=#h8#h#hl#hr#QL$4Qh#n(D$f($-D$](E!L$:!PS E P蠶 $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q t5t t5Et5tIAtcAtCAtPA tSA@tBAyAAT$ht5UWt$PVt$D$VPRRhF#sm,l$ }"E!Ê<)\<$y&=t5`Cs|$[VPWl$Phq#h#m#<*<0<2=t5<$w#<t~#sQh $lҤ"1L;c"y#QRPhf"~lGJ%9u<]K%C=Ph#h $8l=t5S<$CPh߿#lKPh#lK s k t?L$D$F#PWh$k N[%܋L$D$(Mu} L$D$D$F#PtPtPu.## !#I"QPh$7k N[%D$ŋL$D$(ȉ</=t5%<C<$y&#=t5CPh#=t5CKSRQPh#hĿ#jC~@sFNuQPhؿ#Uj IRQPhο#=jMuj>Mil$ L=t5?CPh#j(sh#h $i=t5<$CPh߿#iKPh#iCk tAt$D$x#\PVh$~i O[%܋D$t$)E}twt$D$p#ttu.## !#I"QPh$i N[%D$<t$)ƃl$ rPh#hj>g<$€#$y&#rQ=PuJC<u;h#h $^h=t5yCKQPh8#:h ]=t5Pȹ#6<"<'## ######## ###h#h $ug=t5<$CPh]#Sg1D3 c"t#T3 ׃l3 URWPQ}&hk#guj>fl$ <-#"#CPCHÃ)gj eEŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]h#h#j%L WVD$(1www ww7fWfGfGwWhiQ6 uh#1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQ  ;l$D$tD...P.^_[]Wh#Qc  1<$tɍGrD$X1.Phz"S E;,$sGwUSWV։ϋ\$Qh $dWL.)Ǎ 9~)jsc^_[]ø wL~&øI"øSwd~&øI"VPt$ D$Ph#V[ tD$P^hr$h#hhB#xVPt$ D$PhS#V tD$P^hr$h#hhB#GxWVt$(|$WhiV tgD$Ph#V覊 t7D$D$WhiV 1uh#D1H^_hr$h#hhB#wh#jCI fUSWV8[ y hy#hF$I/ y h#jh#gt\L$jQPo D$tPh#jh#Qg D 2>1 VPhB  VPUSWQRPh_`$1EVRQUhBVWh. 1H\$(C CCVWPPUPP P P PPPPS8VSj8 |$www wwVWj?. VWj3. V: S: W: D$ @ )T$VVQRWP<1I9u 68tމ5t5 D 2tщ1@8^_[]h#j U-jj[ h#\ u8#jVket#jh)#h#Vh!h{$胷 j ,j ,USWV`~ZD$=t5tIt@ƍD$H@ L$1jQRRjP>ut$Vh#< 1t$HFFF FF1G>\$SVj, l$ UVW, ƅZD 21OjUjN t:9uB$=h#jV8  48uh D 29tttn1VSj, VD$$Pj+ D 2vhJ#@jjj 1VSj+ VU6hy#1=D 2u$=|$ u'1VSj+ VWj{+ >`^_[]Ét҃t̓ u1Ht$8F FFV5 Ph#u1#WVct#D$8x xx8WPV`5 !{jh#h:*#| {$SWB Wh&#j VQ*SWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSPW* $H $u˃^_[át5H t5t$Vt$V"Ph#ijN V)D 2VPD$$Ht5t$ I?rj2$ !P$Ѕuσ^PD$L$ $QPjڟ 諟XWV1N=t5tED$@ L$1҉RRQWjP萜t4$ h#^_VQ6 jh|~&4 jV4 tP1]t^VhN#>j(Vh`#)jm(PD$L$ $QPj ɞXPD$L$ $QPjٞ 語j XÐUSWV$$D$D$D$,1H$11D$h#WS2g f~/P w`1A$~&5$; D$u[FtR=5$;D$,D$낃g$;8#u(@j L$ QP $D$8L$;Pk@$)$;8#u)@j L$ QP1 D$D$8$;L$QP j D$ P5$; D$D$8c1Fj D$ P5$; $D$85$;h#8_2<=t5u-t5~q5t51ۋtVPG'uJVh $%YFtPh#YFtPh#Xj X-t5C 9|?,u)É\$(k <D$jdP D$PWP Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0-1ɉQD$ P4q D4D$8u -8tz`Xt$7t5u t5-t5CPV%t Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP jxN |$tt$ VUWbP  UW1 F,8C|$$8D$@PW藜tD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWkft!t$ VUWO #|$$tS9u$UW1 RW2 $D$utSPW2 uWh#1ļ^_[]Ë pm2DQuP==N|45$;K1@D$5$;Fp1@D$5$;L$ 1@D$_2H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ ztuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ W#W@$N|dže^_[]hg("j t$h`1$臵Ph#hLf2W6 jM-WVPt$jWVZ 9u9t x^_Vt$h*"jQ Vt$VwEt@^hu"V^Vt$VsJt@^h7$V|^WVPt$jWVѷ 9t9u x^_Vh*"j WVt$|$ VWp t$?/tWhb)"DSVh{)"6S^_WhM)"j fWVt$ |$7_ WV1^_USWVp|$o$o\$WVUS$$jHSuWh$, uI8KD$  = v5%D$ Vt$S jHSt$D$@D$ $p QPh܊&hV SD$tS\$O$oj j ShWt$ P-tP<Ph #Qt$ SWh0#2t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@hO#181p^_[]WVh3*"j j*SWV\$D$@u+t$蔱t;SP t7VZ1 u5Cu5C^_[hp"j j/*USWVPL$$T$ l$\$1$1 2֍zh=#US)= @~7M$\&OӃ23=v5 v5먀'룋 $;DF@N@늋 $;IF(NnOe $;R2KF ? 20O' $;aF8N v5O $;g\PD$ p4t$ N @OPt$(h<&5$;7Ƌ$t v5t'tOt@tO t=v5 v5 s= v5v5g@tOy  2sg st1A T$ J shu"V5$v5$fyh$Vg5L$ A$I$she#VE5L$ A I$shk#V#5L$ A$I$sht#V5L$ A#'<1H ^_[]fUSWVd$xj[Vhlv5 j@V蛼t4$Fj:V!A $$|1D$hhhhh hh(K H|$WPh$V1tP1PVh#F #CD$D$ @4$D$ UhD$PX D$,$Uj$lS@ VW9rȉ$`WVSf jD$PW$lPjt$hD$(P t.2,$AuU= v5uLD$D$ 1@D$ $t)ɋ,$t;|$ hd#D1(v5$,v5,$ $v5D$ @tL$L$fQP$|BDlv5D$ HJ@BB,v5u,v5ȉBB B b1Ed^_[]fUSWVUE1ɉHHH1F0HHH HD$ 5;5_2\$ \$(%\$$} ]D$,D$D$D$D$ D$h#WS/ H$&P5$; 3$L$T$,Jjuh&5$;+P<+뇉=$;jh#W t5jh#W~ tZPW $T$D$0PW D$0t 8D$ D$(JD$0PW D$0t 8D$ vD$$c5%$T$$MA QD$5$;D$o5$;D$1@D$Q5$;tD$ 1@D$35_2)h4u }WtD$0PWig|$L$T$t$ ut$HEpD$tT$LEP|$uL$8EHe^_[]]5$;h#hg(" 5$;h#j Wh#PWh#WhC# PWh#j< Wh#Phv#hLf2" jSWV$t$$$$\$VPWS$H$HTj S7Vh!A D$@t$h#| t$t$h*#g  t$ t$ h:#R  t$7t0h[#3 jt$hK#  t$1t0hy#jt$ hi# t$ h#1$^_[Vh#j WVt$ |$7̫ WV1^_U0E\$D$,1ɍT$ QQPRh#\ uUD$ L$$L$D$l$%\$ D$L$ |$D$ fD$l$|$l$D$T$]h#jd WVPt$jWV 9u9t x^_Vt$h*"j Vt$V0t@^hu"V^Vt$V5t@^h7$V|^WVPt$jWVy 9t9u x^_Vh*"jt WVt$|$ VWC[ t$?/tWhb)"=Vh{)"=^_WhM)"j[ fWV1t$|$ ɉ @4uxȉXȉX\ȉ\ȉEx%xx PQ40w40<8w<8D@wD@LHqwLHTPQwTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40v40<8v<8D@wvD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7uVw wuV FwwuVFwwuVF^_USWV\$l$EffEffCEffCEffCu upuS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uutSCuutSCu$u }tS$C EDȉCDu,u(atS,C(E@ȉC@u4u0EtS4C0EHȉCHu P4E1A$ &=$;h~"WhI#W<$t=$;W5)@,$;1#PPhPPVv5Yjj5$;u D$,9$;1#PPhPjv5 =v5=$;jhv5h$2WP $;1#PPhPj w5$;1#PPhPhov5r$;v5a1@D$(S$;1m$PPhPj%v5($;1#PPjcPPh2=$;h7$Whu"W v5w5=v5v5=v5=$;yW!@$;1#PPhPj?w5B$;1#PPhPjp21GhLf2Wj>h8#=v5<$=$;h֐$W uw5G=$;1V#PPjPPd21@D$$$;1S"PPjPPjv5m$;1 #PPhPh<w5P9$;1#PPhPjw5 =$;=v5j:WAj/Wͤ.?yv5$;빳#l$0UU݋\$UW|$Pv w5w5spm2DH,WŃD$hhR$Wnhڏ%WXv5W v5N1.#PPhPj l2,v5 pm2DHW1D$<$v5h(#_2=d2_=v5tVh#z5$;h#j5$;hw#ZhX#Phg("j Wh#9Wh#.D$ =v5u1=v5@v5$1󫍄$Bv5Al$$+D$ -v5t1$ 1D$$$MljL$$ PW?t$h#w5l$Ul$RQPw $׉ȉ w5=w51| h#$t/$$T$9‰sQt$t$WPh#tFtA w5WPUD u5w55w5t$h#|$(F=$PUf uRt$h"#Z A#$=`h w5h#1=w5 $VhMu Vh6#al$VjD$P! w5-w5-w5݃=v5~VUWt$hP#o|>9|Pt$t$ s )̓ }4$E1\$l$ v5v5ɋ|$  v5=v5 w55w5σ|,@σ|1ҿ9  w59|щ v5|$ D=w5Ejjh w5 .h w5h6#v5=v5tv5v5t&hQh#& v5v5t=|hPh#& =v5u1=v51@v5=w5u v5w5=h2,=v5t#jh_#h7#h,#-&v5= w5u=d2v5 w5t$t$ t$4Ut$$Vt$t 9t V t U =v59$PtE:ktƃh#QEj Ph|#jd$ P- j j j h$ ${5$w5w5ApQtv5@jxQP$Ph# g0Vh|#jd$ P$\ $|$8j脅U$Pa $PSu/jZ$P$dP u$<mfsjWVk 9uD$8%PKGP$Ph#h#|$D$D$4jP $u/h w5hI#$Phu#jX: h"j . /dev3 w5 $w5/ D$ %w5tD$ w5<$~~l$4 $jWh'2" u ƃrl$Wl$$UlMGWUY:l$ ʼn\$4Ë$H$|$v5\$L$ u Dv5$dT$dž,<tx(=v5dž dž,dž(Ɔ l2p2u(jhy#P=v5-5,{5u"jh#$=v5,5,{5 v5N0v5F4Qt$Qh#=v5w,5,{5F4Ht$Ph#=v5S,5,{5F4 w59}"QPh(# =v5+,5,{5F0=)hPhV#a =v5+5,{5F0=|)hPh#1 =v5+5,{5F0N49}QPh# =v5+v5,{5;v5|QUUUU)ʹ3333!!сis{09\~\{0\\5v5sXș9}%CX=v5~Qh#Q,{5sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$h#f=v5**,{5{4$=w511F9tA uPhS#jK $Kd=w55w5 u։<8=d2[ WVh@# =v5),{5<$C4$8=w5`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPNjs8ƒPVRWV)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVht#u=v5'w5tm ,{5yxH1҉$q1ҋ8$$)$<$$1C$I8$ w5=,{5_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W赾1C1 t׉Ë$$QPV$$V\9s($$$VOÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPZƒ$$$$$$׋$$$RPVQZ$9wȃr$9‹$֋$r‰$$$$$B1WRQP胻Ë$Ë$ʃQPRS)ÍC4$$W$$P$Q;Y@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQ"j$P$$*X@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh# =v5 ,{5B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d2$_|HL!ʉG41SSjhjPS[<{5N ,{5I4QSP1 ,{5H @{5 <{5 D{5P44Q5H{5щ L{5`@#HL 9| Hh h2H< v5HX w5H\ v5PTXH fǀ$%=,{5O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d25O _(HLJ$v5$$$t!LJ^F=v5$$߬$$ڌ$%ݔ$ɊOd t1G0 T$D$\$t$ED$\$$#q ,{5$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$#=,{5O0 9| IУP{5T{5=v5u\Tu))УT{51VVjhjPVWX{5uP{59T{5T{55T{5jP =w5Gw5 w51ظ|(RQh2#> =v5w5 w55X{55w5~ ș)dہ|4&GuȹC=v5tL1$PP$$5v5V1=w5VhZN w51u;1$VhjVu  =X{55,{5h`VWƢ =v5tWV5,{5x\X{5hhP6 1@$=v5h#bE=v5|o5,{5N,I\Tt~!NȃN׊Nd1 t1WPh͢#RR$f29u1H$Whht@P! PPftu!ѡv5t $ Q$=w5u$|&,{5H,$$DŽ$%$ ,{5I,$1$ DŽ$1he2,{5$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ h#B=v5Y ,{5j50{5U 50{5FU $F +$^,{5$~J`^p=d2uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=v5uFh$ NlK`ڍOȃ$ډFd;v&h# A=v5,{550{5F $11ہ~U uv`щSA,{5$~!ـ1@ 0{5Il ,{550{5F=d2Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\50{5N uҋ,{5B8H!tk)D4,{5B8)Nj50{5$9sE)ȉـ1B~U uv`50{5F$CHu͋,{5B8$؋N9ȉ$J`~U uv`щS,{5$~!ـ1@ 0{5Il ,{550{5F=d2Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD450{5;Vs2р1@~U uv`50{5F$Bɋ,{5$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$D{5H D{5V$P V PV~x; H{5up=v5tL{5s4PP ,{5@{5@@{5Kd15L{5s4L{5D{5 ,{5q4jP ,{550{5{0 9 X{5PVQ =v5tX{55,{5P50{5g ,{5y0X{5$ryxtG$\%TuCl$AP$ ,{5Ou$ց\TtQ!QЃyId t15X{55P{53 5,{5\TG~8^xN`1?9'T{5+$~0lj$Ɖ$)ى$=X{5$%GlX{5T{59wߋ$9w$,{5$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=v5} $H$$$~A=w52$=|j.扄$c"t$ ,{5ׁ\TtQ!QЃYId t1RP$VhJ# $$;$$|W=v59,{5H,t =w5 $$ DŽ$j DŽ$C,{5;X,/$~ j =w5 $hjP蹓 d2 v5+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A@$h$ $ld2fDŽ$2tt2$_ lj$DŽ$,{5H4$ $ H5,{5D@VL!! $`Nd8w fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t2@ lj$DŽ$ ,{5H4$ $l$h  5,{5D@~L!! $߉$Nd t1$Sv4$j2,{5@0p9w Au1H$$DŽ$1$$t ǡv5,{5@05v5V$SQP$h$l v5ɉ$$$t RP1$CPKT$l$hߍ$󥃼$$tA$ȃ=v5CX$tFDŽ$PQH118$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$0$pthj$P" ,{5\T$$i$$ $$$$DŽ$H0$$_$ ,{5@$D$@L!! $`K$h/ $l$  ,{5Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h ,{5@$D$ @L!! $$+$ $$h$l,{5Hd t1$S6j$$V ,{5$ȔȐG$11F$t =v5$$=,{540=d20w4w+_1X{5$`SWPF $PjS݋ =v5t$W\=w5tX{5ǀ\8 ,{5=X{5x\hhP~ w5QPVWV=v5t<{5 ,{5q4PP׸ 5,{5HLNd t15<{5v4t5L{595D{5vG=v5t,{5p4VVx 5L{5@{5@@{5=,{5Od1Vw45T{55X{5,{5@4P5<{5e^_[]ÿWjV` 1=w5VW\h"Bhq#v-j&j%j(${5j }jvj'ojhhS#Lhk#BjMjFj?j8j1j*j#jjjj USWV=w5ua΋\$=v5tw5${5St$PR= 4׋ w5UPSt$$58{50 9u^_[]_0PWVh,#j$nUSWV"=w5΅ \{5u,{5H4H P{5 \{5 =w5;w5w5,{5;}FWh &1I!;HtG#P;Pt;H uV9R_1ڍ_5X{5P=w5Wh De^_[]USWV΋L$l$=v5t=w5teUjQ藇p׋ w5SPUt$$54{5訫 9t?謣0PWVh#j"w5${5UPQ%; ^_[]SI`wD$$|&1C:Qh#hLf2j .  [SWV1ۃ=v5։ SjQ萆 =d2@fF F)f ^_[USWV Ӊϋ5,{5F Nd t150{5G=v5t0{55,{5PP跳 0{5yU +y/\$|$y1U =,{51=U L$D$uq`|$ G`Ӊ $u щw*l$$&р4l$skPh#hLf2 =,{50{5D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ahu# h%#hO#'11҉ ^_[]ÉՁ|$U u L$I` L$w$&ʉـ1@BPh#hLf2 8ʍ 6ʍ   1$5,{5$~3%)1@ 0{5Il 5,{50{5K=<{5Od$sC=d2CNdЋT$ t1҉t$VQPR,{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPR8L$|$ щT$ՉD$ȋL$D$VW|$RPыt$ʋL$Vt$QRP&$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45,{5;F8|$}X1Bσ) 0{5yU uI`1@5,{5;F8|$|=v5t0{5VPP 5,{5F Nd t150{5USWV$΋=,{5G Od t150{5=v5t0{55,{5PP胮 0{5xU t)hu##=v5(0{5xU ‹l$(H $t@\$=v5t0{55,{5PP =,{5G Od t150{5w,{5<{5HC, $9r%UQh#M =v5V,{5 $\D$jT$RPQ,D$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5X{5W,{5\TudX{5jpxt$0t$ 茾 $<=v5WV1L(ɉL(@ u1LXɉLX@ul$X{5jpxt$0t$ $ $,;=v5trUV胪1tttp\TtDpC u16Cu) Q% $D l$hVU} /% $D9Pl$,{5T$5X{5p0^_[]j׼j мWV։σ=d2ȃ@PQRy} =v5t'ȉGffF=d2u GffF^_fUSWV$8tW% ƅuWh~8"j $$<$4D$Phd@U4 tj1OLVhedAU%| F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(hm$t$EI 1 Sh8"U CPhA9"U7 C Ph8"U% CPh9"U CPh%9"U CK,C,Qh89"U C0PhM9"U $@D$t Po 1-Uhzd@$<Wz t1 VhedAWz hjU{ D$ P$4GD$, 9L$L$9u0$S11:8tx$0h8"\Db$11҉ $ƅ*ŰPj PU| ^_[]$0h8"j USWV81ۍD$4ShPSuP1NtAljSPSWuW uMU D$t$$$Q1e^_[]fWVt$|$ VW' t$?/tWhb)"Vh{)"^_WhM)"j? fUSWV|$$\$(SWt$(t$() )jj`SW=&~XNjL$t$AhQl11 mTTDPD$T$ |$,t RP3E`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVx 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$Vj:$u Vh6# t{5{5%{5ʼn߃=l{5~VWUt$hP#苵|>9|Pt$t$菌 )σ}4$a d{5-`{5uU-d{5uY5{5={5t{5@19lj| 19ǃ| d{5u `{5͋5{5={5t{5ˉjURP}=|{5l$ x{5uA@19lj$ $t$u h{5h#jPVW|v|$wext23$2fs3$ Wh@%"h{5hv&Vh{5hX#} 19ǃ} h# |{5t$VUt$  U& t 9t V jjUSWVӉ $)|$j W\$ S Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph3"1L$8ɉ׉u L$8t 1@׉׉|$l$ L8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h3"3QPWUt$t$h3" QPWUt$t$h%4" t$t$h3"j+ WV3Lf2Ph#Vӳ 1GVWjh4"HVh&OW訪USWVu} D$8jPK=5555d{5%UUUU)3333!!щ%i`{5Bt{59922T$u tv|$΍Q5555 5VT$ 55ډ5P…Ƅ!) 51f1ҁ‰t$$r={5{5\$9D$ 5T$51t$$ËT$ u׍؉)9H1D$ 1|{5 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ|{55552t$ƺQ=5D$5D$ 55D$551 555D$8555S555N55555[5^f5C f55 2f5\$H$SWt 93rWh5讁 5h{5|$t"V'wYjVh5h 155\5X55D$5 5+ 5 1҃r1I155~σRVPW55H19w+55|$OL$)9r΅u 5f5^55d{555VO5YVjPf GD$AD$ 11L$\$55tn5tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 5@5t ^5 5@ 51H5L2 5D1\$;|$t5)á5f\0 5D1 5u\$fT1 5T1fD1L$ G;|$tD$ 5|$11t$55=l{5~i d{5 i{5`{5Q5{55{5PRuh# 5 d{555PQWh*#軪5@5ą51QQjhjPQȅ5I 5ą5jPc =p{5uk{5 {51! V5t{5 1N1Ƀ *%Fu  1@D$$=l{5|>hq#=l{5|(L$ 5 51PQh͢#PPTD$$f29u1H|$LWhht@Pb PPftu!ыt$l{5tL$QT$=p{5uL$L$D$ 1D$L$ 11T$he2D=5t$tX5tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f55515 5ȅ5D$ hh5P$b 555P55Vt$b =5=5 515t{5ǡą5)؉1t$ P =5Wjh̅5aa 5H9|$u_555 5)ʍZ9s1Gр̅5B9r)̅5VhP` t$ 1Ƀr!11ƃ̅5Cω 9rωp 9ǿs"ˀ̅5CI 9rޡ5L$  51Ҹ̅5Pt$ 55Vj̅5PD` ̅5 5L$)QhP#` u1̅5@ u5L$ D 51Ҿ̅5Vt$# 55jV_ =5tb1=5t 12?05F;55r5L$ D 51h̅555 G;=5r=l{5t$|\tX=5te5t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=p{5|$T$T$|ʉj.Yt$몸c"|$|$t$ 5 5jQt$,PhJ#T$;D$_=l{5* 5t=p{5u&D$ D$D$j 轣1h"臤~ j 藣=p{5d=515$hjV] fF쀁苭fFD$8FFFe fF55 ׉؉t$ ֍$fBt 5$,F܉VDF81 L$ F4D$4z 51CL$ =5WD$(\WD$S55tPjt$0\ ^5 9`L$97|$0N5L$,ʋL$(T$51GL$ T$D$ 5D$5D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjPv[ L$ D$1t$V 51CL$ \$^5 5=5t$,9sD$()QjP[ t$L$ D$41ҋt$(VW'V$Yj=5t5t 222@1=5à r t$hhjV`Z fFABfF5ÉFD$8FFF 5fFfFV 5AFmlj\$r*D$p1ۋ 51zC9uߊ 51h̅55555f52|$D$1ۉt$ 2x1ɉt$)rͅ5RQPYY Wh2̅5VY 2̅5D$ fЅ5 51Vt$ \9\$t552D$ CiL$T 1VhVD$pPX 955t5t222fD$TA茨fD$V2ƉD$XD$8D$\D$`D$dM fD$lfD$n 51@D$pAD$| 51h̅555iL$Tj f51ۃ=5 5ȅ5<hh5W'X 555P55V X 55 515t{5ơą5)؉1WP5ą55ȅ5e^_[]hv#hN# #h#PܝhS#Phv#h#Vh"#RhJ#PRhu#hVh#hVh#RVh#Wh1#VPhk#hP#vjVWt$ho#gh#`h#Yhq#Rh#KRQha#B#1#'hv#h#"hv#h#hv#h# hv#h#j USWV5=5tr5tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(5Ѓ5t ^5 5Ѓ^_[]SWV=p{5u0׉΋ t{5\$QPSt$ 55y 9u^_[WVhK#h+#jR USWV=p{5΁ ̅6u=51 5 ̅6t{511;{5-{5ǡd{559v@1Sh&8!;HtH#P;Pt1A xVWh06h# h #=hLf2ć71B h7ԇ7@ć7777777̇7 ȇ7 uCء7x77t7 7 p7̇7 ȇ7Ї7 ؉+77D$HT$Ll$HЇ7+7D$8D$85Ե%v?|$ D$ fD$l$\$4l$ D$4Ӊ ȇ7̇70%wh6 77 ȇ7̇77Ї7ʚ; ȇ7̇76eĉЇ711ۋ77D$T$ ؋77D$7D$7D$5Ї7L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05Ե%0%t$v ȇ7̇75Ї7=7|$(t$(|$D$ fD$ l$ \$,l$|$,=Ї7ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5ȇ7 ̇7=Ї7؅6t 1A؅6y7D6 @69}(7i-@=B'6@9u7e^_[]h#h#je USWVh7j 6ص%\$Du{'-77D$hD$h5Ե%\$Dݜ$݄$h7jz u{(-77D$dD$d5Ե%݄$\$Dć7;܅6D$Ḋ7 ȇ7 t]+ 77$$߬$Ї7+7D$\D$\5Ե%8%s=ԇ7uZ؅6tQ̇7 ȇ7 t5+ 77L$xD$|l$xЇ7+7D$XD$X5Ե%wD$DD$D؇76 ܵ%w١7 7 t>+ 77$$߬$7+7D$`D$`5Ե%D$Dw\$8Ѕ6$fDŽ$jh7jdT D$8 %|$&D$& fD$Bl$B\$Tl$&t$Tj$PU SD$lD$lPD$,Pj5H65L65Ѕ6T <h7jօ L6D$8<BC97)؉D$D$8 T$<&\$A9P7I؉L$A ć7Iff9uԇ77@77<7787H7 L7u7P77L77H77؅6 1D$1P8 P8l1A h#hLf2A؅6<1A t$, PVh#z ΍T$(jt$>Ph#pzD$ ؅6t$؉T$΍T$(jt$F$&h#΍T$(jt$Jh<#y΍T$(jt$bF$&hJ#΍T$(jt$$Fft$NfQPh#>y ΍T$(jt$؉t$h#΍T$(jt$^؉t$h#v΍T$(jt$z0FT_h(#G΍T$(jt$9FPhx#΍T$(jt$ ؉t$h#΍T$(jt$؉t$h#΍T$(jt$d؉t$h#΍T$(jt$9؉t$h{@%T΍T$(jt$X؉t$h#)΍T$(jt$-؉t$h#_wh>#KwPh\#7wL$lL$AQ D$iPh#wh[# hi#h#vNh|7h#vt$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ/#L$dT$C; 7u#Ph7QD$X虼L$$ D$L 7PQh7/ T$Ҹ/#u1G0#T$PuL$r |$ rIe2H e2~e2H e2 he2j z(  }T$A{^N2D$ˀ) h5#uuPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh:#th#t9 |$ sSe2H e2~e2H e2 he2j iy  }KF߉Ήs(T$h!#sL$T$؅t%e2H e2~e2H e2 1I he2j xhe2aء7;܅6*؅tء؅6!^L$AQ T$Q=<7 87 t+)|$L$p|$tl$p@7)ЉD$PD$P5Ե%X7X7`7`72v2؇7v؇7\$CfK%h7f!th7 7T$ .KfKfh7D$ 7@1ۺ9T$t$,, L$IfɋT$8RD$4\$T$T$$T$ $L$J7@)t2(uK l7؅6t1 l7h3# l7 ؅6 PVh#lq Ph#h#h#h#AfPh#h%#h9#hQ#hj#h#h#h#h#h#wh#mh#c l7h^#p1BD$D$pf2@)f~\؅6tSωL$!ȹT$V!RPt$ h#RQPh#nD6;@6}0u hn)$nPhu#}nCы\$1B\$D$\$D$T$jh#jT 1AhL> QPh#l؅6tkD>L> QPh8#F|>uGD>؅6ufPhn#g"L> ffPQhY#f ^_[WVم6u8jjV t'86Ƹ PWh#hh|7=e"6衸 Ph $hh|7e^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h# $t$t$ t$SPh#e UPh#e t$t$t$ h#et$· Ph#et$ 訷 Ph̹#er0G9s'GPhz"de| KG9r߃$^_[]fUSWVLƀ8-uFhœ"V93u 7h"V31u 7T$,11CD$D$h#Rt$0p Hw؉$ؔ&\$̃duE뻁뱀=7t\랉\$떁댁낃u1 _21;L$(uj|1L$ 1ɉT$Љ $P-L$Au $AP|D$t2ڋL$ PWtH WK-f uމ$DluY|$uj / DžuZ Pz.#t8=7uIj Vhœ"芦 Wh#T1FV>Ph $VOI SU(> h"=7Mj Vh"4 Wh#V- \$c""!#VWSӧ jjVWSŧ\$u9 1GWWV-WjK-Wj@-Wj5-WV&-Wj -VWA; u h!#jH jj$; u7.#8j u8 jo j j: t)qtOQH j j: u}7D#8t1Aj jh" ukWh#jhZ#Ut$U< #Q"70WWI: #tc"VQPSh$WaG SWh#jsAV2%=7uc"VPh#hLf2bjYfD$tPhb#血h(&Phv#hLf2bjYUSWVPu } h(&WVl cR~5StET ԑ7͍Hw4$&đ7벃L7̑7둃ftTdL 7tȑ7eؑ7VБ7Gܑ787) _27=ؑ7tjjh$88 7ND$ jjj" 7jL$$Qh@hPjY u h%h7i )ލ<S H $8&=7t1Aj D$<1CPS1D$D$ PSD$D$$PSD$D$(PSD$ D$,PSՀD$D$0PS辀D$D$4PS觀D$8|$ |$z |$o |$ d |$Y |$N F 7D$8gtj57a8 rD$ D$c"D$D$c"_;-7S t.H$1ۃ=ȑ7uWh#h#h5$} >ho%SH+g =ȑ7uh#h#h5$| 1C7FLCSS H3 VT$W$`& \$@1ɍP$0&71A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 127#7L$L$# 1AD$ PD$@PD$ D$<+7R D$ Pj$727272 77׋t$#D$ Pj7d$zT$ ED$ L$TL$@JL$C7"2-L$#d$d$d$L$׋t$ 7:87@.@7"(707 H7\$ X777 t 7t 71SSPs L$Y\=7j$)/jD$D$ D$c"D$c"7L$9a|$u q7 7ta|$  ‰4 D$=7T$tD$1@D$ p.1ۉD$0`.hxSh`7 atgcuL$c7 h7b77@7t77l777 X7 7tJt$(~A|t17t|$ ObT7ؒ7tPt$ tH@WVhؒ7 ؒ7=ܑ7t=Б7u#7tMD$tH@Vt$ W =ܑ7t=Б7uL$#7tDD$(tIAVPWm =ܑ7t=Б7uL$(#{7tDD$,tIAVPW  =ܑ7t=Б7uL$, #.7tDD$4tIAVPW =ܑ7t=Б7uL$4#7 tDD$0tIAVPW =ܑ7t=Б7uL$0)#`7)f=`7=ܑ7tP=Б7uG=7t4e2H e2~e2H e2 he2j Z`71=7IWh`757, u++87t+t)7|$t+u-#/9|$Ph#!}#|$# PPh#t*83u=7t"*1ۃ8=71ۀ?D$PSVha#Ahe2^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV+D$  PZ1PPWSjV躁|$dt$ \$hj# D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy92tE2P{y$L$t h#h#QQh;D%PPh#h@ C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lPq=#PPhY#? e2H e2~e2H e2 he2j DT$h9t$h hj# L^_[]h@# jh#j% D$t'T$tt h#h#QQh;D%PPh#> ËD$t%u#%tu#Ph###Ph1">USWV|$<\$8D$4t$0~u/jUZ u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhZ!=Ph $=PWh#= ^_[]USWV|$4t$0=7uM7hh7Ҿt 7'j.h7Vt@hPh7 t"^tCt0Wv`rhh$h7n ^_[]1w)ȉPjQm SVU fEu jUZY WUu&Vh7Sh#hh7H;7^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh7Sh>#hh7:7[SWV$L$4D$1Gԙ&t$"tZ@:t9rD$Ph #;,^_[SWV|$t^D$uFD$jjP t1Nj0j.Vt@h7P u7ut$蓍 $hVh7 7^_[VD$L$ 1Ҁ0QRRhh7VP6 thhn@%h7q 7^Au yuyt$Qtu ȃPۂ QӀ APhb#hh7V97SWVD$7Q4H#R74H#R7ƄR7.r|I1AFL$ tWWVWh8& u;D$ D$ P#FWWVD$Ph8&X tt$VĨ ^_[]h$t$  tԉ1|$l$Vh$PVSMHt$t$Wh|dD$P \$tN1D$;D$ 2i9t$sVt$PPt!ʼnD$t$Wh|dt$ ul$$WhedAP f$a$>ukSt$h'2"h@Z%h$W*Ƅ$t$75$ 1$t$QPW+ $Kà9Éu|$$PU 1h$j Å~A1ۉh "PujVh'2"h$h$W*Ƅ$|$t$7\$ 1$t6$QPW+ C;\$ mU&T|$l$|$$PUSWV uj#D$$D$<$shQ$Vth@$V3hU?4 Ƅ$h@$s_ut s h@$V4tt s hT$V3t P:8 $7D$ h^$V3tHá(7th2g#P(j,S聿tZ S蜩,PD$PU7oxD$!=`ÉUh $般 SGDž?tG<$tSWUhy$h%h$V'VH tEUh$HZhh$H?Uh$h%h$P_'15(7tD$D$ SWPV#t$$Pt$hH$ a<$ |$<t$T$7jj hc"QPjR7 9\$؋|$ T$2jj hc"PQjR )t$ \$Ojj hc"VPjSͿ SD$6PD$?Ph_$2D$L$,PQ] D$$#D$<T$T$SRQPD$D$L$ St$ PQ+|$t$$ St$ VWL$$QPQt$ Qt$0h$5t$ $ t$,t$ \$WSPQkD$D$t$ WSPQJ $)T$T$D$( WSRQ&$L$$߬$ $$L$$߬$ %$L$,L$ L$dL$L$LL$L$@L$\$D$D$$$$?$D$ P[G1Ge^_[]h>"jv h!hp$USWV $ $ h$VW* fu 07t R1ы _29<$$\$PhVR' &$UVnZ tJD$PUbt>D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h$h$S6\$ =07uD$##D$ P$Ps $8\$t$Ph($y07PUe uUh $R1@$~#Qh$;1@$\$$$Ĕ ^_[]$Ph $j  ˜Ph3$hLf2 jUSWV L$47$T$t-87*jh47" 87š47$T$1i E$48t!u6$t$P"T$ uF$t$PT$ tEM<ǃ hM#1 ^_[]ËD$ t 047$4$݋D$ t 047$$ؾ<7Phh<7J$ uh<7h $j fVD$t.})zhzQ8hT$5l7( TI8T$%X&PQh$5l72#u5l7h#" TI8^ËD$ H^WVθ%X&PVt)uVh$5l7 TI8SGt8tPwh$Z wh$Huj whzQ8 GQ8Q8^_WVD$ t;5Q8D$=7 |7u 7X&;pt8@uVhv$j @u=R8thR8Ph$襀 Ph$蕀u5Q8=7^_Ã|$t $iTI8Ã|$t %HTI8Ã|$t $r'TI8Ã|$uhQ8h$5l7 TI8Ã|$uhQ8h$5l7 űTI8Ã|$uhQ8h$5l7 蔱TI8SWV$$DŽ$HH$pƋ$ ƒtS!=@I8=$t8$3$atσ=LI8 =PI8 PSj $;rtr1Auu($$h$PQ te$P$$h'$PQu t8$(1;BQPVW'Vy?.TI8^_[USWVx֋$$t{tp11@=pm2D_t1z\t r9΅t<΄t45pm2AҀ|Vy5hm2TVP5pm2@u΋$ $t`1HhjI8trʄt<$1ۊXI8t8tCu 9siI8B+$=FFu4$D$|$ 1 zI8$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ zM8<$؉D$zM8$to\[$uvz$\$-pm2BDEJ<0HB,t ]tVрy$t[pm2BDC$G)=~"B $tG)=BJB5Apm2<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$5l7h$ <$?uhVW x^_[]USWV0$Du%$H$DhB$PQ\ y1E-hZ8h(j0Uh@7( t$H4$=7I1VV$P Í|$0;=7=hZ8$H5PI85LI85HI8s =@I8=$t8$9ƒ=7RPSQ7y=hZ8uE=h7t<77$HcthZ87 hZ8VV$P Å 4$jhZ8ЩTI80^_[]Ã$D|Ã=7t=7;1 T$󫋄$HRjh4蔵 |$D$=7ʉǃ=hZ8$H[L$05PI85LI8j =@I8=$t8$9Ã=7VPRQw=hZ8u9=h7t0577$H1thZ857G=7-=hZ8$H$HL$05PI85LI8j ƃ=@I8=$t8$$H9=7PVRQv=hZ8u_=h7tV=77$H1thZ8=7$$H4hN$^-D$P E;$Dnj=h7t#l7@=u1Hjh"Ph jh@7i WV=hZ8t@=h7t757= 87 8157= 8u hZ8^_USWV1@=7S= 8Fϻ,$ͅtUSh:$5l7w5l7It$PhVhe2xdhm2L$DH?u"t57RPh4$Q'7#5l7jj6h$71TI8^_hW$h7t$t$ TI8h`$h 7t$t$TI8WVD$ tZ}UuZt$~h!W@tOh"W@tBWy7vh|$5l7S J1H_1=|71@1|7 x71Ҿ"t! щ x7PVh$5l71=|7TI8^_ËD$uD$L$h$PQ tvD$ph$gu<=TI8u0=7t5l7h$躜 D$ph$Vgu+4R8`V8`Z8.TI8VD$ L$TI8t u]H 7HQ*tsP t8c=`R8l7t5h`R8h$P TI8(^飘Vh$ׁPjj$h$cV'^ËD$tIDuD$L$h'$PQS t$D$phB$7fu4R8 TI8SWVD$-uD$L$h$PQ  1G=hZ8h(jĴWh@7輀 t D$1VVt$H ǀ?tx=hZ8tyD$thWhB$deu 4R8=hZ8uB=h7t9=77D$bthZ8=7 hZ8VVt$ DžaSj߳hZ8ԖTI8^_[ËD$uD$L$hJ$PQ tmD$_D$L$hT$PQ tI|$BD$ph\$]du8D$phd$Ddu4R8Ãt(TI8USWVt$ |$.E1ۈ$5l7jj,hl$蠑% u v1.褔TI8^_[]TI8USWV D$ #D$$L$ h$PQ[ L$ ȃ#D$$L$ h$PQ1 D$ L$$|<$Dhq=#t$t3$8|t+4$$H$$ 3D$$h$0D$1E-hZ8h(j菰Uh@7| t D$$\t$=hZ81D$ H9=7""t"$9t$tS#T$$VVP4t$Q̀hZ8u?=h7t677D$$" hZ8tA hZ87E_t$j讯hZ8$9t4$!葒TI8 ^_[]SWV$tKjjY]tK~S| 9uWj01uh$d{1HTI8^_[þV Fujjh6#螞{$tj/V8 t@hQW =|7t85l7V l7HQP~ Q Pj |j5I8hY"WVN  jWVN Vh$uzTI8j!SWVPD$D$t&D$t$h $PV rTI8^_[ËD$ph $^u|$h $ tD$x|$Wh $~^WPjW uP|$h' $ t D$x |$Wh1 $+^WPjW蔯 1ۃuM|$ Àu*D$p Vh1 $]V耿PjVT 75l7h9 $ D$TI8=`Z8t =`V8u.=`V8t#h`V8hn $5l7Y TI85l7jj%hH $ËD$TI8=`R8u=`R8t#h`R8h $5l7 TI85l7jj$h$讋ËD$uD$L$h $PQ蠺 teD$ph $\u<=TI8u0=7t5l7h $觑 D$ph $C\u4R8,TI8ËD$uD$L$h $PQ teD$ph $[u<=TI8u0=7t5l7h $ D$ph $[u4R8肍TI8ËD$t8uD$L$h $PQY tD$L$QPhc" 2TI8USWVh$VX $|F$$h1Gh4Vip 9}hh$VRp G9$uVh $Zu j577uhk $YD$ phu $Y57^VD$t$577u h $X%ȊTI8D$ ph $X57^Ã|$u|$t荊TI8Ã=7t 1PP)jW=7t 1PP jF|$u|$t4TI8Ã=7th $X鏽V1VVcVVPD$ D$t}uD$p*ӉTI8h $W t+h%W t h $W u7 1Cvtt7u7Xz1H!7P57h $5l761TI8^_[VD$ L$TI8ʃuCuD<"2tKD"2Vc"tQPj h $5l7u^yjpp TI8^WV|$ W`tQƋ|$@tPFWծF=7t3|$t,P6h)$5l7GWh$5l71 ^_WV|$D$ TI8uIwЈtAƋ@tP-F6h@$5l7 TI8^_xwh$5l7 ^_V|$t.=$D$d($uV1KPi* F|$Dt$d$`t$hl$dt$lY$hD$d|$p$lL$tf$pOG8>h$P(t$Dh$$t$ $t|$@t$t$@ЃD$; 7t|$tt$qD$L$d3.$`'.$c.$tW.|$Htt$H)D$H|$Ptt$PD$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD= 7t;P譡D$HL$H+ 7tD$Ej/t$L t@Pt$Dh $t$HaD$t$Q 7L$D|$D$81,I8(I8$I8 I8$$9$7t1$Pt$Iu$\$` ,I8(I8|$py4I8r$hL"t$L蚸D$|$t$I$QPuu5$8$<$$$\$` $I8 I8(I8 ,I8t+t$j5,I85(I8PY=7tPt$Hh$5l7 ,I8(I8 tQPh$5l7c5l7h"m 1O$=7K71O$*|$pu% D$TQh3$ 7ht$hW! =TR8|$Lu:|$LD$puuhK$t$Hh7#MuhA$}D$L4I8$|$LD$L8|$dD$t$hb$}8P薞$$W踘$<hJ%V 1A$<$ǀ?tvj:WH t=@j $QP ~޻t?$9u3;$u*W.9$<r$)PWR! t/hJ%V Džm1Ft$Hhy$1$t Pa$$u |$p$$(I8 ,I8t$Lt Vh$t$dSt|$dj%Wct Wh$1$GGG fG"$P$xPW# $u2$t'8t"$tJ?t1h$WYtVh,$ $'(2WFDŽ$t$D[$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB X7JBB D$(PRW$8 t ]0ZRtD$(Z$$PV-j j WhSvvp t%hI"PS( j I"PW =7t+D$(xt!~^$tr$WSP5l7v jvK Åx`=7u~PvvS5x)$P$P$Phc"ykS¤ 1KW$Ph$GN Nȉޅɍ$P PW$4hE$ h1N=7tJ$t$uP$$t$uPٙ$7~RlZ8Wh)#otNu1h@h$h7| t\7058ދ$tP5DŽ$$t4W}PjWQ $tPDŽ$$t4W>PjW $tPDŽ$D$(t PR |$D$$hj0$7<tQhj$$蒰D$$\t$ Jj7tV=7tWh$5l7 t$$tI=7D$tPt$hh$h$5l7s1@t$ht$hh$f |$dwh$V̭ #h$V赭h$V觭p7tphK"V苭 ȅu(I8 ,I85l7h$'e 5,I85(I8h($VE5,I85(I8h=$5l71F&1t$lh$V $`#=7t"D$$w$td$QPЬ|$h$mtPh$W謬 h$h$h$W蒬D$$0$|$Pt1$t$t "tD=7$tPh$5l7 FWh$$8W! $$0t-=7tPh$5l7h FSh$W t=7t5l7hil#c hdT#t$ 诫t$H1V|\$D$Lt$P5"2ZƉ$$ىD$ډ׋$$|$7‹$4$8$ 47ˉƉ$D$@1S$P)R$+$$$$+$ى|g@By)Q9j$PQ$+$$$$+$ΉЃ||$`t$@$Dt$$|$`tCt$57578 hdT#57讅M|$`=$@$Dt$hz":Yhq=#t$XD$8|jjj n$D$@h""PP D$@|$@DŽ$`%,I8 (I8 m!ڃt9}M#$H5$I8 I8$$!;$$=7t5l7jj h$+MD$TZD$@e2x=8I8=7,7 (7ƒ079}%l7HQP ;HQ#l7HQP<Q 8tB$ڋ$!t  I85$I81ϋ$H1 D$h"P h""t$軷D$@|$@tDŽ$ t$}D$@Ph$hT$Vhv$Oъ"7)PSh$(8h$%Pt$Hh+$jkh$h$ bh0$ L$D$ D$8t$4D$ D$0D$D$,T$1@މPj 諹t$脛th$7ej ct$@P$= $#$1V$WwM$$$$$$t$@Ѓt$@Wt$c u.5l7$PpP蟊Ph$V耵 ,7=(7| jj$I8x& (I8 (7,I8,7; I8R1,7(7!1\$  (I8 ,I8PL$T$ T$8t$4\$0r\$ 71tt$h{$5l7譴 L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Wh$ D$L$ L$8t$4\$0ËD$D$,T$1@t$[Pj#D7tt$h$5l7 T$d|$MD$TD$L$ L$8t$4\$0ËD$D$,T$1@h $x D$L$ L$8t$4\$0h$P D$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$h,$$ $D$8$D$4$D$0t$,$$1@މjh$= D$L$ L$8\$4s$$ًT$ t$\$|$|ljL$xL$D$$$$ω$$$yUSWVD1D$ D$D$D$fD$D$0D$8D$4jh$QJ t}D$V~ƉD$j@PTEt%L$L$4t7@P~ƉD$j:V E@P~D$ t$D$0|$($jPW4 D$4t 8D$t{8tvD$ t8tj;P* th $Ph$Wh$WVWhQ$C Vh$3 1C)1C>l$,|$ $tc?tTj/Wk L$9uut$@jh$V*i @L$ǃuC=7taD$t$uI$t>thq$V*1Ʌ $t}thq$U)1ɉL$<=t7=7t 1PP=t79.|$DhPWYh |$L$D$L$D$ tD$ D$$=77L$QPq=77t=ut$8t$8t$ Ts t D$,t>D$Pj 3D$T$I"tQPhx$) "D$Pj跓<$l$,|$u'j/VAtG1|$t>tFhhÈ%l$LU g l$t$1l$ -4R8D$PjЫ9-4R8*x1l$,1Kd}Z<$t3$DSVWf Sh$W( SUW( <$hh"%t$LVuf t$l$D$ D$<4uT577=$7$t$hP|$LW%f |$D$Pj57 7uj/U t@ʼnD$ D$$=$7tAD$Pj-?>uP=TI8uDhLf2jhh$-A)1D$Pjd8TI81ۃcÍL$%L$0d؁D^_[]1Eh$$ Ph$h$j USWV օ\$ |$$jh$Q: l$t=jh$U" t;jh$U t9T$(.C fCPC fC C 1}Gt$j/U>$t9lj)CSRyS\$$UP$d { uG<$W&xC Uxj@V>|$$tZ{ u t7w@PwƋ_j:SN>t@PwG_Ot[uUnj]U>$tYÊ@t<:uL)SUV V~,$}:1j:V=tEt$t$Vh$1ۋ\$ t3tHj PU }t $9ut=s fCt$t$Uh$F CC tWt_uk7KUVhz$ t$t$Vh$ \$ n1HJ37(uc"UPvC{u{ $t$P.vC1 ^_[]hS$j WV։2vvuGvuGF G FfG^_USWVȀ%t u7Qt*5pm2|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdjw\=h7t<&Ph$jdV=~ l7Iu1IPVQ| jh7( Vd7j\=h7t$" TI81^_jփUSWVu} 1D$(D$ 07T$L$4I8;"D$,7(71K$I8 I8 7L$,97t7}t1?-tWh$5l7蛘 tVh$5l7胘 =7tVu u ~Q89Q8t jP0}D$ \$\$jhx7/ hjMh߫jMD$hq=#} Wd ?|jj LD$_hL"Sr/ D$|$47D$ `j3=7uTI8D$tt$j`LD$tt$j IL7xPn 7|$ t|$t D$ t$Ѓ|$t t$w`D$,71,I8(I8,7(7e^_[]D$e27} 5jhx7 Ct$jKD$=77xPn 7|$tt$_D$jTI8,7=(7jlKhL"WwD$|$D$  D$fxtD$XD$0PS8}x.#D$8=u$$ $I8 I8u h$5l7脕 Sh$Wh7#,I8 (I8"" t^L$$h=$W[ath3$WIa""u3Q8H D$fxL$$D$@щ˅tVWh% Wh $@4R8SvD$|$ p77t9tP t7tQ谻79|ʉ׺9օt p7Qbt7j@D$ujj ID$=8I8tD07=7t $I8!ȉ'D$$jSPt$ 1Q8HsoL$1HfytL$IT$fztD$PW5<75p75t7E:u h"%\$(St$uƃ t0ti,7 (7;L$D$|Tl7HQP;H~0Q#5l7,07L$D$L$Pj#͍D$ Pt$ j u D$@ @(7,7D$ Pt$ Vt ttD$@ @uj(7,71HjSQPIЅx,5,I85(I8h$ j$u hy$2n} tc,7 (7;L$D$}%l7HQP ;HQ#l7HQP~ Q Pj ÔD$@ @tt$(=e0Wh"D$@ @t/t$ e0e8 t h$t1H,7(7j=|$ tD$ t$ЃD$t$eZ1t$V,7=(7NPj#SWV |$$D$h$W\t D$$=DI8=$t8$D$Q8ƅu=XR8=\R8 4F95Q8t jVuh$)j$=795Q8t jVthp7h$t$ jh47 jhx7 hdjD07h$W[ 7|t1@v5l7h$* M5l7h$* j!#TI8!hj D$ ,I8(I8 tQPh$ \$$SWh% j?! j"D$ ,I8(I8 tQPh$ Vt$h%v 071WWE"W4$j5Cj%"=07SVh$5l74$jCj! ^_[Åu1t P!=7t jI  |$1=7P!=7t j  |$1=7Pi!=7tV o81j J$,y h $=7t TI8jxYVV=7t j j =7t TI84$jAVt$h% t)Vt$h% u=7 j =7{jlWVd71V#A5hZ85,74I8rt suY1!$(!$dWPVnE WhY!$V l7Iu1IPVQ/a jhx70 Ph7!$jp USWVD$=7p777jjP  7x7tL$jQjhP蕃 7<<=D7w=L7j=7=|7u 7h$Ɖ=7~&t =7u!hk8hX#5l7ފ =7tCTI8=$ 5l7h$% h$ 1A =H7=P7=7=|7u 7h$JƉ=7~&t =7u%hk8hX#5l7 =7yTI8=tT$ wJ5l7h$2% ?$tgL7h$=7 $3$t2P7h$=7$PASV3Q LPSV3Q QEPSV3I1  $TI8=t$$ <$$T$$$VRQPWh$hp7ש *$$:$:$:$77D$ff7k=757_ 77=7177u f77t P_ 7jjPd 7=7u(QT$ RQhP 7 7Qh7P`y x7tjD$ Pjh57 D$1777Ĥ7Ȥ7̤7Ф7D$Ph757 OD$7j57hy h$;=7" 7$t#/=D7=L7=H7=P71)L$ ׾7󥀼$u DŽ$$j j $Qh$QPR =7=|7u 7$P$Pt$h$Ɖ=7~&t =7u.hk8hX#5l7ʅ =7+L7 7tPV7 7757=77SWVRQPh$T7$7$¤7D$|ä7D$xĤ7D$tŤ7D$pƤ7D$lǤ7D$hȤ7D$dɤ7D$`ʤ7D$\-ˤ7̤7=ͤ75Τ7Ϥ7 77PQjRVWSUt$|$$$$$$$$$$jjh$;X=7[=7N71ۉh$11A#hb$h$u 71ɀ=7D$jD$ Pjj57{ 1Ƀ5l7h$ 1E=7TI8=$ w5l7h"$h8$j57Z 71AJ7;TI8=t+$ w!5l7h$W5l7Q 뗠7<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,Ph$hp7o , |$ |$|$1-7-Ф7-̤7-Ȥ7-Ĥ7-7-7f7D$L$  ȋL$$ D$( ȣ7D$ $ fD$ L$$T$(t$\$VWRQPSh$hp7蟢 1-7-Ф7-̤7-Ȥ7-Ĥ7-7-7f7D$L$  ȋL$$ D$( ȣ7D$ $ f7f 7;77jPh757_1ɀ=7uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph$hp77 \|$ |$|$17Ф7̤7Ȥ7Ĥ777f7L7@uD$ $ ff 7jh7h73 5l7h$5l7h$5l7hI$5l7h$5l7h$=7USWVX=77tuPEjjPAV ƃPj57"V t$7D$fD$D$jP67<D$T$ |$ Mbt$1PWT$L$+T$ +L$(x@Biy1PjV` uR8tQ8#th:$uh[$ 7t$4\$8VS57U ǃu+Q8t Q8#uoVS57U t׉57JU =7t$jWT ut:|$9uD$0jPjjWu V57Eh~$ 57T 71e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$ SWVd|$t1F57j"jdh!