'Vi0qkX{NetBSD/earmv7hf ramdisk 08ȝi<  ȝi:mt mtȝi@@<@T 08ȝi<  ȝi:mt mtȝi@@<@TU ȝimt`Aȝiȝiȝi$h ȝiȝiȝiAȝiȝiȝiNA.ȝiȝiȝi08@AȝiȝiȝiOAȝiȝiȝiGAȝiȝiȝiOAȝiȝiȝiAȝiȝiȝiAȝiȝiȝimD`#ȝiȝiȝi (08@HPX`hpx$[ȝiȝiȝi (08@HN$ȝiȝiȝiPX`hpxK$6ȝiȝiȝiM$3ȝiȝiȝi (FAȝiȝiȝiCȝiȝiȝiAȝiȝiȝiAȝiȝiȝi!ȝiȝiȝi aȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝiaȝiȝiȝi aȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝi!ȝiȝiȝi4!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi B!ȝiȝiȝi B!ȝiȝiȝi!ȝiȝiȝi"!ȝiȝiȝi"!ȝiȝiȝi"aȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝiaȝiȝiȝi aȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi?\!ȝiȝiȝi>\!ȝiȝiȝi=\!ȝiȝiȝi<\!ȝiȝiȝi;\!ȝiȝiȝi:\!ȝiȝiȝi9\!ȝiȝiȝi8\!ȝiȝiȝi?\!ȝiȝiȝi>\!ȝiȝiȝi=\!ȝiȝiȝi<\!ȝiȝiȝi;\!ȝiȝiȝi:\!ȝiȝiȝi9\!ȝiȝiȝi8\!ȝiȝiȝi:\!ȝiȝiȝi7\!ȝiȝiȝi6\!ȝiȝiȝi5\!ȝiȝiȝi4\!ȝiȝiȝi3\!ȝiȝiȝi2\!ȝiȝiȝi1\!ȝiȝiȝi0\!ȝiȝiȝi7\!ȝiȝiȝi6\!ȝiȝiȝi5\!ȝiȝiȝi4\!ȝiȝiȝi3\!ȝiȝiȝi2\!ȝiȝiȝi1\!ȝiȝiȝi0\!ȝiȝiȝi2\!ȝiȝiȝi/\!ȝiȝiȝi.\!ȝiȝiȝi-\!ȝiȝiȝi,\!ȝiȝiȝi+\!ȝiȝiȝi*\!ȝiȝiȝi)\!ȝiȝiȝi(\!ȝiȝiȝi/\!ȝiȝiȝi.\!ȝiȝiȝi-\!ȝiȝiȝi,\!ȝiȝiȝi+\!ȝiȝiȝi*\!ȝiȝiȝi)\!ȝiȝiȝi(\!ȝiȝiȝi*\!ȝiȝiȝi'\!ȝiȝiȝi&\!ȝiȝiȝi%\!ȝiȝiȝi$\!ȝiȝiȝi#\!ȝiȝiȝi"\!ȝiȝiȝi!\!ȝiȝiȝi \!ȝiȝiȝi'\!ȝiȝiȝi&\!ȝiȝiȝi%\!ȝiȝiȝi$\!ȝiȝiȝi#\!ȝiȝiȝi"\!ȝiȝiȝi!\!ȝiȝiȝi \!ȝiȝiȝi"\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi \!ȝiȝiȝi \!ȝiȝiȝi \!ȝiȝiȝi \!ȝiȝiȝi \!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi \!ȝiȝiȝi \!ȝiȝiȝi \!ȝiȝiȝi \!ȝiȝiȝi \!ȝiȝiȝi\!ȝiȝiȝi \!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi\!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi$!ȝiȝiȝi4!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi !ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝiaȝiȝiȝiaȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝiaȝiȝiȝi aȝiȝiȝiaȝiȝiȝi aȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝi?\aȝiȝiȝi>\aȝiȝiȝi=\aȝiȝiȝi<\aȝiȝiȝi;\aȝiȝiȝi:\aȝiȝiȝi9\aȝiȝiȝi8\aȝiȝiȝi?\aȝiȝiȝi>\aȝiȝiȝi=\aȝiȝiȝi<\aȝiȝiȝi;\aȝiȝiȝi:\aȝiȝiȝi9\aȝiȝiȝi8\aȝiȝiȝi:\aȝiȝiȝi7\aȝiȝiȝi6\aȝiȝiȝi5\aȝiȝiȝi4\aȝiȝiȝi3\aȝiȝiȝi2\aȝiȝiȝi1\aȝiȝiȝi0\aȝiȝiȝi7\aȝiȝiȝi6\aȝiȝiȝi5\aȝiȝiȝi4\aȝiȝiȝi3\aȝiȝiȝi2\aȝiȝiȝi1\aȝiȝiȝi0\aȝiȝiȝi2\aȝiȝiȝi/\aȝiȝiȝi.\aȝiȝiȝi-\aȝiȝiȝi,\aȝiȝiȝi+\aȝiȝiȝi*\aȝiȝiȝi)\aȝiȝiȝi(\aȝiȝiȝi/\aȝiȝiȝi.\aȝiȝiȝi-\aȝiȝiȝi,\aȝiȝiȝi+\aȝiȝiȝi*\aȝiȝiȝi)\aȝiȝiȝi(\aȝiȝiȝi*\aȝiȝiȝi'\aȝiȝiȝi&\aȝiȝiȝi%\aȝiȝiȝi$\aȝiȝiȝi#\aȝiȝiȝi"\aȝiȝiȝi!\aȝiȝiȝi \aȝiȝiȝi'\aȝiȝiȝi&\aȝiȝiȝi%\aȝiȝiȝi$\aȝiȝiȝi#\aȝiȝiȝi"\aȝiȝiȝi!\aȝiȝiȝi \aȝiȝiȝi"\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi \aȝiȝiȝi \aȝiȝiȝi \aȝiȝiȝi \aȝiȝiȝi \aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi \aȝiȝiȝi \aȝiȝiȝi \aȝiȝiȝi \aȝiȝiȝi \aȝiȝiȝi\aȝiȝiȝi \aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\aȝiȝiȝi\ !ȝiȝiȝii!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi aȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝi aȝiȝiȝiaȝiȝiȝi aȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝiaȝiȝiȝiaȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝi B!ȝiȝiȝi B!ȝiȝiȝi!ȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝiaȝiȝiȝi!ȝiȝiȝi!ȝiȝiȝiaȝiȝiȝi aȝiȝiȝiaȝiȝiȝi aȝiȝiȝiaȝiȝiȝiaȝiȝiȝiȝiȝiȝibpf!ȝiȝiȝi $ȝiȝiȝiH$ȝiȝiȝi.$>ȝiȝiȝiK$ȝiȝiȝiP$sȝiȝiȝiR$ȝiȝiȝiXAȝiȝiȝiZm ȝiȝiȝi`hW$ȝiȝiȝip[ $ȝiȝiȝixAȝiȝiȝiAȝiȝiȝiAȝiȝiȝiAȝiȝiȝiAȝiȝiȝiAȝiȝiȝiAȝiȝiȝiAȝiȝiȝiAȝiȝiȝiAȝiȝiȝiIG>e&B!!T?"=(*vI~yxbosQY"k4!-i8c=cR-uCٶ,DU]vc1ĵe~D=ormWmK\-oTwM)\#<(}*sEhz&ecsڔ { k7JMg>>/Ae. ]!N~mY9h5&pOHU`5^/8SJ9hKkU<QVcl0`z3Gm^x.P#կgm%6[G(=m))D f{RX/PiɮP@Xl` [YZ#QW&8hb4k$!x ImM:6I1-D f!Dw3TP GHVp;,z-~VEUky@I;2t>o/D"~Ex#dV|gYY"PIȊMmt . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@4#4 ("""\'\'wLL"\'\'Ptd#QtdNetBSDAPaX NetBSDearmv7hfA-MQ h10 }~P @Q  Q/R R{P, p`p`W*0/W:U d\P\`P`U*0/U: -J{&z&{&"'{&{&TZ&y&Z&Dz&Pp@-8@@4PPUp(P`0/G y&y&0H- @ P@P0/T0(tY&x&A-@TpP$`/RP@X "@P@SIP PQ (@,@ @0t0 A/A- (@@,@ @bX 㮇 "@` P@!@%GpPPU: ᎣP MP უP@H-O-M`PY @ ~㴄Dдp@(@(@(@@(@X b@Qx x x x x x x x x x x x ,(@(@BP/@ g(@ (@(@(@p<(@`P  P A {p8 a(@P @(@Q(@QQ(@Qk  p(@PU >@yHP *(@ @PU@PP2 p|(p@`(@P` `PPp Y P  X V @`@@@(@P(@P X( PO@ \@ X X* (@P8X@* (@P`pP @P` >XX^= (@PmTY- @ @-@ (@P^`pP @P` XX$Q`O$p`I`pP @P` !XXM ^pu `pP @P` X `XI^Il p`W^MdpY `pP @P` XX--RpG (@``P@`pPy P XX& 4p!(`pP @P` XX^^!p `YA`@?Qp Qp Q X` X  @ (@ @㹺(@ ` `@ W c|(p@`  @㟺(@`pPUMP(@9 @KЍ(@Qp(@OPWp(@U >@GP (@P @zpPvJ {po (  PzPwPʇPpUb %zppPZ(@vWpm Q@`V {PZ ` V MP p@㴠Q (@` yP@ yp=@Y yP@y (@ @(@OPU yp y @(@`PUhGyY@g`V V`@  @O-M`P"Y @l~Mp@ '@@  0 QPd@Q) 44444444KPP HP 8LP PP: RP /@   XP!<&( @0Aq@-T@P V PX P pRpP0p<(@ R&p[pZp@Q @@RX `P@ Jzp@ @@P @ `3P@P5PGPU6p`@ P2TllHHP 5pPba + @X)P 8 $ `O + @F`T XIZ XQ 9/P [  @㞸`n"@qH-A (@@0PO-OM@PY @0qo(@(@y(@(@`@(@(p@(@ ePH@ Q,`T,d(@(@(@oP fP6 iP9 lPF (@pP/ rP2 vP< (@aP.(@(@(@ (@(@(@(@(@(@(@ (@p<(@@DT )(@( @ RQ' ((@( @ QR Q (@Q(@Q @~@(@Q(@Qx(@x(@xpDm'`@Q$h= P@ v2BPQ/U P  A A Q Q/R p@aB(@PxxpeFP'T{ (@P (@P! (@(@ xp  P) T^p/U$ @ "  @ %xp  @  P (@(@p `V @ PAP:@ /R @ @R: A` @/R `V  W (@/O-M` Pp1P @3Pm  +'@P @p@P\p@pp@pp@bl  @` ZX 0` @@ P <\ @Q3pP-LPPZ, P/L@Pj @:CP 0,/QV/Q/P@ E0A P:^@V ᧶  P Pp/Q  PP(@P wwpP2 X 0`P!0#0`(%0#P @ޜXp  P  V6Z  U+ : S  @PÜX Z 0ZE0P0%V UW`@pdp@ppp<(@PF uD 9(0@`8(0@P5` PSM Sg 9 i(0@(`@ Rupc P  P) PS @z  5L(@P  P P LP  PPPpU  P(@P( @@ "P (@P LP )( @AQ, P(@P Xu @(ph2vPp(uDP2Ѝ%T!\1@ @0@6A%o!v1@ @0@?8  @Fn"@AOD @- M@0 `@ *` @*@P @O ЍO-M-MP (@P '@@iv UuPF   up<} Xp(@P (@P`(@P (@`V`Yk '@+tp8y , (p P@ p4` x 0<&p  Pu$` A (@8P '@(@`p@0GT# tP`P  0 A `$ @ 4 00@p  t@T`  @㩴 (@P L'@(@@ @]P@sr (@PP  '@@u+Ytp8p '@ @pt`xL 4<$(@(>tZP8 A $Yy@(@`0(P@'@(p@8 tZxpv P y0 A4  `00@ @  <(tP(p`,zVM`S (@ P@p P YP @'@V ?up H Q *up '@ <sP7 '@ @<- Y@0 @޳`(,p uPZ  @г(p`,H8P(@@P <P '@@㼳<sV sPЍЍP EPUPP PY  8sP '@ @㔳PP '@(PP(@P8@tP '@ @wP` Q(@8sPY@H-@P z=U00 sP` '@msP 3B`P '@@@`U ms` '@TsP '@@)` W" (@PpBU Ps '@Ysp A-PP '@@`U '@P`A-M@ `P#rp Um'`@ PtP @  @ rP  @Ѳۍ(@P Xap@-m@Q'`@ PsP @PrP @᫲p(@P p@;pp@-m@Q'`@ PsP @P" sP @ᅲp(@P p@pH-" (@@01O-MH`)@I)@V)@@) T㐎P@"@PW =p.PX `QV  0pPS S 2/`V #=@Q B B S@㯘  @ Q6 t#, @@Q@ !- ,@t@( )@Ѝ@ @ @  @ #@m@@g>H-M   @ 0=H)) @)) @ЍH-M  @ 0)8*) @ЍH-@zH-M  @ 00*) @ЍH-M  @ 0P'@Ѝ`H-M )@  * @ 0)) @Ѝ)@$/H-;@3H-M Q @ 0)) @ЍH-]@H-M )@  t @ 0H)) @ЍH)@$/H-@H-M  @ 0H)) @ЍH-M  @ 0()) @ЍH-@ I)@)@@P! AP R0PPPHY)P@aQ8 )@ H)) @/H- "@ @H- "@ @H- / @" @H- / @" @O- MP@Ym `@e p<(@@`GpȬ @&d )@P +P p )@P  ,y0뗺%Z P  ,j0pV D  @)@`Fꄊ)@pP P)@P(@0  0!@+h/P )@P)@[ 0t | )@@Ș`$T Q !44P`U7 $ `` n5 a1;U0\0 ";@%+![ *ar A  a1;U0\0 "; P@ $@+! *`r*a @0 `@r*b A `r ` B p[T U)@P)儊)@Q' P :PL| PpU:P T)@)@PT U)@P`)@`U (rqߍۍ@@@$@S@@@H- (@@"H-M@4P P|`^5P `PU FЍ@0H-@ )@P Q P 55P Q )@ )@ 0O-MM| )@P  0P (R @ nR $?.8LX P)@p0`P&0R @ @Xh @3B@L xP#|@ |0@ !!@Q  X)@t )@Q L J)@㐺)@@)@P P#  P4 # /@@R )@@  E P! '@C@@ @2 B'0@ 3 @ @, '@@ A9@ H)@Q '@ @ )@*) @@P2P'0@  B b0'`@ R0 0S P` Pz @ &l `)@P  9@0@90@ @  ` )@P  )@ @ @  0 @YU(@ TpRH TP0H )@Pg )@`Vk8[Dp@4 (@@"@rPЊ)@)@P  `jpE`)@? 0 "P JPHȚ)@`)@ ,O\0)@0 0 p  @  @ )@3喥 (@@ @"ޜ`3儥 (@@ @̜0H-H^@)P@0\0)@0  @ @0@-,)@) @ 0'@Q\.) @@ PڨT)@ * @DTP*P) @  Q @ QQ  AQ S, )@'iH-*) @P00S S P )@R !@H-t)@ )@?d@ @3%4[PP@P.Pz)p@P/P :)@@ F)@@ QP p mP@4`)@P d @,p @'S @M`dp@-J)@@P pZ`)P@`P `P9Jp!P`00 (@2"@ 0 @`"p$ )@P (@@ H)@`@ ;00 (@2"@  @nO-MP@mt.)@`) @ <)0@\)@pP H)@p@@pP)@)@)@P8 `T ` @P, P, )@X- VpPW(J@ `TY [Vt^)@)P@P" + T@  P-,)@*& ! t^@)@)P@(@a` p)@ 000T0PW pT` Q`ЍAO-MLl)@@)@)`@)@P PP@:Pu U4`3pZ  Z  "3 ሖPJ <)0@ Q `,)@`O Pt)@B  )@R R,P0p00SP )@`PP, )@VY  '/寠 (@@ؿ"@;P8,)@71 @Z+   )@ )@t.) @ QR P  @ .r (@@㛿= @ЍnA-@P!P4@`ᖿ`P  ;P6Jp!PJ.<0 (@2"@ dT @ Up$ )@P (@@ QHUPr.0 (@2"@ Bl @PO-Mp` )@P @W( W&\@)@cP) PWt)@P )@P P PJ@AP*`p P )@P  ЍH-|@P`)p@T Q @DPp.嬟 (@@վ @8O- MXn)`@@pp PW.@P' )@<)@W)0@!  W  ,PPy @)@PP , )@ @p Ѝ@ d% @@PJGZlGP)`@UI @)@P PBpZ Z)@ pṔPo `pP  `, )@@ )@ %U5 @P. lJ)`@ @PJxPPZ @N- (@@"@@)@P, )@Q} QpZ )@@Cl)`@)@ ZPQP QP% @+-廞 (@@"@GPL-婞 (@@ҽ"@5P:,)@@ -O-M\@@(P@)@)@)@pP p @:Tp`E`` R R,p000P; Qp,)@J D`t)@@ V< )@,2 @] @@`TX)@Ѝn, @A"@@P, )@ R O-M`@P @㔼|T(p@ '@[ `Q A` Ep Q? P@<Z= X!@\` A` \P @^RQ*p #QpQXX\X\h`V @ P <@@0@`p Q0A`0QXM8X X 3`p A`0Q&QX X X7`p QQ0A`0X X Xp%`p QQ0A`0X X Xp@TPu`P@`XX X ЍO- MA'PPr@o \<t4(@@)@P@(@`/p@)@ ѯoP p EP% SP( )@`xP! sP& pP AP! -P$)@P`` )@` @ 03$ )@`@P @ ',P@''h@'8 )@`P%[0 )@QP P $PP @[P @@jP @[ @3lq)`@P /@) @ΏQ @-XPPJ @)@P P3D)@PJ+ P0JP H)@pP$8~)p@PN $ )@PI @e[ @PP. P` @`Pu u6 u( @D[P8P)@P @6[ @PP <)@? @)0@A# "@5ᶸP) P<)@? @)0@"pP !PD  4 )@!=/@) @OH-M,@)@0 h D\P JP#@"'@#% P#@"'@#%ЍH-)@Q,@)@0  H-)@Q,@)@0  0H-P )@@P !P j @'P /P I@@0A-L^HPnTN)P@)@)`@)@@PJX~)p@ 0 0 ;R,R ;Qp R R  QpO-MXN)@@(@ 00@ P  00@ R @p=0G=SG`@\H\<<ȑ\t̒8LX8\<\|D)@P; @0 W$ !WZL)@P PP%J` QpR nR lR   `L)@Q 0l0CS  QP`\)@PPJG@okPJVW`GW`PpQ nQ lQ`@`pQ nQ lQ`L)@QD`pQ nQ lQ`L)@Q.`pQ nQ lQ``pQ nQ lQ^`H~)p@kPPzJ`PpQ nQ lQ`H~)p@PPP_J`PpQ nQ lQ`8.) @ R $,P) @ RA L.) @ R@ PP3 p`PpQ nQ lQ`L.) @ R@ mPP !P @L)@Q`pQ nQ lQ`P^)P@Q  ` pR nR lRE   `H)@PPJ`PpQ nQ lQ9`P)@P P` pR nR lR4   `H)@PPJ PpQ nQ lQ" H)@xPPJP~T)p@)@`P~JL)@P  XJ\)@P V X``PpQ nQ lQ`H)@BPPQJ PpQ nQ lQ H)@'PP6J PpQ nQ lQ @ L)@P\P)@)@kPP p`PpQ nQ lQ1`lh~P)@)p@`0 A R*& P7P&"Px ` QoQ Q gQ`pQ rQ``H)@PPJPnT)`@)@pPJL)@P= XFJ\)@PA`pPpQ nQ lQ`L)@Q`pQ nQ lQ`L)@QY @pHT)@)@ VPPeJ1@Pc& ᥗb'`@PU&"P. @ H` @$l @= P6L\)@P.)@) @Q "@D P#D)@PP)@uPP \L)@)@b PeZ HT)@)@ PPJP )@` P$ 8)@)@`qW`P`Q` !@d)@Qn xP PD)@PP)@T)@PJ9P PD)@PP)@T)@PJ\ )@0RQ PD)@PiA P PD)@P[P)@T)@P X  QuP PgP P P`P P PYP )@T)@" PpQ nQ lQ P P:P'@)@\>)0@0SB`P P'VGGGoogPPQ" P )@q. P 4 /@")@' @0 Q S   P)@P (@/@) @ε PPJP 0l0CS  P @P PD)@P4L)@@Q oPP)@p;PJ \)@P8)@T)@P)@PpQ nQ lQ`P P4L)@@Q  oP.P) @ 0T.) @4  @@WWPwJP8)@ @d @g. @b !@X QY ^Q QKpNP)@@ C⪢$ )@P^!@7P P5\)@IP8J 1P4JP7JP!P 4 )@ 4P)@ R P@pPJ '@8)@@'@P PD)@P  P @\[)P@ FP d.) @Y P d)@d.) @`)@P, )@n[ hl)@)@" PJD)@ RZ  " QpR nR lR   H)@PPJ`PpQ nQ lQ`P PPY d )@ Y!P  No oRQQPPh, )@ka _$8.)@) @qY QR`h @EP P?D)@P ` PpR nR lR   `!P  o oR]Q[ @P P P 4  )@4 )@A!B @JV B @DPЍ`PK-P" P\)@P3`0P Hp)@@P  0PP JpPW@ !@@O-MXNԣ)@@(@ H~)p@P@ Y  @ Y A\)@ I6Ru0瘩,L,PPvk" ᮓPPg`""PcinL>)0@;Y P.) @PPR.YPGI/Io[PHJPY7^YC 0 @ S @%^Y-YP" Z`P ""P f^Y`-Y`P ]PP JJ !@. @/PЍP U!@JQPO-MY7 H\)@P)@pU W!ppWpW  `P @t)@P  0  0؟P pW.@ЍH-(@a@)@HO-MHnD|X)`@@)@)p@)@P PPA  Q PMJD @)@PQ Q=P.Q& P# PT  @P U8)@P, )@  Q P,)@ ЍP(@ ` H-L.) @ R P)@T)@P.) @T.) @PP\)@ Qث !@6O-M)@`  v P% \)@P$@Ip PD)@P (H)@ @8)@P pRP, )@ЍeA-MX^)P@ R|nx)`@)@ QG|L)p@  ŇP_ Q@7,)@p0 j(@ @  00@ R R @@0s@P) !Q)P JpN)@@ ?@ 0 S0 0pp pp 0p WP@P@Ѝ P7@q/ ב (@@"@c@P, )@ K-o@)`@p W )@)@\2P$ QP,)@50./OW G)@ 0\S00S@ Q   (@@㨰"@ P,)@qO- M@\)@`P@ P6 㐞)@)@PP p)@@Q Q@  Pq .) @Q@,)@  ,` P`)@@Qڐ~\ Q)p@)P@@  叆PR  )@@R ,)@l f)@ @KPNJH^D)P@L)@)@@P  P 8)@ P 4 /P+# (@@"@LP宐 (@@ׯ"@:P, )@  Ѝ, )@ H-#( @ a@.aA) @1S)@000O-M\~TP)p@)@)@@ )@`PBP0`UP00p`@7 -P P $P P P` P1)`Pp`QPp B@DH)@)@@Q 8)@ P ,)@ЍDH-0)@Qe\~,,)p@) @0@`S, x4@@ up$ʧ @P PP` UP @ZP/Q/e .Fh04p@@ N)H-0)@Q ,@)@0 8 )@}O-MT~P)p@-@P)@`0pHV)@0Qp0  BPQCS|0F8P)p@)@P% `U ` CPP P,)@@HX@Q P,)@Ѝ?O-M( )@)@   I@@g {X@)@P^ p)@`〾)@Q)@  Q  "`ᆄP .) @Q`,)@AB!P !Q" Q %QU YA Y `]P .) @Q`.,)@' W_ @U U`=P .) @Q`,)@ PP \R  P4 )@Q p)@`QD  Q ,`Pv .) @Q`1,)@* pN)@@QQ ~)p@ R( R `ӃPN .) @Q`, (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx)@  A Q P A Q   P 0 Q:p/N)@@UpN)@@L p)@ U  "`ፃP Q`/ pN)@@5N (@@"@P, @: (@@ "@nP, )@" ",)@pN)@@ )@P!@oBЍ @ @@-@/P 0嘍 (@@"@$@-)@ R >)0@AT B R@Q:H-P  q\Ro MH-M  0)@' 0墫ЍH Ѝ/H-X.) @ P P @@G00 QQ )0@P8)@")@\P)@J 0PCpa@FT:V, V<!0 0 10`'0CaP`!` ` a!P@ !`PP` p`! 0 1p0``Sqp'q0 /P0 1 0C @P`p` 0Cp D)@P 1H.) @P  \.) @,)@ЍHO-M`@P/P`"@PY-  @ኙp<(@EQ_Fpnhplt`@)p@)@)@ kePrPf@Pb@@|)@KPLP PPMsP vP wPEx)@FPp)@x)@p)@)@)@p$0)@= <(@)0@R-RE h ) @ R Rp0xp)p@ )0@ aP P P @ " !@ E|)@@Q FP  P FP  PPP `P PP΢  @ [H-+ (@R@0:ỢO-uMM‐)@P`P U7  +  QP " P! @07 P;9?l )@x+@ @Q  2/P   P#  @4puߍڍhFP   P |)@P MFP   P PP,x)@P' /P 7FP @@+ P " @0! @ӣFP @ FP`P p)@PVz t)@PVH P( D0 YP /P @@/PppHP D [G X Tj  @F  el)@c 0Pc DPJp)@P\)@ 0 G@㿣S|(p@X밀,@ @P@` (@g` P@Xp P YPh)@P   PD{EPz 9 @ 0p .NNjEPZW  .YEPI 8-<="#A H-L="#9 @ j\\\ \H-XX0Dd T  V H H0S \\HH-XX0Dd T  V H H0S \ \HgH-XX0Cc T  V 8 80S \\HMH-XX0Cc T  V 8 80S \ \H2H-XX0Ee T  V X X0S \\HH-XX0Ee T  V X X0S \ \Hp@-X X`p@tPp`t0 T  V  p\\p@p@-X X`p@tPp`t0 T  V  p\ \p@O- MP@ᛵY @`됐P)@ h Dp|DPP$'@p)@)@`qCP㜠 `)@p`@ I1@GQ>8@LX|4$D(T,P)@)@)@)@)@ )@ )@)@)@)@p)@)@|)@)@)@)@)@)@@ph)@)@)@)@)@)@~)@ pJ )@q)@)@ ?)@)@`)@])@)@')@ )@ )@)@)@)@)@)@ )@ )@)@)@)@)@)@)@)@)@)@ )@ )@)@)@)@)@)@ )@ )@)@p<)@(@ ) @)@PP  @P 5$'@P㈰)@ )@) @`q1 )@)0@V`)@)@`R 0)@) @`S` Y` ``^`RQ X)@v)@/Y)@Q pP P P6\ @0pP P P, @&|@#)@P @p@)@P `@)@@ @)@@ 4@R)@E)@Q `@)@Q `@)@Q @+)@ @0l@S!P) @ ,'@ )@ ЍH-霸 (@0@㬠-O-Mp)@@% @P P P`)@P ЍOV)@pPbP\ +A㌠p@ @@)@@PK@$$$$ 5 -g8LP \.P)@P* )@P )@P m@㻟 \ gP n@㯟 )@J)@PX  t3pPF@B@@PЍn"@($ 5S \ S \ \  S / S ) @ RL R !) @ / S \ O-MQ P)P@)@`pL)@PL @(P$8<4T HD@0, ` PP $v +\ @mfp)@pV \.P )@P)@Pp0PPLPP X`40@Ppt Xp   R0RD 40R03PP @Px0P|,pD  U  RH pP,pS0P H * ) R ( R4 S"60 S 80P< p0 80Q< l )@P gP0( " @JPP )@P [ 0( " @7 P  (Y ( p$W$)@P >@& P `HqP ppJE)@P P :vP)P@p `TT@TTQ PLP㈠ `8)`@<P ,0)@ 0B?B s@~"  @㾝g )@Q V%@U%EQ$s@:# @D@ᡝJ H0(" @㘝A Q @s@~" 4 @凝0 @)@@P VDUEP@@( P [ sp @ 0j ` 0a QڴD@P)@1/ )@ Q  EvZЍ/H-PUl@(`@ p   $`P@`XXpX }PUH-MPXp`)@P  s@[@@)@P. )@P p  Y @2pH j  @=x)@ 0B?\ )@0s@Q@ %@)@)@ e )@P q@)@Q @Ѝ)@P  Q z@O-4MM@} 1) @)0@ RD PU9 3p2`(@ ) X)@P $ s@ɜ)@P1 x)@Q Y- @   ; $㞵p j @ ᩜ)@ 0B? )@s`0`@P@  `0( @ 凜)@P 0@}  @x)@P  @n   P(8 40 &  P$@Z`p)@Q Y @` 2p ,j @ =)@P 0)@P@P)@)@ o )@P {)@P )@P  Q  PJLP " ! @0\+ \0 @㟛 +<p @)@)@ " 5}0 @_)@P  )@s``@,P@c  @㹛`P@`XX X 㺜PU4Ѝۍz@C0H-MLQ  )@) @  )@Q  0YM  0;$ @@@mp @yЍ0 ) @@0 ) @ P S@@@@B?Z 0Ѝ0H^z@H-M XPPP@LP`p(@@V`Q A` p Q P X X pGwXF)@P P`U`Q A` p Q P X X `F vUX)/p/O)@!` @0 p P \ P`U`Q A` p Q P X X `Fv*X`pP @P` XX X P``Q A` p Q P X X `VX֛`pP @P` XX X śЍ0H-@)@P ]Pa !@YPP\T00H-@)@P uPa !@qPP\l0)@Q \  !@゚\ @~H-q! Q   \          (@`p Q0AQ`0NX X @GI (@`p Q0AQ`0@X X *6 (@`p Q0AQ`05X X =( (@`p Q0AQ`0*X X % (@`p Q0AQ`0X X | (@`p Q0AQ`0X X /X@ X* X=X%X|X/O- MpP)@P$P)@P )@P,P)@@)@`>$R'P@`Q ЍOF4B'@@pq)p@Q pPt   @Q  ! "     QGP`BpV`Pp;WEP(@ V*)@)@0P,$ XP@E`pP @P` XXX y@T@Z`P@`XX X eP ЍzptO-M@P)@P$P)@P )@P,P)@`)@p$'@`VЍOp\(P@W9 ` / [`P@`XX X $)@P,  PJ`pP @P` XX`X YpW`P@`XX ЍX ЍOיO-M@)@؀)@P$`)@`P P,`P)@|(p@P`UH $,'@ = [2`pP @P` XXX,㝙`00@`0 0 QPpP XX P XX X ~X z$P,  PU`P@`XX ЍX ЍO\p@-@)@`P R&kP  V Po@ @0pp@@ O-CMPu@30@T4∠pD  0 wp `p V wP?P ?`  P((@W:PU:? Cߍp@- M@ ` vPp TR BQP  (@X0 XT wP ЍpO-M@`תY @"x8NP!@/@ P ᠋mP XP pP>ppPp<(@ATe @a p!@ n9p UJ:t8pE @*x>`` $% M` % [ pH9p [ U:L8p p19P Jp  P[ /ppp  @w`@T)H-錯 (@ @㜗O-MMP@1Y @{w3a$ `@)@p)@ hPfP hP)@ vP iP:  ()@pp.<(@PEU(A,)@@m)@PE8P  P `$< P !8@JU=NḔP Z/P / `pp/QP pp/ PPP  Q:8@]` P`X@~H- (@X@0q0)@/O-M-MP )@@P98P "7Ps P 8E8P 8`?8PM @Z@ vg$)@P8Pd Z@X@  PMo7L,)@P 7P 88P7P)@cT2`pX_"1 Y @!0@ Vd0 (@ @pv0@  P  6p$@ ~6p G48q)@)p@XF L7P @v`` (@@ Dl(`@P@p (@ipw W  AQ X Pp `YPD  @Tv$글nhP $ 6P;p 㵋(@` 5P[0`)@P  a0 A pማ Ѐ Y0 A0)@ @ 0 @  ӕ p$5Px.$ p@u$580 `@*` @*@ 6P @uTX 6P" P @u@@P  @u6P @u@u@$5 51@ 5P @u 5P -P @u 5P  @6P @(`)@P@@ ǔЍЍ Y@0H-MP@K6P=  p  @@\ @@nuP$R #@@[Ѝ0)6P7  xp  L@@L@@P$R #L@@( )@0AP!@ @@@ D@m;!0@  @*u6 T"@LBD@@@ @M-@M8r@'p@p 5@)@〆D)@'@H)@LQPa*)P@)`@) @Pm""0#`##T5 !4p5" @0)9,T2 !4p;@T. !4pBʳ" @0 97T'@TM)@'@T<)@'@pX)@Q" TD)@'@TD)@'@" @08pX)@Q  P Jp)@Q Np `A)@@5p  P  P%  PKT)@@ @L8 MT)@"0 @@8I4@ 8D5PЧ`V T'@ )@)@`'@nQ?&%%h'%V# )@PU S 0ppP Чp `VE:VE@1*}:0@P 0!QP)@~\V0P% \ V  )@PU ?  F ~\  0> \U [ V)@P~\ ~\)@PT'@`'@P@ЍyH-M pP`@z4p/ڊXp'@.P Vpe433V [4k`@T4k`@O433 0p Ѝf@[u@V@QK-M8r'p@phn)@)`@P)@- P*)@P 8)@P @   D)@ )@H)@ ㉓8N)@)@@ 7@:LQ)P@P`A)@@4P   PT)@P4XB'@'@@P \)@P P22P # P 8Ng)@@@2)@ DH)@)@0P SPR" 0~ )p@ P\'@     ^8N)P@)@@Q P @   )@* P )@n@GP -)@) @ p 0+0 0s@aP )@PЍO-MMF"P"'@@`r)@ 0)@ Zp00 (@㰠VXW P M`)@@+ @J@0 !~ @+ @0;$*p @7Uf)`@Q 㠐+ @ '0F"nF* @ 1P @)@0` ( ~ @+ @0\*p @"08*}) @)p@@k \2`@'0@    )@  p0 U!n @+ @0ΐHm* @ "`0U "Ng 1+)@"> @ ᎑ߍڍA-~MP)@PTR'P@P 8b @'`@~,1P~܍0H-M)@@P)@P8R 'P@0@UQJ 0p|# @5@Ѝ0H-P)@P@d5@)@Q)@@0 )@ S5H-@P`p 91Pp@DPTWH-@P`p 1Pp@DPTWp@-TR'P@@T9 P)@`8'@1@VT D)@)@ 00T" @ @)@TD)@t@\1'@@ @4\'@$0 @P5pO-MT'@@T8'@`pP  0P@pPE`UW@T D)@@)@P)@Q)P@@Q *tCʼ PR@@4@sP4TP  0tQ*J P0PZ#P P P tʋP P@@EP@@T JT @D)@PT|@a4&T t0)@Q XQ @\1'@@ @G4 @F\'@$0 @4ЍG-M@)@P_T'@PZ '@P<@OD)@PH!0) @0P!) @`V!*8`)@'@Pp 0pQJUpV` oR` 0u U0QZP Pk@ 8'@ HG1PJ@@3ЍO-MpPPPPCT'@PU>PP)@@P7:8@'@` 0PQJ`)@p 0t8`Qo'@``r`pP  0Pf0 S P  P% @3PPЍO-MMT'@`VJPP)@P PyU@c3pV 8B `'@@p~,G/Pp8'@Mᎎ@H/`H`0pm/H`0p~ ~,#/P} `@~,/Ppd/H`H`0pGW`  taQH/Hx0pp p)@`@US  0B$4! UM @U8b'`@ 0q& P 0s\ '@0P [@o`p'* @``pq& @* @ .& @* @+ @3p`pߍۍ H 0pʟ&0 @9+0 @2O-MM )@a.pʇ& @2  T.pz' @2@)@P)@P)@P Ѝۍo)`@P)@.@2TD)@'@PP <'@P P)@pWWWP @62\'@> @b2밮\ )@@\2 @Y2l2P6J\YijL㯙йp@P@`@ @@@@.P& P  P  P  12.2,2?2PZPZ @2T@'@n\"^' @ @@W 2@@W2''@ @  @Q1밎)@@1?@1g@1@11P9J?HgXxT`@@@@P@p@)@.P) P QrPYP SP ?yPp7@sP3 1 11111PZT@'@@!) @@1)@B)@@P feT!P)@) @ @@1#T@'@@@@-@'@p'pH-)@P )@)@0+ @1H-*.p H"+ @{1@-@-p+ @0m1@p@-MPW.@p@PP NPP  P P ` :.p   P `@ЍpO-M@PsJ0n)`@H0/PlJ 0/PgJ@l PUv (@)p@̄㸔X @Q @0`3/P= 0P*4P3J%f"P!P*JP%J/P PP8 Y 0 (@@  0PP P (0/)@ E, SЍh, @0O-MhB'@'@@P J\'@L B 0SPp\PfJ)@pL  PpWPH \PEJZ'@PN d@&0  `'@PJH  2/sp'p@*PJH  2/pPJZ'@P" d@/Vp pF  A@/ LA 0)@ )@T ЍO- M0)@)@p`pPJ @P,0N)@@$ )@2/P F R j80)`@ 3/P @ PG W'@PB 6@/ i@`p[ P P pW'@P @/ bp P@u/ Ѝ@R <)@1/P )@@Z/O-M`P=J0)@H0/P6J 0/P1J6'P.Jik@t )@PP '@+P 8- @/P)@P $PJ@IP (0/)@ `*K'Ѝfp)`@̄㸴@P  @Q @0`3/P 0@[PJ P   0@`P T)@P -,P pd)@)@&  ,P!dp)@)@QPP ` ` Rp RP~JPyJ # 00 @/P P@1 R)@)@& +P!)@P)@QP ` ` Rp Rjh)@P 8P)@ 0=)@PP )@Q '@P P@@Q:P P   @P3 @)@P @pJ @03/0)@P@ 0h)@P)@PH 8)@P @ 9 7  0\t`"h)@P)@P 8)@P @ 2 .8)@  0 @39" @0)@S 0@PP '@p )@G-AMp)@@/P P`PYP )@p )@/P <- @0p-PP/P PW(- @0-AލO-M0n@)`@PPeJUUZH0/P]J 0/PXJd)@P "PPJ Y p#PIJh)@)@^)P@ C)@@ 8)@;P4 (0/P`!P&J)@N)@@P 8)@g@9@P)@ (@ 0@@,ЍV㸄)P@P  0pNP P P !PJY #PZO-M0p)@ Z P2J `P/J,0/P*J0hP)@P Y"PJf)`@ P W 40/)@ `]($`)@P $ `ЍdNP)@@3P[PJPT PP o!PJK_ Z x PJ P a.  ?(p )Pap@/P LP   T ʠ)@P  p  @P,0 @v, _ P ~h@)@PP 8P)@ 0X)@)@1/pkP h)@P)@P4 8)@P @ & " D03/ p~ h)@P)@P 8)@P @   )@ ^  )@WJ P P J P PJ pP F )@@8   )@1 H-d)@P N P JP J0)@H0/PJHO-MM~`)p@, , P q@`M+Ѝۍ@ /PPU/P /P@(p&   P+<`PJg PJ#PJP)@P PJf)`@i P )@ `&E#9 ,0 @`h+ @dd@P  p@)@ᰬP*p)@  /PP @*0(PA  PJPJ M P  pڌ)@)@ (Pb h)@P 8)@ )@*X) @)@Q p)@QP.P4` 4P(T@Q:P PF j&p 6uppڰ pp _oX,` R p Rv)@P)@Q4P:` :=,0 @*hph)@P_ )@PZ 8)@P @   r)@E` RV p R4L |,  h0H-L )@@\ )@)P@ R0)@ ~ Rڴ@~< @<)0`'@)@ T)@ p,PJ)@ =)0@  -) @0@-,'@) @  L)@)@@Q R ~ R@~< D@<)T)@pPJ )@0 )@-) @ -) @`~'@, )@) @ )@/O-MP<)@P r@S)@Ѝ )@`r )@`'p@R@PJ )@)@pA`? X P0P0 RpPPCJ<PU)0@ U`p'@Q P. P:`'@ @}PJ`'@  -) @ Р)@000ZMPSS'@S@SU@(G-db@'`@PE '@P@(;}p)p@1P3J`'@)@P P@ RUPpP(PJPPPjP m)`@ 0)@@  = )0@@:M-M@ @@L })p@)@ @00C`So``V``  /PP`5 )@ ?U P'J-) @РPU`U @APPJ  0P000S00PU `u @Ѝ@K-)@Q `b\'`@)P@P m)@p )`@pm )`@0pp 0M)@)@@pPJP mpppP<)@0H- M)@)@@P0)@PEF`P'@0HO-M@ )@`)@'@ P  Pe@'.pd )@-pQ) @a`T` )@`pPU U- PCJ p)@-W) @?TP`D,) @pV2  )@1 -) @`V!,) @@D` 0 -)@) @Q YQ <)@Ѝ )@pO-M`Q! )@)@p`P'@@HT]PJp@T@ pPE`UpЍO-MQ )@)@`P@pKWpP`Wp `@DPT`pЍHPpO-MPP$ )@)@`@pKW`'@PJ`pWPp;PU`Ou`ЍO-OM`PpF o|2F)@P $pʭ"0 @'X }M)p@`b)@@'`@ @RP-J R z"PXx #pH L0"# b@k&p A@c&d0 0 @&\"0 @&OߍO-M@`pQD J#P ; 0 @&ꘐYZPPP崐1 P)@` )@ @RP) 0 R Pڠ.) @ R  0` BRPZz``W J R PnX ```)@P 8P  @%ЍO-]MPpp4 50pE,8 @k|2E)@㌄`P 8#pʧ"0 @%`4`D`E#P   @0%P[ө (L$`)@@'@  `Plh!P&`P0$ R( ,[? 4u4 P`'@ E!`P Pp .@)("px |0" P#`$ >@@ P 0%%`',! @0~%` P   @ P0Pq%`@0$Q(, p!R P4p`]ߍG-`@P   /R (Mp)@@PY @$QQ  G pSP+ ,)@QAP" @0奻pp3ʔ)@@pP$( *PJ 0勻pp! @0$8)@0" @$PPXPpFO-M@//Q/DP@ p` P`!P/4pP+\p6 )@P   !p!P G 09/ pP  !Q  PЍ/p@-Q$J@`P, p"UP" @0x$Pp[!pB"0 @k$ X, )@pG-MQjJ`P@T@p" @0M$)@P $( QP)@Q P  pQ84)@t)@PG E pI'@'@ P`p pHP p ʦS" @0# W,)@ЍH-`p@!PP P 8)@# @0#P@-@P8)@m# @0@#H-M@`Q0 `3fV'`@'P@PP*  P H|# @0# Q 8 =b0A0R``pBQ H =b0A@R BP NPP p# @0i#Ѝ/H-M@(* R $ PRP ` V  P A p   Pj@ " 0ЍA-MpP@$ P P-  `6P X#$ @0@#T)@Q "#!"#@ "Ѝ  P " !@:P /ppX$ @0Q/ 0 0H-M@P QJT)@Q   `' &0 0`' &@ @"ЍO-MMP(P!08@P#`E($pEE ,( $p@P}~~~~)@@P x)@P C^P8  P Y% L#p; CHP8p P p,j,j (P% T T lP Ze)@P 5pl@"$ @0")@P  P" @ 0!8N)@@Q P l< P;Q$l匆㈖'@P'@D)@n@)P< p0PP,P. (#@@ a!@5Cpl? 8Q?"0P8 OI#$0 @!0 .@ l@ @ o`@ $Ѝۍp@-M` @xPPJT)@P PЍp  P" !@P pVP aSP@ Gp8)@BRP@ 0R!PO- MPRa 0PpP4W@@@P `T V RQP z z)@)@ )@)@P R  hP (ZJ?  rqP!N`P  f`0PpWPE@} $ @{# @80 Ѝp@-MPR ` 0@5Q J0)@ ,p TP@4TP@V 0 PЍp0H-M@PJPL`)@P `$P  @0 Ѝ0O-M Mq` V k# PPp@@ PP  P`8`9@Pp*$ ap`HL  # ` 0`q8P K@"0 @ ` @$0 @+ `Ѝ ۍ@-xt.)@) @ Q<R.)@) @ R@@ )@P MDP)@ @P J`)@P P@C@@O-M\M)@@P 1X)@@LD s<P)@(@@)@'p@\)@)@Q P Q5`Pop PV P` qP V  `C\P)@ `Ѝp@-P@P@$p `[MP P@P/Q@)@ f0@S  L)@ PPp.@L-P) @PpP)@Q  \)@QT )@ |)@QL)@Q P/X )@Q \  )@/H-`)@P @ )@pWUEn(@P@@`@Q P zpWO-M-HM@T )@\)@Q PPJPP P( p0XPU `)@$0 P@,4dP @ P܌p$  -PUZV @TN4 ϊX   @ QD0 +,,pN@  0% @$%  @0'`)@P" X` P8@0 Pp8 <0 @DP"P $% @gPX  P8焎000000$& , #0 `)@P  `Р  C $ 0 0 , ,(@ )@n@_PPP )@HЍЍK-hMPh)@@P1 (``pTDf Q̹p>Y P @0Wp  @  Sy<PH@ 6P$0  @AyhЍK| #@8y 0 !@2y<@Q** @PB @!y Y@ZhЍA-8MP@0400 g0!4 @p`PYP6v&0@ @ @0dP8Ѝp@-XM@` P0`8e\0D2@ 8XЍpp@-MP@PkP Q `P0 :QЍpЍp@H-Q \ 000SQR P* /00B Q:AB60Q:aBV0Q\ P * 0Q0A\A|*:H-A0\ Q: W \03#€A#2\ Q :A1^0Q:0AQ*H/@-Q0E\ 000SQR% PH* 00@C TB"/ A@CTB"@ a@CT1B"`   \& P"* 0@0T00C!\@? S 0! S@" P$: H-00C\ S: W \03!€C!\ S :C^S:0CS*@-l@)@Q@@;@H-P` )@@t/p@`Q` dm)`@` S! H\h`U?`-V,d)@``````V vP:V (@ @Hjd}`)p@`:P<(@Q ! <`(@`  (@@0aw?`/p@-lm)`@Pp0X)@@ nP X(@@P@0 >wP)@@PQYO-dM/~P)p@f`@x8\^P)@)P@ 4)@`jzc Pp@'`@@  0B0@JQPԝ<<T<<<<<<<<<<<<<<T<<<<$0<<<<<<<<<<<<8<<@<0$̛<ԛlHԜ<h[P<<\<<<<<|<ȟ<<<<l/@<'@pPc}\)@x'@P @'@pPHbT)@]/@P)@7ڀQX )@!@K@X)@Ed'@@)@;/@'@pP&' @*)@%'@6l)@4)@'@'@lLP  /@0p)@t)@P)@'@'@'@'@T)@h $)@/ @p= )0@ x)@Xh)@ @/@pʬ'@P*/@-QQK T)@ )@P)@'@)@'@X )@@h)@'@Pt )@P/@P hL)@P)@})@Py'@u)@)@lT)@ e'@pC 0 <0#(@ 8>X (@ )0@  R Q[q qR)@h'@L  !p )@0.) @Pv -qG @`xp@@3  '0@e /PT0BJP\                X ܤp    ((XЦ   @l إ0      0( `  `Hh x H8 @ '@ BP 眢̢  ܢ)@RFX/@)@'@Xh)@ @|d)@ivX)@`pH)@`jX )@@dP)@ `^>/@~FV)0@)p@'@@'P@ lRmR oR pROaR eR&' @h,/@X p1c$T/@)@`kh)@i/@ -) @ p*,gp)@f`h/@'@  @ L0q0P)@ h)@l)@g/@p^ @fP %dx'@pp@)@b)@a/@ pex)@dL)@`X )@!@)@/@) pbt)@e/@ `)@Px)@c)@@|lxl/@Opq{)@aj/@pojbT)@@`\`)@jVR[k P@d'@xp@IrRB  P P 8(@)@X.0'@0'L Q P)@kh`@)@p[ PK@T*@ @T @P" P P P p-) @p p  )@ p pGp@Tv p pp)@>p@PP @ * @ s@P4 PP PA  P KYW U p @ PWU J⎊p JPP p  pʝWU J>@P(@ ᥜp)@ PQ  @Pjp)@e '@'D" @ @Q Q-'@0 H0-'@0 HB 0'@O". @0  #Qh0'@)@LP$:@Q:P7<(@ PJ)@ 7p7 @`P * @qPPf\(P@P. k{@`@p@ DP  2P XpC@P y@T5EPZ/> @P > pP} @$P .pqd'@ TA)@@PPP 2 @?PP7 @dЍ>@ :7K-af @!`@PPypp af /!