$S' l7Iu1IPSQB W9Vhx7 SWVo8 f$D$@=u1H$jjSPt h $t hh $5o8m 5o8 o8j Dž,y h $' =7t TI8j9t+t&1ONthSPC j2u=TI8(u jj 'hf $@ =7t TI8j8^_[V@07j ,7?0^USWVP,7hj |$ 7te$Ԥ7\71@K$\7Ԥ7177E7 TR8CthQP$ ETR8 <77<77󥡬o8<<o8o8@@o8Q8DDQ8Q8HHQ87LL7@I8PP@I8DI8TTDI8HI8XXHI8LI8\\LI8`;XI8VQP# VWXI8P# q;iI8VQPs# VWiI8Pa# PI8PI8;zI8VQP.# VWzI8P# zM8VPS# VUzM8P" 4$Vj=,7t,7jփ^_[]7j&=h7t#l7@=u1Hjh"Pq> 71hZ8,7jh47` WV׉΅tF=u1H$fD$1@1L$tWu1JfD@iQPRJ ~%tD$t1ɅLɃ ȃ^_V|$u&|$ t5l7h $ TI8Q o811j1xt5V o81Vh$ $X TI8jR4^5l7h $? fUSWV(1hc"Sĥ$@0 77>$7O$7h!$N !$t 71@77777 77777 7$7,7(750747587<75@7D7H7L7P7T7X7Y7h!$ tVPhY7  9 I\7h]"\ 6!t `7h!$> h$P蒤tFh%V耤tJh#Vnt5l7h7 K=7th7h͹#5l7*Z 5l7jh@h7he2'tEt W=8k\70t&ƅu' $$$5l7P / $~ t $=7t 8j 6W \78\7058V = 8t'~t!l7HQP;H~Q~  PjH\hRj hj ^_Ã=h7tl7HQP~Q fPj [fV57u<<"2t!@"2h"P谖tFuh#$j< 57#$tPhh7J3 7^SWV|$1t*<"2t!<"2WPDt Cuމ^_[V57u<<"2t!@"2hk$PtFuh#$j; 57c"tPhh72 7^V 87 I8 81I8 \7A85P5\7:t8^USWV1|$-2t}D$2111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,h#D$P"t uu ^_[]c9ơl7=7#tQ$$Qh"$$P.V 2t72 7ttPl#PV^9 7uV-jVf D$E3Vxtǃu&Vt$hY$$ Vt$hu$$5l7UE|$tw7j h $5l7gU"j 7t$V t$D$PjW Mr^_[]USWVP  8 I8$t!uLI8t.u=I8A 89!"2"2I8 I8A t tu I8I8tu$I81BI8 I8$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5 I8  8;$ I8  81tu I8I8I8^_[]WVt$ t8<"2tD"2VPȑtuVh$$j7 G^_h$$f="2u b- "2l7@=u1HP4 1;"2USWV}uCjho8 o8o8o8o8o8o8(I8 ,I8 o8o8|$(jWO (I8(7 ,I8 ,7w+o85o8G1;o8)ʉT$t$o89o8s?D$0o8D$(L$, o8o8o8=o8D$7D$"7ʃ|;D$L$y =7`E\$ |$tY1${ {{;{{WSWH ;{{{ {{|$$PS\$jU$1ۉ___ __$PWj 1@G ____SW|$ S\$7H =7fDŽ$ 0I8t$Ph $hQM1F$I8 I8ƒ\$x|$|l$x%ݜ$݄$ %L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)Wh&$QPMI89|ӡ0I8tPL$ L$ )΅~DQ4))hc"Sh̜&Rh&$QPLƋ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4&QPh&$SW LL$(+ o8T$,o8\$0+o8x@BD$ډL$hT$ll$h|$@,7 (71G؃D$@5ȵ%vqL$`\$dl$`%ݜ$ܼ$%1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4&RSt$Dh&$QPJ $I8 I8ȃ,7(7D$u݄$|9s0;T$ D$r$|$\$|?؍<)h!'$؍<)h'$QPI N+(I8 ,I8T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh7 VD$ B J1rrJVRVA $^Ã0D$4L$8T$ 1ɉJJJ JJQRP  x$1H0V0j0^USWVh=7u=7u }t$XjV +o8~=o8N+ o8y@BD$HT$Ll$HL$$D$$5ȵ%,7 (7Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ иc"t@#|$d54I8PRQh<'$hWEF|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQc"r@#+|$QRhO'$Pt$E$ų i)s<$*<$Hrr޸t1@D$))kd΍ o8HQP~ Q P: ʍHr̃t"1o8HQP~ Q P \t"u5o8HQP~ QP o8Gduo81G o8HQP~ Q Pd [~#\uEo8HQP~%Q'H wr? t:,u3P t%o8Gdzh($H\ 1No8=o8i$&ho8PR tu :v2USWVՉho8Q)|tDj.V1ۅt6UP|u&)Who8Vw u1ۀo81C^_[]SWVD$=7t5TR8h($5l7z= nD$t$h#PV` uA 77t7t$~Vt. d79PQTI8^_[Pv|t=7t"=7t5d7h4)$5l7< 1G=7 Sh%hzQ8 =Q8=Q8Sh[)$hQ8 =Q8She)$hQ8 = R8ShC!hQ8 =Q8Sh%hR8 0R8=71PPv h)$j< WVPh7ơl7?snt$h[*$P; Ɔ7 7?)PRQhe25 x?t$|$ 81; \7 ^_Ph?*$ ^ha*$t$h!*$5l7C; =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=t7tDt WbhI#$.$t Vah8$PD$D$ L$PQRSm:4$uu|$l$ 7l7tQSh*$PS:Sh*$PB: D$WjPUhe2tU57sƉ$t=7t`VS<WFWt$P Wh#VJ WSV? $t P`4$Vh $莟uD$uqh $ t66h"t$h!*$5l7G9TI8kt$VD$VPjV D$Ph $Ƌ|$WPjWe u{D$ u?h' $  tt$VD$ VIPjV D$ 8Ph1 $肞Ƌ|$ WPjW 1ۃD$  ˀuPh1 $>u_4$dZ81F=7uR7,=7lZ8Sh)# Ouh2*$U 1$tP^$|$t.WCPjW D$tP^D$|$ t&W PjW D$ t P^d^_[]h@h$h7 \7058Whh`R8t u`R8`V8`Z8V57=|7u 7h $軜t>hl)$hk8r1ɀk8.)hk8Phq)$5l7p6jh)$hk8  tfjh#hk8 tN=7XR8t\R8j h)$hk8z uh5l7h)$D S=7XR8t\R8Q8j h$hzQ8  thzQ8hT$5l75 1HPR8LR8HR8DR8@R8Ht^Vh-$j hh`R8Co t`R8USWV=hZ87t`=7tW$twDt8PhhDp8O j hDp8Dp8tJDt81P2Dt8Ht8tNjwtHt8Ht8t$h5`7V |0/thh$V߫ hhk*$V̫ V>5$$P  7L$78I8$-718I87$ t1=7PGt*""1SSQPVh$a"u8TI8d$$r tk8$ t1=7PND$7$8I8-7hL"V/Dt8V=Dt8t2*$75Dt8rDt8Vhy*$(  h*$L 1^_[]USWV,=7t8l$@11 SjhU tUhN$dL ",^_[]<$tދD$0S ,^_[]WVP57=|7u 7|$=LR8tft$h*$uqj hk8@j WP(H  =pm2LO@1 5l7jj(h*$ru=TI8u=LR8u LR81HtJ=|7uA5l7hk8 l7HQP~ Q Pj k01H‰57^_USWV457=|7u 7\$L=TI8=@R8!t$Hh+$Ғ+j hk8t|$j.hk8thk8,k84$uYk8519 k81f u>hk8h$+$5l7L, fk820hk8h`+$5l7+, k8t$1 UVhs+$U' D$(V- !у $ 75l7jj(h*$u=TI8u=@R8u @R8tj=|7ua5l7hk8 l7HQP~ Q 0Pj q.# |7tUh+$5l7+ 4$|$57=TI81Hƒ4^_[]t$h+$j2hLt8k tLt8h+$j USWV\$l$jWhh#WhUh+$S& Džu&Uh+$S& DžuUh,$S% VjKh^_[]SWV`Z857=|7u 7=TI8h*#`V8u_j hk8ڽtL8tGx"uAHt.1Ҁ"ux"u"@`V8ZHt@r1Ӎ`V857=TI8^_[SWV$h$V VY h%Py1Fta\$SWdd t?|$/uH$VPVS| 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRho%P* ƅu 4$"* 1$^USWVHu\$ $Cj j ShWuu h t I"hVW  j VS 7]t/M I9Nt vuvvSR jjS ƃPjS \$fD$=7~%|$@jW趷 7O$Cuu S VjP: 1D$ PWhp! D$ PWh#h,$ 81\$@jPPhSvv thhI"S O8Sh,$負 -D$ PWh+-$%8$\$=7~N1PD$P譶 T$@L$H+T$+L$x@BѺMbiy1fD$ PjS| u,8t8#tj}ud8AuZku<FD$ t:D$L$ PQhhu t\$ ۋEu Y "D$ PWh$耟 1He^_[] t$ SWV|$GHO~H0^_[Ë\$1NW{u4G `f@u8t 8#ug GHO~막뭅trUSWV|$\$GHO~H^_[]1M;G~ uWS u4G `f@u<8t 8#ug GHO~렉륋t$t WV|$h#Wt.ho%Wt!t$?tt$ h`-$ 1F1^_, th-$j Vt$ Vt$ - t^Vh-$j USWVHE ML$8t$QPVvv DUt$F|$ T$D$+T$ +D$(хy@BMbiy1IVjD$P4 u)8w8#iMtuL$E5l7>57Ph&$V << MA(1e^_[]ËE@,$G(8<$t19#u‹F9~sWP99tF~WuPP ~ FUSWVP|$ Guh .GG1(,O _91G G1Fl$WVVU'tY\$GOQWG;Gu!,EUwt8tGo1F u$ G(1@1(u8,t<_tGO T$t$)9|JSPV= _ ^_[]DUSWVPt$$\$ l$|$WSU tU| u2HDeO,1t,$t,$G(EK9u61Cl$WSSUt|$ ut[.$G( t^_[]USWV謔h!!Pt+h!Vth!V{ut8t8u }h.$VWr Hσ s У"2߃c u1t8σdt ltntHt8뵈t8t8맃t Vu'_29u=t8q1z4$9-u yt$$PQ@X1ۅtw<$uat8tX28uNWƃP*VWP 3.gz$PSW߉ޅu4$h1$\1$tE=@Vh"1$t$$=t815t8=t8jVH DžD$PW $$P VhZ1$D$V=t8$=t80Ɂ==11BWjV $=t8$uXhV1$Vh$PWK9r DŽ$.gz=t8uhh W& |<$D$D$P_D$ T$W =t8D$ #D$H=`t= ujV xLVVh=1$;VhiN"*$VhiN"Vh41$t$/ u h1$VD$ !=t D$D$pD$5t8hVW W|<ǍWhV1$1tI=t8uCt8u:Vhh1$$WhY2$-he26jD$P|$W- t $Vh1$1PPPW=t8$uL=t8uLhh W ƒu 1@P D$ 1@P T$1=t8uW4$T$WjVh)/$$P} t$t S7N| $T$ V1PPPD$T$4$1 t h1$D$ tP t h1$L$#L$t8tKfjjW tT$PQL$ʱtDWh1$b4$u WSVh1$WhiN"KWh1$*$l$pT$ 3T$ϋD$1 u V4$< $Qt$Pt$h2$s4$ $W|h!$1B1PW 5t8/h&hX#hLf2 jVLf2h&hX#V  Phu2$V  jUSWV΍D$PQqx#L$D$xt$hB"1L$h $tS&$ǀ=t8u$h.$jى\$9r<$SWV t*t)u1ۋD$)؃tǃwh.$ h.$@<$D$1Bh.$PW|$ WW3e^_[]h!+PD$L$ $QP3 =t8u t8XPD$L$ $QP j^USWV׉ˀ=t8u h2$g t$t8jjjSv!ƒt7jPS tuh.$Tl$h.$11PUVWh.$ ؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph.$jVL0L0D0.Vh/$he2  Wh." ^_[]PD$L$ $QPC* =t8u t8XUSWVpT$hL$lhx!}ha!D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0ReuT$ T$,:)QPt$tE t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$ &1@ɽ9jD$0PA|Ń|$<T$1D$ D$,8@D$,O|$01PPD$(PkT$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0 |$_ $&Cىt KDP@uD$ pm2|$1 ,,C t ^DH@ujGt-Ê pm2DA@CCu 1OD$" 8pm2L$C CDP@uʃ;K}/ K>C<\W O Cj$jGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E8ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$~8$$ D$ PhWZ  h)G1$C<\  Cٍ$ j  H$$ j  Êtpm2DH@tKCu$ D$VVD$PV5z Ǎ$$ D$ VVD$PV5T 94$ =j21@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$~8L$ QhP ~811 |$ 1 $Rg4t1BuڋD$8L$ Qj P94 Ǎ$Pj t$4 ^ŃuuD$ L$ }D$HPQ4xWt$ P< $(4$hUt$P L$l$ ȉD$<9 ɽ|$Xpm2CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't pm2DQ@tVFu$$  Qσ s[j $( PS; 8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A pm2CDP@t Cu;|kwpm2Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VtE =8 hh Vh EKCDH@uٺT4$yG=8 GKoCDH@uٺ^4$KfCDH@uٺk4$ GQC t _DH@ufA%ƋD$pW脽@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVSƍ$ jhU0 uG1,|8t!9}uEpV*mj |8xt$p@ |8>GWVt$F1Ejhht8f Å1|$څ,5858h4$|$t5858h2$t8 t811<|8t6 uGp5858h8$E W߅uFu48t@Py88\8P``8(^_[]R5858h*3$j0 5858h3$5858h94$VQR5858hK3$$P5858h3$$P5858h3$jjUj 5858hx6$lV5858h5$UP5858hU6$>5858h6$(5858h7$Q5858hf7$5858h6$5858h7$jj- 5858h4$5858h7$5858h 8$5858h88$n5858h4$X5858hr4$B5858h3$,$P5858h3$Sh $95858hJ7$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u48_NSFJ1<|8tJ9ouwvSOt?G $pSH|$698^_[]Ë$@S5858hk8$j SWV׉HЃ s%j SV G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S0 uC9\8s\8؃^_[]Ë58=8SP PWVh?6$j$ USWVP׉΋$1m~ w]$̞& 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x "2"2>u)jH1҉P5"2 "25ojnH@"28 "2>u j5t8he2Uu 8P h!j5 fPPh|9$hLf2 j USWV\$|$t$ 81EtB5Ć8WV 885Ć8188Ht8hL"p Ć8 8I 8Kph*"jh̆8 rf8"8 ...8̆88@Ȇ8 8 =8uȆ88#uxnu 8  Ȇ8W1 t,E-Ȇ8@J}88R)ʉ1ɉ89‹\$k81m1 8Q8u>#u~nu 8tĆ81B C1ɾ8f 8@Ȇ81ɋ\$u8\$t1A ^_[]É>Qh $j USWV|8uN 819u:=8u8e2e28#/$ 8e28!81NHQPPI8=e2P=8tC8SS58 th858R o8=8tM 8t=e2tP葭V 858h8 88=8t88 8@88=8QP'rf|$󡨆88t0W588V貜 W58V^ =<W58$V耜 W58$Ui V faU. PWVhp9$Wh8 9h8. 8޻t=e2t Ph""h8  8rH9tt$t$PҼ 8H9tȋL$!QP̼ 88=8u88 8e28!hL"Pq 858h $!c 88$@1Q58P2W 58h8h8: ƅttb8|0 uNt$@ $@ $QV58P81@|^_[]58h $jx 58h"hX9$hB9$58h89$j h&9$h&9$b =8uh/9$a h8 j h9$벡8@ u:HQP~ QPt58PU 1=8t 8t SWV8X1t^hL"3 t&Nj@HOW航uWZ[뾋HWPaU W81F^_[Vt$Vgt^Vh:$j Vt$ D$tVP)uVh:$j V^WV|$t$ WVt^_WVh:$j SWVP\$|$8t P]D$jPSW PL8VPSW 8^_[USWV8jh891FD$ 8t8<8JBtOz T$R uW|$+;A 88d8ыR L$y th|$ 8)щ;HT$7D$t{T$A 88+d8. 8;H@ 88|$tod8u1ۉ81;A81;AT$t1~T$ d8=`81ۉ__ WjWSQPZE|$t4JT$B8 8;H`<8T$d85`81~>~ VjVWQPD1FT$1d8=`81ۉ__ WjWSQPDT$t tCsBtt$u 8;Hr<8xt$t81BtȉÅQJA7$&= 858$=8FPj Wv @) 8QPWF t8Ҿ5=X8 X8R҉Y = 58h+!5 8 u 1Pjh"8S1P5D85@8)1Pjh"@8S1P5858S%1Pjh"8S1PS = 8 T$8=8GPj SAu ƅ $8D$4)أ8$8 508489a88j5D85@8h8j5858h@8 4 5 8rt  T$88D$<= 8e2="211 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;5"2r5 8jjh$m5 8j$O 5 8j ? 1-RL$ tKQD$ ;"2r5 8jjh$)m15 8WjSmt$ tsQ5tejPhd&Js tQF;"2r5 8jjh$l1d&)q:$Phm:$5 8 Z;"2r5 8jjh$sl1t$ D$13Phy:$5 8h F9ut$ t$L$)4"2F9r5 8jjh$l5 8j$ 5 8j  8@ @9  ֡8  8u55 858j58k=$8t5 8j ^ n jh8Y  85 = 8( 5 858j586k=$8t5 8j 볋50848988+8T$JQd8T$ut Q;P 8T$Id8D= 8yBu%hh rf F 5858P ;8 jh"r衪  _ T$=@8ujjhc"h@8  8D$08D$,8D$($8(8,88@8$8L$(t$, @85D8L$0 H8L8T8P8= 8_ 8QZ=j298 @ 8 89r 88֍48@PQ88508 F@+6vFt P: uF6^_ËFp vh $jޭ USWV ՉL$l8h8щT$Љ$ pm2`8E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B |89r7 |8P5x8x8h8l8$`80D$SPt$V 4 it}ŋ4$L$]\4$L$t&uE\|89r+|8P5x8ƣx8h85l8F1C4$l8l8\$D$ |89ȋ$r+ |8Q5x8;x8h8l8 ^_[]USWV`}$111D$h:$u W uu5$;>ut0Gtg$;;u$;$8u _2ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1hJ%S t+8ttDGh:$jڪ 1E L$32 th%P u3h $jʪ tD$PW[ uh:$ۃ|$ tt$ uh:$뼅tt$@ uh#렋Cu/h6#j{$tjh:$VV脨 VeSP QVh:$ DPh:$hLf2 j菼 UVQt@t $e^]Vh:$j荩 WVP։1ɉQPWcr V?t$8t1H^_՘8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pVo Cf{~a11C403t?L$qPt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPF tvPVv F vvF^USWVP1k<j02~4j02$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<j02j02$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)op phLf2jjCh-;$Vj V1=8TPVJ t* jjj VVO5X;!85X;.8j5X;@8jP8t#1ɺX02A<.u81 1@^USWV D$0f 98Z 8,I fEE!f ufE(Mt!U1f~ t @9ufE,$6ZtE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? pm2DAhLf2j2 Wy@$&MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$&E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuLT=m$ 5T;菠5T;蟠1QQPS?t$V5T;5X;b1U)19}1ۋ$p$)ŊEt9}1< ˊEE5X;h>$1VV5X;;UVj5X;)Vj5X; 5X;5X;1= hm2DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&hLf2j1 bxu+=8 8σqt$VYaVVGu5X;IhLf2j ,$,$fUuE 9|)BfUhLf2j ,$T$4xut EfEuGza|1x(| E9}ED ufMhLf2j !}Eu)uE t uPpużf;}]D; jt|QD; tt$4UЃF4; ~ttt$4WZuE tuPӸu sE uu{sE8,Et)uE t uPsuȻEtPQEEf~3M1tR'MEGЃ9|׋E4t t$4UЃurEE tPrE ^_[] Pt$58t$t$h>$hLf2j ZO$@ t$St$t$ t$UPh?>$'O $A It$U58t$SQPh=$hLf2 $j USWVT$qЉD$ q9Gud$ T$T$ $P$ǽ)j PtI)1Ƀ QWl$ U|$ WD$p~tS;tNt$Cj S/I)؃ QSVWD$p~t G}uo $ $l$Atl$|$q~KL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufth>$VSwv}|$Gu1PPw |$ GL$G)VQw, wA ^_[]D$L$8 fAËL$1x9 8~8USWVl$0.89}=8DP58wǍ PjQ5j =8ۉ8t @tFj$Pkwt*t!h O8 W^_hËD$L$ttu*hh8hx8 h8;Vt$ hNN As'T$fzufJvPh!$huhhY^ËD$L$Q1Ɂ~t't%u'f!tKu1Af fffHËD$Ik@ltH@1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH 1@ËD$Ik@ltH1@01241571h;$u 1@j81h;$W 11ԏ8jM1d8j%1<1h;$ 1@jj31jj$1jj1jj1ËD$@1@ËD$@1@ËD$@1@ËD$@1@á,8,jh@1 1@á,8,jh0 1@á,8,@QjP0 1@á,8,PjP0 1@ËD$1@ËD$1@Vt$ ѥ1@^Vt$ ja1@^Vt$ ja1@^Vt$ joa1@^Vt$ ,b1@^Vt$ ?1@^Vt$ 1@^Vt$ 聩1@^ËD$1@ËD$1@ËD$1@ËD$jџ1@ËD$j蹟1@VD$ 1F0V袟^VD$ 1F0V苟赩^ËD$119‰)Ѝ8hPPQQj jh  1ø81hPPQQj jh  1ø81hPPQQj jh  1ø81hPPQQj jh k 1ø81jPPQQj jhJ 1ø81jPPQQj jh) 81Á=8ftpthh8hc"h!81hPPQQj jjd 1WV81hVVPPj jh =8t#1GWVhA$] WVhK$N hA$ω hK$‰ 1^_ø81hPPQQj jhE 1hD81ԏ8jH1ËD$@1@SWV|$YRW~PVh;$S^_[ø 81hPPQQj jh  1ø81hPPQQj jh  1ø81hPPQQj jh l 1ø81hPPQQj jh H 1ø81jPPQQj jh' 1ԏ8jG1ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@8$1@8$1@ø681jPPQQj jjet 1ø81hPPQQj jhP 1hO81ËD$1@ø81jPPQQj jje 1ø81hPPQQj jh  1ø81hPPQQj jh  1ø81jPPQQj jh 1ËD$1@ËD$1@øh81jPPQQj jjel 1ø81jPPQQj jjqN 1ø81hPPQQj jh * 1ø81hPPQQj jh  1ø81hPPQQj jh  1ø81jPPQQj jh 1ËD$1@ø81j$PbthVhc"hF1hVVPPj jjd3 1^WVD$81hVVPPj jh t#1GWVhA$豲 WVhK$袲 hA$#z hK$z 1^_ËD$@1@øh81jPPQQj jje 1ø81jPPQQj jjqr 1øx81hPPQQj jhN 1ËD$1@ËD$L$A f@1@ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1@ËD$@%1@ËD$@K1@ËD$@1@ËD$@1@ËD$@1@ËD$@1@1@ËD$1@USWVPt$11Mf$0jWWSSUUh W x;}ԉ1@^_[]ËD$1@USWVP1A~9~^Պ\; 1ۋT$~N,$9uh>$PRQ\v>ph$PRQ\|$ Ft$uMh$v聹;FVx$9tكaw~ ـb(Qh>$PD t^WPS\$[F8tt$SVЃ F9u vo^_[]fUSWV|$58ti=8WwWwG-89v1W褨uá8t P 8=888^_[]SWVt$E2t58PqE21SSV2h 1NtjSSPH81ASSWQQPSTE2Wh =E2t@hX$W=]t58WE2WR ď81^_[WVt$ w?=E2t-t)95ď8r!P t;8slj4\;2^_588858m58 nVt$5888VLPh $^PT$D$ $1APYXWVPt$|$58K88D$$WVP1A4$^_USWVt$R5858 >-8Epm2\Jك@to@uwt uDZ@t< ty< =̏8u =ȏ8tI58@ttj 58=̏8uj 5888ȏ8̏8?=̏8u"58stj 58Dj 5841̏8ȏ888̏8 ȏ8f)81ۈD$u8C58Sst$L$4 58s9Ƌt$|258sVUUU9}j 58|$uCj 58fKVW58Z E߃ @ Ȣ88=̏8uW58rt7j 58%5858Uȏ8̏88858 ^_[]t$Ph $VPt$D$ L$ $PVP1A4$^hc"t$t$t$t$USWVP|$ \$$l$(t$5888D$,$VpUPp1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW蚢j581ɉV,$E|$@t[D$@8tRD$u:h$584Tt$@58"Th?#58TWt$Dt$D h$58S4$R58>pD$ 58Lp58p‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US58S588pth[%US58T/)PS58 58 58Ã~0L$ZD$  N#9 L$X1)<(x1 pm2~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP QtRD$(υ~] $9I\$)RPQ> KOuLuH|$@tAt$t$D|$WA W&PhLf2j D$z19Dzf tN;L$$} pm2DXuhLf2jק  $9A)RPQ $8GED$t+)j Pt$58,L$88D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P@ 4$踮0^_[]hc"t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(58l58l$tKۋ|$,;SN|$0L$Dȃ19AD$LD$Ut$HP1t$PQQ Źt3;|$,t.D$DE9}S NŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j PtC@j PuL$$)݃} 9WUQS58_ƅ|$ V}ƅtV5T;謆4$58PW58AJPWgF1PPWʽ W!D$E|$ GWUPS58迄Pŋ=8VEPWK=8VIPWE5888#WUt$ Sh`$58J1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV葼4$tWV`V'@W讈UP @W@^_[]hc"t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]hc"t$t$t$t$USWVP|$ \$$l$(t$58衻88D$,$VAUPA14$SWt$(^_[]hc"t$VPt$D$ L$ $PVP1ɉ4$ ^V58g58g^fUSWV $$$ `8158588$58W8WVP9 &Ft(=8tvvPc; vh8&B>vuɸ(88888hO$&D$|$ h$SU e~o~1pKrtCGD8붃fg5$;hL"V蹁 PhW@ \$h4"W D jPhcT#? t \$Sh|$W u4 ޹$&WbHPWVE t }u몋}tE$th4"S <=u͍4@h4"P Fh$Vi804$VW9 Hd8h8h8hʸ$5$; bSyI$$$ Fm$;D$/J1Wh$~u#D$=uD$h|$d}:h$/ t61WnW t@ < uFrWR) 1WE) jh#h#$葜 AR5X;dǃ5X;d1FVVPWz 8$gt5858W5 8hRy VjrGVjgGhӽjXG5X;&Rhh8cD$D$@VljD$ VD$1Åj2P L$t|$ o u*t$ %n ut$ 3$n j|rjUtc1L$ <:B @9u1PPPPPjPPj jUVPb4t(jt$W-WA11Vl|$ t$~14S4HC9uW:V1j tPjպjVh" ![`8j8j"8$u誸t`=d8t jǡ jjGȜ/Џ81 ^_[]Ét$ hT1GQWP PhX#hLf2| VAWr =hLf2jj,h$jr ŹhLf2Vjhи$Vr V1FhLf2VhEh[$Vr UWVV hޫ"; P"u 6|[=8t>V萙Ph$W<{ 5858D8=8t>VHPh$Wz 5858HD8=Џ8uhLf2jjhʼ$e^_]Ã=8tá8tt$Pm j}q jvq hޫ",tPt t h$s Zjh.w hjUSWVB L$QL*  PQ Ń j hN$UL ~ uF t$|$ Wo W-AfD/UW<\ Wjŋ>7PrEtn,$n ;nu:FUWњt^FPv蹚tFljFn ~D$P 4$ UV SP ŅS" ^_[]ËD$L$I41@fUSWV1t$d8j%Vt$t$ t$t$4$jjVP;=d8P~t$Vj >hj]jYj߄{jVf4ʁVIVjj^4?15d8踯s{,8VPX~Bjhy,8jPWyjhx=8V/Vbu%,8ǀ$jhxup z,8Ph $jX jtO,8)tTPCu2PKu#PuajhxP辚^_[]Ë$l$ D$jP輖tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uVYfVKfSWV1t$t$t$ t$t$4$5d8jV#jr4PVf8 ,8$*tKuKt!Pуt,8$P,8L$$Q3 tXD$t$VSVx)VOu$u$t*VB^_[À)ujhbsu Vt5T;w1WW5X; 5X;5X;wSj X9;xhj_jZjC]jVkJ$$!}E'USWVο$WQSJ, Wh%$S{ WSU., Wh$U_ S1tGUt0VVVVVVVVVVVhQ"h41PP/t US^_[]SWV$SQV+ Sh%$V SVW+ Sh$W Wit VW^_[WV1t$t$t$ t$t$4$5d8jxVtkjo4PV[5xG,8*tD$$tL$PQ^t$VfLtV誕^_ÉWj $?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QV8D$l$1@$4V'89D$pPt$V; Z$DaD$|$ $%t umpm2DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5pm2t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8upm2DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV肆 \$ 9tOL(tu(D, $ $ rt04' Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW5 58t@WPh$Vm 58u5868sh"hK$m 8t*W蚋Ph\$VFm 58.5 8@0AtPh"h$j[1e^_]Php$hLf2l jc UWVV? =8t>V1Ph$V݄ 58~58658wh""h$l 8t81h$W莄V虊Ph$Wv 58$?0FPh$h$j[1e^_]V1hhPhPjjPj jjhE2hи4xjP訪V輹^hLf2jjh,$8tPjjh,$jjb SWVD$x1|$8t8Ps1; P]PVh]"W^_[USWV$$$L$$QPhVqg $hL"V $D$Wj1K4$j 1G9r6|$  WUŋ$(\5F4$ ÃugD$ PVuH|$dhL"Vj $t:|$G=8tVh$h$Pi 1KS1D5$$t 4$ 4$3u8tVh$h$Pi 1ۉ؁Ĉ^_[]U袐$$$1KO USWVu ED$l|$(PVW<  ED$8D$1ۉΊ<'t  j Fj'Vu Vr0ljt$ t$PSW D$ t$ )VPh:"L$Q h8$Vzp t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/W` tWl É@/ WY É|$PD$|/S? ND$+D$D$ .t Vt$W3 tS? Džu]D$T$L$;ȉD$Pt$ SD$L$Wt$t$ h;$P 뒋D$L$T$;t RPS |$\$$h$Sx G|$\$1\$L$<t$0Vhht@W fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=X;jP|$ W* 5X; n$\$E28t P8t PC£81t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@58L$@EL$D$D$9}t=D$hPi(=,F7d|$u9Mx{;5X;tVEjP聺|$ۋ|$t h"(hP'ce2H e2~e2#he2T*9Nj|$tcj. ;5X;t V|$ t E%u15X;ٗ5X;{j5X; U3ct$(胆twPquW_D$td$8u-e^_[]D$t$ h#$j_C Vhǽ$PU 1Sy6 1FVm6 Sjh$}5 VSCX +t$B6 $ D$pL$|PSt$(y t$ ]8t*t$h$PQ^ 58'88t*t$hX#P^ 58'8hÈ%D$ 0*u.h$D$ p)ut$vm t$e s h8REtt8tjPn8 u%t$V6諲 6h$ jB(3L$1Ph$ USWV։5X;蔕1@P5X;R5X;$`h 1PSU & 9hP$M:hPS1CS% 9Wh $肂:hg]$$FPU"Z`5X;A@)VUPRQ5X;\tcjP躦t05X;苫PV葪5X;!PV91PPVܶ V_^_[]hLf2Sj+hB$SR fUSWV-1@=ԏ8$h#$Pjq h:rD$1D$ $ $?$V"9V$VWMPWt$ w VW2G|$|$&pm2D$W"PWt$ O& uD$L$DAu >uD$ |$O 4$ ))ht$P FD$ |$$ ))Ƅt$茁$}8 }? jSz ƃ $NfF9Ju1ҹhuRRRRQRRQjSD$DPjuǦ4D$D$D$ D$ jtSD$ Pt$yD$ p ԏ8 )) hPh؏8 148&jVh؏8$ t1GuD$(VhX$j@$SU 1PPD$0PD$XPS t|$Lub4<&h؏8h$h-jSj"D$L1QD$PPQQS Shj$s1=؏8su=ُ8lupm2 ڏ8DH$D$$Ph$| u5$nfsu( $D$1@D$ |$$tD$$D$$i jvjh1Wt$TV* j!W|$0W iW&]hh$QCh08PPji=08 h08PPhh"h$W Ph($j+o hP$Woh$WohQ$WohT$Wnh08h_$Wn =08t!h08hk$Wn $9hv$Wnh$Wnh$WnWh$jtnh؏8h$h DŽ$h38VVj~j h$V胚 38defa1ȋ 78ult1 j h $h38F 38manu1ȋ 68ual1 381 38none1 78 tlf=38 tb=38t`h38h؏8h$jtCh؏8h8$Sj~$$'|38ؐ8hh$HOh"Ifh؏8h$h$hL [ 8 ؐ8h$D$ Pj3 ~ht$ hܐ8  t$n{j hܐ8thf$D$ Pj ~ht$ hN8A  t${j hN8t=N8t ؐ8h$D$ Pj ~ht$ hۑ8  t$z=ۑ8u:hp$D$ Pj@ ~ht$ hۑ8  t${zj hۑ8t=ۑ8t ؐ8hhڒ8J u=ڒ8t ؐ8D$1@$" h/8S$W  Vڒ8PPjxVۑ8PPjw SWt%ؐ8|$$|$ t |$ujٓ8PPjye|$t j8PPjz^hٓ8 =8u=$=r!ƒ$t$=ujQh86  j8PPj{hܐ8PPj}ؐ8u4D$D$Pj|$uhN8PPj|=N8##tN8=38$t38=ٓ8tٓ8|$ti=8##t8=8#t8=ܐ8tܐ8SVWQRh؏8Phڒ8hۑ8hQ"h,$L=8##t8=ܐ8tܐ8WVQRh؏8Phڒ8hۑ8hQ"h(jjj xP ( 28$Ph $hb ha}<h؏8h$hSL S"jrjQ$H1WWV$Ph$ t( ;$P$Tsh$jPbt^DŽ$ 1WWV$Ph$z ? ;$0$4&h$jPh`uq58 1H t$t$6v1t$t$vh-$j<$t$jԏ81@$F=N8h""hJ$N h[$jft$(V VlPh$hx$Wtf=ۑ8thۑ8h$WXf =N8thN8h$W$jt8tPjj"hA$1FhLf2Vjhd$VB 58th贺VP h蝺hLf2P jgB USWVL$,!ij u!D$@tPX jPhٓ8x L$,%ij u!D$@tP jPh8@ jPPO ƍ\$1 jh؏8S Sh8i(V V;" ulD$PJhPh38 WKt;Ƹ#38SPU SVU WfKƸJ%uցļ^_[]VPh؏8ho$Pj"Vt$]- VjR- tfjh$V, u;h$VQ u&h$VQ ujh$V u"h"j, ƅu4$p^Ét t t@hVh28 SWVt$hVc uT|$tMƄ$j.Vt#GSVhڒ87 SWhۑ8 hVhڒ8 ^_[SWVڒ8SPhۑ8AhSh/8 =ۑ8tO)~!ْ8.uڒ8Phۑ8茆t(/8Vh%W Vhۑ8W ^_[ËD$wH&øc"USWV$Vh>$u $1퍌$Uh$W :HUUW f@$|$$jh$P 9tx/uG/$N~/vt$jh$Pa c"wH&1҅‰)ˍL$$QSRPh$hUC ^_[]Ƅ$8USWV΋l$M9vb׋D$tU|$t /u"t)|t<8P1ɀ=8/8QPh]$hh8B 1^ËL$1Bh 8WVt$=ԏ8u jG7Wj 螄u1@l858o1ɀ=8/8]$QPVWh8B =1ɀ=8/8QPVWh8A 1^_Vt$V dЉh8$^WV D$Ph8C u:$nfsu-Vh8h8* Vh8h8 tWj 蔃1F?t[h8h 8h$jPu>8$h8VWh8A h8VWh8A 1 ^_SWV=ԏ8hUؐ8u(h%Q\u9h/8h $U=N8t hJ$˵=08t h$赵|$h؏8h$hWP@ h""WƅVWPh'$j[h-|#V[=38th38hG$Vy[ h$jj[ؐ8uGWPh'$jK[=38tDh38h8hٓ8h9$V%[=ؐ8tCh$Th؏8h$h8hٓ8hQ$VZh$jZh"h`$XPhk$jZ Q$SWZh$WZSWZ=ۑ8thۑ8h$WcZ hٓ8h $WPZ =ۑ8tPh/8h͹#W/Z hڒ8hX#WZ WR h$jZh$Zuhܐ8h$nS=08th$XSh؏8h$FSt V jQ^_[USWV։ϸjPP辿 tCËl$hjW ojh؏8Wp WVSE S 1H^_[]USWV$΋$Ph>$ u tWc"V ^l$PSU 8<$u8PVUWh$hC1Ʌȁ^_[]ÿ$fT$L$t$!u/Átu#Ãt6u8h6h/u uhn@%!w&hhV D$L$FFhLV~ ȃ ^SWVP1ۉSSWSjh@& ~t{4$6V1ۅtjSSWPjh@&}tEh$V" t&|$\$PS׃th$j" uVXf VKf1ۉ؃^_[USWV$8&\$|$jSP5 ƅt Eu$wS7 wh"7C G^_[]WV$&|$u4&t%|$ jWQ t u1^_ËL$E24USWV1td։σSPSW  t u6P1PhPPj D$PUw, D$t΀8uɃ<$uð1^_[]ËL$E2w4USWVl$\$1}$hmW6StOD$SWPHDWWRt.ljFt(V$'E$EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ $V1VP 95d8D$40$X@h#P@tt$45X;?he2pP 5X;b!9r d8ɉt$ =1MD$Ni8D$$11t=i8,48tǍXUS\N݉|$|$l$$8,8ƀyH1ۉLPTXVUQ0 ,8" .hQP VUhh8 ,,8L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP,8$()1HD,048Ƃ(1 d8<586W8|$c[ 8P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً d8ɋD$L$ӾV Wc"QSPSl$GU} ,8$H@ VWc"RPQSD$BPK 8t% ,8QUHDRh$P=8 =,8$0@ơ,8$p&L$*QUPVWjj:WD$ D$D$ PjvD$ t.-d8L$QP5,8 u<5,8h_R$Pdž$l$,8()8 8 8VM8VjP L$ D$@D$9 d8yuƇy$u4P4 44S*$똋D$,8$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$9D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ49El$L$),$|4xfDŽ4DŽ49T4E,$DB8t$ 9zt$D$tj$DxZfDŽDŽ9D4B=ND$?P1D$ +D$D$$|$y+DxXfDŽDŽ9D4B1hPPPPjPPjjR$Pjz4$1K|$$8h $jW D$Wt$%sD$tvl4u^u3h1PPPPQPPQjt$,$Pj4ÃtCD$WSrD$lxSŁ1H$^_[]1M4$见$<t4u/h誢hPh2F2 ,8F21@멃=d8yud8d8s19dL$w BsÁt1USWVD$$,8*t1G.$ )$PhB$hVS/ $jt(hfMVhL$h% j$ i$W踢,8$Ph$hV. WVh$蜥 ]h$Vjj\Q1PP3Ah_ jl1qt$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S6t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$T&h$D$PG '$D$,$X3|$0tPhe$hW- Whk$D$P $D$z$zh$D$P诊 $D$$i3|$0tPh$hW, D3t#Ph$j\$S, S\$W D3t#Ph$j\$ST, S\$WV L3z,"t#֐$tWRh$D$ P D3@z$t$D$$D3|$0tL3tQh$hW+ Wh$D$P蔉 $D$$Q|33$tK$PD$Pd W$D$^$!h$D$PA  $D$$D3 $t!t$PQh%h7t)$j4$UtQtUd3U$ :=d8t$ $QD3$t<|$t4øSZS$PW^$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRh$U EtjPz0 t4$T؁ ^_[]Ê$ h$WI$D$jV ù D$jQQPS S  9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uh$SSVUh$SC$ Pu1Vt$h$P4$S$ l$She"U h:UWVjPK1PSG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQ^_[9rwًz89y8rw19HUSWV ,81G*ZƄ$hg$进h""ha#菞Phl$jVC 58t ,8QPh$V* 5h$SC,8)\$J$WPZx$L$@PQ $d$ PV D$@Ph$SB D$0PV`Y"D$0L$8L$D$h "PTw\$D$H$194$h "W!FuށǐW$W SQ;t$$ *h^8tPjjh$x1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7>#tc"$:$\$t7ȉL$7 T$wX$D$ $D$$p&c"$uht$$P ?$Pt$hC$t=uD7L7qQPh$u.#$>#d%D>#t $D$ $ $T$h$R.T$ D$L$ 1@D$h$RT$ $D$L$ h$RuD7>#t$$D7c"@t$c"y$c"t$T$(c"t$T$ |$$c"t$L$,c"t$c"t $ c"t$t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h$t$D?@غRPh]$t$>ClE;F{Pp\$CPW SMt$0|$4hh褕L$0QjP7. P8WMtVh$t$y> SvM=8u#D$@8@@hLPih$\$ S0>h3$S">hM$S>=8th8hf$S= $ 1|$@VVPWh$ ;wc"r43#t43#Qh$S= h$ٕh$̕h$迕=8t h$評h$蜕1h$WL=S We^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ \&h$U虬 Ueuh $h$Ur U>FjVD1Ktljt$'2"h$d GW$$G$G w'2"Gh$2 G W$${$$C(s4C8\&h $ C<{@$CDsP$sT\&Sh$U觫 UstlSh$U苫 '2"U謡 FW$$F^ FSh3$UW F\&Uw F W$$F$^(F48ih $h$U Utl $Wh$U '2"U FW$$F~ ^Wh3$U轪 F\&Uݠ F W$$F$~(^48+4$iƷm۶|$9U81Khg$賙tzha#臙tiD$ha#Pj記 XWl$UVt$t$]I6NIOu4$=I,8Ph $h 1PP}#,8)t5Ph$hUY 鋔$ 1$ 91APuDFl9Ɖr:,8Ph $h6 1PP"969ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhbh$h$hhG$u3 L$T$jt$oËL$T$jt$XWV׉κ$jujWZhc"VhK"蘔 ^_V081ɾ 9r^^VD$08tU@8xtlIuAH1FVVjjhh080QRx tjh08j t08^À=08tjh08j{ 08USWV 1WWj^ &iP 6SPj / t$ ápm2D$1/dev4$D$iƋ1N/ u1FSt$$Pic/dev uDL$DAt|tER|$$t.jVj t pm2L$Nj4$D$/devG4$D$M[1O4$1O1VyE ^_[]USWVPD$tPpP11OFtFh$P%t.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T$w$PhU"h]$V!x ^_[]Vt$D$QPbLt(D$t%t!h"hPQD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$58.@ujP =D$1҅D$t 9tL$BuT$ЋT$P]1hPPh?"h"jjAPjQQhE2w i4WPZw 8CM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h#PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPk;D$1҅ӅtwUt\P,40U5t5L${|$P=$tL$ST$Dځ8Nut/$E t$AЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W9ŅjW9{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ /D$$@$;E tL$ A;L$tI1۸hSSh 0ShjU>~`^_[]USWVϋ@PD$ P-hFPt$VJ x1|$T$RtPQL =`81PWt$$t$$GD$T$1PWt$,t$,+ t$t$RPqh$|$dWq D$,tjPpW  t$ Wt$  |$F;pRw =D$G e^_[]WV|$ tt$F fG ^_Q^_SWV|$D$XhƋ1ɀxQPVh]"S<^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6<^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVh$h:1^_[USWVu $(&jVP uh8j}w jVwZ E2OE2Ot 5D$PQ0CG1*QP菂D$,W D$($D$$(D$ ,D$L$40$VRB$$(QVPh$hS Z8^8PG@$QP"B'$HffsWBD$Bjh$O1ۃt$D$d]h)$h$WkD Vh8$S\D ShD$W- S$Ph}Dt$VW 7W}Vۻ$PhU$$i9 1ۄ$hb$$]hu$PGL$LQh(%PB t$,04t$jj hc"RPjV |$LWpm2r \DZ@uWQVt$h$ht$ 1C}$e.1ۿ08PSWF t$L^^^F~ FFVhQt$ ? t |$dJSjV $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj hc"RPjV読 VSh#ht$b }G8@É؍e^_[]08=}t'fy"f8 g8NuEt FuXt1€1ɾi8( Ӏu A'w'h8 ' Àu A&r  uȃsƄ\$,04t$jj hc"RPjV茬 $PVSh$ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj hc"RPjS W$mPSVh$ht$ -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ h$q Y|$h$u Džtoh\&6tkDŽ$v/rDŽ$/dev,$$VuP D$/devf@/VuP Q踃낋E\tu xt@@AED$58$ttt$PуuN,8덬$WPUC t$/devfF/,8WPV  [S$\asla9aO$CQPUۆ {PWV,8$t(tt$Pуt Nj5,8,$1D$0$h@h#P5tt$G,8PUtTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVSK $WD$pV l$ UhJ%V ǰD$ha!Whc_#Wwtyh)#WetghQ$WStUh@$WAtCh"W/t1J%D$t$tD$VPSu VWSj UhJ%j DžED$4$v PS} t"vh $jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=`8SWt$t$X$1PWt$t$?|$u1@G84s8]$VPWSh8Y wsVPWSh8C 1^_[USWV |$ faa@D$>$1Cc"=8thG$j8VrPWh$h:vD$PUAD$h6858h$j訙x8rW!8u8QWh8Vt$D$PWh$SR$'D$D$ =mdt2Vh8h8} Vh8h8j 1$hVS} t$t$t$D$ 8jVV[ ~;Ƹ PV;!D$i jQPb[ e9]D$|$hr]Ww'o ~#u4h8h8 21jio8ލ$8Hf@9tJu1SSSSSjSSjjUVjlL4jmoPV>VMkt8Ph8 u`~*=8t!hG$jU18Pjn)D$WjS>\$tt21ۅ1C؁ļ^_[]h$h$h'h!$  USWV|1ۀ=8t}h8h"$jŕ ue8$]$8h8VWSU h8VWSh8n VUrB#N@1 É؃|^_[]ËD$L$I1@Ã=8thG$j(8Vt$ D$t PmVj=m5 8*^USWVPWj<1F?tihh8h8h$j讔uL88$ $h8VWSUh8g h8VWSUh8Q 1^_[]SWVPVj`<>u1@;8 $h8VWSh8 h8VWSh8 1^_[ù1@t U8It1ùtA?8t 1ùD$?8Au48ËD$48SWVhflhy1$hWV 㹔G2WSChWWh<Wj65|8WjWPVWXI4SP5;VIJİ^_[USWV|$1i/t\1tW48tI1r rr2l`0u&1q1ur1ۃ0݃侷`r @뜃|$tB JaBBxa^_[]USWV|$D$L$BJ 0uQ=x81۾X%-p8B0t#1urF48tux89u'Cϸp89t048l8th80 5t8|$Q-jVPh$W!^_[]WV|$t$ Nt tuh$Ck$$2t$jjPWV^_USWV|$=8t h8j;WWG8u8l$}QWVh$hU 1PP8 ơ8t3Ѓ<PU=uu#D$=ueߋ$$$t\8P{jۉt{uh#$jz$t]PUhK$h[Z$t`8hhSjP2 jP W V jUht$h V Ve tP$td8Uh $hi jj7ah5 81@|^_[]Ã=8t=8tUh$ju C481$th8Vt$h$VtV8t 88^t$-8u8USWVt$,VοD$j$t$Vto1\$l$t$GSVhVVj UPo L$Vtu(;D$0s"L$44mL$|$)L$OGj$W莋DžuD$@PPDžj$t$0b|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$V 1D$44U= D$44螾$D$D$ j$SƊŅm<$t$ >tV\$S VW$|$);\$u ^_[]hz$hl$h h!$[ SV5G21/t.T$ G29u9t 48t q/u^[V1ɍt$QQPVh$ y1t1^USWV|$(1$PPWVh$إ $D$(1PPWVh$蟥 Z$LF1d$Pj%J4$>$d&h}dg]$Ueh~.hhG$ehhUdW95 8D$hĉjU5 8O ʧ&PPqhVjU5 8P&VGt PVW< 谉WD$ P=St$5 8RO 5 8*5 8VSjhb$ j D$ PUl Uh%c D$(SSWVh$ $jM h%fMuQ1AtCjV u4Vh$"1ɉtjV uVhV$j) D$(SSWVh$Q u$~h$jTȁĐ^_[]1USWVhh$68tPjjh$过1l8h8d8`8\8X8G2/u D$8G2ڃ9t48u@X8Q/uD$/u.h8X819hajƄ G21@|$>Z48M \8L$ d8L$j5T;5X;5X;=8thG$j聈8l8h86P5X8h$jaa8Wj b0D$ttRN1ҋ0t1t /u oBrg48uƃ48l8148uAuVD$u,D$ \8D$d81@48l8^/ d8FX8h8QR5\85l85`8Ph$h` jj\/_5 8g]1C8tvh$hu>h,_t$FVj.~th.$j軆he$j謆h$j蝆1G@8@8th$jfh$_L$QPL3u{h$_$QP*3uYD$3$L$3$ t?h$h$Mft!h$jޅh$h5$a迪1=8thG$j訅8]$1L$VVPQh$踞 }t|$ th$jTGjS"e^_[]1F]VD$FVj/-F^SWVPD$$h"h${at@Ƌ|$]1Ph4$S9 4$WV Vb h$S^_[USWV-I2ta1FI2t&U7Jd1tUh $h] 111Fo u1tjh1@1^_[]Vh$]t$hPV萦 hhȧ8V x(ȧ8ƀȧ8h$Q j/P@$t8^SWVh$&]Ǩ8hPV V\ȩ8K5t8j ̩8Щ8PVh$hW5 jWh>" hnMV-jƣ8^V=ز8~GtOز8Ǩ8W蜚 Wѱ;ȩ8t18h-Y ܲ8A @fز8$Ǩ8$V y))L$H 9Jx .@ SPt$ D$PhǨ8B-=ز8-O29|uP5ܲ8 ܲ8QjP赠 P58 8 QjP| -O2D$%=@t=ut-ܲ8D e1ܲ8D8 jft$h$t$/d =ز8-ܲ8ȩ8Ǩ8Pf  8D G=ز8VL V; $$ܲ8B ز8fJhfjQPsĄ^_[]VPt$D$ L$ $tt$VP 8t 4$VP ^PD$L$ T$$RQP XUSWV$01D$$h$WL$Ph $Q B hP$WL$Ph $QA hh$WPh $QA 4$ P詾hj$t$ h D$ t$` h""PX D$\$t$ hS tt1h4"S > 4$0PP$4Vı u <.=tSh $t$t t$ hS? ut$ 药 t$聯 4$t$ t3h0Ut$FVj$~t$t$賾t$t$薾1Ʌ2jQ#D$t P D$t P Wh $h3CU jj$T5 8%1N^_[]t$ y t$ n V蕼11N4$D t$8 t$ t$ 4$ VD$FVjw#F^SWVPD$$h"h$Wt@Ƌ|$4T1Ph$S 4$WV6 V読 h$S]^_[h$h$S$)1ۅtH!t]! 1ۅÉ[USWVh:*#腈Pa D$1Ʌ$l$hgS#UQ ti\$WPSɜ 9s?hh$S^ =w%hVS^ =wjSZ t@hgS#U u4$R 1jV* 1Ʌȁ^_[]4$$ 1AVt$Vx1|TsrLc1f ^Vt$h$V迮tV8t 8 8^WVt$ D$wǃr9t\,tSPQj2 V5X;0V5 80V5X;8V5 8)5X;5 85X;5 8^_WVt$ V u.>vn0"PVWh$hLf2 $^_WVt$ 0PprPGt$>FFVj F^_SWV=G2/t/t$G2GtPV!t /u?É^_[USWVj$t$ t1ۅtKƉ|$\$FUShSSj WV) $Vtu;D$ rj$Vltƅu1؃^_[]VPT$ D$t$4$VP ^USWVӉϋl$jUtMƅtPt$V S3OVUP tP׃S.V%^_[]VPT$ D$t$4$QVPv ^À=Ъ8uaЪ8g!P8$|8$T8#x8.#p8&!8SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQPn $LL $UT4L$ L8L$T$T@Lƽ$$hVWUʥ uD5<w |5L Ku1PPD$P )ƍD$Phd@VC |$D$|PhedAV V耱f$1 GaD$P$,h$t$VTa 1PPV' $C]su PUhhت8t$t.٪8CD001 ݪ81 u=ت8tZF9|4$葰ja$,h$$0u` EPP jOh8D$4P m D${O1ɳ$$uƒrL+1Ht$,D04$t$$,h$u` EVPh#P` EtE @E w-G$9@  V蘯؁^_[]1D$L$I@P48wʀu?8Au48 481USWV$$1$hWV E jShWWh<Wh5|8Wj jPVW$$4SPV%1Ĭ^_[]ËD$1ɋ0t1ur48A1ËD$1ɋ0t1ur48A1USWV ։D$ $E1$ T D$$ ,$D$$7^ $E$u$D$$$$u$F\$$x8= \$\$$&HD$\$$)|$=h8=8=x8$ <$D$D$$@<$q|$4$D$ x8D$]$$] |$D$ h8D$8D$<$=ԏ8u$ByD$1Ƀ O2\$pJ2C|$D$$$g]$D\$$({|$!<$D$x8D$pJ2{=O2c"|$l$ D$D$$$kljl$4$ K=ԏ8u $fxD$|$D$$.$g]$C\$$'|$u1= 8=8=x8$ <$D$D$$r<$t|$4$D$ x8D$]$Z[ |$D$ 8D$ 8D$"$$juLl$ t$<$D$$i$ \$<$D$$i$~ l$4$2 > ^_[]Á=mM2ftp]$=M2PFSWV|$ty̩8GO4VSŞtRVP t{S5̩8Щ8VhǨ85ȩ8h;$hS jSh>" fGlJ2~"PptV2zV1^_[ËD$ ȩ8ƁǨ8 8fH 8fH1SWVt$ȩ8Ǩ8V~)S4:Q  F8F8F1^_[ËD$L$01覝fSWV1ۉShPS$ ?tD$$Pq t VӨ8V迨81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6fu61^_ðt$hzd@t$  SWV$1ۉShPSWRt/S$SPW3Vy 81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=`81SWt$ t$L$ T$DD$T$SWt$ t$*D$ ׋8t$ t$(2A$L$\PSWt$t$,t$RPPQ $`81WSt$t$̔D$T$WSVt$赔É֋=8t$Ht$H迍$PWVSt$t$A$PPPQ $VD$`Pjhq1@USWV u C(D$|$8hjW- wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@Ǿ&|$D$u$,&B (&B$&B &QP׾0&B@ tu Ǿp&pЋ$+L$L$8L$9Ǿ&HQQQQRPRPjD$ tjpm21҉tDH@tӉOGڄu܅tEۋl$0t/t)hq=#SD$ 螑L$ tEH/uj#EH@EH`L1^_[]/EHjSP~ EHHLSWV t$ vDh%WS 1WSSPPjjh= S=FDNHA`1 ^_[ËL$Ahh1USWVL$Ayt&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vD$F@ F58me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|b94$ukGllPwYGX FPv3t~C $i)ىQRP$ 1D7D77qfD7 D7 b4$~Efn'  V)RQP$ fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A wjOu\$ 8fA |$tAqfAAb 1AA tAfAA{ A ݃AufAAG) 91jEVVh-hShrjJVjVQPh@84C(OL$<@C,SPm{,BD$$4D$+{tR[L11HD$Cu5{t/t*Ch$P]uF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0%ƋEp%PVjWOUBƃu4UtU%ƃuEtDjUуƃu:C(C,SPJ{,1s$C$10s$mC$s(!C(1ۅÉ؃^_[]h$h$hlhn$ USWVt$ kFllPvuNj\$FFi )tkllklPRQ! ,$kl11CPsNj$ /L$s)RQt$  1/D/D/D/ wj{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh- WP1^_USWV,8t$ 1$V[/} Vٞ$T$GD$ pjVD$D$ 1ɺ<t$N#t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$$|$W+ 1P15`8ssQjRP͢#W$P+ CKKV5`8QPjRPW$Vr+ 1P5`8s3iRPW|$dWL+ $D$Ht$L|$P8D$TD$HPjt$( ƸPD$P$W PVW V>L$wA;L$D$4|$HD$0G8GjRWjPy D$1Ex tjSWjPO Ã|$tjTWjP0 jUWjP ۉt$t2t.$L$ PRVSƋ|$Wh'$Q t$$|t%L$ PSƋ|$ Wh7$Q t$St-$L$ PRVƋ|$Wh*$Q] t$ "L$ PƋ|$Wh:$Q9 t$PSVW`8D$D$] ٹ}$L$ |D$ L$L$<1jPWSgRPh͢#j$Pŝ t">tt$ Vh:$D$DP D$8D$ D$8t$XjVt$(1IQjFj QPS D$89D$ t PV$Pl |$YtZV MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV< )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ`8}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQP(dVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋`81щT$1)΋EM M1WRQP[cljT$1Pt$uu@c)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VScD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$h͢#jVɘ C `L$rL$DPh$uL$DPh$jQ茘 D$D---D$D$s8CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVh7$P SVh:$P VjWaSX`8D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`h͢#j$P< t"?tt$ Wh:$D$LP D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t Pg$PW=f{{ t|$uuxD$t HL>@D> >jhEV> wE%rhD :$uR1jPPPh%hPj jjj%VjMF4x!t$PW0Va1@^_[]he$hT$hhn$ WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ &N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; &tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$VhV#jS裏 t$]EѥfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=<8t@u.1}hGju tEx .$rt$t$M u@=Uu,>t'D$ L$,8;\M`|ˀuK(Ѓt tu tPjbjWuTƍD$(PVM $1 $$QPVS $VT9$ul$`=u]tP$PS4 $5fǃU'VTWh $h<$ uQe^_[]SWV0\$@1҉1 F FFF =88tjP4D$VjRRS0<^_[USWV,8(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$hJ$jkt1e^]USWV8=88EM 0~klP1 ËE E8؃lklQSP ߾&,8$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C u |==l$UhV uU[< t$V|$Wh$蒄 8VWh$Pr 58 h$]F0観PVh$j[t1PPtvV9D0$ t$t$Vhx$hWn t$; 8tWh$Pr 58 Wh $h$m 1 ^_[]SWVt$|$Fpc1V$t$:)ȉB8tSh$Pq 58] Sh$h$m WV1^_[WV1|$hVW( hWVhc{?t[hd诂8<$jj8$t]$WPQhWh$h 1^_z1. h;$V1h?h<$hAUSWV\$p|$LhjW' t [1P2D$D$tt;unt80P2+txhW$D$ Pj l8t Ph$hl8j FPG9f_PShx$D$PjN8t#D$$P6Pt$h$SIo \$S6$Si<$s XP2=0XP28$Ph$hl8jl8DP2E:h8h8h8& 1 P21Ctu 0ext"L$o oo/C G FL$5T;jr1WW5X;8 5X;誦5X;$USWV D$ =|8u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h$$h $heh$x USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]hb\$|$ $T$ tuR|$Nj\$QPSW g L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$9u @p9D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$D&d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth{A1Ot1L$D1 L$8ɋT$]t"9tjQP7T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(9u ^n9D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$T&t$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh{11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQA |$ƄE C ^_[]WVt$ hjP' ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9utp$1^_[]Ãt ux(tth~ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPVS >uD$ D$iousD$fictO4uQG4 t51ҋ5pm2D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuD l$(Phs$U3 h""U] [Ɖ$Uh$jYu D$Ph$VFu wXw\w`h$V/uPwdh$VuwTh$Vu f1ۍ{aE4p&WuWuWh$Vt E< t<uEMPWQWh$Vt$<I$9|"PVwtC9z1h$WTtV% D$PD$Pt$\$4Sh($h$WSIj 1(^_[]h$h$hBh$h$h1h$h$h h5$h$hhP$h$hh$Un USWVhj{{1O1ۍD$ShPS$4 z9+ōF,PhedAU= l$$4$0$($<$8у|1҉$$ F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$謱t98t4 .jPL$Q% D 9D$ u D$4$8,$F n$9Љ} 1F$F )ЃF n$,$G9t$1$$h8$jP r=t31>t9>u 9>t0uk9uV.V&OVU|01@19$,|;ЃVt$<0؁^_[]USWVHD$1PuهRhjx;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d&u FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h$hH$jg6h$hH$jh(h$hH$jih5$hH$jj hP$hH$jkh$*i D$T$ L$DrRQPy ËD$Djt$ P USWVl$j/UjN 1NtbNj\$)CDWPU=! uHD/t(t+t!u GF "u^_[USWVPӉ΃=|8ui"sv|$4L$0Rt$`VQWUR ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=9u [9~V19|(1@@89|~@w1A^_[USWVP=9|$(L$111=&"\$uӀt0t u@tӋ;4&tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h&t$(t$(t$(PPt$04& 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVDnhh&h 8  8k811KjdƃwD@&DtGCuޅtH=9PGd9t)1ɀ<t <&AuVt^_[1V 9t(91t ҡ9 9F9r9PPt^fUSWVPt$ 1h4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$h$jQQWRjjh}$(,1^_[]USWVhu}WWPHD$T$,8L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv,8@u ǀ@>1t$(F F>D$,Vt$<|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP2|$4r!1FD$0P2F;t$4rD$0=0訷D$p藷D$6艷D$vzD$  c"1ۺL$#PWVSh0RQ t$kPWc"PShPV,8VL$'Qt$t$t$ t$PPh`g$hg]$Ǻ,8$0Ͷ$,8$p謶Ft$uD$D$\$(1t1D$pT$xPRVу t\$8CfCC,ffC C :CfCCH=9rC fC*C,VG1ۍD$(huSSSSSSSjjWPh貓48P胓@,`st$VWrW膔FuQ1K58mt Pmt$A58mm1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h{$ha$hyh$P USWV$(E]0輬ƋEp謬ljl$E@ t P蓬c"PWVSjh\1U5`8|$ ww$t$R58RPSQV9 U5`8w$w l$458RPSPU9 G\$skhSjPD P迹Vc8j!h$Vm V4h裫7@%L$58PRUQ9 hv$58P7@%PUS8 hKPSD$Ph$hh88 1҃9Q8A \߉$4PWhѠ#j$Wz8 hWh8G Nw@EƆ8 Ft3N$t.1@Ƅ8-H9s Nr,Ŕ8$EBL$ ;QU8Vh$Wζ Vh8W迶 hg]$&İ^_[]USWVX] E81hc"PPPPh$PP7 9_ vSL$QSWPL t@D$ tWD$8uN 8uhƩ 8D$9H*hc"VhҠ#Ep6a+D$8u RPt QPVW҃`81VSt$t$D$$VSt$t$L$8QRPt$ t$h$Ep`D$V9p1h$YQVu WPTtY$UtOwGD$VPN)vVQj P W@ )Q$YQP H LCF;puD$VPh $Ep` e^_[]USWVLt$`T$d\$1*kvs0C41GPjhtQ2  9u vEL$QVUPL 1hPPhhhj6Pjjt$(SP衅4ōt$ VPqwU腆S_~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 58c_|$.8L$`ʉAfAD$ 1Ƀx fJ1O S _1L^_[]USWVpU t$01^F4jjX1AǾd&D$ǃ@&SPHD$ $,8L1OًP|T$|$`1 |$0jP4D$DD$ `8|$ 9ϋ$|$1HPPVt$t$WRQjD$L$4t&t u$Ut$ t$ hT$jt$_LW $ ^_[]USWVՉfD$/D$jh%D$5謔t&裔8t虔SPh]$hUa! VSU 991j/U t5ÍD$9tK9vH8/t@P  CߍD$ PWh D$%= h$PWe FƄ$/u&踓$QPh$hUy /h$PU hh%U e=@uW1 x*|$VW$P 9r>& ? 0|$W W 01Ĉ^_[]hU` t}/u }$$tcD$Uy Wn Ɓ`|$tVh$U3 9=VWU 9%|$W x(W 7, >1F1S 0jh*#j% SWVύD$ PQe 1xVD$)tOjWx@ljj PWc Wx u $=rɁ uƉĜ^_[USWV h讐ljPhW@j \$hjS jhc$D$ƍD$ PhW@V_ t$1hUS ,$ܬ&tWP u-8D$C E,$ !u1L$PPPPh(jPPjjj!Qhm4t$t%j=t$VWf_Wzn6V ^_[]VD$@t(L$ 4@Ԭ&VhW1h F 81@^ËD$ 8fH 8tPPQQQho$j跶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj f^>D$48T$y:D$ػ˺#L$~D$<P t3c"D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$c"t$DRQPh$jVX D$ T$Bj5`8QP c"t[%t$DQRPh$jV D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o58t$h$jt$hVD$XP1WWjjj0賕,`8|$4D$0,8L$QW<W,D$DPV[~ljӍD$DPV |$߉څu D$$H؋Pٸ"D$<h$t$ |$,] {t+[1h$Sj t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#ΊPt$h$jt$hVD$XP1PPjjj0?,j D$DPV( D$׋D$@tpm2@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5`8PQ} |$ RPh͢#jW ;8CVDSjP jPPh8X V8@(^_[WVt$ 5X;GQ5X;~$uFjP59F$1O~(1h8QQhz"hO!hRjFj WjPv$h8{e4F(x;F,VPOWv(afv$?F(F$~,v$n?F$1^_USWV4ˋA@Pjq$ C{$t%K0 u G \fG lJut&fG G5G .G G,/G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPc+{$4^_[]V$j)藆Nv811Fu >tlIut5t.j+ȅj,輅L$PVh5$jPQ8 'u tEj,j+荅L$jPPQ h"7j*fL$QjPT6 hg]$j-?t$R58Ph#jFV j.ht&PVh$hh8 İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5`8RQ L$RPh##jQ G<(\(|(Pu#]j#]L$>PSWh$j&Q%j5`8SW L$t$>QRPh$j&V $F|(,u)|$hgPh$j(W~ <$1e<(Ou*?D(Ltۍt$h趃PWh$t$t(Tt(PPWh#j(V 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPh$v:t 4$@;|$|$upd^_[]1؍L$>PWh$j&Q  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&h脂t$PWh$j(V 4$h^VjP lj|$D(dph-PVh$j(W *USWV,8$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá,8H1WjHDWWQZơ,8$1$ ,8@u <@TX uDHXT=d8tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W Wc"WRPPQ1ҍD$*W Qc"QRhQPŮD$$W Qc"Q1Qh0QP蝮&)ߋ,80D$pL$$QL$.QL$QPt$SPW/ ,80uNjpfL$$QL$.QL$QPWSSj'B0 hg]$0+|$pG$DŽ$$T$0<$tT$@BfBB 2ffJ B 2BfJB%2B fJ*B,32=9r~(uB0fB:B|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!8 L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Oh$D$ P t5h$t$ u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0X8)ދ\8\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$ L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$(. L$)։t$ t$A58 1Fh$h$h]h$ L$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4S|i tt<1^_[USWVGD$58l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 199ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX9AL$D$~@ 1ø11OT$LhuQQQQjj PWWSRh649tBƍ|$WPZ(Vn7x#9}`8k<4LE1UЍe^_[]USWV19T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=T8t*=( 911M<t9\@u 9DDMHEr=P8tO 9D$PP1ipt$1t9 :ut$P9t:,@uލEpr=x8 9J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@( 9D WVu)y8u.q$t"y8uqxu Hu^hA#h$hm h$ D$x8u@hA#h$hm h$u V 8; ,8tD8t99t‹9u€82t 8^WV΋$tRttyu)89tЋ9u80u1H|$58,1C1҉T TTCD /k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D /$k 9$t8ntyPh$Ut$%V߿ PV$ P> 5 9$,8U蛊 t4Uh$ht$%V菿 hV$ PY> 5 9$,88UL t4Uh$ht$%V@ hV$ P > 5 9 $X8l$~4Ph$hU hU$ P= L$ 5 9\8~~Ph$ht$%V赾 hV$ P= L$ 5 9`8~8Ph$ht$%Vo hV$ P9= L$ 5 9h8~8Ph$ht$%V) hV$ P< L$ 5 9l8$~pPh$ht$%Vܽ hVU< L$ 5 9p8~1Ph $ht$%V蝽 hVUn< L$ 5 97 878h$ht$)V] hVU.< 9t$PUh$h;WD$ 9ts $|$|$ u^ 0D0<4t|88uL$81ɋT<|Dtsu|$ $D$@¸Ѓ=|8@D$1HD$$D$1i8 9$P58\$ "$x 1ۋWSPQL $($0}U$WP W跆 |8/tW视 fDŽ/ 9 $< R脆 P$PW2 t $L|$$t0|$t)$P@ t$2 9Ǎ$vl$t$؉\$C$;X |$O|$\$@|$5D$tL$4= 9,$V豅  PVh]$hD$)P衺 5 9.c"tK"PS >tiD$Pt>Sh$hfT$\$  9$DL$4L$0 90|]t$V=Ph($WS 9( ( PQVh/$WSt$\$ CCa5 9.> >,>(>$> D$)Pt>Shq$hTS$$(t$,t$(r 8t P7V `81`8tWWh$CUWh $hLf2 8t8Wh $P 81Ntjh$P ^_[]1N =8tt$hz$jPuR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ ,8V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$輾$ytPmptYWtDžtFE tWPV" u WVkjVS E t VPV1HPPS| ƃx`80^_[]hA#h$hm h$ USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4&jP8 D$$tIWV<VH /11 11$? t1$@$J1$A( 1tiu`$B,\$ D$4he"US 1USSVVjjt$" S xL$1^_[]WV|$ 1uOG Pq t/1; }OQ("h 9x 71^_WVt$ F1hWP a dž dž dž$dž(dž,P40^_USWV$h^2t$hPVQb $$$ر&D$@{tUh$VL$ USVA$ 8Ouڋ$xhLuhMSPh,$V}C(~Phe"hV }hNHC,~Phe"hV }hO#C0~Ph6$hVŤ }hP#VPh,$W^_[]USWV$R2u*11IhuPPPPjj PQQjhQ2P4R2Nw'$R($&WP\1N1jWWVVjjhQ lS, T0D$4he"QPΣ 1PD$PPVVjjU D$PT x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP] 豙Qkd)Qh:$V- ^_USWV$h^|$hPW_ $$$&{hV VPh,${hWvvPhA$W'[hXp1~,t[hYS1~0W[hZ6ǃ4Vl uh^V0FT~Phľ"hW膡 sh[[h^1~`{h\vXPhM$WF\~Ph6$hW" sh]mFd~Phe"hW sh_HFh~Phe"hWؠ sh`#Fl~Phľ"hW賠 shaWPh,$V/[hb1~pPPWh,$Sr^_[]USWV$@1N R$fT$8& 1jWWVVjjhc|Gl=Ol,8,1۹dWS<S1,G,10G041jWWVVjjhe] 1`G`gX"h\id jhD$4he"QP% 1PD$PPVVjjU D$P x1pGp1^_[]1wwVt$F~|F Pi t1@1FF^SWVT$1ۉZBr 1Bl@ZpHQkd)QhW$Vt) ^_[Vu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_h!$h $hh$ت SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N FԴ&tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$8uh8s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IP sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW_M 6Pw$$$&@21^_[Ã!t*Wp1@<QKWPVrN rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Phj$Q D$D$uPhq$j[t1ۉ؁^_[]E@USWVt$ $=p8$Wh$jP 1t t^_[]Ë 8! ÍD$XWh$Pj1~jDjjtD$$"Vt$\MjVjBjD$(KD$T\$`C D$\D$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h4"Wɝ ƀ8tt1tCuVL$ D$ j jVn É$qj jVn t#D$Zj jVn D$T$C\$ \$D$|$u\$uthh$S hVS \$E61ۉSt$,j SVn É$ tbD$ ʉ $tQD$ D$tGjh$#t$}V tOjh2#Vt tdjh#V` te|$ush"j&hD$(kzT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j h+&l$}U hj蠤$tJ@j`PQT$S= T$ $B0Z,D$B8D$B4D$Du0|$`t)Ѓt$\PO T$uD$DЋL$Ht D$ D$,D$ T$HD$TD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPv<fWW߅uvF^_[;h7$h.$hh$ɑ D$phE$j iSWV=t85|8t^s3ߥtq=#$t$j(PV5 4$蝣_u9hsj|$0VPh#jxWx WVV &t Ĩ^_h#h$hh$ێ USWVσ=t8u hѹ 1t0?t+t8t!-|8E WPG tt/|$thhJ%S !hvS u4$$$$$St$h\$j ^_[]SWVD$Qt$Rhq$Pj h"t$WY$jh&P4A uWh"j.Y$tAt$h4"Wc 8tjt$2h"jX$ut$補1ۉ؃^_[USWVӉ΋|$|$tBh$S\A h$SFA h$S0A h$SA h$SA h$S@ h$S@ \$h "S^ ǀ?t( #&WP@ uE F@j`WVa- -j(W tj)P t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ A tLu;1ɉL$ L$L$ $1111ۉfwfWGO D$ G D$fG1^_[]Ë<&D$ 8&D$4&D$0&$D$fGD$fGD$GD$ G L$ G A똋$t$T$L$ fUSWVTt$h4&D$6&D$ 8&D$9&D$:&$;&<&=&>&?&PQRVUt$t$t$$t$,t$40&hˣ#j@\$HS4m 8D&@&Sփ UT^_[]ÐUSWV t$ ,8480h$h&\$|$USWV[x4$t$t$h$h USWV t4$t$t$VЃVc%^_[]USWVD$4D$D$0D$ ,80 $48DHD$,D$D$(D$jh>VU5 |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3he"WUFk WUUjU H>wѻPD$x0he"SUk SUUjiU H=wˉ,8DD$H1Ƀ|1M1҉$PVRU{4 1Q\$ SRPi4 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á8tq.8Vt$ 8u W. 819vFt=N| 9wu1w< 9 :9^ËD$Hs-s &.hA#hK$hh$ Vt$ =8u-(t;u2L$ rȃs&$tu091 :9L9^WVP|$t$=8uI-j PVG =v1t-h;t @ 9t4< 9^_Ë $9u։^_-=8&9t4&9ù^-D$1ËL$T$t$ h5.WV D$$s1!t$ T$L$7GWh . ^_SWV L$T$ D$$t$,|$(;sCShf-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh9@-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F VhK,^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Phf,D$Ph0H,1\$}UM;t;Gs} Sh$q} ~Sh$yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW? L$D$ T$VQPRt$Vhm$h$P(e $L1QhPjV:x`WhydPu D$V?|$t;jWSu! \$;MU}hy$he$h h$z 1e^_[]RSQ1! ShH$RQd ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSJ] )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H< 9)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSVjf )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SU @$\Cǃ1:k0hWV D$4WhPW$XlD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(e)tÉ|$UFd#D$0jPUQt$(-)1 Ⱦu#\$,hPt$  Wnt|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,PT P轢D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjjtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14pFuUpt$D$l$x P"!tn{ C K$;}sL$4QjSPL t_D$HtW< 9)1ɉAw Puu2S"j@jP| fdžUS#p1ۉ؁4^_[]h$h$hh$[ USWV4D$L D$PhjiƋl$X\$T|$Ht&W F|11Kn^؃N$F Fdž?džjh>US @džPWtwt%D$ D$D$D$F114^_[]h$h!$hh$Z USWVhED$$11@D$|$ t&1ɀ8>@,19QYvPW~ D$vP6^ 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h $h$hxh$fC USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D7ݹ15DQ95@Q95HQ9D$D$ D$1D$h9$WU9 pu $;HQ9e~ft$lt*zD$ƒbtCeubD$벡$;D$ ChjVV5$;hD$ADQ9@Q9zVhVV5$;h#D$Vu=_29}4D$$D$l$ t%1PPU^ D$yUh $IL$ tHt$(UhO$V hL"6uRhZ$fD$0Pt$ #D$8=$$ DQ9@Q9jÍt$0ShVK u UPVq UjD$0` DQ9@Q9Sy hy$t$(T1|$PU'y h$ϐ y h$vuWjt$&1St$&4$t$$Sh<#PPt1h$t$t$i&4$nt$b5TQ95PQ9XQ9e2|$tLf2\Q9f2tZf2=l$u1HL$(Qhht@P PtL$* `Q9t$Buh$lʼnP&yh#$T蚏 D$ yh$@$uBL$$4jP%4$t$V66h$j4P^hGj  j|$WUt$ x>tq1.SPt$  y< 19u2PQ9TQ9)u 8t1FVh$1FVSh$Vt$D$D$L$D$ L$ D$|$tvD$ P艭ƋT$ уƉǃtωÁtt؉D$ u o 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj * UQL$ɋD$tP:! VT P hc"PVh/$hLf2* j ! V jV jRI VP^Ð= R2u  R2\Q9@=u1HP 1; R2USWV}uCjhxQ9 xQ9Q9|Q9Q9Q9Q9hQ9 lQ9 tQ9pQ9|$(jW 5hQ95PQ9lQ9TQ9?X+=Q9Q9@1;Q9)ω|$$\$ tQ995pQ9T$s;D$0Q9D$(L$, Q9Q9pQ9D$tQ9D$$D$ =XQ9EtQ1$w ww7wwVWVR 7www ww$PWjn M$%1~~~ ~~$PVj> 1@F ~~~~WVW =XQ9B5fDŽ$ HQ9t$Ph $hQW$ 1FDQ9 @Q9ƒ\$\$xT$T$|l$x%ݜ$݄$ %L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Wh&$QP# `Q99|ӡHQ9tPL$f L$)΅~DQ4))hc"Sh&Rh&$QP(# Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4̻&QPh&$SW" L$(+ xQ9T$,|Q9NjD$0+Q9x@B‰L$hT$ll$h\$@TQ9 PQ91F؃D$@5ȵ%|$vqL$`\$dl$`%ݜ$ܼ$%1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4̻&RSt$Dh&$QP1!  DQ9@Q9ȃ||=TQ9PQ9݄$|=s4;T$D$r(|$$\$ ؍4)h!'$؍4)h'$QP ƃ}u 4)h"QPw ơ\Q9@=u1H$VQP e^_[]+hQ9 lQ9T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppr"u%h$T2 8t( 8#u$SjVq tGtV $1E48FB$)Ex t$7@[h$h$, h$h$ 7h$h$eS^_[]$Vj$A3t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhjPEuha$h${RÉhPKt4VhjPMEuha$h$-R1H^_[USWVp $$$!19L$PVW1Hl$U ƃU) VD$PW tb$U%tM$dt\" $dPU t$jW< tu)$-j4'WJU) 1Hp^_[]Ë$j-UP D$L$PjD$L$PjSVt$ t P닆t>PDdžW1ۃ1ۋt9PlDZdž- t^[V^ V' 1uA 19^SWVlT$|$$VPC1Nt/ǍD$P PSW t Wl^_[USWVӉjh0jQ ǃt{jjjVQ L$ F"tc"g"tŃ$c"c"t $؉c"t%|$uc"SQRPh$jhV ^_[]USWV$=~ 71Ha~B11ۋ$4V <(Gs@ ,PVQ C$9u1$WQ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)Y jj7ƅuƋNtHNO N uFF9sSP8tVF^ St$P ^GNON1wOWh!Pw {@v>V=1H^_[SWV$uSh:$h$EM $%~GuG$O1@G$GD$GD$ JPRv T tOt;HO6 8  89hX$hN$LNF G8~ ~u3FVh!jv S?uhX$h$3Lt6hWv  t%uhm$LPWVu  s V^_[WVp׉$ftPh$h$K jL$PQW jjP, PjW tnjjW t\PjW tHD$|PWV t2Ph!jp >u6h$h$J"h$JW h$Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Sbڃs tAt1t% t&%S@ su^_[]USWVt$48`ځ% t0ty@ !ȉف tV @t !ف tVat ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jW jW 5^_WVPt$4%@5@u^t8tW%Vq $%8Vh'j?#45@u`V,2<jP, u h$G,dž,sh$|Gj?3 t1t3u5q $0# $1Ph$F # $1PWh$F^_WVt$ hu"pG8r4@84^_8t8t uh$W譬jJ>^_USWVD\$\t$XFtt+NQT$PQhj@Ruh$FD$n D$SPU69Vt)ǍFxۉ,$t1j@SP4 SUh$F SUh$E 1KNދl$Xue^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uVr'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j$(ǃ,f@K(1ɉHHH HrF>rD&>C5F $P' w_ǍCWt$P? ;)QjP h$Cu^_[]ËFUSWV |$8t$4l$Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQh*$d> SWVt$~ t^_[ËD$|$F @PWDr( ~ t͉^_[gV6uYhU$Q肣~PtVAt(t NLtL"t$PV9^WVt$ >~Lxw16tЄuOF$uItV@u h]$4=jjAV? u h]$=^_vF$ljjVz? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph$;G$C$G>C>>-ك**PWQh WtHAt[ƃx t Ph$p;$KFNtTHNUh$; 1O 1OOWt#QWtJV<1V\$ GtIO9tA t1Uh$:@1ۉSSD% 1G|$ ~UVt$$H? { t S^\$ HPtQPV P-<uV[+US?^_[]USWV׉΋A Phv$6:11BU$tPVVUU1n 6ujn1^_[]USWV $ D$PQhht$h2$h#$9$1PhF$91F\$ MbihS$(^ EuVh$?9u 87t } 8 uF띃tVh$9D$$ \XPW>&Ƌt8t* SV>uSj$( ҋ>$ 1GOtHONG Pt=%7uFGGtIO9tA t3@UUD" W7WQjj.>jV(t0<t$VtSB< t<=VS= h2$7 ^_[]Vt$N Qt<tv$vLP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/s 7 Vh$h]"!7T$1|$`F(f9t(~ tωӍV QPRh$6ڋL$tf~(^>8u(F*4$QPωD ~ tcF D$F*|$ <UWSPωT$ P\$Sh$6 <PUt$WPSh$5T$ V>t*4$QVf H^_[]WVt$4rDD$ tN8tCt;D$ jP, u!h$hN$5 j-^_Ã~+ajjj  ̓kh\$hT$h,$5 1m9h$h~$h,$4 <6Rh$5@hC$hL$h,$4 111dh3%hf$h,$w4 @+X1BWDPU hC$h<$h,$14 11G1=Q9Q96u P9W+Q9zhu$hm$h,$3 t0S vPh$44WVP1PPPVCD@PjVlN48@t @ sfyt ‰48WV{K^_USWVP$t8D$ \$9}$w ŋD$4V tE9u݋D$ 9t9 u~<$h$Wm1PPt$$ sUVW s W@W;9t>G 1PPt$$ UWD$$ W42D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1G@8u^_[]USWV \$@l$8;h$W .h$W !h$W D$$D$h$W |$t$<t$ ǃt1Fl$<4 GF9uW$t$<l$U WUD$PX E t=1FߋD$@D$P Wt$U EE F9t$@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[]S |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tW tFt$9t$V_Ѓ с u VXV{^USWV$1t$t$($|/xh$W h$W \$,hVS( jǃ08$$R21O$$0@4jVm9u11@PPU$u1Ajj5 uD$l$(D$ D$D$$dJ$tI$Uh&P$V?u$duiM)4tQ6uD$ 럍Hv H w?$ &$;$\w$&D$p$D$[D$ PxGD$O$D$2 $d 1@D$D$D$$h5$;o $hD$W$D$D$i$1@D$x ˀD$D$FD$9_2t$bS{($h($$p$l_2)$艄$\$,Su1VVVS6$U$PjSA\$h$BK D$9_2$4$|$0W ?_21VV4Wo6&$$Pjl$|$t\U HrBPt$h$# t$\$ Sng. 8$U $`$d$`$d_2T$ QR$4 $$`h~!h$l$,<$茄D$ t<t,<ulh$tG D@Ug uDh$NG LHUL h$,G TPUCs D$1D VhT""4$h~!h$"D$1Cl$,$bu Uuh~!hg$d"D$PU'$tCt)QqtrqpQ#$PDŽ$WU':$t Pô $ }$nUqq$VU# U+A$;$R2t P%$dP@1uhx$ !$dt3$Xt'L$jQP uh~!hN$#!$j"$hhe2< $$d ؁^_[]Ë$r,u'_2Qj$4 $u*$`1PQQw $$c@u h$$VUI h>$$`5 $d$`$dUh0\jj$=t'UhT\j$($}h~!hW$h~!hF$D$L$Ph$U$"hF#(耼 8th~!hk$3$`] L$a3 8 S$`$d$dl$,hh$%, u! 8th$h~!h$ hh$+ u!谻 8th$h~!h$^ U~tUh~!h$Uh$1k$`r;$d@ щ$`$dUtePh~!hI$KD$ Pjh0j,J hl"yUPh$ U$`$d҃ ց uK$`$dr>1r_2$L$ QPUM W$`$do$r _2$c"c"ty$ t$VQRh}%opU{\$,1D$WhPiu h$ShXj$$nuh~!h$N$u($`r$d$d$`L$$PQS!$"$1l$,~O$4P t x u$$$4PF$$9|t$t׃z Ru$dh$P_S[$bh$Jh6|%yD$ L$$$XP UhWj$d$ uh~!h$~G $dh$8n$dD$ L$$$XQuUhWj$d$W uh~!h$7S$D$xh~!hW$`_h|$h~!h$9h~!h$*h~!h$h~!h]$ $Oga Ph'$$`m$8l$,t01 t$VV$ uً$t$VPS VSmD$$b@t S$$1t*1G{ tS!u΋[uً$`<$$r>$1Ʌt z uRl$,<$$l$,<$$u@u0$d@h:$PJD$,PB't#%@tD$,Ph'Qj$dWD$0P"0$01~ tVhW1jj$$vS WVjh$ҷt*VPuVh$MW腸h$h0#0^_Vt$V0t$pApdr$Ph$NjjtVhWjdj ^WVPt$D$uPh$h$ jP,赶 tuIh$h8uM, ,蒷dž,>wt=D$|$ffN(ffOfujPZ ȉG_1_F*N>QPS舐 F>)^_[USWV$lt pvh%PWj t=wM$lD# 8th%h $h$u)h%h%hh% $$l~>1ɀhL QSP ƍl$hUPt$ ͵UD =wfD @PUhh%W=udh%h%htI{>tA,$fEC(ffEEK*S>RQP C>4() PR1pČ^_[]ÍF Ph&%n tt {>u[[ht hp%? ~>t$fF(ffCCN*V>RQPe F>4)mC PhI% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#辩 1HXju V >8t~L$ T$pFhf@H X@fPFM1^_[]h%h$hGh%h$hHh%< D$tFL$tt 9Jt   1HBH@M1@h%h%%hh% USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;v. 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$h%hz%h h%hz%hh%hz%hh% L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]h%h8%h|h% D$t L$HH@Lh%hO%hh% D$t@Lh%hZ%hh% 11WVD$ t!L$T$t$|$x0p4P8H<1^_h%hf%hh%V USWV(l$<\$߾&1|$ |$|$<$E4t.1FM0 I?r E4  G9rՉt$@Pj蝦 1Nt91D$ D$D$D$9E4t$1E0jS4 t G;}4r1(^_[]h%h$hYh%v Q9tD$ Q9QQ9Q9WVjPj1tMƃPjt/1vN F NN F N$(F(N,FH VL^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t P=NSv@1F@FDFMF t@PtQPV P؋PtQPV$ PjF uPtQPV, PBF(uFN^_[jt$USWVu-~L =Q9t'Q9H Q9Q9N8tv|x| @t,'\$$Lf2SVU Uj X (V2 s SVW  ^_[]PL$T$ D$$PXUSWV։& $VhU SV PUh]"W ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXá,V2ËD$,V2r SWVhS$ { 1OtFƃ ||t 譜 +D$HP0V2Ph $Q] 0V2^_[á(V2ËD$(V2@P )V2 SVt$ u{ hjh(R2hLf2(V2 s1fà QG jSP  t V1H1@^[_ fVt$tNVV{VcV.jVPVO6v^^SVt$ V1Kt=jhjE t!jhjE 1ۃۉ^[E Vt$t'PÞdžtP襞dž^靄D$t$t$t$~ SWV$hjW4~ C jPW Whi} 1NtF$$T$ !fD$f9t hWhix} t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv 軙 7 讙 V1H11Ʌt $BD<IG9uލ|$$ ^ F>L$jPWVt uF>*PWV!} 1T^_[]VD$0tVUjV v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8`VGw}uM ufE O $PJt $jSVPUQt$4Vjt$8]$?=^_[]ËL$1t$VËD$t 0z- VD$0tVBVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjVz Fjŋ$@V& $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP tًv\$~;1$D$0Pt踎 tF9u19D$$"$8ЃD$P1~11TjT$4R4z t GP9|PX~11\jT$4R4? t FX9|XD$ 9D$H$~11LjT$4R4 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$WuVh%t$ 0|$w$H;D$t$\hjSKlj$w jD$4PVz CG$C D$ jt$ VUy C yQPD$|PFx D$lD$ @D$pUhi$tw l$D$m@t$ FGF<<y<$l$D$0P$0 R`~/1djT$4R4 F;`|ӰD$|$0WQe~t$\yWh %e$_w ɺ@r <t5<(<$L$ 1@ut$h %$1@fG(FG>O*VTPRQv $t$6@u<$tW{tmWqG@WfGDGȉGHW~t GPGH$G sW}GLGMO9EVha%W%$7t)|$ jVWv w_ jVSv r 1N^_[]j:SP t/@1UQhQQj QP_ G8mt輐 (G8GjSP v O t pm2DPu:pKCu1l$PVhVVj US_ G0Et=it.u1@1QVhVVj VPY_ <$ O4G4SWV$WjSs F jPSTu WSh~is tD$Đ^_[USWVP2!D Q9 Q9 Q9Q9h=%FQ9 Q9 $<  O+VQPmq 9v1 LJ\$ I;<j,jU@t ǃD h%Vj,j&Ht ǃL h%'j,jPt ǃT h%t$$Wh0&Vp D$9rh%h!%[H$|$ 7D$PWD$t$h4"D$P ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW螖D$u?\$S~ J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0WAqD$t|#t3=w&AL$0h%h]" HD$1D$S0Wq 1ɍD$D$$D$ 01D$ύD$PD$$PD$h4"D$P ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h}#U艀 h%Us h3#U] $D1)h%U1 1Ʌ<$t$V{ H9t- t u!H\Ht$9u1@$D$$<jPSч 1Ʌ $1@D$S$@tXtT$@Sk $1B*$Dt,t($DS? $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd/ t6ʼndt$0 `Dd<t A`Nh%<$Dt&u"t$ $< 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U&} tu;uHUhL%&D$uuUh/D#t$$t$$P&t$$^_[]USWVt$ t-tQN  8uP5|$t-tQ uPtt*t$1PPUd t xTuXTj卆jPW5 $@DtW,Du싾@WXHLtW,Lu싾HW&PTtW,Tu싾PWX\tWg,\u싾XW(V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(_2|$$t)`#L$# $ 1CƋl$ \$18J$sI$Sh&Pt$ujt$\L$,1VSWPUAjt$\t$ VSWUkU#jt$\t$$VSWUMUjt$\t$(VSWU|$Xj=|$\W< Ê@tC< t< u CCu1j h %W)t j h %Wt jh %Ws jh> %Ws jh7 %Ws jh- %Ws jh* %Ws jh` %Ws jhi %Wis Pjhs %WQs 8j h %W9s ?L$P1T$XPfL$T$t$XVY(1Kj/Vk; uD$|$PjP L$r L$rL$T$t$XV'1Kj/V: uD$|$P jPp XL$ r  L$ r  |$XDD$Pi4$PTt$X'TCD$P@3|$X D$P$;$R2t PB11j|$\W6!ƉD$V茼yjW t>th$Vq V$ǀl@F |$X L$P T$Xj #' D$X |$PjP^ <7h%h%OD$Xt$P jP hy%|$Xx D$P$<t$X"  $<PU D$PX|$X h "|$\Wgp t$1VWjWWWWP覒 L$P9>t$Xh% |$X t$1VWhWWWWt$tF L$PA 9>t$Xh% |$Xt $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV"$6?mjt$\D$ 0USWVcO jt$\t$$USWVEOjt$\t$(D$Pt$P1t$X#džD$X= 84 j/P6 1|$Pt@j/Pw6 tƍt$X.