`@W ;Pdp p;( @0nl)@P  /H- (@@Yn@- (@@B  @0 @ 0 @ 0 @ 0:nA-M `Pd Pp0 WA L: RI 0lS bS kS(k5xP;mS wS(o1xP.`k4xP# (f:xP  0S xS *SP(P6 0R!0 PЍG-PQ@nP) lM)@)@@PP" ,$`P=P p BP 0 S00PV@ @@34HG-P)@(@ @$@pU H @ @p5 oo oVUP@ڰ  Gdpp@-MPP P@P PPP.BP PE`  )@`P)@`ЍpK-MP@P@e`p\Q QY QppAPj  6QP ` ;Zfv@ 0 G<`\P P+ P``P" PP)P6 P fQOQPQ SQ 0gQ sQ pQ*  GQP> oG'@ gۍQ)@ R )@ # TGE@} MG@ .) @A-PP@6p@PkAP `pp$ 0)@( )@PR ``@``H-$)@pW@n(@P@@`@ P npWH-$.P) @Q# 4p@T \n0)`@`V L>)0@0S Q Q Q FPP0S M@P0SPP `P/`T @/Q @0@PP/H-$.@) @p`W P 00 /PP pWH)@oH\)@)@oQ`Hp)@P aPCSUSK-P`>Q&?Q) [QS.QK  !R`!Bo  @`P? ]P# p-W pW]W Wpp#P @P *QSSP Q! QP R`*P P P  0P QP P L)@Q /PPG-MM@'@PP `p.W.P{ 2@/PyW Q@@QP.QP.QP/Pf )@P U` PP^ P P2 P ` PLP)@P| )@@o@@@PP0Jj㽐ap @@@`@ \P  P!:@@E  PZ P/Pg@ JPЍۍ.P PY@pP P@g` p,WZPi@U P 2. ,:4)@pW7 P/P`P  Ѿ@p.W ;@PpW P /PP ` P  ᫾ @ P.WP;@P~O-MM@&p)@`P,X  @'@P(P`'` [h 0YPa V3Q V* V3W V1: Vs P5 &Q \Q 1BQ0B P@Q UQSJ@PT IP.  (XQ \R\&R Z:Jp '@` V Bp, P ZX  @& Ѝۍ V*' Q pP P   '0@ V ` P' P  ',' P (@('0@ k (@@ kp@-@P` 0PJQp  0pp0H-P@P/TN@N Tڻ@ 0@ U:UNAQ:0Q0N0A-@MP@ ~ 8(@)@10 P<8400 0 P<8400 0 P<8400 0 P<8400 @D.) @@0 )@0 0 b @ @,0<~p)p@P  PJ pP  PJ pP  PJ pP  PsJ pP  PdJ P\J }pVڳPYJ'@P " !@ p'@SP'@P p@  @P@P4K@@fPP PE/Q <`@)@V`'  U `D.@) @/@)@J`@@P h3"" @@Ѝ]@~7" @ X)@P  qP@U@-@h)@)@T@@N, )@P |`)@P qgH-< )@P 0/C%=Q5aQ^ PU )@P  /C#=1#aQI 0S )@ R> `0p PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V RA-P@`PV~)p@P=?P8 #V \V `#P` /P`(;P P/C!=QhZ;paV Q P;P `P@@@ ~ `@ @v A-P@`PV~)p@P=-?P8 #V \V `#P` .P`9P P/C!=Qh.9paV Q Pt;P `P@@ , @@$ H-P`@V@/ipW PP`VpP0 F R :,VU .V,P (PA`V2;P W`P>@p bRCR MR mR cR5p@ TR(H p `Q G JpUP)@ R )@ ``.`) @`g@0 !@ !p R@ 0 @ @ | }@@v H-0@PS$ p(@ .SmWpj0SV`W Qp!@V`p@ QH Dt(t tttPP!@k@d TO P!@P@P!@ P!@!@Wp0H-^@)P@P  =P@ @0O-M)@Y: 0@P4 \1: РPq vM㐡`aV p !  !  pP` @9P, `AP$  @ `Ѝ ,j  AP Q ???E@y H-)@Q 0$0 R: RC qN vAMDI%bAT0 $ P "P%  `$p% "  @TD?HA?K-)@P y`AT P1?/?U@`V 0H-^@)P@P)G <P (D)@"@ @^O`)P@A@p'@ J c@ %0 @V @0O-MMN)@@Ql p PG% t嘶'@AT `P  ! 8 tP7 cP8 @T 8P ` 0QJ iP- 0)@p` a0P !@ #F@@% @% @  `@ 0T E@@{ s>Ѝۍ@-M @Q0@@B!S !Q 0@Q@?0 !`#!K0" ?^   @@@T: 0 Ѝ0H-^@)P@P ;PC@* @0A-N`)@@P$ "@PqW P p J8P+ p}P# `}P qPw@P `PP =}P @==@ PH-~`)p@P@P"_qW tP p 0H-^@)P@P =z;P@ @0H-   PM-`)@@pW# /PC!=ahP Р+0* R 7P ` P@9@o O-M)@PU 0/>3C=a 3@0'sfp$0 "Q  U `p'`&p PS0 R^ @ PN PXZ l7PE  p  p P "B @ N.)@@) @ 0%=R />3C3&3ᓌc1S ` p'`&` 0 0   "  PP@ @ Q@Ѝ 0@ 7P 0 pp ``  0H-^@)P@P =:P@@0G-M)@P P=p aV  0 $@ P4(` Z ЍO-M)@`V8 @L@P@/8C<!=㐱hP ! # " # " (0@ 6P p {P ( qP @$ЍK<@ЍOBG-)@^ /NCCD%C=Q%dAT $ `Ёp)P(PPЀP) p(P (PU@  (00 <</G-Mph )@PP/P` צ`P' (26P p{P @)@0 @ `P Ip0@ @ ;@ ۍO-M^)P@@T, ㌖㈦f)@'@'@p'`@P$P ;  p p@P ;;@TЍ )@ Q/H-)@0S ^Q ?)0@0SQ@- Q @P @ P '@'@q X@J @ 0H-M@P V `00?(P2*2*`` 00 Q*  ;00?( P2*2*`` 00PR PT/@Ѝ0O-MP4 Xj〖@P@`@'@)@p@PP P@P@ 0(:@ @0@@ 0ЍO- M@PS`PJp( KAQ: /?) @)0@P /?) @)0@w d  l , t 0 |  p[ Pp$``  4P  KJQ1Q 2Q ,  KQ LQ ` /R5Q (,,(  `  ` b$   l b `/Q``@ Ѝp@-@ Q P`:peRe #p@O-EMP`@Q @Pt`ptteQ  @@)@Q@P@dT @ pB d @Q:P P/ @ @D @i @ @12 d ~0 |0  `x)@@@!| @idPЀQ :1qpA~1QSpPQ: A0 cA ,\qlp Q :1QPA^1qSPpQ: A0 kAh 0\ytp Q :1QPA^1qSPpQ: A0 sAMIpJ: P Q :1ᒁA䅎1QSPQ: A0 A0s `  ?(P2*2*`` 0P eQPp pQ :1QPA^1qSPpQ: A0 Ae0 @@Eߍ Ѐ |pQ :1qpA~1ᩑSpQ: A0 {A=   @h'@PJPJP P@ //0H- Q @P P @CP 0#@ :P)@P)@Q+@ 0H@O-MP@PJ㐄`(  lY!R ,<`/  KAQ: /?A) @)0@@5 /?) @)0@) d _ |  p P`p$p`  HJn)HСpt 9p ,` (@pl (Pm GJP1 @R 0 p8LT (  aK@Q:gPxP =+xP@ @ @     )@QD KP  bC   1 ,  I PQ p @ /O! (  B  /R    *KP@ @ {@ Ѝ O-MP@Q :P P@)@P D@! dP)@P  F`dQ0)@P&Q$d@ApQ /Q @e @TT }T Y `/ P%  }d 0@ Sa`23 75pd`DD 1p@ 4 Hp `q `OIVDQ :1A@AN1qS@pQ:./O B0 ?W&FQ@p hqQ :1A@AN1qS@pQ:./O B0  0t+@ @0|` f$  QS:1a`An1qSH6pp0  |0 PK d ] )@@`| @Q :1a`An1AS`@Q: A0 {A- t+0@ @ p)@` pfL|Q :1a`An1qS`pQ: A0 {A  @@=rutF`)@P  0Ljd` {`Q :1A@AN1aS@`Q: A0 cAy t/ 0@ @i,lrl@ @pQ :1qpA~1ASp@Q: A0 kAX t/ 0@! @H0Lztp pQ :1A@AN1qS@pQ: A0 sA8 t+0@ @(x )@!@Aq:P@ @Q :1QPA^1ASP@Q: A0 A t+0@ @@ߍ؝P0 JYm  `@UP TI)X` MIj  `  ?(P2*2*`` 0+  ?(}P2*2*``P P 0@Q :1A@AN1QS@PQ: A0 A t+0@ @}@PJ CPJ$_)P@P o)`@ P J @ +PJP P@xA-MMM `P@tP"@, U U $)@ @$)@ )@ mMލڍT@ ̈0H-@P P@ 0HH-MM A0 S0Q #( @@ 0P `.p*V ?V.`pp\pp0` Q0/P @,0 @ [@P$JP,0 @ [PJ@,0 @ [P J@,0 @ u[O@ЍڍK-M-PP * @V\PP a =0@ T\(P@p`@P @ Q 0?k`P @ @(@U Ѝ0H- @PJ4@@:(_P)P@ * @1,)@Q0P)@P ,@ @00Mp@-MP@<)@\h)@)@(P@ 0n)`@P  "P)@< @[ t\ "Ѝp@Ѝ/ M@-M(O)@@  P0  ]\عЍ@ Ѝ/p@-@QP,)@ R `A_"P @ @iP@@pMH-MP@<)@lh)@)@P(`@0~)p@P X "`)@< @S[ \T<V @F[ "ЍHЍ/H-M@PmY @#;h  `@p NLP PPp?<(@P:.@0P) @/P%@kP2@ePsp " !@mp  0"# 0"# 㟞@PL(@@X@ZX@H-r (@@ZIXO-MP@^mY @p:m8D`@)@)@ 'NeP qPrP vP xP8 VPPP RP fP iP)4)@ pWP dP0)@ @)@4p)@H)@<)@ p <(@`V4)@PЍ @QvpPW> PP)@#@Q  /Q@ pPP/Q /Pp.PP .PP PpW @ ppQpWPP)@W㪺LY)@wP)@PU +aねp@ `@@、{HP)@ Q 6PF 4)@P PI ?PE PA  @:;Q :  2 Q0/) @ R' 4/) @ R Q  !P   P  P <)@PP@)@P o PU~e4? )0@P0Ho)`@ `Yp 糴P@ᗅ@፶P_P)P@PASk +p `@ @@ Q HX4)@Po X Pi 㜹a4)@Q X PV P Pg P 64$)@QPG p9 ' = P4)@Q/ CP-04)@P$P( P?P% Y Т 9P_ )P@<)@PP _P4)@QP &9pPug@)@PT)@P T)@ P ?P Pn"@ԄB9+0 @ H-p (@@X+VT)@/A- M@8)@P (@@ XL(@@ͶP@'P&L`)@P5 P P0 P+ P' BE<)@P!, @/` (@㒂P P@Ⴢp P Y@ob Ѝ`奘p "1 Y @!0@ Vc0 (@ @p.XO-OMM`@Q  p  P#@ 4p PP Ѐ # "!Ѐ # "  PpP 0w pwЀX` XzPp X PXP 0㿽 LЀX` XzPp X PXP 0㔽&ЀX` XzPp X xPzXkPr 0jjW WjX`  oPS  fpWPJW;mPB 0::РZ`'V`: Z `Pj PZz Kpp`P Pp)@p @H7 /Pp)@p @<7*OߍٍO-MP@iY @6aXp`@)@ _JvPppPp<(@P<P5 P @p!P$p/1`P PQ P {p P/ 6 6` P TH-~n (@@VTG-P2Pr  pR4J)@GB<`'pd#< <`)@ aR8)@P GO H-@Q  0S`oJ)`@P@' `qW P `pP R 0S JA' ``)@/p@-P@U  Q4`)`@#.!..P8)@P PpH-4P`)P@@`)p@Q `'VP8)@P HH-@PQ  0S`J@' ``)@qW P pT `@-@P@gK-4`)`@K@T;`P)@ 1S ppW1 0'PR0P8)@P iL?0@ :T `x@'p@ ``ddQ A @_`@T KP; @hp@-`oP)`@@Q  R @RP'UpO-M@C$Y)P@QD `V@ d`'@@'@@P =P w N`@,P p @``cQ A ^ `V+@ '`>Ѝ0H-L @@BP aP@0$Y@)P@P g @ A-M`)`@(@@L\"P@ > p) @00SqQ Q, Qp&]Qa 0AS@$4%&&&L%X%&p%|%%%%%&%&&&&&&&&&&%&% &&8&00 @G  p) @   G 000@0@oG@)@@:P)P@ p@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S     @H-M@P9`)`@PL㙰P  IRNP  ㌰pP  ㆰpE)@@)@@@ )@PP9Ѝ@ 0H-@Z P)P@ )RR0H-)@ h@A-P'@2 $(''@' @ip )`@ P Q @Q A =:T@Q@ A T Q.:PYM @@ Q&:@8@ )@o@ @ 0P^oK-0M@)@pЀ(,``TV F P :(( 0#@P0ЍI@PWV  F008@P`~"  @0 R h_G-@P )@ %Rpo`S&P`)@W@ 0W @E@-@Qx@ +++++<+++,@,P,\,h,t,<+, Z # qY PM 00^R R ^" #o ? `2 0PQS? @PS2 `QSQ!!R .," # 0&@7@@p@-M])@)P@`u`@,'@`P T0 TPL"@@D ͹@P;PP 3P R L"@    RЍpD@t!@|A-@pP )@`P,)@@$ 0A-MP@+ `)@p BP0P `pR)@`o`P 0ЍK-(MP`@p!PW&WI We W)@ 0p'GP:$WB "W @)@@#PtW> W|UH ЀJVn U)@K`'@W)`@@P'WP~" @ @jPM)@ 0o᠂@)@{ 03Ѐ)@l 0(ЍK'FP] U)@ Ѐ )@`'V'VP~"  @P z] (Ѝ@{@w@sO-M8 P`p)@"@#@)@   01@ DR0 0SR* @Z 0pD`PP PЍO-M,O'@@@>peP P$)@@T' `V )@pW P POpLD6` EU E<=%=@  @^@P .P.PP/PX|"@ +Pf `p P@N6p  P[ Q up,XRxLP FX5  PP0 @&Ѝ@^^P-PP )@)@@P@@@@ @p@-`@)`@Pp()@Q @ܰPSP y5pp@H-4p`)p@@p/PP8)@P $ V ,'@6QP )@@Z@P 8)@P @@O-MPIpU)p@Q) @)@@P '4P)P@P8)@P SP  @ [@ [@ 5$)@;(i'@$)`@'@@/Q PQ PP@6@UP U/P@DpWI j\" P@!@ PQ /Q @ջP P,  ͻP' P@5@/P P@5@Y$'@T1T   t/R@pW$'@T p)p@@@_;p)p@P@ʨ5@/P5@ P4@)@@)P@P &$'@U4 @[@ [P@8)@P Ѝ$)@P/ 0RS /S  00B /0H-M@P P/P" !@p p  0"# 0"#oBލ00H-H L @@P><pP$ )@P6LU]8P)P@P0P) `H'@@UX! !WQ A X @X0/.I@&@"(@p@-@ \3`㦑P 3"P P3`3)@p@3Tp.@H-)@Q  @HIZT@HG-`x'p@P`!V  @〺P U @yPo`Vl P @T7 \T0@a DR0?@HA(@@@(@(@(@(@(@(@(@@(@(@(@@(@@(@@@3\T1 0T `@ P0 BR6!Aqr@#\@` P, Q A EW `V@ @ @ @ @ @ @`Q A 'W @`@X Q A W RW@nH-,)@P0 ) @\H-M4)@P 8)@8P)@  A)@P ,'@6P;Ѝ MH-M)@  Q0  @-@8)@004)@Q000%WMH-M  0 H-p)@M0H-MP@ 0 p@-`$'@@ PPQGH)@Ppx)@ Rgd 8<'@ @WL)@Q 8<'@ @WV 8'@ WTJ8 '@!@WTJ*- 8 @'@WdH'@@Q A 8V 8'@p@rVQ P$'@lVp@-@P`[ M@-M  @0 s@-@l M@-M@  7 xЍ@ Ѝ/0H-@P+ 0Hk MH-M   `ЍH Ѝ/ X@-0"@ r R P  R<@')@@" @ TW@X)@P)@\)@`)@/A-P'@4 $(''@' @ip )`@ P Q @Q A ʗ2T@Q@ A T Qʈ2Ph)@Q~2@Q1@d)@h)@O-MP @1 )@ )":x'p@P" ,gP @'`@U ^PZ  P P)@P1:PP!" v1[h)@ZЍ$O-M,P'@h^@U)@`h P pC1P)@QIJJKDKlKIJ8JJJKKKKKKKKKKKKKKK(LL^`P ^`PPP# ^`PPP )@P R^`PPvP PUbP1U`hP``f )@P RW = )@P R )@P Rc? )@P R5`!/ )@P xR$ )@P nRA @U$'@T )@P ]R ``(o` 0 0 )@P SPP 6 Ѝ1 `PtSG-M,P)@,'@PP )@ )@HT@TpdH'@@W ` NpWT@S9T p`YP 0)@@LP S[@Sd'@ TP<P9 h)@24@)@@p I`P8)@P  LP8)@P P Se@Sd'@SލCYK-@p,'@PP. )@ )@7H~S@{S`dX'P@V  oN`V0@lSW?@gSQ A dS S4PW)P@G(`Go"(P W(h)@QP'PW@P8)@P 95I)h)@P8)@P $WPP )@ )@GSC@Rd'@KBSO-M\P)@@,wh'p@`^)@P3PP)P@`P QP $P"  `P P P^P PP@P`1`@ЍO-M@h,)@'@ ^P.U`PP)P@p`pW  P h\ ) @00[U mp d)`@'@P( )@,GsR  @pR nRQ A kR =RQ A \R R T&h)@^PP P P [PP\ h) @)@@ k.ЍG- MPN.} )p@ @h`)@T7 P)@P2`PU  (P PU@T P `P,W'P@^P` P  `V P^@P ``. ЍO- M@P 4)@&pPW8 8)@`P pA R /'PPP VJPJJhVJ`pWP T&'h )@R8)@P | ЍVJ롶I(m@O-kMx  )@T,$ )@ )@ p)@e$v-t@)@]c )P@T  copP ;P ' @T paW aO`;P   pW x!P xxx,|Q | 0|1 |,'@6 `)@R0 PxP|0x| A|Ru )@EPQdx'p@U1 =` @ Q A P @@᳣P @ QQ A ʪP ``PP @UAT P Q A ʌP PP@ PT @T Pu qKP@ PTQ A kP Px@P\ PK C`"@@Pp (P,PU;h QH$$x|1 \ P @pP`@ -R -RQ ` pV`pV# TP@@p\ xW@x|| ,xP@F|$ ,0KP \@hh)@Q @QG*h8@P@PAP0 4`)`@$\t t[#pO&PP \t!S%P! th@)@@PI tPp@l\ PP-NP &P M8)@P  p)@P8)@P lpH@Q *h,@ P \%P @ MP sE0I㔽)@@ )@ a@|L` )`@0h HppP0x1pp4p)p@|P0C000<  \P8)@P FXPTP,h)@PP$\)P@T dP|!A )@R``)`@PhS\ hA\-V  )@<B2 h DT Q GP8)@P P)@QG V\#8)@P= ;|Q  -R] -R RWQQ QPP Pp])@)P@<P px ,@T)@Up ) @<P X@4TPq,)@ @T DRp\)@0t!$\t!0$Ps$lmP tttP Lt'@ 0@p0txp)p@4@s,`8)`@X@T(S|`XP)@'P@ 0)@44PQ 4PP)@Qx )@,@Q hx@P\@P  )@<(, BQt DxP$QQ/@<6(0@@|! H)) @@h1|!$)@Ad ) @x|@3/4P h)@TNd8'@'@$'@O(P T<)@4P @;4p 4P4Q4P2 84)@8)@P h P pFP Lp'@0  0A0P 0"@)Oe)kߍ@h)@L4xp@ )@@  R~CP P B@PMPPRp ) @|p `h1, p0)@P@0 @0 h D P FZfT  )@$ )@,<)@TRc@P8)@P ,$@O0)@Pp)@h )@) @P 0H-MP. @ PP@Piiiiiiij$j  @TP   7  Ѝ0@-MP @PP y6P x)@ 0Ѝp@-@PPP p PPPP  Pp ``pH- MP @,'@^P6U4 (4p)p@p+i! `!P8)@P rjE6 `P8)@P [( Ѝ@}@-Ml@)@@P' 0'@ d"p 'P   0'@S"p =PTDQ'@Ѝt)@/p@-MY @0$I)@@PDЍp,P'@NP6P!.|)@`V BN`@Px )@0P B`)@/P)@/P)@ / P)@ /P)@/@-@P,P\)@QQP @) @cP@@@H-Mh`)`@/$Y)P@P @'Px)@P`)@XP)P@p&pt'ЍH-M@x )@/sP P%  P&  P) PЍ NP pP `P   Pl' 9PP. !@|@w @rX ) @QU/H-P+h)@X` )@) @0 QSQSQ P0)@ //G-HMY @/8R08 (< p @@`PD`'@0 @ ` @PJLHЍ H-M@P)@@`pW'`qp @g`+ # @ @ `z@ ?6P0P ᜫp0Q P.R 0r0S O @ 㴦@Ѝ N@O-MP@/p ᔝP }PP 0T뿯P U9  Pp;:ꈐ㘰`P)@WP 08UPP P  P p PPꍯPl&  9pG`P> ER:UU ~ @) @^+0 @ H-`@PgepW apV U*%,)@x)@^,O-MX+ pR%pPPP :PW ݪ(G'@@`Qz&P$g'`@U@  ئZ/P/Ѝ U, ) @WQ:Q:Q ᤪ@ЍO%O-MSP@p`@-b@Q'$wwv,w8wvvvvvvvvvv@wHwPwvwXwp`@PW$9 )0@` RW pW P  $Y)P@AP Px x,x8xX [ Z V pWi'@pix  )@0z PPPQ PT P P>J$)) @pWAoTጐ )@pPU P\yhytyyX[ Z V poPMP)@|Y:`H'@@)IP @HP PPЍK-4㌐)@w@)@'p@ PP `Q QQ`PP|U:P8)@P KK-M Rw{{{(|x )@pP @ u`$PEUY D@I'Y,.Y, n@PH  @I4@)@@U PP8)@P hx@4H2H~@/H Y \@)He@&H  @I `H'@@P Q A :H *Q A -H Ѝ@WH-`@Q  0SCpa)p@!(@r !!ApQU P# pPV 4`)`@Ѩ#P `*P8)@P P)@p@-4@)@)@@ 0 0P8)@P @O-M/@`P0寚P  x )@P` @P `zP+ pP P P  p꽬P P   '@p P p'@p @P@Yp P'@ 9PN 删 )@ pY#Q @'P P R@'P /P  W YB P p   PPj P AP =P 9p@ pY d`'@@20"@ @FH: p(@p4㴐)@`W ppAo  pQ B0R0 @8)@P W    Ѝ4@㴀)@@`pPsp@op`Pa$'@@DU""UP pP#@ H-PP"@@P `pQ%V 7P Pp@H-`P"@@P `pQP Pp@0H-`"@P0@PP@P0H-'@)@ 0Q R RP U 0|S(K-@x )@㡃`pP@P P:Q :PPQPPQ %Qv&P`:QPp@G'@@qVQ`UV Cq `A-4P)@)P@`@T pP9S@p@T`|V:P8)@P Ap@-4`@)`@pPP P S Pp8)@P p@p0H-M4P@)P@,7'0@>0 0Q P Ѝ08)@P Ѝ0H_H-.P QRqO-MSP@`p@I)oPP VP`ppP vP@cP  /o0"  $Y)P@ 0S X 0u@"p@@ `@YDZ @` QP9 P:P? @Y ` @kFX4@D ڗP B@D@UFP `H'@@Q A D Y ` R@D@DP h0 `@ P: @ `pP(/㋗P* P7 ~@Y-eG @@Y#@TDY t@Y@Y @E x )@@@P @4D@XC-Y9 @Ex )@@ p  +`X @DTY _@PY @X@E@E0u@ `"p@@@Ѝ@R4Y- cP0@ @ @H@DH- $'@HA-P!) @00! p) @p !) @00!) @0-) @,'' @(f '@$wIRaP'p@)@@)`@00yX PP@ C @@A4ap)`@` 54p)@ @p` W ppQp&4 )@ Q  @-0 r RSA sQڈ@AT :QQ0Q 0 0NO-Mp  ( h()@' @  $A'@)@@P`~P  Sp F    )@ `P<UځE P%8Tdؒ Dq)p@ p U :U U)@=UPutP pP Pp $'@ AApPPp PP~ tpTpP p@Pp=P )@pP} P|{)@P1$ '@@Q)pQ&uP^ PUTP('PpPN p~PJ=U PpP @Yp ;p P5 P<;^ p( P gp P!PPPDp UP)@7p)@+p#p Y P`pЍO- M0)@@Pz ( hh)@'`@ q)p@@` P_P @Q::P @P- T0@ PT5  U5*@T T` `@ÔP' ^"@ ざP P `P᳔P PPU:^"@ l@ UT PP ` U: PpW pWcQ P T  ЍG-PN 4Q4`<8@)P@)`@)@)@ >RR4 *R[R?R pP / P A PP LP P  R' Pp@@T0H-P04Q@)P@@@Q@0H- A)@@P 4P8`)P@)`@p7pP P P0)@O-M P$a'@)`@AI,7p☠)@@'0@P[ 9[ ځKQ:[ Q W [ [ /[ Q A ʹ,7'0@EQ ЍQQ YP Y @DP9 EP Hp"@Z y P p P*p P PpPePy/PU/PYO-,M (P L"@o = 6@    P*  dP2 p `(  ( )@/ `Dp$1'@)0@P0RC$ V< YH0 ( )@ ^D( P `p Q( @P)@$'@)@,7'0@0AS p*P@P p R Tp$Pe R$Q P PQWV)@C)@P( `FV00`/PQdU)@  `p P )@P( )@P( PPU`F R $'@)@0PA `倐@ c! !@P0 )@P ` `@BQ;*$Po  0 U lU)@ f `H "@u P )@P+( )@P( PPU?BQ0pppp$pP )@P1)0@$p!Wp( P @)@( V*4( 1)0@p$'@0PA0 0pPq$')p@i' @)`@ 00 @ p$'@)@ A ( R )@ 0S S@`VW   S S00SP,Ѝ  @l DRʬ )@@P #P  )@ B 0@ @)@  B 0@O-M$ 4 ` )@'@) @ `)@ @P)@0)@p @bE o  `0)@Zp)@ E )@p4 @ 4`)@)@@P@ʴPqJP8)@P  p.P UPS p@X X@[PP[ A E@QPE P@P@DTPPP H "@ P p P *p P@@PJP P t)@P$ '@Eo)@PP8)@P ЍO-$M$)@'@ )@ PHPZ@a`@{A" )@`p)@ AQC~"  @> @@ 0@S "R  @ $ЍH-0q`)p@@PP Q Q  )@`P @PK-0Q)P@PJ )@ P# a)`@P 4p8)p@)@@ @P P P P`P  Q4`8p)`@)p@@ Q@P P PG-Pq Q:PP ULPE`"@ p@@T @R:PڊP P `P' P@D U p  U00 =P=R V Q V`F `P@V PO-MR)@`pIQ)@@)P@P /V$'@p p  >@pЍVP(|4"@0@0 @ 88'@@ [=-O-MpBW*(A)@@QPi)`@P )@!) @W$'@P P @,\H Yp `P^V`ZpW:!pEW: `PGZ`@P wQ  0S Q:ppW*apEW]: ^P<GZP wQ  0S Q:pp`ET@* AP Z Q@!EY`) @D)P@0`CW P@Qi)P@)`@D@p5@@ЍO-:P:Qd@ PPP3[Pq -Q PU ]U \UPY[44@ $ `81PJ $ 84P1P]P9 R RX L"@ X* RX L<"0@00 0Q 4X* @hP  s@Q: p  [`N[ `?<Ѝp@-M`P@P*P0 @)@P< U9 P5P2!P'@@P@)0@@ P%ڞ@@ `ҞP=PPV 0 )@V @, )@U PP @ЍpO-M`P RP@,P! @ R0)@ܻܻܻܻܻܻȸ'@@P+ ?P -P"@@TT,y"P@'@)p@)@aP P 9  P@T0)@T(h)@09 )0@'@`TA0p  0S0P o/oHJY""@@)P@)@だ  X) PR  P PP      P( W P :P PP      P< [ P PP QP PP~Pv uh)@A)@@-Ѝ0@ P `ᒝP=PPV V0 )@V@0 )@Q )@ @嘀``P yQH)p@)P@ぐ"@PX X)  P PP       PBPQ P PP      PPPPN PP|?, )@PT1P5 Ia)@@)`@pU P :P PpP   {   PP HJYa"@@)P@)`@p P PYpP   H   Pp@- M P0 Pg0`BfF TDaOa`C 00``BS:UP0pY-)P@ @P @ T@P ЍpO-M@P ZRDڈ0BSP:RD [RF 0^S!S 0pCW,:[S ]SD S# 0:S:0ps`\V:V  ]R V 0S /SpV /V]V  00S/S  ps :R *R?R R /RP PR/R Pb [ P AR*Q@ Q: T/DZ`PFQ*V8`)@P"1P p .P.V  7P Z Q/@E<)@-Z/EЍ P5 )@rDD'@Q , /P Q pTPTP RQ /PQ Q㮊P P8)@P ?ph@%^0,'' @N RQ Q  P t@-E)@@Q)@Q)@Q%) @ 0S 0RS Q D@(A-MPP0 @)@P* R0|X `!P@ @ttDlH@xxx @P3 @" !@7 PpW iXP@P pWPVP @@P @PF !@[\@a@m@{P3 @q@p Q P3 @x@ bP3 @@@TP3 @@  @ p @3@P:P3 @yU!@vg@rop @l`V xX @p@P@^  PV`V@@R @=K@86XP@^  P@ XP@XP@XP@XP@0S `[- @h)'%P  0s @[- @W) P>@PЍf@f@ЍAO-M)@)@ QCPw "@@"p@` P<UځE Z 0߸@$P `(DPhxP #U $U'U =UO \U U:F"UYP\P3` ܸ P@@ 000C S:ϸ P@@IP@P `}P`@ 0@ SF)P!@ " "P0QPC[P@0U@Q V 0PQ P0SP U  "`=P:P `Q"AЍp@-Pp"a @P!`@T PA>PUpO-Mⰵ@P)@ P < P)@)@ 0 S|( p`P'@|"@ Pp pPe QP/QiP@ ,PJ帥)@!0RITG)@Q PPP:PU P Pڈ)@$ '@pkyp@ )@PʁpL8 " @ a@@P]&dx'p@Q A X& XЍ6O- r  w  @ x   rw x  rw  x  0   @!`H'@@  ] @j Ѝ @ꞅF C @O-MoZfP@@bRPP HPSP aPc"`@pT  pP @i$ )@[ ZP @[Y@P5 @YP @0B P 0@L PS *0@B!PH0 @ R 0:Q@MPP0 kfP:H%Z< v @!p@@l  @T!@@ P % C!Q@ 08f@ 0P5!Z  0!Z P5:pD [ @P@ P^p?P b)@@P@ P% @ 0e @0 `H'@@ + @dЍ  @ꘄ@ @ꐄ8 @  @R0 B0S// R/0R/@-M@0@ P | RR @W R!Ѝ @K0A Q/Q/p@-@P PP ` !@ w@P   @ oP V@P 0@ P*pPpA-$Y,wP)P@'p@@ 1GAq `t()@`@ob6P V ZuP VuP66,i)`@PQN6QNFQP -PF R  P QP x@)@@P QP^ @ R00 00)@ 0R 0 S AzK-($P@)@)@ RX Dy)p@0-S +SAP-P P; PP,P< -P`c@oQT poP T rP1 APP TQ TPp RTT,'@TP K2 @B" @cE @p @0H-,W'P@6N4F)@@P0vPq놴q!k(OPl  @ @@ 0H 0H-P``Qi@P pPrPPpp0Y)P@@ p`A-@P PTJ T@jP @@Te @Y ,W|L!@`'P@p@@@PE0  @`Fv`H'@@Q A ]QzL ` @p@@@Q E P `Fvh,w`'p@Q P `V  @ @cX P  1 PUR@ @,wL\`'p@@@@P@ Q  R `V`H'@@Q A  ,'@ 1pW`V PAPPU pR0H-, '@1@T P @ @Q R APUP00H-@P0P PP0HA-@$Y)P@P Q-QH )@0i)`@P< Q-Q8H7C0I)@@Qt4PA)P@P `pQ pG`WQ PN8)@PI XG@DXX> XJJXH@4)@h @0   0pP!U:P @A  0 0S QB 1 Q P8)@P  @3 @/ @+ @'@-H)@0SQ$)@ @T9 -Q60Q2 -Q@T+ P 'P% R@ R! @ :R  @ R :R R$ )@ 00P L)) @ @ @P 05!@-4@)@@9$ )@QP8)@P @-0A Q  @P0 )@ @H-MP0P)@0 \ 0 0Ѝ/ @O- M0PQ`V R 0S -QpW  `-V0-`S @T 0 B@p@@1?`Qpf R 0 :R  0 Rp:P R WR Y @ @ U@:T R @ `HQ8 pR @ @; @@18Y'@@ <R @!?`@0@p[- @ @ @ Y @,P` ` P Ѝ:T  R @ `:`8m'@@PP0H-H5'@@P P)0@PP  P!P P@ X'P@]@P0 @H-)@HeO-M0'@"@ @ T P @ T+ @,P) Pk  @p`Q%}P pP {P @P{ GA@T ЍO-M@'@T P   8%A2X Pdp`P@Q* P pU [ PPFP*pP PT"TV@TZ   8A1 VTЍnH->'@   p@-@`2P P`P m`0'@pO-MX'P@[B `@F"@ P )@ h  @   B/o"V`8p  @ pQ    .[Ѝp@-@MP'@@ P` z P / @ /"@ @1 "/ @ "0 `yTU J/"@ @1/ @0 JA-'@pP ,W@'P@PT5@DP pd9P}P @`PP%PhP` @W !@H- '@0@O-Mx'p@ ; @ P$PP@2,P;;;;;;; <;;;lBlB<`<lBlBlBlB;; =lBlBH=lB= Q    Qo E P BP<P7   ,P,P! P% }PuP `P p `PP`Pp pQ P,QF @P,'@P Z> P 4P 08A P%0`P     `tPRP P@zPcQaL "@     Rc   PQ< Q0yP`p  &P#p QQ;p`0\  P @Q* P QA P8 /  0P Q,QF 8 '0@ 0  @P%"%`P Pi`Pi P$PPc@ @ T Z P  @ Ѝ@yP PP'@0`p   `t PP p'@ @R*xP'p@@  @zH-X'P@$@B PU@Q* HYP$(`,P R R R @0 @BT:R R  r R"0`8pN     F   P `@@-@P L," @0/0S/00/H-P@-@ '@    @O- M Q  L\  p'@"P@@`p P'0 @ V `W   @   p R =R    QV$@0`@Q 0XQ]PO W'P@40 pBW:R R$  r R2 000- PPP{@08 F0P0 Ѝ /hP8A4@9@L," @0 0S/=S 00// 0AS:Q Q/q Q/H-R@`P(P 6 )0@)@0 P P-PP UX'P@0`8p     F @PO-M W'P@@`pP|($'@'@)@p '@\[ V P ` v\ VQ P P  xQ P K VP F PpQ?  KT\V P@ʫp` V T`p#P@ʜpG P P@ʑp `2`pP p"@ P  P@lp$'@@GE@AЍO-M$7P('0@'@'@p)@0 '@8$F "@`Q0`J "@ D""@ Q `&`P1`@rQ QPMO(NOPNU WpC&P |P >P #&P >P <P@@ ` (-P(  @p PQ$` @8Q@zM@9t0u@0P *6@)dZ@#@@Y@p@O-M'@P  刕)@P J  w|aQ'p@)`@)P@80P@f@T:T D P@fhh@ghhHhh`hlh: PpOTt 1\T- P! R0m T T  ;;T# |T9|P&1p D "@ЍOt!#&P&P ;P    Ѝp@-\PpH We'@@'P@)`@ P 80R 8 \P p @ p@p@-H'@@8QpY`)P@Q A `8  R8 pO-MM$'@`,)@@0 (0A,$p'@ PuP4PF4`)`@U0A| @0i@,)@P8)@P  y'@P('@)p@s P@P刵)@  P $ @>`[P \P8`[P P $P1  P  ` &`P$-p!\P `P  0 0$  ""P` P\TP\@PJP`P@AP$'@EPP @PPPQP``Q P   PP(G '@@`P}PP@U  h4)@@@0P (P8)@(PP ߴ$0, ) @P 1S  @BQ A ʼTP@ @P ʮ@PEUQ A ʢMߍ 0@(0P 0$, )@ -@@-Q@@Q0H-'@Y @Q E)@@PU0U U  )@ )@ '@P0@0K-MP@t('@ 4@$'@TlyP)p@U )@` hjЍ`uQ X)@P ```@"``@O-[M,)@`  @"p,'@H֠)@P'@P DT@ @, A AP ,'@֠'@P,)@0)@PM PN Y @F,PPP)@'@@``@ nF "@P],'@ P R R  @V  dV0`! \X1hA$'@ @֠HT)@,)@P[ߍႳ + t R/0S / )@\/0S  R 0/A-pW IP)@@`pQ@U U p 0 PZtWH-p@PR T%54`W VU _V'@Q@v Lo0W@ AHq@ 08H-p@P` @P`O-Mi@ P)`@  @   U )@)@pWWpP P P @T Q @P  )@Q  R [N P QG  Ο40)0@)@ PC Q  )@Q 㶟@pQ '@T'@@TJ 㦟)@4@ )@@ 0 p)@  Q8)@P cW)@ PUr? )@P QDP Q  R;  dp8bn P PP4 )@ S@pQnP MnP" D@p@ @TL`'@'@ Qd'@Ѝ  @()n&n @ )@ R/0S /0H-Y )P@@ pQ  p  p   p  p '@ P0@0H-P @)@P PP0 2/՞P0@- '@ P@ T D㻞PZT@'@ Pŷg fFP Q! )@ K-M4P`)P@@ T@P }x}}}}<|<||| pWJ )@P  R #0@ p`V )@P  R 0S T Wu!0pr PTm0@,'@VP p6pl `᧟p   P!@pp !PeJ`W % ! pp ! `PcJ'@V`T  ,V'@ P  Vo"0p#P8)@P P P Ѝ8)@P ЍK詰ly @ǰh)@l㫱 @ᷰl@Ἕl@)@l㗱 B@ᣰH-M@ yp`'@pV`;hP P x P 匝@}儝hhehbh_h \h T؞p@-4Pi)P@)`@@UPp8)@P p@ p )@P/p@-@ )@PUpT `V PJ<`Pp@-P'@@QQQU $ 0Ppl` @p@-i@)`@ R)@R.  PZkP kP R  P'@UPU @p0H-@ PUP0@)@ $0@-@)@P  R  @轜O-Mp<!/@`(@ @@` `pX QP@/@pvP sPV` pVG7 #!@ -P p+P -P  "@g/P!@XU: iP  Q #!@PQo oᠢWi aQVr  % % p@P0P`PfPt)@W )@WjZ  01)p- P[ ! 0 0P P QWOr pK   R pF Y  0L`VV! V)P@P J@@ 0:T`H'@@ #@ЍQs@ᳮb@ᮮ@ᩮjjO @jH @ᖮ=@ᒮO-Mp`pJ W`xP'p@  @ Y m @`@[/4`S#T "@@!0@ @!@!@  PU[ P[  UPP |0 @S[U @ p @ЍOjЍp@-@QD PAQp`R P@`e"`@D>Q <Q  R [  @?D@Q:P P7@ r[  @( Ri  @pP@-p@-@ P)@P QU0p )@P Q  R ƚp `p O pU i UpiX @᦭ P @@-@QP @* !@pPE P0H-P @ PP Y[- )P@ @ 0y1SP@0A-@Q P@5 k |P `@ p@  ?U U P@P@UO-M@P PP9m!@fPP4P @fPL >@fPP&i4p8P)`@)p@)@@P TQCPP @@T @)@@%U` @fP w@fPpPU`PEm!@fP IA1@`'@aPPEYUT@@U)Y i6W @)`@@!P@ @p WWp@WPT T  T@Ip@@W}oY㠢 )@Pc@YEP P KcR @)@`@!P@@P*pY$ Z P @P R>@ Pd '@@ GP @Pn4)@P P :We4)@P8)@P T  @Y@g @)P@@!`@ @pP P T }P T@p@Wp@@WT  @Ksb @p@!`@PP V)@@T@Ѝ-PPU@H-M@ )@PP U)@`Q U PTT TT,'@NP )@P `P`UP TV T,'@6`P`zT)p@`P PVЍ ep Q,'@NQ= T;'7 9V V V8 @Ucp U`V PD ?Q @:Wg"1p  !,'@6Q()@Q `6QP`H-4@Y)@@)P@`pPP `p W: )@ Q8)@P HK-P )@Hyo4@8`R)p@)@@)@PP`P:FPP XK )@Q/)@ 0S00S/ <R:/0H-@fP)@TQ 4)@)@Q- P+8)@'Q% )@P )@Q PT )@,' )@' @6 R T4)@PYfP0p@-j@)`@PP@Pp8^bUp )@)@PQ /PQ/O- M)@zZ)<h`)@)p@)P@) @)0@)@Q@P.QAT  Pᇫ)Z<)`)P@)0@) @P  P  Z<))P@ `)0@) @@ Ѝ?)@ R3/1!@R/0H-\@)P@P0# @0H- )@ )@A--JM  \)@)P@ Ph)@)@Q)@Q  +) @ R $@(P,)@@U$@P,)@)@@Qi)`@@TP;4$@)@P,)@@q `Vf@ P @ϊgaF?Qϊ:se"1` =[i巪`'@0H-@Q PP@U Pd'@P00HGd'@p@-@Q,) @ 0 P /Q(4`P)`@ AP 4P)P@ Q8)@P Ϩ@p@- Q @RPH Bpp Ӳd'@G-@'PRPPP L"@`P1 P/ P@`'"@\PP@m"``EP@_`\'PpUWB 'W P@IpV P@<P@2P@(Z`P #P pP@`V P@'d'@PG=0H-L@"@FP'QP @ U0P0H-$'@$8'@H A-RP`p@ הP P dP  T@:pGWPH0H-4@$X)@@'P@ P  P08)@P 0H諧0MH-M  0 ЍHЍ/@-M@hP gЍ@ᶧ MH-M `'@  ЍH Ѝ/Mp@-MP@, `,0 PP@X۶!@Ѝp@Ѝ/@-M@ -)@) @ @ 0B@M~%)@@ @iЍH-M(|"@P@)p@` &P p pPWL)@@ @ P@5ЍA-P``Q=QR`V XJ@' `)@A@pW P ;P @PppX@p@-郕\@)P@```@@T `O @@Tl @ p@K-BMp,@`)@@PEP   p*PBߍ0H-P0SR00S L@"@00SS @0P0PSS@DR DH-M@ P=`P" pU 7^p@pPQ A =U `"Ѝ @lK-BM,pHP)p@)P@`@P `@BߍA-M,p'@@ PPTPPI `[ T4p)p@ R < 2/`"Q  Q  OP!P )@V <)@V P"8)@P ˥ u  #< 0 ``  Ѝ  @ХH- M! 0  PP -P -0 )@P0( )@Pcx)@Pf,'@6QiFQl)@QpPs @ Ѝp@-4`P)`@U @2PUPp8)@P p@Kp0H-P0@PPU0K-M4P)@@-PP5  P p    ` 0R`` =Q  =NP-  - H'@@ ,'@PX P& )@W  =Q$ ,)@) @AA Y   )@ -) @0Q08)@P Ѝ0H- @P P Q 1/P @0p@-@|)@ R 0`PU0=U=UV =mNPp PkP ` Q 1/P 0 R=R/="o/A-)@ 0S p00S0W 0R:L)@@`pPU Q Q 1/P`PpW:H-\)P@`@T p  1 ,@ @p@T`V:HH-pW @@YXP[U @H@HNUeP@`@'W W 'MP @p <@8@px !@H/A-@`PQp8T  @W  @`H'@@=P Q A ʌ 00 =PX 7 @Q A r 1/P PPO- M⌽)@]`@)P@P0 `)@`p Z T    V WpX:5 0@ KW` @ 0mpW ЍA-@Q,($'@y'@)p@`=LP@=L@UPP@P@`P=PP@`AQO- Mx` p@@PrUP pP nPVn@rU`iT`@ dT $ )@P\ V   0N Ѝ$)@QG pWD `    P=XPP T  =X T=X 9P' T U R =X   pW @r-@ቢH-rP@ဢ@|0H-]P UU@P@KMPP IP@NP xP@@$Y)P@P 0C@TH-MP `P9  @ R2 4pR)p@ P|"@   #P8)@P ЍA-m)`@@T ,W'@'P@W P   U  R   02/  @TH-PH P ,Y@ơK-yUp`P@ePfP vP xPP ePe@o8p`$ )@P /o@P"pPW ?PPP0H-P@M!@1[PPE@*[P2U*琼00P 0(S !S p o00)S R p0@I@E0H-MP@!PP P)@ Q (P)P .P U U Uo!PNPu  P ^Q  @HQ oЍ0EQ d(8HXdhdddd     @  @  @  @  @  @pt qP@+ @帎DH-M@P`P)@3 Q0@P\$```` $8T,Î@P ὎P@ 0p@`P#V `' P`0Q(Q !Qop)QQoᑎ@P ዎP@ `0@V p P#S`'`@V@nt@Ph nPc 0"#\ 0"#YY@P YOFY@P@?@`&$oB3y@`u&$@@(n`pjV@d`p`P@Z`pVP@@ O`pKV@@$ލuWH-M0 -R Q Q QP @"@Q @HY<(P" @ < $@"@ <  @4"@00Ѝ@/ 0Q@/p@-M@t[ TP`k[P g[ "Rq*P (@ 00@RQЍp@D @?H-@P῍P QC C `CVAApPp`7P @QAO-M`Y @ @TpDP-P{kPP~ -P,Pq xsP< lP$PDZnZC(@d @P@DTM pI P,@ x@}PP(@ PP P-PTF@㈟p`'@'ʞpD"@AXPP FPXPZ Jm!@+XPJZXP p@%P`P; cp v v!@@ !@@UU-P)VZ  R`P RP:9@ZP Y Y @ @ A@ g@@pZS@jH-Mxd)@'@ @ 0 ==@-M @R R 1P ! PЍ{@ ᣞH-@̞d'@t0H-@M@)@)@uT /@@T P=GP c@T[- @0 @@@ Rh@'@  C @@@ 6(OPl  @ @@  @@, @ @Ѝ0@-飞0)@P )@|)@IP )@@8 )@'0@R Pd8LH'@'@'@@` $('@' @P i 0H-Ph@)@@ag)@'@@,'@0 0R @@Q:4P)P@6S )@ *b(B;;@;;;;;;;;; ; ; ; ; ;@TP8)@P Ԝ0H0H-MP @  qP   nPЍ0H-Pn@P"`@PK 0P00000000<< %  pW pW ?T  3TPUPU PU p@-P. P`"@@PiLLLLLL\LLDTTll<<<<<<<\\ @G 6 P  00S) ! / 00S pP/0H-P0@P PU0p@-MP `@P`PU``Ѝp0  0R  /P/P/Q /P/O-M-(MP`'@㼍m@)@)`@!U%XEP EQ ])@)P@p\  q%P%P  @u*P @u.X @*P@@  @qu@X `Xp/aHP`P j q$ t\  )@`Pe5AHPZdP $'Q"Q  S A t)@w 5Vp$ $ ) )@P  L q tQ )@p tL  J+S )@+S t 9 )@ 0 XX O`V< ;\`V P P cl  )@q t  00S +S )@+S  0t   n)`@ )@P qR᥹0 )@S0 pQ Q @@@@@@t|a#&QQ "Q 'Q\Q #( @ P  n vbtfreM  Q^Q@^-psp m]t)`@)P@r x n)`@ )@P  )@)@pP  P)@P )@P \R Rn P)@P0]S 0S MS ^R/ -R P)@P^S% cSK " d-) @PP(@0@pp 7TQP)@ @P-P) @PP >)0@p t  t  m]t)`@)P@ )@ pᦸ@ )@T@ x Ls )@0p w  0)@ 0  )@wp   )@ sp )@#)@pP\P PG `@]P 0P" MP^P -P `^P cP(   `#@ ?P ``(@ 0pp 7S00CQ`j)@ )@ @.m)`@])P@Y 8 sP \P! u`H'@@Q A ʍ! 00 ;P P3pp`H'@@Q A p pp`H'@@8 "@ lnp"`@ LPpp<m(@)`@Ex)@@ d'@(ЍЍ@,%XNP @BT @᎘A-P`p\@DV/V90FPF*@0PwP@P0@Aq `0Q Pi\F PnF P%<<<l<t<|< @T<<<<,<<$4@EV9 "VD 'V '@=EV@9@7 @5Rg@٘ @)@) @' @% @#(@@0pU``  A`GaGV/`6`3PV`3ABq P R!