#t/PF1V #6 |$X t$1VWjWWWWt$t裐 L$P9>t$Xh % L$P ЉT$jt$\# h%~|$Xq j,|$\W5 * ƀx 9l$Ps%ƅ |$1WShSjSSt$t9D ,9h] %T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFuu냃|$X0t$1VWjWWWWt$t؎ L$P9>:t$Xh % |$XD$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1Vl @jP 4  L$j ZP< t< lGG|$Xt$P$ft$X1 $h%|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P&$Ɛjt$\V3u7D$0J|Pr 8Ut$Xh %011IT$P  =D$P-D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hPTU fFPfFSfFVfF^fdžƆ D$P f$6l$Ptu|$Xt h %@D$X  y@Uh %D$P |$X D$P D$P D$P |$Xn$6t$Pvih% %fl$P@Dil$PPTT*BE$ E|$X.E$$(i1|$Xl$PX$\@D$P` D$P D$P D$P" D$P  D$P D$P u |$X4t$XVڪ@@ $dD |$X|$XG\$PH  @D$P D$P D$P@ D$P |$X$; l$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV|Fu8jt$\t$ USWVbFujt$\t$,USWVHF t$XhL%l$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tV 9]Vh %'D$PG D$P7 D$P ' D$P D$Pƀ D$P@|$Xt$1VWjWWWWt$t^ L$P9>t$XhW %|$Xtut$1VWjWWWWt$t L$P9>t$Xhp %D|$Xt7t$1VWjWWWWt$t߆ L$P9>At$Xh %Qh % %P C t$Xh %W_ à \$S螮ƅ|$PPh %SVx  jvVj/t$\{+ AL$1|$P# KD$ɋl$t t OGuh % N|$XoE1j:W* l$t2At$1VUhUUUUQN 9.Mh % j=W*  ED$(@1 t H@WhC %+D$Pƀ 1K1t$P # $D$P1t$P D$X.U$ D$L$t$X3d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu `XNul$P(BjRQ Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/U( SGJVhL %>nT$P   xUh_%=D$(h%J h%Ɔ <h % D$Pǀh % 1K$dVh %D1DDD DD.u h% 1D$(1h$Wjh%W1xh %Wh#WphhL"WZPh%WDJh%W.h9#Wzh%WhVs"Wh%W hW%W> t$ h^%W hd%V hl%Vs hs%V] h{%VGY hFS"V1Z h%VT h%VE h;c$V6 h%V' h%V hP%V h} %V h%V h%Vk hcE#VU VhR %  t KC  t KCWh %Ɔ  xt$P1$ƀhuh] %XttC< t< Cuh %0ǃh%D$,Kǃ%1CƆ 1CL$PTGt$P jW l 륉h*%W[ t-h*%W[ th$W[ t hB %W{[ t@ChH %Va[ thM %VO[ D$P@ tsFH t t@@1 t H@ttC< t< Cuh& %Ƈhh %wsF< < F1$SUj tUh %1C CC"$f8l$1USjxSjSSW| $D9]$ƃWh %ttC< t< Cuh< %Ɔ L$P1S=flF D$PVQa 7Ƈh'D$Pǀ 1'S #؄  H@เsƇhD$PǀFt< t< u GGu1L$l$S$ L$1W F 4$VÍD$PSN#CUPA#؃8L$QP.#D$PVSP SL$PT$Xj 6t$PjPja 1Ӄ  (jVtZl$P  h#" 1F؄t  H@h %1K؃<^_[]ù@D$PǀǍ0PVjI wh- %F -{]< < ChF %G11|Kh@ ыD$* * h% C{K< t< tC C{< < Cht$1VWjWjDWWSx L$P9>sShx %8l$1S 1K;4$(ƍ|$WPQ FWPD 8UP5 D$P4$VP L$PT$XjCut$PjPFCt+j/Sc tIGC1L$P4 1D$PVSj u7tb\$1SVhVVVVW{v L$P93tQUh %tGSh %1F FF@dD$PƀMG=6 @/@(!  t$ %|$(t u$Whc %t$蜽t$1D$( s$t %@uh %j?suh %ItF1tC< t< Cuh1#Wt)W Åu"=1rWh %31ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QPG t(t$Qk,1҉T(T$T T!h%S螬IVD$0D$ FD$(F^ t8UL ljD$FWUP< >)QjP< 1FFL$TT$`r|$\s72USWV׉ˋt$$VKL >"u y"uIFA $Vj"ct*Ń!9 VSb ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=pm2DWtCT41Fu|$ D$ |$jjD$PD T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v&V 71M^_[]USWVՉϋR; j=P ,$|$D$ VI 1ۉ\$t?t9D$ 1j=S )9uWVS#M D$\EuVި4$ t5ƍEjPt$ " 4DL$h %Uh %h % |$$t#4$8 tzSRD$h% D$tHTMPR( h@%h%hh%Ɍ Vt$t#1PPV6. t@Tt$ V0 ^Vt$t$Ƙ^h%h%hdh%c SWV1SSQ- t&WV* W蔠SSV- Džu^_[WV|$ t^ǘ1PPW- tPW* hƅthjVt0 ^_h%y1h%h%huh%袋 D$t L$tHTh@%h%hhV%h%hh%d Vt$t61tpT^hV%h%hh%/ WVt$D$ L$zVP& 9tVK 1^_ËD$HTt1Pt$ h%h%hh%诊 USWV\$tF+1PPU, t.jVU, 9^TuVU) V_u^_[]SWV D$4toHTty9|$0uPLjPW$ t<Ƌ\$8PW( Sh%j Ws VNV ^_[h@%h%h h%h%hh%h%hh%蠉 USWVa$c$L$<D$ VPU }W D$]8D$HVPS SVËET%t EtuuE 8Vt h)%跨ňjjUm& jWUW& Gt ;D$TG9t ;D$TWUG# WV urGTL$tIѺ!! tD%WWj03u!0E 8t&E 8t h%ާW߅11SSV% tLWV" WU 9t!D h%舧WSSV=% Džu1VD$PVD$ PD^_[]t$ t$ hËT$11;T$ tэ HUSWVӉ΋BTx tt /4u$SGtCP7t1Wl$SV DžGT;CTuQGt ;CtuFSWnu8GttCtuGKQPNuG8K8QP:%tS%SGtr7tCtt-SjJ1DC 8t h\%Wj1u2C 8t(hk%ե%tS%ScSj0uB 8thz%菥1ɅtWVf W^_[]ËCT@$u Cx;GxK%Wh?%h8%h;h%l D$t%@<t <u ø8B /1h%h%j;h%) D$t%@<t <u øA /1h%h%jQh% D$tBHttu#xðÃxux uxuxA /1h%h%j}h%膀 D$t>Ht4t uxjh&P 9A /1h%h%hh%' D$tEHt;tu&xÃxu x uxux@ /1h%h%%hh% USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^V@ Wo1=u!GB9r1ɍ|$0+#@ /1NjB1ɉÀthAu_1ۀ=Q9uD1FFFF FFGFQ9SVrVW_uPQ9މ^_[]Åt 1u19[:Rt1h%h4%hh%w~ h@%h4%h'USWVP|$G<t<$ $ l$W)Ã|WhV" ۋ|$t(ٸF\$$)؃|PjVk" 1=Q9u+Q9W9u!Q9> /1N^_[]hf%hX%hnh%o} SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQ賮 ^_[h%h%hh%h%hh%| USWV|$t$)Ã|UhV?! t(ٸFx)PjV! ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQaGSKWVPQg ^_[CPhb#WVe 1t߉h%h%h{h%h%h|h%{ D$tL$tf Hh%h%hh%h%hh%p{ VD$t&L$ t/fqPp QPI H^h%h%hh%h%hh%{ fV}#&Ph%.f u^USWVD$t$V1Ij0V1|$/ooo WVF5X&t-1C <&I?r t;   DE9u֋-`&t/11C \&I?r ;;   DF9uWt$V; 1ɉt$\T$\RVQ2Pg\Vlt : 81I $ȃD^_[]WVP|$D$L$ $QPWj tWj耆 t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP tbL$1tHhW%h3%hM8| /IG?uWG9rD$^_[]hC%h3%hh%x USWVl$t$|$t1ۅu>t7NL$tד%L"tÉS1ۃ1Ct:tV>tXtShk%t؉8txt@HtPt؉CjV.t.Vt!ths%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPV|L 1H^_SWVD$1t^|${t7 1NA~0jh%W[/ uW軾W+ G9rhe2 ^_[USWV |$ 7u ;l$$Ujh%U. \$C UPWh%NS$t^DžtnjSW+ 6 8th %h"荙9h%~1HzSlt$h %h]"R tG11CGt0WJ ؃uh%h% ?Ņu1 ^_[]Ë$t|$u%tPWh+%h% =mQ[PWh+%h9%辘KUSWVӊB D$ L$$t W *QPTnNjD$$7@uMh:*#X %tQh%W  Ph %We |$ t$h%W@ {D$ D$h%$U$- t$hk%U - Uy( |(6hs%U, 1>hU$Q, hL"$U, 5h$U, h$U},  hד%Ug, h$UQ, h$U;, 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Ph#%W I4&h0%W +7$@D$o|$L$ uMD$@tBL$qPSh,$W"A,$D$ E|$tSh,$W <$tBt88t/SQt"D$pHpDSh,$WAM|$ tSW3D$ t7t1Ph $W D$ 0uW} Wāǀ|$ WD$(P D$ A#t%Ph<%W; vKLP$t>$X%tRhM%W AsHhZ%W 'CPPhf%W  s$ht%W SmPh%W {Pt;CQt$(stPhhV tVh%WT {xtCxPh%W3 tr7@OǀD$(h&P? t0ts~ t!V^t&PD$,P9uvh%Oh%B1OĨ^_[]D$D$D$h%Wp[ t1PPt$0V tc1PPV 9th$h $W0[ oET Ph $W[ QjUt$0VY Ņu1UVWUz h$$V& h%V& hU$V& hL"V& hד%V& h$$k& tzh$$S& %tn|$"D$<u D$xuT|$t Su@|$"$<u D$xDu'|$ tjSu%A#(A#A#D$ A#A#t%Uh%W Vh%Wv S,E%tPh%WP 3E%t= t1tVD%u vuPh%W ?Q@th%W|$"D$<uMD$@tBL$q PSh$W0;$D$ S|$"$<D$@LL$qPPSh$Wtl{USWVl$t2E1Ft/׉˃PWh%S tEu11N^_[]USWV\$l$|$ttUPW  1tk<.tgh"W# tUh$W# tCj hD%W" t/tj.WE tUW 1t^_[]D=|Vt$ 'Bءe2H e2; f2he2j CZ e2H e2 Fut$e2H e2; f2he2j Z e2H e2 FshO%T Fsh| %T Fsh#{T F shL"eT FV%]%c%k%r% z%@uwxn%rhES"r]%rR:c$ rG%r<%r1%r&f9#r%r%QS F sh%S F sh%lS Fth$XS Fs h%BS e2H e2~e2H e2 he2j >X he2 ^ù%TVT$ L$\tX9t(,Nu2l1th9t,Ju^USWV$$Vtg$$QPVh$h$h%USP 1N@t+9w');@MQP'At9w :)߉h$h$h%USP ^_[]USWVD$<P t$ $h "Vuk ]NjD$@HD$?1jh %W ujh %W u|$D$4Njt$0tNF tA.t;\$SP^ D$P1U1HPUUUUSA 9l$u9t[,OuD$,Njt$(\$Sv  t-D$P1U1HPUUUUSLA 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ h "Vj Dž4$~y14$oy% 1H^_[]4$Ny% USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQA t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$# V # "1H|$0t1rЃ^_[]# t# 7g# USWVT$$D$ |$\$,ۉ$l$(1\$]fsuypm2DHespm2DH@O\txpm2DH" \\$ $2f\\ $$H#T$$H#O$sZ/t uP " tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1! T$$t4<$t s%|$$u1FU! 71N^_[]USWV Ί pm2D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMElj 1 ^_[]ÿP 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3VO 18 1H(D$ %t%L$QSPWVsH Ą^_[]USWVt$HD$DD$L$UjS? C@G jPS fC $4CCD V$4PP UShip C O*W>RQP UShip_  1N^_[]WVPRQi ~u~uF $`19؁Ĭ^_[]h%{oUSWV(ˋl$uG*SVPn tu 1^_[]fD$fx(t1ËL$ D$fx(uD$ V1ËL$ D$fx(u D$ V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS |$jjI`Ƌ$(@h@h%ljFuJ1ۍl$Sh%j U% h@UFuC 8tǍ\$($PhqB@W f<$f|$ jUS ShlBW txD$PhpBW tZ$$VЃuBD$PhfB@vg t(D$FP>F u+ h"%^Ft PV)O1ĸ^_[]USWVt$fFtV)vv v8 AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP ^USWV L$@T$*@h t$ Vh|%U $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@莦ËD$D$ PSCL$QP ؃8L$QPSt$@车9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PUNEL$QP=8L$QP*Ut$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $PmPVhK%S1I/ދ$0$4Wj$@U t|$r $,84$GPlP$0Vh\%WwSYGPVhn%WR$0$4|$WjU $,t|$w1Ћ $ Q!lPVh%$4$4#]SkPVh%$4轴T$ }ltE$u?ClhPhhWWVh%$4i{,t=u8C,j@Ph@hWWVh%$4$$0t1WPC,;r鋆Dt%@1W"C,;Drlth1WC,;lrF $'1|$TPÀsE,$0;rT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$Ph"Vt$$@$@$L0 >}k|$`$0PDL$L$QWh"Pt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$Ph"St$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ V t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$~  q V1(^_[]ËL$DtD$L$tPVQ> D$ƅu& SWVD$ L$tT$$w .11t$|$X+9s "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p @v\F\^VF`t# P?v`F`^SWVjh0jM 1NǍ\$PSPhW trjSjjW t]jSh@hW tBD$$1ɉ $L$ L$L$D$fD$DtD$jPWA t W^_[USWVt$+VjUAChu,$t#tVh6%Pj@^  r3%s%PSh%cPSh%I 1BhT% ^_[]WV΋tF>rD&% GTt tB9tt9BTtI䋆tÀ~>r QVh%I ^_ËD$$POL$1BhT%` SWVt$tgw]Vhk%j @^ w$bPSh%H GLhR ^_[USWVhuD$D$G$D$GH t-wa9GGGG G _G_1ɉO OG_T$SPwD$@tGHd%_0wF SPh%H _0G89+\$8D$<l$8 %|$ D$ fD$l$|$Xl$ D$XG8N PQh%G w$Haw(<PSVh%KGG0GH9% w$aPVh@%G G0GH]%c1HG8G4 w$`PVhl%F 8\$0D$4l$0 %|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( %|$D$ fD$l$|$Hl$D$HG4N PQh%xF ?G0D$ D$$l$ %|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu P_w0PVh'%E w$_w0PVh'%Et$6u$HujGtGht:?K%tPR%I%GHPuXj<c@O;Au<t M%?uD%GH0ts]Shk%w4Q;Sh,w8P;Sh-w0Py;C w8w4PhX%yD 1HG8G4]@uPD$u>C wiVPh%8D wwhV3uVh%DOhD$L$u2wHS3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;th$CjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h%h%hh% SWVt$^ Sh%'BG0+G8PSh %A VhRj81G?6u%EHPV Vh%|? ^_[]WV։h,j")t/L$ PǀcSc tfǀ 1 ,^_ËL$h/VD$tF9tAtIdtI;u D$ th$P^USWVPt$t1t+l$$# uVjj4^_[] GiP6mVKAtAt;<t5^ w$WPSho%= j1VUjt4/w L.o ow;.GOGO oo_H,$uGdGhSV VU=w-1GG G$^_[]USWVxT$΋}D$t$(HL @r@t‹D$PLih D$ɀT$wȈBBV*QRP辻 T$(  D$tz tA<t]<tYD$PPjp D$ 1SPD$XP. 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Ph%9t$*]tVSt$Dj/e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ KD$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSPl ǃL$D$؋L$؋T$B)Á+),PjRӱ ,L$1OAhT|$ 1|$CD$PjsǃSt$ PƱ G D$G D$ GGDCff_f_1ۉT$SfGEhi fGG@D$ffGSf f_ t$WhD$ p\W F Ph%/ ΃]w'6uh%V VjjA&1gydA$jD$PVo$ D$D$uD$HwK*PQt$>9 u)C Pt$h %* ىt$ t$ [u^_[]WVt$ Vt>wwvw k ]WT6ttt9uq@苆t'P{idžtPKdž1^_UWV}tuPG><r 'u#r G(ftf u  s% u`h] ƍG 4$D$,$5%D$\$$%u(WhFVjde^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0jw* u&h4j@`GHU$GP_iVjhStSE0, pLJ  twAQ \ BjWhrbjP[h8 %h$7'sY EX>@P, UB( A J*R>RQP  ]rts4 t*Mq @T$hRQPPV]ho %2C>t2Mq M*T$hRPQPV]h %% PjR1wLw w wL$u]rruG XixiF SPh %F% D$h$PS6ΪNRh8 %%@u3EpCP t: @ NH M plYhH %(%u VhD %%h %v$e2=u1HL$h$QP t=w:F h %Ph %$ w 1Ƀ8tmF SPh]"$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQP荥 h %C$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6hL$ <G cSc{ ni;`CLsu%1C &cMScq s$;PVh!%! M1C1G G\$"O0)G4)G8uL$YME Phh$ A}w s$9PVh % WuWVt$ VhFjtht j66t^_USWVt$ ~3E(L$tW9ud G N Qt$(Ph%%>W0Edh$WWNttxV1ɄutZE tS@;FuK_ P8PShX!% uWt W+8#4 uE$;FuUhudEh>t ^_[]Ër^tuMEEVF $PE}t\$G$u=EH9%j7~ruHWЃ댋Et {WZtstـT$sO$tPЃ8u)ʃAr N@H@USWV׉΋D$$E t @9u ;M$^ P6PShq!%L EiP6r$u!}@uHhjjWV Džt jWVjj|$$tD$EHPVK#8#4 u2j1Vh#jj؃^_[]ËL$hRWVP֋T$D$WPt$ 1Ht<$u 1t ɉ^_ËL$hRSWV1{\t^_[ÉjhQ蟻 C\t4WhSjpuh}%h$豸 8u"54V2hp% Wh}%h]"> 1NcD$T$ PUSWV$$($$$$_\ftPh%h$ ch$USY t'sPUV`t3_\t,Ct$?tF Ph%h]" V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%h$  t `jW0V tD$ WV h%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ& t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r P1PVh%$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@sb%n1ɋl$ T$Et*u4%& Vh8%"%L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$ %t$\$SWVStǍF WPh% WQ} /6uh%VEiP6ΛVh#uPj EP'uD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S蜈 t$<(4$teSPhdR"Vt$Wh%t$( dR"ۋD$t$0h~$ P'4$L$ t/PUVt$Wh%QSPhdR"t$Wh%t$$7 $PUt$ Wh%Q  h%V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EPtUWP +މ^_[]SWV(΋6ulVjj3K AuA jQV_ t=Ht*ub 4$&PVh% OVD|$ss D$L$ q qQPWV8  >(^_[VD$ Ph% v B1F FFL^L$h[bWËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Ph% %GHPVq^_[WVt$ F Ph!%g OhGL^_D$ȅtȰ (1SWV\$C r诨 1H4t${GPhV5 ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0h&D$(P~ Edx t]SXƀH|EdH #HL$|$WVrhEd@ D$WPYhF9VD$(PY1VVPb VVPG ƍF8Pbuz3WMhVPz SWWG| WD$(PXjVP҄ ƅuSD$(P臮C$t{tlSWD$|$WP@gFWP3gF8MdQP gXMdQP gVD$(PWS蔭1PPD$,P toVD$(P ~xF| uF|FXMdQPfVt$|/~ 9tV;UVqT1PPD$,P詃 ƅuC$t$xh&D$Pc| 1PPVv ƍC D$~dV`Sn8U`?1PP$# 9tC9t?UWd T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$} E PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u&褚 G蔚 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ uL$( Ʌt ѹ )QPh %jW ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]h|"% VD$t:t0t!PtQPV PuVj^WV|$ 1u7jt @1H1N^_USWV $ yr薘 t$ $ q>YtiDD$ \$fl$Ӌl$ hr#%WU_ % 8th#%h#%t$@s"j@{Dž@7# D>1ɨ1QSVw PQFRC F CFKN\$l$ ! F ! F D$(t8tjVW uʋu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF ’ oUSWVD$1tW8tQ\$l$G@tjUPE u8u@$Vu4jjt @H h$%1^USWV0hjdƅT$PL$LD$H|$D~Ӄ^dNdžu`P VLPVH@FDV@PQ5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUtNj.PUjt:NhVRPh %j.Q' @jPW t&@`F`Nd#h5#%Vy1F`F`uNd 0^_[]WVt$ 1WWV# t1@WWVL9 1^_USWVD$$t8tb\$(勇tK0tEFPU#t.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]USWVD$t81t7\$t(tEPjSP tmu^_[]SWV|$\$L$Ƌ@t9Xu9x t)jtXx N HF 1h#%K1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP_ t&hPt$ hB#%t$-H1Ƀ H1ËD$1t' t!1Qd(u Q` uSWV|$uuu jPW t$H:u @`PUjPVWTtaQPAHd1IH H$ǀqjPj781Fuhk%W0J1N^_[11SVt$ ^d؃ FdF`u uhF Ph$% F NhQPhq!% u2 tQd s((thk%PI^[USWV |$41G$ujjWT t ^_[]ËsWt׋trNf(@_>t .o*Sh&UR Sh &U; TD$ 1L$A AAPj@QWj1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU Un V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS t=m<$hj.PSjf1T$ JO9zPWE`t.tRD$@D$,$KU5E hUPh$%3 4$u~ f4$Z~ 1SWVt$\$Gt!PtQPW Pt1jPWtt2jP4%W51VPj4^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPU tKd(1tD$ @`C`|$u%CdtC KhQt$(PhT#%C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JSN0t4$r| 1H1^_[]SWV\${C KhQPWkƋD$džuC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUy?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPt t u"GPt$,h&% GdD$ D$1xG O4SQPt t $tsOdtYG y%toc$OhQRPh&%hWj[u!f 81tf 8t h,&%Sw$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPwYs t $t8$C O0QPh<&% OtHO\$u4$FTjPS NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$e D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRh4Qj螽D$ t;t$(hQ&% j6Qhs%V,e^_[]SWVt$Vjj艽tj11G9quƁjmمuިt?5j6  shs%V+^_[USWV] D$@Cxt$rj.VL$0Qj|$,wVh|&%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh'%h&%e^_[]T$rRQPh&%ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQ t8D$ L$rQPh{'%h RQh;'% \Rh^'%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVPm L$  uhj/ËD$CNC KFCF CCj.L$vQPF Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph'%T$$RGTD$0Pj襔 $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h'%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h(%<<tj<uŃt$h.)%|$$HL$Xpx jP$PB D$<t$h|(%|$rst$hE)%$p΁Vt$ h(%t$$C$x|$D$ƀt$hZ(%B1|$t +D$(t$( 4XPjQA Vt$D$`PA \$Zt$hc)%t$ 訾 $A D$PAD$LIL$HD$DD$xdt4D$t!t$ut$h)%赺|$$t$L$U@AH|$u D$&D$6D$t0t$ t$<t$0V)j6t$ \$1ɿSQWҰV1QW轰h%t$D$u%D$6j D$@`L@O|$ut$h.*%몋sLߋD$,9CPut$,t$V^ VGPD$$t$,XGLtbt$,Vt$PY: wPD$(À|$$.&D$$h'%ø|$$3WQ%t$4q t$h)%Etk,΋D$9t ,JutVt$4q t$h(%U|$u/j |$u$jt$ut$h*%$t$et$4t$t$h8(%|$$tL$11BL$jSD$(D$$UWV}u WYh輙 ƍG 4$D$,$5%D$\$$+%ԶWhVjíe^_]WVt$ Vh"WۭVhWĭVhθW譭^_SWV|$G Ph:+%聶ujj蛠Ɖ6GF_>tC FPjTt.t+@JAH *RWP7 tF F^_[hX+% ^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh+%袴L$jQST u h+%$BHJAWhθjj*G Phh+%+WhθW iSh+%|Yjt7UhjPs@h+%h$O)h+%=d^_[]USWV׉΋A1PUSͪFVUS跪t!NtHNVJFxUUt$Pt$PtQP P9vL,V#^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUhq!%! t#@uUhN*%' S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h*%j봋4$VUh"%. WjDu!O 81tO 8t h|*%QL$o@G WQSRPU踶tDD$GdՃGdD$ j.PUjt'OQPh %j.Vx h*%ر)h  WhwPj)8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPWL uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPw{ Odt Od tY?uŋFuhs%Pchs%PMt-u~`?w#F0gF Ph*%^_[]jt$趾USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh+%h$ jSWTO tD$ SVk h+%詯p^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh+%v PUn!D$C,9r|$t"w 7h+%v PW8!,Nu^_[]WVt$ tqwgVhj胥1GGG G XGft^_# VhE-%h]"w ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUWh u?u^_[]USWVD$t81t9\$l$tp|tSUV u6u1^_[]1USWV$.FX|$ j.WUj)\$wWh,%腭$$tXjVWr ÅFD$Pjt$ L$QƋ ulp|$NjSW: tL$9uPWVʺ t0 D$ PSh1,%+ ^_[]h#,%蟬jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PShQ,%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh,%$ WShq,%藫 F PSh,%ت t){4t#D$} t*tu Vh.% Vh.%蔪jjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]ED.%f &9t Qf9Au<< <\$H $$&|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh/%oD D$ PD$p Vh.%% D$ PD$p Vh/% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPh/%wD$`$T$B"pF L$ QPhC/%P 1Br&$F  $QL$$QPh/%<$tD$x%$l$ |$$ PD$$PVh`/%蓥D$wEC 1L$ T$t$QPR SWVPjh0j 1NtKljjSj hPCgt $jSjj)W'gt WF^_[WV jh0jt ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW达D$jPV` t?jWj$j)Vkft"$jWh@hVIfu%h,%螤VE h,%艤1N ^_SWV\$|$1tD$P&1ۃ ʾrft1ۋhDj͍H(H,| t1ۉfǀ<fǀ?WjhP jjW t W G Ph -%ߢWh{W購 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ Wh(5%P E]1@EEE,E ]$z t(VhZj jWhJ5%h]"t^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$&D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPShjPh5%h$Ġ$1ۋ6<$tD$D$$t;F SPh %Ο D$$hPS6V%Ch5%6Jh %蘟e2=u1HL$$hQP? Ã37@$:VL$QRP% \$\$TSjpjsD$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F PhR %~T$E|$wD藏S GDtL$$SQP _Hbh5%Ğߋ$t|1QhQP芰T$R6#\$sD$1CDCH%-ۅt}u2; 8tn; 8tdD$ Ph5%h]"6 FD$ u9H|t;A`t"ftftAdu y  Љe^_[]1ɉH1BPP@ H~ Wh5%\ot/Vhj jۓ1Wh 6%h]"b vF Ph5%h*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjPwcE <$L$ V諟txEtptk8] 1ɉHH@H HH$7E.%$P67!11Ӌ$PR*uLjEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 tG6%tPV"ELPu4 u<Udž6ttFtu7@t'P <dž ^_[]à VhM6%h]"ٚL$1jSWV|$Wh{jdtxWhS>WhS'WhSWhSws^_[SWVt${Du ?~ Wh`6%P 1@1ɉKCCS(C|S KtHd sHdit xt^_[Wh~6%h]"k ^_[ønL$xtBL$4SWV|$t$_u~G`ux{ ur 6ugtXuG@Psmt3O WhkjP迋uh,-%h$蟘t|t$WPV6^_[D$T$J P&)USWV$1@|$D{l$Hwz5 C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1WoC,$;lrD$Vh<-%P聻 D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P. D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hWt$$t$$t$PD$\0 t0L$ D$ PQhVt$$t$$t$PD$\0 D$ L$)1H"3 t$|1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s 2 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP贅G4 w$p&&2   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP  D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUPP D$Ãx3 t 11A9r1Ë71$1 $&D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ PhV-%虐1l$S3qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N `'H \'H X'H T'|$ t*G>r!D& D$H<D$@k VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh% D$P4 uOt$ pffBfBpɋ<$tXQlR ڃ p7t$ffBfB<$tD$WVPR ڃ L$t3D$fffBt$tVWRωe ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQP |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHP dtKWUP D=l$_D$ fǀ< 1fw t&)ha0%葃R|$QhM0%j WI D$l$ f9<t1}~ QWhu0%PEt$sf<V fu.Wh0%z`'Ex\'EtX'EpT'El6tj!zD$0^_[]USWV΃|$$w Vh1%躂1H׋ 1ۉt$$S1ItU $]h]d]`\$,Džu\$SjNSƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh.1%&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph2%蒀k(UPh2%& ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh2%4},WVh2%Ȁ ^_[]V΋QhjFw1ɉHH@@ @ @$"t X^D Vh3%h]"* ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth$VtP6jVjj`v-wx9DthQ3%Vu VhZ3%<^_É1jVUSWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh3%Q|1Q3%8WjjVuD$$PjO<$w$&8uJ3%=ǃ8O4%8u+h.%8uo.%8u 3%8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h4%} ؋?ut$u {`<$uhs`t$ h&4%{} 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h1%u:fD$D$D$PjUVD$0T$4)̓w! t$h1%ufjPD$DP D$LȉD$LD$PȋL$LD$P9v)q t$Pt$Pt$h2%ul$4D$h|tjD$@PUF upmjhD$DPt$<ǀfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h1%]s t$hO1%ws|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPhq!%r wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Ph-2%rt}u^_[]8V6)^_[]SWV΋y WhF2%q 1CCCC CC$t^_[Whl2%h]"q ^_[Vt$F Ph2%q1B^L$Vt$?N Qh,3%Po 1B^jL$XWVt'׉΃|jt$RPKt j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV1t:ǀL/艈L/f$HC;,T^_[]SWVt$Vhjg1CC C XCC~ ;u Wh3%p Wh3%ot^_[Wh3%h]"o ^_[ËL$Vt$VhjifF Ph4%o1B^hVt$?N Qh\5%Prm 1B^2L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh5%h$n tjS0" tD$ WSV h5%vn`^_[]ËL$aVt$?N Qh6%P?l Vhjd1^L$L$@h9%P1|$L$8jQj*j)5PR;Q"u h9%Q;rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5PR;!y h9%QQ;t+DŽ$j$Pj&j)5PR;G!uK1ۃ|$$8V2D$,tD$t3S?hR;uh:%h9%ƣQ9Q9|$$tF1FFFFF  F)F.N,Q9Q99rF t$ƃ|$t.t$L$Aut$h$:%+8V2D$,|$,tF)F/8V2F Q;@;DŽ$jjjV y h?:%R;@%<hv@%S h "F Nf=%fw t&P  Q;F hl@%Ffff=fh=%fPhe=%FffQPhx=% sFPh}>%| L$$T$ /Ftc|$ umhC%h>%G Fz$(&h>%t$Ɖt$ t$QRPh!=% h>#kPh>%`4h&hf" Q;F<<=%h>% Q;tF0>%s>%Pp K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( pm2D$0LA y:$s$PQ F9uEPh'?% h>% h>%h?% |$ FPh5?%~ 6PhV>%n |$ "hD%hC% h#h#iL$$ 'j.$Pt$ jEWF$Q4\&h-@%ThH@%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"P $@D$@|$ Phc"h$O t$ 9|$ohbA%hU@%( D$$$T$ $@WjWh#%P Ft h#1% e2H e2~e2H e2 he2j  )L$|$$t1 q΃j.PL$QjoUuj.hI"$Pd $Ph@$ |$u"tVhM>%  hA>% e2H e2~e2H e2 he2j  t$GNjL$+{hC%Jfih.#{ Q;t$Nh$] Ntu=%%P9 1L$1΄u j,8 D$H=%x=%=%sVQ D$9D$t$uKj, h=% D$4L$:D$tHj, D$4WPh=% $D$4D$ uj, h=%n e2H e2; f2he2j)u ne2H e2)hb@%h.# Q;؋ e2Qe2~ e2Qe2 he2j  Q;z|$h ot$dc~)/F1#ty1htA%n2td3hA%m ^ F N t$~WRQPhB%B \$S(ƅx*Vh?B%! 'hA% N hMB% D$@Ph`B% ~`1St$'t:j.$WPjQuj.hI"W WShxB% ShiB% C9u\$,t$ |$d|$h19wƉ΅he2 (MR;T$p1Ʌu9QV&jV ? VPj 50R;h;% 5R;h;% 5R;h;% R;tPh;% R;tI R;9~h#n 0D$D$L$d$ % \$$ #< e2H e2~e2H e2 he2j 8 R;TR;tzR;$$R;|-R;@V2R;$\$\$\$ \$$;% $he2H he2; USWV $$919gՉ $t$ $;8t$hh%$,薁 =&GШu+$ ؃?9?)9K9si pm2LA y:$s$PQhVD =hV$, =GC~ 9r9$$ul&hh%$,V賀 =wDG$8:$ t-؍L$VSthV$,e 1 ^_[]USWVP։1|$4$u9|.HPh=>% %wS$L&W )1@1sC9uÅu.Ph%T t$߉E1 `^_[]USWV4)ȃ'h@% :։ϋ ˉ hKD%^ˉ $Wf_oUSRQt$Ph.A% Gl$j.UPjLuj.hI"U讼 UhPA%` Gj.UPjLuj.hI"U{ _U]()|c؉<+<'ueh@%0<9#<,uth@% '<+ugh@% <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5v;t$PV;hD$$HL$L$ 1x1PPPWr jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$7 ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$3_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$v;D$PVP4L$@D$D$ 1 G|$<$D$=XV2$TD$j=h%|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=h%S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSPf SVUf |$|$t$ "+Hj=h%P Ņt$,] 04$Q" 0D$$&߈FHGNm&Þw$&:܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4 "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=v;u t11jNtv;1w;v;t P1@hL"heD%?v;1USWV1=w;MT$ l$(L$DžD$5v;hhw;  |$t$ z"j hw;1 D$w;h z"V v;tUP@ uTWV v;WV t7j L$QP  x#L$9uv;;D$ D$uL$us v;8 v;APQ~ PQ(  v; tuQhhw;  |$uw;1^_[]v;{;{;1Ҋ+~,u"1t$L$t' t" t΅tAL$= ~;u ~; t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=v;u#w;v;tPù v;t v;1^w;v;tP菹 v;VtJT$1Aj<ƃ=v;u#w;v;tPE v;t v;1^t v;t D$v;1@1USWV D$,L$(l$$~ )$1H$`t v;1A\$9|ωL$ tgp9tX tt$ P4 t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$w;v;tP$ v;D$,L$$ ^_[]f11f11Ã=$~;u /t((~;11hhX~;PjNt(~;1\;$~;t PM1@hL"hpD%$~;1USWVT$1=\;+\$0L$ D$D$|$(D$5$~;t$8S  l$,D$ D$D$t$j Sv \$1 h z"V1E|$tt$(Pz u~ z"WVEWVt^j L$QP6 xJL$9uAE;D$ D$<u/h z"Vtj L$QP x L$9t[ $~;8 $~;APQ~ PQ8  $~; tuQt$8S  E hgS#V,EthgS#VwhgS#Vah z"VEHh z"VE /h z"VE$j:t$  1@|$ u\;1^_[]WV=$~;u et3t$|$ 11t$t$Wj1tЉ^_1@PPhhX~;h(~;t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=X;u+\;$~;tPL$Y L$$~;D$$tˉ01C؃^_[\;$~;tP $~;PPhhX~;h(~;t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=X;u+\;$~;tPL$腳 L$$~;D$$tˉ01C؃^_[t X;t D$X;1@1fUSWV\$l$t$VB PVWҾ U) PUW达 S PSW誾 t$ V PVW蒾 ^_[]WV t$uRt>DžtA=b;t ^_Épxj Ph! ؀=`;u1F1=a;t証 1맋5\V2g c"QQhD%Pփ蜰 USWV1ۀ=p;t ؁^_[]U D$ |$GSSPhd;jW&u d;L t; x;r1H|;c"1ۃt2u3hWhyE%W D5l;~ȍQ2w$&;PAu ;?$D$-\V2f h"L$QhE%PՃ;`V2@;dV2 |;I9@hV2 |;I9@b;`;a;;;y;p;g`V2 |;A9~WH`V2O;FdV2|t%ƍC!t2)É$)t*;L$ ;$)PD$p xPh; =;=;WjD$hpj Ph!% 5\V2_ c"QQhD%5\V2^ c"QQhD%Pփ貧 111{PZDWhV ESWV 1L$ |$ ru\95;s(>tGǀ=;u.;=Ђ;rN;=؂;rDh; DžtVjWz =a;t^赲 1ހ=b;t& ^_[À=`;u1Ffu]pxj Ph!豶 뺋5\V2] c"QQhE%PփZ NUSWV|$4t$0Ë ;9s&;9 8Ս1ʅ/;99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95Ђ;95؂;H_ŋ ;!9r؅ ;9s9s_x; 8!9t.M9wI9rE;8! dV2!9u!=;=;h;Rf ʼn9rPVUV  8!!ōD$p ;PVL$豉 D$PVt$8迍 ;Pt$jUVthŋ$L$Ai Qh;Ċ =;=;u=a;衯 1=b;tM^_[]t$h;h O=`;1GDu3t몍D$0xhj Ph!z 5\V2^Z c"QQhKE%Pփ 9U7)SjZP)MPjS :9/ $)QjZP)PjSL tƉ111USWVˡ;!9ta)‹ |;h t u9=,$)<l u=;OE$)ÍFu\wl&xD$X ;PWy PW荋 =;N V;5;w(& w&1É;GsG1B TGHO;Mu9}tAtDEWP 5u%E9tt9sMxt MPQ }-E $ut=;tGV^_[]ÃWU VjZSr vjZv ] VjZSL V t$=b;tt ^É01ɉHHj Ph!議 ҋL$SWVȋ;!9t+)֋ |;| u 9t%)D @A Qh;葅 @D^_[USWV=;t^_[]þc"VVVhE%\V2Vh"h "hE%\V2#"=;u"[%=;us%7"=;u!RQPhE%\V2~%=b;uF%$"=`;u˓"*$=a;uެ#F%=;u+$VRQP\V2\V2$ d;|$gfff̉ҍ4މ劄1"GO wһc""SUWhF%T$t$|$f4SUWh"F%\V2\V2$ ;Ggfff̉ҍ<߉劄9"FN whc"h"Vh1F%T$\V2$ ;|$gfff̉ҍ4މ劄1"GO whc"h"Wh@F%T$\V2$ ;|$gfff̉ҍ4މ劄1"GO wҸc"PPWhQF%T$\V2$ `V2|$gfff̉ҍ4މ劄1"GO wҾc"Vhil#Wh^F%T$VVVhcF%\V2USWV΃=Ԃ;tPt ;3!1P/ǡ; ;!)ȉ9r1U/Ԃ;9tEuótP-x;!1PPjhjUP? t(;t;=;=;-;1ۉ^_[]V΃?; ; ;v$1u;Ɖ ;^USWVP;;; 0trƃh&P F,=t;=;4$t|n011FEEh&P ـEEC;(9r:5\V2R c"QQhF%Pփ=;h;11;9s[ $,0EEh&PU s+;C;]ǡ;;(9r;9$sj,Ѓ0EEh&P ; ;s ;)ÉE;ǡ;;;(9r$^_[]E L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡt;D$;D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9;s$5x;!։Ņ9;v6J Љ  ȉ  F1r{@p9;sBJ Љ  ȉ  F;; hV2u%1I#5;!֡; dV2HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU" tPU2 $Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=;t=;uVj1^_[]VhU臅 USWV5;1!-;t E;1-;E@;;v@uW-;E@;tE3t,ÉE uUh;G| =;t"=;t!;E-;^_[]VhVjSȄ USWVΊ |;T$ T$FD$t$V$D$9Btr$u$…;ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S} ~VS-{ SD$x,t @,KZ ;tjNjD$G G; ;)ʉWOT1Nt TtWt$z -;T$ |;^_[]1USWVȋ5;!) |;L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ;94$1PPh܂; Åk jS܂;W SW| ;;;-Ђ;r ;-؂;1WWjhj\$SU5 t\tV9tRSP uE芞 j@\$S0蜤 -\V2I h"ShF%PՃ=;1lj1;4$9v(; 1QQjPjVQP5 @wg1=Ԃ;j %ŋ5;!Ɖ)tP$Ԃ;9tut݉<$/؂;u1]4$D$x Ph܂;yw tA<$܂;C 9r09$v+jSV} SV{ ;;uɉD^_[]R Vd; h;r!1F<u. h;d;F9r^USWVP $1N=;1!׉) |;D$)ot +t=;;;v|u+HL)͉ll+;;s| ullD +lD;G,$vuWVz DGWV5w ;_s_u.G WPy =;u.M,t ;-},^_[]jPRE 5;^_[]USWV@׉9 Ђ;95؂;j";؂;u >9uP";؂;FjWV΢ *1ۡ;t  ;8;H@; ;v@j;H@ ; 3H ;HPh܂;u ;9rWV u= j@S0 -\V2F h"ShF%PՃ=;9=;u];t  ;6;H@; ;v@u,;H@ ;t=;p xPh܂;<t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[áj2D$t$PhWVL$T$ ‹q~y ;q~ t 1~9 QP^_D$ pm2DAD$ pm2DAD$ pm2DA%D$ pm2DAD$ pm2DAD$ pm2DAD$ pm2DAD$ pm2DA%D$ pm2DA D$ pm2DA@D$ pm2DA%D$ pm2DA%D$ pm2DA@WV1F|$ 4&Wv tF u1^_ËD$t w$Ť&1ËL$1t9t1ҍB|uËL$1t# t|$tpm2LH1H rËD$t pm2DA$H1ËL$tT$At9ut1VD$t$tPt$VIz ^D$ hm2DAD$ dm2DAWVD$ c"c"tƀ>t$ 0DPWVh %hLf2^_Ð1|$w L$t9tøV2f|$3"tc"fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[]; 1۾$$T$$IwL$I`q|$ \$߉t`r&j`PSx `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ Pw t F;&tm&D$&D$&1FthPt$$VJy V葇 Ft$N tVD$PSw |$ut$`e|$ \$|$u,1F|$uu1;&t$`=u-8 01H^_[]Ë& r ,$&t u‰,$&&<$t9rPQt$v 1t/<$t9v轒 |fL$,G%9 'v`m2fL$AG%9 0'vx`2føÃD$L$L$ L$D$Vt$ t$VhLf2| h!V^t"" 0kPh#hLf28 Lf2Vj VW ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t\ 0 S 1$^ÐWV|$ W4&x tFu1 ^_D$ftL$Q\&1USWV$п$$ u V舃  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#+Lj4$Y(m111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$;L$L$ tU+|$$1Ĥ^_[]USWVt$~X>3܃ V$ & j F H @(N]_?[\;^r~uFF;;C><% ^q{t|~F~F ;^r~uF;FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF;F^9րրw t$rI{i9s <$=pm2]D_\,<$t~uF F;;Au~uF ;F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=Apm2IDJt"m9~~uF ;NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF ;F"{u@9s pm2DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup pm2DAu f'tf`uW~F=@9t8}@u~uF ~uF ;FЉL<$USWV t$ ^h.\u/;nr~uFF;;EMŁ'$~]$8&|tfύ]Љ8S dBt@SB*@.