@㮘 )@P@"@`EQ R<@㛘 )@Pp@-Mm)`@@T' S P(@@U @ )@B Ai )@PЍpH-m@)`@`X'P@ p R R0B0 00p5 pRQ A $ @H-M})p@@T 'P"PЍHJP`@S KP`+P-PmЍ(@ )@ A@ @ )@K-`NPAU:@ P)@MpE)@@ 5@@H-MP@ !8pN` 8pUP )@)@ A@@㱗 )@)@ A@@㊗ )@Ѝ0H-@P  P )@)@RA@$  @" )@)@A@> @zR"P0 )@)@A@Q"<0 @ eb @a )@0A-MpY@HP@ "@ 0 P`P , "@ 0P`P7 pW3 P<U uU&@,@OP P P  PQ"pP ^U-P P?PPPHP,Ѝ @ 4 @` @ ǩM @GOp@-M@  0 @YH"@Q Z `P@ L QP @Ѝp@=O- M@:?P H`p"@\"@/PPz =?Pw @ }kXcX- iX: @jOPW  @dOP. @ e$ElX oX" @ROPB  @LOP @ M(- @>OP$ @5OP( Q* PX *OP QQ @ # P P Ѝ H-P*@5 @/p@-M`P 0@-Qo@@@(`"@P ( R  4Q 1/Ѝp? @ @ᶨ<NH-M$ 8d0 |ЍH-(Q @ $D0@H)K,58<@ 82D8<  < D,H-@ ,$"D0@ HK 5 8<@D @-@4u08 PMKD0,8C D/H-M$ 8d0 $Ѝ@-M@(`HP    ,ЍH-@@ p{PJ8, Po`ᇁvPER8CR<AR@?RHPDV; @ * @`Y: J @`T ` @`U m @`V f$ P)@P ^(y )@@Y U@"Y@Y U@Y@@Y@3Y @ !U@ @` &U@@ &U@ `&@ &@u @` &U @ & @`&@ & @ !@PP  @ !@uY U@l@` &"U@bu&)@YY 0@P  !6U@FY =@=Y D@4 M@,YU@#` &]U@ &dU@!l@PP ,t Y@P{@Y@ !U@`YVU@o UQ@ @PP  Y@ @xU"@U@ !@Y U@u`&@  &U@` &U@z &U @q!@gY*P HO "@@@pW ]p`P@sd 0[F pWP j7P aH_`"P@`0S* ~p @p@Y P   /<0  %` V kk` 0SV pk kЍp@-$^@)P@`V HIP:h @V  @R ( )@+ @I !@Dp@-Q,J@@$0P,N[- )@@ @,)@M0S^S@^0,N)@@O-tM`@8Y @ソ<8(@(@p[0 q @jPMHU#. @a@Pp<LLL8p /@~}ppʣp[pP a8@ p`=p@b B D ~p!@}dhD ~p,@r$ D~p7@hGP:W W Pk(  0p'4P0Q ԣBp`p(@@P%P =PpP   IP<!qP0ppQ0P  VpH@4P gH V~pR@A /@ @ 04? @yH- (@]@#H-;|O-M`@1Y @{u4~)@lX8)@p@'P@o@o  0$QP ePfP hP vP; KP P HPRP dP )LP PP%/@p<(@V QQ Q`Q` `X`[ Q`@A)@pP<)@W8)@P  3n}p0@  :8pP  .bRP <p)@ 8ppP #P <)@(p!@<)@@ 8)@P<4)@8 6P@@8PJPe 0+` @wp@@ P2pU ;P8`PbP H)$ G ?4wp@<Z)@ qXP Xr 0S   7/P P  @㎻ P 5in"@[@MH-M84)@)@K? P (@ @0@0@ *@-@P#P P  @@)@p@-M@`3JP #PPᒠ`'JP PЍp@ 0  @ O-MM@P@*@Hp)@8dL>*`@ )0@P.) @m<X.*@) @Tp)@d@;P$-@;P `\"@ p@|GP QK@  :lo``@)@/@ A@6Q h  D | ppp pp    x p`pppp ppppppppppppp P ppt pph  ppp p p, ,\)@e ܟppg Wix)@Xjgf ɟpp\I"Px H)@Sp)@@POP)@|)@Ed)@ 9p >At)@&8h)@2p @FP) @FP=" ㇟ppI"P: L)@l)@P)@  I"P T)@ps [= [; pT)@P:@  @ @  @ @P@X$)@Q0Q=0Q8$* @Pn~)`@ 0)p@`00VL>)0@0S@$H>* @)0@ 0S<$0* @ PAo0'@ '@l)@t)@P Ho:@lh<)@(@pQp[PE pU|p)@QWWta.;) @WKp  . @) @Jl)@P  zP  Pl)@G@PJ x` XU; ( @ :4;@" @0@P0! @p 4P@.P  @,@U\ T)@*P@ Px)@P*@LU* @P>  @U m H\pL@PP@P&@ U *@QQ *@@ Uh)@ @PR*P@f/a?PT @  k*@@P @@xR.*P@) @d)@ Vp@(@ Ix](Pp mG#PS3S(PJPUt PJP /xoRUb * @@PX P*@f>.`V ZPo @XQ6P@ : P@ +p P NP% PwJ  @% R(@X@.*P@) @id)@ *@@Pd@R  @3y PwWxxSxhx @8JP@@@ 0!@ e4S@y@+!@ @PFPpl0H-@"@P@[DP  PQ@ H>U)0@ UPPPT>)0@ P> )0@ L.) @o($* @00HA-(d@*`@,*@X~o)p@ PP '? @TP0@RT @@K-Mq^pP@!@ ęx(@`"@@  0&Tp P@W@-M@" @?P b@ݝ"@ 11@"p00@" 1@d@D"t@Ѝ0H-h@@ P "P<$0HS0H-@`)@PP^)P@P p@P@ P *@0H"e"D* @\p0ș@Pp@wP l)@Pp)@P *@P%eT"QD* @4P " * @-P0@O- MP (@X@g0@  Rd - "@@!@r( @m, @h0 @c8 @^4 @Y40 Pbi`@b)Ym @ @ `@I4S @ AYm `@4S @ 7Ym `@4S @ -Ym `@4S @ #Ym `@P0S @ Ym `@T0S @ PG bz j@p@`@ P8  03a0p 0 0S$ !SP "@!@1@ P"B @ %@0_ !@ Z:  ЍO3O-M@(P- ,P- 0P- 4P@uP@m8P,08<Q4<P (fBQ @V]@l@}@K Ѝ@CP (HBQ @8@3T8)@ R*D@(8` a BR RpA @Q ``@p} @0v0hS pRa`P R v@<Qv@< Qv@P PU*v` R 0 0R *0 Q*Eb @̛p pR:ppW:rO-,MM(P *@  㻛P d p"@\"@ @s+Py@ b@XM :1P(R (y(@ a`Z"@V (AP @yAP> @sAPo A @tPP T)@P*@V"@ ~:(di@"`@P }Pm `@ V:0  MP  @6pV. F@@P( g`( XP  @RP  @LP  @ (p [*@XV @P T0  P )  @p*@\ @P(*@@(dV`(dh!@@Px J@@Pv m@@P} @@P @@P @@P  @@P @@P @@P @@P @@P @@P @@P @@P @z@P a`@VP  @  h0P:($ @ _*@P  @VT)@*@*@*@ g MP0 HPKPH QD*@(0 4P7*@,0 &P)*@80 P*@00 P *@<0 P z (4@  *@40 P*@0 P*@{0 P*@m0 P*@_0 P*@PQ0 P*@TCT)@V*V:X  @ 08 @  (*@"(4*@Q 4  ((d4*@V) y@_(VP @"@`V N= P P P @[: P w((@"#@)=`(dP' y@_(P0 $P  @ p@"T :  @  @@@@(t P-'-''H-'-''|- (( AtP P (s@4$(* @Q P  (f(4$* @Q >z (W@4$(* @Q~ Pm  (J(4$* @Qr >@ (<( 4*@QpTp*@ o,Ѝۍ|  @㌘pp@-MbPW*`@VH@H>`)@Q.ln)`@P!f"H* @7p@P @P&P m H#pڐ'@P @5P f"H* @p@'@Ѝpn@L@;H-8'0@0S Hr@@-@*@Q f/*@*8@>@-@k@PP P *@P P@  @@l@R@@m'@0$H* @O-M$T$*P@; *㠻 |)@$*@R P@ї;`KS놔(@X @-pkE I ! $*@fQf/7P Y *@ @Q  GP} JP@)@Q W%1V"HQ WVHPTp)@Q: P |)@PY Z@ 0jQ&1E'EQK0EEPF  @ 0V=|)@P @ 0H *@P7 n @ x)@P @.) @d)@ @? f/+7 *@ɯNP @|ߍO-M`p@|P)@P2@ ,㫺 P5U P:? QQQ Q Q8/PP@Z Y  Q|)@P  @㸖@ߍ|)@P H@|)@P i@㠖H-P*@$H-M@0P  Mp >"Q@L)@ЍH-M@0P  1p >"Q@H)@ЍH-`@Pkh~P)p@ RR$ PR0* R v $$*@*@ fQ*@M@ cH-P.) @0,S P0H-M$T*P@ R@$4*@0Ĺ0PЍ0p@ E.@ 5@0H-MPRP@ p`ᦔp8>""Q  "QOQ QQ#( @ @Ѝ0H-PP@P0y@T6P y@\P@PG-M@PPQ| @  0/P @᎕4*@Ѝ /Pb 0*`@p/8pP 0,`pP   p@-M@PPQ| @W4`  0`^P @G4*@Ѝp ` Q 0P #:r/ Q 0P #:r/O-M-8MMPR@:\e8 (p슟8(@@X$ P p !D"@ `!@@9 :PD @T)PF(@aTC:aP?(a @ RB`@š⠀ i( @j"`@@!P! p P) ?Pj"`@@" q` "@ P `"V @^0S  3/p@Q`@%  @ A B*@     @ p P( 9P8haV :ZaP8< |xP*  0qJ%Q @<Q:9% @  %  @ A B*@    d @ [pP P 0< A | r %Q @ 0<`00V% @ 5 ( dP d )@0zD*@PP @b R q R @T: d)@0 Ye$@8ЍۍЍM0H-M@P 03,( @P Q Q  xCQ  Ѝ0HЍ/0H- !@"@P!@@@ c PQ`@0HYp@-fMMr0+@Dup <4< S@E@   @P yP<<fߍۍpp@-MDD *@@.) @ @Q1 @ P nP yP @Zۍp0H-@ (@XP.) @ d)@ 0HO- MM/@oZ .(@) @X  zXQi `"p@P@@P!Op P ?P @dP @T{`P :~@#  @@@ @ 0(pX P  .  RQq `@P@"@p@(p@ P  P Qr `@P@"@p@( p$ P  P {(R?r `@P@"@p@, p P  P _,_Rr `@P@"@p@0 p P  P C0Rr `@P@"@p@8 p P  P '8Rr `@P@"@p@4 p P  tP  4S?r `@P@"@p@< hp P  XP <-SQs `@P@"@p@$Lp| P  <P qSs `@P@"@p@$0p` P  P Ss `@P@"@p@$pD P  P St `@P@"@p@P p( P  P P2DOd Pp@@"@`@T P : P dT Ѝۍp@-M@x@  0P  ȶۍpd. ) @(@ X p@-MHD *@@+@ @Q @ PC@`P JJJJA@Xۍp0H-M@@ PP yPP x@ 9j&x @@QuXۍ0O- M@P 2Pn@X `@p`95Pp@X P`P=0@ .%HpP`H@z6TQ:lP(`@ `pP @P` XXX Xp Aj Z*4P@`pP @P` XX @T Ai`P@`XX  Z! Ѝm@ H-M@p $PP4 )`PP_ bQJQ KA P[ NOOOOOOOTO(OkA P NOOOOOOOTO(OF `Q CQ GQ 6`P/gQ cQ/A 1 `. `a* `a a @  Q&PH*@`P8@0 )4ăp 4# PU00p T&Ѝ@@@H-P@@m R "@@!@`0@ Z0@ T "@ 0`&X  @ 0W&X @ 0N&X @ 0E& l( @+, @&0 @!8 @4 @< -@$@@ $I@$Y@$h@P z@T @ @ 0&l!R@p\`KUp"P@ pW!@ 0%H'O-MpW `S 8@T,PU@a @ 0@ !R "@@!@ @ QSTSTT\STSTTT: @SP PD Y= 0@ @F @ =4t`4@I5'T @@ 0@8Pp,@4u`4P35@' 0@ @Ps@a @ T0LY- @ @ '@ >8Q `4T @ 4<P@PPW+ ]L8@ D 4Q TTG*TTD  8@'4a @@ < P @PP+84Q @PP*D @ 0$Ѝ++** K GH-@(`g@Px9@ 0$P p 0pW:H%@-W%@V"H0P f/s. p@- (2/0Ͽ ? 0 b B b B P2/<Ͽ>3?( 8 2/8 < 2/< $/$$/$D 2/D $/$$/$$/$$/$P 2/P T 2/T X 02/\4\X ,013?1  Brpp 13?1  BrT )@0`2/3?HVXO>_ XH0p0` 0P@5_4OP@@4O@JJJOJ ^:p@-@)@P xf/- W5V2HR2/RT.q) @ R3G-MP-L4P *0@  L!DnLp"@@ P(@@ pa D`9`P@`XXX BpGwЍA- (@@J0@@ 0#(tE\ @`"@ P@H0p`F vK-M`@@Y3t|"p@P Q P3pLPd*@  *`@  ;PXp*P@  `2/ЍKf@ m  @pK-MPM@P G,PG* A, PG*l5  K`P@p^5 "Rq:*w=S5  ӴP5E5"P p4  P*@`yLgp, M @}ЍMu@  @  @ @@ @3@L0*@+ @O- MMP@\!@2P_ @2P !@2PPH*@@Hgp    P  ` @w L9gp Y Ġ (P [(PH*@@Q pP XZ 0p`P @Pp 0VH3LD `{z*@@ @p@Pw*@ Lfp Y   P ` 0(Y RfPx*@Bfp^L*@ rp 0L *@@pPHx*@@Bf p]  @X? (@XP Kp7 @rP*;$* p f  @0],d2 PU !@ @R#Q  @0 0V`pX Ѝڍ L*@ g@ @@7 @ (@*@ @" @@-MP@  *P*P{*@H fpЍL0*@+ @x@ p@-MPt*@ DepB LT*P@   @ @ @YM $l @@  `@ @   )  @ Q  @ u  @ @@ ЍpL*@@ 4A-MPP@*@zD ep  P` 0@z `C @rЍBL*@@  H-MP)PH*@@ Dxep"   DoeLtp*p@% @@0P ` l. 0C7 @ :Ѝ L*@@ p@-MP$`@ @0PP .@y0PoP*@ wH.epЍpL0*@+ @O-$M<@b}P/@(@p@` qP p ePjPdP|*@L @ @@dp Pа Q P*᭙PJ @p  dpLe*@@ XQ) 1p=0@ L Y *@e6 @0@R0 @P ]`P@0p   `@V: L*@ @ $ЍOLt*@@  @-MPP@*@ DdLp*@  @[Ѝ+0+ @p@-MPLPPI `@^@/P * @/P 4@/P @/P/@` h ``@@`U @r/P`Pu*@ H)dpЍpL0*@+ @O-M-PMP p*@P$}Pˊ@`(D( @ ϊ @dp' ˊUϊ@ @ U'L( *@2"@ P S( cLp*@` 0<( @PЍЍL*@@ W*@ O@-M@P PL @.PP*@v HcpЍL0*@+ @,[0H-*JTR0O-\MPPHn @@`@/@p mcPQ@Q:aPl@Q m\sPn\sm\sm\shndP <p6<(@lW E R*W( rGdWo @ap acWoW(PdWt lW 0 Q@PQWQ RWQ SW H@ '~ Hcp@pW] rW P$ 0 C @ @  Dm'Y   g'P@@ œP `PpU@P{U@UD`@| (H bp@bXH@ <'~H bp@O @ +'{H bp@>pڔ@ؔ/P@ @3 @@ }}$0 L}PХU}> @}P@QyK@Pw Ta@@_  @[ FT `CaV y  `(@!P@rF    t7P( @p l7= P tiFPᤕ Dს@P Xp @ ŘYb\Ѝ".@ @@ 0/ @/ @^@@ H-MY @ 0 (@cO-$MHP A@PXE  D&L ap@ `ធP: p  ap3 P5 X!@pP !a !`@Y ᙿZU @㑿NT  0X/Y$Ѝ@@0H-PI @PmsiFPtiFP rmFP# gtGP9yrFP loFP.О/ V! @@P0HM:@ @:0H @00H/?PT@MᦥP0-! @O-cMPX@*@p\*@`*@d*@hh*@*@l*@@t*@/@x*@p4'`@0,( RP"a@Quxzxz@@zT{@d{@@~@@@@@ z4z@hzl{ z@@{l*@0@Q-A@Qox@@@yy@@y*@(|80@* @0PK8PF*@*@Q>Q*@xyyyyx*@ <◄<QXp U|*@*@SPd*@z'@'@*@p`\*@/Px puh*@_`/PX @6`PSH  PO'@`*@HX*@(*@88T@* @*0@P8P*@ P-ڈ*@(*@$"t*@R '@ R U33UE33CB @ @ P: `*@P /QP *@ pP  p 0W> /9P< `9{'@ *p@!@0LP S^PJ_pZ 4`Vx*p@ V *8^PJU P J^p*@*@h'`@`P  pW ,V /PP y pE (_@Pm.AP"`@@@0 XPEucߍ@ *@ @Jpp<d(@*@QEl*@Qp*@Q_h*@Q`*@QV\*@QN P7@ @@ *@ @ם *@G @ *@^ @ *@u @S ]\`(*@* @ R h(* @ R Q@ (' @  /o"Q@0EQxQ'p@!|*@P-b? `p 垏P @b? Qp@|*@P @^PH  P|*@|l8*@*0@ p*@hh*`@X*P@0嬈`'@P@o2R  ]p @c] *P@4 p ,P+  @*@㹃fP|*@QPq^p3 @eT+QD * @h^p?p @+* @]^p4 @ @*@%H!L1  = @pP⁃   *@ Q< # @Q[@A{*p@? <, (004+k* @*`@,p(P00?P4< }*p@}*p@0x'p@P}*p@|{*p@0x;*0@*@[|;@*0@ R;?*0@Bx*@@Rx*@*@*@0 P'@T!B\\p'@ *@ @vd\'@P U ኎P*@@ 9(* @uP% *@P XH*@*P@*@@n/"o(U * @PO @O @O @O @** @n +*@* @PfX*@P(x;* @ *0@*@ |+* @*@*@x *@ P| *@ P [*@@<;*0@?|;*0@0@ 30@P&x #*@  *@@P* ]b/a? P5Jt A 4 !$ t_/^? P Jxp!B$ 4p|1p"8P`RPP  0 @ &"[*! Y Q  t 4$!{'p] @|*@P @*@P@| *@*@(* @8!*0@*@R  *@P( *@ '*@( P* @U33UE33C@ !//@!!!@!Q**@h!*`@ 0SV*0qW WWK!*@@1@`!p0 `0,D#Pf0 T (pQ$ QQ! PP!R!RQ !С0 Z P  W p: @p xh*@*@QP\ P( `|*@x倻*@*@P*@X*@P \*@P '@ x*@ 0 ,00(008, @p*@P'@l*@Px*@Qm p*@P&*@P XH*@*P@*@@n/!o(U * @'@ *@R@;h*@Pl*@P5 `*@P *@P@ *@P"@ۀ> @Gh*@Po  *@*@   @Gg@P *@ *@o'@PU `*@P @U @K@xX]*@l'@y|h ؀*P@(`@p@@P H'@@&q5 )\ @@@$d ᄀP8 t$@FEQeQQ  !@FP[3 [J   >'@ r  @z @P m g| @?P`@p@  @0@ @@@  0 @@ @@@ 0 @P@@ eP (P* @QKJPU`@*@P @ @P * @㎸V\ gl pP@`@? p pppu @P 8*0@P! !Tʰ*@ *@QQ1QFP `X (  *@0 P@vP*@" `)0  VPo@ @0%,0PT @wK*@@P ҌP$ @ D*@@DЍ   @O- Mdp*@ xP*@Q3P @ *@Q4A @ ЍOcBPK @]B밈o P*@ `@P۳ 0PUP% *@ Q @P2 @³*@ 0U  * 0 ЍOP@ q @!B[*P@P8tγ )`*@@p ᙳW   0*P Q @ㅳ@W  0   0*@plWP" RJQQ\ @A @VP Ѝ @ ЍOJ@-M'@d*@P* @= *@*@@ *@*@0 @0-| *@*@@x *@*@0 @0 *@ @Ѝ@ @ @A+ * @*@-* @0 *@'@ @@ pP @lA *@*@@|*@0 x *@@ Pn @*@*@ @Ѝ@ײ M0H-MzV @̲L(@@P@P (@}P P p P@k Y@oЍ0H Ѝ/ @7G-M@*@Q4 Q1 pP`%  *@P%& \  p \  @@# @- @y܍M-M⬈x|h'@'p@*`@0 P0Q8 (* @p- *@PX*@*P@@LTڤ$p @[*P@P% @ؠ$p 0@T @ޒ m H-TpR@Ԓ @ϒ0 P0Q Ѝm HTpR@㼒p@-M@P! `PP P!"PP:P`ЍpA-M@d*@pQY Y U( @* @!P@PbP*@1P@DSQ Q @ ᱱ1` @ ᫱ q @ᢱ1 @ ᜱ 1 @ᓱ1 @ ፱ ?0 @ㆱ 1 @}1 @ w ?0 @ЍAn 0ЍA @ ЍA]O-Mt p0*@PQ @ߍO? p pơP` P` P``$d @P@"@P $0ㆯ P "@`  @ Y-  @ @Y, '@ ?2, @t *@P  *@ RX 9-㵰 P1)㭰tx *p@Q Q; @ܰD @ذ 㜰P YM P!?0 0P @@@ İ!?0 0 @ ḰP B P PPDPP=Pʈ *@ P7 *@P2 Y- @ @ᖰ$  vPp% @`Y $p `P @  @ 0  0`@pW *@PQP ߍQ Y- @ @ ^ $p  p $@\P @Q t*@/t  *@!6 @0@Y- Q @0 @ :哑. @ 01otx  *p@!6 @0@Y- Q @0 @ !N @pPX$@U: R W*P Y- @ @  !6 P  Y- P @0@0@ @ p @t*@P1@P Q !тP) pP"@ 0: Y- 6 @ @0@ pԯႈJ)P Y- @ @ ɯf)P Y- @ @ tx*p@, @ZG-|〛*@*@P@0 ` @᤯VeST`X  BQ  BP  @G華TP R/K-MX'P@ p- H'@@`V-ږr0f!!  ?p  RЍKOPꨘ*@OPUF,\Ѝ @ @H-O*@@B^*  Qapa`?A aQpQP?QA@@DP@ ppW L aQ3O-LM4℀  t( p@ @@0X] ($ oy*P@@@0, D@P 8<4x |0  @=| *@*@0 0p8@< 0'@a ? Px| 0 { yPX]0@*P@p@0儀@4坮,d( @uP  ^<pHp$P P Q (@-PhH uHpD^"@lP@PX  @ ^D@P P U+K   @ RP  @ KPa X]y@*P@@8'@ "*@P 0gy@e(* @  @儀 p P$0000`PTPQ(@ 00T0 P@X]*P@D ; PxD0[| Tx | @T, @ @D*@yP8< <0<LЍ @wO- M@QbQf Qa {*@*p@R I P[@W0P4` P0R`0L`8*@PQD PUA OㅄPEZ, 0>C$R' P `0p a1P0F{ [*p@R`*@Q8Q t `MHQQQ @ Ѝn @O-M,(0`Q4   *@ 0Py p@y p@q*@@pWpW@PpPWPPpp[p`*@Q\ [*P@Pr {갘*@@!R RR>Q QQ[!*@p@$  PQa=t`A*@`Q V ! Q  0  R Qq\  @ |GFR 6QpQbK*@@` `*@P\ P|P$  B @ J\Z [*P@P fP$ @ Eppt0\ " #\p Pf0AQ  B p RprQD  *@0 @p Ahz p@CQ @P\= P9 U*   `+ p*@Q% QP `*@P @vPz Pp@py p@Q$ @@y p@pЍ, @@-KP*@@ ! 2A b A 4$@O-M∛@*@`, P} Rؠ*@PU 0 p 40p0T0PRPP B $edUU  E 4p g*@ B`   D!!p| *@*@ @j` fkV Pd X`ᐺk SJa  ?(1`)?+* @Ѝm@$O-M✘'@ pA '@pB1!?! gPo 0p  R,ЍOK!*@KP 0 !  G*@P, KPЍ> @O-kMMر!1p QA`-*@* @*0@ p@/@*P@*@@  cPd @RE0ttttttLtdtltt tttPP1 TPyP :P p VP *@@T% 0P& @x?*@   Y- *@ @2  G *@  = pQ*P@A*@@#4N!0@PQ nR R oR*@pYM P @@   # !@{pPp!* @<(@ V RA*P@`  v@P @/O!P@ @T( 0 ! @0@ P QP)  VPt p4@@P @P  @}Pf  0 P`:FY  P@T. ;pT z D@LP e.DLpI JNBPa@PC"PA*"@ATAJ@@X. *@d?  @0@`kߍۍK @Y @[ @ L@G@B @ @.B @ @.0>"@!( @'H-`@PipDA p H- (@X 4@"0@zA-`PV p@g*` @0``p@-@P: P4@P @P  @P'*@`V PP `V*@P *@P *@`V PoP `V@pO-MM*@0Y] @ P@Q `QP `V@@@EP !@*@QqT k  N0-! @w @P= #!@ nP4 #T@p@`!P@ F[`P -P = qP p    @ qnpP @ @ *@ a Y .) @ @V  1 @iT JpG !@@P ^W Ip @P9 P  V @ A @ P  Ѝڍ p P PQP@/QP  + @ ro @ P hP= G> B 㧞ァ "@pP!0@!@@d"@@  ᝧ P [  ᬈ ᨈ0SPP"@㚈  @㔈 G @ ŧPII"* @*@/*@/*@/ M@-M  (@@   bo᧥G-p@DԒ*@aVQ *@< @ョR*P@P Q*@x @u tȈV  @hVP (VP*@@Ͽ  @Ub MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    'O-uMMز*@Na !@IpB@ #Gp ppJHP/JPJn*@@  P-  P /oL pP   @p pP* HPZ @- @*8%<5" #*@P PHp   P   @ @ @ @a uߍۍH-M P *# 0*@ @.9#  @*@$*@ЍH-`*@Q 1/ H0H-o@"@0 PFd*@P @0@-@@O-CMM@ h(0*@00p $40 p(@*@㰀0 ,P  `P 4/P 89P P0P h @ 4PY   0(` 6/PT $P , P ,W WPYPYw C/ ; sp z8DP G`Fv ᐰ (@H * @  p*@`V P  PP `ㆾ` ap0xW0*@*P@  00 0`` PU  P PbP =: 7PPGz @ @1 @l;4PJ pW20Pp*@`V (D W @@!P@N pW Hp `Vxp*@P*@U@PUPUP ,`(P $Q V`@PU 8 @Cߍۍ ? ] @@ml,,` C}p  匓 4@Cp*@pW P p Nl dp U `U4Q   0@P UUPP PP 0   @X PZ h*@P` ` f}d}b}|7 *0@PQ @  T% x*@x'T* @A'  `PP$p*@@T@ Q Q(OP $Qc V (E@P $QX `X`@` pi` Y, hG*@@P% Y n `P @" @4   @0@PU wD @ p@@@0P  ̤PU H-M `@p0 p4/|WP*P@ Q | 0p4/P QPЍO-MMt P`p@/@'*@* @ mPn0@ So@'*@*@* @|tttttttl'*@* @PPfP pQ[ *@P *@P V @!k<(@@`V< `P @Z넧*@P @QV$AP [  0p`pRDo @]pWH@PXPЍH- (@ @ሡMH-BM@*@ !$1P *@Q^T\  @1Wp> 1G*@*@@ ., P@ @  @Go:D lP@@(`@;XP@pp W  AQ  P  mWNW YWyWnW Y@BߍHЍ/G-M℧P*@*@g*`@ Q  @o C@p P  C@P J @ P  㙢P 㓢txxPP\ Y  @@RA/1\0/`h\p P: P  0`] 0p F{`R PU:P @1`PwP @0`Pi `bP4 @0 U`UD!  @P  @0` D @IC BPЍP3`xp0|P"%  @'up. @V ( PO @P `  @ ` `f @ 0B`Q zB  @O- M` DDP pW P| @p|pXxPP@p uBpW!URQ  @ @uz]lH@TN PJP L A@@ $!1X(,xP@u xP@lpDQD% 3z1z/zXY `@ P@' !`z ! @ @Ep Ѝ @e($X* +HU,0s80004p 00 J  APBR"rBa!DAAFPPP L @ !@pPY R"0a!D 0U:JA130p 00 A  ApP80P<@5 @  @0 @ X $P, ,  RTR @|9 @@ DPFQW* * *JL>o @10p04C 40   UAPA A O JP& 4 @ ڧ `@0 R } `eV @ EyCy "L P\* @ 0Ph0dl Q* /L PUPBPP=PUP8pP4[z @H-MpP`v@P@0 p00 00 " @P0<0@p10q 00  @P x0 @ xЍo @O-$M` 0lp@P PRrP  P PP: LP p0p@@ @@ @ x0V @0m @4 @  @QPLCLpqD Q@>P PLp% P @P Lq @QP@LpPPPP@P PPPP @PLpPQP?:P P p 0    o@ 0  e@P 0  Y@P R * 0  K@PPPU:w w$ЍG-M@XpPrP  d 0!  X?X Q b @ w @ Ѝ0H-ML@P 0T!@!@% t T llppЍ0T: tP0T:L60@ t6 @ 01u @  @GP P @/ p3@3/1 "@@/O-MPpP:AL `p@@ P 2R B p:C q : p4 q5* r) @ @ 1 @q  !@nC p:S6 s60@4:9 0@"@0.R9 rE*& @G9 @R  @P' @+rs#*K @@R@ r) "@ @  1SA s:*F@@<; 0@ @*  @P H+  @$ @ P P<=)  @"@   @ P  P' @P )I @@"@@ @0  @P AL @@ . @ xAL P P@@ Pp`VE:Ѝ@-R:P P *2@T@PO-MPP:`"Q2 sS p @PQ`:Q*r@pTSPP`VP:Y pP@ RMZ:Z*0 b `V Q Z :AZ0:   z/Jb q:Z z*& @Z :Z *@ 0W  @P  @ +  @)  @"@ >  0EPpW:<=  @ 0-  04`| P@ P UPZ *  V pZpGV:PQ *"0S 0@@Q@@PY P@ЍK-@| p@P Y:P 0S *r` VP 2S  @`hP Y:P` Q*`Q `O- M`PX@ oP Ul L q " Q&# @ H0Lp/uPWPwPP   @uPQG:/L0S s2Slpplp00rP'tppppp%r020'2Slpplp02#402Slpplp02St0pPPQ *RUlpplpp202#20P0Q: P @X !P 0!  P< P @ @ Y:@tt@ ЍO-MPpP@P<:`@Q  Q P`V:(  @ 0@P @bP PQ *"0S0Q@[0P. <`ql Q+@q PQ*lPP +  @+" @7 @ !@.P PP:"R PV6@Ѝ @} !@`Pl`<@A-P W@B`n`*@V` Xn@*@T@ *@P   @ t @T+K=nP) *@KgD8Q:PQ*" P:R$ R 0S, r:yI @ @ *@ss @w @  @ @8P '2* @ pp p p@-'* @@T *@0@00T@*@@Q '* @0S @0S0SW*P@*@@@sg*`@}s@@pG-`*@0GWp*@@*P@P 0   p O-gM@ `H0 1P SH:PSE*pP$ hP<,@p8D L`D lp\@HP 0C`!D@ aP 0W! *P@0p4` : P Y XoHpX0lp`dP( Q Q ( pP` VYlpP d@ p1 @X @PP+ (*@ (JG@l@ D0L@ P TP p 0 P* PdPpX @yPlpXPd0(((d PP@@] 8Q,P: P0<S`h \ R h `.KT`@p  P P P QP@ P @Q|Q|p=@H Q. 0  p R0 PPOJ QMP PI @@*@ pP08 S o8 <`h`h\<hPpTC HPW<      0DL@ m hTPPXlp\0hP%  Zq0@ pq8\0TQXlp P <R`h` P h XhPlp\0Hh\0TXlpL Lq(   hP $*@, @sP\0PTlpX8PXpt, p@Pyhp0<W   `  DL@ @tW <P\ TlpQHh *@R P  P P} j @ p?PP? p<* @\@PhhTa  D*@ TdP, Q* *@0`@ APPpW\ pE@P?pT pEP0U: T @:U*P*@ 0 APpW@Ty pE P?pR pEP0U:R @j:Uh* 0SpWa 0pP?0W0X Q:Th,\0aLPP*@  Q 4 @RU pd@ u:@W @pp!> @\@P @pPy (PPPLLpQpQdpo @lpPw Pt EQ*h  @h <R`` d\0TP  @ p@PY` `0HPhPhPXlppT*@lpPHZPH p@8 @ @PW Ld@L r!@d@PAdTlp)pdpPTlpAT!:LPT*@  PhP0TP PdpPTpd@p,T TX L PTT*@dT7*!A 0@$ @lpPTP: $ A$$@0P  @ @P3 dP\0PQ/\0 d.DLd Q:i @ @}lpPTP LPAdQ*`0P@p B PR:dP\0 Tlp.Q j @@kP4 d@*@@Tf h h P @Y @ @:P PTlp \0LLp"H\0PPhc TRlpb Q $E @p @Po  LLp"]ppg @O]KGi@P  K/'@* @P 5iP 'P* @T@lpS @*\@Pdp7@d@@QdpTPzQ  @ @P LPQQLTplp\0Q'TPP`0@p"L`0TXlpPPddL\0dhhhPPHX0lpdL`DP<  @`@#P D@4P0`lp `0pF! l P*@R 86Pb@L`lp\0P@ 2S:PS&: 0 Xp僒!\D@- @F`@hPP Hp-W<` ` `0D`P@ 00D` LDHP  4@0P 0!  B*@ 5P @Mgߍs @ @_ / ? @ @0@YO-OM@ @ `P *@PG W*P@pWd hP^ `ᰇ*@*@PW d pW*QQWM: w*p@P4:PP1*d0@` 0P" $u ! (d 5dP!p*@PPU ~ p@ 4P PPU  @@]  @@`V @Q @NhKh  (" @  0P]` d 0QP,Q 4  f P P @P0Lp0  44    P !  d *@ 4d`P  @l`Oߍ@-G*@@P mA-xP*p@@/`P `F @DTdPU@?dO-M@0T^:0吠 <`7*0@08 p PpTL*TDpWG@pP0D`` #!pV 0 ! @0*@ p 4P' [* p 0}롁 ! @ P*@ n4P <`T  *@0BTЍO-ML@P HP P  @ @ @ @BP- Dp ( 0( 0 $`dp `` 012/3?7dhl p0tppI-PP@3?<Ͽ> /`o `P!|"w"D`6oD`o#@`6o@`g#H`6oH`_L`XLL02/3?6o8<\1L` X`\p `` @p8+ ` @8+p0"S/"!0 R3?0/O-M0`10$0$(0(, 02/,10q0  2/40419q? p 71 p13?1 R\ET AT LpQ \TpXP75_012/:\p`0t1ptl0d 3?x 2/TpXPhl0x U @Y :5_7$P  13?1 $5R\ET AT5 0S  13?1 0RPP$ 0P?0T T0pa6oa`@P`@VO@p W,r0ЍP  QO'b` 0 p p/K-M`L RppBDP=P+4PU  QO'b`0@U 3?4O02/ !q p ^0@ p R  R OpUO* ۍK-Mr ,(@p@QpPp  UoP` VLB Dl# 5_ Pz P PO'a` 0 p ЍG-P@ p`CF P =FP  !  @Tc@@'FP !FP  !  PF@pA-@Pp9[`K ` @0`AO- MMHQP(8h*@ 0Bpop @o?T *@4  P p PH*@P1 B*@@ R000 @Y#@* @?*@P`6o`@`To`@p@p pW v`ov Q p p Rm0tPe @#* @@T p` Vk# @*@1/p@ *@P*@P@*@P"* @ R000 |@@0"* @@@ b*@*`@  **@EC@*@P =  Pppp Ѝۍ @A2O- M@*@ 帒*@`4  R000 -@ph0P*@ᬽQ  P 0PU @3*0@`0 S< 0/?sP8PU  PP B @P `D p @R000 ?@#h* @*@00` R  W M  MP0Pr `P@h*@PQU USVP  PIh0P*@`: pF0 PY6 B @DPB*@@ R000 ?@#0* @ R q*@ h#* @00 P000 U  *@ ЍH-M 0ЍH-AM`(p @@P1  0P@CU :`*@P:q @'>P @*@Q p.   @ P @  !@1 @1AލG-Mp@PK @*@Q p`V8*@Z *@P*@P` 0oP] ( PEUP `!* @ #"'@ Q p.   @ @ P @B1pF @ ᩋA*@@P*@Q u b* @1P  @ P@ @=P *@Q P wp*@Ѝ @  @ ЍG P wppЍG2 O-|MMBNpXt @`*@PQ p @ @ ZG @0 *@P *@P`<  @Q @]=PR  #C`a*`@ `Pm#* @`Ph@X$@*@'P@0 d$ Qp S 2/l$Q t 1@ l$ Qt pB`a*`@/[ @v0*@Ps @=PZ '@ 0S 0 L P !* @*@ R5  @014@$ @#3* @*0@0 S R AqR AqA`*@P L  0r @*@Q p  PjmBP`*@ @`  0T t` @P:㠄f V @  0C! D@0  f V`Q#*P@X 0Pi  4B@ ZA\j\ P@  ` p ` *@P `*@m@3*0@*@ 0Sd Ri qe @/ @1<P& '@ 0@q (' @ P@;z @a/ @z @Y/@*@@|Ѝۍ @N/  @@ 0`PP@$h AB A @6R qk`Q*P@A    @ 0/p /  @0ᆉ*@P EO-$MPHp): @P`#:*@` 4  ? 0{B@sЈ*p@'@ PP  '@@h*@#* @ 5_ ARq0?1<1 0 '@# @* @h*@ R A  Pt*@@Q p@tR @(@Q 4O*@㸒 *@04 SPpppp <Q x` h 'h A'Ah*@p R0 w0?B *@@hP'`@04PW00 b+ B'B pP4 0 S:@s*p@@  R PUpPP _`@P 0? Vp `@P @P 0+  됋{ ` @@P }@P y@P@P*@P _ l@Ph@@#3* @*0@0 S R qR q $ЍO-MMZ:``*@P 0Z0*0V0: V* Hp @~P8`P @H @ @( @h@LH@*@p*@<@@X@pW 0X t 0 X t h#* @`_ 0; X W o F0p Wd@W ^ F0@ TS F0p W  F0@ T@ q HR=G 0 ?  *@@@*@4 X pP  P8   "* @ P0 @S10 0cSc1dQ v X (Ѝۍ8=B *@@ (0*@p, P$p0+ q@*@PpxQ- (  0@$P  @81(,@*@Q 1@0  (*` @@+ P@@*@ 0R p 0h 2/0h <Ͽh h4*@P@PpP0 0 gh*@P5"' 0Ww#Q pSpP 8%0-p L0 0 B *@@pP000 9PPPlJ *@0 ,09PPPYJ p@*@0P q0?x*@'p@ 00 Q `+ @'@0@0 0Q: *@P0@PQ4 @P c:P @S30SQ0X8-L  *@0Sl9P*@PPa  *@P$ pp@*@00"* @S @(`0P@ * P$@ P "8@*@P 0qqpq@#* @ 0`R Ph 2/B1$@P $R ,Ph B,08 L=*@y gG+ @'@ @a+*@P  @? @7P  <*@$@40 > H\Ip@-XM@P`P 08l   AH A A( A@@*@h0*@H  PQ`p D@S  2/L Q t 1L  Qt P  XЍp@-d@ QЀ@*@ Q 2/ #* @ R M= ЀO-MdP@tQ pp@*@ P p0@S1/0 B?0r 0/3? BR"p00*@t0 S =D @ W Q*@QQ@ЍO- Mh*@p0 ᚵ@#* @[ 1 /r  3@*0@`0 0@S`C*@@`@0@Q@%*R# GP Q) pW(,PP^`S pP/P pW` `PH `*@P V @㗄 Ѝ`*@P 0*@PJP PPp[ Ͽ| L@P 0 L @@p@W0 PQ` ``*@P 0*@PZO-MMMp8 0(@(PS p000*@0p@*@W`V0  /r  : Sx * R"* @ (%0P?n1*0@0S <PfRW h[ WC C,@g W0PVP 0 ( @c*`@ $ "* @ 0 0B?p( PX p  *@@*@(08#0*@ @TR S*@8% -L`T ? a@c0 Q*`@SQ(0T    R 3(0 P Q 0H $pR00HP/U, /@ *@ : @( @5P p*@#* @ 0R  Q 1/ YxQ    @4*@*@ (0*@p*@ @X8 R (00pOaP!C_pXX   @#* @ R (0 P @*@Q 0$  0 PHPV / *@ i: @i( @5P [3 *@pt?#"(0`V $*@P "@#*@* @ Q@@R SPPP @+4#*@* @ MߍۍO-MPP@h:`*@Pb:h"*@* @ἢ*@  U :x`U?:k0 x됷?#"1T9A'(\%R !p0ޝ'༢*@ r!V`x``p g 0W 0QS0R0000 5*@0x` CUh!* @ 09*@0Q0Ѝ  @0['*@ / O-4MMPH`P@:/; @ ^Q3r@*p@@0 25Y,0 t1I $P(``*/*PA`0+S\1 U4KYc*5KV왢"p5#0 { !+ A a`0 T$P1 Q0kS q!(`#?$ P 0D#* @0 X1S(* *@P (,0P(@pPC,0p@T (,0P!2/!(Q0*@ .5Pl $@@ pPK(*@tQD(,4q*@P    / '  @9P *@P ,,*@,  p*@tZ0*@4$@ p(,0PXI*@P    @#* @ R  P @*@Q 0 Z&  0#HP#! 3@*@  }8 @}& @)3 pP$@,0  1/,0$@ p[(`P4Ѝۍ.@#*@* @ QppR _ P\ P @7,0*@4#* @ O- MRPP@Pp*@ P P GPb*`@8Q*@P A A0  0 Q *@Q   @0`? 6\%TAR 000U<6R pp 0p0 0S0T*@PN 6bR*`@ p p0 2 0@ @9\5)S A0  J @#6 0S0!*@P 6bR*`@ p p0 j  @0 @ 0 ЍO-M`x*@!@* @ p$%R:p1*@*0@Р@ V *@:`*@0*@k@@  Pᐇ/ !T)A'\P 0 ``?" ``  pp*@^@*@*@T`p`*@dPxM!T*@* @ 0j ` Z03,2Q  AS  0e*@*@@03u U rQS 0v3< *@p1*0@*@P @pQ 4 Xs@*@@`*@YPQ p P hp oPp7PEuPp7PEu@lT@*@*@(EQ<@X5@*@`P*@*@P q QQ 1P1PP`U TJ P   T:A0*@*@@0 c3p1*0@*@,Q Ѝ  @0#A-`*@0Pp@ Ih!*@* @Px*@`*@`*@威*@P8H *@ pP*@WP5`HFd,W *@1`*@*0@!* @T@p P` e`P   @0# @#@-A*@@P WO-M@*@P@*@U Rp p*@0 0B?n P``0V8$QPe *@ ?' V*@,` `#V*o $(p p(0 U 0?0`V  [:@X 0U p`pop0S`Rb*P@*`@Qr.*p@TQ  d *@Ѝ7 @"0H-P*@@ ?*@P !# " 0V  @0"p@-B*@@PpR*@*P@Q`@NVV*IVGVpA-MP@`pW@*@Q p ( @ P @  !@#Ca*`@P!  @ xH*@  R0Q  pL `P0` px6*@P *@, m @y/PP*@ 95 *@  *@ЍH-Ps @ 0@&}Ud:`*@P8q@| @}@S*@c*P@*`@P  PpR 0OP  @  PpR 1K"@|Q p @p|*@P "< @|0PpS  h  0@|P(Q 0# @H|H-@@#* @P8 0U 3?`@0&0 0t0 D H-@@P`V DP @*@P 1Q`*@ 1R:P 6oV`*@P:pPa0H-8 B@$|0@P@00H-M@ $0P @ @! |H4 AR: Q Q Ѝ0 @b!O-MP*@` @*4Q P@`s*p@ U *4`P P@%$ *@0 p '!#* @ U R/: Q ``W`1cRP p  ! _P* F00 RsP*p@ Ta3`*@1\%T9AR !0 0hr *p@  ?/*@ @<*@*@Q P QP  *@ U @ P PP 2 *@0 vp! Q.\ *@0*@ L#@ 4t 0S4 B  $**@d1@*@P 9+hr  X*p@  X  X*@82 *@p s1W @#pp* @ R  z溯@*@QN 0P(t z溯J @ n @ nd 0 XⰠ[@#* @X ~ "* @p  0`T @ br; RpSQX  c ^0  4P(& 㰠d[@*@ P 1" * @ ?T b;r RSqQP 0 0p hx*@s *@*p@ p0W  ,ЍO-tMr0*p@P 弐a@"* @`1\%T9AR !0 0 hR  ?*P@- @<*@*@Q P QP U @PPX@X I @$ ~CP*@@@#* @P pR 1dPdt0h 0dPdth `P *@,*@ ZP*@ @ P1`PQ d h0PpppP P2x*@  R0V ? 0 p!Ur p@Q\.0B *@@4L#t0  4   $*%*@/@*@P '*P PhB*@@0 PtЍ @`TO- MP*@@*@@P0 SUs2# 0cQcUaQ T /r 30*0@@YT  @Y@ Z@"* @ 00l ?PR v Y2  R4 P00 PV`0 U@  p㑊PU`J+PU p Px*@Y  R  pQ( 0 ^ 7,RQT 0 O (,  0!*@P  0q@*@@P up@  0@#* @ qR 7@  0*@P`0 +JZ0*@0@@ Ѝ7 @O-DM*@p@*@`W VP **@P@WP`0 p V ` p   hV 0,P@ `T><4 @dSD>FQ 0t0"8PrPV p*@#* @,080 $4,0_R 0PV @#<* @ R ,!T 0T2pS` $0P@㕨`Vp8+P 0V P 0 @P-*0pP040 $PpW@̐N  `Y Wx   @r$PQT@E 0PE QA 4O?@*@Q 0,( `*@0@*@ *@0S R o 0j R d 9 0 0  $h*@ T !8P `*@#* @,80 00?R00 @#<* @@ R -40$ !   *,`@(  0*@P  0@#* @ R   0@#* @ R 0 "0* @ 000 *4`V[p>8aPE p*@*@800 /Q0  @,*@<P   0Y倁, @*@P 8 0I 4`(V& 09`F4`P@`}pDЍ@@*@Q 04 $Tlr @R @00H-R@*P@88-  0 *@0@0O-M@P *@@P <*@p*@g *@p*@ݱp*@`@p/@*@ jTP"a@Q)|$h((((((( d(((((((*@EP FP PP *@UP XP BPp @P| @Pu*@ *@pb!@ 0 *@ @Jv 8 *@@p PY 5 @PW ; c@ 0*@P*@L @{=x*@0*@pq 5m @0 '@ R * @ v`p*@Y*@0*@P*@pI*@*@@*@p:*@*@/p} RY` *@P  `P  @=`<(@pPUa *@P*@PP @J*@P @@A@=U6@*@QLՍPP @ X 0  W1pp8I`/T@ @T@o @2VNJZ@ *@P@Ѝq @H-ō (@ @uVsp@-M@P` 8VQ QЍp @ 0ɡO-MMa@*`@P@*@PP  @@p PP  @8#B* @P*@@  @#P $ @9 @*@P P ^ @l*@P | @d @pP @iT P @bP @[P' @T*@P PF @H9x*@ p*@ 8@ov' 0p  a @/*@@dDt!!/00b  0 0dP@0!!  0# @  @vtR*@в*P@*@Ps `*@xc*@ *`@Q 0A*@@  @TtPW *@@`, ?P4?@R%8pp*@O!4# @1!