[Oω\σ~uF;FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF;FωωD$$xt~uF ;.n~EFx pm2DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s2pm2 DJt"r 9~~uF ;N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF ;FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF;F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! ljhm2TXL$21@u"dm2TXL$1t$1ɅtT$T$1=j2E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8u;F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 pm2LAtx dm2uhm2f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQA F^_[USWV1y19sC11-pm2D]t#=k)CB9u1Bt=|yuA ;Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$&)@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' F;FUSWV\$1=j29v1@(ϋF,@jPv(V t|F(N,QV,fH~<t}hm2Dh j21҃9v1B j2dm2Dh1҃9v)1BuG ;G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF;;;^_Ã~uF;NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF;F1^_[]É؉D$eG%&t$t$Upe u Ua t/uՃt~uFG롋$USWV 1=j29v413A8 $A,tI hm2L$ dm2L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS\&uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQgP o^_[]SWV1G9Qs7ӉjRq tF^~uF ;F1^_[USWVP1N׉$1+t{`tswsK$&@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=j2|$ r3GtD$WT$ou]t$S^ |$Qo ]GtD$wt$wt$wSI^ |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋O >M1PVh{t$Vt$pL$xtEpt$t$4=> L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ } ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf pm2>|$u l$`\$\z pm2D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" pm2T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA pm2D$¿!DQf_֋D$ !DAf|$$_8tV|$upm2L$ DHuf|$$_u3|$upm2T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$&$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ Z ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf pm2>|$u l$`\$\z pm2D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" pm2T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA pm2D$¿!DQf_֋D$ !DAf|$$_8tV|$upm2L$ DHuf|$$_u3|$upm2T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$ ,$Ept$8V( MT$\t$Vt$(W|$t$p \$(D$$ŠL$d|$T$ DQ f|$$_"4$l$`|$dtF1L$<)tD$0@D^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$`&$M|$$T$ \$l$$1P\$St$ W71Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$@l$$jVPSrK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Us9uËL$@!Ѝ4NG$jVWS9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWSR9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$t VM @wj/V} 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPhI%jPh;J;ø0%Vt$1Ʌ1t э^fVYnT$ws^ÐUSWV[8l$,D$(u1T$|$;D$ T$$75PW EPW PW $PW t,PW |$D$ tHаPWi 7PWQ ɰPW9 i?PW! tGPW  |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [U$ @$ $ ,159r 胼$ t+$ $$ FhPW $D$ D$jD$$ xfD$4D$dz /$$ AfAfIQPRhWJ;qt$ VPj $D$ $P!;1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ VhPWJ j:W D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVP6t Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃKt5D$ $t1L$ L9s ዄ$ @<C6L$|It$tjhQPR*D$4 qqPh$PV8$$9s|$$$9s$$[1 $L9s D$HL$H P [RQt$ Ph$PW7$$9sD$4qqPh$P6${$_9sD$hI$/9s狄$ @qPQh$Pb6$$9s獃t$Ph$P 6$$ o9sD$ tWqQPh$P5$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ 1$$$9sD$dL$HL$PGL$pRt$t$t$$h$PD4D$L$HL$HL$HL$,HL$(HL$$H @ fT$0PQt$,t$4t$h }9u8jj tl PQ= 1 4 0ǃh gǃƃl tz 01^_[ÐUSWV[%$01l uut!j/V8 uSl tƅuZƍ|$i2VPQhW*=r ?h@VǍD$ jPWS  D$$WZtLD, L$Pjhjjj QD$(P Ƌ<$t'Vu D$8 t? 8 1 L$^_[]ÐSWV[ִl uLP'6ƃl $tj/V uAƉ獃i2VPQhWt)=r ?t"l VP tEFu7hh%@V- l hVP 衪h jj t=jjjc !ƒt"C1h P!B 1u 0 0^_[ 8#uVt׉o ƐS[.>[ÐS[t$[ÐUSWV[u } D$<$ t$u$$D$Pjut=k<T$JL$|D$x$L$x$PQ$$$Pt$?lH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$`1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$X D$@j PW蕪 ; 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $C \$ 8u$$>$0։ D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR!ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6PW8G4jjdv6 jjdRP+WPGLjh'v6u W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$,s L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$t9u1^_[ÐUSWV[kL$tEׁu$C t+t9u11ՉL$!։1^_[]ÐUSWV[|$GtB#l$%t$PB<t!G t7t9uӾ^_[]ÐUSWV[{tC#l$ t$P;t!G t7t9uӾ^_[]ÐUSWV[ tC#l$ t$Pb;t!G t7t9uӾ^_[]ÐUSWV[Øt$0t$,zǍVP6‰t$D$(%D$1퍃D$ <$l$tg|$ !RP:tG t@/t;L$uЃt'D$ t$j…<$uNt$0t><$9tR PUWg >&t1<$W #^_[]fUSWV[[t$D$hEt'1PV9t%D=u1p u(IVPjD$@ 8^_[]ÐUSWV[؂|$ D$hEt$1PW59t%D5up ^_[]ËD$@ 40tM D$jPt$V| ŋD$18te r"u##p uB"tt$p a4$WPjуH(IWPj^SV[ít$ v/!v $!V!^[ÐUSWV[hD$,8tD$,1퐐8@ujDHƋ|$(WwF$"jUF D$ D$,F>D$Pt$1}nu1ɀ}ouL$D$j=UԌ tǃ|$D$,t1PU6tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8p t 4$Vw1^_[]Í(IUPj`USWV[õ$4$, 0jPU uj:U跋 =jPUm tKt$}/3t$UhV jVEPU P t$UD$P)|$ DIjjWjjV5mt$ jjWPjVl5t$/!D$PV?ǍD$t$jDžjt$W uj$4$4jWMtƍD$Phzd@V胭 VD$(Pt$P u^P$0>3r$0VPWM FD$ GL$ LIjjQPjRT4tqVUWUq R 0o$0Xr 0Ckc 8uj/UŃt$ $0UW跮 * 0QPW蘮 111 0o$0P$4i 11,$j$4V$4WjUP~*PWt$t8HPQ&| 0C$0P$4 1,$D$PU= 0^_[]Íc,$UPVW1 (*=WP$8$8VfffffffS[Û{D$D$ $L$T$jjPQjR=2yD$[fffffS[;{D$D$ >$L$T$jjPQjR1yD$[ÐS[zD$D$ ?$L$T$jjPQjR}1yD$[ÐS[{z$L$ujjPQR豢yD$[fffffY/zT$uÐS[yt$JSWV[y|$Wt$t$o 9r ?WVPj^_[ÐSWV[Ìy|$Wt$t$_m 9r ?WVPj^_[ÐSV[=yt$ oƅuPj^[ÐSV[xt$t$nƅuPj^[ÐSWV[üx|$WƅtuWPj ^_[ÐUSWV[{xl$|$UW4ƅttuUWPj^_[]ÐSWV[,x|$Wt$ƅtuDWPj ^_[ÐUSWV[wl$|$UWt$- t 0aUWPj^_[]ÐSWV[Ìw|$t$WCƅuWPj ^_[ÐSVP[LwD$L$T$$RQPI ƃuPj^[ÐSV[vt$t$t$aI ƃuPj^[USWVP[úvPt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1 (t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[:vPt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1* (t$,t$,t$,t$,t$,t$,Pj ^_[]fXuL$"w ÍoffffffUSWVHXuD$0T$ht$\L$p|$d1ۈD$4<uЋT$`l$l4$T$l$D$ L$D$D$D$ D$$D$(D$,|$L$d tt t$\ %ju%#jo%#jxt$\l$L$t \$0WPURV \$0WPUjj~D$ |$4R|$D$811|$<,L$4L$0TIGD$ 8 O3L$8 `|$4=RL$ ;L$s$=D$L$ ՃL$ -O? G<@ |$4fu  t$ T$։t$81 tl$81 u<@* '  |$%O?1ҸGD$ t1#T$#t$ |$,D$ D$(;D$s $,D$ D$ wӉډGD$|$,L$ tL$(;L$s $,L$ L$ ;L$s $L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ D$ D$$D$(D$,T$ |$)\$<$\$0WRT$ RQP ؋\$0Pt$ $ڋ\$0Rt$L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ t$)$\$0VRT$ RQP;D$s $T$L$ t$$L$ )9v" 2L$ ;L$s $#L$ L$ D$9l$Ds$D$L$ ݃L$ L$$D$(D$,T$ t$)R $\$0VRT$ RPQL\$<L$D$(T$$)9sqT$@f\$0WRD$ Pjj\$Pʅ~D$ |$\$0VRD$ Pjj[T$4ωD$ ;D$4s $>L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ |$)v>$\$0WRT$ RQP;\$0VRD$ Pjj1҅l$D\$0WRD$ PjjgT$@~D$ t$ t$ ~!‹L$ s1|$,D$ tVD$(;D$s $,D$ D$ Xt$ wx;D$s $l$L$ \$$L$ )9v" +L$ ;L$s $#L$ L$ D$9s$D$L$ L$ L$$D$(D$,T$ |$)vH $\$0WRT$ RPQED$ y|$Q ;D$s݋ $L$D$ ͋\$0WRD$ PjjiD$ u|$,L$ t@;L$s3$ >"\$0L L$ ;L$s$#1L$ 1L$ T$t$$)9v" 2L$ ;L$s $ #L$ L$ T$9s$ T$L$ L$ L$$D$(D$,9s$ T$L$ L$ 9v_r $D #T$r= $D /T$9s$ T$L$ L$ 9vr $D #T$t $D uD$ H^_[]ÐS[hjt$t$t$t$t$8[fS[þhL$T$ Pt$t$t$[ÐUSWV[xh|$$t$|$0t$(aD$ j/Ujt ,$t|MUPt$ WVt$8IuU, 8uFt$ t$Pt$t$@t$WD$ ~ L$u [ËPQ2  [ÐS[VD$~ L$ u [PQt$ [ÐS[þVjt$ 0 [ÐS[ÎVjt$t$t [ÐSV[]V0t$t$V|) tD$~ L$u  PQV ^[ÐSV[Ut$ t$t$V ) tD$~ L$u  PQV ^[ÐSV[ÝU0t$t$V( tjt$Vh ^[ÐSV[MUt$ t$t$Vp( tjt$V ^[ÐUSWV [Tt$4@|$ǃ( <ǃ, ^ǃ0 vǃ8 #ǃ :ǃ 'ǃ #ǃ #ǃ #ǃ< -ǃ4 -ǃD _ǃX |ǃp oǃ8 -ǃ@ -ǃ\ <ǃ` >ǃd *ǃh !ǃl f2Ot^t8tjtfxx ؋tvQjPW 1 QTpQTtQTxT|=u^_[]ÐVY,1 T$tpqttqtxqt|1=u^ÐUSWVP[J, l$j+GG(ujj]UQPup uoPj8j3NQPRej>48 j<$` j^ jv j# j: j'p j# j# j# j-( j- j_tx j|d@ joT0 jpD jr4P jy$h jz j{ j| j} ǃ8 !ǃ$ +ǃ` !ǃ( ,ǃ !ǃ, -ǃ !ǃ0 .ǃ %ǃ8 0ǃ %ǃ `ǃ %ǃ aǃp ǃ fǃ ǃ gǃ %ǃ hǃ &ǃ iǃ %ǃ jǃ8 %ǃ$ kǃ` %ǃ( lǃ %ǃ, mǃ <%ǃ0 nǃ( %ǃ< qǃ #ǃ4 oǃx #ǃD sǃ %ǃH tǃ $%ǃL uǃ 4%ǃP vǃ ,%ǃT wǃ@ %ǃX xǃ0 ǃp ~ǃ #ǃ8 pǃP #ǃ@ rǃh d"ǃ\ yǃ e"ǃ` zǃ ǃd {ǃ `"ǃh |ǃ ǃl }2NthtBt'zxÀ z ϋtuQjPVpx | 꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVX&x l$+4+ع x( PPu^_[]fffffffX&L$fǀx ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[N&t$0[ÐUSWV@[&|$TED$G8$u!O9OuO9Ou 9u_uWEt W|$XE3t:d10{Eǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3d/1j ‰PD$<x-.D$8|$AG $tJt PwW W~"G @t;o 8u1E3t%d10uEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u*E2$t L$Xu$ L$Xt$AsiSV[ý"0t$t$V tt$Vj^[ÐSV[m"t$ t$t$V tt$V^[ÐUSWVL$[$"|$0D$(T$ 2D$ED$4D$D$x fJtW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃx ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4x ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃx D$4Pjjjo 4449)4L$ 4QWPt$)4;4}2Dž4t(D$4PVt$ t$ 1|$0fx 4)Ɖ4fǃx ff9t |$ u |$ t)Q)Rk* t$VUF @f|$tg&D$@ 4444H44L$ 4QjPt$e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4fx f1jD$` `4rփփ19‰4 4fx fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4fx f1Pjj!QI( j_S[t$j[ffS[0t$ [ÐUSWV$[Ø|$u G2t P:Q2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍ RPQUY|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(P@6 tjjP ,GTP6 tjjPe GX!2@@xGX GXO <W$d OT h2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$VW P薦D$$<$$u$Ps# HuǐuUW PD$$鐐<$$u$}P# Huǐul$Ut$VV(U$|$~"14[;>|FV=^_[ÐUSWV[Åfǃ h}u$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$ Jj T<TV$2@J4tV}P =wlj<$hVt$ V B VTP 1rNj2Z1퐐T,jj L,LNp9u^_[]Í$Pj1S[0[ÐUSWV [è|$ EG8$u%O9OuO9Ou9$uxWo/t W蒋`8tUEHAIL$WW9uOO 9L$u-O OQRt$ PGGMIAG GAE3t4d10xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R*G4$=u8 $A @11 $<x=D$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a UY 8uE3 $tԋd10vL$Eǀ3뤐SV[Í 0t$t$V t V^[ÐSV[M t$ t$t$Vp t Vr^[ÐSWVP[ $t&T$t$2PWj $^_[ÐUSWVP[è 1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[ T$9D$PJ 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[ 1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[x D$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9  f$t|$u!|$t'QL$ )RWŃuRG @tGT 8u=D$3t.d10yrD$ǀ3G @|$tmG  f Hȃ  fftVW=Vt Hȃ 9 Hȃ f9ufǃ f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f D$DhhA Qʃʃ19 f ^_[]ýG @tBbR 8u8t$3t)d10 pǀ3g 룸FPjj Q j)uSWV[ü|$WדƃuOG @tDQ 8u:3t)d10boǀ3^_[ÐUSWV[;tt$339}3AP3t' 333343;33PQRP 33t331^_[]ÐUSWV[ktt$339}3AP3t' 333343;33PQRP 33t331^_[]ÐSP[Ý$tT$ 2Pjj $[ÐXO tT$QT1øUSWV[TAx43fTFT$Pj 躑+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhh(to DHDHDHDH uǀD$ FF^_[]øۚPjj$,PjjQ jpPrjpffffS[N0[ÐUSWV[(|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQ@uF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|t1fF9vʋGPt$wW&"W1^_[]ÐSV[í0t$t$V t VN^[ÐSV[mt$ t$t$V t V^[ffSWV([)0Wt$<3WV0^_[ÐSWV([t$8Wt$@2WVt0^_[ÐSWV([é0t$11;3}:tt3PT^_[]ÐS[T$t$t$ [ÐUSWV[93|$0t$,T$ $uo`MDH@utl$4D$ UG 鐐t$ D$PL$ QD$ P@x)t$茋tL$9D$)<9u AT$)RUt( $4T$4R7D$0D71^_[]ÐS[Þt3t P[ø[ÐUSWV[X8D$ $4VjPjZtSʼnt$UeƅtMD$ $t$UD$PVtT$t$$V VJu^_[]ÐUSWV[Û|$3t P 3~/11퐐440t0;3|4t3ǃwwLJ3j0jm4tW2Ht<@xX3~3|#PL72@HX3@$4Ƈ31^_[]ÐUSWV[{t$3t P3~/11퐐448s0;3|4s^_[]ÐUSWVXt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([è4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$WA 1Ґ$t$V|$(WD$0P1t$$脆ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj VN $4D$)Džu |$ $tR1VT$ j 4$)tWj V T$L$ (^_[]ÐUSWV`[14t `΋43t42NzRЃPWVrPVhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<W9 PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DPy;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$PD$T$3;4}D$PRjQD$PRjQNj$D(P趃D$$L$ ;47&ffffUSWV[|$$D$hjjUt t)ƃ|$t:L$tVD$ tNt*T$D19tL$  11fVUl$ U. D^_[]USWV[K|$$2t$\Ƌl$r:D$0膂D$4euX9uE$E EEEEE EEEuDE$E EEEEE EED$%ED9tL$ ft M}Wt$U3 1^_[]ÐWVYD$T$ t$w4  p@^_fffSWV[Ìt$V~~tyы9uv0jv,j9p9p 9pt P jVj1^_[v4~j9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PiffffVX.t-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[Þ|$ uT${[ø[ÐS[n|$uT$ L$O[ø[ÐS[>|$ uT$[ø[ÐS[|$uT$ L$[ø[ÐSWV[|$u<t$D$9% ƉM1^_[øSWV[||$u8t$D$|$% Ɖ81^_[øVXt9|$ u2AX2#Q@Q@p1~8tt$ Q@^ÐVL$t9|$u2AX2#Q@Q@p1~8tt$  Q@^ÐS[nT$R[S[NL$T$ 6[ÐS[.T$[S[L$T$ [ÐSWV[t$8tCGX2@TtgAWW@x8tg@1^_[ÐSWV[lt$|$tCGX2@TtgAWFW=@x8tg@ 1^_[ÐUSWV[΋AX2GTt tNA t tNA t tNA@t tNA@fy tNAt tNAt tN@t 4tN@ t tN@ @t tN@@t tN@t @tN@t(tt Vdt"G8tt V1t$׋NX2#N@N@Rz8t N@^_[]øSWV[L΋AX2@Tt{ @f @tf@t Vt V1t Iy8tf@^_[ÀfA =fA9fA@5fAf1fA-fA)f@%f@ !f@@f@f@RD$t@@øÐXHTtG1 u<uA uFuKuP(uUa1(uHT t  t @t t (tt 8tt tLt ÐXHT1  4@(1( S  N @I D ?4<9 6@3@0(tt 8tt tLt ffSWV[Üt$8VPVW ^_[ÐSWV[\L$|$t$x"1t%<t9u WPWVN ^_[ÐSWV[t$|$WPWV ^_[ÐSWV[̾L$|$0x1t!<t9u WPWV ^_[ÐSWV[l0t$t$V苑 t|$W9PWVn ^_[SWV[t$t$t$V? t(L$ |$x#1t&<t9uWPWV ^_[SWV[ìt$t$t$Vϐ t|$W}PWV ^_[ÐSWV[\0t$t$V{ t$L$|$x1t"<t9uWPWV7 ^_[USWV[$AL$I,D$$|$@1 $D$HL$D$ $[UT$1 |$@T$ D$D$jD$Pt$t$D$$Pt$$)~"D$@PVUD$P nxNjT$u$^_[]$USWV[ջ$$AI,D$$|$<1 $$HL$ D$$hUT$1 |$<T$D$$D$$D$Pt$t$D$ P$$)~"D$$P lL|$Ll$Pt$VD$XL$D$ D$|$LG@D$GXpX);OTu%G8 uD$P .G9|ƅp|$Wt$P薸ouAt$L;NTxF8 |$P#$VV _PktUl$PE|$Lt$L$X L$T;GTG8 $Wr D$TDl$Py T$T$L$XD$\pt81$jDL$\LT$J HB 9uЋM t$LF(T$XQ;}I ;T$T$~D$XPP2VD$Xt$$щy194T$l$ 9ŋ|$L~cl$ D$TO,WDx77fD7Pu|fD$ EHD7ELfD7D$XT$щy1뎋l$PʋM G(T$ЋI;}t$$D$\pixL$ GL$X+9D$ ~D$T;GTuZG8 uHEL$X)VD$T|$PD$X $WJ M D$XG(Ћq;}D$XG9}Tދ$GDVw|Re[GHFGLfFfFD$XG9|MW(‹I ;~G$Pt$ t$\6WD$X;GTtO,pED$O(T$X @;}F t$PmeF L$\Af W@ %uыWH ȅtL$ ‰VfND$\@D$rGD$11$j@#L$\L pE 9|$uӋD$HD$X|$ |hD$ p}$$@D$\@GE!ȉGGfGFfD$X~GtPSdG맋|$LG9El$ l$9}dG,L$T 4p$f~y9GDfFVw|cGHFGLfF;o|G(L$P I ;~$Ut$ D$\0WL$T ;OTl$Pu3G8 $88u D$XW1GO(UR ; ~ G$Pt$ t$\6WD$X;GTtO,EOW(у@ $W18^_[]ÃO, MO,L$X 4pUSWV[E$F$$$$AN11ɉFXhXș)Չl$$;FTu0F8 u*$1D$F9|ȉD$|$FD$FD$1|$HL$ D$FN,D$1 $l$ ^UT$1 |$HT$(D$$D$ jD$$Pt$t$$D$,P$$)~"D$HPVUD$P_xNjT$u<$D$;D$$|$H.V $͋tp $E;FTu;F8 HV`$E$σEN,1 $n@ƉׁuQLb$H($$P; } $P ; ~ $$xD$ t$H$ u$$fd $xHt |$$B9u$R1^_[]øfffffffYϫt0 I8t u tHAøÐYD$t0 I8t u tHAøÐX/ tPtaAøÐXL$tPtaAøffffXt1HX2I(t u tHAøÐD$t1HX2I(t u tHAøÐXt @@øÐD$t @@øffS[Ωjt$ [ÐUSWV[è|$tyG8 tsl$ 1tiWD$W$jwPW| UW4$t$W| 98uj z88uG^_[]ÐS[t$02[ÐVXΨtT$xt$ 9q~ 9~QPqT1^ÐVL$tT$ xt$9q~ 9~QPqT1^ÐVX^tL$ T$pP2@T1^ø^ÐVD$tL$T$ pP2@T1^ø^ÐXHt t1ÐXHt t1ÐS[Ît$0[ÐUSWVZX|$(QL$,CDD$8t98t #GHD$ɉT$}_;_P| wT9w)9|ʃ$)9݉t$ }h$؉щT$9\$t$ 9GPjVWF;wxًo;oP| GT9#G9G\$Prqg _9ZG,T" !uW,LЋO\$t$ l$U9ʼnT$5~11$G,ODT$x7 7L$L7L7fL7\$Pu|XHfD7$M9ȉ|G\$t$ l)ڃ9unD$)9|ȋL$‰D$ )ȉ $9}WD$ 4\$!WRqp+ ;,$}%W, 2 !uȉ O,Ӄ|$ G\$$щ$;T$}i~11G,OD$@( (L$L(L(fL(fD(Rw|VtG9|델Kwl$9\$}!GPjVW`9uGt PW1^_[]fUSWVL$09AD$)‰T$ 9S~CD$A,$K(\${,1T$t_D$D$ȋL$ $4L$,1\ [ˋZTJTJ9t$uΉD$L$0\$YD$+D$$PP/^_[]fffL$t QtA+BÐL$t QtA +B ÐD$t@øÐD$t@øÐD$t@øÐD$t@ øÐD$t@øÐD$t@øfffffffS[Ρ0[ÐUSWV[è|$$98t#GHD$D$GDD$ oW,4u,$W/19E|$$GGt1҉$G9}^N4T$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZ>L$1~t$ ~9J$u9r ^ÐUSWV[D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77>1^_[]ÐUSWVP[zt$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux lQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p d912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [t$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV$1 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[ýT$L$ Aq D$t$jVPt$ ^[ÐUSWVXx$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQDE;~} K(t$몉SV[ÝT$L$ Aq D$t$jVPt$ ^[ÐUSWV[[l$1t>19)Rju uuu0tPU^_[]ÐUSWV$[t$D1Sl$HGL$D$~$L$ ~jjjjQP2 [1[ÐUSWV [1|$4׉L$hdǀǀǀPF, $jWJ$F0|$|$@F4T$l$DL$G:uo~G,D$ 1fу9~ƋD$ 4t',$E,D$G+E݋\$t$C,W+S&륿\^_[]ÐUSWV Y{|$4t}\$\$4$Pjt$8T\$ D$ L$H HD$8;Hϋ@,L$4p0 F, fFV8 !k, < fN< 49D$8;H|%T$t$t$ǃD$8;h}pD$$p|$ OoL$AD$$jG, 9;t$u 9l$ut'9L$D $jUt$t$V$T$ BL$$ ABAc9dOfɺL$Nff|#udt$T$։D$,)jVD$ PRPfL$D7$|$T$t$WL$΋D$)jPWVW#t$_D$@f|$0ut$It$t$,Qp4QjP-ɋ$Rd4PjQQ f~$~gD$@u]D$$t$Fh2u&D9u%$PD$<0l;\$6>v t6>vuD$@tt$ t$tNFy$j=D$@$ $4jQ Btdt4$PjQP D$@|D$<@1fl$<΃9T$$u뎐l$;|$ ,0t$l$,L$HT$4;|$  E;l$0ŋt$ T$4D$D$(l$@}D$D$(@L$|$ t$9T$9|$D|$T$ЋL$ 9ȉD$ D$ AD9@ @ @ $Pq|\$IT BfBD$ ALfBt9zAD$Rq|<\$uD$DWD$D$(T$D$(x;@ uD D$PD$1r.1@ $Ph V\$ ǀw @ $PQRX\$ D$@@ L$PD D$ D$T$)։t$L‹t$ )T$()l$,7|$LD$ pPD$)ŋD$@H0t$T$l$ xpuHt2t)|$ "T$t$>l$ ;WT$~Hqt$t$$Qf 4UjPG jjjWVdt$@UjppG jjt$jj9@t$ QIfUjP}G t$D$(T$L|$ )T$t$T$L։t$TI,T$DD$D4|$0|$4|$D|$(D$ <D$H49;|$;t$D$ @,\$ D$hx6ƋG 鍄@ $h QPW\$ ŀ=rv4l$G@ $h WP  E$h Wl$ P\$ w荋@ $PQw诐 D$PGD$H$Qjt$HVP訂\$l$,KD$@, /D$H$QjVPf\$L$09΋t$HuD$ @,tϋD$T$49ЉL$0D$4D$ H,et1L$|$ t-L$ $jjQRVt$@$U4b $4$QjP'D\$ D$l$ )jjD$Pjt$0HUPbl$xpuHt2t)|$ "T$t$>l$ ;WT$Lt$|$$WQ"b 4UjPPC jjjWVt$@Ujpp)C jjt$(jj@6D$ PQaUjPB |$YED$4D$<(jjWRVMD$@ɉ|$0tT$t$9rtK؋$PQ8a4QjPfB |$jjl$(Ujt$@HtlL$ QP`l$*L$l$t$$4WjPA D$l$|$ l$ t$L$$4VjPA |$4ll$l$,|$$@VjdA ul$ t$-?$jjt$(RV$4t$@$Wj A\$ ul$,ŋt$$@Wj@ ul$t$UjH@ |$ t$|$,t!|$@UjH@ u@L$ IQjp0%_ UjPY@ jjjjt$ |$$4$VjQ @\$ |$4l$l$,@$Vj?\$ ujL$ ɋ|$t$y8UjL? D$ t!t$,@UjL? u@L$ IQjp0%^ UjPY? jjjjt$0@@p1t$4QjP%? L$$jQVjU\$bHD$ $jjt$RVh$4t$@$WjH>\$ uL$L$ T$9Q|$4$VjP_>\$ |$4l$l$,@$VjL->\$ ut$gPQhtRT$\USWV [XD$41\$t$LL$H\$DT$@|$ PQJ t*NjD$9 t#W4$~ 1ɋ$4PjW+ ^_[]Ë0D$4L$ d;> MIIlttt$ jQh+ j D$uǃ USWV$T$ [TF D$PBpL$ t$tIT$$d t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$Pjt$) ǃ ǃ 11ҋdD$8 tlj)D$8>$0D$8 $<t$u; } t$Ћl$)$t$@@9 9<$PjQ0) @x H$L$T$ t$dՉL$)4/L$T$ 9~L$T$ <$Pjt$( ǃ D$ ; ;T$ 9<$ to j P;x) @ltQjP%( F t3 j P:x) j |j m  ǃ 1;  $l$*ǃ ;  @@ltWjPV' yA t`j t$9x )ȉ }u D$8o@@lU8 LQj `u ;  "UjP& ; ~U   @@xuă tjW9x) j띍 ; ~- @Uj% yxD$8 )ȃ,$D$ D$4$jP% D$(19 ș)Љփ< 9D$@u t!j t$7x) j t D$@, @D` D$,$.  -; !D$P, t$j<L|$ tv ufL$L!;H@L$uSDuLf~54t t L$ fu-@t!,$UjP#  t0j t$Z6x )ȉ j ǃ tD$ D$ $^_[])ȃ|,9t$,$,@tUjP# <,$ t!j t$5x) j f ; ~nUjP" ;  @@xu̓ t!jt$)5x) j룉PS[n=D$ t# PQ4x) P1[fffX=Hy8~DyD~>Hlt htðuu냹tt u1ÐX<@ xÐUSWV [È<AP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t4PjR MAҾt.4PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21ClD$L$ /jt$ZD$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVP[ú7L$9 ft$9|$ 9l2uCUw$-4$t$sk*OwN|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVXx62lT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVY4|$xv9{`|iT$t$p"fr"f1l2u@>_w-s y*Of>2~w-s q*Of ^_[]ÐUSWV[3L$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 74QjP8 1^_[]ÐSWVZ<3L$x?9J\~2D$t$|$ Irftf>vf1^_[S[2ǃǃ9t% DŽp"DŽt" t 1[ÐUSWV[[2T$L$l2uI~w-ss*Ow!Off ffffǃ>t* f0p"f0r"DŽ0t" t 1^_[]ÐXo1h2ÐUSWVP[J1t$ t@@1EHd9l2p"fx fr"yVRt6$4PjR{ , $!A@Ep"f@dfx0ɋ2@Ql34QjP* Er"Zfp"fx fr"yVRt6$4PjR , $!A@Ep"f@dfx0ɋ2@QC34QjPq Er"]fx*ҋ2@R434QjP2 Efxd#H@ H@^_[]ÐSWV[/l2tu6@t!|$4QjP ,!G@f@d^_[ÐX.f@dffSWV[Ì.D$ yOQW~ ;O~ t Q WPWv@^_[ÐSWV[.|$D$OQW~ ;O~ t Q WPxW @^_[ÐSWV[ü-xWt$5W?^_[ÐSWV[|-|$Wt$W?^_[fffffffUSWVX;-tLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j xL$h( $ș)l$T$ $L$$$D$wgx)ʋ=T$P?xl$tD$  dl$lыUE)Ѓ9~t$7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$HPOD$g1fT$t$j 2xŋh0L$ș)L$4$T$ l$lt$mD$$Յ $$vx;l$tl$l)"Px‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ [)T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ KhOЙ~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ KhOЙ~ ƃQWT$H ^_[]ÐSWV[Ü|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[  jt$t$t$P1[ÐSV[  jVjt$PJ1^[fSWVP[Û|$t t9t QD$PYL$QjPWL$N|$kK)l$kK) (_;(_i)PPU]t;y t0q$t~fuUvy]u1 q P^_[]ÐUSWV[D$$L$t@1D$D$>D$PXL$QjPWL$kL|$kC)l$kC) s_;s_i? )QPU\t7q tAy$t+nuUwY\u AQy^_[]USWV[èD$(L$1҄t@1D$D$8>D$D$P^WL$QjPVl$-?L|$ ) i)ʼn) i)k_{_lj*SiŠ)ǍRPD$PT[t1D$HR<tzp t:h$D$t}suPuZD$uދ} مt3l$,t+Et$WP݄uVAVEЃ^_[]ÐS[t$ t$t$ [ÐUSWVH[t$\UlD$PؤND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$UTL$QjPUIL$ȿNt$kK)kK) (_3(_i)PPUX$D$$PED$j=UX tƉH$$D$<$|$WSL$QjPWKL$Ƚ-?Lt$) i)) i)K_s_Ɖ*SiŠ)ƍRPWWD$5tcL$f <$|$WSL$QjPWL$ȽkLt$kC)kC) s_3s_i? )QPW2WtD$ERE!D$QD $$D$PUVQPUVPUVʈPUVPUmVtPUYVtrPUEVtePU1VtXPUVu^O1<5.' D$U2QNj$tP Q 1L$;D$v==wL$L$Qt$ߪL$uD$ 9D$ tf, UQ3,$t'UW |$BU4+1t$ 1 t]|$uf, FM $QP~4$P  $LD=uVQ~VO $4D$ H^_[]1|$t4$a1USWV[öh跞WT$L$ $L$`1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃGOM=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$蠪/W 1Pʋ$H $$$H $<<$Rt$W /$//$H $>$D$^_[]ÐUSWV]ň 2~:^^t@\|,$n*^ÍxЃs.ÉD$$`D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%`Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[1l$E<%uEpuEπ r?Tуstlu~;|$~,|$tT릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[-L$ T$D$$Pj [ÐUSWVX$1h ։ͅu4$ u'$hі 5 @0t$E4}0u"$h虖E, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$Rσstlu7D$ ~ ~$RDŽ또fЉ9N1ҍ$1$$u>D$$hjP5 l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,sE,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $eȉىӉl$ |$uGD$1l$뀋$`DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $Dg$t"A$|t+H$D+$O1$uՋ$O1ڃV$h!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,֜RE,}0M4T$$V$0PRQw1$E4$N1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$P@P=D$π$O6\`D$TDl$H$th$Vk@9r‹E0M4ʃ9‰\$WE,y$H$|T$`t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$4K1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$J1L$ ʀŸw Dʀ¿~4r$VJ1ۋu0M4A9s E,u,߃$Vu,rE,u0M4tڍqu4 $I1$P$I$I1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,ҖtRE,}0M4$V$0Pt$QqE4E,M4},$H1^_[]ÐSP[]T$ D$$1Pj= [ÐS[.t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[T$ D$$1Pj [ffffXL$ÐUSWV[Ø|$(t$ l$u[8Pƅ>l$$uj hjL$tfjVP NjD$uj(P/D$@ x |$(uVqE\1F49Pk1D$tGuP|$(Mx |$(tF|$(mqV|$(Phht@U) t$t$tL$t RB(JtR0PtjjP8 IA(;PtjjP IA1t^_[]ÍPjVVSVP[LT$L$D$tRQPVƋ$t P.^[fUSWV[t$|$t$jt0ʼnVUV|$T$VŸלPt$<t~ Pt$<tkܜPt$<t[Pt$<tKPt$<t;Pt$<uA1 @VK^_[]ÐUSWV T$L$[Ýǃ PŅt'}/u{L$$ t$  P`/PPV藖uU\DžjWWWetpL$v u\D$ VP$tIT$ L$$ Pt$ V`'u1V='P^$|$ $~:s1퐐Nt:t됐tÍMwUPW% D, L$$ t$ [tuPtGT$ PQhRj~)T$ L$$ t$ $#t$ $:uw1퐐Ot:t됐tÍMwUPV$ D, L$$ t$ [tu$ $ȁ ^_[]Í USWV[hl$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%貌\$L$ A ZAthhP#+jj!xG(hhPg#|$ Gt\$h(jPH#|$ "\$jh"|$ G9ouG)o\$UD$p|$ Go\$UVP(# W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP  ~ gC C$ދ\$P蓏F$ދ\$Px~ F$D$\$jW藈F$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|Vt.)9uUt$Vc t6u0,1(VR,9ſuUt$V+ ^_[]fffUSWV [D$48H L$@ 1퐐/t <,tEPzUWP .,v3l$4uWCEED$\$cD$[D$|$j|WtD$4@ T$L$ to17t<,t\$RT$*D$PytDl$VWQ Ut$P 61<$W*Njt$D$Pl$8umEW|$WV| W܉D$D$D$ Džt$躉\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0X\$<u3D$u'\$U=x\$8C k$K($fC K(K(|$T$ t$4CPi>p1\$91\$-4$;K\$OP%D$P D$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$3 ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q ^_[]USWV[8D$t uyo[|$ 1퐐/t <,tQL$&$Put2ƃ$UWP 4$t$P 21^_[]ÐUSWV[{|$ t$FN,9vtU6NuCu;UKut.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[|$ l$PW:*uLt}D$x@ȃǃtVot$ U))Lstƃntfuă뿐1ɋT$z HV1D$8l$|$ u)1|$_WuPt$D/W$przWuPt$D1TL$4xT$$s$tntfuσ1} y[ÐUSWV[xt$ 6b!NjF1tPI!ŃD$ @tP0!ƃ,$/t$l$ EE(MHE8ȃPpƋD$0E Ef~t WPV <$D$ @f>t WPV l$ E|$f>t WPV }t0EfEfF}WuV f},t&E(fE,fF}(Wu VO f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[ë|$ t$FN,9vtU6~xu]uUU{mtHnNT$l$f,Ninf|FFWRPW ~F 1^_[]ÐSWV[t$FNy9vtW6wuCu;Wlt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[xl$D`EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1bGj|UMD$tL$j|Ut L$U=r6UPt$P 10^_[]ËD$tPbL$ =r"D$t+P>L$=r˝QUPt$T^jjPttt$ $@ 1D5t <,tFPjD$4 VUP  D5$(L$tSD$HtJ11t <,tFPj Vt$P  D5$h|$t+D$Ht"t$ $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0m$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p ]m$D$t$HjjjPjfWjQ)VWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[*|$ $ ftGt D1DWG(f hwUc =wb, Ƅ |)ƋtVPU/ 9vD|ŃƋGtVPU  9s D|ŃE$^_[]ÐSV[-t$ tavhvhvhv hv$hv,thVkh19 uǃ ^[ÐX @ÐY @uoUSWV[e$(E$$4D$$0j:Wit3rjQP  t0V$0W NjE;$^_[]Ã(u 1 tM0ut68ut@x$f$O:t @t@uS4$l$w$D$j@UP <:t$EF<:uEl$4$D$D$OtuP9(P8pǃq,bD$O$$,PQhWJ; t" ǃt=謺j j,(,)3P4+3PPvtj/V 6t|$uV$jPRQVВ'VT$z*$jPRWUQV角VPj!SV[t$ j:Vt3rjQP] tt$V @1^[ÐVY~T$փ1u t^1(^USWVH[8t$dl$`L$\D$Dȃ= u(<$yL$VPj@Q8T$tLT 9 $ƅtID$\WU(b ~*)NjD$\u $dVUQB ;L$Dt[a1Kt$\(A 2DŽ(DŽ D $;D$Du ЃH^_[]请USWVT[|$pL$ll$hD$P= u( $t$ uƞL$WPj@Q7t$t$ T$Ijj wD$Wt$  $t$j N9<$u-;D$PuyL$T^_[]WQU ;L$PtNT( DŽ(DŽ ;D$Pu T^_[]PUSWVD[ÈL$`T$dt$X}|$@uM u (t9ƀ̞RQt$dPj@W96 tRQt$dV M;L$@uD^_[]虵SWV[|$=uj u (tVw}tL!(s dDŽ(DŽ WA^_[ÐUSWVP[(D$hT$dML$LL$pL$t$lуuc u (tOz=m8@tW=mT$ vPQj@R4x. VPR b<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l(  4()uT$ff׺r$σߺfDfu,$tу$$1S E;D$Lu^P^_[]Ët$d(  DŽ(DŽ ,$1,$lS[ÞD$u& u (t -[Pv[ÐS[ND$u& u (tI -[t$ P[ÐSV[t$ j:Vt3rjQP} tt$Vx-^[ÐSWV[Ì|$t$j:Vt3rjQP tWhVe  WhV ^_[SP[-D$ L$ $L$ƒu& u (t-Qt$Pu  [ÐS[þD$u u (t1[PD[ÐSV[mt$ j:Vt3rjQP tt$VwR-^[ÐUSWV׉[Rjj D$UWt$ l t$j 19tG4$(  DŽ(DŽ ^_[]ÐUSWVL[VD$D$H1,<jU( u} t @u D<@u^(  DŽ(DŽ D$;D$HL^_[]Íl$ E< us{U38|$jW(1 u|$ u}Fu(+   DŽ(DŽ Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:p# D$t$DRL$Dp# A @`? 19<$t# D$D@ @`ƒ?91s# D$D@ @`Ń?+9r# D$D@ D$@|$`D$?;|$  ՋL$q#  <$‹D$Dpu# D$L$ D1 <@4$T$<`Ń?|$_u+19QL$ T$D $L @`ʃ?|$_u19 l$ D$L(D$<_D$$D @`Ń?+19 ՋL$ T$D |$_$D @`ƒ?9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0tٞ֞;D$(Q,^_[]É<$t$D$# VRPQT$T$L$ t$ ?3|$D/? D/ ?D/D$/T$T$L$ t$ ?3D/? D/ ?D/D$D/D$L$ < L/ ?L/ D/D/ p# <$<$RUSWV[Å$D$$  ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# 3С4t2tkƷ< sԃ1@tt# tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# |$| t!qtAD>1tBD>׹@# D,|t.tkŷ< s݃1@tt# tр‍ p 1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# |$| t!qtAD>1tBD>׸@# D|$t=2t$Fi%I<<fw1@tt# tlj瀍 ;p 1ttD~t# M  fAB w~4AB w~4AB w~4AB w~4AB w~4A wʼn41 @tt# tlj瀍 ;p 1ttD~ty$Q$A# $B# $u1 @tt# tlj瀍 ;p 1ttD~t⍃K# 0p_QP_QP_Q_u# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فр3ʉрUɀʈǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ΀# D$# D$x# D$t# D$p# D$l#  ʋD$h# ыD$d# D$`# D$\#  D$X# D$T# D$P# D$L#  D$H# D$D# D$@# ʋD$<# D$8# D$4#  D$0# D$,# D$(# ΋D$$# D$ # D$#  ω D$# ɋD$# ? ? ։? T$ځp $T$ 1# u# E# Qu# ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t  4$l$T$ L$ Ń4p x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]USWV(]8D$<X%UUUUʁUUUՍ4P᪪p t x   x p t x   x p t x   x p t UUUU $؃p t x   x p t x   x p t x   x p t T$H l$ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $yh $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3p 3p 3p 3p 3<$t$3~3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 1#t$t$D$|$811t$3=p $3=p $3=p $3=p $3=p t$$3=p $$1L$t$|$l$3l>l$|$l$ 3p 3p D$35p 35p 35p 35p 3p 3p 3p 3p D$t$D$D$$7֋T$ Bl$l$l$$xl$ p t $x   x p t $x   x p t $x   x =p =t $x   x p t ȃx   x p t x   x p! t! x ! ! x 5p" 5t" x " " D$@P1(^_[]ÐS[ËD$1ɐȊt tT Tt t t4 uP1[ÐSV[ D$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[MD$$D$DD$@D$9\$6D$L$T$@jjPQjRzOqD$HPj {ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVW&uD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP$$jP$D$0PjU\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]觊USWVd[Օ$|D$<$`# hjD$@PYR DŽ$@D$V$@8$u H$@D$$@UVl%ljD$P=t;uHWPWPuD$ߞWPmD$UV$ljD$ߣjPW D$,u:|$$@PW#x$@L$,UV$D$l$0t$\$UV$D$ D$D$ D$$$@&D$ \$UV0$tt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWR#D$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V11$xUf$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-9PQRc _h$DUt$@V j jWM hjUM hj$PvM D$@hjPbM D$<;$`u`d^_[]D$RW D$tMT$@PQhR]l$ $fffffSV[D$ h`rƉP!)