@0@?Pc p*`@0@p0Y`0 0  @!tR*P@P @t`V K @@ t`V sP  @t`V =K @@ s`V s*@A(R*@*P@P Tb *`@@04*\*@)@*@P ^$ 4c*`@P*@( C*@@,P pQ fL ,pW:]L8*@  Q P D @1 *@Q@*P@P, P @!P t @P a (!@BP( ( a $0@!@!@$@P P @@ЍۍO-M--MMX*@*@*@P,P=  T Az/:&\%R0 ?Z 00 0 0Z p`Ppop`PWPOPNGp@`W*@,Z:4@ⲧHL$0P_`^@PPA@ UPQ*@pX p*@b*`@x*@l @t,P pP4P8儃 xD*@Ћ(< *@(@*@@0 qTyAT@4!\5S 0p0 0hB *@@  ?Pp &  @<*@*@Q P QP h *@*@ QDR Tdp`,p+ 0@ 0pr *@P  *@PP> U @P\ 4U @P TG @U @P X X0 P XA0TX@ 0pX@0gp` T劁 X` *ADP p$@*`@(ppp\u:  hpP )@l*@pQd #* @@TQ@  t` *@*@T 04%!TX\ p*@` p pbdPd*@ YPXZV00!  Q  :0QQ : ^dVa:d*@P 9  @ 0q @ 0lPm @#P  \*@hpQ6 ,*@5\*@h<(0 pdP X*@ XPXb  @ 0m @#P  *@Q< ,*@;*@8 *@ `@6@*@8pP7Ȁ @wpQNH @@[#PG ,zP@*@*@@*@ 4R Q# ᧾0! *@sl`@hpPpY:pȀhPQ ሾ0? ? 4`O,H`*@X@0 B?qk8 ` * R`@ PmH0*@Xp Pd*@Pa(P J S:*@Q <S* 3P*0@!0n S!So V: FPt,L@/jb F`Af0+S[1kP4[Xs#5[W2"F  K '+&A ``0 T,L@1R0;Wb"!![!d* @X0 RH W @ dN;s:hP @(*@LP 1,d *@3*0@0"00@$P+H@*@P  0X @@*p ~P( *@Ph pfP *@Pha ` v*@ V&ʆ( pP (1_0l X V Vt@ pP?  pP U*@!X0 PA_@p3 Q L!X`PHpLP/ x3@#*0@* @ R l@ \pP^BPJ "LP* @HpX`@ O 1*0@0S P' @*@ P    0@!* @ R P @ *@P @  0 @@@mo@*@XP 1 @ao*@( @ @!LPPHpX`@ D  Rlp  0LP*@lp8p*@!P7*@Q2 @*@Q pP PpP l@0*@P/Q ?s0 q3?p01 p0 t*@%* @P%* @@#* @ pR P1t0Xd0PtXdp,py*@P *@P *@P;4@#\* @` h@R 1Q <8Q  ,B @ 0a @ P @@*@\ Q Ol M *@PW @\*@Q 0PN  *@L0 @LP@PU *@ 8@#\* @ R 0"* @ 85 =`L0`T  0b0 RWQ!d`  @#* @ R Ȼ40t p2/L@@\*@ 4ap %*@P`P @#* @`@ hpR  @h*@Q 0`@hp 0! 1 , C @ 0 P*@P  @^w @ PJ 5 *@PQ @#* @ R d@*@Q 0h,P  0  &ph}*@H0@XpLd@*@( P 2/ @@@m*@ u*p@*@P@0 pXp6:p*0+0 `1 T@*@40P0003`PPS`Pa, \`&% VB*(>DPA \pT@Q`*$HfpbT@*`@㄃@*@*@,Tr:ED*@Ѝ؍Ѝ`  @`0v @*k`  @0$ @ o @4!O- M؁PH `XRP:  @?P %  @*@ p R @p pW8R`*P@P   `PRX.*@1  H`00) "  @^e*`@ 0 P >?PS Q *@ Q ` 0`& 0#0 Qp"*@`0``000  *@ # " `pW% @*@P  @` @`P*@A @*@@PP @`P  ЍP!TjO-lM@XX" * @*@ *@ l @X,Qb (@*@@P Q d> p,  ᄳ@0*@lQ6 pT+:UP& `*@@*@ P@pR P1\t0P\t`#P  @PpW:,X:lЍO- M `V: ERЀp*@@*P@  PpQ   " "  @F Z ZP Q `Vpp ЍO-cMMz#AP LH\` @ @P, @P @#3* @*0@0 S: R?  < @ @{P*@!I @ @nP  0  . @S*@ @TP,iR   CN*@P #b B*`@*@@l1 0@ US^X @4xP($NC/@(X*@Ѐp(@P `*@*@pK@Qdj @ 0pLk*@p(P% P%`/  @kh*@P E @Pj#`@* @*@ (Rh Qn (lh*@Am ` 0 "h#*@* @ R   @@    @@ A*@@P  @h(*@P@ZE(@ @|P#@* @*@ (R Q η*@Q ķ Q 㿷     C3@*@*@PU Z (C.@㞷0 Z. (C.@㔷,C 0(, Q 1P  0`P0`0 , Q): 0@`30`$ Br0C ( 0, R 1Q00 `Q`, R: 01  Br$ aU B Z $U1|0$U|CS/@Q*@([:H*@Qu *@@(Tm*CS^(`pp(Pa C@*@*@[ Z (C@  Z (C@ C(, 0R 0 00 ,0Q:C(, 0R 0 !, Q:[ `$ @CZ 1|[ t1|[ t(@T:*@p(W]*j @ 0(0S `0@&P#P0s(pW:B `  @ @ 0 @P(  @@   1 *@0P @ @ 0 ~@*@*@p*@PAP` pPQPW:*@pW*P    " pP=cߍۍy @ 00@/O-IMM@@P8*@@*@P%*@P Q 2/R `#p* @7  W *Q 0P `*@ P*O   @@T " !@PQ Q 0C*@@,Q" !@ HHHV  @ R  `p  Q P2 p @ @-b @*P` @Q/ @pp)P 4O  C &  @ @ P7Q 02b @P4  A+@p 9P  ,  A *@*@PP@p.`Q 0s*p@,Qj @  (( 6 P  P  /r P0 A q0 P0 AP=@ *@@0 BS qKPU j @P1 p p@ ppP P< @  @7 @7PH Pd!* @ RZ  @lV@*@P 5_ PPP   @ @ Pt *@p @@*@P PY!* @ RO  @4K@ *@Q L?  @e @P*@@*@Q ` @p   ⰐP  0 xA@  Rr P.Q`VP!  @ .P%!  @PPI 0 Q 0`3*0@`V *61 0@00PE @ZP6*@P- Q 0PP Q 0P PQ 2/L P@0Q @(PE P@5*@PPg @ Q 2/0  P; @P*@Q 0% Q /* R   * R   Q 2/p`GP*PvW_ @*@P*@P IߍۍGP:WR WxPW0 S 2/"? 0@PQ 0p0 P2   P 2/00} ! @ @0 *@P  @E @xPP Pǡ*@PQ@UC0 S 2/1 p0@00 @OP*@p  @7 @*@Q/0/O-M*@Pℓ  "*@* @@ @ (@P P*@`K@d @ 0`eeP`(  @R@p00R 1*0@0S83*0@0S!@W, s*p@P(P%J@P`  PT@3*0@0S R @ p g:js*p@T/ @ Q @P\ PX  `@*@ p*@`\@PpW P1dt0 "P%,Pdth= @ P ! @" (`O*@ K*@@[(*ߍO-lM@X+*@@,Q S(@*P@*@ Q d @,`e @ 0`vdQ `PT:0P*@ @*@0RpS 1\Rt1`Xdp7\Rt`XdpppXp0pAWi4 H\pW *P! *@P=  @%R0$  @/*@P+  0p0#p'0 Q P# *@P  @ 0hc @ 0 p"* @ < @ @`PUo:NS*@*P@,XB:lЍ  @0bO-,M*@@`p(P? T"* @P1\%T9AR !0 0h *@  ? x` t@<*@*@Q P QP XU @P( P(  @|(` Y$`H` "`PlX*@!D`] *@P P  "0* V Q$PU*@  ?U @0P`?.1pc(0*`@H PR L 4@P0A_!  $P(0 8 QU $4$ L# d0 4  `@pY "* @ ; `*@`$PVB*@@*˴*@V@*@P +P PhB*@@ P,Ѝ(@ 8P$Ls 3 03p?`PC e2! US Q0vO-M-)MMȂR*@*P@p@@*@*@dPpXP2$P,A*@@P 4 @tpPN @ pP #$* @@@*L*@@*@P Np @XP$E0TT~T|ʟ @e @` PP0$0`pU"0.p0_~Pk @"p0$EVA*@@P  @p`$͇J 0_P.1!`P@Ve_naA  @p0P1 P@PL`*@@:8P #* @@@@*ų*@P@*@P %p @0*@Z `La P D!!H!`La;p؋$5_S!P!!T!Q`@*P@PU B  X!!0Y4 \!_>!T!U @PBZ` %.8D|0< t00 @p ?.x0H o*@ PP0 XPUHP%~0X *@ B| B Bx 80 B oPR0c /0`P`OPN`q~``@@f`pPp,P TPT4lc*`@T\hXPXB (@pd*@L@Pp dx,P d 0@P尀`p1T9A'!\%R !0 0hR *P@  ? pA*@@*@@Pd P*@T @\%R p. P!' 0*@*@QYP @ %, %**@@*@P Y *@P  @`XY <*@QKYI 0`*@PfM *@@  @R( @Yȁ`*@PS*@PPL,r?*@ L@ p @P fs@PW @  @ ᴠPO  @ @8"!* @ R @,0Pp*@0 @ s @_?`P @XATl ࡝Z *@`4P [ Q d0p8S8Ė< \$ P!*@T)A@$P ` @ P 0@ PE *X30*@ @*@P ^*@ @ RQi O  @m @ P+ 5  %*ѩ*@\ @*@P 1 P:% @J @j P  *㮩*@9 @*@P  <dQ:Y @J @G P < *㋩*@ @*@P  *@P:Lq1 QQ+} @|A*@@  Q I @WPJ @ P*Q*@ @*@P S *@P 0 Hq, @FA*@@ 0RaH I @ P @P**@ @*@P z 4 Lq, @A*@@ 4RaL I @P @P**@s @*@P H *@Pg@Y  @F~@ \4S+ R( PQQ PUQ P  @  I R  :  XIQ@qP*@*@*@*p@% A*@@P I @P @5P*{*@ @*@P } *@Q,QS 0"!, 0@iA*@@0Q4e I @DP @P*>*@ @*@P @ *@ (R xQ2<Q0 6 @1A*@*@@x 0Q<S( I @P @P**@ @*@P a H8%<5"#. _ @A*@@ HR?8<5 I @P @P*ɧ*@T @*@P ) @L@%D5"#D @Q*P@ LR?@D5 I @P @JP+*吧*@ @*@P @ @ @ p*@P  @8@H 0 A*@#* @@QzPx,%Rs*@P> @d?Lq QQ ڤ @UA*@@ Q  I @0PJ @P***@ @*@P ,  @ @P *@   ,84e00 < (%* @*@ @*@P Z*@  QWPULpQ*@P @ @PP *@ h0 c L0Pp- C0pO$e>qV1 `@U_a\``@ LPp00   *㜦*@' @*@P  P *@P*~*@ @*@P  h l0 *@p @5PL  QW0P AH4Qd P8Ld,L×*@  pP@ 0b432 R"1Q SP X[ @: @P <*@P  8Hdd L0*@P` 0b632 R"1Q S@*@P  p0P QP*@/!`@ Z5XP*@= Ⴚ,)P*@> `C*@  TK*@ 0P @5@1*@*@@ *@)P*@P)UQc*@*P@*`@P @3 @s @`*@`8, @@ 5P*@ #* @ Q P ᧇ` K㱃Q,*@*@ 0@PP p`L0ADP *@P @` @ P ` 0``@` 1Q  @Ra*`@P  @0Pw @P  p P @/a*`@P R @ P @P  " @ a*`@P I @P @P ` 0```n `piC @P @% @~PJ R@p XLuPuMR*P@ *嫤8@*@P   pq*p@f @PP  @ 㭚P*@ @ @ @`PYp 0PRp @1Q/Q `V"*Q:Q! @sq*p@P R @QP @P   Q Q @Ka*`@P  @)Pw @Pj  c@0p @ p 0P @B@@`D   7 F? ᥼@ @`P T P1$ T9A  R 0  Y SP T g N' @@ @)7 '   @@ @0@HQ^ @*@*@Q*@*P@h#* @QBP@   @'Q!*@`*@*@*@+0 p0pWPB *@@2p*0@R  p06 !@P`Ag'P*@P`'U*@Pb @ *@NO- M*@P,*@*@U *o  0@Ppmp)ʄ @*@ "@@?ԻP` 0PpKP  X @[<*@P *@P *@P *@P P @ @P: @@*@P 9 @P JB*@@*עP >80!9AT)A\Q\% *@Ao*@h YP @2@ Ѝ*@d 04C'"q*p@p#%„ ?DW& RB*P@*@@i<*@P*@P *倢 @*@P @*@  o,qTyA @1!\5S A 0@R*P@ ?>@P<*@P ᶾBr*@@*p@ h @@*@P 奾8 )A\QTA\?fP *@*@P 3 @@h Q pj a@P0 R DOP@pU: @m*@Px$@*@@E @| @ | #*@* @ 8A 1\%T9AR0 49AR1 8C\5!* @ R \%R  CR/ATA\/#* @ RV  0SP 0SL 0SH 0SD, ,0S@0 00S<4 40S88 80S4H H0S0L L0S,P P0S(T T0S$` `0S d d0Sh h0St t0Sx x0S 0S  0S 0S\\Q//-RJL%R60H-P@ ` @XX<<@@\ \2 p 2??τu/7 `*`*@ @h 0HIH-P@ ` @XX<<@@\ \2 p 2?τu/\ `P *`*@ @$$h  ŕdp@@SD `PHPS0He @h ńdp0HeH\%Q TARTAR(  C TAR T@R 8AR AR /ER CR $*@QAo TAR/*@PPH#* @@#* @D*@<*@/P/@-@*@P < @M @@r@-@*@ Q /**B R*R&:@3 !@* @ R Q p_ @MH-@*@P r @F @P MU *@PY0*@pT*@PU *@P @M @Ml(`@XbP@P (@JxPup W  AQ 9x P  mWNW YWyWnW ,M pyQ8*@ @XMO- M@*@*@@0`*@@ 1/Pj Ph*@ @A $/P] *@ *@ Ɂ@P(@ p  /oWbo[ X::P%V/ %,DP*@@@*@ZP P p 0`(p .W [o*@bo@*@@*@ Ѝ @H-MQ*P@@T *@d n 0^<Q>0S`p'`&p @T@T  @  0000 P@@Ѝ @A-M*@*@pPdpp ` @P`2q`SpT,tQ! 0*@ @+,* @*@000 0@n@`ЍO-MP P` `@V *@ pY-  V @@@ 0 p 0p p*@T<*@ R6@0@*@0`*@pL3 BR@Q  v8d H4LĐ@P 0b532 R"1Q S P  \p0@ `RЍO-$M`*@0p !?Hp$ @7P 00P^  x 0@} @KWKP*@ @  6 *@ R0 [Q  X  0 @%0 @ /) G? Ƕ ?0  *@ @@0K*@  `Z HK $ЍO- MPJp*@`0@Pᐢ!( }6P(*@ Ѝ @0P @VKT Pb6 P  0 @?K P`U ЍOJO-MP *@PЍ*@0*@P&J*@ $*@*@P*@PH A*@@P # @P*@P *@ ?) 0,*@ @'P( P PJ*@  ? *^*@@*@P Ᾱ`0*@  eR*P@`t#hR*P@Ym#p*@@T TPA*@*@@"* @PL HQ*P@P f @,0cp*`@.PA#?#pU U@O @P& P%  @P$T$X$*@*@~@*@P S  @P @ S*@*P@P  @@*@ǜ*@R@*@P '  @*@P  @  *㦜*@1@*@P   *@P *@*@@dP~0X @ J?,*@ЍO@A @@-\%T90@R"-RH?>ˀ c C*l "BLŐ % E|0 %,@ 0P%0@P%,0@Fp@-`*@@PP Io @ 09 @PpGO-MPH0*@p8^P*@ R/P 4X*@*@N`PC YJ@.!2 @pS @000 R@0 TPpUpP}\%1T9AR  !0_ 0B *@@  ?hR*P@ ᦰ@<*@*@Q P QP 効U @ P PyPy `Y!ϊ0P @X*@~ 0a"!on P P `"@Tq !B `*@@Pp8p*@ ? W 0Lcp R "pGp`@0p00GQ$ CP$Ls A$ R?0 B Bh*@@@c*p*@*`@>*@P ᠷBP P PЍ  @)p@-Rb*P@*`@ @ @*@Pp p@H-XM pP`X@᢯P` @IXЍO-\M"`pP&@! o+* @Q@P*  Xz%$H !!@a !@ \ЍOϮ& P* j  @`D@ ! @@`@D  ၳ@K ᡚD/P T `*@*@ P*@& ?eH+ယ\Ѝ0H-@`*@ P:0*@P *@ Ea1S0 '@0   @00H- Q(P@TTLTTLT@HPᄻ  @U*@P  @3 @P 0 @*@/O-M@\PT@P P~JUQ PV|Pv V. *@P  @<*@P9 @L*@ pqqR ` ٮ X` ϮZ LpWQ @ p⸮W 5 ᮮ ?>p(aCnHg0*/1 Ga]☠ȟLu C4 ʿw0*Fj0`\ 5 N P ߍ, @>H-P*@@paV Q PR P P A@`S @2 *0@00!R  R//G--`PP:@Pp5PI*@!% #^1 F7KR 9 # "7 ! oQ.*@Q) k0*`@<P  R   [*P@{)Q( `p @ P *@ w ap A @-"* @0!% ^! F'K^ 9.$P% "  / #"o  O-8PU/w$"p@\q灰"@p> X8A"@a pWQ\ 5_P5_pPQpH8Ph@`WXH-`0SZ [Z([ 0 B @@o" > @@ H-`0S[[[[  B o" J @@ H-`0S\D\(\`\0010B0B" Z @@ pH-`0S\\\]0010B0B" g @@ HO-M$uW Őlp|hh79ON`SQ0vvq|$p pWp!@4OW:0p[ P` N0AVU P 0f PPX@``U0@B D  Ep_T pa R  p NpG`P  W0D R| !  !P! B!Y @2/P 2/ ! !Y2/ B2/! |Y 0@0ЍO-MPR @qPt @ qꨠ pD pP `P e D pu (0 c0< C0 $ D8(4@DP` @ @4 Ap @ I0pj7  @ @ @   @ . ,@C @ hP )`Y? z D p8e D p4 㞫{p) 0( @T!*pcT  0 P  @/%0 *PP ^ ٪ߍ @ pK-M@ P;pPa`p @0 P+pW ` 2!ݍO-MMP`pl#@PJ   P)  P/P rQ" 0@ @pC$iP{p `ȼ LP `pWkW~h Upl~P `p -z@`PTVJPQJ  !o ~PBJ040 #mP9JkP5J[N"  @ 0RC E@P#J~PH  pNDPF"  @04C 'P@PZ/` P &V iTJ'@ߍڍ   P ` P" _ @0C~@^`{F~HPdZ@`oZ [P ^/DTp P X BEA-M@)`Pt@p*@P  0r*p@0P  R Ѝ2 *0@0@ 0BS*@@cP P*d*@P Ʊh PO-MP@p*@ `@lhT \ *@2*@QTР JP @@#* @ 0 ?  0 Р @*@Q ' p 0 Z,*P?p  pwp` TPީ@c0*`@P 0XDP`@ 2V 0@P 0 0RP,  @% *@8@VAp*@0 PG, RC6 >ERp^1 F7KW0Su #3V @=,p*@#3 @- *@#0 @ p*@P  @m @P; W *@*@t @*@P  @s @P 4*@ `᪾ 0,*@0Z,pP0*@@#* @Q ppPRp Ǝ!$ ? "@P *@p TP (p @1嫊 `媊J`$WJ$`Z:(p$ QZ :!p171(pQ p(pW*@0, `P`hEhp(0(@@ @PX( (,p 0@P((P( Py@$*@[0@`Pb: J!  *@ 0L  @:*@P I @ @PK (@$P@ R*P@00?0P0`Q((,`*@0`0` B (@s*p@P0TPpW , p@V @ @ Z @@( ([*@,*@4Ѝ0pSR z / r P{  @2>*@#3 @O-M@*@@ 0P ᝍ@Pw *@0 Tpp  0f 0RpPY?0@`p   6/  H@ `*@ЀZ  `%$ @  V$ %`P@QPQZ @@P` @  PPP@QZ @ЍO-M*@Pp0@o 0o&"0W$!"* @ `pS W/p  3R` 0Vл/*@>` ! (@Q` R5J@X*@P 0*@3?R' 1 q @ *@R  @ *@P I @ @PP pPTЍp*@pO-M` µ r@@V*p@1/ "*@* @*@V   FP 0]0PP !@ @V @Z<XЍ`ᨙ0p @Z ppPx `pW 0@P X Ze p`@X"  0@  0,*@P  @   @P  Pp W*@O-LM@P*@ppXP 10P 0@ C@ (KP `ip8РW,$@ @P %0$ !,ۋ ! U pW`@+* , @ P #"A p`, p @P` ᵋ,ᰋ p 0 ( 3 @ 0*@P I @} @3P @ *@P ጋ $pᆋ$p , LЍ*@0H-R@*P@!8 ^! F'KQ#@ @O@*@P$ @@3/ @K@# # *@P@ @@P 0D @.@*@P;O-M(`@,P 0|V` 0puP @h`0P " Z P`pUЍA-M`p@y,E( P ^ ( FKpwP 9w:0HPZ0 P@P(PPP PPP0P4P8Pk6 V  ``?k7 VPQpW#* `  @T pW*@`!C @@ X*`!F @!CC@`@T: G- 7O0@`pWT ?p@T s5T P@0S6 @T@&@T@ @@T@p@T1W1Z:@ PUpP*U p p@0p0@S VS(B'K-Mp($D` P fP$ 0v!   P ЍK-MP$Dd' 0T !`   HP`ЍO-M p@P   @L{P \ ` @`Ѝ  Q 7 "0@P`rQ "$  R)$HP  6ka 0Q nP PV % "@ 0pP`V0%1 # PP  @ 0P `P   @ 0X PqQ ${/ b w  @@@  $`  0@ `P [ a P`u [sP@`To T"@ Z+ zP1 pD 0 PPT$@+  @ 0@P  @ 6P  P P7 P@ PZ:/Q  ? @ 0{ M0H-MP@ 0r 0Ѝ0HЍ/M@-M@P 0 < @1M' f1Ѝ@Ѝ/M-MPp` P. @HL< 800d`@,$ 4(4;T$ĦOp p H  P-$tTWР|p f &@ @%+ۗ @ @p @} @ЍpWQ Р [  0a`pPa@ 0zP }@ 0` Ppi 0[ p p 0pip  0pFp P6 V0B갤 ᴴ0 "! 2@ &뢠D p pW @+D p Р  pk @|@y P P ${ Rx*0pqe@`MH-M  00 ЍHЍ/O-MP`pP$ @U P#? "R R$# P PPH@ 0 @P !@ 0 `P [@ 0P@ 0 0 @P_ 1SS@[ơʁx@ 0}P !@ l1S SSH L0@  0 ip) 0 P @ =@ 0>`A 0 @P`ЍP/@-M@BBQ  Dp @@ vЍ@/K-@`P p$H <(@P @ 20  H (@< @&0 (@p 0T U@ K0 KO@-@P P  {wQP j@@E@K- @'" @PT0U p`v0PU#&d  PUX 0ps`PUp&q#4' Up Pq@@ \$$ @-SN"@R0^\ T /$ T! /$  T! /O-Mp @P T= P 2(@`@0 f/@T-KG,@ +Y= a 0@P (@P`@ `@ 0G/T:Y p@D @  0@`7/@TЍH-(4$$,0əPO-$MP@PP @P $Ѝ 0- $tX` H0!p *cga 0 Q0 ` Pp`PZk X0 00SPR 2@@ 0  P QPU`a  0Pp $PW p 0` pPK pZ0 WE0 P0IBRE#8\    8-pu $$Hp2`r"pTp`` H QQP p`pZ P`pV:LP PQP@Jj@@C 0&p<  0 0  0 `P  4$$   $@ `@O-Mp@Q W#_P@^ BP@$P PP`  0&P @$ @ @ PЍp@-Md /`@@PR@ ]p  0r @ @tЍp0H-hRLR aR bR,%iR sR tR#P"@ u@P/@P@08 R @E ( Bp @@8@0p@-MP@Qd/`@ PQ @Ѝp0H-P@Q 0/@EQ0@0A-M@`Pp,/@ P P # 0RS sS bS SS pW bS S BS R j\PJ $$2!PЍO-M` o r 0R(Q0Q{ @pPt Pp }Pk P P`P] (QQY R 0#"P R " 0#F$p@ T +0P p8$ m00 pᑙP/"@ tP   tP"@ @ 9/$ p)    T 9/$ p 408 @N@PUpЍ@ r"@ tPwpA-`p@_PP  7/$|p  7/$ qp 4 H@PH- sR iR aR Y pR@A-M@ P $dPp0 ̖ @ 0`{@, (p0Pᶖ `@ 0PЍW 0l|PO-M/@@#!@P" {#P"p@!@@`᳘P `V    PP ЍH-{T@`"p@P@ 00+`VO-$MY  @ @ᦑP"@`   @ PY @  PU  `&$ @* @ PY @ $ЍO- M`Q 0@4p P -@( ЍLP P0S*<@  D  T +"@ UsP$   Mp  $ 0 T0 У0  0 :p w@ [@ H-`P"@ s@P t/p@P @@p@-MPY- `  @  @OCp @0X*P V  @Q* *Ѝpp@-MP<(@P:($,4@$@<*$$0(@,` @0k@㥸/P$ ` p @"*"@#)@[- P80 @0<@*PN@ * "@Ѝp@@x@ЍpO-DMP@P @ x` @4p@ A@8  rPBaB PC00P0HPf>/@@ !P(@ * @`*PO  P7 # 0)@4 (@Z )T  PsBP:3LR Wp+r%0S" <(@P.  @@@ ! (@Z S @ "@pDЍ 8$ O-$M [ LH P p@`Z` [2@ $Ѝ `  pWp tLA@P `q "0# pH L0 %! PP\+ \U& 9\0@ "@ !U"@1@QP@\ \T H 0L@>TX $@(Y`P] @HTPLPX $$ . P 00R 00 P `p`8  'p00' @@T` P`&(PP! H0Z P L@*k !Hr`are B`Q H@@P/@-@$P !@O-,MX TP\0R, `Ppᆓ @ P 0}TPTP 0@s ` p 0@iV  0 0 $X(F P=@T9(P5$P (PR`py  0xW0 `P p  VV VX,ЍRV0 000PvO- MS9J4pw60P@9  0x @ P0x@TP p`T +X@ PR (pP+ V 0pp0X@ @P ЍX P "@VX0 P0 @@ @ ` 0@P(  0ᄒ@T P 0 %$#@PK*h[!Hrare H]@0T ` \@@PPTC @0t\ 0 @0T` 0`0P@T@*h  `Hrre5 Q Hv$R/0S  //QQ/K-P $ ` p@ PRPQ   TXp@-(M@(P`-P $` @ P `PX&P @(ЍpO-MP49 ?`@P` UPE @@$kJt0@@,/p@`(  xlPm@ P    [8 U8Po[ʰHP TPO@@Bp $0048pꀠ /p '  ,(ppkJ @@ΕpP, Ǖ <,<P PpḕP *@ RpZ<(@UU R!UN wA"p@   Q @P "@pQ 5PP4   @!@03PJ@8  -Q & P` 4 0 ,00(00``P 0 3/p @V @Ѝw@@ /Rp@->@@P *(@P: @@0@ &  @ 0lGEP"`@"@@PEu}#O-,Md{`P(p@(@ bpPYp(ePp AP"fP sP<(@P(@P`;P p j@{4"@6,Ѝ  $0@}p  p H}"p@`` $RƱPʑ1Q PK+*@@@ @$@@ 08!RR'C 8 H0 @(P P  `VR R R  Q@ R  10@ 0,p p{ $P 0O @O @O @O @v pi@]@XO-M `0sP W8VHQQ @ @Ѝ(庨Z @ 0S 00S000S@P R@P@ 0뺨$$0pcZ  P0#S: \+*P@@ @#"@Q @ 0gB<0 3/p 8 H0( (唠$DṐ 倀PT 0 R0  pW:@-@RR R R @ R R@@@,@'p@-0@P R CPt p<pSp#S: l+*`@ @@V# pp ppp"@aK@ 0 pQ K-M@P`P @>|"@| xt$R 0 "0# "  ; @ Q  @o/o"R P 0 @ЍP U0Zp  Q P  0P  0p "Qp 0p*(  0pP# pU  0 0 p p 5@3  @5 @G @M-M`@Q V*㍎ _p@P@^ p@P@ؠ  `aP p @ 0j@ |@@ ЍO-M`PpH V V9.  @B @ /㍞ B @@ @$$  ؉` p H  L` 0$@zp 0@ j@ @ ЍA-8MP@ P @I~` @4p@ A @0 1p p <(@PL+  @0"@!8Ѝ"@ a @/O-LM~P`Dp@@8<@8,40@0(, bP p qP   0p% {(<(@P8<PP 8< 0S0S @p"`!p P"@PLЍ,0@ D004,p pPp @@D,`P pF "@$0jP $$ 0p嶌 P pP pW@[@ Y " # # T 0 0 ኌ 0  0 0@!$ + !(P@P$p{  , pr  @nPiO-TM(H`PLp@sH@ sP  0>pMp qP.<(@P'HPL  0 P>@p5 T  @ 0D$$ P`pP 3@ D @0 "@PH L0@  < P  o@ PTЍ0 4 P, P)  $, p   QP @D @0,'p! P @@@`p  %  哒 8Y*`p "@ hP  V  Rp`8倐Y:D p@0RV _(<0PV[,^@p  t  $  ^   D  ^D  ``Y PQ>[ @b@pD <0tP(0@  `epO  0  V00 P  4$$  V  @@+} @(? @#  0 Y0`  `R\ $@0 `P@ p 4P(0$Pq#( Q0 0 0 p@@O-$Mq @`Pp@   ~aP bP iPTP  o TI TC  p=p NP9 lP3G"@2PVP  0S0S `p"`!p P 0T <(@P  0   3"@*$ЍO-gMM3a @pP`@  tPa@ Q&   pMuP xPIp<<(@P7 PC@C6P P  0S@T `0"p!0, P @TL P `P `V @ P"@Pgߍۍ=A  @@! @   @r@JC@@ P LGP`$(@@pP i  0c`pP @P` XX X b`PpP @P` XX X QQ Q@< `P@`XX D@& `P@`XX X  G_+  @ 0$[-  @ 0YP"@ zW@P [- `< @*0@P@ @P[- 0 @L@(@@@$4p##Y @ 6p  @$4##@`P@`XX X 8'p$m0 @.@# $am@G!X @Q* [-  @80 P $0   [- $  @ @e`V=A  @@! @Z   @Ur@ɫJC@@ YPP l?p(`@ @@  =  9`pP @P` XX@X 9`pP @P` XX@X *Q F@`pP @P` XX@X `pP @P` XX@X  m`P@`XX X pWD @ P0$$!@0$$@+ GO @0[- ` @0PG"@ 2'G@@ [- 0 @@8'@$m0 #@O@# $[ @m@PA-MPP8`@pT`0`\@N c@c@`0 PA@@$ S 0@S@3s@@Hk [- 80 @ @@ЍA<` c@7 @4VWU [-  @ @0@m@C@@ЍA@#(" @'0 @PP(@1Y- @ @S 8 !@ЍA P8$ m0< [- P0 @[- @ P0n@ЍH-M0P@4p b #Y-  @  4p 6@0P V  @ yЍO-LM@"@P*` P  @` @8@`B*@4p A@0  kPLBP PT 8psBP%*T  8p"@~pLЍrT 8"@ cP <(@PX&80 @ lRG"@Np a @/G- M"t@`Pp@  <aP bP iPT  - T T  p"@' ЍlPG"@p PP  0S0S `p"`!p P0T <(@P0  O-LM4p sP㴐`8  000<0尔,`dDEF$d<@"`@ P ]cP 'Z48 ;p+lPd<@p"`@P EcP p'W48 #pFGI0H 8$ @Jp4800 p,pK`$` 6LЍG-8MPPPP( 0p @c2P  0p P`8Ѝ(  0  00i @@ p`V P 0 QQ1"2(pdp"`@@囇P p'W d I(. 0rp 0O-lMP# 8,p"@@P0  @ ` @ @` ``  :/p'WlЍH-t*T@`"p@P@ 0`'Vp@-"@ A@@P` `P PP@TRp0 p@rA-MPP (@kp `p @ \pH PH WK:pW@k0`p 6c s0(@=0 4$j SM0pgM0V02: 8t@00A8p =1@ "86 0p` P p0  P`@@@0ЍO-TMP5 P@ P @fw @4` AY@p@LH@ G  U@P  p,P LR /@ p"@TЍO0r<(@P/ @ 0P P / @ 0"@TЍ0H-p\@R*P@ P  ` Ep*@ e @0@-@R*@ *@ `8 @O-AM>gtP@@`@/p@ oPp<(@P`P $$r@@P PX ep!@ @@PMtP 1P {P dPp@p`@PPk PS  PK ! @[PD !@TP= ! @MP6 !@FP/ !Z"@?P( !)@8P! !2@1P !=@*P J @"P  rX @P g @P st @ P W;pP P @@T Wpe @`P!@ @yP  @ " PE @P [- 80 @ @P P r @xP @ NPP P $P` @P Y  @PP `[-  @0Z"@ FP @[-  @0@ 7Px   !@0 Pp  .!@0Ph   @0P` @ $m0P   @PP PK H@$ T: @P; @ @eP`!@G pWSP@ p> @㫄P' 4 @P* P᰷ (@XU A"@AߍOD @} @`} @`y (@X፷` @ LfAߍX W)7@ @0@(7@ @0@(8@ @0@O-AM>XDp`@P@/@@ iPp FP<(@P$$0(,PP`@p P  @"@AߍO o P  @> @P@ VPE @ P $$0QP= @ p$<P9 40,P3 pZ@ "@P( X@ P "@ ^P  P !@P .H !@P  P0 TPH8 LP ,opP,m4$ZP,  0]|pp 0$4P  ,N0$S0Z8##@|!  8P $$8,2 $RZ @P e!@P D,!} @ P P P ,s <%(vP@ @  @3P ,  @@P  @8P  -@1P  @)P `Z"@ Py  )@Pq 2q/@Pj  =@ Pb  J@PZ Xr/@PS P @ g@PB ts/@P; P,0U*  0z{! + $$,p$P$$P @hP^ 8 0( $D`{Z| "@OP |CP| @CP |$7P  !@P  . !@P   @P  | @"P |$ <, @WP !R$, @{ P $D0 z!  4$,  P$8 @!1#z!  $,  ܴP$,@ o{h `8\ <$0( 0(4P,REEIB DPT4H 8 0 BL PiX\e0$$z! h $$,喴$Pa,@40 <``8\B$4#S#}z! H $$,s$PAp@ 8pAߍ @ @ @ @#|@ p,w @ @0@| y@ L@ @0j@@ '@O-$MMP @tP ^Y $#p`*@P QQ 4*@o    ЊP Y  @$y @ip P`fV{z z$0P 0oQ a` p(P  p @F`$*@ 4   告P Y  @$y @+v` PpgW;z  pz $@1` 4   eP Y  @$y @ P+ @0> @V   YY$Ѝۍ*@ @~?R @y?G--MPHpϊ @0`x` @Pt H!hH @pd @HT`@Ll@ D  <4,$H@p8`0@(@ Py  ϊϊϊϊ1ލp@-M `@Py +  ` @@p ' L㔴p Ѝplx+@ @ ?@?O-M@`pp PVP px x&!@P PV @PP P  @P @P  @iP PhQ @ 5puh @UP ohZ 0 S 1by pv P P P@>[  $ Q 1  [sU  ,0(S 1;y0P Y  4Q 1  Y @[>HQ 40L S 1!yPZ @ hϳP a1P l 6P 0 S 1y@ `平p$@ `岳p p R 2/p 8 X夳p Ѝl@@@+ @>\ d   @>\ @ >@ =K-P! P oP pP `'@ P [PK-MP@ @P ``p k p @P@TЍ -x  )L 'p !@0 `kH-Mk @xPЍ@-M@p k @hQЍH-@PSP ptP?ꅀ` `r 0xDwH-@P5P pVP *`\ xDw_\?`H-M @LP LЍp@-8M@ @P:PI @P * `+ @+ `L H `+ @+P@ ~`V q 0p@0 P P@ ^@D8Ѝp ~,1 @ @!0@0H-M@@P PP ` '`H @+p Ѝ0 {,<@ @0@V@<@-L*@@'@L*@@@@A-(MMA.P0 C Lp P(Ѝۍ@,7`C @)P ]P@,{@P$@, @C)P ']P@{@P@-MC @@^P  HxpJ @lЍ>$1 @ @!0@&@-M @@=P H Wp @KЍ{$1 @ @!0@p@-M@`P @ P uPP PP  @kP Ѝp$1 @ @!0@ @; @ @$ @;@-@) @P  @@@$w; @ @!0@0H-M @Pp  @P  @@Ѝ0$w; @ @!0@$@ @;@;p@-M@ @bP `AV*P P @ 0p  H`PP~}~Ѝp @d; @_;, @Q;Z @U;H-Mmxi `LPp @@;pP @6;@ p婰p @(;QQ[ p P@`W =tp`W 3x O-4Mp"@ `(*@@ T @@`P0'pR @:,*@pe @: `0`V{ '@o@堲 PpW`VhQ pWQ   @ 0"0 PP1/PQ 1/P 㣮(*@P ɯp p `0  ! P<W90`VP0/FeDL`I KCPpp@pp @pp`W P `i0  Pʏ: ;CPP @`W@`R"@=:p@-M`P@P  ^pg @ 2: 0H-P&@!@t@P "qPJP #0#w; @ @!0@ @:0H-M @P$p ) @P 0  V  @ @`@Ѝ0$$w; @ @!0@$$@ @9p@- MP@ @P `P PP @ 0_p  ``HP`p |` Ѝp @9 @9M @9p@-(M@ @PP. Pp$ $ p0  `q ``Q 0$` P `f @ @PD(ЍpO#1 @ @!0@fJ0H-M @@aP Y PH|p qڸ !0p@0 fpЍ03$1 @ @!0@C0H-M @P/P  @kp   @ @=$|@Ѝ0p@-M`PgP  @'pg @ 8bd ////0'@0 /0'@0 /0'@0 /0'@0 /'@0 0/0H-@'@iPP {P00D PaD"P# *^'P@`w?Q:{ ADPP*@0H-p*@P0@ Q:a@QW@ A@Q=@H-{H/O-M(`  `r'@P P,* @p@0PPU 8@ T wp`_0 0` p$P( C AP '@; p @E8'@1 p @;8ꔮ'@ & p3 @08'@`V y'p@ `V*@X*@ *@Dn '@'@Ho`@P@  jpVP BWCW NWI *@PaG QsGP(tFLGHtHHLGLGdH%*@PGAW IFLGGLGLGLGGLGLGLGG!*@PwWW/@!  Kl,"* @Q p lW*@P`WFCWY LWM vWFmWH sW '@Z '@D'@Z#*@P$*@P+"*@Py'/@*@P!  l("* @Q *@P*@PY&*@PUaW lWQD'@NwW zWJ '@Z '@C,'@@@'@;'@6$<*@(@P   '2*0@0S0>1*0@0S92*0@0S2*0@0S0'"* @ R!* @ R$ $P  '2*0@0 $0H$ 0(0 P PU@,! @6b/@!@ 6$ (`@ pp@6$PP PP PP}@Ey`p` pl@P@'@P V ,@! @ R 2/g, ?@! @0@*vK-MY"P#PUC%@ @|6n@'`@mHgpLDgY eP  @ @ `@(@㰐IW0 @0  G '@pW 1/pmP` @  0PPP PP. '@ R/0S  /0H-M P@p` @$P &!@P  pp pH > pk @2Ѝ0X$w; @ @!0@0H- Mf@ @P P P ` u*` H @*@ p Ѝ0L#Y3@ @ 0@i{ @5H- @㧗H- MP 0 A A0H p ЍM @5H-M H PЍZ @5H-'@vfPO-MMQ 5@3TPw @ @5\`⺙Pn`$*@Y[  ^<0884@0H,P(X$` hpx p(@P`XL P[  vPJpU vP@ k @ 4P9 !P*@pP1 "*@P)&*@P" %*@Ppo LpK p P `P Q 2P֨pYH`p \`'@Q P QD\`D pX NP p  @%.  @ 1  pT XL Bp Q L @; @T   Lg +pQ W @  p L@P 0 mQ: P@ ! @P p >spP< :!RX P@P p%spP'@pW  2/pTP pN f@  Lx ˩P @ ` 5 L  Ჩp zP, X L䤍墩p% X @ -p*@P annL > $&p R@"@f @b\͢ @*@*@ DP 0\ 3/$*@^o *@L PXWeVpP@ 8Y L @!@ ` " @ %$ #*@  " @ @4  "@ @  " @ @  0 @0L !@ ` @"  #*@  " @ @,  "@ @(  " @ @ e'@`VD 1/`\P'@$`*@V 0 3/`VH`@PP C\`寘ߍۍR @3l@ @_ @E" @3& @3@ @2*@ @ v @R2H- MPf @@`P  `*` D*Dv p L    `*` D*Dj@f @ <PwE Ѝ0H-MP @Y]   P@P e& @ @`  Ѝ0"eVY @ @P@P! @ @Ѝ00H-M P@mL poAoЍ0p@-M@!@KPh @EP  @?P] @9P 40*@82*@*0@ P 0``l7L `{ p Ѝp @E2p@-M@P @ P  @P TX ` !P@#D !@@P Q  @tЍpK-M@nP PP(p pP` @$ A8(L kp? Pb P @\p C  @7" !@Q  @," !@) PJ g ` @X"@ 0SR2 R "@ 3 P"lL pm @TT g P @"@u @ QRR TG Pq  @< @:7!T Y !@ @ mP& /8x P @ @ p@P`! RQ  z`V UP:YЍ@C1l@ @;1 @61 @' @/1@-mjPP 0 @=P3Q0 !P-P* P(  R$ %PP !` CRp P`VPP@``JP pP h$@P z|`V  0pP PP `P Pp@T  ?PzU P ) @ @0`- @ @) @-A-PU `@pZlP:p6P  0p ` p O-M- MPPU͊J @pP%  0`X6/P' P)P `半 aP D  ͊ XP  0}pPPU[ [ FpW?p P P D2p ЍЍp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V @pQ P 0P -PmP mP `VooЍ @(@Q QQ Q R-0ssssss LcP P0 0  0p 4 o  @s,p@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`pP "" @p`$@ H-`P@pP p"@PB @0H-@PjP  R$ Q  0H/00Q /  Q /K-p@P`P QpU 6P `PUP QpA-p@(`P P "@ @p PA-MpP,`P @$ ( #$" @ 0 Pp@ЍO- M0Y$ P 8P J 4Q44 Q Q((8YP Ѝ`P$P Q(`lO- M@40PP*U( `@p HL 0[*  0@  4/PFPYU@A  2n@ 40 B| |LB! 0 [#*U! @Ap  0`6/P@ LD 0[ *PU, D,L 400 ЍK-R P@`V`V p6/y P@T p@-@`PP ]P V  )P PT ` ]Ym PpG-FM$@ @pP @kU`P G M @ @` Cm@(P R" pF`d Ppp 7eppPƘ 0eJH @p @FߍW @O*0H-DBH *@@'@Y_LB *@@@UTRH*P@@Qc0HiK-NMMP @*@`pF)e(adKL XW `p/ ) + P*(p) 4`t 14`JO t) 0P ,*0* 0Q,U1  @R @TNߍۍ 7(@0  @ZH-I H4p8 @)p@-tP @'P@\b*`@P p T p T@ p@@pO-Mp@(Q0 0X #( @ xQxAo@X; `xPW nZP6Z (@   % V1* #( @  W B V)*@0 H(@W@0@@`X ` @@p PFP@cP @! @@Ѝp@-P@QU 0P (@xQ (@ 000  @UP 2+ @@UQ p@t@  @qUp0h `@jPUpp@- M `P 0 BP B P$P `@P`@Q@JV:Q `]c  R@'P P`  ckP ЍpH-p@Pp `$P   H6p@(@(H-M pP`@ c @ЍO-MMMPi Ppg `KŌpe @Fc jbt }, @"p@XpYI @4iP= P9 pp 3c L $ޝp! !@ !P  *@ 0/o004"  3 sP3P E 3 @] 9 @ @aY,ɍMߍۍ@l@N @9+ @$(H-M`@>p pPb  pp b L ၝp Ak@+P X"@'k@1P k/PtЍ} @H-$"* @ R @H:A-Q P`p@hP PP`V@- M  @p  @ᾸP 9 Hq @'j Ѝ+ @ @'@- M  @mp+  @dP   caP  @ჸP 9 Hq @g'uj Ѝl+@ @Z'0H-`B *@@'@[ahB*@@@WpRt*P@@Se0Hk@-M@ p QP ,P @ @ @ Ѝ #(@0  @XH-P`@PM @sP  @pgP(@U @&:L Ep@-M@n @%P  HpЍ @&f 1 @ @!0@Nι@-M{  !@@ɷP  lpЍr @&fi 1 @ @!0@M៾@-M @@᪷P IMpЍ @&f 1 @ @!0@Aှ@-(MP@  0 A  B  !@p L p(Ѝ( @q&   @ @a&0H- M# @@mP Y PHp  p Ѝ0 @J&f!1 @ @!0@q- @<&K-My @<pp v` `Hp\PXP k @Hf#E P@  @ kiPXp(@ :Q0@\#t@!p@0 :P3 @` TP  @% 0@$P AAqX\PH 8H qV @%hݍ  @ @% 0@-0Mg @0@Gp P  Hp0Ѝ @%7J  @ @U @%p@-xB *@@'@P '@B *@@@R *P@@yb  *`@@w~p@O-M-MXP@Pϊ$ P8(LxP{p` h` dp@ⰰ ϊ 4P  PPLϊ ϊ NPPyp !R*\ @yVpL+  Dp P c @*@P m @d .p P v @*@P  @N  p ) Qʋ @?*@P  @6I p ) Qʙ @'*@P  @P4 y A8pL  J IpP  Lp^  @PS  @Q @PJ` ᐋ(f@px ĀXQ@ppP3(0@0   :R P  @gP @p`P `@U ,KqPEoPQ @ i@PL mp( , Lfp! @8"@ *@_P I @Q  @{ ?Q  @rލЍ @k^2 @# 0/ (@0 @TH-M P0 CHpЍ @#H-8MP  A( A8Hp8ЍV @#O-UMM8 L@p+ ] " |p&P [PJ+㩗PJnP PiP +㚗PZ @ᮗ @, @ P?n A0Lapڴ(Z:@ p!0(  P .PP`@pG'W^ U= Z- @ 0@l!@ @0=,  `@ @ 0@  p@((Z:W㹞n⬁@"P@ @(@!0!  Z   30AS9Q 9Qg)  00  0d#A, ,L",@Q  0ppS0Q *@p@ 0*@EPPP0IPPPcP*@PCPPPPc P SP @P@BP0PA P  0 p (@ 3"叾r4` `Z @*p@. 4,!)PPa4P 0 @p @ @01Pe*P8 0P>  @ @@P  @ @`D@ pT T P @!@ 뢽PEp@UaF଑@@FPU% ` @/ @P P /"@PR. @%. @E. @!$! @T !@`F@@VK@[: @>dr*p@2Pm P@T:@P  @ @P  @N @} D pP mNTX `@ @@!P@,9 hKp[@,II@P E^,` P@ @㬑@$  @P !@P "@PR. @%. @!$! @T !@7`F@@V,K$@Q' P @ @@ @Y nT @ `@ @  P @ 0  #@T!@>㬑@Wn"P@ `@5P  @7P  @0 @` J@@TPUUP @0 @ @@TP>P ` ᏾ @P  @Q PB@QN$hhhhhhhhhhhhhhh ,8DP\ @T:@PP2 P   @ @P \ @~|Py  @s@Qi  @|hآ @bP^ PYK @[㬑@{P*  @ @UPQ  @N`Y] @ P@ 0p"" 0  p9@T>rP `*p@㬑@, @% @" @ @ @  @ @ @$ @ - @ 6 @= @Q @F @ JZ 4`0J`'ZP*3Q  , f6/O3s2"0r R 00 , C,L%"^#Aq, !