Ɖ^[ÐUSWV[؏l$0MjD$PUv th h`) $)D$j PU $l$1}$K1D=t<$t h`tt$,=ōT& 4$t$L$QWPjbV$% L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃]t$ Wt$t$Pjbt$(V& % %  % jQPR ;& % %  % jQP ; & % %  % jQP ;& % %  % jQP ;& % %  % jQP ;& % &  & jQPS ;& & &  % jQP  Ƅ; & jjt$I ^_[]fffffUSWVD[|$\w !2t$`tD$@jPVD NjD$@9t8tD^_[]8"u trD$D$ D$D$D$<D$8wD$X$2a$hWQjP90  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ |$tl$ t$`D$ tKWV(tD(1t$t$ UT^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[ht$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[>gjt$t$t$@[ÐS[gjt$t$t$[ÐS[fjt$t$t$[ÐS[îfjt$ [ÐS[Îfjt$ h[ÐS[nfjt$ H[ÐUSWV[Hft$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[het$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Èdt$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXcL$Q##wÍˣÐUSWV [xc|$(l$$t$ D$4QD$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[bD$ hPt$蠒 [ÐS[îbht$t$ [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[bD$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[86D$pML$LjPt$lv D$h|$df$D$VuL$)L$D$PVWeD$ |$$v=D$ ~t$.D$lp8L$ QjjVVau|$)cƃPD$2PL$Qhe ? $ $$m=|$D$lp,t$ jjt$>V讕Vt|$)Ƌ $PD$2PL$Qd  $ $,t=D$D$lp(t$ jjt$>V?Vt|$)Ƌ $PD$2PL$Qd rg $ $,p=D$D$lp0t$ jjt$>VԔVt|$)v#Ƌ $PD$2PL$Q%d sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7$L$R)уtuÐWVt$  r!̐cw^_fffffSWV[Ü/t$|$G@hjPD_ j@PW_ g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[u-$$N$@r8hUtE\EXETEP$t$tAsE@hjP\ Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV\ h$$VKhVU< hV1;$u Ą^_[] USWV [+l$(16t$ %T$$NP NT  ()`N`L$$WRP[ ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWPZ 1 ^_[]ÐUSWV_^*$hRPnZ RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ WL hj$PlL g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ5K $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PVJ D$hWD$$hPD$;$xu D$e^_[]ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[È|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]ň$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$ͤ$FQ? T$‰ً$|$D$G<uD$ $ $ou T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4H9L$ |$ )t$)t$$t$,)wD$ L$?? nY T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4EhBT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍vFL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q3 l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj 2&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?XፅGPGX GTG\GG?$L$u aD?FFQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  FL$Q? tFL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$@$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v'tVD$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$$~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=o$FL$Q?P$$NL$Q?D$T$ ߋ t$$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $USWV[FiE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP )t]D$)WPu8 }43M(U,E4E09w)RVP E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[<t$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[L$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU F4n0)Pv8U 1tN0^_[]ÐUSWV[;t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[L$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVX%D$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$|L$@>D$?? u)D$($L$(@É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+T$D$tq01t ^_Átփ*tUSWV _L$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[l$$t} t}$t }t9/t ^_[]ËGHǃ8xD$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjP8 )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[ø|$$ $w9>~NQǃ8wH\l$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw  o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw i o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~+ Nl$("@Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQ F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw  o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQ1L$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw v o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw ] o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq n $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq X $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$X$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv  n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv  n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv ^ n on)n)ouGGD$8xt1$^_[]ÐUSWVX$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu % } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu  } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu  } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu  } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XoÐUSWV^HL$4t;T$8\$0Ӄs3I͉у1&Ӊi913ƒT$4zR13ƒT$4zR13ƒl$4M1ʉ3xT$  1ϋL$ 3Ã1ؐ\=13\=139uЉЉ̉D$ ,׃}l$D$D$D$11|$ $333.3 $3Q333 $3A333D$ $3A 333|$D$ $3A33Љ3|$|$ $L$l$11D$D$333333W133333G1333ȋT$33W 1‰333\$33_1ˋT$ )333É3ϐÉ13W13W13W13W13W13W1Љ3O13RЃ^_[]ÐS[t$t$t$ [ÐUSWVXȓ$D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX$D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPX $T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐUSWVPXz$T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[>t$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffXoÐUÐX_T$J r <ù)ы<ÐS[D$D$ P[ÐS[t$ s*[ffXϊL$ d $ x, | 0 8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_;T$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P)L$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$ ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YRsL$ 1 fщ;)t)T$l$L$ 1<\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +4)9~P fHpnh1pXkh (f  fыt$r t$t$ <|$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVXo\$T$L$o>o4>o>t>t$Xt"Pt$5jD$VvD$1^[ÐSVP[Ü>t$(t&Pt$t$!h D$VDvD$1^[ÐSVP[L>t$t"Pt$iD$VuD$1^[ÐSWV[=t$t$gPw=atadu,V Vt|$L$tVU1^_[ÐSVP[Ì=t$t$4Tt&Pt$t$ g D$V0uD$1^[ÐSVP[,=t$t$TSt&Pt$t$f D$VtD$1^[ÐSVP[<t$t$tSt"Pt$hD$VttD$1^[ÐSVP[|<t$t$Rt"Pt$gD$V$tD$1^[ÐUSWV[+<t$t$CeP(v=gntsu?V8ŃUt$UPV t D$8 W[1^_[]ÐSV[í;t$t$dPu=gntsuVt L$1^[ÐSVP[\;t$t&Pt$t$d D$VsD$1^[ÐSVP[ ;t$xt"Pt$UfD$VrD$1^[ÐSVP[ü:t$Ht&Pt$t$Ad D$VdrD$1^[ÐSVP[l:t$t"Pt$eD$VrD$1^[fffSWV[:|$t$jWVz tt$Vowt WV{1^_[ÐSV[9j ƅt%PVqFF F^[ÐUSWV[{9|$tzj w1tcPVpFF FW+yŃP3tQP蛧~n Vp1^_[]ÍfKPQh/RSV[ý8t$ tVxP4^[ÍfPQh}RSV[]8t$ tVDxP^[ÍfPQh}ROUSWV[7D$tfL$ L$QPjj責1x@ƃ$Pt+ǍD$ D$Pt$ t$W{1ɉV.ʼn^_[]ÍyPQhURUSWVP׉[V7,LPQXj Dt}ƍPVnn~L$N uq$' U3' VP^9tBPtnU $u vSVJ1uW5Uԋ^_[]ÐS[~6Mt$Pc[ÐUSWVP[J6t$t 9.t 1^_[]Fu VmF $Pt͉NjFuoPWt,LPQj t!UP$mF~$F qW/aUSWV[x5l$1t 9}t ^_[]ËE D$PTtߋMuoQPD$诣,LPQ)j t'WP_lE$ED$E y4$biZ¿4L$1t 9tËA ÐVY4T$1t 92t^BBtuo^ÐS[N4T$t 19 uL$ tB ;D$v1[ËBuoPQ蓢[ÐY3D$t 9t1Ê@$ÐUSWV[û3l$1t99Eu.E PtNjEuoPW^_[]ÐVY^3T$1t 92t^ËBuo^ÐUSWV [3|$ 19t$$9Gt{o F D$D$Pt[$WoȅtЋT$ՋVtэQPRt$t$V苧Owo tQ1 ^_[]ÐUSWVP[J2l$9EuwD$tyEti} Pr$PtFUuot$RQt$ PM}u tQQ1^_[]ÍۦPQh;RȼS[~1D$t9u L$ t9t1[QPzk[ÐS[>1L$t 9t1[ËD$ IuoPQu[ÐS[0L$t 9t1[ËD$ IuoPQ5u[ÐSV[Ý0D$ t9u L$t9tf^[ËpoЅtItRPtאS[>0L$t 9tf[ËD$ IuoPQt[ÐUSWV [/l$(|$$}(tD$t9u L$ t9t1[QP:Y[ÐVYD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY^D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVYD$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [óu t1D$D$ D$~N~(DN+t 0tV-usiD$WPvޯ T$ D$1ɿ9Di8"yxu"iD$j\iD$WPvk T$ D$D$9T$rFh8"utGjPVl tu L$e^_[]ÐS[' jPq' PQA1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[D$0' VPDV_1^[ÐUSWV [èt$4NswD$8te@t@uT(ppQj WgjUVUZ tWVgWt UVY[1 ^_[]ÍPQhR;WVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[ÞlPQq' Pn[ÐS[^' Pn[fD$w sÐS[D$ ;D$uPt$t$ [1[ÐUSWV[D$ t$tPXD$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋lL$qD$ tL$9QWP> 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋhH vHN1 =tP w싔Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]ÍʨlPQhRSUSWV ]D$ \$$p1}<"$N<\u< $1ۃރST$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋpHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍۨlPQhR+USWV0[$Du wj0趠11<o<$ou}u $hD$(P Y|$0D$D$@@@@ @@<$GHws 琐HOP} w$B8"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BP$B\l$(D$RD$ PUу L$T$ l$UD$D$jQRUW%Xt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUyWu҉pBD$HD$Ews 搐<<}jt$W)R tfjt$WR tSWjPWR E $AEtLt@<-Eu<-u}>u$h\t u94$j10^_[]Ët$t[$NjH<w sO9t1V\ED$"} D$,$t$UެD$m$hōQD$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VuT,D$DD$ PD$l$$@T$$H9trueD$9dataD$ 9dictD$W$@arra1Py fals1@e ȍT$8q$@D$stri1D$@5ng hA$@D$$inte1L$D$$@eger1 D$\ T$D$4$RVP D$D$jD$PD$PUVSt/t$t$t$UVT$ D$D$뿋,$t$t(jWt$1 t t$,$VB,$fjD$PD$PRVzSt1jt$t$l$UVT$ jD$PD$PUVISu1{롐S[~ jt$ [ÐUSWV[U $j$hjVIY t5ōD$ PU$%t $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPj+UYtjVU/^ |$t'jjjhjt$P|$t-$U~jWU] WUTVUwCS[ jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[íj@豖ƅtCPV>jP^F,F0F4F8F<^[ÐUSWV[9t3Pjtjj@!DžuU蕦Oj@1t=PWH>GjPZ]o,w0G4G8G<1^_[]ÐL$WUSWV[Èt$19nU]N4 Džtbl$~4<$tC1퐐F,ǃ,wj,<j<t$6$D$$x,ljH0l$,UJ6w,4t2$ƅPt$,Cy& $'L$n@4@<C $΃̓)WRP L$$A,T$TT$,T A4A<$D$PT$mhQP65Ft$(PFlt$ ~URt$(|$WU#tmP&5URD$ x|$$t$P$<WVV L$$A,T$h t$ VW6$9Ƌ|$$usUERD$ D$\ɩPaPQhRaPQh RɩaPQh2R؇zbaPQh\R蹇aPQhR蚇S[ND$t9uL$ t 9t1[Ãt$QP] [ÐUSWV[t$$t 9tFD$ PRF8D$$P4D$$@,D$1׉T$4$)ωD$4$ƃPt$,?t1Ʌ~믉t$9vwL$T$ )VQP D$$@4@<W24$2t$ Q^_[]ÍɩPaPQhR*aPQhvR܅S[ÎD$t9uL$ t 9t[ÃQPS[ÐS[>D$t9u L$ t9t1[QP:4[ÐYD$t 9t1ÃÐYD$t 9t1ÃÐS[ÞD$t9u L$ t9t1[QP3[ÐS[^jt$ <[ÐUSWV[;l$}t^_[]j@.tƋ|$PVn0jP~OF,F0F4F8F<}(t7hʇtL$7PUrVp0bUSWV ։L$[r|$ *?u-wG"}MG]jjWU -\jPwwt,ut$$艗jPww,(Ox"OD$ $QPht$0Wv$D$=L$$?u%8"uh׃P8:uQ'jPWX t4jjWG t#\jt$(P6t$>t1t$$}U. ^_[]Í_=aPQhRS[ÞPt$ [ÐS[njt$t$d; [ÐS[>Pt$ [ÐUSWV[ t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPj-D$(Ct(aPQhjR藀QGPLWՔ1^_[]É.aPQhhRHaPQhyR)jaPQhR S[þL$A4tPQ4I,Dt*Pq,[Í}aPQhRj}aPQhRUSWV,[8D$@xl$DuVJ}4tS|$(jWl$HU4 tjU3tD$D9(t9$VJ$,VnJPt$D54^_[]jj]tt$ \,At$DVL$*L$ql$$9.|$F' jP5C' PQ1[ÐS[D$L$ PQ^2[ÐS[D$ t$P22[ÐUSWV[Ûl$}tQ97uGW2DEtS90uOH<1;M uM;H4w\t @,4ȃMWC^_[]ÍϫaPQhRUxaPQhR6x]aPQhRxSWV[|$wVqCGt$9uG@WUP0 j xDžt!PWN Gwo 1^_[]ÐUSWV[øl$19}EuBM1tDm $t: $Uvwt^Ut$D$Pz U;1$D$j:wt"WP$ED$E E^_[]ÐZL$1t 9tËA ÐZ¿L$1t 9tËAÐSV[ÍT$ t19 uL$t r ;t$v1^[ËR1ttVRQs ᐐUSWVP[*D$1t 9t ^_[]ËHh t( $tDUvt؉Ut$P ątPQhRq!PQhRqZL$1t 9tËAÐS[ND$t9u L$ t9t1[QPJ [ÐSV[ L$ t 9t1^[ËT$19Q ut$tRVq辢 ֐USWV [øt$(>t~(t  ^_[]ËFjQvPgt҃~$t1D$jPv u ʼn$u n18"tD$N N$9u8"t=_HPQhRGp1jPj N,$Us7ǍFPD$PU tcD$;$uZjPV tD|$u W&1,$jsƅt-PVF~n Wt W׃D$$0USWV$[%y11T$G=w ⍋jAPQx u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5jPB2F,F0F4F8F<^_[ÐUSWVP[xt3Pj-ttrj@`jDžuUzWj@Ej1tE,$`UW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[ø|$1tv`9uloUP1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[z*։ $|$?uwG8]u<GcjjWb tC jPwwt,t1|6jjPUt$t1U^_[]Í`CPQhRR[S[îPt$ 賾[ÐS[~jt$t$t [ÐS[NPt$ [ÐUSWV[t$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%f5PQjmRZQ"oGP=&W o1^_[]É.F5PQjkRZ5PQj|RgZS[D$H4tH4[ÍհPQhR!ZUSWV[D$,hUt$0~Wp%~4tR,$jUt$4V tjV2t`D$090t9$W %$W%Pt$0\ ^_[]jjft 55AD$0t$PL$T$rL$9Al$ F9(u:G@j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ðUPQhRKSWV[Ìt$~ t 1j Vt ;~ r^_[ÐSWV[L|$t$t0t*PVtuj Vm^_[1SWV[t$F|$uLPVujVm1^_[ÍyPQh$RJSWV[̾t$F|$uEPVtiu]jV}1^_[ÍPQhER#IUSWV[۽t$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]ÍPQhdRGUSWVP[jD$1ɅQh Dt$7jFK1Ƀ#h-K$GGG wtHt$WՃj W=tjW$$<ٴPWtiu千pPQWq tDj Wt5D$h VPW`tj WZ7ZWZ $ȃ^_[]ÐUSWV [$($$WtEPx=ŋ$$t$t`?t[Wt.H|/t+1]$,9/;9sfD$ .t$ V/H rL?fDXDXXXXDistXD /.plV@ttUt$ VPD$t 9ujt$D tYj'P'Ut$u t*l$ WU $t1$t$2$l$ 8t$H t U?c8\8VXL8$ ^_[]É,$9tG9t iy/t)rD$ UWP D, ,$S[îjt$t$ [ÐS[njt$ [ÐfffffD$ǀǀÐUSWV[T$$L$ |$l$t$u2jGtUhxL$ H L$$H*s3uFˉ,|\T ^_[]1ϵPQjARBϵPQjBRBUSWV[KT$t]D$ |$L$tKutUtMtM L$$tEUuVL1Ht t L t L |$$t L2 ^_[]ÍA1PQjZRAffffUSWV[XD$8t|$4D$0uHL$HL$HL$H L$H L$H $x p PHl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dV衈4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[(t$@|$t$t$jt$`[fffffS[t$t$jt$t$t$H[fS[ޫt$t$jt$t$t$8[fYXZQ̀QQrS[Þt$t$t$t$[ffffS[nt$t$t$ [ffffffS[>1;D$[ÐS[1;D$I[S[<8t j11[ÐS[þ<8t j1[ÐS[Î<8t j1[ÐS[^<8t j1[ÐS[.<8t jq1[ÐS[<8t jA1[ÐS[Ω<8t j1[ÐS[Þ<8t j1[ÐS[n<8t j1[ÐS[><8t j1[ÐUSWVX ( ?) R4(( ѐ>t1 @u~1ɍ(( >t 9u#;T$t$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍMQPj蝋S[ΖL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV[È|$<v`QPt$@t$@q ׉L$`ODH@u]D$j PW( Ɖ>8"u+4")0rOiPt$ QIT$91X ,$ .,$ ,$ ,$9,$dT$9މH1,9'T$,$xt*unD$<L$Pt$1ɐD T 9uD$L)̓|$DD$L|$11ɐT 4t T tt TT tt TT tt T9ul$t$DL$ D$HD$(‹D$LЃD$T$$1&T$,L$ D$;T$(t$DD$T$,D$$\$ |$LWPU T$tC1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$L'D$,D$9ŋT$L މ|$9s>$\$ t$TPWT$\ $x NjT$Lt$tB1ɋl$9u)σ|$_Ѓ|$C1ɐTTTTTTTTTTTTTT9u|$ $T$Ll$$|$\$ t$TWUT$\ t+1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$q1Ґ  LLLLLLLLLLLLLL9u\$ UM-10^_[]ÐUSWV0[ÈL$H1t$LL$Vn\$ D$D$DىL$ )D$D$HNL$t$T$14T$4D$H9wՉ݉L$L|$9s2$\$ PWT$X$x $NjL$L4$l$\$ UWT$XD$Ht$$ft21D T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$t$DL$ D$HD$(‹D$LЃD$T$$1&T$,L$ D$;T$(t$DD$T$,D$$\$ |$LWPU~ T$tC1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.$\$ PWT$X$x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ $T$Ll$$|$\$ WUT$Xt/1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u\$ U='10^_[]ffUSWV<[xD$u T$PD$8tǃԟǃ؟T$(9L$(l$XoT$0sT$4\$|$ /L$D$,)\$؟ǃԟ|$ l$X1L$uП0D$8;L$(D$T4П>-u FD$0Пt$4腣E<+<-m؟L$ԟXT$,))D$ $t$љȅuD$+D$,\$؉D$$1L$T$ /t$T΋T$ D$L$9~D$<0D$TuT$ ΋D$tNj$9|D$롐T$$t$Tt4$9|t$l$TD\D,$9|ȋl$؟=oПԟ؟()ȋt$()։D$4$t$֙uD$(L$$)ș\$؉D$1t$L$ +T$T < L$ D$t$9~D$(D$T<u#ދL$ D$tˋ$9|D$말T$΋L$T<<t $9|L$t$T<4$9|ˋt$ŋD$D$0 L$$ $\$|$ V؟tԟuԟП<-u ~П4$<:tkE$<4$P荏L$ tEH<$W;:&L$A;D$PʋL$TTD$:uH8t}:t(4$P $? tǃԟǃ؟ȃ<^_[]À:uL$:tVL$D$X:L$u^WoПH8t}:t=jWP|Wx:L$~T$0ПL$ $_D$h/oП:t#j=Rʼn)ԟ؟))ωD$<$t$יut$$)\$؉D$1|$T$ (T$T  T$ D$|$9~ΉD$<D$TuT$ D$tNj$9|D$롋T$͋L$Ttȋ $9|L$l$TD\D,$9|ȋl$1VD$\8l$ pD$D$1T$ $\$" $>T$tbQWR uW8 $9D$t0ϋNT$\;LuN;Lu N;L tD$딉l$뎃|$t`\$H8D$X8:RQP $L$$D$ \$\$D$\T$l$ t$\$D$\l$ tyD0H8|$Xt?:tRQPt 1L$\|1uD1 <-t<+::_yH8tD$X8:tRP? Hl$ t,L$)l$XSA;D$PʋL$TTl$Xu{D$L$ D$TL$DL$D$\uLD$8uCH8t}:tRP]1L$\|1uD1 L$ aL$\D1L1 t1ɋD$`<85oПH8t}:t=4$P $E<-t<+u:}:1<: :fffffUSWV[[}T$l$t$(+ tlǃ(+ 9}@L9-u7yI,+ -uK-?o^_[]Ët,+ ::ur??ܟt::ttζUPQR듍oj-R蓈mǃ,+ --QRntRx:ue?u%1x:tH9}gL$|鉻0+ oT$?(ǃ0+ ?to:D$8:?ܟrffffS[N{j jt$u [ÐS[.{jt$ [fUSWV[ {t$l$tyjj1trj tkNjD$oGG Ė̆PjQRjW+tKjP 1^_[]8l$uEm8d(W|$7@(릐USWVP[yt$ l$ME 1҉s9r J9sAEOQ0t`U)ƒQjRD$ p E $}E T$)9w΋MVRP蔩 E E MU9r‰^_[]ÐUSWV[+yT$L$t$ D$t0tUyyaRPQhRpxA)9}8Ti t?jRPQhRx3rH HPp 9r@ 1^_[]~䐐S[.xt$1[fS[xXt$ t$ P\ [ÐS[wXt$t$t$P([fS[îwL$ 1t$PQt$W[ÐS[~wjjjt$4[fffffffS[NwL$ 1hPQt$[ÐSV[wt$ jjjjV t^[ffS[vt$j t$t$y[fffffUSWV[ûv|$t$jW軎~G0t ujW蠐^_[]fffUSWV[[vt$|$ttft7Gt9fh L$f@Hx$p,L$ H(L$$HDL$(H 1^_[]ÐUSWV[uj1L$,l$(D$$t$ T$wGo Ouu u&t,t+$Lttڍ uft?$L$et: $fH f@xp$L$H,h(@D܋H =W1^_[]ÐS[tL$ D$T$rRQ0P [ÐUSWV[ët|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[NtD$t$t$t$0P [ÐSWV[tD$8pPtWփ1^_[ffffffUSWV[sl$T$B0~-z,t xu z$t juuR:1Ƀ^_[]fffffffSP[]sD$ L$T$$RQPI[ÐSVP[,sD$L$T$t$4$VRQPI^[fffffffSWV[r|$f tmjWG0tW@9t QNG0ǀǀ GG1G uGGjW螌蔾 ^_[fUSWV[Krl$T$B0~-z,t }p z$t R UE!1Ƀ^_[]fffffffSWV[q|$jWՉGHO~ H0 W胴jW趋^_[ffffffSP[mqD$ L$T$$RQP{ [ÐSVP[vt |A 1^_[ÐD$xtÀx|$ÐL$ytI .wuÐSVL$ 1yt^[ÊY u.wT$~9|ԐD$xtÊ@ u<.wL$9Ð|$t1ËD$ÐSWV[lj1|$u:T$D$9w&t$PjV FfFF^_[ÐWVL$ yu/T$Az |1z|1:RT1 |1A1^_ÐUSWV[øiL$(yQ׋t$,<$PQVQM N1<$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ËD$xuHuP9røÐVL$1yt^Quq9rt$ x9v1^fffD$ ÐL$ QϸwD$T$B)J 1ÐUSWVP[ h|$ L$$T$,r 4$9u+$1!)1օҋ|$t$uEEFEMPjQM 7D$8t pVPUw 7+$p)t&uFA̓PjQ 7+ $O 1^_[]ÐUSWV[fl$$1L$(T$4z <$9u+$1*!)1ׅҋl$t"uGFNPjQ  D$ }+$x)t.u$GAL$L$PjQٕL$ }+ $M ^_[]ÐVt$~)FσwyrrF  9r]T$  t9tq9w<q  9w! 9s9tQ9wQ^ú9^ÐSWV|$)OσW 4 9L$ 4:t:tz9w_z  9wD9s.D$9t7tz9w#z9w9rָ1҉^_[1VL$t"T$ tփuQ^ÐUSWV[c|$ T$$D$(<9D$|$,Ѓt)։Ѝ4*T$$t9wY|$tOL$,|$t u D$ (GPjW L$8T$0D$, W9^_[]ÐSWV[ c|$L$1uLwt?;t$w6)w*t$uQRjQ脒 ^_[ÐSWV[Ìbt$|$D$Vt$P蘒 ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWVL$tkʃudT$t׋t$(9}GT$\$ א?tW9w)o/9w 8t9r^_[]ÃD$$(>+T$吐SWV[`t$|$D$VPt$  ^_[ffffffS[Þ`jjt$t$t$t$[ffS[n`jt$ t$ t$ t$ t$ t$ [ÐUSWV[%`$$$$ft$tPQj VD$0D$4D$8D$<D$@$D$(D$,D$$D$L$$PQVu"t)6PiPVQ <$D$@t8+ hPV u$%`PQt9xuP|tUWL$$U$$Ƌ<$t$ ;$?Ę^_[]ÍD$$T$DPhQR$|$D$Pjjj$t(D$ PjjjD$ $9x}D$ t$$<$t t$ܭjjt$( 6MPQW&Rt$]jt$?xjj/y6VPQVj[t$$ujjx*jt$xt$ جt$̬8y6_uYD$p4uMQP6uR$$u8D$@$8j萟D$6opQRj/|$ WL$ $t$$tw%e%jPQ z*$t$u+sjU6$PQt$WĶ NjU6$Pt$W訶2׻j/WStejUPQWt6WPQT j胞USWVdT$,L$[-[E$`QD$HD$LD$PD$DL$D$DQPjڨ l$$D$D$0D$ l$JP2TmjuD$P Džx4$N$\$D$PjL$Q$"PF\$D$]$4$֋$ߋ\$Ut$//$$$ߋ\$$PNT$NJ<-td<+$tHɋt$@$t؃L$Q$jPv!$tHɋt$@$t؃L$Q$jP؅\$VQ%$$$ߋ\$$PDT$uYoP$E1u5Ku*@P$t"tt]tXuto$WhhUN'1D$ D$7,1D$;$uȁĘ^_[]1=USWV[HD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP#;L$u^_[]+=USWV4Չ[QHD$$0ƃ<- <- Ƅ$/jjjhVRQ1Ʌ(t$$/jjjhPUWt1D$(D$$D$ D$D$GD$D$D$ $L$ {PQRl$U4$|$.vt:D$.jjjhWvv uW$3P蘋u,$@$/u<- PRQj14$+D$;$0u ȁ4^_[]u;USWV,[ãFE$(Ƅ$'$'jjjhPRQF1$@D$ D$D$D$D$D$ D$D$OL$D$ $T${QRV1Pux<$1tdt$&tBD$&jjjhVww}uV$+Pu$ $11PE;$(u ,^_[]:fffUSWV[8Et$,|$(n L$N\$ PjQt F1l$,$1D$' $ $‰ЋL$9 $ރш̀Ѐ w ЉT$d̀şw©T$M̀ſw ɉT$-tuʀ߀¿k w:T$ 4ՋT$D$> $ $T$- $ $1 $+L$T$,J $ $T$,BЋ$)J)Ӄ!r^_[]ÐUSWV [ÈCt$ ~Nƃ|1 V҉$t`L$FшT$?r?鍋=1 $j@UPQf\$+=1 ~t0|$>L$:$u =1 uL$>͍ >T$1ҍ|1 -9si$:̃U;L$s>t 9sE.9r9s34$̃h9s맋 $|1 9s$=1 ^_[]fffffUSWV[+Bt$|$tULF T>LFuF ;D$u ^_[1.USWVp[õ9$E$lD$P)hh@V薈 1lj,$t$\hVW4 Ņ~UVD$ P e0W-U0,$xj$uj!ƅth$\L$QP1\T>F T>LFuF E;$lup^_[]1K-USWVl[x8$D$hU$$U  uj!CƅtVD$XUPI1LXT>F T>LFuF ;D$hul^_[]1,ffS[þ7t$ t$ [ÐS[Þ7t$ t$ [ÐSV[}71 jPV i D$ jVPj^[fD$ȉty!fSWV[ 7t$,D$uj)ƅtZt$(P>1 T>F T>LFuF(;D$u ^_[17+USWV[e6$ $$Pwh@VI1$|$$ $ u#D$P|$WQP|$`l$d$$ʃ|&jQPt$ ie|=P$Pt$O ƅ~.V$P$P |) uc84$)Q8|$$uj)ƅ~$$QPJ1T>F T>LFuF(4$W萄|$;$u^_[]18*#)S[^4jjjjt$t$[ÐUSWVt[(4$D$pUB$$Uk uj)ƅtVD$\UP91L\T>F T>LFuF(;D$put^_[]15(ffUSWV\D$pL$tpxH 1!t$T1ȉ͉L$PʉT$LL$p L$DыT$pZ\$XÙyZ|$H1T$D!1L$tIɉL$yZ1!1T$tRʉ$T$H,$ʼnyZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1͋T$tRʉT$ÙyZ1!1ŋT$tRʉT$́řyZ1!1T$tRʉT$8ȉyZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$<͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$4ƉyZD$1!1ދT$tB8ȉD$0t$ǙyZB<1ʋt$!1ȉD$,ӉyZD$@D$L3$\$ 3\$411!É؉\$1\$@فyZD$3D$ \$$3\$011D$@!1É\$Չ™yZ$3\$l$(3l$,11!1ʼn,$މށƙyZt$@1!1ÉƋl$ 3l$3l$<3l$ʼnl$ ߋD$@߁ǙyZ11ÉŋD$3D$3D$3D$D$މށơn\$@11l$8D$13D$43$D$ىˁán3L$@1D$3D$ 3D$03D$ D$ʉсn113l$$3l$,3l$ʼnl$8D$@Љ,šn11ʋD$ 3D$(3D$3D$D$ ׉l$@ׁǡn11l$$l$(L<>4LuŋD$;D$u^_[]Ë$IffffSWV[y!t$,D$uj)iƅtZt$(P1 T>F T>LFuF(;D$u ^_[1USWV[ $ $$Ph@Vo1$|$$ $ u#D$P|$Wr;P|$`l$d$$ʃ|&jQPt$ O|=P$Pt$n ƅ~.V$P$P  |) uk84$ok8|$$uj)肮ƅ~$$QP1T>F T>LFuF(4$Wo|$;$u^_[]1S[jjjjt$t$[ÐUSWVt[Ø$D$pU$$U uj)cƅtVD$\UP1L\T>F T>LFuF(;D$put^_[]1ffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[Út$ L$A͉?@)ύ‰Ul$P19wct,B$ WUPhM 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP M ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [è|$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jW6 ;D$u ^_[]jfffffL$$Yai qyD$A(tQS[xRjjcT [1ÐT$D$ Zbj rz $z(t RPS[(jRjT [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[ÓRjj~S [1ÐT$D$ Zbj rz $RPS[NjRj9S [Xt@ffffffSP[D$ L$T$$RQP+ [fffS[jjt$jR[fffffffS[þjt$t$jr[ÐS[Îht$t$j_r[fffffUSWV [Xt$ D$D$$|$jjUVjW1D$D$ $jjUPjWúD$D$$jjUPjW茺D$D$$jjUWjPSuO8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjRɹ1u ^_[]ÃtOw OsҍHfUSWV[u$$$D$|PhHtHU1 t'$WP$3 19r4"-$PU0tPUtN;$uRĴ^_[]Í3rWP$Uf3 "9sǃ#D$WUPt$0t$0?SWV[l1 hVt$ t nM81^_[ffUSWVh[#5 uj'X5 D$Pj5 L$@B1lj1L$ED$$1t$ƋEpD$Pjxw5 L$@B1lj1L$EHD$$1t$Ɖq jP*u(5 L$@B1lj14$e^_[]ffffffUSWV[l$jPUR u @t tQUnujPUR t 1^_[]ÍugjPV{R Džt&KjPVcR 1uú!?E1u<-ut<+u`MDHt$}D$j PW{ L$9e9$YQH}+t؍ ߃/Љ(!ffffVZžL$?w5t<t#΃? ?9tA|t^1^fffffVY>T$r1>w ^ffffSWV[ t$(WjVA xqN|$,t?r$Jd$D?r'I- d$!L$jWV A ^_[fffffffSWVP[[t$tB5 PQhR:rx>L$ $´5 )QVWRqM5 PQhRq5 = t@= ^_[fffUSWVYD$t$D$I@t ~_wˉ"+t҃-!ЃÉ^tu/u4u?t#!tu>uG{Pt̉#.!t,#.!u븉# t# )#>  ^_[]ÐUSWV\[ÈD$pD$$8D$HD$DD$@D$oD$G = = D$ 8tP DG^_[]Ët$$T$(,Ye׻jVPQRWHj1USWV׉L$[b2jeVj+Vt-1vE|$WjPj\yFu<$|$1jrV^tXb $UW]t1j|u%907=w=901^_[]ÐUSWV׉[w= tuX=mu?ru<6B=FtjP_v$=+u4jj_&v=tjP^6<^_[]ÐUSWV[T$0P1<}tPA_t1D$D$08rl$ u_Pt$\+ŋ$t$Z80}tPAWՋ4$1<t$%<M801UPt$*ŋD$G6;oD$G = = D$ 8tPAG^_[]Ët$,|$(l$$T$0#VWU[; j.USWVP[Ê<>tP@= tD$9Gt7?t9Gu(>tPp@X7k1P,u= E>tP0@吐jUw E ƃu 68tWTt4$^_[]fffUSWVH[Øl$`t$$WVUt$hFstUVt$Yǃu.68uj莻~;$} VPYǍD$9tLV豉A$jD$Pׂt&WPUt$hr{D$$oH^_[]ffffUSWV4[øT$`t$Xuot|uut덫tŋL$\toD$0WD$HK|$T|$LtD$PT$0xKD$(Gz9G|~dkd׉<$T$`D$L$D$=SQ|^)k׉<$T$`D$(D$L$D$S<$D$dD$D$1D$عD$dD$ $D$(D$Ѓto!L$ V' 8T$L9v NjL$\0l$$t#)D$ D$,D$,rAD$ jt$t$t$R&t2jt$RP7&tjt$RP &d$D$ ɿt$t Љσs1dt0N,1 9tDtPxt$FPrxF^_[]ÐUSWVYT$tht$1BtBظkw+tրztЃːt *u1^_[]ÐUSWVՉ[B$4B tv*$EVPq}$uMtQjPD$ t$ L$$l$E1퐐f$NQV$r$0!E/%f}/L$@Ɂ1O tgTO tWTO tGTO t7uً$$$VPV$t@uD$$$PQ?D$$$PQV(u%#D$=@u;$s!E/F$$L$ ;$u Ĉ^_[]Ë$bUSWV[Ó$T$ f$$9t$<L$ D$,D$D$$EfR$t%=LEu⋔$B @D$D$PQo9j=*uA=*uA=*D$$AD$9$L$ K D$$);L$ 4 f? G D$D$PQR$1 #L$L@ Eft:$tK=LEuH$hPQg $A @u$PZ $PQ t#$A @1 $p1ɐDM CDM /DM DM u~ID$4PL$DуP$L$8\$l$0XL$0\$$$W$W$6t$4T$D$I t#$Wrw$v ux .u$f:.u@t(x .u"Pt.uxw T$ ;$w'0jf2fu;$w9;$v%$f8tB|$,tY|$$D$ fD$fËD$;$f|$E;D$8f/D$ fD$f9$r f|$91ۈD$D$ $|$D$D$D$D$D$D$7ڐ\$u=*uLw*t;$OL$ڋL$d$t=?t)=[uBD$G=!D$t?w=D$uyt$f9t$uYt$$w1T$ЉFD$ЉT$(|W]uZD$D$;D$(;L$ $tڋ|$9|$D$(D$T$BD$=]zr-u%D$f9wf;BwD$z뾐f;|$tD$랋t$$|$t$fT$f9ljf|$1t$0FTFTFtTF`=u1D$ $T$D$D$D$:ЉƋD$D$uT$=*uI~*t;t$NL$T$L$؋D$t=?t=[u1umF=!t,~*uU|$։‰}f9|$u:g~1ЍWD$(tF]}D$D$;D$(u6;L$ \$$t$tT$9vT$D$t$fD$f;T$f|$D$&މD$׍W=][_-u+D$f9wf;GwD$wf;t$tD$랉ŋ\$$fEL$0$Wt$($]$D$ fxD$D@uP$PfP$P$P$AD$L!=+=D$ f\$$ 1$A @D$4uPPQu w8t$A T$ $$t$ W$$Y$0Qփum1ɋ$B u^ZH JD$ /GT$ $$P$tL$< ;$u0^_[]ËD$ fD$,ټffffUSWV[$$$tu1|$$t D$3|$ :h@PD$(D$$D$ cL$t$L$\QP|$tXD$D$0t$\ |$d$<0fD$PPj7Z D$ $D$1p1$D$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$tV~PVw $D$$uhdUND$$D$iD$,D$ 1҉t$Յt6D$D$0D$4At$,jD$8P .jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9L$~<r9gL${<r9KL$z<r9)L$q<r9L$p<r9sL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9t$u4$OD$^D$ $GL$m <s9u9tL$n <sI9uD$$$9r4$tzOD$_WY9t븉t$ypd$i$`t+t'|$1jPw u1Wt$]Ƌ$>xt$`D$|Ay DAD$$uD$*`ՋD$DJtDHD$D$"$@um  ` DAթD$5jPD$pt$$jPD$py D$ t$xtG$`L$tZ1jPq4@ˉjPD$p -1ҋ$t5jPD$p1҃ t$D$t$$D$ $D$D$ D$(D$$1GD$ 1PD$1D$ D$D$8 < Y1D$ D$|$t, D$D$\Pj7T |$ 8|$|$ t"$%tjPw |$t!b D$7%|$H 8|$ $t t$|$H|$tu VL t$jl$ U 1$u UR_;$u Č^_[]YS[Îjhjt$t$t$Y[ÐSWV[\= t-= jhjVPt$$t8= 0jFc= = tP N= u^_[ffUSWV[۾= jjjˑ = |$= tWQ= 螑 = th1i = 9= wHt Q] = USM= t$WUP8 = u 1T$ Ɖ^_[]ffSWV[ W%= u= jP;.xƃ= 1= t = 1W^_[ÐUSWV[Ë W= u= jP-x5ƃ= = U@";D$wUt$+1I 0WQ^_[]ÐS[t$,ƃ= [fffffffUSV0[ļD$D$L$ 0jjPQjRqst_E rT$,$$t>Ut$ t$D$l$tt$$t$D$l$Zu L$(L$D$ l$Ze^[]fffUSWV [7Pot\ƀ8tUT$D$j PV7 tŋT$t|zt)AVPQ1ɿokP&wAZ@8ʹ^&KQuo@9~ $WjP5Q,$qVPQT$t$$D$ t = RUPjQ/L$ t>= ^_[]ffSV[}= u*ǃ> ɡPV3= tt> VP1^[ÐSV[ ǃ> = tPhR9ɡPV2= uVPJ1^[ÐUSWV [Õ$ǃ> ǃ> ǃ> ǃ > ǃ> ǃ> ǃ> > = hhUOD$ 1Ʌ$t$@#L$ $t$ > L$l$<ǃ> = hhUND$ > t$P萫j\WVL t8t剃> 8#tj\WVL t8t뉃> j\WVL t8t뉃> j\WVwL 68t牃 > ǃ> ǃ> j\WV7L tD8tPu> j\WVL t8tPE> h > |$$W |$j\PD$ PK ǀ8tW5u͍m>UWthoUWtTiUWxt@]@UWdt,L UWPt GUW<Q> E5xxMf l$<$j\WVJ 8t牃> 8#j\t$VJ t8t艃> j\t$VJ tOǀ8t扻> GPWs" > ]@PWUtb` > D$ɡ> PQK > l$tэ GQPuJ> <$j\WVI t8<$tP> j\WVI X8<$tP辠> t$t$1ɋ;$u ȁ ^_[]臩SWV[üt$ǃ> = t PM.ɡPWK-= t2t+V> u䍃> WPϭ1^_[ÐSWV[t$ǃ> = t PsL.ɡPW,= t2t+V> +u䍃> WP/1^_[ÐS[~= tP3ǃ= [ffS[NL$T$ j@t$[ÐUSWV0T$[D$H$D$$E͋T$D`D$D$|$\$9EtL$|AyL$DAMZe*?$6.&)f$B t$ =OUPt$(g tD$ PB LB XB UPt$f tD$ TB XB \B =UPt$f ftL$fhB rvUPt$f ftL$fjB AUPt$rf 1tL$flB vUPt$Ff tL$fnB RUPt$f tL$pB UPt$e tt$tB RUPt$e tL$B OUPt$e tt$B fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$&B aD$ `|$4L$ qL$%L$)L$-L$1L$ L$5D$ PWt$e tD$ UD$,Pt$d tD$FUD$0Pt$d 1ɃtL$Nt+D$PD$4Pt$d t D$1vF UD$(Pt$vd tD$ 1L$ F L$ D$ PD$(Pt$`L$ L$ t$1|$ PW) t,Eu勃`1DJtW軅t$F t$ z9L$ L$ l$|$4cD$ fB fD$4dxD$6D$50UWt$nc 1tL$|B D$51UWt$Ec tL$B D$52UWt$c tL$B D$53UWt$b tL$B D$54UWt$b tt$B ǃ B WEVǃB WEV4$k8t$D$;L$8u<^_[]rfUSWVP[ê|$HL$Wtك</@t)9v"9vH8/u)t\9v N8/@tvljC 9thUWV"Ƅ+C ^_[]À|$/tHÍ9ffffUSWV[Øl$UtNL(`1DJuK4$D$j PU) }t֋L$9tJ9tEY^_[]ËLJ wӍ<(@눉8"u rL$ <$։q1늾=3ffS[Îj t$ [fUSWVP[jt$HtttnL$V<tH|/t|$/u929r9vzz/u)ρwG hUPVƄ+G ^_[]fffffffUS8[ÕED$D$$D$ D$D$D$PQj tD$(|$0e[]ffffffSWV[pƃtk|$|$u9P1uPjjP t8jPjWjW|W^_[jfS[nD$t=u~[t$ P[S[.t$ ht$1 [ffffffT$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[ôx[Ḯ̀rS[Ôx[ḭ̀rS[tx[̀ffff̀ffff/̀ffff^̀rS[$x[̀rS[x[Ḥ̀rS[x[<̀rS[đx[̀rS[äx[ḇ̀rS[Äx[̀rS[dx[ḓ̀rS[Dx[̀rS[$x[`̀rS[x[R̀rS[x[2̀rS[Đx[ḩ̀rS[äx[P̀rS[Äx[ḷ̀rS[dx[Ḷ̀rS[Dx[ḉ̀rS[$x[̀rS[x[Ḛ̀rS[x[̀rS[ďx[Ḩ̀rS[äx[1̀rS[Äx[Ḍ̀rS[dx[òrS[Dx[ìrS[$x[l̀rS[x[t̀rS[x[s̀rS[Ďx[r̀rS[äx[p̀rS[Äx[j̀rS[dx[m̀rS[Dx[̀rS[$x[Z̀rS[x[ ̀rS[x[S[΍x[ᐐ*̀r׋L$Q1fffffỲrJ!Q{fffffS[nSV[MK tFK Pj%tsK 4+K 4K K R+ ^[ËK HK jjjhjPj6p1tȉK uj$Pj> jS[ÎD$K );K t P,[à QPH[ÐS[N,jPK uP^[ffffS[pPt$t$t$ [ÐUSWV8[ЋuD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$y`DP@Ӻ\$%D$ D$$OL$ۀU|$ɋ<uL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ P Pt$t$ ZD$x$WPt$W @D$x$WPt$W )D$x $WPt$W D$x$WqPt$Wq uD$x$WFPt$WF zD$x$WPt$W `D$x$WPt$W <D$x $WPt$W D$x$$WPt$W D$x($WoPt$Wo D$x,$WDPt$WD 1D$D$$T$EHL$D$D$D$ PPt$t$ D$@D$ PPt$t$  D$@D$ P~Pt$t${  D$@ D$ PMPt$t$J  D$@D$ PPt$t$ D$@D$ PPt$t$ D$@D$PPt$t$ 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ 花|$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ ֽD$ ߽|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$GQ@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ VҿD$Pt$V ID$ V裿D$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP蘲=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$pQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$DA(|$€´|EFt PF t\~tM1퐐t(0F t((F t( r;~s F @ƋF PVF,t PFF4tP1F8t P!V^_[]fffSWV[lat$HW葶L PV:Wx^_[ÐSV[-aHVVL P'9V>^[ÐSWV[`HWL L PQ9W^_[fffffUSWV[Û`l$UuPUt$VQ1tmNjt$l$Ut$2QDžtqV7t^oEtЃVP虤t Eu릉l$}uEtP轡E^_[]É1ffSWV[_t$dWLL PVOWش^_[ÐSV[Í_dV趴LL POV螴^[ÐSWV[L_dWuLL PL PQOWT^_[fffffUSWV$X^t$8T$`D$ 1ۀ0T$u,N 3i=)Njtt+~%L$9N$ut1Ƀ|$tΉtL uj(ƉDl$Utwn$Nj 0Q\ 1L utjh=XʼnpL 0ƃL LtMjуtL @1t*n$F ~UQj PA|$z^_[]ËtL )USWV[SxL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉ|L uj(ƉDl$Utwn$Nj 0Q 1L utjhʼnxL 0ƃL LtMjу|L @1t*n$F ~UQj P|$z^_[]Ë|L )USWVP[zRl$UXNjL $tOs;1҉vL ljh=L $uƃL D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$ܕt0tL tuR:t!jуtL tiE$StL uj(ŋ$,tIEj |$WP葂 WtE@E$L$1E^_[]t$t@ϐUSWVP[ÊPl$UhNjL $tOs;1҉vL ljhL $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0|L tuR:t!jу|L tiE$S|L uj(&ŋ$,tIEj |$WP血 WtE@E$L$1E^_[]t$t@ϐUSWV[ÛNt$|$ tЋpL t61=tDtPǃpL D$L$ƃL L t?1=tDtPǃL D$L$ƃL ǃtL D$ 1^_[]ÐUSWV[ËMt$|$ tЋxL t61tDtPǃxL D$L$ƃL L t?1tDtPpǃL D$L$ƃL ǃ|L D$ 1^_[]ffffffUSWV[uL$tA$1uh^ƅtcD$E/$tt$$9ux/Ĕ^_[]J?