ɠW%#Q:A, A,L"KUߍ؍ @T  @O @- M P@ 0 C@@@!H @Asp @g@ ЍO-MY ppS   A^Q0S  Z` V..@ЍO^@ @ Y`W JP:PJ0@` @  ~`V*E@UPH-` @ @PT^`<pfoWpfU W `E0X P@@oV `FpWP->H ` P!!@/@"@/ @+@` P!!@/X"@/@-M @@YP  WЍf/1 @ @!0@ᑷ@-Mw @@AP  ?Ѝf/1 @ @!0@y0H- MY PH@p  @!P  q @ Ѝ0f/1 @ @!0@O @^O-dMpʝ @| !@rpʵ @t @`㒔P ACp P < Hp <Q  @] @|P '@@ @  a p@ P @ 0P@ p`R @ 0``H @ B4 00,( (@ $P`n Ԓ<@P P @<`_ _ X `T\T0\`p aQ*@ '@Q 1/dЍ @ 1㐓 @㐓PD @@. @4 $RP @ !@@ 0@=  A-hM:P*@(P 0P @ D@(@ 0up( < @ @@P(  @T@_ ^TBp5 @Pd r σP'p@o @ Gp PP8 P5(@EaQ%P Q Q% ( ^ ^n @ \GP( ^ ^ @hЍ @PQ P PX@d`\Xב @B @@P2P @PX AÑQ @ @@ P,E!@@\J @i}LE Mp@-M,Q, @P`A o``` `L^QЍp@ Ѝ/H-*@ R00@-@W @-AL  '@// Mp@-M@Q P`A?Q:`P"1QЍp@ Ѝ/ MH-M   6&ЍH Ѝ/@-M@*@P 0>p @ @Ѝ@-@a"@-'p lp @ᚒr @ᓒ MH-M    ЍH Ѝ/ MH-M    KЍH Ѝ/O-Mpj T@`@ P@/@ <fPl@ Q! 砲,P xFP RPR? Ph ` gPf#Q  P qP&  #Q  P 1P  P 9  P  @*p<[(@6 *@P\ rK *p@Pն @@ @ @U*@`P ]Pq q  YP `XP PpGPG U*㭐@᫐Q @pP cP bP  XUp*^ GP*U8p _  m  P^P! UZ*@*@[*@*@X\P X Pp ZpP P  ! @  6/ R Y@ `@P'W  0PЏp3ʟ^PdPa P `( `W H`L !(   ŐV  0% Q P ˏ꜏p4ڸ qr ὏p @vЍ  @ . @A 1 @2 (@u @$g @  @ "G @  @0H-@ (@P @ @ 0L @ lH-M 0 '@ P 6 *@R  0 '@P *@Ѝ @@@-P@@O tP ^  60S8"0@8"0@8"0@0H-M  @0 '@[PЍV[P 4Qqs0#4 S 8"@"0@ Q 018"0@0/H-P P&@ #Q \:8"@"0@\01P Qq0 0 S:8B"0@ @ ^1V7 0@ Q 018"0@0H-P0S\ 8"@"0@\08"0@0P S \ :8"0@"@\1"@/@-P@O0$S@q Q :"@"@"@P   #Q\ :8"@"0@\018"0@0/P   #Q\ :8"@"0@\018"0@0/O-qMMpmW  "@` P@/@ 0@ cPd@P甿Կ(ܿ̿*@&AP 0 aP# 0@@*@@@ 0P B[( 0p*@<(@ GP 2*0@0Sr0C*p@000PY Pj PoY P 4P* p@@@`YP  YP  YP  P !@P PP5 @YPP(O   P, 0 0000 000P` xP `[  @yCP  @['/PAU `PJ`P y`P@`P p4@YP @{YP  @uYPp @nYP U =P(8P( pP ` U +`P(%`P( Ȁp2P P @ ?YP p P`  P   A   ~(P @PPl( P(*P@T`gTpp$^[P}'P+'R/bPPVP q Qr'P/pp, Rz*P@D ឍP e(D ᕍ.Py VPaP:a@P !P"@QPP U"@ 4 0 0`qߍۍz @3 @  @. @  @ @   @0H-MP0@U  @ \Ѝ0H-M~ (@ @0 G-P@pnQoQ Pp#!@HP #@!@nQ`oQ ``eP @2PK-MPPp`DȜXP XP p`VЍO-AMM p`@-.P $ ,(IQ $uT @XTJ $f @kPP/P@ 0 PC PP) @P9 +X@ ` P@ȼp WȀZ WPY  WPI @T ` p. @ 7$@$ % @7P` L $ @  4$@ $@  $!@["P@ZN 6pᨠ@P + @ OWP $LZ @P _( @o" @B 0H"@$L fs@( TB45 #!@` HٯP. #㑁 ゾ@P@p!@@GU`pP -P =A.G@T PA ᰯ@PPPP p`4b*`@Ԃ*@po p0S0P g @u WG pP!@@xPW 9PPeZ (pm @.:pJ @P $ P  ZP- , 8i  T^Z`F( Pc P(`FP ډPVP(  ΉPZ (@X┉ ?p P1 P+QTU- J  @$ P @PAߍۍP*@P*@P J @ 02 @p/QPPZPP*@P 5p K? +  @*  @<PZ ( |z, Cp @> B め "@`^ B~!0@!@@@ pUVXP  f0SKXPB @0YᰊO-,MM`ᨀp@ @ 0~ P䑷 @OXU @*@6 $(`Th "@!`@@p Q Q Z XPU f P:U Y e&E @ @ Z  @0>(`$@pP Z  @.⨺P  @[ @!PI 'Z  @P> Z @ X`Php    @ "  @P8  0@,0 0  @ :P ,P , WEP, A  @F !@Nv,Ѝۍ D @@Z @,ЍۍO0H-Q  Q @PUP Q*@ *@0p@-@P5 nQoQ2 P# P ,R RzP @P,DPP ``,DPP U  @B @>#@p*@ 0H-P@0H-MM @  P0 $( @0ᦈpv  0 @ @ @,|" @u>O-Mp`P@?N /@ <(@P\[|‰ P@/@  TPe@ Q$<L\xGP MP4xUPgt  0"@dPI Xp<(@FQ: `V X  X  V `p!|ZYpp჈p Y4tZ8xV V Ѝ k @  @  H- (@ @l0H-MP @P RQ pЍ0 @ 0@-@ᶶP @@@-@kP!@@@-M @$Q QpЍ1 @ 0H-P@)P /P0\  @eu  @0H`G @ 0H-P@(0H-M @ P0 )  !@0Ap UP P    @ @  @U) ( 0 @^O-MP,p<((@偷m/@@@/@"`@ oP 0EP 9p<(@EQ A Ok @*H- (@ @0H-P@(P /P0\  @Ĭu  @0H迬G @ 0H-P@0H-M P 0AN (  !@0ᢆp TP P    @ @D  @T A> @O-MP,p<((@偷n/@@@/@"`@ oP 0P p<(@EQ A Ok @H-Z (@ @j0H-P@`(P /P0\  @&u  @0H!G @ fH-0H-M@A 0P" @0 p  @JO-M,偧(p` @pP@/@"`@ oP 0/P #p<(@DQ @A +JЍOk @xH- 3(@0-  @Al0H-P@'P /P0\  @㧫u  @0H被G @ 0H-P@j0H-MA>@ P +$r @0ႅpv 0 @@ @" " @ ,<\!s  @@O-MPp @0Kxam `@/@ LPg@Q!P,t9P GP9||||MP( UPw| |||  "@0KPc ?||Fx pp<(@QB0Z S  S Z `PY`[ `p( [<pY@tZ(Z PP"F$||Ѝ k @  @ H- (@ @90H-MP @ RQ pЍ0 @ 0@-@ჳP @@@-@8P!@@@-M @Q QpЍ1 @ 0H-P@l&P /P0\  @2u  @0H-G @ r0H-P@0G-JMM4P 00@ 0 H @0 pDn4@Pp*@ `@YRKPVP S QP0 P U0 0p 2@G Pʎ% " @8P  p< 0 04pYP ] @Ʃ<0 @e`p @D L0 T T0 @Xp\`t@T$@p `QJލڍv 0 @Rp@-@ P PP p@S*P@`FI`pU @2O- Mp`H@00I '@H yID@ @*@*@ @P@A@7PpPPPPPPPdPPPPP<HPP\PPPPPPPPlPPPPP PP 0XPd2PJ 3PQPeD/@h@ I/@^( R/@Pd '@ h '@}a/@;8 s<*@mi eg/@#PT4P Y@UQ /@( 0"@P P <*@   @B P  P  @h  '@    @       @KH$* @   !@A $ = @6    C @+ $ L @  <  V @ 8  ` @  @  k @ , q @0F r/@X$t/@J, w/@= ux/@30kP bp<(@GQQ0`+F4D  Ѝk @ H-y @ 0H-M@ P;QPЍ0ȕ @ 0 H-M P0 @ 0@ (@ @? @ @ 0@ (0H-P@#P /P0\  @cu  @0H^G @  H- RR @ A-M`PPJ ҁpPJ@@ RR0 㞁 ကP 0pЍ @T H-M` Pp0@ 0@LQ 0ЍK-M`p@PHp? 0 4pP< 8$0*@0p4O76oB048 AB<0<" A@`@I@~p P 1Q 2/R  @ @Y OHЍ @H-BM@o^% 02/ 14 10>p p0@ 00 P N + @ @)NH<Ͽ BߍA-MP@` p$N UP8 *@2/R1QP5_U @4ON@N0 @ @ Ѝ2P(0/O-Mp 帿렆P `@@ p{P`DH @0@3/pB{NP=p@WP ` p@y+  @0 3/ qZ㋐r uP P YR*< @ @0 0SPk@ e @ > 0SPf@ ]I Z  p<(@EQ$A+C@  p9 0<S p@ p(00Qp0 ЍЍ'  @k @   @  @v @$ @ n  @ h  @ k BH-: (@W @J0H-8MMNA. 0P$ ( @0~p4 @-  @P@  @  @(P < @((, @0,)P Z @,(J @0z0h @v8Ѝۍ0 @ 0H-P@0H--M @0@>P  S    zЍ @0H-MP @7 RQ pЍ0 @ 0@-@ᝬP @@@-@RP!@@@-M @ Q QpЍ1 @ 0H-P@P /P0\  @Lu  @0HGG @ O-LMP8@H  08@C E$S4<CE(SH89柅ⲏ9D, !2/!A4qC)"X32/\c3?s6o7"X3\cs2)-)0 &) ??h ) p ) p ), p  )$ 0p )(0X$2/X$\ 13?1 Br4 0Ѐ1 ŕ$5<Ͽ(u3?,e7 6o ń$5(u,e(@ 8p (< Hp (D`H%L52/Pu3?7H%L5PuT0TX0X\0\LЍ0H-@P( (!(!(0A-P ($`6o P<Ͽ2/3?> ( 0( 0 $`dp `` 012/3?7dhl p0tppI-PP@3?<Ͽ> /`o `PU(!P("K("D`6oD`C(#@`6o@`;(#H`6oH`3(L`XLL02/3?6o8<\1L` X`\p `` @pA8+ ` @8+p0"S/"!0 R3?0/O-M0`10$0$(0(, 02/,10q0  2/40419q? p 71 p13?1 R\ET AT LpQ \TpXP75_012/:\p`0t1ptl0d 3?x 2/TpXPhl0x 'U @Y :5_7$P  13?1 $5R\ET AT5 0S  13?1 0RPP$ 0P?0T T0pa6oa`@P`@VO@p W,F,0ЍP  QO'b` 0 p p/K-M`L RppBDP=P+APU  QO'b`0@U 3?4O02/ !q p ^0@ p R  R OpUO& ۍK-Mr ,(@p@QpPp  )PD`g@ VLB Dl# 5_ P &P PO'a` 0 p Ѝ Q 0P #:r/ Q 0P #:r/O-MMp[/*@@xs @P*@ PP  @LFPpGPPc @Q `@`840,( B@4Q 8    8                    ,            < 4  d    | H L      |  /@ @@EP @EP /@@ᳪPe m!/@    @0p*@D/@@ `8P !/@  i  @0U*@g/@@P? l %'@* @0P  h!/@    @034*@E(/@ *  @0#*@5/@*@/4 >(/@  ) !@0 *@c /@    @0 '@ /@!@@IEP  @CEPB*@ (*@ q l/@@P BP !/@    @08*@!/@  ~ @0 '@ >(@0 @@?5$*@@ /@@!@DP,*@@  @0 '@ 0  /@  @0k D/@@(0  @,[0*@@ | !/@   @0F<*@X:/@@ *@@4Pf/4PaP *@W/@!y00 @ 1@%* @ A(@o k, 4!@bDP. f"@\DP*@'*@"   @0 '@  *@(@f k( *@  @dpI <(@'@@P#*@P e @P  @ X @F9 @Ak @E @- @*pPt[oQ=*@B AG@P' T@P# L $4!@ @ 0@  @ @  x[? @wp0  @zp=l=p* P0U*P@P T0@(E*@*@@ p R!v pn @@ pt @'4z ?P"+z? @ @E p*@@$ zxp pxP!@*@@*@z PH%* @;PJpzwp @H%* @0@e*@*`@ ?@@P@[ot"  pz wpb @v0%* @ ?@@@P*@@t @C P  P *  @00Y$p<4P$pJDT*@@*P@ $RQ! *@P@`*@, zPp}yP+pP*(0p*@R x  P& @P$S0*@ ?!#$dp@*@ @ $@"p  @Z(*@$PH*@ up$# @BLP  P @ p.<@0%*@* @ b7 'P 1 @ 0P$@V U   uu`Vp V ᜭp\+ Q*@Pe*`@P  R @++P  Q* @!e*`@Pc P8*@[oQ '@PT*P@P @( @ @ @04*@Q$ ' @0 R01, ( 80F@w W =uy 9uPU B.%P @p4 @Ѵ }v](0B @duuuua !@u0@*@*@L)* @ p @ Btx[? @upCN](B @d0 @pfs@ȀB_<`  p1 ~APZ lAP P  )p% P<PP edB/0 @pP%P* @z @B/ @X @@ @ }PT)`[Y p OK @APrG@APz  APu `F[Vy pPPp[o*@*@*@E*@@ ?R H*@  kp "@H%* @*0*@H9 Q*0@RQM @ @PPs d @r @  @ P *@ 0Q*@Qf[os@ PK  H%>"@* @0@9H% @* @ 0[oP[o4  H%>"@* @0@A-U*P@@TL (@@> @ 0@ @@  @ 0p0偎`@P( "@P` pPW O-$M pB` ` ㈙ @Pp0S$ P PaSKC P 0( ( ( ( ( ( ( ( ( ( kC P0( ( ( ( ( ( ( ( ( ( \PBSP GSbSP gS  @0F(P`\ ` hSB 0Xx 4 hpScQ7VQSVQ"R. ! *@PW $*@P- R  @ p` ҙHL Q $%* @ R!  @ p`忙$Ѝ 10 @ @ 0R @p` p @`  0O-M-]MM1t@*@*@P? (*@P:0*@L*@T "`AP@` 0P P`$p p 0P P`w$p ssD 0e$pp Wp  ֳTiP*`@| @8 ˳XP*@q 8` \*@5 '@*@*0@P 0P o %x ,< (%(,  '@'@Q 6 @$*@Pe @P ] @$*@P[ @T*P@*@ B0 4  @$*@P1 @4A  @}$*@P' @40*@ Q @n$*@P @0 Q * @a$*@P @0Q >( @T$*@P @04 Qi @G$*@P *@@TU3UE3CD @ @ P*0\PB\C0\@*@PXPU*@ XQ @ X80PP$0 4`@BRFPfLP_ȟpbHpP@0pS0PVT0QTR@P`@80pS0 P`1 @$*@P T *@4`a  0Pp8p0*@Lϊ`V @ T @ 6@㰁*@Ѐ pdY4 TQ?Q8T'QQY!Q '@TYAd@Q3R: @$*@PA T *@0*@48$`<4 0pT @1<0\@'D00LPx |`!$ 0X 0p!( '᧑x 1\Uta F? g; 0A0E HP? [;E_( P`@F $   y9!@P R!1R@TI*@@1 @$*@P <*@P x`8@<P8<@P"8*@xpT` 8q0 0a2!# 0Q0#Q0Sr<8 # @P0:Pao 0A@ԁ P 0 0PP*!0:PP0Aaq.W:`AT<tP@0 $Q!1Q 0o.0!^ `Ñ!~1AQ1`  0R\b>B boQ"\#Q 0O.@0!.` ` 00 pP0pU0p0 AB0J QAPaqQ!ȁ!!! 0`4  PQY# W1I 0Z:!0B@0S:W` p0 PD\@@ !?>1``PTf_nQQ 1 0 `1 S@1 AR> : 0@ \` 1aT܁/ !R!!܁P!!\ @$*@PT *@p @8<$x`I`p!善e0V;P18 X? $Um?H$U,0To`P`4 p`'0@`0L S|尐4? @ 0@ @ diTY*`@p*P@ 4h5l*@p4*@*@*@h9*0@PpHt94`*0@L p9 *0@pp'@@u<VPD QTD!h A? ABXD@HE `0 ,p B<4q 841 S!` 0PY2 `ɯQPYSQ@8@p@U D0QP@SppD? Æ $O0܁PSSP0S4qP DTD4 0t'@Q H( p0 T*@@*@P ^  FK P1A KQ dZ0 pa `Q 9wzqSvQ @ ! P `0+STY*P@@ 8   !  +S,p @w`0*@  P0x9R*0@\%|9*0@R| T@P 0*@@ @Pp*@|i*`@x *@P  0@ @Pp*@ |*@U4(*@P{@E*@@ r 0 @+$*@P  *@0R0%* @  `H"@pJPE@T`VA *@P !*@1L0*@ +0T*@,`| *@|>0*@@ TQ*@ tL+0; P L30*@ `+0 @*@V.P4 *@P @ PJ *@ 3P)I @[P#aTiA, 0A/r"\uW A0 0d/ 0`13 0P#QSS:# @\(P@z/PhDn(%* @0 QPPPSppGRpSq,@,@8T*@ `X+p@8<$唦Ϡ\ P0QPPT AX !  @Vaȑ Ti*`@4 `@ TAX !/@ Ti*`@QXI*@@3 EUR P@ P$aQq`0p '@P tx R !x  PJ,@P wTX\`$%R?0*@Q@h$l` R/dP u @ Z$*@P T *@  Pq W TiP*`@U @ P`$P 0l '@QBd 8U" @QTT! !U" @QPeXPeVd ! ! !8@p7ta!q! XI*@@87Ti*`@8P Z:aUR P@ q0R\  /0 A T *@8@% @4  4 T  F*@8pV*@ 0Q"`P1 !`$$Ti*`@8pTi*`@Pf`7 P`h$P 0l '@Q?dW7QTT! !QPEXPETd ! ! !7`P07Va!UR P@! Ti*`@7"7XI*@@8pPQ AT〩@*@44W* P`!p$W$:T〩@*@$Q+pQ( &p0P `  R $ER A@A @PTp@p`pUXI*@@:TiR*`@ $5R 101l9p)*0@* @ a AQ. *@Q tY4 *P@s  @eX$XI*@*@@Px ptY*P@hy4 *p@d0l)* @400P   UZ/1 *@P  G0x S00# !T P`\u%Wl`P\T @T*@ a/6'\%1T9AR !0p`x)d* @P0 p` 5w pPSQNT ܡ*@P\PV`x 82'6PN`| *@0p @ a候|I*@F*@@ `lP`PT a*@AT@AATIA&6#\Q @ 0`08d  h `X9"HFQ5ܡ V 0SapVE*@@PT〩*@*@ȑa\Tȑ倩P*@*@(a*@PS YJ.IYBYm !Y `@\uƒ2#" !@aTiAW P`p0pd ? p`2w0 pP7QWS!  @ PaP, (*@PFb `,Vu:Y w(*@PK / *@'@ R P  0 0AP; `I ;AjJj '@ RA  '@'@ G@!P4Q@`PLP `@D5Lp0? d?j`Aj | `_p`l  A '@GE  @*@E @UP!4@'!  T*@@5DuL`0pdP04k4qa`0 0e03 0UQS4 <  0p 09SY` pp@ h $jiP*@0 ,A E*@@ 00aqp`X f`p !@TP` ,/X 0XQ4 0 XPX#,Qp :`pTI 
@@*@`.T*@\%R+!?0OQ? 9d\Tt0` X P tPLf @DuL / i2iL d9!1+ Qo` A;*A0 AtC!4 @ @DuL +4 oiphld @ b4 RQS <a O 0CAc`p@#P *@PPt*@4 0'@Q?.; b*c "Ad4 *@@A*P`V.Q.VDV. *@P ,P*@P8A\T *@` PJ -0*@ ?1 0 TI*@*@@P 4 5TI0*@@dpHd g4 L6 WQSrl 0*@P *@P 4 0hy*p@4 dV| *@h4|h(KЍh  @x. @T&%~({ vs'pm @( @`]ZWTQNKHE Bp@-M@(*@P"`*@P 0L*@*@  0P*@Ā"` *@$! PЍp5^ @ 0$ M-MM@(*@PZTX *@pW Tx9*@*0@0 42'p0 *@Py@*@ P=T *@Th P*0/ "@ q`V 7Q  QW_` 3 `F*@pD 0KMi9*0`KH-M@*@`P (*@P! ,'0p*@$%\ *@ T! ᇰP 5Ʀ @ 0d"q0L*@*@ !Ѝ`0S \^ ^ ^ ^ 0/ @(@ @ 0B0B/01//p@-`*@KPPB<, '@PC/DBpO-MTY*P@XI*@@0d` p f7 VQSc *@P vU @ QRQU QM T,*@ 0P( @ S` `` o b @R9rUqŏQUtQR` ` ` ` `@1 4G``@Q,`aQ%Q !^ @.X T*@*@8 _Y02 @ @  @SP Ѝ SX`*@R a a a b  0{ @ G 0G !0TI*@@`$P0l a>Gp `@d)* @  @P@  ?  0  '@PLd ` 0P9QS?@/ QTT! B! QPuXPuW&d 0P  ` 9QS?/먠 b 0? X*@/ !?/A0 P; 4p8@k0 H  8 A ? $ $8A4  4 T*@`8P `?@>p T`@`A0o~ B0"  T)* @`8 P *@P  T *@`dp g 00o `WQSHO- MT*@XI*@@`0dP p e7 UQS *@P UrP p@ Q 2 @Q$*@P Ao"R \ A !. 0P 0dP p e7 UQS@d)* @ P@,Z : @0 $*@P @؋ 0 y?`#"1T9A)%\%R !`Ž?#p2!P`x/0 d`@ 0d `T036QSp 0ki0s*`@ [0QS :TIT)*@@ @\Q(x 0p *@SQG `(!1pG2/ w( X `1qA3? qX0/x 0 *@TQ% @p`p!p`X`p@ !p@W   )l ,)TI `*@@P 00 ЍO"b _p@-d P'`@@P ) *@P 0PppO-MPR @Pt @ ꨠ pD p~P `P e D %dpu (0 c0< C0 $ D8(4@fP` @ @4 Ap @ I0p7  @ @ @   @ . ,@C @ hP `Y? z D cp8e D cp4 (cp) 0( @T!*pT  0 A1P  @Q0 *PP A 'ߍ @ K-M@ P;pP`p @0 P+pbW ` 2!ݍ0H-P@P /P0\  @㕈u  @0H萈G @ O-M(`@,P 0V` 0pP @h`0P " Z P`pUЍA-M`p@(,E( P ^ ( FKpwP 9w:0HPZ0 P@P(PPP PPP0P4P8P"@* @0@9) @* @0O-M$-``  @P@Q 0S\0aQ JQ;KQ 0G MQ0D SQ 6jQ:kQ 0< mQ09 sQ,P0p p`,"P2 0'`60'`#Q7 "0# % P %80< pSpЍ  @  0BQ GQ  @0bQ gQ0`Pp1 @R @  @@-u (@@ @ᄽ  @ 0 "@[]O-iMPP@^ U*@UEpa@a@  *@ G33C0"!P *@"2@0#LTA* *@0CA *@SB:'PC  WHWM  '@'@ 尰R[ITM MH*@@0P G(7 Vvoog  Ff Q:w 0 <)$$8o*@ F WP`R`,PP * W `a2 ` PR SPQ@)@ *@`d V `V`) (ᛀ ) )00D P X:T  P QR !bPQR  , L,P *((@(0 ,MSo*@@P 68 '0@0`@(pW 0,. @$`@HEP@ $D (0 (R ` 0*@A`0`rd`\pL (00^] @<T ߦ<Ph@- *@PU !'P*x G"L0[\` *@ᚎP0o "0@PZ Mp`*@@ [ d0 V:VM*@@ 0 0Q RS 1c!QRSM*@@\ 0 0 0 PN0V, PEV0  @0`p V! Lp0 (*@M*@@ pP 9*@*0@{T`9*0@0 0Q6! c& @8) 0( @!*   C*@@0  P*@UP  " *@P *@ rR*@ 0pl  P"`@pG!Q! pW I*@@P.  @NIP :#*@ @  u\(P@4 PhD\ᔉ)*@Q* @PP0P S@RSH  W' m[*`@9 X@*@@P$$,P_LPd +庵 *@*@orE! *@*@&*@0m#*`@! 0*@ +%'#* @0 @%Bt (v!@ P  +" @R*1p71 A [! *PP:Pp p PW:P U:0 0( 8(p :!V E1![  P0  0  !(P P$P pᗐ$r$pdW:0 0 &(PU: *@P1,P[@p LPdQ P( *@Pg PU_.㑹EUPPW[3:[` P, Q R) !b P Q RO@,P? U " !@Y @ @㝹PP* *@P"  *@P*[:[ P Q R !b P Q R 4P0[U + *@PLP \ p O[P [ q" W!pq  d0 P808pl! CH0 C(0 CppXqP\ Fv P$ 0@P VGU $, <U*0 UQ*  6$ Sd( ,p':Pw U Q:QP YX h PYXRH* @ m*`@Q 0PR*A, 0v <G(P0U0*!!U:3' @ @m0 @us 3Q 5B0 V@P%%P %P@0@},AU1P\  0p'U*$A /$P  0'  0ALP `  '@ '@`pV@u `Z V `#P p l h d Z&ẗ|)P V0p :,pPF *@P PUM*@@*@& 07 '@V㴰 :,pF `PV1+  u 0  㴰X pⴰfH` 0F0LpP`M Z '@@PPdPplhYG|P*@ 3&*0@@` 0*@Eo@+bU!&0# *@a$ 0%C0Yiߍ '@h  @㗷,  @3' @) @ @㊷ @ @  @ 2 @%_ @ ; @ 8 @  @  () @ @0 () @ @0, @X @ @. @p @ @Y @ @B @g @ @ @@-*@L(ƞP d Q:Q0 @S RT 0Ad!SRT\  H-MP *@P p*@` *@%G!  PЍ) @ @kG-M@ *@PU TSS+P@pWm*`@pp圉*@P]#` *@V8 *@*@P P+0+ "@ q`V 7Q  QW@# D*@0ۍG!#+0~ۍH-MP *@p` *@%G!  nPЍ5T& @ @G- *@c*`@p ZW @ c p*`@P @  PUB@D`Rq@  K-鸝*@`0FQR vWO:PK P 0@  T 0 Q0pW S Q @pa0 pWᎎ`! 0F'6&0y0 A0 @ `<. @! @KO-M⸽@*@VpᐈP| W@%:( P"@0Qu   0`&q06&0 00A@(`WN*@W P0cp&!& $&T0f?W#0( 0 hx0" X pSQ $&?A @'@ᒐ(L%P  P ((||||||& d 0@ ЍO؍T @ @ } @ A @x( @O-MPR @Pt @ ꨠ pD pqP `P e D Wpu (0 c0< C0 $ D8(4@JP` @ @4 Ap @ I0ppr7  @r @r @ r  @r . ,@rC @ rhP `Y? z D Vp8e D Vp4 Vp) 0( @T!*pT  0 %$P  @50 *PP % ߍ @ K-M@ P;pP`p @0 P+pTW ` 2!ݍO-MMAn@Ph<<P X@"@  @@5Q= ب ب ب ب ب ئ ب ب ب ب ب ب Ȥ ب ب ب ب ب ب ب ب ب ب ب ب l ( ب $ ب 8 ` ب ب 4 P x ب ب h ب D T/@@3;/@0@/:/@ 0@ yD4m;/@0@/lp/@pUp `s9/@ 0@ T@~9/@ 0@ JHt9/@ 0@ @Wj9/@ 0@ 6pXp]/@X]/@ @ O/@H(I9/@ 0@/?/@L:9/@ 0@/0G?/@ 0@/&?/@ 0@/9/@ 0@/i9/@ 0@ p,p/@0/@89/@ 0@ pVp6/@ 0@ `" 㪼p`'&"`pP "| {y`|P3 P0p"P+`p%<(@Q*Q/@<P  @@)0 @0@f@P A.Ѝۍ|*@ ?DH-MPpN" .y@`E"P?V=JP5 Q6G@ Qg@ P0 L L L  h L L h L L 0  L L L  h L L h L L 0 $aO $kE $fJkDЍ @ 0 @H-@`pP! P  V @ 0H- (@@ @ᰲB  @ 0} \`"p@ P@!p0៲`FvO-MPR @Pt @ ꨠ pD pnP `P e D Tpu (0 c0< C0 $ D8(4@FP` @ @4 Ap @ I0plo7  @o @o @ o  @o . ,@oC @ ohP `Y? z D Sp8e D Sp4 }Sp) 0( @T!*pT  0 !!P  @10 *PP ! ߍ @ K-M@ P;pP`p @0 P+pQW ` 2!ݍO-M-vM`P0FpxQlp'q#$dP{`(@t{ppdp1#upo`oo4PrQbpb`oo@bpP``oobp00U53sU5E3sC00E`#10@d#2`0qq@p#<0$0⃀pqppQtpp\0o`04r0pJppH0p}|0ppG003pp0p80 100tpXp00\p ph00< 02R  1 p夀U PT  P*P $aYi/AK*Qp !18 "@ PP 0A $aQp J @RPYA0AP  P@ P Q耍[ rPXv@  @P``DoPN PI pPUXv@p耝$a0  @oX    0+$WPU n @"`@`P D@T"LHD804X`P)0L PX 4 R$ H(R`D QPQ`88S<@,0P $A/ &P@0S  (@000D B0SR @D@T`QU HPDP @LaQ:`PPV?p耍P @☠蠝$?  Zp t04w8@  wQp? p/ KᘠUY: Y P?*H?W?p#PWHp2 DPX7 XDB*pV耝@  0]`DP p P P  P *1%?SP0:W QT` P`@V !P  @ 8P` V`V_ T\0㘠saP:a !PȰ P pP pPpPp吐 !PȰkpP ipPB P wX @PP@PP@P P?*Q@:QD `^ P   1P Q P *P@P PX@PPP[B / P @ M. @ 0 @PT Op J`PP0,@  P  q@0 }7'!0T T  aQX@ P p `,\pq(`吐<P PTP嘠 QN Z꘰ P a[ W@TB@`W pᙵ!/ TQ 3f:XTPPq<b @ `P@W !/TP U<D: @Q P P P`` Q` T X T V@X T V TZ@ Z:  P) ^!~@ Z [P R P X TPq<ZPX  Zh: R"[ P X @/`W' p@T @!pT TWP @"! @   $ U:pW:YP*$ ࠐ0 Y ! U : +` a耍q E@?0!!P "Q p@P0 0qPU UX U@Y p 0!@ @@GY㐱+T @`P`Zk:U?? U0Vi*Y p@PLQ夀 PHP  @:t9 @$4t @G  @. @  D  @:W  @{  @3  @㊍  @,, @)  @%  @ 0t  @t  @,y @ x @ ~ @ @  @ @s @|P0$xplP4pVU U @* @  @  @P @$# @  @  @e6Y 0@ @ VPP`P``R`0] @P `KT$0 QP #S!  @ 8  P3Z8 W p RT: R5TP3S  @ Ao  @C  @T @` @`+ @ @-r @m+ @(` @  @) @VsvލЍr @) @ S  @ 0 @ XQ  @TPQ  @ګ @֫T  @ЫHD @ 0ʫU  @īT|A8 @㺫 @㷫HZ"@@oP@Q @㪫Q@TPᣫ gLQd |MX \劚 \X``\  @$ph~Pt  @< `Q 1 W`S0 !0<0@` aQ0 @Y 0W00T@VAR `$pFo,r P c /oL0"d 4 &$`8 ,x ( t p ,l ( d `% %%| , (  D H   X    \z@PA\ (@+@Pd A @$! 0@j+@ @pP  @Z3@Z <T3P  Q ( \Kp PTP   XZ@ $P /P Z$#"!|DH   $ PP` @321x/t.p-8,(l'd&`%0p$p)Ph`gfF P`@h !l'0(@ PU `0P P`%`PP@ B rMP0- @Ω0pW p@pQ`TPP\p 0S 00P@ "@T aU WA Z:Z* JKQL ZP  (@0S 0 0 0p#p00KA q0 (0 00?O$(@ 1@5 Z P 4ZU @rAFRaDnLPi: *a/!`%>r#h"""B{"Bp@{"B""p@{p{*c!`r#h"2"B;"Bp@0@;"B""0@;0;*b!`r#h"""B+"B0@  @+"B""  @+  +*a`ph  " "  @ @ " @@Q A  Ip P  Z+C$ @ $f$ @ ,_, @ *  +@/O-M-MpD`C Jp+@ Jp+@  @oIp" @㎉IIp; @_BB8 @@/@ ᲜC@4Q(  x < d   P ( t H T \ +@<9dH<+@ P9@ 4+@/@  8$W @+ @T</P@ C<PzڼZ +@+@m<(@@8 }+@T</P@ <QP +@>T</P@c<+@ P@  ` U+@{@$/@+@T</P@ n<P X 9:T</P@ ߈<Qp +@ '+@K+@F+@A+@<+@7+@2+@@0++@/@ + ($ @+ @0 T</P@ 嗈<QPPC +@+@  @pSD+@@+@ @ Pm a  P HPp a ZHPr +@P}HPo Qq@PT0 AP` x,@@,@ `  PP D+@@P @n  +@ Q8! QJ<G(@PG  Z @'  @# @ g @  @+S @`RMb@A 0 @  @{Gz?eA B @w @ @ @ @GQPd `4Y +`@ @+0@ 0PPZP 8 f+@ @`+@@!zp8+@[Z``Z` P+@Px@tu+@@+p@`y|P+@- @ =@  V)+@D``Z!$D+@@0S (@XM  @ V=r+@0J,@-f D0wB@kKv"P"\P D%+@@dp, @+`@ D0 &HpE @T+P@ D0 Hpd @  D0 HpE @ D0 Gpd @E+@,@@,@   0 '  P$+ @0  0 (  'cU+@,P@@(<,@^ D0p pGpq @8$+ @(D+@@  +@CPp )0U"  p   0 p  0 Gp @](@ 00 * 00SQ# !Q!H@ 8 400 (,00 0`,Pb 0 `PbB0< @ 4$Pp+@Q%@+ @D `0aS0`P`+@7  @kU 0H+@D` @@``PU !   +@HH0 Gpʍ @U +@C0  Gpʮ @d+@+`@ 0 Fp @P+@c p+@`0 @+@ O P'@@ 0PFp P4 @ ? '0@ F @P,@HP!" @B @,@ @@$ P P\H@!xyP E,@@F~PU A-Pp G!P@1`P T +@ uPP uP QTP A  /@ڛC0 @ %\ @ H- (@v @ቢH-,@Q0,@Q  @  ,@+@ R1H-,@ Dp @ O-M- M؅,@,@$〕 E,@0%"p+@,@@+@=tA T<+P@< @ _`0 `+0; "8r 0"( # Ep]`%+ @<  0pDp t  @Ʉ0 pEpE,@E  <  hD @ -b A0DQA#1Hp ( @ @(0P4 < @ @(0P* N @ @(0uP  c @ @㏠p 4  @ㆠ  @゠ @#,@I /10"  @n  @  @  @d 9  @,@\@pp Y:Q Q Q$W @DpQ Q@PIT** P pI@WT@T"* p W,i H 0  p p @mW*D@f[ @AP`D,@VX,@ PZ P,@ `X,@Ve[,`@ @& @  @ޟjIp T6:@`P@`XXX ؠ U@DI T 㿟KI T* p p`P@`XXX 㶠 3@DI TIYK e[,`@  @㔟DH W `P@` XX " +@,@X ㇠X +@,@=0,@V,P@pPqP+@  j@M ` R P`W&1 A, @  B* 0 h,@(/ ' @,@e,`@+ p+!xb ,@( C'@CM,@ `Ͷ @/0 RU .0, @,@ ,@Ww ,@U H 0  p ,@ BP (P,@PX+@ ,@ @I,@P E+@ 7 @Ԟ9  @L @E4 @BU @?pr @= @6 @3 @0 @- @*  @'#  @$3  @!D  @]  @w  @ ,@ @㙞PUp 0 '@@ODqPU$+ @  p Dqp0  @}+@KU0 S'@S@Q+@P,屠 H 0  p pp+@p QX+@St+@+@` G@DPC %WP+ @ PDPPWPZ,u H 0  p t%+@+ @`0ED U @te+@pPp+@,`@Uh @ @pP+@e,`@ p|e @W @A-@ 4v,p@l(`@Q8&<, @,@P0P.P`p P0@P`0X X PX.ӞQ q8&<, @,@P0PPC`p P0@P`0X X PX㲞pT 8F,@@P `P@`XX X 㘞<,@XMK,@ `@,@ @+ @-@ D0,@P@x K--@@`pu+@) @ 0(PRX  @M @I@   h @0+S;  X (@Kd@@A--0M@<T ` @+@E,@@ @0V1,P@ @n,`@Q G @ P PX @ @ ` { @ 0+S 㸜Qr t"+p@ @k   ,@* R +`,@+`;Kq+t++( '@ R;,@ `;c3+SK ;d @b; ; ,@H  &, @P` 2 B* 1 A졛0 ,@  ., @P`  B* 1 A졋0@ @@ +`` 0+S|0ЍY@@@eA-C6?H-M0P0 ,@K @ @_ЍH-@+@,48&,@, @ 0#J f0,`@  @,@R@  B* 1 A pa  a <,@P@dtH<eA?333333?G-`+@P@p @( Q#<Qʀ,@QW,@Z @ @G . @, @H-D`+@@p P\U U U 0/ 1 @ Q   /r @H轛/pr  @0/ 1 @H觛0H-M@+@ xlP Pߝ, @,@0;Ѝ0ӝ+ 0 @,@Ѝ0H.O-M@  @ Qᾐ`p)` * @ 0e៖&  @ _2  @ 0Y堝D  @S嚝 @MV: pPW *0Ha @@@V`FW:ЍO- M`pᩳ@-Q@ @P,@ Y @~P,@b^ P@@ l@Q < \  \   \ \ \ \  \  \  dP,@P p<(@P- qWm`` P``PmW P p W@<PZ T?`P;mP`Ro `@,@P  @ |k @%{ @ [; @,@PY @ {x @  @ {Xy @ {~aY] p@"`@ P@ <| 06|Y: :p @:p P}Y:x :p @T n :p P  @  @ @[a : @z @:p @PN{T 0!@  @ 0]{@-d ,@YM "@ @@Q@N (@. @0]ޗO-MMP?`2 @pdP @`4P@@, ,@7@U-P kL(P  p@/@ @@,P@,@  ᤍ MP!bBP4   h X h  h h h d h h h h   p h  0Sn DR MRP/ P,@  ,@NR@ RR  ,@ ARz0 , @QP < '@ ,@ ,@ ,@8 '@A -z@/ ' @QP4 ,@ ,@} ,@ylP lkP @ P @`bAP P- KkP -؅Q Z-@rPN @j  @  @i @`9<(@@ ,@QtP4 ,@ @O PPI @pFDP?L(@@Y38 ,@  @җcWD p'@)qPOrPe tP xP O$ ㌾@,@ @+T)P %`< '@P ]& 0!pWC  ,@P _  @ @  @+ @Z pRP[ iP  EQ@arq@ ,@ ,@RIP xX0 @ Y @} L ,@P X0 @  @0" !@ DCc ]@ P@++(  0PpWOYO @@r% 5 ?P X0 @ b4 ,@P X0 @ S @0" !@pY @ Z    ,@P ,@P X0 @ 4 @0" !@QY @pᗕ0H-@ (@P @W @  @  @ ` @ uO-MMN @ @  T @  @  @ a !@ʵ `(@p @,@` ,@aJ^P@ P LL平 @,@@  ,@ P ,P G ,@@ Q/R;D2d w P @,`@,p@  @ኗ   \^  Q J^P@BD@P Q Q @ԌQ:  %`,@ @ p" ؀ >@! @u @@ 02p2,8J>P @Au u uN !@p @ * pʵ @`, !ʅ p @`"A @U @f @ 0' J^P  ,@  P La@QD ,@< |! D   |! |! X |! |! |! h |! |! |! ( t |! |! |! $! T! @ !@P+'P %@J$ ,@< '@P 0$ @  0 ʵ @ ?P,@c DPPz  @mPP ,P@P  @r@g2 "@ZP& *PJ. @㈖@P  @CPlPz @ rP: @-PV = ,@P ,@@@"  @P>o @F#  @_3$ @ @( @ 0@, @0 @40 @8U @<{ @ @ @ @  @ @ @? @! @O@ @P] P[ P ,@P  ,@ @1K ,@PPD JN P P @ `P :hP J^ `P @ %n@ h@ʕ]+ ! @0P Plf o `\P` ,@P  ,@ @1 ,@PP P" !@iP j @cP PP\0  P  @ y +  `Ph P@.  @!PJPL @S@p  @6@  @P/ wP @P" P ,P@P) l @ 0:@`@  @P T@} !@Pr   Ei @ 0>~ @Jd60 @, . @ 0$ؐ }`@ PP"   @ 0sP` ʕ V @,@c l@= 0@hV`T0 L XPPH@0P ` S` ^ P0T 0003S@ PH 10Y :/oHL2/oP`PT"X@ P ,P@ "0$ 0S|@ QL LL4 Q0 Q  ' [lsl 0@xQkQT@t@pRPPx`xdpPm 㘶  ,@Q x @  d PQ A  QC PA   3PQ A  Q. P,   |P#* PtP*t@AP @PѸ ڰPW@TpPXMJ Z[ʵ @P,@ @P:@D Zk`@0` (ЍۍK-P P& ` p 㠔 ,`@,p@,@@QQ Q  0B01z P ȅ p,@0 0 p^0H-P @P  ,@Q $ , @0 A!2  ,@QP @ P0G-" !@`PP 4@ P /P.. pPR*  Q 0/S/Q Q P/R@P7 jI@ @ P  B0QS/SrpD0.S `FQ P@@ET@EPP/Q@@C@ QA:Pp #(@0 @HH- ,@iP ,@P @*#P5 ,@bA-@ R R fv(@P `@ @!R"R'Rp?oQQ2 QQop2S გR R R  \RpQ  " 0|A-P@   pW  #,@( @`?0V`p`p 0`pW@ ,@ Q  ,@ @1 _ P* ^ Rl- - - - l- - - - - - - - - - -  P /= # (@ @ @%A-Mp ,@B`8/ ' @P 0 ,@@(@P / @Q @X1X @ 0pёUPЍK-pM8 '@B@ ,@` 0! &P ,@iP ,@PF < 㐐'@P 8' @d`PY  0 1 ,@P, #(@ @X ᎑$Z P p SP  0" P  0 PYT@pЍ@-  B,@8? '0@@0 1 P  R  T@O-M P ,P@(@P >X0 @ J t P,p@# @P [X0 @ 9堔 P,@`A 1 0"   V@ ,@P8: ؛ X`m@P,@,@ @ P$ p ,@E 0P V P  $ppWP@U:ЍO- M ,@PBa @T6P `Py @ pVPpp z `P PP P`PV W aJ  ,@P  (@X @ㄐJP@0  P P PU4 t7 $5 5 5 p4 5 6 D7 D7 <4 4 <4 p4 <4 4 ;  (@,@ v @0TW  QH @@P * `V  S(@ @ ,Zu B  ,@pQ  ,@Pi K |,@@I DpppX"@ 9p @@ (@X ,@pQ K |,@@I DPPP| NDFD@X"@ P@ (@ XWD z  0d @ZN ,@pQ IP5 0 (@ @ ᠏pxy  ,@ @Z 04 @ZLI @pp\Zp ,@PP @ 0  @,@pQ> ?f ,@(@ X @. C ,@ 0`$ @ 0 @ ,@pQ 6 (@ ,@X  @0% Ѝ0H-PK |,@@I D | NEAE@ | NDFD@ X"@ @0h"@ @0O-M ,@P (@ X0 @ 먤 ,@P4:  Ȉ(@X`@P,@ @PQP@U:  E,@ 1 pW P P  ᧎qZ p ,@PU& ` Ȉ(@X@,`@ @ @ pW PP  sP  ~H1 p$PUЍH- ,@P  (@X0 @w[ ,P@@T `p P $p$ `@TV ,@@TY P@/$@TO-M ,@,@RQ P "(@X08  @<P (@X0[  @1 ,@ t 먴 H ,@,@P` Rf* p,@〩 @ (@@ @P` U *pP  0=X   %0&  pP  @% @  1> @ 0ḍ~ ,@P  ,@ R:ЍO-M ,@P (@X0  @H ,@Y` ,@PPkpM@`GP \pP P: P (@,P@0  P  *`mZ:gS*P* P Yq R0  RMyg `@ T *P}   @'@ T$(P:P[ v Q@` p P`@   p P t*ЍG-MM ` \P,`@(P@ @P X0 @  +2@TP  X0 @  먤 ,@P':P sP `pV  x@T@ `PU:ЍۍA- ,@P (@X0  @먄 ,@P82j@P `@3P p RFP @pWP@U:H-P`ptP! @o"@/o"PPoR b  @0|RPP w @ H(@ @ PO-cM@ ,@P (@X0  @밄 ,p ,@,p@*0 @F '@` ,`@ rPF 4'@@F_ 0*'P@ @p 4@ P,@ T( +0 @F '@ rPF 4'@@ۋFC 0+'@@ @ڊp 4@ P,@ Hp 2 ,p@ @P @$/   PJ (8,@  ,@ta`P @@/0  ,@,@0aS0+ $ C  4<D   ,@p]ύJ`8 @h (A,@,QX8HZPU\ P( @ @ @D  ,@0P ,@ [eP CP: ,@2  @ P H  P P"+  P,@ 6k (@R @ ,@P PF '@SPcߍc  @cߍOCF '@F '@ @ @ @F/ ' @ @F# ' @O-CM@ ,@PP' UP`p㰐Y AO` ,@P y v~ px@T:cUa ` (@X`,@,@ pP 0 ,@PP P `[:P-P  @ 0 P + @ 0v 0SP E @TP Q Z:P CߍH-, , @0S KPF '@,A-@l  ,`@p \ ,@ P,P@  ,@ 0a(P  pppF '@H-M @  @ @ (@ 0@n@-F '@@)p ` <\P p@`*Ѐ@-H@ ,@@   PO- MM`@P/0' ,@qW !  p0 01/ Ѝۍ0 01/P ]+ ! @ 0Ḉ a ,@P _@P(@ " !@SP  @ |w@T j @BP  @ kf@` 0VT @ఐ`0 P @ L $ 00 x 9`@ 0*@T`p@-M@P` 0@P `Fv m(@ @  ?e`V +)ЍpO-MP `  (@㰠,@Q +(P/Q!!R 0KS p@Ta !@P$  ,@T:P - @ ƈpP  @㻈 pP  @ 0pЍO- MM@ uD/Q a !@NPp@PC ӽ0 a `PbA/,0@,@!@ !R`P/ # "  G@PoP pU +P apP  PMP @0 /P,0@p ЍۍH-P /0`@ ,@qW !  p@G@ @-@U(@I`O-Mp ,@L(@@P O X0 @& '` ,`@ rP  , ,@, @0+F '@ @#F '@#Pv  @I 0 @) F *'@ @ P,@ `{(0 P` x@@( p(@@  xPU T T_xPZP@@0T O@  C@ $sxPiPZV P@N $ $ ,@PFZ  ,@P9p lP 'h 'x0ST - @ @ 0l i $0 @   E B( ,@P h0t  !@t '0` ن@o F @'@tg  (@0  @ATO_ЍLg@ @F# @' @ ) @ 0ЍO"9 F @'@HgV  @ F @'@?g  @ P 0 (  @ 0K-MMP@`/0pS ,@P # "  @0P&p!&p* L ,@@ ='@PT `,@ Tp{ &p& P &p0 KT&& <(@@ @ ᜆgg @ᒆЍۍH ,@ @ P (@@ႆOg  @H ,@ @ P (@@o@^P *@ @㞁PQbP,0 @ @yr*!@ @㋁P  ,@P ,@Hm3br%0 @! @\p@-TW @'P@0 ,@@Qpi ,`@P oYSP @p &(@0 @N~G-M ,@P  (@X0 @<E Е ,@@,@P  ,@ X p'@>a0 (@2% "@, @P X '@ ,@0P ,@,P@ȥ ,@ 00/ Q,@0 `%`V P X %'@  Pp "%,@ P (@ @XĀ@ ,@@P P ,@,P@9 p,0@ A ` B,@  F P &(@0 @P  k*,@ ,@Q!T)A  1  R) @BP ,@tP =@p ,p@ $ , @" !