$9u/(>?USWV[ûIt$tD$tdPVxaa1ɐ΍,?UQvt&UPy.w耕8"tV g1^_[]ffffUSWV[It$VL PL ƃL ` tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t PǃL ǃL 1F ^_[]ÐUSWVT$t$L$~ 9tS1tT:u>8ut}Y8uuuȀ@t:utȀ:u 1y@t^_[]ÐSP[mGL$ jt$jt$ [ÐUSWVP[5G$p$L T$8L$4|$ $h$dʼn\$uL tu$l|$th8|$t:|9v,t:t|u싌$lho$ $L$1xjjjUu|$`PQhl$XU jjjh@U赊jh@6 D$1l$t$(1ɍD$L1Ë$L$AD$$Љ|$L9rB19r0T$\$hWt$@ ƅ4LT$< u|$tT$$$1t$#tT$$l$t ߍX8؉t*s:j|a;$v<t:t|u싌$l덋$$$L$t1<9< t+< t'#<:t <\ut111;T$l$ \$$L$T$$L$)\$QPT$)ʼnl$‰$L$\$$l$ '|$t t$诓t$(D$l$tEFH4$ DD$\$t$(l$L$T$$pL$T$D$$1L$,$t$(l$D$֊<:u>tuk{D$؊6U8u Xuuu@=uUt @hƀ:t FuFT$L\$t$$Ut$t$4-\$,L$Lt&]u%F:D$L$,()D$ tD$)T$ D$t:u)ʀ| :D$@t:\$L$ ыD$)9L$ |KT$<,$D$)\$D$PU))\$)D$Ɖ$T$<*)׉ڋ\$QVPN% Wt$DU@% t$ t$t$,/D$L$, \$D$T$l$1ҋ4$t PЋT$ЋL$89T$v6)RV|$ u(Vy|$ |$ L$41׌04$6Ō0jL PCt$PL L$<$ 14$$lD$,P"|$,\$D$0jD$HPWUU t t"t$D<u/t$,D$HȾ\$UU|$ <D$\$VD$xWt_WVPk# UUxx1ɊD$D$8T$D$48B\$W |$t$;UUZ |$ ;$LutP^_[]00WVƃ|$\$t t$4$p\$Ua|$t\$t$豎\$t$,:jW3X>L$ÐSWVL$T$ȉ֊t~8t1t0:t+|t&9vt:t |u^_[ÐSWV[=|$t$L tPǃL ǃL ƃL ƃL WV]^_[ÐS[Þ=L tPSǃL ǃL ƃL ƃL 1[ÐUSWV[E=$,E$$L uL ȋL u!Q0µL L t1L  L PQ,t $D$uz1L WMW6~ǃL L HL @MQPL u<`1DN@u:t#t L 8|\L L L $ƃL l$L$L$ $Dt\uUL P+uًL t:tuT$ T$WtfW}ǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$W|ǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8&ƃw5L tP|ǃL ǃL ƃL ƃL GW{ǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$u,^_[]À|\u ƃL ƃL [.USWV[È9D$ l$HU:u0U8u't#ϐ7U8uuu@=uE<@}D$jd 0ƃd$L$ƿd$M]d\u}M:ȉʀ0E€0 ȃE€0 ȃ,^u"M:t ts:tn[<$)FdPW7xу¾2w/@:뷃벃뭱멱 륱 롱 띱 뙉,$)u %FPUt L$$WU$^_[]ÐUSWVP[j7D$l$HU:u0U8u't#ϐ7U8uuu@=uE<@D$jdtWƃdNJD$ƹdEt#<:tu)FdPWu4)u袂 "FPWbtL$ W^_[]ÐUSWVL$t$T$~ tB:u>8utމ}Z8uÃu뺀@#uZ@tỳ0uB 8/>9v$uPc FN8D} .~ wF F Pk>uWv 4 tŃ ~?:}|@uH)ƒVԍ׻F F BBQWP"c uvv 衂 ?~?:uF:~t ~ ~8u ~F,;8u e^_[]>'S[n20t$t$ [ffUSWV [12} F FEFUVzRu)ʃԉF:FJFx9u0Rum N ;Nue^_[]S&fUSWV0[Ã1D$(}PQvL t$M L$ML$f|$ L$T$|$QRj WPuOt$ rF|$j WP u0O L$FD$D$ PjL$QrD 79_t$} urP tgM9uWM % QUQPR}Wuz19r"y";L$(L jjP< PED$t$XL$ WDt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V\s uEPVu5a ;EsD$t$WKCL$%D$"T$ ;UwRPuv_ 1ɋt$;D$(u ȍe^_[]#S[/jPL h PK:P [SV[.L hVt$t$t$%t1^[fffSV0[Ú.t$DD$@t2D$D$ D$HL$ $@D$1L$V2]븉l$WPU11!$PUNQV9l$V\`D$ $!V\L$WT$9F|$L1 󫋼$$WL$PQT$ RPt$ tt! $u*G $~oQ $u D$uD$D$D$ D$~3D$HD$D$0D$V[|$WT$9jFT$L1 󫋼$$WRl$,UPt$ tt(QD$#D$$D$~kUD$1WPtWD$0$uD$D$$D$ D$D$0D$~D$HD$WP;S$D$D$,|$L$9sȐVP9rG$)X $u0u8L$$QP(; D$D$T$ -L$$QPy9 D$8u|$|$0$D$D$,D$W9D$l$T$jFT$L1 󫋼$$WRl$,UPt$,tl$t%)D$ D$$D$l$~UBD$1WPS$uD$D$$D$ D$~V~XWP7Q)ЉFL$$QP菔 D$P T$ t 9l$D$D$,q|$cD$T$ u^?|$#L$,|$$L$0 VP]rD$T$ |$ GL$(D$<$Hʀ߀X$uD$VQ $uD$fxWt$,jU,ID$eWt$,jU< $u&@u(u-uu||$|$ |$fD$,T$ L$ )L$L$ m|$[|$$:|$<VP7rL$׋T$ c|$Q||$|$ D$T$ D$D$8׋T$ fD$9I^׋T$ L$Q׋T$ @݉T$ @L$D$,N @1|$8 D$,D$D;$u6D$,^_[]Í$9v׍HL$@VPsRfffffffUSWV[|$l$ 8unnjU)}0u LJE T$uGEt-U$/E EE}0T$fE ʉ $7to9h};8%fE EMtY9vU8PuPEEi@9tgWVƉ|$UPWA l$ E00L$HcMM@(@ )@$|@({@,}@0]@4\@8$@|$T$L$ol$L$T$ jWPjU1xL$ȋ;L$u^_[] USWV[;|$t$t V;1oL$1jUWPV ^_[]ÐUSWV[|$ t$t V:1oL$T$jUWPV^_[]ÐUSWV[Û|$t$t Wx:1o1jUt$$PWy^_[]ÐS[NoL$1jPt$t$t$C[ÐS[oL$T$ jPt$ t$ t$ [ÐS[oL$T$ t$Pt$ t$ t$ [ÐSWV[Ì|$t$W[uGكs^_[!t_t$t%<$F$F ^_[ÐUSWV[ |$ u ^_[]l$ t$W耭t t- t(WithWPu뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[X|$0t$,Wt$@[D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv<$|$Dփ 6D$4)D$4@u \҉L$x MV%t^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉɪ$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/`DPg%0W$\P$D$4@uWҩu#`DxuGws>4$$^_[]ËD$4  !rfUS [E$D$D$D$PQ'DD$e[]fffffS[t$ t$ [ÐUSWV[Õ$$%= uRl$ 4$nƅt EuM(<$V茎USWV[A(u/nPFJt0fD$9j|jU~ Exl$FJuЃN $t6UQ蒪t^:8Uvu&:f )UQܪt(`:8~ j|jU f Ą^_[]E%===@EM $N~D*GN(~DFFJVVPj(G(uwG HF,F(nTPUw j/l$UXt5;$u~Ut(U'D$HQUt$ D$F,GFFF8N1fFH0F D$D$D$0t$T$j6,t5D$"D$<u 0G OJ0D$,L$T$T$D$,D$D$D$1D$HGW(|/uL$V7 }t!v$2v$2v$|V|W>-^_[]fffS [+pPQt$ t$ I ,$ [ÐS [t$Pt$ t$ ,$ [ÐS[þL$T$ pP[ÐUSWV ׉[ÄT$4x |tbq=t= T$4t=uD T$41 L$ L$| L$x L$ D$l$ L$RPQUWVs=u("كTw"d # $T$сK1 $  ȉD$D$ ^_[]ÐS[nL$T$ t$[ffffff̀rS[4x[̀rS[x[ ̀rS[x[L$D$9tt P9u1fffffffS[ît$ t$ [ÐS[Ît$ t$ [ÐS[nL$T$ pPt$ [ÐUSWV,T$[2l$DD$@L$D$\$t?D$@|$"v/*&1t$\$UP\$u+t-tD$D$@tN1D$D$@u90u4 @$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[dx[USWVT[HL$pw_<l$l1.t$h D$ʼnD$4\$P^[D$,D$M؃|$xD$ JL$!ϋl$ t$hT$p $dl$ щʉ $9wѐD$ ŋT$;T$hL$xv֍<\$QRW$$\$( D$ ~L$p|$t61ҐD L9u֍*|$p)׃|$rσ|$q1Ґ ,, LllLLllLLllL9u ?D$l$ ؃OL$$L$xD$ l$(\$T$pl$(4$"\$ύ ʉ $9wҐD$ ƋT$;T$(L$xvՍ<\$QRW$$\$( D$ ~L$p|$t61ҐL D9uՍ|$p)׃|$$rσ|$$q1Ґ l,LLllLLllLLllL9u|$4l$,/MD$4|$,4D$ t$80t$h\$QPV$ |$ X\$ىL$0D$D$p@D$<|$ʼnߋ\$9)L$,D$L$D$4L$,|$t$t$(9/9$}D$<4(L$ \$t$xVR$ L$8AL$ D$;|$(r0$t$hL$,\$|$3t$h!l$ t$hD$4;,$=D$/)ʃT$D$tӋD$pt?1ҐEL5MD59u.)֋L$,|$$r|$$u1ҐL,l LllLLllLLllL9uՋL$,L$  $9ыt$hD$ T$  $D$|$x\$t:D$ $ȃL$p U0uuD$0L$p9rދ,$;l$(D$ \$WUP$\$( L$8D$ L$T$ <$9׉[ $<\$t$xQW$ L$0Ȩu$)D$,T$t$0t,L$pU7uuL$p9r<$D$D$ L$ދT$ ct$hD$4<ȃ98IT$pz|$<T$8D$‰D$4t$H9t$h ωp9׉t$HtՉЉt$D͉L$,|$@D$L&D$DBD$DD$LՋT$P9tl$ŋ)<|$ 9t8|$P+|$@9D$09l$;l$ 9\$ |$$\$t$xt$U$\$ L$ L$\$~L$0L$ىl$1҈ډT$$T$p<;|$ L$(l$\$t$xWt$ $T$| ;D$$~7u$OjUTƅtF PVW u$*jU!t@ PVW 18t u $tD$ 81^_[]fff̀rS[dx[ḃ̀rS[Dx[SWV [)|$D$ D$D$$.0L$jjPWjQd1u9 u 01 ^_[fffffSV[íL$D$T$ y9'RVQPi6Q4P 1^[ÐS[ND$y%9'P PQj@R  P j@4R P [fUSWVXL$tCt$81ېDWl$llof9u1t9u1)^_[]fffffK̀rS[tx[USWV [Xt$ РD$Py7$|S_ NL$ 9t6ʉi)iAi ˍ $4L$T$ o9s9s}$?9r|t$^uA$t209r9r։t$Q^_[]É݃t209r9r֋9s9r9r봐USWV[è|$8РD$Pt)1ҋP1L$4T$0 s7ǃǃǃAQ1@Չt$sAs(11ҁ¹)҃L$ $‹D$4HL$|\$ÉhT$r1L9t;Ⱥ_ Nʉi)iAi ō 뺋D$0 $Dl$S9w9\$rыT$ҍ4)tG109r9r΋9s9r9r봋9t$r9rʉ艃)D$ L$4t$o^_[]ÐUSWV[t$.̉׋D$)ōР$Pt)1ҋP t14$D$^_[]ÐUSWVP[:РWctI010$9r$9r$i0mNA900W^_[]ÐS[Þt$t$t$ [ÐS[nt$[ffS[ND$@ @@@@@@D@0@h jP [ÐUSWV[إQ  R h EGGjWE8jP<EǀPǀTǀX`Xul^ǃQ ȦWŋ@~*uf~ XEuh?35l$|$h @ h$Ɓ| D$ 1u0dždžjPlE08jPE0ǀPǀTǀXD$ X`zD$ $ȋ|$F FFFFFFDF0@h jP WV^_[]E1␐USWV[k R h EGGjW1E8jPEǀPǀTǀX`Xul^ǃQ ^_[]ÐUSWV[èjsƐ+w?uiƸPv1l$x pxkX$, 1׉j0DžDžjPG08jPG0ǀPǀTǀXX`l$$1E^_[]ÐS[Îj輳[fffUSWV[`$j(j:$hj9ljt$VF1ty[PQJ5L$ D$$@tQЃt$$@J8PQv4$d>Gt PT>WK>1t$;$ue^_[]QXL$ÐUSWVH[UE$DD$ChP˕t]Ƅ$CljPjx69PQWVD$SPpM;$DuH^_[]|ÐS[ÞD$ L$I$PQPR [ÐUSWV0[hD$H8t$D~$jppQyo GtP<GUD$P tEFEMN,$UD$P GONGFn$E|$jhPWVWI t$ VW8 tD$WPy[PQ2D$@tWЃ0^_[]ÐUSWV`[3u~$G9FGD$$D$4L$jwPQ2D$ PD$ P$D$PjP被D$PD$ D$D$ jL$ QPD$ PD$ P$GFONF$D$|$8jhPWVWt? VD$t1^_[WVctGPVxgtۍGPVctʍG PVctWVcVZD$ L$qtu0qwY ^ËQ tu*I IH^QPI;@P^@p^^ QPI H^ ^ ^ ^S\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ffìrS[dx[v̀rS[Dx[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWVL$D$utdT$pא?t 8uلt&~Ր}8t ut 1119^_[]1fUSWV4[$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋ l$1 r$Xt$\t $X1$Pf$TWՃiriQVPؾ ,$$XtY$\tOFl$0PQjUU$\9ȋ$QU$`m FfNQPR$`U$`1Ʌ9$Fx$P$T)PURQW*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LQPR$`$`l$ 9+d t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`\~$PEDL$oPQ|$W$`UUt;$Tg$P$T)D$D sP|$Wt$L$QRL$)D$D Pt$t$t$RL$)D$D Pt$t$t$RL$)D$D Pt$t$t$RWL$r)D$hD Pt$t$t$RL$9)D$/DPt$t$t$RL$)D$DPt$t$t$W19D$F$PED$1$1oD$ sD$D$׋D$ tD$ $ 1QPt$t$U)H)D$>Ń19t$un 1f$PL$$T)fv fD$ VQURt$L$ ;$T$%T$0L$RQPWst(8WT$\9vpD$0PY_;fǍ$0PQhW#W $\9v QW$`菸 %1QW$`u D$0P^Fl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF M u)L$ QPtPŅ$y+8ET$ PQhRr=$w*;$(v.L$ UQPY $$1%D$1;$ u ^_[]vffUSWV[$8$E UPwZE 1Ҩk4$$4$0$,uRUW-VUWt9~uۋ$0tPv u*ft#Q&$4ƃ1ҁD$D$ƉffD$D$hVQP t$D$L$ T$PQVRu0g9t$D$ ff9|$$0$4t*G9D$D$u_GRQPP= uEt$WVUHZ24$1E u UU;$uЁ^_[]1ҋ4$E ttfffffff̀rS[x[USWVP[P[xT$1tJT$ t4i t}um9ujqt$$V 1$11Pax8^_[]ffffffSWV[,|$jW5G=tjW(^_[fffffffX~L$rÐSWV[ì~t$V#tF~tP ^_[ÐUSWV[U~$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ $D$8D$4D$0D$,D$(D$$D$ D$$\$$b$xuxuxu x$ $\$PT$1t2\$WtGotP܋\$$$0$;$ЁĨ^_[]$k$@$QC$FD$8FD$4FD$0FD$,F D$(NL$$vt$ T$t9t5T$ t tu#u u$ D$ D$D$\$$PWWti$t$tf1ۺD$11 ߉D$ŋ6t>N tFtI1л t̉1$1D$\$ \$t$o\D$ L$8L$hL$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$T$ T$PL$LuD$ $L$$Pj$rD$hD$8D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$LL$PL$ D$\$D$8D$hD$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$L$ L$PD$L$4\$ N3D$hD$8D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$T$P1T$ T$LT$ t1#D$! ttD$ 9tFtll$$V9t$(\$[$9މuL$ ȅt$utT$$ۋ\$$u <$t$T$(oL$$$PjL$ 1T$FM@t$Fu \$ =<$3\$ t$iEjjPn x P8wL$$\$$PjND$ 1ҋL$T$Du`xl$\$j%$UwD$UmL$)L$D$H$PUl$U$i4$\$t$Hg$yL$Du`gl$D$$u&JB$L$$\$$PRUJBD$L$uA>Qs90n$l$t$Wͦ\$t$(^_[]ÐUSWV\[èYD$PD$x8hD$8D$4D$0D$,D$(D$$D$ D$El$ |$uHt$W$T$RT$RPWQVڂt,t$D$t$D$EML$@ML$XML$TML$PML$LM L$HML$DD$;$$(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$T$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$T$L$ ut$t$$LUv)1ffffD$@@#Eg@@ܺ@ vT2ÐUSWV[(<l$$|$G? OW@)19w_WT$Vt$$PL$ k T$]$19s'D$ 0L$>@9r|$1T$ )URPk^_[]ÐUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [3|$$D$O $GD$?17l$ )ȃ8 PQWH jPW: EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWb ;D$u ^_[]'fffSP[2Pt$1Ƀ $ȃ[ÐUSWV$Y2t$8D$D$ L$`1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$|$$xt$\$l$t t$ t$v$1D$ T$Dt$ $u U<V辰WjPrQ |$t$$|$ 1ɉt$!1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W-Q Pt$l$UQ t l$ /D$$<F\$hPWP |$ l$(D$D$ l$L$ff9NF L$\$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$D$P$t\$|$WUROT$ \$WjRfOT$ |$L$F t\l$Et Njl$U \$Wt$T$RgO E xu D$L$ H$l$L$~ xl$>Et Njl$U\$WQRT$ OT$ L$E ED$\$l$PUC1t$U/D$L$$9sD$DQ 1ɉȃ0^_[]D$D\$^S[>t$ý[ffUSWV|[j$m1tGljPW8t)l$XD$\|+Wmi Wm1|^_[]jjWjjUjWmt҃D$ l$<$D$ƅuUW뚐USWV [8|$$(rl$ NBCD3EB 3M t9i1 ^_[]Ë|$,j<Ɖ8D$0FMNUV } ~$E$F(L$w F,w F, F,$wF-T$$ T$$w F- F-nV U(V|$Ǎ<((1t)lj~$BF9r\9rXD$9rPl$$9wHҋ|$1Ѻtr1ҁD$sD$rgVIs@sщʉѺ u׋ $)jQWj[F0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPjF4~F:F:t1F;pS[nt$t$[ÐD$@ ÐSWV[<T$|$9W v#wG,ʃt$<u0 Ћ0,fL  )r;GveD$Ot$1^_[ÐUSWV[Èt$,~$ED$\$Pv(t$j jt$ [ÐUSWV|[$$$T$LT$L$$Tal$L D$0p`D$4 󥋼$D$0 M`l$TD$XD$DD$ZD$@D$\D$<D$^D$8`t1 l$H L$4,potXǁ Lt>Q 9quJ9_$D$dD$4$It$qD$<$L$HL$D$ l$yD$$$$`$ttl$$;W%`t %)l$ $D$D$pt$L D$0^t"l$ $D$D$0t$L D$0^t"l$ $D$D$t$L D$0F^t"l$ $D$D$t$L D$0^t"l$ $D$D$pt$L D$0]t"l$ $D$D$0t$L D$0]t"l$ $D$D$t$L D$0F]t"l$ $D$D$t$L D$0]$t"l$ $D$D$i`t66\.f&{T=Kv^_[ÐSWV[|$[ƁYjVW[ yWPV ^_[ÐUSWV4[Ø$D$0D$IuD$HL$j.QPjT$PQj.jR^$tEL$PQV  D.0;D$0u 4^_[]USWV([t$L$-uAD$QD$ +tD$ +u AD$Q`x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍ4щ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍ4щ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$4щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$`8D_L$u D$(1ˍA^D_uk*… )хt 1Ҁ|0.щ^_[]ÐUSWV[} LD$|$D$ D$P%lHHPP 0ppp RQWjVd$r D$ƀe^_[]USWVP[zl$(PU^^UPUF^PU.^KPU^PU]PU] PU]jPUA 1uR`MDHt?:j PU~ :8u$8 L$A.&L$0t9^_[]ÐUSWVP[l$/PU\txF u64jPU@ 1u[`MDHtH9j PU} 98u $8 6D$t8^_[]fffffffSWV[ |$t$jWGHO~;G~ t H WRYhjW^_[ÐSWV[ÜT$L$Bpr~ ;B~ t 2~: RQg^_[ÐSWV[I|$(D$$uO$P#,D$D$D$D$ jW"G0u ǀD$PWjW^_[ffSWV[ülGHt Jt @t A?t/t5Gtn hPt$Qwh[fUSWVP[ T$L$I):t$ H4$ t$,t$,t$,t$,WUVt$$QP4^_[]ÐUSWVx+[À}4E0D$$p+E E$D$ M,E(U\$t$,tA\$RPBFUM,\$ u$/D$@ f HM0_|$:t]ׅt9QWE5\$M,wt!<\tt<.uwu)ր:|$t~9J/\$VR|$$WUM,\$ 7)t$D$E0D$E47|$<.tyt <2L$s3L$..AE0}4A_.f M0}4D$%.D$@ HM0}4D$u0}4WVu@ R.Ɖu0)lj}4uueR$+PWQjdjRD9E4-P$ +Pu0I E0 8)}4M08}4M0D$L$\$r7)M0 M0E4QU0A}4s/}4D$n|.L$L$r;)M0 M0E4QU0A}4se/}4D$E0,,f E0HM0E4@\$)E=U MXE4u0} PVu,W,,D$1))lj\$}$ju E %PQjdj$+WC9E4,PWu0n E0M0)u40E4u0} MU J}$u D$E HM HL$HM xQƃE t$V|$Wt$PQjdj$$+WQB 9E4f+PWu0 E0M0)u40u;D$Iu xE P;PWjdj$+PA9E4*P$ +Pu0@ E0M0)u40u E PPWjdj$+PA9E4*P$ +Wu0 E0M0)u40u E %PQjdjW*A9E4?*P$ +Pu0 E0M0)u40E4u0} MU PVu,W=*)E L$ )T$X\$h*RQP$5D$w!}4\$)E0f (E0E4HM0@xd!}$\$u M QU Qqu It$k\$QRPVjdj$ +P@\$ 9E4-)Ƌ\$P$ +Pu0u E0)u4M00E L$ )T$X\$h*RQP34\$}4(‹E0f (E0E4HM0@xD$M }4E0T$ WP!*(9E }4^(E0 E0HE4M0@M }u ;L$ T$ \$WE0P)"(\$&E %PWjdj$+P>9E4'P$ +Pu0) E0M0)u40E HM @PWjdj$+Pu>9E4'P$ +Pu0  E0M0)u40E E PE PWjdj$+P>9E4+'P$ +Pu0w  E0)u4M00M AE 9L$Pt$ jdj$+P=9E4&ƃP$ +Pu0  E0M0)u40E E uEE ;D$ }0L$9\$$E0 E0E4HM0@E ;D$ T$ E4PW'1&E E ;D$ sɃ}4w\$d(&}4u0E WVu,P &%}4%E0 E0HM0E4@MU \$WVu,E P}}$u E %PQjdj$+W:<9E4O%PWu0  E0M0)u400 M t$ )΍VUUUЃ=T$XPRVQ@0}4\$$ʋE0f (E0E4HM0@xD$E HM 8HM @D$QE t$T$#t$Pjdj$+P;9E4-$Ƌ\$P$ +Pu0u \$ E0)u4M00twE L$\$Pt$ jdj$+P:\$9E4#Ƌ\$P$ +Pu0 \$ E0M0)u40E E uE4w#t$M0fA  QU0E4A|$XVWt$u .F9E4\$##VWu0x  E0)u4M00L$M M E4;L$ s]}0u \$"M0fA  QU0E4AMU E4PWu,V""E4L$ 9M r\$"}$ u4u0u jP}$w u 薽E %PQjdj$+W99E4("PWu0{ E0M0)u40}4u0E MU }$ E PQjdj$+W89E4!PWu0 E0M0)u40E  E ֍;T$  D$dD$`D$\D$X)XVPQT$ D$Xu4u0Pj}0W?lj}0)E4u u |$C;D$ \$ }4 E0 E0HM0E4@ E4u0} PVu,W  }4 E0 E0HM0E4@E E \$P誻M ȃE P蓻E E u0P~qPQV E M E4u0T$ PV!  E C*uPjdj$+W6v }$ u4u0u j脗u0VƉu0)E4E HM @^PQjdj$+WW69E4lPWu0 E0M0)u40E E ;D$ M11 }$< u4u0u ju0V7Ɖu0)E4I \$u +E E \$PM QU IT$|$0\$QPVRj(jW5\$ 9E4PWu0 E0M0)u40M t$ )΍VUUUЃ= E48M0ArintAto pA ong Aoo lArd trecoM0E4I }4u0E WVu,P#}4E0 E0HM0E4@MU \$WVu,E P}4E0@ f (E0HM0E4@E L$ )p\$P衸E M4;U0B  ru0M4B\$ ~PQjdj$+P39E4Ƌ\$P$ +Pu0A E0 0M0)u40}4E0D$nr3)M0 M0E4QU0A_}4sڋ\$E4u0} PVu,WgM ;L$  \$AE AE IL$1$+E ;|$8t1ɉT$|$਀t^L$ P#MPQjdjV29E4PWu0 E0M0)u40T$|$L$lE 8D$E ;D$  |$XWu u$u, E4u0} PVu,Wy:E L$ )o |$ 1ҋ\$ML$$+р਀tJRPt$ jdjV19E4PQu0 E0M0)u409T$ ыE \$냃}$\$u 褵E E \$P苵E L$W|$X\$PVQj2jW1\$9E4PWu0f E0)u4M00M u4}0T$ VW~\$E }4E0 E0E4HM0@M T$ VW7\$E }4vE0 E0E4HM0@M T$ VWQ\$TE }4/E0 E0HM0E4@E MU VWu,Pz}$E %PWjdj$+P/9E4P$ +Pu0 E0M0)u40E HM @PWjdj$+Pg/9E4|P$ +Pu0 E0M0)u40E E ;D$ L$L$\$Pt$ jdj$+W.9E4 PWu0^ E0M0)u40E E ;D$ r(E4u0} PVu,W}4E0 E0HM0E4@\$u ڲE PPWjdj$+PA.9E4VP$ +Pu0 E0M0)u40u vE P9PWjdj$+P-9E4P$ +Pu0D E0M0)u40u E E PE E PޱE TPWVQjdj$ +PY-m|$XWu W 9E4PPWu0 E0M0)u40|}$9u XE E PCE E P.E TT$XPWVQj2jR,9E4PWu0 E0M0)u40E4u0} MU PVu,W}$E HT}$rb\$]T$XPRVQ x?D$ }4\$E0f (E0E4HM0@x \$9D$ +E }$tUoIVQPRjdj$ +W+9E4PWu0 E0)u4M00t$ 9u ziD$(D$t$(jdjW0+M )Ήt$|D$<+t$~;D$ƃ\$T$t$PRWo |$}\$5\$-E 8\$Pt$V8\$ ƃ9|$u؍$+)9u4VPu0 E0)u4 0M00\$}4mE0)E0HM0E4@}4E0.sAD$.)M0 M0E4QU0A~*}4sf E0HM0E4@ߋ\$sPjdj$+P)4+D$$D$} \$`D$1҃|$|tL$ L$D$$4+1 D9T$t> ..x\$DK.ẗ$Lx̋D$DH.t뻋\$/֋\$L$ t xL$DA.t.$+)9u4VWu07 E0 0M0)u40D$E E t$ 9PM0+L$NjE ;D$ HM  ɃtڄyL$u2E4e׋M0A  QU0E4A D$T$RPjdjV(9E4PWu0j E0)u4M00D$T$L$Z*D$!D$D$L$L$ \$t$\$9E4Pt$ u0 E0)u4M00D$ ƃ0|09u4\$^|$$ +rz4w|$7$ +r|$7$ +rz4|$7$+Rt$$+2|$7$+2z4|$7$ +r|$7$ +Rt$$ +DŽ$ +====2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +Rt$V$ +Ƅ$+=fDŽ$ +==2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +rz4w|$7$ +r|$7$ +Rt$ּ$+Ƅ$+=U4{ u0$+$ +^>~}0U4FU MU FD$!D$D$D$D$ \$t$;9E4 Pt$ u0P E0)u4M00D$ ƃ0|09u4\$|$E M4U0B  ru0M4B\$QVP2 u0Ɖu0}4)lj}4>r3)E0 E0E4PU0@+}4sڋ\$}4u0H;T$ \$BE D$BE JL$d$D$T$E D$щT$;T$L$t1਀t\D$T$PMPQjdj$+Wy9E4PWu0 E0M0)u40T$dE L$D$E ;D$ \$u4u0Pj|u0VJ)E4u0E X\$u4u0Pj|u0V)E4u0E )E4u0} MU \$PVu,WM ;L$ t$ )΍VUUUЃ=rE4\$8kT$X\$PRVQD$c|$|/}4\$6E0f (E0E4HM0@x|$[D$!D$D$D$D$ \$t$9E4Pt$ u0# E0)u4M00D$ ƃ0|09u4\$|$raT$$\H @>rET$$H @>rT$$"H @+<$+D$$L$D$ ^_[]fffffffYOT$4D$#8<ÐUSWV[|$ l$t$~Jt$~2UVx(ƃ|$tލF9wȉ9v(+t$^_[]ÐUSWVP[Ê|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }/(^_[]E ffGftC,$RWגxǃ9w,$)xD$ hHGftf,$RW腒f 8 9Xσ95,$)5|$ oGwtc,$RW 8 9σ9,$)|$ oGwtc,$RW衑 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$. ^_[]Ð~34$UOx(ŃtߍE;$wMȉ;,$v ;(+l$xD$ h,h,L$H(ht$0Quus]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5@(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[x|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.^_[]Ð~34$U迍x(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu苛U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWVXتT$4|$0$D$ D$11ɐq;t$<_T$WT$t$,$?t$8D?‹T$DD$?l$Dc D$fD$Bу1T$r8Ѓ17T4T7T4T7T4T7T49ut41Ґ9uM;L$<T$D$0 4$|$|$l$8T=T5=|$tT$$D$808=;L$0}V xn^c|$8XD$4D$~D$`D$‰<wsBքu1L$ˋ|$?|$ $LOL$t)L$<$\{<$|$ LOL$L$D$<$1$ r $L$t|?TWT$T$ Dzt]$؉ÍF$и rT$ӋD$T$<$t%D$ЉT$;T$8D$^_[]ÉUSWV[|$t$$ u f0x<$|$Vt$~p$ƃ|$ 19tG,00r7 $ r7jB؃u;$}B.뵉ED$^_[]fX?s ÐS[s ht$ P. [ffffÐ1ÐXϣt ffffffUSWVX[èl$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMn1^L$"jWRPj2jQŃ9D$"PD$tPD$pD$)D$iǓ$))ŅtUT$ 1^T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ 1^|$"jHQPj2jWH9W|$WD$D$lj|$)ƋT$ D$kD$p` txҋ9|Wy>TWPڋD$+D$pyXffffUSWV[Ël$Uvƃ;D$v(`|$UW1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[$$$hWP! x3l$hU$( xUW|1Ʌ;$u ȁ^_[]ffSVP[LL$t$D$T$ $xRQVPx9rRQP) ^[USWV[|$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[{|$t$l$tt$$PW%to^_[]VW t W LJWVUF ͐SWV[t$|$jW1Ƀ PVW ^_[ÐUSWV[û|$tt$O#PW$t0l$VW/ t WRLJWVUM ^_[]ÐSWV[<t$t5|$r#u#jV#tjV$F1^_[S[ޜD$tL$ ttu H1[[ÐSWV[Ìt$t_|$G?wS>1RjV"t3jVU# tۃtjV"t jV/#E^_[ÐSWV[t$tAjVq"t2|$jV"wsf~ 1^_[ffS[ÎL$T$ pP[ÐUSWVT$0L$@[HuD$\V>MD$ Pǃ|\$D$t6=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$$$$$D$D$D$\$$|$,Vt$8PQRWyǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q& t$\$W$PQ%\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$,\$t$,PVD D$,\$PV蠾uD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[Î{|$   >L$s*D$@--tr0twPu@-g[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[ìzD$Hr %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[yt$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[>yD$ L$t9u[ÍoPQjpR9S[xD$ #L$t9u[ÍoPQjpRD$t&L$tu1u 1tÐS[^xL$ D$Qss)ǀ[Ãuu ǀ[ÍoPQjpR5S[wD$tL$ t 1[[ffUSWV[ëwj 1tQ@@jjP (8t(Wu(^_[]ÐSWVP[+w|$OGQ9u0$jQPl "08t  G $GT$pw1^_[ÐSWV[ìvt$tRtC|$t3~t-0~r4;~rPV^_[ÐUSWVP[:vD$H $t.(1tt$V肺t 9<$u1^_[]ÐUSWVP[uT$J $Ћ*1|t$W"t94$u|$ l$tWE$F;$} $)Qtu<|uprP $كU|gD$ t$QPt$+.[fffUSWV[ g|$$藳thƋD$L$F t1ͺWt$$t$$PV\ŋD$t V觳/Wt$$t$$PV-V肳 1^_[]ÐUSWV([cf$LD$$$t;$Hv;$H$@xT$P j.Q0rl$u"D$$hPU$H.tD$`(T$DE$t_ЉtM$u<.uKBt(DMu.t!E茱/x.$u<:t#gj:RnqT$ u<:uNЉtu!Ǹ1>u5~u/~ -t/9uqL$Dl$@|$<|$ l$L$L$HL$,,,$ql$l$PRVQt$t$t$ D$(P*k 1t781L$H^_[]Ã~MF @USWV[`$0$8 $ $L$HJ @BLt$FNV6:l$VRQPWhUWhPȬzōt$hWj jVP ‰$0u uuuVj PWht$}w$0+i@ ;A7T$ B@$0p t$ V規 $0xD$@ {$0;h/t$&|$$SD$)L$L)ʃQRt$ PW~/9s)u̍ZL$hPQR =t$0@ W9$0@  $ ;$^_[]WUL$0@ V,$0@ tt눋GD$fFFfGD$GD$ @@ t$辪$0@ )lRUSWV@[Ø]D$\L$<(px ux P̆t"D$j.PUVt tpcD$$x D$PL$QRPD$Pt$UƆ $tQ}L$TA 'l$TU4$Mtɋ;L$4$D$L'11UVH1(^_[]Ë$D$ L$@T$HD$A D$As |$L4$먋D$DA4$D$ )D$ )rD$D$DD$AD$9v |$Lgt$t$t$PD$PVΉT$訉 FL$N FL$)L$@WQL$ƃ)]L$D$ D$D$D$VWPL L$@9|$ tsL$L$wD$1D$$D$ PݘƃD$)D$Vt$t$ L$@AT$9|$uAT$D$LU4$ZUSWV[XX|$D$$0PQt4$ 4$A h荤hVl$ Ujl$UP+‹D$p pp0Wt$UV0Wt$ zuBF tt$ G VD$@ ^_[]VWUSWV,ՉL$ [W$L$D$(tt1 G D$Hj(1 ‰\$D$ ʼnhfHf |$9f׉t$\$$T$TPt$t$06Ƌ$Hfxx\$$PT$LwD$ D$;D$t$`$@D$L$DD$$$PtD$ $@$Du5\$P裕=$L$P9D$ $LP$HDŽ$D$;D$\$|$Lt$$9ubft$ ff $L\$Vt$Pt$3Wt$@Pj%M 돍Ef$w rM|$jPD$D$D`OUUOPVt$Lt$HQj% T$L$ t$|$$1ˋD$l$9T$0|$V$PuпtVuPj%u T$09U |$$f|$Du D$8x|$,t$\$t$0Wt$t$t$00Ƹ1$Hfxx\$t$ x1gD$;D$$|$,t$L$(D$89r3l$8(\$PR l$8L$(+ $‰$ȃL$(L$L$t$u\$V芏T$4ƃt$ t$l$D$ )D$ ;D$4D$@$ 9s'D$@|$0WUQ\ 1l$_l$0l$+D$xzD$xil$ (\$UՎ=!Ńl$ 1$D$D$t$$|$,L$ t$\$R1\$ t$$ t$$ˉ\$|$,t$D$(D$@$Hd|$,$D$11T$ ;t$,tZT$ :/1$Hl!9ht 9uf|tP݅uT$ tDtN9|1뚅tb;l$,}\M ;l$,tK~TlPΐ|tLf9~fTtLf|tN멋t$$L}t1L$W\$t$<ƋD$4L$)9ƿ\$Pt$@Qy~L$ Mt$$H@ }} EE E8tr˃T$4)ھ)9|P)ˍKT$PC CCT$PSx@t$ut$$ $-t$كʋ $l$()̓D$4)9s\$O$LP\$UQRT${ 4$VL$鍄$T$@)ƒ͋D$4)19s:Q&赗$X;$(u@,^_[]Ë$LoR$PUp{ 1뿋t$ $1>?\$hUSWVX[K$l>Wt1T$ T$G j(¸D$$D$ D$(D$@#$1ɉ|$ D$ l$L$Pt$ Vf=ǃt$Vt$ t=ꐐ< t쐐D$$D$ t$l < t< t8PW<t1ɀ8 L$L$D$D$L$ t WPtT$$9s=ȉ\<$.u)$T$rD$09wL$s>$t$$;L$0u?4^_[]$D$09uڋD$,T$PB D$(BD$ L$$J$4USWV X@`8D_u$$ ^_[]ÉD$T$ T$0u+Y $$L$ttet$ EMU}t$6W$RQPUjV9WV$Wo D$,D$(D$$D$ D$D$D$D$1L LDLDT ʉTDu݋|$11Ʌك|$tк$.c/1ʃ$|$t$ Jt'D$,$9L$ L$uT$4$у|$3t#L$,$9͉u|$4$|$  t'D$,$9L$ L$uT$4$у|$$ t#L$$9͉u֋|$4$|$(Ϲt%l$Ƌ,$9u|$4$|$|$, ‹4$9utƿt׉|$tƺt|$ tƿt׉|$$tƽt|$( σtƹt|$,t¸tȃ4$9u$$|ȃt|$F$ȉD$1퍃(D$0L$t9|;l$}9u:ِtNwD$t9 :u5u1$t tuR|$$uF|$,u?t$t)tt$4VWL$9K$G O WoURQPW|$JjW譮~nL$t)9sdQWV4k V{yL$t|$uGL$t9s<:HT$t9s*D$F);$w$PJSH1t$ ;D$tu x^_[]-ffUSWV[8$8uSjUPE(D$t`$$$tWtv\UKE uujjjuT$ !ЃE Vx 1L$1$L$ D$L$ 1$uP}Tu.$tEt+E<$ $<$$2Eu0)׃>t E<)׋$$x`<$1L$D$ D$}T$uUsL$T$E ulD$;tM UE=t܉t$L$8QPRt$ T$u#D$@=u$ELM D$|$uIt$MtȍL$8QPQL$t$$D$$ʉD$|$ T$4t-E uEjjjuT$ $!у‹4$$t$E0D$ E0D$D$ u?|UPuTE)΋M0E0D$ D$ L$tKE<)‰T$Ή4$Et$ $UE8T$,))Ɖt$ƃE<$D$(14$T$uED$,))t$ $E$D$ D$(E D$$ T$4uPD$+D$D$0|>$0D$9D$}&D$,L$0ȉE)Ήu|$(T$$21+ELt$!!jRVuT$ !ƒt`EME0MtU@9tQmD$ e ߋD$)D$Uwu E+D$UGtjUNĴ^_[]Wt$t$ uT$ !ƒtˋE0tU@9t QE0EEEe jUJN1뙍E@L$ 9D$T$$tQE0U fU 뼋L$MEfUSWV [3t$4D$@ue8HL$@D$\$jVK1D$D$D$E1;|$,v`\1WtztLEtD$uWjD$$)Љ$D$PED$$tt)ȉ$  $EWt$UP $EhRQUP x$EWQUP t"$tWE̸ RQUP 1D$u7}u1u-WD$$18PQd  ^_[]ÐS[î&D$ hPPt$[ÐUSWVP[z&|$t$t!t2ujFQVtZ$$FQVPt=T$$D$ Jt?9:t t j9zuL$(t PVу1^_[]ÐUSWV [%D$$L$ 8͋1t1uOWe<$1t0t/ƉD$EL$QUPt-EL$QUt$1;t$(MtQЃ1 $u"PjӽD$$ $t|փt )ƋEtot`t$ERt$UP |$t,M̸ [14$D$$ ^_[]Ét$ERt$UP t$|$tϋM ht$PU 1u%}uDžu4$D$$1눉넍8PQi1gS[î#h(#t$t$ [ÐUSWV[x#|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV["|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV["|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[h!|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[ø |$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[ |$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]fffffSV[]t$t$Vt$t$t$~>.u^[ÐS[t$t$t$t$t$:[ÐSV[t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[t$ t$ [ÐS[îD$t$ P[ÐS[~t$[ÐS[^t$Z[ffY?ÐXL$T$ ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$PQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$lw;t$b\Gn߃^rxo;l$1\,, $*XwkdT$Ɖ*t$i $*Xwi (Ћ4$XWm;|$Yȃ|$ U(!Ћ$PQV xuD$ ƋL$$QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$c(^_[]Ë$ncᐐS[.jt$t$t$[ÐUSWV([|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ X0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[~L$T$ pPt$ [ÐUSWVT$[Bt$4L$|$0\$t4D$0|$"v$?Q1T$\$VP@u+t-u!$$l$0tC$l$0u20u- ot'1t P̕9tGGP贕GT$JRWO1^_[]ÐUSWV\[|$x|$|$볅t V貐ǃ ǃ 蝗$02 tlQj P D$HL$L t$qGt$EĔ^_[]ÐS[ÎD$ L$01r_[ÐSWV[\|$t$wv4u 76._^_[fff̀rS[x[USWV[|$ <$D$l$$pt$L$T$(PVUWt$<9t; $+t$ ;"1^_[]ÐUSWVP[jt$;8$l$ L$T$$t$,PUVt$8=9tL;8+t$ ?;"1^_[]ÐUSWVtՉL$^$D$ D$p$$D$t$$E<%t#P$9HE֐D$D$ 11ɃuۃU|$d u1ǐ u1ɺD$D$D$D$ D$ uXl$$yqQi|$)Ÿ +AD$(ml$$ƃ|$ Qiʐ)mu;i)\fɁf=mD$( 0$Iʉ) i͓$) )҉)у}9)l$|$ OQi)l$$mi)\fɁf=m$@  D$ˉ l$$IʉЃ|$ g$ V L$ \$فt$DPQ$j V`$99u\$@k $@ D$ˉ $@  D$ˉ l$$hQkd)<4 kd(  $l$ \$ֽ\$߽D$\$t$D$qP$j V_$99u$H*R )tȋL$ \$فt$DPQ$j V:_$9<#9uD$\$t$D$qP$j V^$99u\$GQ;D$\$t$D$1P$j Va^$9cS9uB\$$H+HA$I ȋL$ \$فt$DPQ$j V]$99u$@t)$p$IЃȋL$ \$فt$DPQ$j V4]$96#9uD$[l$$hQkd)<4 kd(  d\$ \$$l$ $~  \$<3D$ ~ Wt$Iu 1\$Pt$- $$9\ \$  9u<$N $@ D$ˉ D$DD$D$\$t$D$q P$j Vx[$9zc9uRD$\$t$D$q P$j V[$99u$@L$ \$فt$DPQ$j VZ$99uD$\$t$D$qP$j V?Z$9A39u"$H*R )tȋL$ \$فt$DPQ$j VY$99u$@L$ \$فt$DPQ$j VJY$9L39u"$9 9 $91$y L$ 9uD$L$\$7$D$DAD$HAD$LA D$PAD$TAD$XA D$dD$D\$Pt$,t$.RPQjVW$9)9u$9 9$Htȋ\$qt$DPQ$j VW$99ur\$7L$$$Wt$ $ƒ8\$qt$D$qP$j VV$99uD$DD$D$DL$\$$PWt$ $H‹L$Dtȋ$;t$f$$xQkd)Ѝ4 kd(+dF$z  D$D ljNj\$Pt$!ƒ $\$މǍD$DP!ƒ)L$D8$9_ C9u2$Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$`Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$6L$D$9 9uL$Dh$9 9u1 t$l$u7y3$9a-B9B09<\$gt$DRP$j V S$9 9u1 „tÜ\$ \$$l$u2|$ y+ $9-A9tfA09t[ $gt$DRP$j VNR $9\$D9u<$5L$$9 9u1fɋ\$hebf tƜ\$u7y3 $9-A9A09 $g|$DRP$j W)Q $;$9$u䋄$$i$$$$\$\$P1|‹$1‹\$gt$DRP$j VoP$9qc9uRHx1gt$DQP$j VP$99u $L$ 1gt$DQP$j VO$99u $\$1ƍg|$DVP$j WTO$;$s.t/9$u苼$*$$ $W1$z 8-Є$$t9s u7ӛ5\$]\$$n%L$ $<$}}\$t9u4$<$Ήƺųʉ kdk<)΍\$VP$j t$TVM$$99u<$D$ ;D$pu t^_[]Ë\$USWV [t$ XD$P.8$$D$l$$pt$׋T$(PVUWt$<9t# $) #"1t$0. ^_[]ÐUSWV [Xt$ XD$P-8T#$D$l$$D$T$(t$0PUVt$<9t# $) #"1t$- ^_[]ffffUSWVP[êL$y~X$T$GsY11t5iFs0hFށdN$t$>-00t!t$t0J$1ɋ\$+dF$ >-00uȅVaFs0`FށdN$t,>-00t!t$t=J11ɋ\$+\F$ >-00u D$L ^_[]ÐSWV[\hR]`ƅt(T$j!tVpJ81^_[USWVP[D$tBՀ:Pt=ǀ}:ju1ɉPDžF $1퐐9}h.dNPnŃ=~߿TFFF fFdžhFdždFdždNUTC><$~81퍻s 9,$t".dNjEPW uƄ.dN_1^_[]ÐS[þt$Co[ÐS[Þt$jt$t$[ÐUSWV8[cM 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtfL9| }Z^FD$ 9߉D$ T$|$\$#)L$ #11uj+DH(4\$tg;~N|X1Ƀ|I|$T$ 9}'4}t$;tt$t}։9|كu>L$dFL$(uV*T$iFH hFdNP(}j[1+dF GыV+D L\$jhY`QPz ӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U|Rut]9D ΋u}\$%1kD$ \$uuPVftML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐSWV[lt$W#JPbH PjVH W"^_[ÐUSWV[l$t$W"L uJPUjVH ;W`"^_[]ÐUSWV[Ë|$t$U,"P uƃP U"1Wj(t H(^_[]ÐSV[t$L$t$j'tt H(^[ÐSWV[t$Wq!P uƃP WX! 1PjC't H(^_[ÐUSWV[[t$|$U P uƃP U  Pj&tt H(^_[]ÐUSWV[t$|$U| P uƃP Uc t$jQ&tt H(^_[]USWV[kt$U JPaGH t 0jP.UP uƃP U4jjƉU^_[]ÐSWV[t$D$t 0jP4W\P uƃP WC4jj/^_[ÐSWV[\t$D$tF t 0jP4WP uƃP W4jj^_[ÐS[D$t@ PN[ÐUSWV[ët$tF |$UAP uƃP U(4Wj^_[]ÐUSWV,[5D$$$(=ΉT$y |F 'D$ D$l$jP$LP$LW*|$t ֋|$ ωjD$P$LV*ʼnր|$t |$ |$G $@D$G~$(PjQ* G>D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU(|$u|T$jD$P$L$L(|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ USWV4[HL$HD$AD$ AD$A D$AD$AD$A$D$,D$ D$(VP uƃP VD$|$4L$jWjj'|$uL$jWjj~'|$t1ՉNjt$0|$ xt$ |$H4^_[]Ã|$(xۿ뿐SWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[$PL uJPl$|$H tABR lP~;yQq|1)͋$P^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[[UL uJPL2|$t$H tWVP ƉU^_[]ÐUSWV[ӿD$D$fBt π?:t ?:u$,?/4$\$u(\$jW:\$ WS?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrD$\\$hWP8 j.W5tU\$j.Pt59tx/ux.uHt/uэ|$H4$$," 4$\$h@ W ǍD$HhPWH +&y \$~ 0\$WBD$(W0gdND$4lPD$0T$LD$D$T$#D$ D$`T$a |$b L$cy ρ D$\T$] t$^ L$_y ΁ Ήt$D$dT$e l$f T$gy Ձ D$hƒt$i L$j T$ky с D$lƒt$m \$n T$o|$y Ӂ D$pƒ|$q t$r T$sy ց ֋D$|$1T$1=y\$$ZL$ʼnL$,ȉ\$@ÉӍ/L$‰Ë\$$[B,9D$(/D$ D$tXD$t‰T$4$\$T$HЋ|$)L$(hL$,QWR5|$#D$ {|$t9D$t9$T$,HXp 1D$uT$1l$t= $Ƅ9>l$ $\DT$ՃD$ 9|$D$ Mȃl$uAT$j ŋD$X l$EÁy] ËD$h ݋D$X T$j ݋T$R l$] y M  É $Ƅ9>t*l L9݉9@1l$l$~iD$9T$$4$1><t >nm^9};|$ |$ 91L$tL$T$14$|$\$$L$ L$T$|$F1\$ ʃ{ s {y $dFJ|$,ӄiFRN 9hF9q\$T$N 1ۅQ΃1rY̓1$\$;8dNT;8eNT;8fNT;8gN9u\$1ۅt"|$41D$(/9uD$4$T$|$1ƄfNfDŽdND$81L$0L$<1ۋl$39l$l$@L$:.