@!p?ڈ  B? P\ '@ B? PB@ ,@@P ,@P  ,@(@ X @M @ZP. ,@D ,@@ ,@PЍ ,@ G S` (@B @ U(@ @ !(@0h @" (@0 @5` (@ @  (@< @ 0@ (@0 @ s}H-M@ '@P)  ,@Q$ ,@Q!@ ,@ P  ЍH~X '@H [!p ` (@) @Ѝ )(@0  @5}O-LMM@(}⟀9 ,@<P' LP PP- d`k Vx L8X h04(P堐t`PT$\lPTAP( P" ` `,@,pP 8`808h>8 2/ 0`3?A6o5_7<ϿL R hM0p P4آ2/3?70<` 06o؄ 89<`6#1#,,8|Ѐ0<i1xS6o7 5_02/ |i3?xS 8`0t (,p@ `"p!p@` ,`@@ p'`$p1 $@ @{z ,@ @sz ,@P  X,@  @fz0 @ r 0 ,0@ @Wz0 @ ,@,@@ ,@` V 0,@ X @;z(P-H ,@P ,@PsW @w o(P  PP(@xPEUʠ ,@b$ ,@QV  ,@Ὁ`Z$ V ,@pG V@Q eY= @ 0@T60 @ yTPG(@APEUʩ ,@P`P(@3PEUʛX '@P/A ,@Q p@-m HP ,`@,P@P QP  @ @(y@$ @I, @ @@P P@p ,@WO- Mp E ,@,@@pi ,`@Q 000 Е ,@(@P,@XQ0 U0SpC W,@@u ,@P  X '@ wQ [Xڦ R[  ,@Q 0  @ ][Q[ Qz  pGW{P (@p  @0=H ,@P P P  @H &,@ @P y H 4,@ @ y  @ 0 ,@P) @t Pu   ,@P  P Z]X '@? pR [+ ,@P 0f  @ P1  P,@P pE ,@@Q=.  ,@Q 5 @x+% , @+ ) ,@, @0 Ѝ %  @ ,@+]YM @x vO-MH ,@4@0p $,PLPP(`P<8H`@0P@ @(p 0, 0DpP  @  P`@瀕 l l l Ж l  l @ ,@P (@ @X @x ,@Pg4 P,@P  Z?p  Z @P ` @ @   0 @t ,@P (@ @X x ,@P*4 ,@P bHpn  llZ P@P ` @ @   0@ Pd  (@ @ 0\< '@P P  ; @  ,@P U(@ @X w4 ,@P  ,@P- p,@  ,@,@PP@  ,@1/R ,P@ ` p O` () @T @ @ @|Z 0 ,@P [   ,@2/P p X(@X@ P@`0 NwpW `,@PR @,P@P 8( ,@P @!@0  @B ,@@,@ ` #  @ @ @P[ 4 @,@P x ,@ `PU 8  VVZ 0|( ,@P p"@ 0 ,@P ((@ @X vP @ `c ,@P U(@ @X v ЍO `,@PL f(@ @X vDxW0 (@ @0P @ P }8z( ,@PO v !@"@ Up@APW0 (@ @FW0 (@ @ nvP @ l`ЍP @ WU 683( ,@P p @@ 0okH ,@P @ 4p@-Mhc @,`@d ,@ P *P l ,@ANxHPl ,@UP @l ,@PH P,@P (@P :} @ 0@ PuЍpO-,MM@  ,@@A"A `Phpb  @/TAP #  @'m ,`@P A" PA 0" p(@XP`P Q \ '@ QHQ A (2/pA P\ '@P&Q A (2/pA q A"@9/pA"@9/pA  pAAA P0 pA OPPPA 0"p `PV |.Q A (2/pA"9/p@Q  ,@Q  ? @uQ Q f ERPNPA PP9  ,@P H  ,@,@0ZP @tPH ,@P  @,} ,p@Py P P`+Q ,@ ,@]P ,ЍۍH-M" 0, @ P ,@ЍH^aH ,@P K (@0> @,0@trH-dc @h ,`@,@PpW  @pl  ,@ppH-H v,@ @P (@stqO-EM ,@@P P (@ (X @ ^tT 8(@N`Xp@@P PPz 0 dsP H '@0`!X @6tX X) X 0B  B   0m( @& 0B  B   0( @ 0B  B   0|( @p  ,@P  @sP  @ P  @ P P  @ 0 Yw:bX X& Xf &.( @$X( X1 XV .( @/  -( @   -( @pP   -( @   -( @p ,@P Y M( @Y @?  @gsP (@X :Eߍ;/p@-MP ,@@P  ,@ 0 ,@3/ ,@P ,@ 1p ЍpH ,@@P`ZT (@ @ 0`(spp@-M@ ,@P   ,@0 ,@3/ ,@P  ,@ 0p ЍpH ,@@P`#S (@ @ 0`rrpH-P H` PH ,P@,`@p @@PP p MH-M  (@  sЍH Ѝ/Q\szzt || {0H-M` ,@Q  13?  Q P *b Qb` 0 @R H +,@ @@P (@0rЍ0K-M/@/tP Pp/P Pp`P 0`PЍ0H-PP 8 @L@ ,@Pp ,@P0 ](@ @X 0HFr@hS0 (@L @ 0H7r0H-M@   @  P^>a ,@m}ۍ00H-@ (@P  @ rs, @rl @qP c$ @q P Z6 @qP QK @q$P H_ @q *@Q @x  @q  @q ,@ @0H p@-MP@P`P ``PPP @C .>,@@  @ 0@`pЍp0H-MP ,@@Pp ,@P '(@ @X 0Ѝ0HzqGR (@ @ 0nqЍ0@-@P k @O P  @H @ ,@Pp ,@P (@ @X @?qd R0 (@L @ @3q@-@P  @ @ ,@Pp ,@P (@ @X @ q2Q0 (@L @ @qH-M`@PR ,@P4pQ (@ @.V ,@P6p p,@P gp  @ @VP  (@ @X0Pp7 @ Q (@  @ 0ppЍ MH-M  (@  eq ,@PN"@P ЍH Ѝ/ @Pnn0H-P ,@P 0@Pp @,@P (@ @X op ;Q0 (@u @ cp0@-@P  @D @ ,@Pp ,@P (@ @X @;p`Q0 (@ @ @/pp@-d @,`@PU *PQP@ p0H-PP@:PQPU@u: @P0p@-PG |,@@ID``` x"@ `@  "@ @ "@ @ | EE | EDP@ }"@ @p0H-@PPP  (@ @ o0  @,@0P 1A-@ 㑄 t (@P@,p@ ~oQ A  ꤙp` V Q A  ꕙ P   nV yVG-MP4( 0@`p.P,@P/P 04@ M @ 0Fp`@1oYF 0 @ ;YM @@0#D @ !@@.  @ o#D!@@  @ o#D!@@  @ o#D!@@  @ n#D!@@ & @ n#D!@@ - @ n !6@Ѝ @A-MⓆk P,`@  @댋 ,@P ,@ !@ @mP R@ P,@ pP| P@@P0 Q #0( @  qpW`Jpp_Q-QY0Q0" @ ,@ 2fk P,`@FU;J0 *,@ Q% r  0p pp @  P@  0pPJP 0p p@ 0p 0pPЍ @5kU @H @: @5H-a @/A-BM`P@6" @06m ,@ BߍH-P ,@@p`  pWHS@-K ,@@P > @ @ H- MPA"0@ @l@ PP { `,p@ E P`U ЍA- M`@F" @0l[ ,P@p{   , !@ ЍAA-BM`@PYE@Q*RV + @@@FQ ,@ APBލ@>PP Q@ @;@-XM@K"0 @Pzl@ HXЍQC/Ap@-BM@S"0 @fl[ @ 4BߍpA-MQ{ `P,p@@ B P Q `F@V @D& @@ЍH-P  @3 (@|1 @"0@mjO-LMP|a 㴫 { @P"`@,@,p@ h`cPRPSP TPn@Qd ,@LP" ,@fP dP ,@ ,@ ,@ ,@ ,@ ,@pm<(@`L ̋ ,@,@ ,@P r!@  "  0) p !@LpFPE@TP Y@ QX   ( ,@P   S<FB AB$:P P00 Gp0Ļ ,@P  @P  @7g0pPz U^*` P, R  PyP ,@P `V:@x  p7P 2QH ,@ PP Q ,@ /P @f0 ,@ @P   P @fV!@J?P 7P P @ @ @H  @.p4Ѝ' @ @P@K @F"O-\MM@ ,@P Q ,@ 0  "@< @Z @\ЍۍOf @~f @zf@P      d 0 @Wf\P*" " @݃ (@X` @Ef(q "p@ ˃ @6f  㾃 x@ @$f1 !"0@\P/y L# "@P" @0P 㡃 (@Xz  ! @fQ3 Q5 @0Y- @ @e\P" " @~ (@XW\Ѝۍ @edAPD   @ @ea  @e]  @e @  @  @ @e  @e Q  @\ЍۍO8 j@Q:g@P3;89 :0?@ABDPE @X5 @$P(p4uejP8  @ie \ЍۍO*e  @ae  @\e O-DMMQ ` @PPe@# " @Pւ|(p@X`P@`XX  Bfp5 0W 0W a z0BR000`p W [ w A,@,P@!p@ aVC [X Z Z/C^hX{ [  p@,P@\4;g w 0 .!p@A~hX[ w  !p@,P@@  .07+ 0 . @wd d [L(@@`P@`XX X eX}DЍۍO-M@ ,@p` V'@` ` ,@  GQ \ W W` `@`P; V? "VA  Pp 0`B V0 a0BSWBA0BS7B0R00S`P  | | "Pp p P@ P:2WW``/ (c* Y /P3 W1` ,@P p"`W ,@0`Up @`Ѝ#p 0  zЍOA/`P W ,@P ơp4P Y4P  E !f`P9`W  >  @* @ Hp@-@`TP ,@ R ,@!PU e0 Eop' @ @ H- P,@0000 P<P<OP<P<3?>0 0ASR   7S86S80 S :S40 S44 ? O00H-P@U U ae  @pb  @c0  @ c (@X0HO-dM p4"0<0(8P, $$0pCp<P 5P <0$ Cpڶ <@ @JTn@ p@Q^WyQZY W y'@Q  '@{*;o @ 6  @ 0@   @b xp2 0`CS`0``p01 P@pP% H0 ``bD 0`\> @ @ vb,( @`P@`XX X uc@ T:;  @dЍ @ @H-M6 o @ *; @   @ 0@  :bЍP P Q E @< @K @m@&bU  @#b0H-P@Q  _0t X @ 0H b  @0Hb@ 0Hbp@-M@ ,@PQn ,`@kzP  .,@]P  ,@,eP `V VO ,@@,SЍp@q s+,@ @ ,@0ka ,@Ѝp@-M@T T Ѝ@Uq +,@ @ ,@0Pa ,@ЍH-(M 0"@ 000S  Q:k  @a(Ѝp@-MP  X2P @P.P  `,@P@Tc@L@@_ ,P@,Ѝp@-Q R  RR@a@` RO 0+,@@ @`p@- ,@Q @;  A 0@.@R$B@@@@@P`@ BU: ,@p0H-M@Q P5_5Uo P`P4O T $2PQ U  +P$<,@ @$@ ,,@tUPT+ $<,@ @TT$<U~+! ,@ @t % {+,@ @|` ,@Ѝ0H-M00ЍH-M  0ЍO-M`P!,K@ @@Pp-Q#P P PZPP@GQ *K @@P(PP@Ѝp@@-M@ 0 0 0?=  0@ Ѝ@nO- MP@sPXk r  `@,@,@,p@,@ ^Tb@Q! ,  4 D L  /@,@DP* ,@ ,@ ,@ ,@ ,@ ,@ ,@hA @᠌p <(@P1  ,0@,@0 SQR2  ,0@ 1 ,0@0S 2 ,0@0S  @;'SQ  d ,@"@ m @R  @*'B @ @T@PB & , @000(& , @@T' >@PP  {,@` pGW:PV `@` `@T  ,@  ,@  ,@ @ P[ +P=(@ ` v >A,p@@0( ,@j,  @b_Ԅ0F P,@@|1PR @  ,@PLPH pM@  @?P]s@(p@PpQJ :PP@PP @L NPr@ Pz     d  H  Qk@R@>9"@ n@vO  @^]b ,`@@s(@PF I&PP Q UP:P@Q ,@<d TO !@@!@ !@!@nN(& , @ r v ,p@Pq @'H-w (@B @_\pC- F P,@@ЀKx2ЀP Pd @H"`@ "@ @X`@T @ 0P I᰹EUPKpP壹`0H-cL @@7xP P@m/P0Hp" @@( ,@(  !@ R ,P@o 0HG-MM`4 ,@P8v ,p@Q yv@,< @ 0@]4@uP @0 ,@,Y 0 pp @ @  @k^YV( ,@ܘ @_^%Fv< @ 0@B?:<V v<&e60@ @0*E^ W 8 ! @Z  @ 0J ,@ R  ,@0@< ,@mPP @8u@.ЍۍH-XMr a ,p@,`@P M @@P ,@Q YN @@A @"@@P@0 z,@ @0 ,@ >㹸 @ ,@P @ ,@P   @m/PJ @PKㇸ @PQ -P @ @    M,@ @ @@@ Q @ C #,@ @Q @ ,@Q @ ,@Q @ ,@Q @ ,@Q @ ! , @ R c  @ P @ F>P  @=H- ,@Pc  @ZH-< ,@lH-. @$O-DMot $ @P `@/p@'@'@ Ph@ Q           h x 1p HPX<(@EQHQ @ P PX T( 0 ,P@! @0@  \p3  P@ $#H Tp&yB \pP* C HQpX 㩌PP@ D  @ H@Ỉ- @ᶈ8 @᱈$ @ᬈH-|t (@M @\ ZO-DMP@ ooИ x ̈ Ԩ `@,@,@,p@,@,@ O`P a@P t l    l l l l l l l  l l  t l l l l   AP( MP, ,@% ,@" ,@ 7'@ @( /@, @ ,@p<(@PP~  ,@,@pQt ( ,@8 , @,0@ ` E XV p,@pP  (@'@X ,@ ,@+C.PQ PW " 0@q>V) * @[P@ ( , @0@0P h p,`@P  3 00pPᡅ X X ap@ pGW ,@@T@DЍ  @ᤇ  ,@ @ ᜇH-(Mks  @$m < @ 0@ @ @ (@M< @ 0@  h[XO-TMMH ,@@<04 &PL 0,@@DU,@`LceH P[ Y " &A }LP` @!@!@@V 00 `[4xdZ8(W Y} V p@ 8@9 DT( '0@TH0! @"5 &! !0@T L0! @ <,@P( '@Zf ,@P( '@Z+ H ,@@P[ XQ( 8PV XP: ,@P< @,@NZXQ  @[ ( <'@V|T) [pW/@[= P;8E> (:p2 PP/  ,@,@e  ,@P`d @ ,@ZZ ,@PT < @,@ZU`V 8 <(0   ,@,@6/>PKQ:    P   ( 8` ᇭ 8@,@T P 4@,P `p@0   m:pr2 q P@,`pP , @,@, @YKP  !@ x L X d p  @@Y#  @YR @  @ @ @ @ @Y@ @}Y 〿P,@@p@pL Y ,@@ @,f @,a#t @!p@ppP \ ,P@,U @,P#t @!p@< \ ,P@,D @,?#t@!p@  \ ,P@,4 @,/#t@@!p@  \ ,P@," @, #t@@!p@  \ ,P@, @,  #t@@!p@  \ ,P@, @,#t@@!p@  \ ,P@, @,#t@@!p@  \ ,P@,گr @,կ #t@@!p@  \ ,P@,ȯ @,ï #t@@!p@  \ ,P@,ᶯ  @,㱯#t@@!p@ \ ,P@,᤯ !@,㟯#t@@!p@T @P( @ 0BXL ,@@,ዯ,㇯), @, @ XHQ : @X(D @{X ?XX(@ 8E>@@@9py  @ ,@ 0L8`@@(p E>PP PP9pP P4 ,@  Pm8P@ (E>@@@8pP  @ ,@ 0#%+@P8(G E>   8p< P$ ,@0I(@ 8E>@@@8p+  @ ,@ 0@a0 @XPYW_ 8 `  PP*P @E> 8pY: '@( @, @sX1@@J@T) 0&4\904ظ ,@pPp h ,`@8( !   QQ 0"  4p`@W:0,TЍۍ  ,@,@  ,@P @@0$  ^.8p<P A pW:<(Q P 40_*40P $  Ծ40 $<X 0 S-8 M,@ @fUO-MMp ,@=㾴P @T`T`?Q`D@`4@_P㌹ '@.QQ_ `h ,`@(Y 'P@P ( '@ h c$ ,`@$P X 0_p/ $ Tp P,@P (@ 00@R   00 S ,@P% W,$ 0XNPK   ,@PCTP=D @ PK@=PPE=P ,@@P X``Ľ(pPP\T @ A A,\XTTTT$P@ PK P` = P b @tP W ,P @@b @P p@ & !@PM  @P` Z "@Pc  @P  !@P  @PTt hBQ0  # # # # # $ , # D # # 4 #  < aRp p pUTV `P" PPP~PQ`y @T6} @DP] A"@>PY  @8PW P @2PU  @,PQ  @&PM T t Q PeP7 R2T`X 7PP P@HPUT\PP ` ZQV`pX @ PX@ =PPR=P ,@@P (PP 8 At,0@ @ AXcX ᝩp X`XV Xp0 `\0X0X `5p   ,@,@gX@P[ "@!YX X06 @ ZPo =PPj =P = oP  ,@PO =e(@PP  A 8 Bc,0@ B    0p  X`X 0 AXXP\4`0 ``5p `P  @,@* P( `V X0$  ,@  6/ @ЍۍOH ,@@XP0 PЍۍGP! " !  ! $P  PTTTP CPXpp\ "P 5 2"@*P P:  @P)  @)n @,@X $P剿@pXW.P,   @eY|5 B  @R7  @3Pp  @ AQ `Q Q _TPtT:"&PX `XX0 4p X4,@ # 0 @35 ,@ @L  ,@,@D2 "@,@S=R/ @^  @,@S ,@1 @QW V t  @VQ `@4@Ǫ+p Zp y P.@@XP P> P= c  8  ( ,0@§ q ' P P ,QMQuA `( XĔ ,@UPQ`0 `3p   ,@,@e@P "@! @Jn4  @q(& @!@ n @P    X`(pQ'@ ꌹ X`(pQ'@ QQ (P Q @ @   @DT QTQTQ2T/Qz  @  @ AP( * * 0+ D+ `l KPP P  @ X= D3p P P. PH ,@@ 00 0*V 0P H ,@@ 0 0H ,@@( 0X 0@R/ @  @U  @ }\  @-Dp㖽T T*  @ tኽ/ @$\RX PPA  @L>  @SE` PP P  @4 @1@PJUETC TP@PU*% o$ X\ PP$PPXP @O- 3 6,@ @M @  @s  @ @,@M0H-M0@P001Q0 P0P0AAЍ0HЍ/K-GMP AN `XᏸpF 0 `@ 2p`PV`v  XQ:*X`Gލ Q( Q.$`O-$MX '@,P@Pt ,@/᦮P X tJ `,P@ ,@@/pF  ዸ b>uPᰰጮ`Pt ,@$ЍOQ>O-\M@t ,@`_2QPu  P@"p@X: %3P t ,@ 0>P P /!  P@*Xp\Ѝ`@0 (H @`@0 H" @ 0Y} Mp@-Mi @'`@P*i< @sP1 0 &,p)  ,@P '@ T !@qK `V  Y Vp@ @ P@2 p`K ` p @V: K#Ѝ @w0H-(MP8@ 0+p P,  ,@,@  0 ,@P< @K  : @@ 1+S*A;B++ + K(Ѝ0 @ wO-$MM ,@@PP? T9 5cP `@#!@@8P+ P#T@p!P@ㆺ pl Wo QlPp*`!8pPP`@H 0R+p V ,@P?Ԉ x ,@,p@L V00 *9o(@ߵ0V  ,#V   *0 @ĵ0  #$Ѝٍ"PW @P  @ v & @ @vA- Mx @,p@`PPV # @㏷P  8 R PӹP @ @ YP^#H``8 0`*p V ,@PCX x ,P@V,p@Q<Q  0oM+1  "* @ 0V PP  0n!!* @ 0 ЍH-(@  0 @000@0@0^S @CSG-Mu!`Pp@ @@`0 T  0 p $"@`VTY @a@P Ѝ( @-' @v; @O-dM`@PP gT5 0ԃp @(@ |' J @0H0  H  00 .[<P 7pT P  @dЍOI0H-P @P8PU04P 4`P8U:!XP0P4PQ8P:!XP00 ,@Q ,@/ ( '@, @  @O-MMP`Ja@ @-P|ㄝ  @M p@,@,@@/@ <TP0U@%PPQ S S S S S S S S S S S $R S Q  @+G5EK-Yi} @P `@,p@/@ ;tPPHaPp-<(@E Q% Q"m P@A,`@eP( P@:DQ@T N @BP  @<PO_@ (@PX @]Gu @ XGD0H-:_@ (@P @HG @ CG @ >G @ 9G  @ 4G)  @ /G<  @ *G]  @ %G  @ GDH-MM@P  ]P/  }P*J  @   @ m } ,`@,p@PP PP `,@P   `p  @'`ЍۍZD0H-M@  c]P P,@P  ,@ fp  @&Pۍ0O-mMM  @"@0@@hP  "@0@ ZP " !@h3P P`堐 ;cp |L  p @ $PM P*P @x| L ppe D PoPl @P$!0 a! @0@PgEX ,@P U~ p@_P ~ p@^p E@T:>P2 @PT( p0 ! @0@3EP ,@U~P p@ ] rE$аX:~P p@ pP " !@2PPP mߍۍO-MMkPSC` (@N{  @@!p@PዲP ᆲP D\P zP Y   @%  PY  @P 9p ,@p @P ` ,@P N @HPi ,\P P (]`, p-8  ` zP @opB6 ]`V P Y V+ @>! @ 0@`fD2P   @ / @ [)  @o%$. >! @ 0@HD@p ,@PU N @o @o N{ @@!p@j`PDNY @P\ U  @ 0eDP\ U  @ WD $ @ 0DN{ @@!p@ V  I @ 0DN{ @@!p@P >2P q  @ PP /B,B@p@-@ ,@P^@hP   4p u\  @ C  @$O-M-hMpPH (0@P#`PT   $ pR@V  @ ' `U U U /d @ @ @49d @ @Cd @ @P φdY @ @P P(V oPL#T $` p[B~`F1V 8 )/ @ @P0y @ (!  p@  @ @ pnCT$@ˋ `  0P ,XHpP  L?PP 4PP8D0< @D Y ;_ @$E P+\p $;Z  \p G UP$;\p _P0e @ Czo Z @  ` C@< D084P,8d ?'P0 A @ BdPʏ 00 G 0D z  0L @P  bP@ 6  P  P P@@ GP' O-M ,@`@PT ,@ } ,p@e P,@ @pPȬ `~AU U ` B P  P H pGX. @i!pЍP` ,@@ pP ,@@} B.,p@WP - @, @ mp@-P P P'ʔ  -@j+ @- @@D ^5( "! 0 iTH "@P! @!0@-`@!@@@0i( @S @D -@pp@0H-@(  "@P!@ឭP PQ [ -@ @ @D -@ RP @& @&P0j -@ 㠦 -@ -@0H-[ @-P@T@T 8e-@-`@p( "@T Q  @ lT  -@P  , @- @& @&Pp@P  @H-4D -@P !@H-4D -@P  @tH-4D -@H-P  -@+ @- @:@4D -@H-P # -@+ @- @(@4D -@H-P F -@+ @- @@|4D -@H-AM@P =  FPU P@ -@03 -0@<# 0DP?o- @s 2 p@`\ @ pTR 0 8  aV @0pU0R0V&$T T l#  @AP P w#  @AP PP 4D -@AލO-tMԳ@R(@1 Q+ p` S@ Q T@:R @ @R `s(p@ A` R @S+ Y# - @0S Q: 0Q Hc @-`@S 0pW Q P CPQP* @\A P  @ A 0S9 jc P,-`@P$P \P P ,1Q:pS `P`P0S1 AQ0SPUPQ0pS`Pj' ,- @ `iZQ]\Qr [Q|$PPp 0P 1@P,P ]Pj  $P Pp+Q\QP$Q 0 0P 1@PP PQpU pWڅ,Q]Q? Qw P FPyPU PQmP$QP000 0P, R7  QTQ  FQJQH  FPD upE \P P3 ]PpPp1@P P!pR pW"  R  QP!PR PU -@n @P +  tЍO-M-HMMP@D P# D @?Px X \-@@@ @k;,@MP@k -@Pg @@ "CP: z< $U㍳ ㈓ @`-p@-@-P@ @ @PPX -@@=X -@P8 @]P2 8 0-@  @ -@ 0 0V-@o00Q -$X -@P -@P @`/P`X -@@ B`P1D -@DP-@P P e@C @P-`@-@@Pl  Š 0Ꮚ@ϊ FWPP @P9  0 $-@03 -0@op0Q00 Ws @ p@#X -@P -@P @$%- @PPX -@$-@PQPY e-`@QX -@PL @ PF @< -@ 0   C @03 -0@ $-@p0Ro0Ws 0 p@ @[#X -@P! -@P @$%- @[P eX -`@-@P$-@@  @yXDPQ5 :X -@HЍۍЍH-9 -@P -@ P @y,@LA-X -@Q-@Q $uR-p@-P@@`P@`O- MMP$-@@Pn -@Pi} -@`Q p@ p` @ 0F<僚 0(@+ AP J̣(@?P  @ 0*< @ 0$<a  (@+0@PZX $-@@0@ @<$oPaP nP@pP qPX @-@@ @@-@@ @ ;$%- @ @ Ѝۍ# - @  3 , 0@ @0 G-KMp@P7`APO @ P8 -@-@<# - @Q0 DP/oS0B 0 @W[ , -@ P3 W7pEpHT T w#  @x=P P l#  @l=P PP /D -@@8 /-@ 0 @{@.PA r, @ R @|Q# - @ VT @ 0) @-@@@\Kލ @n@# - @  3 4. 0@ @0 HO-MMP P #  @<P # XD - @-@@  @ӧP, -@ P \ @l8P,@JPly-p@ P&@P jP\ -`@-P@pPPqPn BP#  dPc < -@P08 -@ @ -@  P P  @  -@ @ :=# - @$%c - @-`@ pZp/o 0"4  @ 3 0@ 0 @2) -@yQ-p@`P\ -P@P $-@ P$-@ ?P7.D -@Ѝۍ /-@ 0 @XK-AMP2@* @S:P- `l P!@ + +-@0Ѐ`` ? s 4 p@@pPJP  0`<+0>pd u.  -@+ @:D -@AލQ  @@P/H-P F -@V$ a4 @ @ 0@9O.D -@p@-P@P Po`@P Q @P 1.pUpP Q:-@ @0@0j @ 9pH-"r4 - @ 0@D -@H-P 8-@P -@| @Hz.D -@H-)4 - @ 0@D -@H-P P(( Q@-@ @@/oQ" @@'`J@@PpP Qp p@iP BP4(  -@ X-@ -%( -@( -@@Y -P@ @ H9(C -@@P X -@ @ <9$ @P< -@ D -@  -@ @'9H-8% 5 - @ 0@=D -@H-)5 - @ 0@3D -@@-@;p`pZ @1PPP^P@ᄡ@;|` ᥜ V <`P,   @=P& 4>0@  G%V ЍG -@ @0, ЍG蘓W`p*D -@ЍD -@O-$MP P#  @P8P Pl#  @F8Px @@>@P|Po @@X \-@PP @3@,@EP @P@ F 㸕 4^l-@ @@@P@ `@p @[0P- 0 ! Sp0p [0$P-@Q $%- @`P$-@`lX -@ `@P `3P H*D -@$Ѝ;P  @mPA-MMP @;3PՅP `P@EP,3v3 @*D -@ЍۍPPU3 @㱖UP!P@/PP+㆛ -@P i-`@eP @   5T  +-@0 @    @D -@2p@-MP  PZ'  @57 @P:)D -@Ѝpc @|`P  Pk @YPPP@$Pv  @g@ᮛT P~ @YPPP P  @O@ןᖛ`T @oP  @ @9Ÿၛ -@_8 -@ @0H-DC -@@PP PP -@-P@PPF<P  -@P @- @400H-) -@ @0% 0HΑ0H-DC -@@PP\ -P@P9P  -@P, @- @400H)t -@ @0$ 0H訑H-MP+ P)P'  @ q6P * @PD -@}Q8-@P -@ @P) @P$ -@(D -@ЍH-MP+ P)P'  @ 86P \ @PD -@}Q8-@P -@1 @[ @rP$ -@(D -@ЍH-M P Pc(  @ 5P Y @t(D -@ЍK-M@P +U" pE` !@ +cV +]`U  @'P$ -@ۍH-M P Px(  @ 5P  @+(D -@ЍH-MP P5  @ 5P Pw#  @ 5P P @P (D -@Ѝ0H-P 8E -@@PP  @ 'D -@0 @P00H- @R:'D -@08E -@@PP  @ @P00H-P 8E -@@PP  @ 'D -@0 @P0@-PQ 'D -@J-@@P  d&P 0H-PQ 'D -@ -@P @SHI7H-0@-M P  PP@ d'D -@ @bW@P@  @.ᷝvЍH--@E0 -@P& , -@-@P&,@aBK-MP P(  @4P ,P p  -@ @1'0 -@ @)p P ,@2BP $  @ 0@% -@P P -@5 @g%/ -@ @[D -@ЍRy-P@@ڙP `3@ SP UP@ 2/, -@P%/H-8# E9 - @ 0@bD -@H-)R9 - @ 0@XD -@0H-P PPU  0@@P  -@0 @@.H-MP: P8Pl#  @ 0P/ 4P+ @ @)PPP^P@^`[`3 p" !@  D -@"D -@ЍO-MP = P;Pw#   @G0P2  @)PPP^P@`y3|@ ? ( c 8-@-`@ -@Ѐ3 Pp 0@  @pPM"D -@Ѝ0H-P/P@' @P  !@P .  @ PPPP6p 0 -@0 -@0-@06 @-U"D -@0A-MD -@  RPd '@0S Y} YaL ` p@-P@ @@ Q-0`SЍA)" ЍH-@`po'P PP }208-@0PT  -@ @ H- j -@ @ H-p@-Dc @-`@PB'P PP  -@ @x-pp@! j -@ @p@k-0H-P , -@P 8E-@@P @P0!D -@0 -@ @0, 0H\0H- @R:!D -@0,, - @ R 8E -@@PP  @r  -@ @0, 0H9 @dP00H- R,, - @ R 8E0-@@ PP A  @Mr!D -@0 -@ @0, 0H I @8P0O-$MMPQ Q!*PE+  @.P -@`V\T p-P@@ 㓙P pPVpW -@  @,D -@$Ѝٍ-@)㩒\ -@sP(p@ AY I @B-@@p$Q \Q Q@  00iRU-@ A)qB@ P 0 0@  AQ`"- @ B)K@@& -@[&P @p  -@ @ -@ @ P -@P -@5 @D -@ Yy8-@P i-`@-@P @   ,` -@`-@ 2/-@PP-@)ߑ% -@-@ -@ @P  P N,[ PUO- MP@ -@L;P -@P Ph @) @)P -@Pp l Ѝ㜙H:,@-@`-@P iP `PpW >@=P|P PP `p@-MP  @ @ṚP   @ 㲚P   @P  ` @ 㤚P U PP 0PЍp @_&PPЍp@>   @ ㄚP!  F @0 WG- M( p` @ p/ ȕ P/P:P# 1p P P  ЍPP DC p`-@@@cP)`PXᛕp p/ 弐a !@ /!@ 㱐 /p(P p/ P :P p`v// PPpD -@@cPP  @UPO-M-^M@p|xppptppppTpppp,@p|pxxplphpwdpp0pp pp9HP-@ p 'p  '|p |'xp x'P: 6<xp 0S @  p x.|d.h.Px(UlpP'PQTPQUi UQ . PI Rtp t(PP 1/PP x+ d) < : P P P P ^ލЍ? @ P I @M/(P..PPP4I P-@؀Pc PL-@p-`@\PPXP PP$ -@ @ * @5P$ 5P@s -p@ \X 5  pTq]8-@P y -p@ @P)   @I)  @& -@ `@@QpQ P L @&<x @&I,@-@@ T,P@R Q P <Q P Q,@8.XP%-@|@- @p |r&|d$P@P( D,@,@@ b6PI  wM peV> "P= W;J@ Q;Q  @ qQ Q@㌕P-W& p@\eP-`@P j  ,@R ?,@0  R (` U/? (`P-@(` R 0d,`@  S 썢Ρ0 5P  P 0( 0 `pWp  Cp q#PP   7X` P( -@P <P-@㔉X-@-@P-@ ,P P P'@],P P -@ H-@R 0ES 2 H0ppT0(4,0@@0P} `#p @P  P  p  R `@c(#p0 P0\% - @P @@@BnPPR@@$   j/5u0SeG/ rP@D?  j/e5 FuSPP U*p@3P) PH`-@`@ -@P t,@,p@ 4P  @KPV P~ `P@ @p @4Ux,P@,YD -@PPeQP\ P^ @Y @Q# @H-@>@P |P $4@=PW ( @ -@  0 %0&   P 0 '0*# - @`0 P& #   P 8-@P -@ 0 @[ @7 @,"$ ! -@ @ QP'Pn/0 pP Ep-@Px|` C0uTpp55505w?tPPX P( @xP!P R P+}"n!@#P (` "tn_$!p@: P   P j H-@Q QP OZ:  APC PP$c -`@qWܥ@@Z` 8!dbj_ @-@!`@ u   00 0p@ #P  F BPP  -@ @ 0<& p0 Po2 {0p Y m[.k? @"%p J  @ SZ ꥠ0p @  `-@, `P %UH@@ U-@-@ ဌP UU ᳐rP P utatp;ڸ @H#Y-P@|Q<0#t @K2T3&#P<"#8㔙-@-@P \ @ %PP 8-@PD x0   # @ @%9C x| @  @q1x  @j1+  @f1 -@P Af `@ pZ1P  @P ? @K1 T @ d%  @;1d -@P {4 $ 0@ @Q)1 c @ `@PXP  @1 V$ a4 @ @ 0@1똀w p@PYp`Q`U 8-@P  @ %  @ 0 PV  8P-@P  @ %P   @ 0PU8-@P D @@0N1p N"봐 Ȱp'@ * `j?PPH`L`@@ P; P   Gk @."p ᭁP Pn Q)Q( #( @ @!  p 0 P ` 0  (@Xc >  0  P `n])HP ᴐ '@ n?`@%PP0   0  PR(-@P P Q8)P Q0) -@PP\d ^-`@ P@pP `pWBP4pD` 0 pP `<@HpD`@0 8P $ w_ @u P>4  @PQl  @PZ{  @Pi  @P   @Pg  @  @P   @P   @P '@n? 4P b # Q- @J 08P 0P ` @P *Q- p P0Gj 0ϊ Ê+Pp Pkjb\Xf~(0  0`c  @}Pq Rj `QMJpP-QGj  0QJPpP @/P5 *R0 `j t0`Q{JP" -@# 0` 8HpPP o(00`8  '@@ 4Pn? P 0p P ` 0  P\ 0 (0)' *# - @  @4@#P @PPxpX QPK P P "  @{x1-P x`%P   @m  @ jM 0 @  ph PPP W  @~jX<0KCPv r 8pP @WPG @ @+ @(꼑,@ " F @5 @ -@ @){w -@-@r @ @{0 @R @9H -@-@( -@P@ <-@P; P 7X%- @ P -@ @P  P # -@P @  PS S -@   00 "~.P r @WTX=\0@ R  ! jO``nύX \0L1/`p  -@@Xb,) @! pPv p -@ Z  @ 0R1,@Q r @   00P81-@S?P 8 -@ @! 8px0 @!9aV P a !@nPi& h G  001DP# D` @K!#!6P 8 -@ @r!8px  00PD" @-8 @)`  008P4p  00`  0p Z PPK H 0pIC @ 0   @0  08PD`pL@ P0 H7V 3U /` H PW-@ W Wx | @P 00p  08PD`@ ‹O-LMM @P @ 0P(P,PPPRP7P  %@P}P 9-0@ , %P:}P %PS  (0 @Pp ,P P PP+  @aUP( LЍۍ`P@VB P@P= / PQ' P/ P(PQ ;ؖP # P @_P. +  @YP5 3  @SP3 h  @ 4Pa !@ = `PQ  @ -@P! P P``U P   @vPTP   @v`P``y `j-p@-`@@@P @78+  P8@<( @D(E-@@p8B!pP P,0  "P X `X8y!$! @P  @>8^`U0 [.2K$ 8p"@@-@ `P /|P``{ P P +㜅@ -@P 5 ' 0 @dP -@P,@S-@-@P P P0H-@P PU e$P00p@-`P@:qzP W"`'P %fzPp  @ V)g  @ N) P P !PR!R   @=)@p@8)H-Mp -@@`PP<0 +0SJ  @0C @P 00S  P  @ЍK-p@`@@ P AQ P rQ AR0Q  qQ  PO-lMMP@,@H A,@P A A-@D0HTLP@zP PfcD,@F,@@P,@QDD -@[@D 8!`<@ P-@!@ 4` wP $㚂 㖂PDP  -@ @ 0 pp 0Po2&p%ᨼ  @ [C  @9DD -@  0 @ +D -@lЍۍW ,P@-DG,@@< D<ᏽp# <Q0 v* @hEY 4-P@@aEI P-@@Q / @  @UDl -`@P -@C @ !PP EP ED -@&MP 0P3,0P-/O-(@҅P |PF pp*$ @/<<P_ ( @, (@<|PY ,@s(P (O -@(Q DE-@@PJ4P 4B4D# - @00P4G1* @<<P! @,<P@<0PJH  P  -@ @    @ @D -@(p ($DE-@@p $ PJ,P<P ,<1/4P 4YB -@Ѝ -@p4@=  @ P  @P4@. -@@Q*< P< 0 $~ D -@Pa< 0  pW -@ @WP @pU  !@ K  @FP~$ -@44P ]y,P@-p@m,`@P Q P Q P Q H$p L$( ; -@-0@P <%X- @-@ R   @:@Q*</du-p@P<400S4 `0pVP}  d 4`3 B  S "P, 8e-@-`@S `30PP @UP Z -@P -@% @- @0 -@PZ Z t-@P  0`A @PPW -@P? Xp``PP -@ @P# @9@@@'b @ @@P0 @"8 @U @-@@@KލЍP>D -@P? @ P< -@A @D -@P @ P -@ @PdX l0   p`PF.\0,@ @jO P@`P\PXP -@ @dl  00   0,@ @ppIOPl$!p4,@td,d(hPxt$ 0 P3?( SB -@ @1s -@h @FS d000  ,@ @O* @QST QU QV Q -@%@X@T -@ @,@ `0 C ^,P@0]p0-@P<l$!p4Ptd,dh(xt$,@0 3?( PO-LMD,-@-@Q LЍO< @pH P pA (P$ (-@@m, PP<@b`A(,  00S( 0B 0@SCC?7 /p ƁP #P @P  @\@庲LЍ ,@ <ⰲPp@< p⟁P #P   ឲp P喲 P刲p =P0 㙳 ;@: @O-LMpp`PtPǿ@[ǿS-@0PW 0㊳T@P~@   2ppBP >#P  #pPJW PP  @pP #Pf @PJpGPWppP  #-@ R p  0QPr" @P  P P ء ?$ R# P1#-@W@w 0 08 (P0S4$pEP/pp r^@P@@A_)p㰀PP(  P $!P9-0@  @P  P  #P @   9-0@o낀PowLЍ#9-0@O-CMX-@` -@/@$ P* -@ @M P-@<%- @4-@P@ @}o8-@4Q P0PZ -@PPj-@ Q P ,@ PP@Z Y-P@P @PD -@p Y@N}P|P{ -p@P -@Q   D -@0 pPu Q Ph ,@P_  ,@PEP-@@ \ @ -@PQ D# - @0P0K H/㢆pSP O P0W @Wa !@z/ "% a ! @P!@mp4s -p@P + P〰p?P  Pm { @.C -@@P ZP   @! 0 @P !@ P*  @Py Y P( @4  @>@|P |P " 4@;&Pn 4-@<-@( @ @B<-@4-@ (@X_P@ pH  P i,@-`@P Q ^,P@P Q P Q_ ( 0-@P <%X- @-@ R @@Q,*P \u `-p@P! R., @0 pP PeP-`@pG~ P  @Xp@PeP-`@p @P@P-@#pN PL P pK^Y$  P-@@T @P  P p"m  X-@ 0-YP-@  0  P`P   ;p# @ V v V   &p P%- @4-@<-@#PeY-`@pk @ T  @P  P #P @ P L0 pP000ctq+1# @Pep-`@Q 0 P!JPp`P P pP p`U  0p+ @qI  @ @ @L}@J} P  @[ p@ A;}@# @Mz P 1/7P I -@@ @ O @ԭ W  R Pw 4-@P @PP s0 !0 < 8 @`p',`(p0Pep A-@P8-y 0 @ #7-G-/P/p!P @a !@T`pa " !@!@U`v. A-@@+s.  V( A1dp1P-@@pW! u `P9QP0P֮PJu0QZ.QJP   @@ -@ @:0H-hM@-@ PD @d As -@P3 ,@H-MY @-P@PF oP  0$P D @\] @  Wk -@ $Ds PP-p@ uD @E-@PT P+PP PP ۍ" @-@PD -@ۍH`@-{@-@7 ,@{@G-T@,@P @P5 -@T Q(nw,`@,p@PQ g(~,`@,p@D :-@-0@P@Q@  ,rA_JeP,@PE_ `,@EO*a EA_*EY -P@$!jd@ ) - @j@P(Q[ -P@,$A@ -@JA00 -@,AHC 4-@@40 -@(1884 -@0 <<8 -@@@< -@DDRCrR ?rYC YQ-@@ 8r 4r@ jC -@l!-@@ l+(r+$rjG W-@@+rW+r  P G/@--@@s -@P -@ P @X '-@, @@-@@,@p@-M@PT 0S00U 0S 0100 `P TU T@Ѝp@-P Q -@f @㔫D -@I -@@ PJP @D -@@ -@f @rO-4MM0,Ym @ `@s,!-@!@-@@-@!@Up -P@ @@lPP-@(@-@@~ @ -@$-@@U,-@-P@0-@@4-@8-@@<-@@D-@H-@@L-@@X-@\-@@`-@d-@@l-@@h-@p-@@t-@-@@x-@@|-@@-@@ @-lP @-@+q P*-@ @l4P@ -@ @lP. E @ @P  !@P c @P !@P   @0-@0-@,-@" @wP  @wP0-@,-@ @kP-@ R`Q P @k !@kP  @ewP@@l_(`@PkX -@ -@ PkP 8T-@ P<-@0 -@ @0`0,P 4p@DW] @ 0pM xX N xX xX xX V xX xX xX xX V xX N xX xX xX xX xX xX O xX xX xX xX xX M xX N xX 0N xX @O xX @N xX xX xX xX xX xX xX xX xX xX O O xX HN L tN M xX P xX xX xX xX P (P |P M P N P N N xX Q -@ -@t/p@( rP-@( 0P t/p@-@+o P 0:/@-@L-@ )-@- @0 -@/@ 0 a$%/@- @0 U<-@8-@G @,-@0-@p/@wp p @ @op/@ep$#$!@Pm Qt pWd -@Mt/p@(  P'@ ( 0P E/@4H-@>@+vP 0 (@-@/0-@,-@'$-@#t/p@( P-@( 0P  -@ t/p@p-@ڼ-@ 0 p $6  @ (@ @0 4Ѝۍp @-@p 0D )-@- @@ -@U@<(@00pA0,$-@0,  P-@ 9-0@ A0@ppuPYy -P@-p@ @@@iPQ -P _@PH@P P PQ y v -@PQ @၅-@+n Y@ -@ @+^ P:?PV H @MQa !@L P 6  @@hn  @ ^V @~iPP  @  p@riY P @   p@fiP   p@\iP   p@RiP  {b @IiP@  @ph @>ir P @ H  @ex @3iP  @ [ @)iP  @ Q.mLA @@yvG  @@qnT  @j0P}[,:dP ,4Ps -@uPh @P @L,@Pd@P `P/@ @/@?Q   @0 @`pP+m,t-@pyTQ -p@ P@ DV @-@@0V P R P  -@-@@zDbP [c0,p= -@h @ @G  @ s @  @  @ ?@+0 @  @N3? 0 @ E3 PZv0 ,@-@P P|r걁  0 @ $3O- M␙IjX-@-@@(@-@-`@-@ P@P P  4e )0 p P Pg-@P -@p pP  @ @岦 @ P -@P5 @" P- @ l-@-@ X P@2/-@PP  @P  @P  P h @ @ ЍP P @  ` \p@-Z-P@Pd '@P HL` @@]P P  @a2Fr! J @P-@@ pp@-@P d` P'`@P 9P @pp@-^-P@Pd '@P O ` @@"P P  @&2FY- N @P-@@ Opp@- -@-@-@-@Y -@-P@b-`@@TpH-P+ ) ' @PU& 0`p@S`P`V p`V V`Ap Vp `PUWO-M@pC` @~rV2 PPV. V/rY@-P@ 0-@>" @ @S  @) ' @P  `Q R [ [`Pj ЍOЍOV0Fr -@ p@`P pb @ 0U 0 a @SHX ` Ak `2/Ѝp@- -@-@  -@0$S!S0S S '@'@!Rp3 -0@ 00 0 S S S080S S03 -0@ 00P@` P\V "V `V "V ` P`V$ ` P `!VV V VU  @pS  Sp # - @ p 0H-P d @'@P PP PP  @ 00|  @0@-@ '@@p -@P<@o O-M-RMC 㨉 p-@@-@-@Y -P@ܥ e J ԥ 1$qS(apPPVpPP -@-@ `0T -@* kPp J `0P P p * P᠟P#gj% f @r@ U:% d @ 0h@r% O @` pp7dcGpU q-@Q `W  0Pp Qp0S|% f @?`@-@pP@-@ R -@P -@ P @&p@O-kMP-@pPi *-@ @`@Й P-@C p.ӫ]Y P @㩦  -@ @ eP2 PP\ P p0SP  P @Pr Hs s (t EP p P  -@umP  -@jP 6 @gmP PPJ?P p P -@RPPJ?P p P -@:-@Qz-p@Q A  * Q  Q Q q R \t -p@P PQ f*p (@@ U P -@^\ -@ \ -@ zP-p@ PP P \ -@ Z{Q A  &* Q qb\ 㜥 -@-@ Q *pP q Q  \4 -0@ 0Z 0ZS P  Q?J婦 P @D -@PPnP   @-@p )p -@< @o)pkߍ -@[ @ -@ @ @E  @ @? @< -@ @A-Y @-P@`  P,PQ A  )P @Q:p ("P&i @-`@Q A  k)\P p"P IQ Z)p< F@Ddt0I `-@@|Q A  A)[P \PQ  Q P ,P ()p D`Fdv @@DF@@ -@P} I "@P -@@@kP PP @k@iH-` -@PP .[@P pP `Gy -p@ nPoB@p@-MP4 Z-P@Q D  -@ @ -@&P$! @ wQ@e-`@5 -@@-0@R0P0R -@P R   @|*D -@ЍpsP P8-@P . -@ @ -@Sj  `-@!@ `Cd U -@ @` -@ ` -@7d _ -@ @` -@ .d -@!@` -@ %d -@"@` -@ d( -@-@ Q  Ѝp@@K-MrP-p@`h딙@-@ T!*U  @ ` `0 @ (@p "-@- @ R `Ѝ9  @G  [8 @ 0@>O-dMPp@Q`PP PP `W P -@P V 6 @U  @|  0ppW%؉P-@-@(@ `0S   @  @ P 0epPOpP @-@P =hP:hP p^c  @ S SP }pc  @`P> Qk @!@P@ hc v @} P@hcT!Q~ @!@P@gcP<  @\P@gc`@T-QP @FP!T @-@ -@P' -@d -@pWO\T n-P@ `@iP7 PpWB, @@  j< @ 0@D -@@P  PU gPc P  PU gBcP dЍ -@ @)b -@-@P\ -P@M@PP -@P -@A- 8U-@-P@`P @P\u 㔉V-p@-@ @f @c P:.P Bk @0h@ @ kP  @ kP H -@L, -@- @Q V)   -@ @ VDP! @! -@L, -@H -@- @Q j -@ @ "bV  j+ @- @",L -@@ b|u-p@ @ @UP  1s0b Br`0H-@Q (@@Q?  @,\ P-P@   @ NkP D  @P B!@P P  @P0 0@-I -@@P % -@H -@TD  -@-@@ L< -0@R t-@D-@ x%- @P  -@Q-@H--@ -@P -@ P @r -@ A-jPjy -`@-p@P P PW%DE-@@PJ㝛僛P P P8%, -@npXZjP  @ :'H-P P  @8'  @*'H-P`p @P e@ R. T : z 0@ p@Rpp`FPl(`@ AQ % PpT  @`T@-@-P~  @ &@-PL -@@v>PO-MMPX -@` -@Q-@Q P 8^ -P@P $@@P 8 @-@ R 8J -@@mP  yWP< @-@@< -@Q`@T`` p-@+n`P/P a !@+Ppe @+Pi5paڏ8%( - @-@0T00 0<5-0@U -@ o~ R 4>f p0@ `@ < 0@RD -@@dP:T -@ U-@ oX( -@P8-@<*-@ @)z Rq T @ #@@s  @:@Ѝۍ0H-0MP -@P 0P A @ A @P   @ 0Ѝ0HP @ 0Ѝ0A-MiP-`@8,L -@P-@@pP  @P# -@V@PA  㴿 R5 3(0@0 @ @1@U- (-@ 0 @V$PD -@}Pp@U PY -P@-@ZP @ pЍO-,MyP-p@8D ,l P-@-@-`@@PK  @PQu -p@`-VP.'VPdP` @ AAPi -`@ @(2Z @ !` P A A BcPBm @@+P;  !0  . @:U5 (-@ 0 @ V,P}PpU" PY -P@-@ƘP  [ -@ z -@ @ ,ЍH-) 0@ @-@2P@ -@  @$H-`P@@  @ *pP   @ *pP  @ *p~A-P -@8e-@ -`@Q D p-@@PP@ P-@@ -@[UPQpP"QQ P 0-@C"Q "R  Q S0:  P -@@H-MM@P$8^6'" `!@ ePP 1;P /Pbp` dPP /@ooP$  @UPЍۍO-M@T `PpbPPpWPP  -@`!dU@D` dVR:PIp-@@  P? * aV ẗQ"*bP*` @P  P `V: @Q* XP  '000S Ѝ@-Mf@-@ 0Sh0DQPp  P-@f@ЍH- Pd-@ R&\-@ R`5-0@0  Q h%- @ \-@ R `5-0@0R B Q h%- @ QAJ  @a#@-M#( @@ "   R Q R#( @ fQgQ mQ kQ Q bQO OЍ0H-M@ -@PY-P@ 0Kpt @? -@P Y-P@ 07p Ѝ0  @Ѝ0H'O-pW% Q" S AP\〒@` @GT ^ *p\W ^p2P`pW ^U1:O- MP JpAP`-@-@@A%Y Y V* `PbY.IP :%Y MYg nY mYb cYP QY PP @-@cY.Y0 Qp 0p/Q W0^1PA UP0PA2!USp@S/T Sp0pG@Q0QSp/Z0^4BQ1 P J-@V-@@*.Y.0TV* 0R07 2R1|*`.gD >#-@ @QPP} V  mY.Pv Rc `PnP J-@-@@GVU*% aT -@P>@PX V  RA `PLV8*% RB:2V-*/   R)*<0 Q0 R937 2R1*+0R*00 R*`>Q V  R `Q   Ѝ/O-\MMp`@    7 4ilP !T!P@7$[ [ -@P P R PUP 庖p=  㘕p-  P㑕pK ⬩<-@8HP 㹖  }p4  qq  @@  @ @7 0xw_d0 @   4kP !!@$[Kd@  @]\% @TAd$P,8pP! iH@b0`@@S 0B0@mb`ASCc?; / 㲀 pdP d#P !XdAQ!P<` PT0 p ThVz `c`C @7 \ЍۍҔ0H-@P0Hp@-P@P@`p``@PcP c#P `Qp `T cH-`pv@P@`PP Tp`@PcP c#P `P@@U yc@p@-` P@@aP "@aP P Z  @u@@pH-钷P  @@ @-@ᦷp  @ 5 MO-DM@h h l0 ݁Qc 0b묹0-@@B ӝ4 `p@@bA04P K(80 S0 0B0@SCS?8 / pcP b#P "P b 弓P$ pbP b#P  Q  A<@b@b  DЍOЍ/ @/(/H-M$Q 0 ӔЍ0H-@㡓P JP0mP @Pᩓ0p@-MP`0`\P @$`P ㍓0+㥔@ЍpP @-@僓xvt@/O-p@P' #  @,C PlU h V1 @4 @DY0 '@< e ;YPPPG @{0H-M@0 '@/LQzdP+ @08Ѝ0H -@Y@-(@` R0B`0p0R P X 0X0Xc T @-@P PT -@{* @P 0C '@@L[P  T @-@@4 -@@O-M -@ P@ 㣍H -@ @X`' - @#(  -@-@ 㬍0C f U'@@-`@ P PpP[Q  㕍LKHHj Pp-`@P@ Pyzw ZsPzZ s Z Z P z Z' 0C '@@sP # P PK P p  0C '@@ |p 0C '@@OP Z @[v Pj Y -p@-`@-P@P   H -@ Q PqP  @z X sP 2 QP Pp*PP `WOP ^ @ U0sp @W  -@-@ 㡌0' - @ЍO('O-Mf @-`@ @{ 0 ['@P, PZ -P@h 㞌bP ܭ 』 p @-@H  [  U J 「DPЍA-M  @-@P ` P ۍO -@@-@@P: @ۍA7zQ*` @[P 0 [?'@- P 0Q @ @ @ S  @ q  @ۍAH-$  @5WP -@H-BM(@` R0B`0p0R8 P6 X 0X0u  @, PQ -@@  W W`' - @@r&  -@-@ ;p`P3 *p@PP PXX1 @yP0 O'@P  P 0 @+  -@-@ 㰋0' - @9&VVBߍ -@壌EVV@  @H-BM(@` R0B`0p0R8 P6 X 0X0u  @,PQ -@@ lVV`' - @@%  -@-@ wv;p`P3 p@P<P PX1 @8yP0 O'@P  P 0 @  -@-@ ,0' - @%DVAVBߍF -@@2V/V@  @0H-M> @xVV;p @P PTD @xVVЍ0 (@0  @G  @UU0 /'@LAHaP a5 (@0  @G  @H-M n-@"@ 㭊0c G'`@w -p@P@P PwU ᛊ @ 㖊 -@ 宊nPЍ&  @ЍH@-PM8 @ @P P  -@P 0 '@\Azp>  @F @`xPЍ@-@ -@劊T R  @I @Lx\0H-0 '@|ATP -@PU =EA-M`  @,@PN - 0S 'P@  -@ @ !b GQVQ`J `@@@ cP P {-@  P@&܍0H-0MV @-P@J@V0G P-@@  O$ K$0Ѝ0p@-0Mf P-`@@bJ@V P((  2$0Ѝp0H-V zD-P@@B 6oD 0H/@-@T=㳉@0H-@PP PP 00O-$MPP @-@  -@ 1 -@ @'0@$p d~/`@ -@Qb pOP0@ Q0* 0@ 1  @'0@dp/`@a@Q8  0  L \  d    x      -@EP FP3p @ UP  @ UP ^ @UP ;PP`!@UPn @UPm ^@U P-@ % -@P -@PKP -@ -@P`/EP0 `=Po    ZI0 0P] & @X( -@ -@ -@LpeSP*F !@ jv8 -@3~<(@U V Q-P@}QA!@:UP  -@@( V -@-P@( -@ -@TE @@bS_S\SYSD 0! -@@ @ ^pK PN (@@XhP "@^ @P p -@oB@0 '@ <P -@AlPP XP#$PPNP$Ѝ@2Z  @  @  @  @  @   @  @y  @  @  @H- @(@0  @D7H-  (@0"  @D+O-4M P @R`o P-@; t `@`-@-p@-@`P/ (P  ] -@PRp Q ᤈQ   @4@P`@iRP@4ЍG  -@P ! @B ͈MRH- -@ -@G-Mȕ @-@ą -@P @zT @2H@P  @,HP /Q $ '@ @б '@ OP6J ,j ,"@P"`@!@ P`Q -@P U h-P@@ ˵p $[ .-P@!@ p ([ -P@P0J/ @: P)j P-`@P /P:@P4  0-@@  -@ -@ -@( -@0R$ -@ -@Q { P-p@ RP  -@P  @: 㥱f P-`@P+ - @QQ P GSo  -@: @&"@ㄱP0C '@@"@: zP @l: rP@ : jPr !@ : bPs!@: ZP|@,: RP  @<: JP` !@<: BP!@: :P@: 2P @: *P@: "P:  -@@P < -@Q  '@0 -@Q '@, -@Q !@4 -@Q  @@ -@Q "@8 -@Q  !@DK c -@@ @ ᩴp  @HK -@@ ៴p!@LK -@@ ᕴp  -@@@T ,BP -@@Ѝ2 @J @   @u u u   @J @ @CG-MP@  -@塆 -@ -@  -@F@*RPS -@ -@PK -@E0' - @` -@  O@  -@# -@  -@$  @.P  -@ @  @R @5 p-@a PdUF -@@ PJ p  @{EPo  @e u ㏕ `@-p@-@ @ PvP 0@ Q :p  ᘫ 0@<(@EQQ@U4 (@zO P:  @   @.@E -@@,JP  @R 0-@% @@ @ TU P@OOOOp P   @x  @s (@X @sE P'@ -@^ @FF -@@P 0S 'P@PiP P0C '@@P   @A   @;0H-@ (@Po  @"  @ H- -@P ' H- @㟅ᢅA-0c P'`@ATP 8z -p@P @^@PP( -@``@PpP" 2@PPP B!@PP+ !@PP T (@㰀 @ B -@Pp  {['@-@ jb aF`VafaFjBp@-0Mf P-`@@FDrr -@0   R/0 '@  PRR   w*/Or  c/ R 0Ѝp0' - @O-M0S G'P@P 2>e Y Գ@-`@-@w @(@l Y  ' p?oR 2 0Q Q Q P  @ P q oRQp\P R R P  (@ P >' - @O-M@  -@ @Np M' `- @ g  @U -@}PLP(@@P p p PU0' - @  ;MM -@P  @oЍ@-@M -@@ @p -@MH-M0 '@lpp>0 '0@ R  `-@p@r R VQ  `RpPwP"  -@ Pw P:P -@p ^ -@P @ ?  P P @-@1/ЍH- (@Q  (@v p  -@Q  P:P  -@ ^ -@P @ ?   -@/@-9 -0@0S R -@0@^@@@p0QP , !@@@F @ Q0S S /H-PU* ( !6 - @ 0@\^^O` pW p`WU@PPPPPU `BlV U@`P -@ -@O-M. @, '@P> ؅ 0 -@I 3 7f p'@-@@^P @ `@ WP)l P:P @P?P  W P:P @P? W* 0P  QЍ@- J -@-@@ ] -@ @tG-BMg -`@ k Xp@P \ Q UP:0C ,` -@P   Q: ᘀGP0S* P* U%P @q_Q:|P  R0B00R P 00P U:u ʜOP z, ~= ,H-0 G'@P< -@P P K-M0 '@P @PT aAP @P\1& @ @[* @MP! @  P u f -p@ P `@P  VP  P uuۍG-p!@LPY ֖ 㰈 @!@ `=<P @=P4 P@LP@?<P #P @ 7s!QP $@ TP .pVTK -@@P @m0C '@@P  @ 3P A-Tk -`@pG!P\p(P@ @p`pP @P` XX@X p#PpPAJ@PM , \ < < < < @ P9 d'P/ 0(@0`p Q0AQ`0!X X !  @@ P p@I X!  @#Q @Am0H-0SS@7 @ @sP\U  ^U%0S! @0C@#0 0RP00C 0R100C P0U!@00B n@t@S @ T^0@0@00SS S@ 0p@-@`P P !@KPgpr@pp@-0c P'`@@P |KP P uKP @pH-@P # p@P6  L $ L L L 8 `V SKP' Pᡶ6P    P  @HVl!P P P Q  @p@-0M@PX 0 O'@P  @ (@X<f P-`@>    @ !~^ P@ @ ~, =R RPH ~N @@ }@P7  @y1P X @-@P (@&P @d0EP ( 4 L X d p  !@P  @ Q  @) @4 @C @D @A0ЍpO-MxF Ј \\ pB-@@ @D -P@` }8  B R (R( }0:PO:P K:P   & "pW @`ЍO- M@ @HX \{ 0 `-@-p@'@-@PP,E  {} ?   .HP  XPP gHbHp Ѝ0H-MV xD-P@@B ~ 8 ~kP# 7o @ }u @0P3P x @ @7 D~ @ }7 ~4}Ѝ0H- -@ @ |HH-  @kX -@\ -@O-{MMP`@I눼 ㄌ P-@-@ @IP @IPh Pu ㌜ `@'p@@-@  =1@ Q*0@cP @dP lP nP @@@p VP <(@PPa@p Up-PP5  @}P$ pYP KPDGPҮPv  KC.z@ }P p   @   P  P  @mP. -@P* ^|pP^JU}Pr i| @ QJQG  PB P PB A|pMPT 8 3|p; `PP T( @! @ 0, P.#z@#%P-|Ppe U.PPp!|P%' P P @   @cw  @w  @s|p @Q 7}nX` +P -@A  PPPFPP@ @HPZ P -@P  {P p: @_ @6P @ (@@1 0|AP -@P-{P{P{qV -@P 0 @ w{@Y z`V] 0`sPq{P  @V i{P  @0 % # P`P A{p p|P j @P|/ @/ @E  @ 0 !P   q| @ +{. @   -@sH- (@z* @" @g@- (@@z* @" @ @TA-MPY|p` p PpV`P< -@P   @0P*7 @/%vpq#@ zp P pW@p0Fs S @  @  @ ᦲЍ @ MH-M  ڼ -@QЍH Ѝ/ MH-M  ȼK-ML P-@@`P @=h 0@?@  @p  OzP p@ @ @@ @I@pZ @00P0`T  RJ@T` `@0d `@Vp@p:O0  }.'F@`i) @0. P @ @ (@p X @ !@\Ѝ MH-M   -@QЍH Ѝ/O-dM$Pp)P `H#P P( (p @(p @ @8@@,PP `4``PLH,oZ  QP X ( +$(h(PyP p5,@,X [ \     H |    H T   $ < XXY (QH(, ㏊z(QQ,H,*(QH,!(H(, P (H,( @ P w ( H,(C( H( ,  P b(H,( @ ,  S ( H, Q(   E (  H, Q(  P 4(H,( @ ) * ( @80oeP  ( fp(8P5  Y .( Q(X, Y Y( Qr(H,P ZkP8 D P    \  @8p ` `Ἁ s Pi` ` X(n84Y[  @n @j` @` [:(necPdЍT& @J @& @ @ @ @v @N @` @< @ @+` @$ -@ @v @H-rpq#@W P` wp P pWPBO-lM$(<P9U@Pv @i0P p: "0@P B '@ B,p+0 4 C : < / 0@`@ 8 00  +ttP 4 @p] ,@ 0@p@P ((P;@202@DTP T)P*)Qk -@P .@P -@P  @/VQhdH.@@P >'@@CP1P  @V"`D\egP%g 0-@q  <.@Q)P I.@@P 1P H .@Pf1 -@.@P  @eUU T>T:@-p -@@@ -@@ -@B&P [T .@P -@P , '@%6T<&%HgL@-@@㬫P @$H-飫PH-*  @U Q Q/@-0SR PaQ:{Q:A@AT 2[S@ @2@S@P@Q0SG-0M -@ P  ㈇-@Z.@" P6p$< -@Q -@ HKP P+P;PP KPP P`[ -@oD -@@ -@H -@b P P 4 P4  @P>9JPP4 2P50PKP# P, 'P P&! P K P KP nP K P      P /@@} `-p@0`D} -p@ 0H= -0@   "  ./O t T0Ѝ0H-Mh DYvL] P-P@ @ @ #P h@P  !@8P @"P hl% P' @0@0PP] T-P@  @"P h@@ @"P hP@PPЍ08@@P@@-@P @h| -@P@J@-MTM  @-@@R@$ $ $ $ $ $ $ $ % % % % % % % % 4%  @(QT  @ @  @  @! @$ @' @Ѝ*  @PT -@-  @P0H-@PGP0| -@Q 00HIG-M0 @O"n"op '@ !@F"|I -@@P"@| -@HPC @PUc @ -@F @ -@I @눙 -@W"@i -`@) !@ -@L @ -@ @B) - @P) - @ ) - @.@) - @) - @) - @) - @) - @| -@  !@~ P-@ PR/@c @qYM  @@P-@V @fP -@O @] -@R @V^ P @ -@o @Ky P @) . @-@ 9 y -0@R-p@ P P @3% "@.) - @Q -@Y @P Y -@ @  @ P-@PY @ -@2  "@  -@R PP @-@  @ P-@P!@ -@ i @ P-@i y -`@-p@Q Y -@ @   @!@0@) 9 Pt!@"@- @-0@_) 9 !P@ @- @-0@* :  @- @-0@| @P -@' @ Z P-P@ !@PP"@  @PU`PQ  `H `S= .  @ -@t !@^l% ' @ P`R PQPR L `-@ AHǾ `)= ~ p@ b P-@& @2P -@A @)`u!@$V@PY- Q @@@ -@@P-@Ѝ@-@TP 0PP| -@Q@TGH- Pp@`P P!@Y P @G-P@Q P L h-@,z  @-p@ F `FV@P -@@@L -@ -@O-\MPXG `X@p @@P;  P1 P@?U. 8 wFX  XP X *P ? @DdPOROX>g.pPX . @LF\ЍL -@ -@0H-O .@P -@P;H .@PL I -@-@@P -@P -@P -@~ -@L .@PL -@ -@n .@P L -@ -@b .@-@ Q LM -@@P0P %OPU0 -@0HF -@A -@<0H- J -@@P0 .@P -@P L] .@-P@P -@!L .@P -@H .@P -@ 0  -@-@P/ -@L -@ -@/H- -@GH.@P/ -@Q L -@/.@PNL -@ -@ -@@-l .@* -@- @Q $ -@@T  -@) -@- @Q @5 -@) -@- @Q @@-!@$J -@@ -@  -@ -@x -@p0H-P '@  -@P` @  -@ -@ .@P  -@ &<$ -@@0H-MPpPP' +P@p%`:-Q%vpm`v   .Qb  P VU`TЍXPqP(b@ Q6 6 7 7 7 7 7 7 7 7 7 7 7 /QPB@ Q*H7 7 7 7 7 7 7 7 7 7 7 7 /yP/wP/rP/RP /WP/ YP////-P// // / /0H-P@-P0 bNPJQ00 '@`/0H-0Pq;P @+PP+P0H0Hx0@-M@P !@;P$  +P PPJ @PJ  @ Q S @S[QJ @zЍ  @Ѝ@r@- @'@$*  0- @0 pP@' ' @  1 `! `@o/p '@P  @&M -@ H-@M@p '@P! (j -`@PU ;P! P P|9 p!@ 4P . P @@0p@Ѝ, -@  /p@- Mte '`@P P@0@ ЍpP "@/K-`Rp@O r P T  @Ps Pp PpEUT  @ @T  @ @K%N됈 @8/p pPw p PWpG8/p( @PTPs K.0H-xU p'P@@p <  @M@00H-hE '@@P0H0 -@ R4* 80- @ 0  rQ @NxW.P@p  "n\ -P@00H-4Z @-P@P =p 0 (0 ?R   0 @ 0O-Mh '@P3J4 -@ 0p`/)0S0#c &ၹFP @`pQ !0# "  WMp mP` UЍO-M4 @-@pW% `PJVJ r P@Ơ   0* ) (EЍ %"0 S  + 0 U Zxw.p@[p  Q4 0-@Q 8* - @ R 80 "@?/0H-4Z @-P@P  ,% 80 r 0HsxW.P@p  @0@-4 -@\ 0 S @ 0FI&0@P@@@T ^0@E@C-@>P 4 ( -@ R 0aЁ@`V p T0!@@Ѓ4 -@P/(&)/O-M4 -@Z& (P R 0@0!p 00pS*0: .0@ % b0@pFT !0# " 3 @'@ T  ! / (.@P  | '@PJ Q CP @0    @@@ @ 0S*@  0 p 0  @ @ v ! 0   W)'   02 !  4 -@ px '@q    *bYHPp 4 8-@p "@P`U`vʞ  @`KF -@P h '@PJV k4 -@ 0V .u8Z -P@ 8Qp .@P P  @K.@2gIP h .@P#P8x.@P74 -@P  004 -@  @ B @ @0 P:(. ?   @3K-@Ѝ@-4 -@Q" ( R B@ PRPP RPP0520Q @p@$p'p 㰀$PJ Q| '@/0H-M4J -@@P( P 8PP R 0PPS # 0@@0@(@ @@ @0!  Ѝ0  @Ѝ0HJH-M 00PЍ0H-4 8-@ 0s0 0@@Q@0A-M⤌ @-@P&4z P-p@2@` `(`,` P   P000  00!   &q@ЍAcH-4Z -P@@T6 p "  `VP   ~  P   @ sj@V b -@Hr&4 -@P/H-PP< p-@`@PUPP*P5jPuP# sP# kP)(Q  A^QQQ *PP Q P dP n&PPPPO-MY @ʩ @% -@[봫 -@ [ -@[{ -p@[XPX d 㸴 @P `@ @ uP+P H-Q   uQ+P  HP {I :P rIbPP .P bP  wP pP cP  -@ -@ [ [,PP -@ -@`-@`k + p-`@- @p{ 0-p@0; -0@ @0P -@@c Q @PP 3 @G @ >4 '@@P-@ 0@ PG @~D U4 -@ 0@ PЍo @r@PN 3P{ @e@P  @_@P @Y@P   @aP  @[P   @UP  @OP   @OPH* (@- @0p`P 0p` Vk< -@Q H p-@/0H- @-@PP -@PP@ '@P P.@P '@PPP0H p-@/H-p0S :< -@Q @ -@ H -@H -@ H -@ SH E-@C@H -@S@# H _$ -@ @  0@-MPh E-@C@,@PH -@P D -@h T-@OC@0$h _$ -@ @ @ -@ h -@ 0Qh -@Ѝ<* - @ RQ L R  000!30 00?!R 000!6+ R 000!9q 000!< x 00!?00 00!<30 00!930 00!630 00!330 00/ R R R R P/p@-P@P `PpP PU:` q U Q P@ RPH- \ *0 R  B/o"SJ0H-P@@P:X (X DX lX X ,?% ?? 0? ?  ?P? ?0  ???P0H-@P< `-@P QRpW`QU4 U1U uP Uu```0H- @-@PP -@PP '@P P.@P  '@PPP0H-^Q R RA 10S* Q1S@- @-@Q '@P "@1S10S/ R/H-P@`P| P'@Q p\3P pQ` '@Q pL3P  pQU  @@NFv@P@O-MHz -p@`P @@QP8 P0@ Q(*  ?YP U 0@ ?XP   @F= T:  F5P.P bP cPH -@T*@y ,Ѝ #-@- @-@-@-@-@ '@/-@-@-@ '@/O-M@0PP0 < ܣp-@-@-@  `@pT*CP P PPPЍp@-MK -@@@q0PP ` hPPЍpK-MsP@-p@@; Q2 SPm  -P@-`@ a 0Q C QQ P `EQCQNPЍG-Ms-@-p@C-@@Q؛  `-@ P0 EnPUP@  AP -@-@Ѝp@-M`P@/  0  @AЍpO-MؓK -@p-@@ WDP `p 0P G% pPWc-@-`@ 0QP} -p@-@AQPIؓ-@-@@x2c -`@p ARpP@ЍP` w0 I A ZY#P- @-@/K-P3 | .@`Pp PU @M1P@ᙜᗜ PpUp W 91P p pp0H-C-@@P '@P0  -@PP0O-MP< -@P s-p@P Q$3- @-0@PQp-@jPg ``-@P ~`-@P-@`Is-p@PP VC -@@'@ ?oR2R@PpHi `i i i i ,j dj xj j j j pk f f hf g hf hf k k T d-P@sD-`@-p@P-@@W[U P P  ЍP-@U  '@pw+ -@- @pAp@؋ -@ [@@Ty ` X0P@Y] -@ P@VP7C-@@P e[ -@bd-`@P  3.P  Q  p P -@Y)  PYPd-`@U P-@P dI A$ '@QmP Pd-`@De-@-@PW:-@ЍO4-@oK-@ES-P@k -@-`@P P QP P1 P,C-@@-@P Pf B-@-@-@-@r-@*C-@@-@P S-P@k -`@-@PP PPP P PP PS-P@-@ P P P -@ P 8E'  '@' @k -`@ PU P*  /P X PP P` V:`d-`@QQ [T d-P@-`@T-P@-@ d-`@[ [-@-@!!@ RQQ *PP;  -@P P'@P O @1a P!@-@ P :p@-k P-`@@,'Q:-p#- @P:00@T0Q: '@ pO-$M{ -p@0@ P p3@` 0` @OTP   @@jA+ P-@pW 0@0 @CSP p0@ P  0 ` @*TpP  p.P  <@$Ѝ-@-@ -@R/-@P / @ 0O-MM@ -@PP(8Pv pbPqJ  Pm* @:`DVd  P\ p5 @ " PT PN ] p @Q Q Q    P e  @ P I  @ P mP "PX Z P@؇ ⨠'@ ⤠'@   4/ ᕇP 4/ЍۍQ  R/3G-M -@PkW h 'P@'`@PP3 bP^ ^+ V+ Q PQQ4Z @ @ PD @ T@bPJ  P`( @P TPd.@P) dpPp Q@`@ P5% @ @ K  @ 0I @2 2 ` [YЍp@-Pl @z@P U p@q>@,`P r!@,P p@L_`P pp@-P@Q `P P '@V`  '@Ve% @]% @@U   @ p@Up '@P ]% @ @ۿ '@V '@P e% @ @̿ '@p@FpH-M@pR"P*`OP`P T`P`ЍP + - @jP`P`p@-Mc-`@Q0  lSP -P@-@@ PAPP =P @ PHQʴ=PЍpG-MP s-@-p@-@؛ -@BQ  @P`Q " 0B `VQ @PP Q  @-@@Ѝp@-SK -P@-@@`V F R '@ m-@ @oopp@- -@P@-@@ -@@ '@ H-@H--@P;Hp@-MP)@PP ` @PPPЍpA-@ @ y @   @`ypP   @ oP  PipᵖW @  ^pP  @ AUH-` R U @ P@pP qp` R -@iPP/ Q /H-M '@ @2>ЍG-@M -@@3TP @ЍY p`P P@U>V`:p$tT-p@" PHad@DTB H-$T d-P@-`@P p@p/TPP P P7P @WP@T @g@@-@0$-@ @-@%@$-@ R  @-P@P@-u@$-@ O-LML (-@-@   T0-@-P@-@.@e8D$txg-@@-p@.`@PCP "L -@P {PPZ ?@$- @>9P P B -@$Pwdd -`@P P . -@Pc-@P[P @;EB`IP ^@;VP :G;(;.@xg.`@P@dd-`@eTx.@PetePjpP6PD8dP-`@ /PPYPF `-@PU W W=WPI `-@eP P P.W 0G P:u xGeP.@@l dddP.@-`@H-@, R{Pp 7P iPP P dP  QP `Pdd.@-`@iXiP i" !@UHcQ 瘎 Ď ؎ 4 L x  0 \ ԏ  0 T T  @ X H  $ t ̓  L 4 h h H   @ p Ԗ  ܗ     Ԙ                                 ( -@Ph !@'@`@Xp`%dd.@-`@.MfPC W W P #@Q2:PxG.@@P .@P (-@pP ` '@}Ai :P  >@ ECP Al '@PH-6 '@?]%xGP.@@Z WSGQ   $ )& @{@ -@P  -@PD -@P P7PM aGhP3-@\-@0@PW6PP 6`/!W @W *Wb -@P]($- @7Q  Q .@6ae @m`-@\-@ -@P '@` E @Qdd.@-`@l 8 @Dc .@(-@rˡQ -@P% @(s@ -@P -@PD -@P Q.``. Q`H,Pa-@` '@`%d!@JxG.@.@@m`-@\-@a"6P X(-@& '@*qxG.@@Q 9\-@ @Qb @*WbW !WQaQxGP.@@(3 (@' # @08H1@Q* @p P   -@Px 7Qt ($- @! Q  '@xG.@@ .@dd-`@eQO xG.@@P @ -@P -@PV D -@PP_WM-W +WHQ6`-@4P; P$ h-@ a@P3$ .6P  $Q h${Q- @ @2`QRP$$@"\-@xG.@@P keWs @Y@ -@PeD  -@Pe= D -@Pe6  Pe2  Pe. ?X|+3FHo?pˡN?:7pl -`@ P>?*7 _ .@P l <'?(?7pˡ? 7T.@QK PG@-@Ap\Xl -`@ P>7T .@P@-@ N>7 p V}7gN @Z@ -@Pe  -@Pe D -@Pe  Pe~  Pez >N7?+ep>D7LhL-`@)-@.@. @0pP-@T-@.@0{ @pe JP  @{ RJ0ddpspHDd0# -@@ R  {JP C @c -@P  L4L-0@P-@0-@0T$.@- @ .@  Pe P {e9>%6= @pˡ+>6T.@QU PLPpˡ>6R>6 ('@( @ -@P  @R8n PL8.@K PX8.@W pˡ Pe  @p1=|6T .@P@-@ P X). @ PX.@X$- @(4p -0@ ~ '@=J6"X(-@ -@ rXd-`@ p Xd-`@ p (-@rˡI '@Mr=^6pT .@P @-@-^=J6qtve! -@`fP 7P  n pˡIP g @` pˡ'IPU `/=5 Pe.@H 0! #e < .@ !S=5 p :|-@L-@#L-@-@k>t @@ -@Pe  -@Pe D -@Pe  Pe  Pe 4)<q5 .@ *<h5 .@ ,\-@0hY- -@ @1" e`/<L5T .@P @-@O  /<85 Ce[ ( @6.@^ pˡF PeH 2P fP ,& @pY @ 4 @ HD-@@]<I5 pˡ' Pe ,& @pY @ T  @?}e L -@@>@y#Pm P   @~6 '@`!@<4 -@c9&;X .@PP -@L(- @`0V0-@F`˱0 PP -@L(- @-@0ppT<). @ Ks @*6e.@A/( @( @G-p;;_48 x-@ .@ W PP`W@-@@RU  f PU g48We 2QeK-`P(t-p@@  =  P0@  7=`X-@V VJ  )  P  =`@  @5T KKH-lE '@@P  .@P -@P8P , - @0s  H -@PQH8j .@@-`@PpP pPp@-\/-@>C` -@@@@P"@U@jw`@`-@PoV  @jU U!@ @`-@p@0H-:m3Pf @ -@"P.PF#Pc $Ph %P -@PTa-@%3  @0H4 P@ P PE P0!P lT-P@P 0 -@P1l' -@ @PY  @@+Q Q \ -P@P Q; "9/P+ 7P7 EP -@P 7- @0H$P P -@P+ 00-@0H0$- @0 0$- @0 0HEh\8T-@-@-P@0 ./0(-@!0H@I0H|CA-M(-@  7-@   9 @  D @  P @ \ @  f @  q @wW `@x P@1  0ჳx@T!a& !@! @  @ i-@Ѝ< -@Q/0H-P@U 0O-$M@`S   P `nH@@P @ pT W Q< A-@Q =P 9 0AS R 1@P P  P *VPp Q:@ P *P ᛓp @P JI Z P Y:HUq P@TA$ЍH-p-@ t-@x-@|-@HO-MP6 @JP,@ P!pP PSPeX P@@P PPV@`pP V@:XЍ@-  ~'@2 '@E @P @q  ' @ @ @0JP  ' @ @ @0@  ' @ @ @08P  ( @ @ @0@-0H-Q0P@  P p$- @00  @0H20H-Q0P@ P t$- @00(  @0H2A-@`PQ >PT #pP 5/@M @(PQ  @!PQ  pP] @ pWK-MP -@@Q@RP<J` pp3@㌈P-  0p!  RR$ 'WPMP+P PQP@P M@ᖊR@ЍᎊGP`@VEPVnPVdPx|tU-@-p@PpuP cP eP PU*4vP #PU* PU*@xP@p@-dP-`@ @PD D  0Dx4|4 -0@-@Up p-@K-PG pA@`Q"* P0SSU5  S Q gR)  B R r R  Q:`VP gP DP @PdP fPddi t-@@-M@x-@ PPQ | -@QЍPo/p@-Rp@P `nP pg  @p@V1H-M @ O1ЍG-Mp@ -@`P -@PЍD `-@P t@`-@PQ p p<iPU:P Pe`ЍGW @R d 3  BP`d`3`dV P HV)dppU PAPEP`p@-`Pe@V p#U `U aU B@.@PC@ C@.@PB@L- @- @ R!@#"-@p@-M`7e@P1JP;P-.P);P&'P"V @U AU  B@.@PC@ C@.@PB@mQ L -@Q@#R"-@ЍpO-MPPFp/w YXPp YP !@ 0@ @CPP Ѝ`wp 0G?@ BPp/w P wp?@ CP O-M@`#pPPPU+շ G'@PWP* P Z P@T: '@P PP @Ѝ0H-@Q P R0(B R P#0Q 0 S*A qR Q 0rS Q /0H-@, P0P0H 0@-MP5 p .@Q- @T TPP% @ @, @ /PP @ Trp , @ /Ѝ@- .@PL -@@P P@P H- -@Q HO-M⤌ P-@@PV cP  Z >`{ P -@U Z;  7@U4 v @ P  P``pJ{  @P   @ P`  Y` `P >@pPp)`>@P   @P {  @P P  @.-p-@pp4 .@PPJP   @@.  0"@Z` @ -@   P    -@  -@ p  .@.@PPQ?к Yz "@ p@ x.@4 0. r- `@ oP iZZ P VP T :6@T  .@PUL P-@@$ -@PQ`>@;P OP ,0t-p@( $- @ -@P k,P# "0W4L-@{ @P   @ P }@ '@ T .@P L@Ѝ9Np4 p.@PH P P   @@z. YP 3N+@-L -@@P, 0H-M\ -P@P$ 0p  o- P @ R -@-@Ѝ0P/ H-@P`Q p3څ) օTHp@-M@qHMOPP JM -@P7  @@.Pui `@`UAU DU. OUaU dU' oU -P MhU 'P@ 0h q Mih '@pʹ  @@;-ЍpO-M⤼ @-@PP  @`@U  P-*P@P U'*  pW  P*p@P W *@PV3 `7 4@V P ЍOv@@P * Ѝp@-`P  P@\P U  EPpT  =P p@pH-P -@ H*HH--@L P  @, -@>@rH" -@ -@  -@ A-x@P`.@T>DpUP W PE` 0H-@P%P PP0H0@-L -@@P @@e@eH-jp g*H*O-M-MP P;  "@͊! R  P \P P:P ^j ͊ @A `@ PTp  P `PV D2/P aP PЍЍA-@D '@QPP+ ' P' @0PQ!@Pk @-lP`@`pPP PW P@PH-k @ P@O-MPk @P@{pW-@O  ` '@'@ PP@WWV" @`P0 @` '@ '@P-@`@j RP @ pWY P [@8@ '@z* 0 '@ @ P{+@`ش@V-@ p" P @ @W pP0 @pp%P ភ@U`PV ЍK-MP@`PЍPppP a N/!@!" @ 0(X @Kp+K @ @-@ @@ @G-餜 㨬 P@-@-@`p#Q%QWWP P #Q%QP `Q `p `@#Q%QTTP P #Q%QP v`Q @p@-` -@PPaP*  @0@ᬩP`TPᤂPᡂែpG-M -@P Ѝk @P@> @RP ` @Pz P p@p ؤP-@P" @0 @Q@ `@|P '@ '@* C @0KLQ" @n0 P @`V z @ p@ ឋ`V{@ ᔋ^`&V PP G-MP@P@  0@p8 `,IP1< 0@ P-@.@ `P DP  `P mP  psPP$P `V:@U@ލH-M` @@ P * @ЍH+P P[`X`p V+ @!! @0ឨេ* @ @ᘁЍG-@ddP EHP  `• }#PpP@p|pw W 0H->@@ PP {  @P   @oR0p@-M@P  P RۍpO-M`` .@pP -@P @PPz @PT|PPE-PD>@PJ De  %R R   0%S sS4P-@ `` 0p`pV5 U @ T@HP>`@  @p(p/@xP pqp[ :P @ @@pᫀЍA-MP -@P Ѝ`O @P @ %R R   0%S sSP  @ЍA5(Pp`p 0`P^_]@XT ЍAH-M Ip    @oЍ0H-M4Y@.P@P Ip(PP'  P# *IPi '@ jIPJ  P5PU '@ᡔ$PЍ0@-M@lIPJx| 0 ЍpC-M@ -@P `3IP $- @ ! 4-0@Ѐ "!q p RЍp @/@-@kPp/Q@0H-$$- @@0!P 008.0@0S 0H0Hp@-8 @-@P p<p `(@P!$ /%$oB@@-@P (P@3-@Q/O-M⤉.@pWP@P`<P`n%@T .@PW] .@PW .@PP\L -@PJ @P`-@T(P`%&. LP} -@-p@ .@ f Lp-@ W  06P`L-@ $@ $@P`L -@@TЍ@-@  .@QI( @O- M0p-@@P L U-@ P .@QJQ@P pP`" .@P 2\.@ 8 %-@- @ Q!0 1 ,P` P`HZ.@@<P L -@@P !&% .(''&%(P ('P ~, '@P 2Pl '@P L @$@X[WpW`P,P` ! %P' ! A(P(P+ P`'Z  , -@'@ % &.@P.@P #-@.@P-@@X L -@@`(PP` @ .@P (P ЍOP8 -@ Z a, '@ ЍO0G-M-@,@P(`Q -@Q .@p .@P L -@@ P T L -@ Pڤ .@Pp .@P 1\.@ -@ 0V R k0Yp@+a`P!&X 'Z~%#@YT Z (ЍG-@Q/ .@p/.@P/L -@@/G-M P P ZP ЍG& p 09ЍpZ L -@@u'P" 8 -@P W' Pxg@P.`@`& 0P@&X& !0" ЍG+ A-MP`C&p@p  0@ЍV 3&ЍA p@-L] @-P@` R ` r `V V@pP/@-@, - @P0 '@0Q0S0\ 00  Q 0R0C0 -@  B ||@|0+ P' @0SQP/0 P'@ R/0 P'@ R/-@/O-MP 0{ `'p@@T P2 @I|8f@V[ 0 $ @ P0004000@  Q  -@ X* |! |T ЍP/P // a @/ ` A/// ////0/0/0H-P4@PP {4@04/O-$M 08Z  )exGH. @-P@-`@.@@(+G P /\.@ P ?.  * P( #+p P Y  E Y + ` po 0P `pP@D .@P U U`pZ P P @`V@p@DTVxG .@@b Fp ` F FooPp V Vv pe P0 P,D .@P V VU T& PPxG.@@` ) @`PATP@ L-@PA Q@P -xGP`.@@ Pp`P .@P`7D .@P+ V V!  P P xG P.@@P P`ML-@PX (+ PP`xG.@@WT .@P  P 0E  P ()8Z eP. @-P@-`@\ .@P  0   .@PW  p P P p $ЍO  $ЍO-M D@QV   0 (*ЍQ OH 0H-M@PL -@ 0Q P ;Ѝ0O-,MIp`.@@-@wP &.\.@ 0W R ,W2P xW.@.P@P @lk T T g P P p Yp PPP P(` mP` $ `P`p x.@P X  P0,P D .@P X XY `Z(N @TJL-@V@@P]L-@PXD .@P X X +&XZ`Z`I.@@-@P: P P P2 P  P P PZ(, ~PI.@@-@$p ` : ''P#IP.@@-@$p `.@PT R  ,Ѝ\ .@P U 0 PwH-@p P'Pp P P @P@PX '@@\` `'@x@VP@TPp@-yP \  @p@p Lm @-`@P@"! p@V" 0s B @"! pp@p@O- M`@ #"PJ@@T! 000P  @ ЍO$ tP! !d0T .@P~  ЍO%P!!  pq V  PL -@@XM !0  D &`P Z@XP)+ Y`@!& PXPpL -@ 0  @-@ H-@0L -@00@ `@.@P 1p-@p{! 0@ Ѝ 0pH-M !{! r   0ЍH-P w  @Hp P L- P- @  BHp@-@P`P1p P`PT .@P  p@H-M@Pj`p pP uP  @P@-ЍT .@P < .@ ЍH<). @  @ЍHA-P@p  @B`p!&  0PP0P<)0`Vp. @S A  @AO-$MM@PP @P-@`Ph '@`1x (`'@1,`<0 1 u-p@-@-@`P` '@ >@ P * @ߞP(@` eP ,Po  `@ P  P!  @ P #nGP  @ P  @ P p 0 S SP0g0 `<S !S <SRP=Q P=S >SHP=Q P P=QP=Q P P B H t W QPQ@ o Q `@D QX -@QPRP Y @ @[o P `@HPQ4 o Q `@8 Q> -@Q68 C^Po  `@4p / p @)o `@)  @, o -@ `@Q -@Q  o -@ `@Q -@QWp Q Q q"Q#Q P Q\Q Q Q Q P PP[ =tP `P+P60Po T `@0Q Pq/QTPP P=P P/o P `@U P PP=PTJ/P P P TP Q Pq/QtQ Pq/QtP P P/pP U U U  Y @ @cR Y @ @]MPU U UP ` P `P  @Bdo P `@ U UPU q=/P LQ Pq-/QP"/q/P  cP* -@$ЍۍA-MMP-@`0-@|/ @ @ Q `0 ڛ-@:ЍۍH-Pp^P' \P1 @aT>0DPz* 0r !`0 B@0TS@0:Q r P  '@-@ %- @0P00P0%- @  S'@0QkD P00h((@(((T(hQ- `0TSCbCPP h$,4<DLT\ZbT eT-@T  %0  @ @G"@"@CSDS LS RS +1S BS %US" XS   C^P#-@0#    -@ !!@  / -@ @  @-@PY @``0H- @G-@@Pp @ @ G-@@P @ K$W-P@ -@@-@--@-W@-P@- @$T-@0P3/-@/0H-$ -@ | 0 0 0 R-@@-@@-@@-@@-@@-@@-@@-@@ -@@-@@-@@-@@-@@ -@@-@g--@d-W-P@`- @$T-@0G-M$p.@`P?  \Y.@.P@$G-@@7 { -P-@ X% ' @ q W` -'@ Q Q |P )p|pp0. @ (0|P 0p|pp(0|PP4    P 0 E.@AQ 0|pQ`|``q (0P %|0Pp`|``1p( | | (|-@Ѝ\ $).@.@. @0 .@ S Q/p@-$W-P@` VG-@@!R, `V`|-@ `pH-pP0U H%`< -@PPVv@F@PLPG$g@-`@P @Q GP 3@P, P 3P")  - @-@y 9 -p@-0@@p@0@@ < -@P A@P@@@- ) 9 -@- @-0@-@@/0$'$- @-@ -@ (-@/$($- @(-@ -@ -@/Q/H--@PH/0H-@PP-@P -@@P@0p@-@P` hPp(P p@-@Q T5 Q \T.QJ0  @ R  R DoQQ PT -@APQ/H- H/hqA-x@-p@P`P  Tw 0-@  Pn# T! .@P.@H-@@P 8-@)@ -@P P0 -@`PHP -@P<$'- @@$'Q- @ p' P- @p  QPA-@*o@@ PQ_W P   0)@P@pp@ЍPPCA-@P-@PDh@p-`@F2 0 PpW@@-H-@@P8-@O-MH-@@`P8-@-@PZ0-@ VgtP} .@G$-`@-p@-@@-@P|& R-@-@ lxY.P@ @R    @R .@Q X-P@Q   0 0S  h  QP -@P Z-@P0.@Q PX  B   : @-@PPЍ0H-0 .@P#m-@P ^ @ P@p @T-@P05P@ P@p @T0A-$w`-p@-@ P@P ʝP`'-@- @0QT7 -0@ @-$-@ 0RA ^01 0R$'- @(/H- (- @ R P). @ R P @ P $'- @|0S1(00 P  B! ~ -@ -@/G- p`r, P(p% xgu$@P.`@-p@-@@UP@Pm@t T`pYXP`PpG--@pP&k@"kT`V V TmPT Om$-@ !Am?mPPPO-M Pp` APwP;$G-@-@@P@ P# x`.@v+ UpP 0@Q: QBQ* PBPE`` P `pZYЍ`pG-M`VQ &p@  }PP  @  P@@@l 06`F@ VR:B AЍH-LX@-P@` pP 07pP $w-@-p@ @P(P`G-P -@`L -@ RP 0!  w`@-p@K 0R`T@ 0!  Vp@-@PPJ` PP  ,P 0 '@≀Pp .@P,#+/0. ' @2S/Q/0 '@2S P0 '@"R P0 '@"R P0 '@"R P/H-0 P'@CA-M@P`pP P p P@"PPЍ@-0). @0 S '7- @-0@ 0@@P -@ P O-MPD-@@` @p-@+ U/  0  @9.@@ -@RPQ P(P- @0p(#*p)6 X 1-@P Q' p pV-@UEQ@-@ P @ P1@TpW @U $w@-p@ P  P@ 0@VP V  /``L-@-@pQ-@ # "w-p@P@ @T-@% @'-@- @0QT$'- @7 -0@ LpX-@@ @T`Q3U p-@$$-@ Q&PR 0ppp0pqq 0R A P xI`.@@ @PЍ0H-MP 0@.@QP@p2 0QЍ0h-@ cR:hc-@00p.@ P!h!. @(l!. @ @/O-p.@pW p.@@`T@`@ `P`P%`&`V pW@hP.@l`.@V pp`ppp.@`VPP ` 0 p ؠ P TP PUV RP0A `pVp0 `0 R A 0O-MP$ .@P@%$Upa.`@P pa.`@ pRpPp` !Ѐu!`. @.@WU0Rp0^0/P[`РVx.@ 0`Gp&'B XV  0#ZUP  ' P(`ЀUx.@ 01`p&' X&U  0.@ Ѝ.@p/$ .@Q -@ = @@-A.@@PJdP!. @  0PU @O-MPPptp@.@Q ` 0pRp!# " p.@pDP5 pU"p# pMp R0UPpF*PЀpU 3xg.`@  0p + ! XU pЀXxg.`@  0p + ! X  09 ЍO-M@`PDpo/t[JL -@ Q@`p!&o T@P` pu P`&0 p'pЍK-@P  @S`x-@.@`PpP 0 0@`p). @ R/)0. @ P0S/O- M`-P`r!@JH  @Eee!]0p0!pU0 @&PPP*PR @@M}g/>0/@;Y n @  H-@@ ЍOP P l@ i ܹ@V+ ! @ 0ᰎ g@TG-MP`p p ! @p@.U T  ! @ 0 0ЍK-pP`P  @'@r4@ץP: @$ 嵾!@   @ 5c 㬹h ?p p  Y `P2p pPwP w P  pp቏m @pw W p pPwPw P  pipἦ @PUm-@PK-騑P.@p@4T 5T'#T'a3  `ppPp f@ P6TH-o0H--P$P 'P(.@jNH.P ^P  hH-@.@@PPPPnP \ @hH.@@P -@P fP#GP @p @@J -@PhHL= .@@ -0@0PP 0 |f@00H-MPP @ jp \ -P@PP0P ]f.@ꖽЍ0a@Q.@/A@Q.@N@/'P.@j/#P /H-M @  ЍH-P q .@Ha@-M p A< .@@-0@k0P6 f.@ЍH-0P7 Q@.P@jT| -p@p <.@` Pff& efP P`pye`P`P@ P H30H-@P , - @ Q  @n PA00H-< !-0@. @ 4 0 S@0%@$0 :p05Qa#3Q'H-.@0N A R qG-z먡P.@@rJP $`Pjege@D6tO-$M .@P*  @ 2A>㶀 `.@@@ @P r 0 pW>p P  0 p ` V$Ѝp@-MPmPI PP``P> @ P Q `@ P.JPL -@UP UP R Q @ QJ 0 S  0 S  B0``S# d `Ѝp0H-M@ -@Q  @Ѝ0H P P Pٶ -@gh '@PJ @h '@p ڴ -@F @e Ѝ0  @: @ζ\ @-P@P d@jdЍ0H虾, 0- @0@- MP P PF.P-5"@ `/ ' @Q, T @'` '@0s&ڠ! @ @ ^P DP0@0S @ @5"@ 3Q j @< .@~ @ Ѝ` '@ <.@H-M` '@ R JL @2-@0@009 <.@Ѝ@- MP P PF.P-@ Rd/ ' @Q,  @'d '@0s&ڠ! @ @ P DP0@0S @ @@ Q  @X .@ @ Ѝd '@ X.@H-Md '@ R JP @2-@0@00X.@Ѝ@-MP @P ;  @@R Ѝ@-MP @<P X  @@A Ѝp@-P Ppᐵ.@p -@P | @p@* ᛵrE@P p@L6Pp `o< .@ p@0H-MP P P"^ '@s[ @'P@P '@P ;c@ Ѝ0H2c '@ @ Ѝ0@-P@.@P 0 -@.@a !@@0H-M@P P P5_.P@lP=P MP hP[ @'P@".@.@  @ mP wP sP@[ @'P@ .@P.@P@[ @'P@bЍ0P/, .@僿P/@Q*=P/@- @K '@@ @  @ @MPxP @) @M @ @ @ @( @@n@-MPd cRA0BSA@ LtMM\M M\M\MM\M\M\M\MM$M\M,M\M4M@P x). @ Qt >.@t .@P Et .@P>@ @Ѝ0@Q*  @P -@/P/ .@P J@-PI.@@PȻ@-MP I.@@P  @Ѝ@-MP I.@@P I @kЍH-P .@P -@P<pH2H-MP P P h '@^R Qh '@¿x @ 7Ѝ0H-0MP, P P4IY.@@.P@,Pm,, @JQ"  @ @.@, 0 .@ @J @@ m, @-Q  @0Ѝ0,,P @-MP Pc P0QSSEC ^: |VVWWWWVWWVdSeC ^/ |VVWWWWVWWVC ^& |VVWWWWVWWV #RS WS ^S   S -S rS wS S SG 1 CR C0 @9 .@ E  F   K    N    R    W   0 >0@@ 0RQ- @G.@Ѝ)@9. @ .0@ .@0R  S0P /L -@.@ 8 .@BP/@-颾HS.@@ @hO-MP @.@P Q Q 2/P x.p@@@ HQ~ \YYY\YYYYYY,\Y\YYYYYYYYYYYYz` V  P@a ERPP3Q Q =QT QQ3S  @VhaHPPP3@`T @PD[[[<[[[[`[ o% ! QQUP   Q Q~ X$ nXz.@Pn  Q @0 PT  `R 2/V ^QOD.@+ýS  @g 0P1 `+P -@P k^| -@-Q ``` KbN+Q @@ +QR .@ 2Ѝ `P9 @r @ @` @H-M0S R'.@ @0*ЍHW' @*.@ЍH-M`@P<p-W0A Q:TU P @ pT-W` T U }P @ ЍA-M`P* @pPQ& p.@pP \Q`P \$Q T P` `Qb  @ i``ЍA-MP  @pP`@W@ f.@ @ @ЍAEW  S.@ @ 7QQW W!  @PO` aaLaaaaaW5 W0 W?oQ5W* W W/ Q QV%WY W W  QAP @  o  P PV R X2/@PX U@Q *p7 @P X -@Ѝ @RPSo/Q !!@ /oPH-tH  @//.@P/H-M.@ .@b @oЍ H-MPp`خ@0D QW1 5 aR0`0FR`@`3 0`C V:R` 0bkZ`0bA` `SA` jbah#fd `0+WV   @`&Ѝ.@.@ QR/@- @{P.@l '@Q@P T 2/$@Pl/ ' @0S/ S  C Q $0/O-Ml_ 'P@0S@ ` pW) >P@AAQ:-P X T T DoP堂 p  p$PZ  RQ   Q P   ЍH-  @PP '@/O-Mܩ8 `@.@p-@P .@VPkp.@P6  .@ ppP@ `-@QF h .@Q '@ .@P o# ah '@PN iQ.@Q QB G  Q#PP )U. @Q8u RP N#P U.@Q*. @P  A #.@P x.@  x.@ЍH- .@H-M 3cH-M@ cP``+! @0pPЍ0H-@cPPZ.P@ @ Md0O-M(`,Pp 0@ 0!W!)  %&9#,@ʇ t'6#z'0 X ppPpj`VP3UЍK-P@p`d0%"W$! y ($5#  W4!00 0dp W2O-M@@ 0pP` 0*"CU_ᐔ  ' $5#j 4#Z%0Yppr@W3[ЍH-MbAQA#,/O @" @ 5"ЍH-Mx.@ -@z.p@QP P`@V ?@`PЍ0H-@.@Q [[ 'P@.@#P: @.@0@-+ ' @.@@P '@ !P-@@-@ '@@.@Q/$@-P@PK-MO  yP` p@? +Fb@  E y-PmЍK-MO  yP` p@? Fb@  E y-PmЍK-MY pIpiB P` @@avaPpEy-PmЍO-$Mp`P@0@ Xa@QW@A@Q7@2XJX 0`  @0 t@P PPT$ЍO-Mp`P@0@ Xa@QW@A@Q7@2XJX ?`  @ ? ;@PPPTЍO-M`Pp0@@ Ta@QW@@A@@Q7@@2TJT  0`g 0@  pPXPWЍK-M@Pp%P PG pPPmP%P cP dP 3nP xP- sPP `pP%{ʷP `rpP 0P `dP p@pЍ@-M@ P @IPЍH-8 @Q 0@ @ pH.p@-P.@@KP, l .@P붯놯ܯ -@`l@n @P P @-@PhP -@Q-@p@L p@H-MY= * 0@ @0ЍH-@P`pzJ㠯3P PPPP @PP @PZ.@0H-M@PP h '@0- '* @ @Y= * 0@ @0Ѝ00H-@PP @ᷮP xP -@P-@ QTx0K-M@ .@jPPVP (p 㚩 0PppV%㎩` -@p.@oQ" `pP [WX E  @P NW`WpU GWЍ@-@P @??TTDP  @mPT96 # P 2  .@.@P%L-@ P P -@q!  p PPP`L-@ P ). @0L- - @ PR\ -P@|P0 \B&L@#(T P  cd Pp'P@!%pᰮWt P0oZ  h ' ?. @.0@P|@ Qw@Pq|P2 ꈮ ^  r* P p $)L= . @-0@ P0  ?LH -@e 0 R : p P2 P P 0 R : p0    p\ -P@G0P=  j 0d!@b0 Y .@ /. @ @QY @Ѝ0H-@b AR0TPQ0P iRjR tR mR BR bR < .@0 0>S:S Q\S 0SS/.SQ?S/ '@0H-_.@.P@@.@oPB '@ -@ 0 '@H-@ wP.p@ `.@  RP  fp@-@S0P Cs/o"TJLm -`@@T @A !0  /o"Rpp@o(.@/H-@-@P `@pp,($(,0 !  PaJP'0. @4 P@#p"`Rp`Oo``B` R  Wp P P&P  0t 0!"P (X.@ !0   (@$` T T(@$`TP  0 !0  P 0(@$`P.@X.@P<Ѝ (cH-{t.@ "Qp@-P`.@@UPtW.P@@T `KV@Ν` 0p t.@`-@pp@KO-MHP`D@p0SP@ p-} P Q Q) @ @ 0  9 0|E W)  @*pWQ p('0. @00  00B PPЍO-Mp`0 V A@T5 P @V @Р @V @ (@ R Z ` 0(@T @Z @( @T  @TР(p V@ T< . ,,`0@ i+ A + ЍT$p% " Q  p .p, `0@cppP p p Q p@" ' @Kp pP   pp@@ i+ A +Q `X00SPU  p X@ WX  WX @@8p@Ep ЍW O%O5p@-P@U P``㋜P0㇜ Q `PP p0 R P000\ 0/@-0@ T P000R@0 O-$MP`CLppH ppp@ ppLP^    QY ?@.@ Z   Y I$ЍH-d @)x. @.@ RHH-P \ @  -@@ Pd @ @HHH-\ @x.@ .@PHH- @)x. @.@ RH}yA-x.@@T Pvڠbٛnkr @dʛ@-@P Lm P} -`@-p@P7QP  -@)-@d .@PA.0H-[ 'P@@T   =I;I9I.@|.@.@00H- '@ @P@P&  @P  @P  @P >@P P J @@@@@0O-MM@P `pP T 넧.@Vb  '@'@(@ 7P  x.@P sP @ Qf Pp R 0(@ p @ 0pRo Rk Pp`0@p@p W P0`@P@  pW 0`0@ 00RE @`` R> @ 0(@ 0S0 0p0@0S( 0 0@ BQ QQ NP 0; '0@ 0   6Pg (@X P .@|.@ '@*` @pPHU 넗.@` 6Pw p!P  P  6Pe P P"Q `Q Q Q@P  P,  ^R  R R  0 \R0Q  $ 404 RR 0p$S $Co0?); '0@ 0 dPN .@ |'@.@ApB  @㧽PŽP;`FpV7p"@W`pₙ @0`pPW WG* @ąPGXo '@P  .@ |.@ppGP"@Ѝۍ p(@X O-M|`.@P]   ЍO!@Ppx.@K 0  gp!*@PQP@P3 $ .@P  00 .@P|`ၺ `0 Ⴚ 0F`F 0zX   @ Ѝ@-P| .@0 '@.@S @T0000@0 BR@-P| .@0 '@.@S @T00C00@0 BR.@/.@/|.@P/忾H-P p`Ꮨ@㉘ZPUa {ZG-|`.@P@p QQ Q ? Q H-zP p @PCH-.@//H-Mw@.p@ Up P`pVUPPЍ/@-@P E/p@-P@P`Q0/ ! R:`Q  E`@pH-M 0)PЍp@-Rp@P`@TpQA /p@-@`PVp`Vp/@-@ R Q Q! R * Q QS@SJ@0A-M$`S R@x0V@"Q^PpP` 00(0,0 00P0ЍO-M-NMM.@ .@Z.@ Pg.@.`@P (@ @ @;PP#P   C  @P   1(@ZM `R 0pp@E  R``PU (@'P" @@ {0S 0 SpV R  R 0 @  " PU R|0LhXhx<( J,R @Q @ `P Q (@@ QQ @ g.`@P5 (@+P (@g0.`@PQ pp@;P }PJ\PPO $K # P @#P#P\@T`Zc  똱P\p.@ $ȍPM \P U P P"bU 0 @ R*$p$00 @Sr  0SQ:P 5\P&P$p$$P  $@@PPAP @K$rPP$  @ B P  ℰ P @0B \PP  $ FP`= @K >P㨠; PQ (@@Q $M0Ip @K 0Ip P((@PG `(@ Ab PP (08Pg.`@P7 (@ 00@n P* pℰQjP$h A.@@  PP\(|@wIP@ TQ   kIpM*@( cIpE*T`V H !0q1 A $`((;P }PJp$ $ $ A  `㄰ [P R  P(@ @ R PP1 A R*P@@K /@"P tڄ@P@ℰhQ HQIQ gQPiQ pQ1 Q Q;Q#g .`@P #| (@P<  00@ P2;P0P,wQ (@ R 0 @ JA PR RQJ P@ ᰁ .@Q ! p hP ` $0S6 p` p@\S- RV @-  g.`@Q  @ @^.@Q g.`@Qe @ @ g.`@Q @ @;PQ @J@,@LP: P: P 2PR2P  `PM `@  \R R  0S S  `P5 D P@fP  P'YP.@ aV PP `=/. @  P !7 p52g.`@+(P.@``@㘯.@!@@.@QU pP 0/AWP`V,.@P 0.@T.@X.@NߍۍЍ  .@0 @  .@0 @ϔ  .@k0 @@Ŕ  .@Q0 @  .@z0 @  .@0 @`ᬔ  .@0 @  .@?0 @PᛔU ᎔  .@0 @  .@0 @ .@0 @  .@%0 @  .@^0 @  .@0 @  .@0 @  .@0 @a  .@0 @~  .@0 @w  .@0 @p  .@0!@i  .@K0!@b  .@y0!@[  .@0 @  @ *  .@:0 @G  .@0 @@ $ @O-MPE ,P@.@qP{P tP rP 3aP bP/`V P p 2pR p.@X PP  ?@TЍ.@ .@0!@`ᲓA-MM@0 A R * $-PЍۍ.Q$Q +Q&/Q \Q `MP P IQPR IAo`AP p.@ @ .@ @0 .@ ep@-@(@0PP@ R RQ .@ .@  @.PF `"pO-M[` [k \[n p[]` \0[S \S SN[[ SDF@P[U-<0@^X^000@]XX5 ]X! [Q.PAU PP0pW" PP]UW0C0 U \U nU 0p0]Q pRp00Ѝ ^.@ @0 .@ Ȓ '.@ @ .@ @O-M .@`p @\P \Q Q: . AR [Y+ P[R[& \0S! Y IP ]Q [QY[[Y][Y   P R   P R p P` GPT.@ R5Ѝ.@@.@Py @ 0EH-M@P`pmPn@ P2Lt aP dP fP       P pЍO-M@P`p$ V ?P P[P E@ Z *?P  pP P@Ѝ00@?6SC ?Q7@?QW@Q?0|/O- M`PxY @]E p.@㜉 (@X!p@.@/@ XHPa@Q&, .@EP GP_ IP.@!.@2@Q  (+ ' @@ .@Y P @.@ 0P !@1E .@ 0٠P !@"E @+ ' @@vp)<(@.@APU + ' @@PPU  0'@p 00p"k @'`@p pP PU.@ 刎P .@b@ᝐH-m| (@!@0|daO-M⸉P.@yĩ㼹@`.@.p@.@.@P P< 9+PuP-Pz  Q Q* @adP .@ 0/  @[cP:" .B.@.@P:@P  .@#QnP .@Vc.@ p0 W8 W @@P.@@@p70@p0pp` CRp  -P- Q#Q) T  P" TP P ). @ p @T ЍnQ). @  @῏O-MMy.p@iIP.`@.@@.@(@.@ .@ RPH * @. @X@  Z.P@ XP; Qp P P/ ^P P P .@P `PP BP .@ P Zi.P@.`@ .@P .@.@P Qk P! `P + +〹 PP++  ᚒ !.@! @ 0b P*XPP ܌ 4.@@ bP k 48( PD  P@ .@.@P .@ Zi.P@(@.`@*@. @* @bP4 @B .@ ** I .@@.@WPP u  E PEP   0.@Ѝۍ  @၎ y1!@!@!0@m @eg!@ g!@B .@Pp!@B .@_C!@K@-I.@@ Q `p 凵 .@P .@QoH- @.@pW *l `@!bP PP 5p pWR@@-@H4PG!@ @-@P 68PS!@ @0H-@P7P0`!@ 0܍H-M rP.p@@P 9 0X` 0|XЍO-MI.@.@@P (@4X,2(b0.@.@.0@.`@.@.@Y Q P# p RPU PY P \2.0@P p R Q Q Q PAnP$ P( Pl \2.0@mQU_ P2 \2.0@304(b,2.@.@.`@.0@PK?AoR04(b,2.@.@.`@.0@PPQv04(b,2.@.@.`@.0@PkI\.@P5 X2.0@0  RN,2(b40P.0@.`@.@.@ PPQYQPPSPPO\.@P  X2.0@0  &N,2(b40PP.0@.`@.@.@3 PP/\.@P X2P.0@0PP P N,2(b40P.0@.`@.@.@ P Q QQ*P PoRUo DA7Pdt<<@$<<<<<<L<<<<<<<<<<<<<<<<\l<<x<< <P<tH<<l<PL@T2 P D P+ E  0I.@,2(b40Y.@@.0@.`@.@.@,P.@P  =Q @ ` @ 08.@ wPp !"pa  PZ @ 04(b,2.@.@.`@.0@P J @ 0Y=04(b,2.@.@.`@.0@P .@ 0!  P  'ZP  P0! ̼ Pv  &r@Td*pj p@P@t:pp@p W '@pQ: .@ 0= !@㈼Z$.P@& &Pm>Q ?p '@Q: .@ 0= !@g .@ 0 _MP' =p$ 8 "@ P p '@Q: .@ 0= !@B8 ""@G ! @.@ !@#_# '@PP: .@ 0= !@$b pP.@!`@  _PU0` PPU` I'@.@@PP.@.@:0= !@ $!& &@ %\.@ ` VPp W+`RV.P@ \.@`PpW (P(@P/W3 P:* 8.@8R.P@ @ 0  0 @TW*p]8.@  004(b.@.@.`@,2.0@_8B.@@P Y  @ 004(b.@.@.`@ 0*b0p *C0 (  A1P8 G PP  E   p _@P ! p Q@P,24.0@.@I.@@ 0`'@p PPvPsP; X"p. @0T". @ p p p TKP ,2(b40P.0@.`@.@.@ 40`(b@.`@.@.@T PT9XQ.@0  p"p!``.@0>` X.@0 P" @!P R `.@ 0&X.@0 p[J\P.@Q P TP.@   JP P{x}0x.@PP x`.@ 0@-AT  W: P`x0P @THx`.@ 0@P.@ $ x(.@0P.@ @.@0400(bpW.`@.@.@xr 0.p@  *b0*C0 8 A@I.@@ PXB.@@.@0 @`.@ FKP`.@ 0{`". @ 0p.@*g0 .@*C0 A8 @P 0!  P  $Ip.@@ P  ,2(b40R.0@.`@.@.@q !p1   P% @ p04(b,2.@.@.`@.0@P @T X.@0! p P'" p[fJpP\.@W pP ppT.@P pp  I,2(b40P.0@.`@.@.@ IP.@.@.@@B  @zPQAh D P'@[U@QP7 SP ?!@p^WP p?Pp^ZP ?P^YP ?Pr!@m p<(@EQ`T'hO/@@S.@.P@ (hD&QPPQ gHg5P  ZP.@.@, xP #. @P (@!@ WVP!@ 6!@ 1!@ , P @UP Pm@!@P3!0@!@3!0@!@N "@USH- n (@A!@VSp@-@.@3.0@PPUp6!0@4!0@ (@`!@ Uh/@P UP U!@U@ %!@0p@UU2 !@<!@ p@U  !@ 0p@O-TMTdp!P@/`@P  9IuPPp GP gPP<(@PU}@X H'P pp Z |@pY P@ #TP`@!P@P Q WO gp aqp " !@p  @W #p!@sZ p!@hX p; @]P @VEP!@@$@! @0  @ Gḟ!@6!@ .H-m (@!@UR@-M@$P   p Ѝ!@  0H-M@P P P Ѝ0 "Pp H-P@P Q `CP <P`P CP rQ <`V@-@Px P O F !@0H-'@a1S  @ P PU  @S*Q0Q aD A0sPQ  0 c A 0C0 @-`(' @!R0@T 0RQ ` @ rP   a @0 BH-QQHH-RRHH-SSHH- C(@08 !@"Q0H-D.@@Q0UuP6 륐P 4 g}㌛Z/P@$. @$. @u @.@@)P.@ (' @!A< *q000O-,MPP_U.J .@P).@X# ! PP !rQ 0p 0R (@㰰(发P :, R P 2/0 R  2/ @P!p0@pp$p ppS pQPPP P `PV `@`Q|l  P0S 0.@0 @sR Q1D@  @r  1 PUʰQ@ r R  @pPV`ӼtP1S.P@P?P ٽT@PU PP`` @PV` pP᾽V `Pp@$.@ PS`/vQ  Q `@ @`R .@A 0PP? s;P |q(@  0 V Q /@S?cA(`@PpPPjvQ+P @Q0SP RPG@Q -0,10,.0,t,0,|-0,0,0,0,0,,=P P/ <Pi>P* ?Pv < ᫪t,|--, Q0r`E RQ V p1 AR#pa0QA ! cR(`@/P !30@S,|-.,- ."P0A@0 B0!ARQ 1A0C?1ku뙬$pW j/`@P 06P Pᅬ$P兩 /@ۓ pP`U$ p`P V P`Q V/@0uQ8 !0@Q 0L +CQ(@@ /@t PՀ PpP<P >P dP  P@Q:P wP uP qP!RP SPU PQ  xP .@EP.@PAqP$@bީ /@tc((`@A c(`@ cr0(`@!pS B  p l(c(`@ xPQ zPaPxP@a@(P(@P  FlQ~t P 宨儩U4R``  R  2/pU P!PU   G Rt `P 偨 x `Ts`.@1 :t P j@P (Q P`P ( P`qV4 R  2/@ PPP : P,Ѝ芎$0.@!@  }$ !@a0 @ @pZ.@ !@1 @ pdPMEO-M@Qsp' QP- | `3P@Ug 0ƙUP` p` P@U 0ᰙUQ Jp@ 1`VpGs\ R0A0PUp`FU``vPUڶav0|Pv00C?s`P10YsPUY `  0`PD !VPUrV !   P (q 0, `PqUP 28!0@ T 6s!A )ЍO$. @ /Q/A $. @ R.@/O-M .@Pp*@.@0 T` %P4 `  늠`P   @<P%P   4 H0,!0 S , ( |%! @, 80@D04<Pp岑$0( 8@Ѝ@-PJ .@Q.@A P ՕP, A A @ @Q/Q//0H-@ .@.@P@U U,'U0/b\ H-%0! @cH=@- Q@L:t:::: ;(;:d;:.@P`  ?.@  8d$. @C3A#. @ .D% . @).@ "(  .@P .@ /f4. @p0@QP  B". @@H-M .g Gf=ЍQ/ ;;;<<% . @D  . @d$C. @A# . @D% . @g Q/ L<<\<l<.. @B". @(  .@Q 8.@ H-M .g Gh{=ЍQ/ <$===.. @A# . @D% . @}d$C. @yH-M .g Go&=ЍQ/ ======.. @^l% . @ZC! . @Vd$C. @RA# . @ND% . @JH-M .g Gp<ЍQ/ D>t>T>d>C! . @1A# . @-D% . @)d$C. @%/2 @-Q@>> ? ?ЍH-MD .@ 0,Ѝ/H-MC<.@ 0ЍH-Md<.@ C0ЍH-MA<.@ 0ЍH-MD <.@ 0Ѝ//////!@/_!@/h!@/!@/!@/!@/H-Md .@000Q  a ЍH-Md!.@ 0ЍH-Mc.@ M0mЍ0H-MdF.@@P  0PYSЍ0H-Mdf$.@p @Q  Y  @0J # 0d7Ѝ0H-MdV.P@@ 0@$P   @   @  @G5 @D5Ѝ0H-M  !@  0ЍH-@.@Jd* .@*J" A//H-M .@000Q  a ЍH-M.@ 0Ѝ0H-MF .@@P  0PSЍ0H-M f$.@p @Q  Y  @0 # 0dЍ0H-MV .P@@ 0@qP   @ h  @ c @4 @4Ѝ0H-MB.@ 0KЍH-J2( .@ * .@*J" A//d .@!@/d _.@!@/d h.@!@////////H- @-M}~ @P  |{^ЍH-E0H-P>p @]~ ~00H-@/p PN~{0H- .@ |J{@-K .@@P ={H-H-0H-[ @.P@ |!~ "{0p@-k P.`@)Q N,@ @ |A{ 0~pp@-k P.`@)Q Ni,@ @ |Az 0m~ 1~pp@-k P.`@)Q NL,@ @ |Az 0P~|pH- .@~0H-[ @.P@ |! z)Q ~ 00~0////!@/!@/!@/!@/!@/ !@/!@/%!@/2!@/=!@/<!@/G!@/^ @/f!@/g @/@/ !@/Q!@/////////H-M .@ 0ЍH-MD.@ 0uЍH-M  .@ k0cЍ/H-M 000Q  a IЍH-M  .@ r07Ѝ0H-M@P  0P$SЍ0@-M@!@߱ P Y  @0 0 dЍ0H-MP @0 @P   @   @  @2 @2Ѝ0/H-M.@ e0ЍH-Ml .@ q0ЍH-M  .@ r0Ѝ/K-@`!PRp  " RrǠ Q|8!0@֓"1 !0@Q P  !@kc!xR Uaq wRb(q L!@YcY `៍80S  3/PK躓A-P.@U@& Ph`a.@pPUPWP:t`.p@P BP`$.@ .@A-MlP'`@(.@p w@U@-  pp' P 0 0p pPЕPu !@㱰P M@@,.@@Ѝ0H-@uT '@PuT'@A0,.@P:P (.@P*@H-.@%g .@$.@.@.@@-@.@g .@$.@ @@ MH-M    $ЍH Ѝ/M0H-MP.@@ 0f .@$.@$ Ѝ0HЍ/O-MT@.P@.@0 ^B$ 4dT.@.@.@.`@ @P S(P@ 0@ @ @ 0@0S 0p0@ @ P P3P0.@P 5P {|P u|0.@]PP a| ^|0 .@ G0Q.@@ `Q PD[ pWVUEPU 1|4d.`@ [4d.`@p $|pGW  JT  S!@pP D.@(P@32PfP库P |0.@ЍO֚H- @HM@-M@ 0# Ѝ@Ѝ/H-MY @ЍH-Mp.@`@Pe .@$.@, {(#  0`ЍO-4MXp/oo`"P@.@Nc\ U,@`pWP !@ `g,@P.(/`<$` D@`@ 0 (@0Pt.p@3I 0PP@I [@I[tPtP Q.p@  ARPAKQ,$`(@0 XU = 0@i AG@ `vP~PZZ? Z_\kAZ2Z6 AZXYIbZ` ZOY(@  AR0 B00@PPPAP @ @ P, `K  n`Z Z#`u Y', K AZPIK`j[Y [P ,P O!P`W Z [(@ ` P D,P K + P`:0P $ 0( @.@z .@$.@ P QP ,   ,4ЍO- !@RO@K, p@-M,Ym 0@ `@(4PpЍpO-Mt@.p@P` HDU

; ,(@0  !@š1; (@0X  !@㵚H- E(@0  !@㫚;0H-M  @㥞G#{P !@?P!@:P , Ѝ)Pb Ѝ@`!FP /@壓J/@@ Ы^噓 {P Z_ 0$PoFP!@C!@@$i&A-(MM@(P+!@+㍑(`+M !@+パEPP (EP / @ 0 @@@@ @@@@@ P((^C(Ѝۍ0H-MK+ߠ!@+R P+ՠM !@+HDP  =Cۍ0@- MP @.@TD'(P @ 'PJ .@*Q $Q A+qP V+ Ѝ P ` 0E$Pf#%O-MQ   0P  P P @X @Padq7 P: (P Rr pQ %R R"#( @  @G  hR%R; dR `W 0 p!!+Qp(iR* sR#( @ 0 ``@`Q \Q`V Q p%Q_p  R P P Q Q(@@QcP aP<0  3/P3 BP$PPpH ` XPX Q Q  0 窟PP$PPP`V: @T0  Q:Ѝ0H-M p 蔮.@bTPH |'p@P  PP ,W@`Y V(,pW% 45J/@@W < {Y @WZ  @%&c+@J/@@WvGW] 5`X5V {! W @:Z  @~~P@ (@_j[ ㈐vW _|X +Yw( PP @ P Y ߍOЍ/ 3``K[!@ a8"@@P 8u58a^!@ ar!@ xVYs BoIP  $!@D5<@.@@6_P  @85,_2"@P 3!@P@ = @@  B.@= <P <P @H!@E< 6!@;H-MjP/`@@pX*v< pZ~- ~Q O~"  @SE!@} TP0 ApP @SϠP ^^f}o| 5Ѝ +(@0 !@㵑$2O-M-nM M @.@Qf8 ^%! @pa㊯PD`<PF @GU@*D @@ߛ _o֛(@P u"@!p@)@ PpW<劯< i9Y⊯3Y iD U S Y 8P  P =@  0@aPp Y 0u  0u,@tPDț8.@"@p0@t[8@)A@p @P.@`PD ܙ@a  ᢠP @P4 _&P @! @02 ( +0フpPT !@ 0-DHP.@ @ (0 fp q!@o!@sPFwGVhlP.p@.P@.`@ (@PAFwGVh.p@.P@.`@a !@P<@ns@P T `q`40iv (@ + ϊL%pc !@ P㸀] J.@@0 ;PS L.@@0 K!@ @O3PA : !@+  !@'  !@#  !@  !@ * !@. @ P + !@ 46 !@ F !@ T !@ \/!@W!@ P)  ⸀~ 0!@ zP< @ zP5 !@ zP. !@ zP'  @ zP ^@ zP P P !@ 0mP '! @ 0P D.@!@eP` "P '!@! @ 0FPF 4  K㽏.@@,yx 0ow 0jCPHDK .@.@.@@ V 0P <P Ey.@0 M<P cz.@ E.@m(. @QP*e!@@D .@f ! @qHEP.@@ ( R  P  ! @[K P.@@  <  P a! .@! @PD.@<P   P  !! @+P    ЎPPD.@I`P P D.@4A> l'@! @ 00PxJt?Qp!@P{!@ 㦗(. @{0} 0D.@| 0E8x.0@.p@ @P2 Q !0@<0R S HcXp.@@.P@`Wp0 pV` `S0 0 3F7G& @. @.0@ph0.`@S0p 0G&Wp50F7 p @. @.0@ppWPM .RrH R  /!@0p  p*P!@P4P4 .@H8,= 8,7 !@4P I@.@ @d.@.`@P7 4!@@1P @!@ [8"0!@! @G.@P G&!@. @ H.@.@P + !@. @/!@ZE.@Pg W' c4D$E8.@!@. @.0@@k "@F0 `+ .@@ A+ 뱀P  0=0P:.@P- T!@+ p"@ `.@ G8 " !@}P "A _ (p!@@PpPNH.@ (zy!@D$E8. @.0@F.@P FG.@@F0P P !@H%!@. @0Q!@omnߍ ۍЍ<.@0S |"!@ 0 (@0 !@(-<.@@T ;7(@p@-M!I0@L PDP 1E.@ 0 PDP 1.@ ٕ `?p8 PP@ @$ A`D.@(`Õ8(L WPUTD.@ 㱕DP 8H`P @.@@  wD#P!@PЍp0H-BMGPP P.QyP @F.@ PG.@F.@ vBߍ0H-FG.@@CGvP.p@>` .@!dPEPQ.PG.@_P K" .@@!@!ƅG.@!HPY @/"@/K-!MpP!@ PPH 3`@!0@` A: 0`9@p3 !0@-P P/Q/pI/P @3 !0@P"@1Y= 0@P#`! @.!ލG-PB@U' vԣ`!@(@pW Y /W P EQ 0-@  ᯋP p`T:H-MQ @ X .@@Z60B.@ /R"  .@! @-Ѝ& . @p@-M@@.@P  @ Q$ P .@@E@ .@)6BR0.P@`B !@@/P @ .@-60 /P P.@P-Ѝp@-@'/. @@=p@-Md.@zPns@P @ d.@.@ 7 A.@.@ 1& j@P % D0!@. @.0@Ph ;D.@@ d4!@@.@.0@ 9- A3.@.0@ 2-@ލpH-BM@.@P P DU.P@  !@PzD!@.@  .@P !@M6z.p@P !@E6 @Q$D4! @.0@,4@6@P* 5b 0 !@ @h.`@P (!@. @/!@e5b 0 !@P t`!@  !@D!@.@U!@E(8. @.0@/!@!@ @O6P9 P85 !@g!`@z!@vsGf.`@P G&!@. @hE(!@. @bP + @. @XF'@. @RJW/!@L!@UPH!@.@^P !@XD!@.@ST -WtBߍH-pP@ p `㳓D.@ p @EG-BM@`!@ڙPP Y} p@e P @D .@.@X !@0@PBߍ}v!p@ PP  P @/!P !P @/PQ !P "@/"@/Q QH-M  @  QЍH-MP  0p@"@ pp p( P$ `  0p"@ pp p " !@`P "q !p@4/P TPpЍp@-@[!@ `jTPPa @ՂUPp0H-|,@p " @"@Q P P KToP P0H-'@ O-M`V! P@p P gP PP `VЍH-'@ K-Mpp$a m1PFP @H0L! p4/P pP 1/$qp g!@p@1/pЍO-lMP P< 8p@ L03/P' H$ 0` 6/P  0 3/o Q 8 <01/P   pW:lЍO-M-UM0zpLpؐ ^.P@ @pPJ`/@@㔠um뷃 (@}!V|@P#Q4"ZLpN/ P`D㬋 0T .@@.@0.P@Q N/)P p P 0 }ϊ ' "" .@  p0! 0P040P8Q@Z,L1H!B Z@ZR$()!0 `(KHaLa及.@0 S< `D.@@a0T .P@P[b4?bmLL P.@$ $ (aP,qP,q048aLQPH!0 >P.0@0S'Ym `@@#Gp P`P@C$``P;$B@C<.@P H!L1L !@*@$p$AB :0<<8<P P,8 .@]P  _P(Pw $1/$@Q() N}Pr$}PmK? =A$ePW @$48aHL; ZXF X - @! /n/!  Z(:0_@p@X BBP` pzoB@B 庠4@N_T40PL zOZ`0 0 4}p0PLp`zOq V@ 0  z 0000008p,W L@  @ E,LLpH {!x  0 p LL`0Pp PXJK,I(P { nM'@@" t .@@ .@p { .@ UݍЍ.@[J [p8Pm AkQ#0B"@/!Q//O-CMMk .`@ *Q Cߍۍ)Q; A_)0! @M( !@ P fP A/!@ _4aF !@@0A_# 0! @,(A !@ 1P a6 A/@!0@\  9 0@p ƒPP A/P4`p4@00Y WPp`X:5;x@B!P PP4/P %0P  P ;x@B 4/A/;x@ 4/< Rp B<@R0P444xLhA!@by!@!p@p<@RR} RP00S &)! @',A!@ D;) ! @!@pRr 1RPyA!@1ry@!p@n00S J)! @j'(0S PQ)! @a',0S PX)! @U'$ # @P @ P !@_ A!@0xy !p@@; !@!@p1(P,Q )! @+'A!@ ޵* y!@!p@$ !@P !@Aεz!@!p@ A!@õy!@!p@P0)pR00  A: A?!@ Y  3.@P A/A/@T pJ/A |0PA/ A/\0`^K-MMpQ8 @P `!@ e P- P & !@MP$ VP!@0+p W V`[ @  0`n@PpЍڍ ip p *r YlEPT@PPJl@Q!@ 0%!@ 0H-PP 0 S,0S ,\ SHݓ S:8 80S:^3O-{MMK p.@@*QD( !@.] 4@@/`.- !@<.@PU . F0!@&VC }!@8`)QH v -P7 N(H$!@ wP$ 䩝ܙZ @zP |PJm@p@U n@`PFv T:0S a !@ 㙃 LDPP Tp@ `T6 (P P PS Y v0 xP   @  0 0;5/ P<zY <Q @@!@ P"r-A  @!@@`DP`````tY= <@ 0@Pv+&;!0@8!@ tP$ DP P  sg8G!@h$Y R/㮄 @@P*C @!@@a !@גP`@ l !@-)! @`a !@@ŒPY@YM + !@ @@! @$ @0!@ +,0;! @ (`k!0@[0!`@!P@`P@ !@a08<0s !@ DP r80!@pp[.: v  Zํ܉w/ P`V 8v/!@N.@@P @A8P!@v!@r!@nP '.!@. @eH H p!@0p8!0@qY- @I !P !@Lv !@8-| !@5- !@2-P !@,- !@)-/!@6.Ou{ߍۍO-$MMP $Ѝۍ茜L P`p"@!@@!PpG`w @)!@! @P`@P @@ @@P@ !@<fD `@ @`@A  !@@!@ @< "@!@4`8$(@<D@LT pP`!@@<@PP _P !@ V @<!@ ` I "@r<4` $(8PEuI P!@@!@ 4{P P!@ * @S<f`@!@ ` @ "@D<4` $(@8Kp K@Pt+P4 .@( !@r.P ] @f.P ]# B @(.pD@c-  0 |@y@pW t$  .@ @ K  .@)Q @# 0! @V#JP3 @P+P@pPT:  .@ @  -T*d0`48 xP  0;`5/P b V-b=!@! @!0@0z0x0H-P !@ @FP0"/) Y- @ @0H,@-@ .@ p8@0H-M .@ Q! 8 P Qp 0@ xP  -0. @;@5/P M.@@ PCPPЍ00H-M.@@P0 P4P0O-MP )PZ@PM  PHJ@ >TE `BI(@ p Op@P R jkP  dkP   P @DPPP  p(@  @T K Ѝ@-M @ ]Q Q P 9 0@}Ѝ0H-*JTR0G-MM0 .@P, @,T A4^ QP0 `$P P0`AT4`0 P ,Pf!1 8 @0@pA`@0'@  0@&8 R_ P4Qm @0R 0pW PpRaPVW:( R1/4@TQ*  O@@pp@P@TB_P0< `Y <P K? Z9P 0P4PP 0`4``N@TV  y P4Q @0( R1/4@T:0[ ߍڍ`[H-  !//O-tM@R,0 0 @, q P$ `P 0QUQPU 0Q03P  L03/P P `V:0Z `Pq Pl (0$`P5 (`$,q P) P 0QUQPU 0Q03P@ L03/P Ph@  X:0`V( @< 0`H0  ```p 4<`8`P$`4`>8P  P 08p<  $` PtЍO-MpPPF ` Q9 p @pp  L0 3/P# .p. @p`0t ыP 0ʋ! #I!@P P w `wpY: 5 `Ѝ0H-@P0P 0HTp@-Po@)`Q"+0 @ p@?A-@ PQ ` 熁(0S `V:0S P0QqPWS:1/AK-0MPP @ `p L0 3/ p 0P@`W:@`0Ѝ8/G-MMP x`p@;p p6/P  @;x` p p6/P  0!@*oBЍۍG-M@p "@p[`!@P ZHP PN K'@'@ Q Q `P# a'P| ``04P A% H` P -`0! @X=P[ 9PWQS HpPO fs@P I @pj `p/P@ @@ @ l}$H0 L~PUFH>. @P; .P8HK@P2 !@P- Z."@P' K?FoY} p@p #  8qq(@ G0 PPB@-! @ 0`HTY.@\ nPL @ Q圑P P3 JJPHpT  S`L0PH`L hPd`UqP P" K?Ym `@ ` # 7,p @vOP3 p167NPEQ, FPXQ( o!0 k .pA0d 0^K?F_Ym `@` # g7- ! @p= ,H`70 pP(Q0030SP'Q 0W0'0Q0p 0WP07@&P: Q@ RQK?F_Y} p@p # '7-`! @ 0NPPPލA-S `pW WW`V  0B pSW WW V F0\0@P\``vp W:v\WQ Q `&c``aa``a`Q p0RO-dMMpQ :!@P P dЍۍ a !@&`P "@P v/t_r@evGVv6 +t/r+tF(P \R R 0S  0 .@@PU1 $P R 2/pcQUk .`@+ut/+rmtPƈ`@PaUn:5aPj+\t .@$P R4  @_R${ P.p@[ᛊP K? 4P ` R 2/p1/{ .p@N_[p2/p p .@P$aV /@;x@ n 4p@`@@@ -P) (P$ #P  @P  !@P  @P 3FO!@ s  s@ ӓP FE&P   p @ Ppppr /O-M aPL03/PH t R 2/.p. @0@ P劇 0デ08. ! @P @" !@ Es @sX @ !@ 8s 4sPፇ P..@  @;ЍOo/G-M  "@"@ 0"@.@R|#S0"p@. @`PW0C's`0Qppp0C.@@S.P@.@.@P`.@`4@p0PP@p*PP@p$PpPP.Y= P! @ 0@Pj.@ЍG&H-M ᬽ!oЍ@-M@ ៽!oЍH-M ᓽ!oЍ@-MC.@@ 0  #/ @ !Ѝ0H-!@us_T@ P@##!@0H M0H-M@ P$0 壩 R !@0@ Ѝ0HЍ/!@ G0H-MQ @ D.@@d#B BR0@ !@@.P@.@ PX#0 .@ PЍ0O-$Mah TX 8p"| @`!@.@!P@.p@Y  @P  !@:  0 P= $ >!@.0@$㝰P#@`pP- @PD .@.@ "B.@B !@ 0Pp` @ 뜰P!yP! a! @$Ѝp@-MMa @!@^gP  @ .cQ u$f @QЍۍpH-MMa !@>goЍۍG--M( P0TO0L0$0LP$ dX.@XP`  PmP @ d.@.@ Ҁ A.@.@ ̀PP\.@ ջP @l ˻PnJPlL@qW W.@.@ cP4i.@?-  @0@ t @T0P" l 0 PPPPPPp- `mT4Tt㐁!.@,PW hE .@@P  !@nbQUU oRP܍ m$ 4 !@! @!0@'Cp@-M@.@P+  .!@. @P#h .@@D dR !@. @.0@Ph .@`Od/!@Ѝ0H Ѝ/p@-$(@PU K ` @@P P  8PUQppp0H-M !@uP z8K.@@ ᛴP J% !@/kq! !@ .@܍0H-M. !@R7L.@@ fz88.@ .@,<}@]T( .p@.P@! @0y @ [OKL@b<$Dh& C !@ @H0 ` 0 @ 0 P`0P$JQ(P@@dC8*@0j" ! @> !@)P  z}QCߍA-M`JBO kP @ y pP`> <.@U.@ (!0=!@ @@ލH-<HCO-ML.@@T(@@P.@P(@TP Hv.p@@TP@@T7.@ u` q~P8 .@U  @ Vl DPb @epeTU .PR  uy pJ (@H.@P UPB  yP.@P7 P.@  y(@  P  P"Hv@.p@  @  a !@iHv.p@P8 .@*P.@pPsHv.p@860@ mЍ@-M@P   .@P ЍMH-M  0 ЍHЍ/O-MM@  !@  @ PJ !@ @㸠P}J !@  @㮠psMpw @Pp Mp}4P@;Pz p PP` y@`v} iP `=P   @ ` mP <<V" ײP @P!㳾P  IJPP 徲2P3Ppҳ г P ~ P z 3 @ ㅾ .@jPЍڍ 8< 5<jH-M lЍ M0H-M@ !@ @P P !@  </!@Ѝ0H Ѝ/  !@!@#@-% !@@P . !@ P 8 !@@P@O- MM@sP2 )P2 e@ZP# eYa p`P@!@@+w P* +?h T  +9h T$P 7P  o᠂ Ѝۍ @-@u|Q@ @ Yo@-c@!@g~P d$A. @.@Q .@H-PPzmP#@Q/p@@U.`@ }P ut ~d;a;&Y#YpSnSiHi0H-M@KP@}% (@B !@ 0Li !@Ѝ0@-M@ql j Ѝp@-P'@@/Q `Q }P /Q`@T@pK- M@$mP Pp` pp pDVQQP:$mP ЍMH-MX00 @ 0ЍHЍ/A-pP`P@V !w P P8/AMH-M 00 @ 0ЍHЍ/H-@.@Q !@ .@ !@ .@ !@ .@|@ .@@ .@a @ .@H-P40 0 C 0 A AH-P40 0 C 0 A AHO-DM @`P pP L03/` PU:p,P K ` PVF pK L03/P2 剁i(PQ "0P  v PPPR $04@P0R@ S8p,00, SX 4 T\0 [2Y1:PDЍO-MP  @ @4 A0p W[ Ѝ@4 0pS RP pP P`4P!ip v U*p`pP/A-HM@Q9 0<S8D@ @8 3/P P pP` L03/P `V:  D@<08 8<P@ D01/HЍp@-PP` F@ P p@@-@ r(p@mA-@PA pag0 hPUpIpW * 0 SpPW:P pag4PU Q 1/pW * 0 SpPpW:$A!K-M@ p@ P`p@@@ m @@ c@ \}$0 Ln@T>@ YM @@ !@ x{PЍK@P  !@P @fTO-M5PE  !!@ c0  !@ PU p@l >{Pa@PP# @PU! @〮p  Dp@PP eD @T y ߍ0P t @!p@ Q R@T: Q4`!~ a0P!@ 0 p=0p  esH^.P@+`p  VPP k Y0 0T !@ a0[&(^O  N q Qp @ 0!@ _  @0Y 0 Qtt.@0@ S 0  0Q00A B r   " /H-M(@P`/.t0 a .@1 0@` P00P `@ᵹ<ߍ.@00S 1SQ/A   .@00S 1SQ/A  H-M`nVpp@ptPpp  !@oVq% A !@!@V !@4 i Vl !@!@.`@&X@Q4:Ps P)KPP .@P l .@PP (`"@ `X @X@5P  < !@.0@ } l% >`!@. @.0@~@.@Q@@ao(`@ ` m!@K( PPy , P. @zPfp@PPk Y- @PPt !@0f`oRW@.@P !@'˸PP@  .@P8 D.@PP1 (`"@ `X @X@P'  < !@.0@  % D0!@. @.0@`P$ P!@ 0`_ !@ PUPލ}&! @H-MP' @<}.p@Pb yP #P% `V8 @].@/07 .@.P@A! @`E  @ 'G(@P{@T NadЍH-8=X&.0@T07. @.@.@ !@-@8-. @ 7 .@ bqT!.@ X.@xH-MM` p@;@(p  P^p @z`z`ЍۍH-|dP@`L P DP p P P  P zDH-MM @`;P`(p p 0V@᪫`tʟz`@Ѝۍ eDO-AM@ PPAߍP` L03/P  P@U: АԠ,( X*$ L03/P  X: аp  [ ,[( YY.@ @ 0 u, (0u@ .@P`$ 讖  !@pP  .@0`  up  0u`P,. @@@0@P ` P  0iO-SMPP@(UqXP@1hT㘰mJ `Vj:T 40@ YVp@$pPh 0p8`"@,P<@Y@@"@ a LPP "@@ RR"@pP8 NRAX; "@ 0 a<@ @H1/ @Pp`0dp0 ppp3/P5 e  I803/|P`$4 .@!$Q ' @ Q"@<40 8L0 d3/Pf P @Pp p4@@' @  0 0 7p` 00  @F`d P& ᫺@q: p<@80QU Sn4P4P@ PP03/q8r L0 3/ |`@D0@ X@<@Px``TPH, \ \T<@!a8 RK Ba"p[,PT 1 C"[ @BtS: q8d 0@ 3/P2 T `Q4P, 0 `V/  0S# @0d`4 6/P P @tP H/V / HnHPp@- MPD0(@" @  `"! 0P `KHDd Ѝpb*8|H-<0@SH`4PtV9 s9V:V4!HWp@- y@y@y@y@p HPnp//K-MP1@Cp (0AS*d`0 6/ 0( 0 pp 7/Qh0 3/ލO-M@Pc4`LPp@@@ P RK V P PC 4$ @PQ= P PP1  @P  J0`03/P#,P P !c0 P# @ Q d! @Q" @Q HPPpZpQJpQ  q" 0  QЍG-`MPGP.@@pWT.@qP X.@qPŁ \.@qPł`.@qPkt.@qPGd.@qPHh.@qPIl.@wqPJp.@nqPŃx.@eqPa|.@\qPŅ.@SqP$ R p`(Cq p`P$ V:pp0  Y4Q P# @Q " @Q' @QY \_,_X^48PQ Q $ @Ql $ @Q} 4$ @Q % @Q & @Q % @Q Pl.@ 0 !@%HL   !@%HL  !@ %HL  !@%HL ! !@$HL - !@$HL  5 !@$HL@ = !@$HL` B !@`ЍG$C.. @ 0 0np`7.0@2t'(. @@P =d! @Qn  Y= !@ 0@ `ЍG$Hd'. @@PP'@.@ 0EpX7.0@ @.@ 0:p\7.0@l .`@0`C !@ Hh'. @@PP !@ 0$`ЍHx'. @0\FH|'. @0` !@Hd0SB (" @  P.@0 !@PQ$rL@Q, P` pdp``I 7/(d0  !@[Tp.@ 0 !@@.@PHp'. @0 !@O-4MPp PD P9 `  L03/PPP` V:&p@P$0# " H  %  0  "^ T ^ ,0S Ppfp Rk8` 4Ѝ4 .@4ЍOA-@P@ P\1/0 ` 0h`@0C?o2SP* p aP, 0  `P" pPbH"xVP P Aq@ @ " aV@A软O-$M@\1/Pp`Q `V` Y6P( pW x:0@ 0P  Y`.@ @q  00@ 1V0 4 @  9@0@u 00B @S@"E0 p$0@@raJP0.@0P `ppap,g< @0 0Pd a (!@`pPV pPP Yp`Vp 8I pPpuY  PW`PW:iou޿pڿ0 [pP /P RpP R 2/pW,00Pp(p(p p(,(8Wp,$Ѝ '& <6 !@! @!0@lkK-@Pp a`P7 pp  Q h!b"pAUhpi P bpI".UP Fx@p(p崁倮Vf`A-M@P `03/P ! 0P ` 2/ލO-EM@ .@$BP B<@/PPT`Pw TPVL- .0@DP0 `P` R 0 0    P"0@ 4 80 8 3/P,41/,H048 ,TX 4 R80Q0Q("@1R Q//@