>unM߃$iN$\D$1. $tDA)>ii;T$tyl$lp $ Y I|$0,~;uM}|1ۉȋl$p{<$L9t }`$@\$ ۋ4$.S؃1Ƀ1ɋVr<$w̼  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF4$91tA ́ 1ҋ4$v~$x<ыl$hF$dF4$9ũ~ 1\$jUSWV։[ÑtK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR $Ec\$Xjt$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0V] >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$c8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$ilQL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$<1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ01i4Q9uB ^_[]ÐUSWV0T$ $X1D$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$ED$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$)ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ %麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$})jhUt$ }T$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9ll$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP|)Nj\$jhUt$|L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ jt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPz)jhUt$zU\$T1ڽT$\$jjdURz)jhUt$zt$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$0|$ 9|ځ41ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$4XD$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jPn~ e1^_[]fUSWV[Ët$1tGl$)Ήv,|$ Wt$T$,t1Ʌ~|$ 1^_[]fffffSWV[t$\ WAt1j t_L$T$PHp | | 1A"  xuxt%txu8u롾W^_[Ã눐USWV[h\ D$ Px | | $ L$ L$ǐ|$$tD$$9G t GtO|  tGwЃ GЋ| 9t| DžuZx u';|$r$;|$s<$$<$C<$1x t$ ~x u#t7W,u^_[]ÐSWV[t$\ W!"  xuxt&t xu8uju $p@@ | | 1W^_[ffUSWV[U$$$D$$DŽ$DŽ$$ jP$<jPDŽ$TDŽ$XDŽ$\DŽ$pr$TK1D$$d$t$l$x$dU$$P$d;$u ^_[]S[pt$t$Pt$t$[ÐSWVP[D$L$T$t$ 4$pVRWQP]^_[ÐSWVP[ëD$L$T$t$ |$$<$WVRQP^_[ffffUSWV[kt$}XjWkE`HM`~;Ep~ t EXHMX WRjW4^_[]ÐSWV[L$B`pr`~ ;Bp~ t rX~zX XRQA^_[fffffSP[ÍD$ L$ $XQPR[ÐSVP[\D$L$T$$XRQPVp:^[fffffUSWV[T$(|$$t$ t&t"T$(qTN @1tVt$jRҠL$0A <$uy‰Ņf1qyQuE)ljuދl$$1$)1t$ ōACAAAjQdxՋ)v1WPVOL$4 9l$QHu0}T$RPVΉ )~>jV l$$jU$+D$1t$ ʼn^_[]ffffffSP[ÝD$ L$T$$RQP[ÐSVP[lD$L$T$t$4$VRQP8^[fffffffUSWVP[*Pt$ 1ht$t$  x=|PfF FfFfn vF$F,F(F $tjjjVx^_[]ffffSWV[\|$jWew jWa^_[ffffSWV[|$W;D$w+t$9w 9w9w 9wPWV  ^_[{fffffSV[ýD$;D$wt$ Pt$Vyi ^[\{VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[tx[USWV[[t$F0u ǀFFF tVu"V]tA aV);F|V0u?1FT$i.;Ft F t uVu^_[]fffffffUSWV[Ët$|$l$jU茛pWVPUjU}^_[]ÐUSWV[0u}D$d$G0u ǀD$?$u 4$G tu)$Wt 3G Mf LfA$`$DŽ$tDŽ$x$|$jPb$jPDŽ$DŽ$DŽ$$hh jP G f$Gf$G$G,$GD$$`$$DŽ$DŽ$DŽ$$Vuu WBƅxW賓1Ƀ ΋D$d$@M42I @+2D$,E$T$tT$D$D$D$DŽ$D$`D$XD$$D$L΋$T$ L$L~1Wt%t됐t\L$L)L$T0T$ً\$ 3KT$L$)Ɖt$T$r/9u8D$T$tT$ L$TZ\$ T$C$D$Pu3\$D$D$T$tT$ T$0/D$#Ƅ$7D$LD$01҉|$LƉِAσ s&1&$D$T$t\$LD$D$#D$DD$@D$PD$H1ɍ$`D$4 EHMT$0҉L$8Ё1ҍ$`1 D$8xT$|$p$@u $dQwPu%ƒPD$ƒ;T$0$v@OMQ U)ۼ$ $L$$L$L$|L$|$D$ <$E6 Dž"L$h)ȉL$`L$0D$($xD$0|$\uƄ$7D$$t$P\$WhD$$"D$D PD$D$Wd|$ltD$#-D$D$\D$@=}T$t\$LL$uD$$8ND$8uW`i $gT$8 D$(߃Gud߉ЋL$`tL$0\$@|D9\$0|>)y1ɉL$0T$to`, $' $L$4D$#L$0L$Dt$T$8$8|$@߃ЍT$t\$@مD$D D$0tD$0ȃ|$XD$";D$XJ9D$@@1D$PӐL$H11Ҁ{D$D$8t|$@)D$8T$PD$D$Hȉ|$@9 $L$4%D$D$@D$PD$HD$(1_)+$9 \$Ѻgfff)À0eT$|D$D$T$ t1ɉT$ uT$|$ D$1D$D$tD$ T$҃\$P)ӃT$H)‹D$X|$4ljT$H‰\$P|$HD$D9NjL$ w}D$XD$4D$( D$0u1$$`$`AϋL$D$D$L$rDW$D$PR dL$|\$D$D$T$0b$jj WQL$2׉ T$)ʀ0$D$4$D$XD$HtA$D$Pu#aT$|\$D$D$хtM1 D$ы$D$0))ˋL$|$|$ D$ G ~r$CD$ D$L$rD$ t7$D$PuZ`T$|D$D$Ӆt1ɉ넋$CT$ ‰T$L$r;Ѕt?$D$P}W_\$D$D$L$tt#ً$T$t$D$ѐD$(%|$8ˋL$|$D$8$Clj|$L$}$$D$PWC_\$D$D$ljʉ|$8G ωщD$8l$CD$L$r1\$tt2$D$Pu^\$|D$D$tZ1z|$$}t-$D$PWb^\$D$D$D$T$t=}t$$$t$$|$}t$$$t)$D$PW]\$D$D$ucD$u[bD$TD$T}t$$u <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v PE|$8E|$8|1 uT t$ 9wS$w닔hwl$Pmt t$T l$PU\ / U| 룋$L$19u $P?<^_[]þUSWVP[ÈBD$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$蒁USWV [6AD$ 069rljT$D$uj$jWPhv (9$T$JHJHJHJHJ H JH RPE$jWPv 踌(豌8t!觌0t$蔌0*)4$PjV%p $L$D$ 81 ^_[]ffffUSWVP[@EET$@t$DT$$pU }jjD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjPo ){jRPA1 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]}USWV׉[W=l$XtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[C<m|$hE t$p |$<$_ MM$U jjl$l$܋|$Xt$`MƉ2t|$D$QC-t?ƃ|$|=FWjP4k ){jQPe- o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[] yffffUSWV[à8E|\$t*\$4x=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$msNjD$L$ttW% ?L$@\$D$4\$j؋E\${ju P") mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋܃$ۄ$܋ |$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(w@ D$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ R&D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃ ݜ$$$$$݄$D|$<ػ|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$*bM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃L$T$vثv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jqbwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$PcWD$P3bW)^VD$P؋|$ |$(|$ |wD$0ufsD$\$t$W_c\$ Džja|$|$l\$WP!c`؋L$1ҋD$DD$4D$RS]D$t/L$4t9t\$Q2]D$\$P!]\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$t_ )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$;\T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$ncD$T$|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQNt,D$$D$H~$Pt$ND$T$ u 1T$ |$tr $t$Q"PT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ O\$L$ʅ|$@'D$D$8|$LD$D$0L$PRMDž~#T$?؋L$؃T$$jj QF |$@c΋$jj t$F ‹D$8 |$Dt$$$/L$|$D$D$t$QVED$ t.L$t9t$Q6ED$$P&ET$%T$$1|$D$Ȁy0ItL$RDL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QRD jt$ LM|$D$ D$$t$|$ W_D$,t$W^Mt$ t$Mt$t$,k$jj PD ljD$ D$L$L$D$D$QPƉ|$Wt$ Lt$ t$7Mt$,N0L$ x $tPbCL$(T$D:Pt$ LV9CT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj PC D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VB D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$RJt$t$z|$D$ jj QA D$(jj t$A D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPH\$ht$D$ PxIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ GD$I$t$t$ |HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[,D$1r 1 9vW<t8Ɖ^_[ÐSWV[ D$1r 1 9vW;<t:L$T$8ƃXt𐐐Xut^_[ÐSV[= D$ PHpR<^[USWV X T$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RU%E|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[> SVH[ D$0hjP: D$(D$,DŽ$@DŽ$DD$ D$D$$jPjX ML$(VPQjD$$D$ D$D$D$D$D$jPjM jLjyMS[. S[ fffffffUSWV[ D$|$1tt (h1^_[]ÐUSWV[p}uui\$D$4PDFD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$$!ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ t$(PV'T$4D$(PV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQ( D$p '3 |$4t$N  D$0P QVR\( t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP" 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 D$ ty0L$u . L$?0to<\$t$ 1D$ʋ\$< l$ tًl$ U<u:^t8\ \u<)̓L$U<uP1D$tM8uI^ L$  $L$ 8 $tۉl$ t )1l$ ʃ pu[MD$+t-uD$Mɋ|$ـv01t$ 1D$t$$LTր1wN $D$/4 w$S$\$ˈրs"rD$$t$ |$uwt$ |$ $|$t)ӋT$ډӅuD$ HD$81Ƀ|$t ȃ$^_[]Åt<|$M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}!"P"L$D$ffffUSWVt$F98[Í |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[ãu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[ût$D$T$<n~,D$9r9s#L$9w)QjP. ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXǀ ǀ fǀ ǀ1 fǀ5 ǀ fǀ USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[ìD$H~( 1u 9r1$PƉ^[fUSWV[KL$P_ƅD$t/Fn?t P&FF ^_[]1?t P%ت\ )ʉʁ oΉتoUSWV[Kt$tbF!r VoO<}t3 WM%}FԽ Խ tW+%Խ Խ ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[8l$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR= E!r&UmE!r\Um1<} $P"}T$,BԽ Խ ti4$"\<}th $P"1}FԽ Խ t14$"$Խ T$, Խ D$TG^_[]ËԽ Խ 1␐T$1Ɂsrr@r"y(6s@sރx @tS[Îj,tL$H@[ÐUSWV$[XD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rUf<9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [E\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[$| 1P$1jjUQ ʼn$tƒ9t t)D$P$vts#D$ =uXitZfx $tu f~ $fFvF$F,F(F ! OĀ^_[]fffffffS[οt$t$jt$[fffffSWV[Ü|$jWGHO~ H0 WSjW^_[ÐS[>D$HQP~ Q[P[fffffUSWV[L$atrt!w 11Qt_tGҍzw"@ؐ+u˽뿁뷁 L$) p 1^_[]fSWV[,|$f jW*G0ǀǀ 1G t WƋO twуy y wP]G0tW@9t Q7]G0 ]G0ǀǀjWG GGv  ^_[ff̀rS[$x[SV[ t$ F0u ǀV"uFH^[fSWV[ü|$8u-GG Ⱦ uuL O @G0taW@9t Q[G0GG81t&W@G GGfG u WG t'HVDPVGOQPwW$ GO fO 1!t Gf@f  fG ^_[ÐS[^D$H u P_[1[fffSWV[,t$t@1mT$ |$L$D$t#t8uӉ6@VRQWP26@VRQWP趀6@VRQWPL^_[ÐXL$EAA A AAAÐfffffUSWV[E$uThjR1$džt.%u%D$PQu1t+8$u!8u $t4D$P$UQ)VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQt|$=|F P/#FEt$P#FV EtF4Et UMtЅBt N&tEu  hV VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFj P ;F@NF(șdžHF DDN ȃN艆8hPjQMPV-$$0$tNC_z(1VTh(1^_[]14dž$j$&DtJpMHNHNH NH OHOHRH88oUSWVՉ[ÔjqRMlj1&NL$jPM$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u1{8"m8^_[]ÐUSWV[4jQ! t $81t>0tRrPtBR/t u8~)1 9}8tQR݋t PLVQtg81^_[]ÐSWV[|$tOWQ^_[ÐSV[ݱD$ p|$s t.jt$ 1dž,dž,^[S[nL$tAt[q[ÐSV[-D$ p|$t?dž,1t$t$^[ÐSV[ݰD$L$ qtdž,&t 1҃ƒt$t$a^[dž,빐USWV[X|$(D$p$xudž$dž(dž 11Ʌt f9 tSHt ()9bf|Qf9udž $뢐V($19jjUV/ Hf9uxV(9vo(f|Qh QjPQVr Hdž(fytV($9 (tdž(f|Q댺f|QRu(f|Q^dž $dž(Ckdž,^_[]Ë(|iw&jt$(t$(PVJuƺm tXiD$$ËD$ ÃrLi#dž$뀋n tD$)K$L$$)A(1ESWV[\|$tu^_[ËD$tx4t&jjW uЉuLJ01뷐USWV[|$(o(o(OG0!D$;G9} $wD$D$ P;$L$L$D$QPt$= $L$QjP( t$K$D$ GjwD $tNG(PxO 9~ LDLDG G,9vG0 G,Ut$WY ^_[]ÐSV[ít$ t$t$ #F,;F(~#F0^[ÐSWV[f4aAj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>N 7l7\7|7<7\7l7L7L7f\7ff\7fL7Php0hPHHPfhfPhHHP h p ph P H H P hpp h PHHPhpphPHHPhpphPH^_[]Át1f9v|pff|p<0f\0ff0f|0|0f\0ff\0f|0D0t^ ~ N n n N ~ ^ N f~ff~ fNoUSWV D$ D$(|$$GHL$H hd$Z1f!fDp9t$1\p<ɉ LflfflfLLtÃtID$CcL$K cCD$CKfkffkfKL$V ;L$L;L$L;l;,;L;L$L;L$L;L;fl;ffl;fL;Php0hPHHPfhfPhHHP h p ph P H H P hpp h PHHPhpphPHHPhpphPHd$1ffDp9t$|p 8l8\8|8<8\8l8L8L8f\8ff\8fL8D8tO o _   _ o O O f_ff_ fOiPɉʉPHɉHH ɉH f@f@ ^_[]ffffUSWV[˗|$oEtjPu觢 EjWu蜢EtP6E EtP6DžDžtP6DžDžU6W6V^_[]ÐUSWV[Ȗ|$0D$,pFtjP6衡 Ft^_[]Ë 1uʃtttjj6g t$b1D$L$T$ |$# l$hxP H@b1jP6 6gY 1KfffffffSV[ýD$;D$wt$ Pt$Vy ^[\ffffffL$1s!t11҃9rfWV_MD$tL$ P1"1^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[ÈL$4T$0t$,t#D$8yt9W t11҅1116n!ՋN σu1҃01Ʌt3OHOOG8^_[]ÉT$L$D$l$ D$uTD$,FuBVQV N u€thV:l$4|z<$jj/,1hƋD$,p j,Ft.t D$,l$4D$0F Ftu1V21NT$,NL$N1jt$Pt$f u-FPt$UW7fnsD$$Bt$ u| TD$Pt$@V= d|$1{F(u^Qjv6[ 5@%u^jW6 FL$ QD$ PV= ;FjQ6 jv6 DžFPWjVG% Fxj16w uj_jt$D$BtjR6I 1u:/ujt$t$6 u 1$^_[]1PWpF,D$D$ijQ6Џ gl$;l$tn1ɉ $Eju6諍 UHɃ9u6jP6j $;l$u|$D$T$,D$fP $tkωʋT$LJt 0f@jRu jVu rD$1D$T$D$|$jP6蚎 jW6蝌 ;F]OD$ Pt$ V_: a/t$ |$jt$6+ jW6. .;Fy jL$Q6 ;l$t|$$Eju6΋ Mfu%jP6融 $;l$u|$2ʉD$T$fQ<$t$ L$D$LHljP65 jU68 t><$H*fJ<$uD$L$USWV[ȁT$0l$,t$$F( :N;M.N9"$F(  D$(ƅt$,$BfD$PVWm`T$< $E9v$,$BfD$PVW4`T$< bE9uUEtNjP7 $fD$QVWD$_  jt$ 6蚋 T$0,$fT$|$(u -,$fT$GjjjPPQW^T$L{O(,$fT$wjjjVVPW]T$LEO(EjP7 $HfL$QVWD$^ t*jt$ u賊 T$0l$,O($l$,L$F(jQ6~ T$0$FD$fFDU<(DtG PVatjGt PVatMO, F)WPPb fnT$0DVNft>uf+9f9sf9L$,|$0fugT$,zT$0)Ӊft~ft$ty\$ 1f1f9t9Yf9r1ᐃft9f9sf9yf9sfy)|$t$$\$ frR\$,t$$t$$fs>\$,{T$0f{N( 1uN; uN9vfN^_[]1fTYf9\$t|Yf9r1fY|Yf9r1fTY|Yf9r1fTY|Yf9r1롐USWVT$[B}A,D$L$\$ ;t$dFjvu $FD$Du<(DtG \$ Pt$ +_E%\$ uI}Ut$ VUV}n@$} ‰$E)QPP ` $fEDufD$ftZ\$uWً$t$fdfEt$fEE \$ jUD$0 Zf%Kt$f9$sffuwUf 3fL$1ff9tIO$f;L$r1ސftf9sfWf9sfW)D$$L$frD$$fsUfUt$\$ jU6赅\$ D$8ujPu蘅 $.PU$ut$U{l1Ʌ $$^_[]1D$"f\Wf9T$$VLWf9r1f4WLWf9r1ftWLWf9r1ftWLWf9r1뜐USWV[yl$|$Et$jP7跂 tBMHjP7萄 E1t+jP7节 tMHjP7c ^_[]f1̀ffff ̀rS[4yx[SP[yjjjPt$ 1Ƀ $ȃ[ffffffUSWV[x$$$ T$$xt$%Gudt$ $1|5vuN| v?2+$ $<19rj/P^tRB1ɋD$;$ȁĜ^_[]Ðj>#9r?Xt|$W$)$hPT$RQL$$ $t 9vϐ?/(9w$)L$L$  D$#D$$tht$U; t*$hUS31Ƀ89t$1$8j?Pt$M tWH0tȋ $9:<D$ND$19ubD$PU3um9t$uCz3D$PUQ2/1Ʌ#D$$=@L$411Ƀ8jfffSV[uD$;D$w.L$t$ 9w9w9w9wPQV¥ ^[UkffUSWVx[xuD$tD$pD$lD$hD$dL$$T$dP:D$@FD$ uƃ}4PQ uƃ~ƃ|$;$uĠ^_[]8ZS[eP8j$jPt" [ÐS[ÞePǺ[ÐS[~eP觺[ÐUSWV[[el$j6ƃ#j61jr6j$jU! WUF!^_[]ÐUSWVhL$$D$|L$4Hpx |$8x|$9wL$T$ LJ D T$Éх҉u\$ K1ɉL$TSL$y<9|E+D$fEL$fDMD$DENɉLL\$l$pD$P9D$,D$8L D$ |$T$WPjjt$ud jVud D$ t$ \$l$pD$jPu~d jVupd u՞5jt$$uMd jt$u1ɃYh &5F,jj6X Hʁ@ TP|UfMjP6>Z jW6AX u\F,jj6!X =H+@ )H| fBjP6Y jW6W uǚbN(NPf9$fL$N,L$;|$^OjP6 Y jw6 W COPf9t$&$fD$N(uNftx$fL$N($FfD$1fOLH|jP6=X jW6@V 1Ʌtz@ t닁$fD$N,L$;|$t7OjP6W jw6U t OftjP6W $(|$FtP'F FF($nf~ F(jQt$4Pt$8RV)!@u$Fjt$6(W ^_[]H@ nfOLH|jP6V jW6T uxjP6V jW6T 1xjP6{V jW6vT HUSWV[;K|$l$t$FtPF FF($nf~ F(^_[]USWV[Jt$,VT$RQ ǸD$(>  .,$OfL$ D$ŐM;tjUD$0kU /GfD$ wfteL$A ;Mt jl$l$UD$0$U El$ jPD$0S HfOD$fOWt$t$( ulHHf9Ou8pjPuT thjVuR fGOT$(‹OJ/L$;EtjQD$0JT D$((fpL$ fH1^_[]ËD$;MujUD$0 T иfffffUSWV([Hu~,jj6Q )|$FD$ VƋʋfqDBtjR7oS jV7rQ D$ L$yftZ1ցϋD$ t@t$΋Mfq Pu Q"' tKOT$뵐1ҋL$A uN1f}%L$A }ED$ 1}  fueL$ItZjQ7jP D$t=@fD$D$Pu WN& Ljt$QR D$ L$If9uYL$ItNT$ jQ7O D$t-fD$D$Pu W% t,jt$QQ D$ T$ MfW e^_[]j|$WQzQ D$L$N FE;t$1ɋ}L$Fjv7BO tVHɃ9jt$V}7P L$;t$uD$1ҋt$jt$VQP D$L$O GE;|$1D$Gjw6N jPu6D$WP D$;|$uL$1}fVL$tgL$}LHLL$fFjP7O jt$7M L$rL$1룉jWE0O D$ ufzD$tguD$DA|jQ6IO jW6LM tFP9fyD$uujQ6N D$ Ufff̀rS[Cx[ÌrS[ôCx[Ḉ̀rS[ÔCx[̀rS[tCx[ḹ̀rS[TCx[S[>Ct$t$t$Ѓ [fffffSWVL$T$t$r ;uwt1>:8u 9u1)^_[fYBD$0%P,%P(%P$%P %P %P%P%@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^ƸAL$<A$iA D$AQT$QT$IL$1t$$4%l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$L$T$ j [ÐUSWV[=L$l$~ v$W V$F ?t.GD>(77)(QjPxm F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPl <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjV7l^_[]ÐY?<D$P&PL&PH&PD&P@&P <&P8&P4&@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[N;t$t$t$ [ÐS[;t$ t$ F[ÐS[:L$T$ j[ÐSV[:t$ tAT&j@PVj FPhjPxj F@FDFHFL^[ÐUSWVXe:$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8&D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojP` FP3nPtPWjPo` UVj~jUX` FPNHVLN@VDPV^_[]ÐSV[-0t$ tA)j@PV;` FPhjP_ F@FDFHFL^[ÐS[/t$t$t$ [ÐS[Þ/t$ t$ [ÐSWV[|/t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjV^ ^_[fffffffT$D$fUSWV[à.MD$$&ydT)Ḱ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <` 1D$D$ D$D$L$8T$jjPQjRtD$8` D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$[vL$:L$NL$jFL$yL$L$L$hjjjPQRD$L$8T$jjPQt$R!L$81 u3rjPI _UiK1D:0D$D$D$ D$L$8T$jjPQjRt$8|$<7QPWVD$D$D$ D$L$8T$jjPQjR+D$XL$ L$hjjjPQRuMD$D$ D$L$8T$jjPQt$RtD$8se^_[]fffffS[Þ'^ [ÐUSWV,[x'l$@D$D$ D$$D$(L$ D$QPj Wi|1|$D1҃|$H1‰|$d 2l t |       t t} t{ ty tw tu ts d1`YRKD=6/( !    s#4Áh uH< |$9T$vQ׋ jjjhjPjd t+f@ fɉ9sfэ4fxtnF|$DtL$DHH|$HtT$HQ|$ tu|$Dt1|$Htt$yjWj| ,^_[]þ |$ $ <+jjPQjR7<$ ȅUSWV[$WDytV6u& pP7ƅt3tUmuWx0tUmujW~x^_[]ffS [[# u?D$D$$ T$jjPQjRt [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[["l$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQPƻOV QRP ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRP$t,NQW QRP FEE1^_[]ÐSWV[ D$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [ÈT$0|$,D$(L$$)q092sVP[$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[ØL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[È|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[x[̀rS[äx[S[Ît$ t$ jt$$t$$t$$t$$t$$  [fffffS[Nx[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[Ø$D$D$huԫET1}8XM4tI$PLE8*$$E4E0|$ 1D$L$j`QPu8VRƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$ |$ WZԫ$Ƅ$D$T\PWt.$Ƅ$8u$L$ThPQP $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$UpF !`jD$$PUF ʼn`D$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PvXt_`u|$ <5$h$PW h$PW U|$|$Tt$h$PW_ |$ u9nuqF$hPW> nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QPmD t$|$"$t$|$t$PRE$$t8^ltC$($,2D$XP$0C $0$$t?^t$t$7g;$r^_[]Ë$($,kc7$QPZC t$bҋ$0t D$TPQ$,$ $$t%(tPD$(PQA $$(1?7$($,91$u$QPB t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QPB t$|$ t$$tPBP$$t T\"$($,uWPA t$l$$t$|$t$POE$$8$j`諞t@8@P$i$t$|$t$PQOE$$t8f[&t$l$tWO$,$$t(#[?$($,t t$7$QPj@ t$$t$$tPN$$tL$$s.SWV[\tM΋uA~8t:~4~"`N4F8 I9rP裭F8^_[ffffffS[ D$L$ AQ jQ0 [ÐSWV[Ü |$t$t+jP6 tH  W6,^_[ff̀rS[4 x[̀rS[ x[USWV^ $ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWV[ T$D$t#4׉9t u|$))t6t'Xt u) WK^_[]ffffffUSWVLXh D$ L$ht$dl$`1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$UPT$)rx,D$GD$\$ D$pPUW|$x׉ t$pt$ l$ Uу x=l$a\$ t$pt$ |$ WT$x xA|$;l$<l$x$\$ t$p|$ Wt$ T$x x|$|$D$؉D$)\$ D$pPVL$DQ|$x׉ t$pUVу x<\$ t$pUt$DVT$x y!!x\$ t$pUt$DVT$x x|$+L$l$\$ D$pPUL$$QT$x D$t$pWUT$x |$x%I\$ t$p|$Wl$$UT$x x,(x$\$ t$pt$|$$WT$x x|$l$|$\$ D$pPV|$ W|$x׉ t$pUVу x+T$|$\$ P\$ t$pUt$ VT$x y--T$|$\$ x%\$ t$pUt$ VT$x xT$\$ |$,tID$tR\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$L$HD$h9L$\$ t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gqD1pjPQwsL1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[t$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øPjj%Q7SWV[\D$L$Pt prxxp| pPxtz xyV螖1^_[ÐUSWV[|$ l$9v`wDt9xtNȅuT$81$Xq3B<B1*׋PtIQPEjPQD$ pD$,PJL$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~yAObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p$ D$ L$Q$ЈA1ÐSV[t$ V PNtHP tQ P V-1^[ÐSWV[|t$>gthGt tww$Ѓ gpNjPQwH;u<tww$Ѓ bC@^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[,D$t$tA|$1ɐt 9u)tPjQ" ^_[fffffffUSWV[øt$0|$,ttq>TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P\ Pt$8=t +l$1jt$8? 1^_[]fffffffUSWV[D$(@x>T$$B tzu?Rt*= =F \$L$()}u(D$ $L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj W t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$ T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RDT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPGT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP# D$$ $t$$L$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ffUSWV[û|$tpjWG 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;HWCPHWC89 jW%^_[]ÀO @1USWV[t$N 1tT~tM.)>1uFFtUWvV, ~)uNDtvу N @1^_[]ffffVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[üt$8u-HN uRt8F0t~@9tRF0N FFfN ~u VCN u1uVVF11+NN^_[fffffUSWV[$$G G$=tUL$QPxC#T$ L$xt+OLuo(1; $1D$G u9tiUJy. Go,$̀|$t)OtPt ,$́f o Gfx#T$PQj@R^1ɅD$Pu,P1҃/w,D+D$1T$` DQt$L$ QjhjjjjPv |$ t:L$u $O GCGG;$u"Đ^_[]ùT$tщ1vUSWV|[è$$$F=tYQPxI#L$1 ED$ht1FLu*N(1; E|^_[]fffffS[jt$ [ÐUSWVP[<8|$t$F0P<F0P9@9tnPj@F0Pt8PQ=jt$r@?N0PǁTt!ǁXN0TtXXu\Qj@N0Q)<^_[]ÐSWV[<8tR|$G0P;G0P3?O09t,Pu'?O0PǁT 1T1Q;^_[ÐSV[=<8tJt$ F0PU;F0TuǀP8PQ<F0P ;^[ÐSWV[<8tn|$t$F0P:tF0Xuj\>F0TuǀP8P;F0P:^_[ffSV0[:D$<L$,QPF1;T$,uȃ0^[ff̀rS[x[S[t$ ht,@t$A [ffffffS[ÞL$T$ pPt$(t$(t$(t$(t$(t$([ÐUSWV[Xt$DuT$D$0ut$t#r 11Չ90D$.0t$Ht$4l$U|$W!D$T$08t /|$8l$4/L$u $T$ 9tF\$9T$|l$<9݋|$@} uL"Du$8tV݉*WT$9L$|l$<9Ջ|$@|ωՉ^_[]ÐS[L$T$ t$(t$(t$(t$(t$(t$(t$([ffSWV[|$jWt tVW21^_[ÐUSWV[Ël$jUtt=ǾqtUWU6t1l$UPt$  "19s#[.D.8^_[]ÐSWV[|$1t,PWJt |$t=t=tƉ^_[ÐSWV[ì4t$WQtPWa V^_[ÐSWV[l|$GPjptƉx @4VPW1^_[ÐS[4t$Pt L$ 9H [1[ÐUSWV[D$01t:>t41 |t$t$ t$ WW$ uD$ <=u.|$$  9ttD$0 M9u; s|9v9tfPǃ ǃ $jWPU ,0,8uyPD$0t$ )$jWP +0+8u4)  $PjQK $ L$ ^_[]ÐUSWV[8 t 1t04DtPVt Hى|$4jjD$P tE t5jVt$^ F: tVt$cV~ŋD$ 9tP}ǃ ǃ  UjP  ^_[]ÐUSWV[81tR/tL,t4t$t$U! uD$|=uօt D$1^_[]ÐUSWVP[Ú|$1|PW tfƀ<=t^tR)tI1 $ $lt+Vt$U u|5=uمxD$8.1^_[]ÐSV[DP3ƅt(0^[ÐSV[íDPV3ƅt(0^[ÐSV[mDP3ƅtx(0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffSWV[t$D$L$~tQPR* x FPVTf ^_[ÐSV[Ýt$ F tBNtjjjP !ƒtF '8u;F %T$L$%fF vtRQP( ^[øUSWV[t$D$L$|$ ntWQPRt !N tfN FPVT fN ^_[]ÐS[ÎD$HtPf*[ÐD$L$AAA USWVP[:D$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[D$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[XD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[L$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[T$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$L$$t6 ruLQU=d$t?$L$Ui$19L$^_[]þT0ېffffS[T$B=s`DP[ÍL[ÐSWV[Ö$JRQPhWV W] PWj t;$uĄ^_[{ S[T$B=sD$ DP[ÍT@[ÐS[T$B=s`DP[Í^[ÐS[ÎT$B=sD$ DP[Íf[ÐS[>T$B=s`DP%[Ípf[ÐS[T$B=sD$ DP%[Íx[ÐS[ÞT$B=s`DP[Í[ÐS[^T$B=sD$ DP[Í[ÐS[T$B=s`DP[Í8[ÐS[T$B=sD$ DP[Í[ÐS[~T$B=s`DP[Í[ÐS[>T$B=sD$ DP[Í`[ÐS[T$B=s`DP[Í[ÐS[îT$B=sD$ DP[Í[ÐS[^T$B=s`DP%[Í[ÐS[T$B=sD$ DP%[Í.[ÐS[þT$B=s`DP [Í[ÐS[~T$B=sD$ DP [Í[ÐS[.T$B=s`DP@[ÍX[ÐS[T$B=sD$ DP@[Í[ÐS[ÞT$B=s`DP%[Í[ÐS[NT$B=sD$ DP%[Ín[ÐS[T$B=s`DP%[Í&[ÐS[îT$B=sD$ DP%[Í[ÐS[^T$B=sDP[Í&[ÐS[T$B=sD$ DP[Í.C[ÐS[T$B=sDP[Í8[ÐS[ÎT$B=sD$ DP[Í@[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[x[D$t8t9@€tuuuuH+D$ffSV[êD$ D$D$$jVjt uƃ tjjjpjVj3 jj_fffffffSVP[ D$L$T$t$4$VRQP ^[fffffffSV0[ʾt$̀rS[Äx[S[njPt$t$t$)[ffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐWVD$$|$t'L$T$t$1~961Ʌ21^_ËT$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐVD$L$ t|$tT$ t121Ҁ9 11^ÐD$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fff$D$4̀D$̀fffffffT̀rS[x[PS[[fffffffS[γ<8t3[Ë[ffff̀rS[Ôx[S[~j1[ffSV[] u# V<u1 ^[Ðfffffff1ÐÐ1Ð1ÐXÐ1ÐÐUSWV([x|$@t$< wf Hw3 uҋ Ȑ 밋 t5 t* 9s8u+h ƃ D$ D$$D$ D$D$D$D$ $ D$ fD$  D$Wj(Pփ4^_[]ÐfffffffUSWV[$E$ l$@$D$$$D$1D$8t$$σ EF <%tL$9sL$א$D$D$ |$0\$Eȃz43M*.Q1 w#1BMQЃ rx뫐T$ 1ېAEȍQЃ r\$T$ \$^ L$ tȉD$ C $:L$L$D$!\$ $+D$ $ $@ $1}lu $ $ $ $D$yD$$x.uu uu@u0L$8L$T$ A9T$L$f8͉L$ L$у $$ҋ|$x;u'u u&@wʱ-L$xL$ L$11ιq $D$OK $D$UL$܃ l$,L$L$D$LD$cWL$ $ɋ|$ $u"u su @tD$11l$,l$muOERjU :)9 $lj-L$ $ɋ|$ $u"u u @tD$1)L$̃D$8 $ɋt$u"u u @tt$1l$,L$L$L1ҿl$L $~|$D$ $̃L$8D$x1{wD$1gOL$ փD$t$ F~NL$T$ u $ $ʃuʹD$$T$ |$҉l$,|$T$ x$$ u$|$ !tU$>T$8 MÉ19Ɖȉr$򐐐t$ À019t$ rӍi$tz0tu0n $rFNj\$jj VPo4)0M1ɾc9ىr0E$)T$ 9‹t$$L$ǀ|$tD$ D$<p $F \$/U $1҉Džy1D$D$s $tD$ T$ D$9s 09r9s 09s9s09r9s0붉L$L$(ʃ.D$9tfTFl$@E;$u ^_[]ÙfUSWVP[1@$t5h$~xX~f tWT$ ^_[]ffffUSWVP[ÊD$l$H1 m \$D$H1yt9~u~f;{uًv;suD$t~u밉΀~t뉋t}u ~vD$$*jt$P` tAt=}txuHT$f;Ju׃xux uxuxu1^_[]ÐUSWV [%$,$Vf1f $$0~ )$,$0hL$ QWPV?x[9wQW葇GP肇;$$u;$(u$ D$ PYmȋ $ $1 ;$u ^_[]іUSWV [$ $q if;$$$(J ;$,Ѻx$ #ȋI(ux(u ff9<$|$~hWV$0W$0ЁxS 9wIV'FP$,$,PW|$Wu11<$<$;$u ^_[]iUSWV[ÐED$} D$0$u\$ jVY=~ t$t} D|$ d|$ QL$0 ;$e^_[]ËKu at8\$ Xat$RjVt$ PT$09uL$H|$$t~ \$,D$$P$D$P$t$t$jjt$$P $$$WVt$dV$P$$D$$D$$D$$4$4$4$4U$0R&UG=r,j$ a;$u;^_[]Åt|.u|$UPQhWfpffffffUSWVX[{$L$p|$lGtG ,t$x6zt$|yPVt$|UQ$$E$ 5BBW(fG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$F[xnNj$L$|PQz_$L$xPL$Q]_$ǃ$fB$) $W 9$A A L$|PQ^$L$xPQ^$Pj^$PQ^$ztQ$Wt$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPYƅxՍ7Pj ^7Pt$]7Pj^7Pj]$ 1۸$IUSWV[kxl$ |$t$D$@tPnK) l$$FPj)E]F|PQ(]fFD$@ u1ftPJVP\Vj\G fffG )^_[]ÐUSWVP[zwt$0|$$T$ l$D$@tPxJT$$׉)Ή $9|bL$(B9wW9vSD$,UP7\EPt$V&\EVt$8P )WP[+t$ ^_[]fffffS[îvjt$ [ÐUSWV[Åv$ $D$0$jU1[Et U uEEEj5U U fE@$hjV̥ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžhtkǃhpjP< EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jUYD$ djVU PƅD$$}`hVW聁 ƅ_EH}DM\D$ 19s( w 51҅tމ8D$ Ϲրwr tt$$D$ PtPǍ$WhhP E`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$Ph A$<#t<;t΋$doma1$in $sear1$ch #+j P$P/ $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P5 $< t< 0$< w 5A< vhQt$~ ƅ_8Pt$dD$ kc$< t< H$< w&(6A< vhQt$VU~ ƅ_j V}tuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< t6PV$< D$<@@@@ @@D$@D$8j5Pj j$PD$PD$;t$ s E$EtJ P,>EDt%uHEPWIu퍃FP=LP҇t\V[ML$0 ;$u ^_[]/_USWV[[jt$xP6džft91 9s)tQDŽͅtMtt|`9ut趹xt P袹W2 džtP džf^_[]ÐUSV[TiEu( jP y$D$F$F_fF e^[]ÐUSWVx[hEL$ L$pu( D$jPxD$3D$fGt$V@,jWVd, VW4GL$ ;L$pue^_[]*]USWV[[ht$xP<dž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[4gD$AtXt$0UPx EO $L$(T$ L$zL$L$ F< t< tjt$Vf jPVL j PV2 TjPV &j PV j PV jPVʩ  jPV谩 jPV薩 j PV| pjPVb TjPVH jPV.  jPV j PV  =xjPVݨ IjPVè $`FPP5d$/FPP|Gt^GddGtAPt$'F P;P|GGtPQ7< < {$H׋$ut$0UP~ $QP)7뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]@#PV ?r?D$PVt$Qp D$L$Ƅ|$@#PV输?r?D$PVt$p D$L$Ƅ($H^_[]ÐUSWVx[b$$l3 h3 p;$ t|OY9h@t)Y|x$D$D$%D$ D$D$D$47PjjjQt_tt.47T$tw 98< u|P8 < ~)@ uǃ@ hPǃ< H L )ǐM\{rƒƾ#$su*9 L X 뽍(;r;P MX L ;P dX j8x$d P_o1<$ )ǍzZPWQRj?ǃ< 0\ d ǃh ǃl ǃt X ǃt X HX 8@ t ǃ` ǃ` ǃ` ǃ` wD 'с''D '='l'b!t L )L X )艃X u[VwSOL GHX ` H@ yy1@ J,>or?>΁w.98u% (;;P s) >;P D ҉L$t'='r 'H D$$PUan)H F( th 9tF F$FW( r R x  ^_[]19u뫐S[AQPR jSWV[ÜAt$8 t3 9t^t, z t7 9u ~t v1V(^[19uΐS[~@t$[ÐWVX]@L$ tsAQQBQQAA, tD 49u4 4~ v x  ^_19uSWV[ü?t$trT t/<t) z |$1l$|=|/j0fƃx hh@x@@@(@, t.9tRt# z l$ E)VPP f}T$$DUMft0uf1f9sf1Kt$$fums)̓fftg,$T$1f)f9t9Qf9r1ᐃft1f9sf1qf9sfq׋T$),$fs$\$ sl$fs1^_[]1ftYf9tljTYf9r1f4YTYf9r1ftYTYf9r1ftYTYf9r1럸ffffUSWV[;,t$nEtjPu7 EjVtE 1t u1@u{)vm1Ƀ V“t^_[]ÐUSWV([x+t$@l$<}GtjP7Q6 G ujUj0 81qujWjjjZ 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$Pw L$9jD$PD$P밾L$jPQUUu*t$t$w ;D$uTjD$PD$PˋL$O$t:jjj~Y!уtRPi u !1(^_[]fffffUSWV[Ë)|$ t$tGw#jP_džL$G|$$1D$@DA,Du!@Mu:O}GQWPUVF u^/|$$KQ;v RPt2MQUQRPd EG/1^_[]ffUSWV [X(|$(l$ E,D$jju<1 $1\$>\$LHQPu2 jt$u0 @ )HfOTH9t,y;l$$vًl$ $Yf_T$|$(<t\$M)1ɋ\$+Ps$tg;l$tY1<Eju6/ t%MLH<jP61 ;l$ur $1MED$$)fE ȃ ^_[]fffUSWVP[z&|$ L$T$iD}w QR jM $uJ t t})Ƌ $9u>EDEf $fDMftMftMfMB8D$H1^_[]Ë $LM))PRQ T$$ fL}1fD};<$L}D}ftfL}fD}ِUSWV\[h%t$pF D$=tD$jjt$|V襐D$4-jj$V耐L$4I H Q*f\$D$<@D$01D$t$D$T$$t$$D~ L$ ~)L$t$0D$ DF)D$D$ Ut$HPL D$ L$ f FD$L$)ȉD$.Qt$P L$ Af,FfɃًT$уfLFflF $T$$tz*9 $f|zz t$)ŋ\$UL$HQt$x x ;D$tT$$DzL$f+L$tH)ЉL$ *\$VPQW ~ff+D~t$frflrD$ $ $t$t$D$9|$1ɋt$4L$4yf $T$HCT$$D$,8觵뿐USWV[T$B =t $|$ t1|$,t*|$$|$(tMj<tuW"T$ D@aHf=tfWtfO1 ŋJDHjWPV&t`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPV{s+l$͉ $l$,t$0t$ED$9G u*D$G4$P L$,1TSGDHjWPVr t&dž(@f8u$dž  ^_[]ÐUSWV[&zA =tl$$G)B fT$L$D$ uf͋t Pm,$Uj號|$(todž(dž $FDGjRPVqtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$4R^_[]DGjt$ PVMq t׋@f8u$dž wSWV[ì|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[VT$$wA =tF)G D$ *$Ffu^L$t P藤4$jĝL$t$,t$,jWQPt$DFjWPQ ptjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $aPЃ^_[]ÐUSWV[l$0|$$D$jPj t{t$ ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-11-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/netbsd-11-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/netbsd-11-llvm/i386/20260404060856Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/netbsd-11-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndstrdupO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)destroydescribeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotestildeshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openUsage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/netbsd-11-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.File%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALLeq!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %spgrpbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20260404060856Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-11-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/netbsd-11-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260207%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldWriting to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.0_RC3 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC3 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC3 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC3 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC3 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.0_RC3 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC3 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.0_RC3xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlolo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemptemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtopbuf != NULLlen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initaddr != NULLsa_in6_init - %s /home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/netbsd-11-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist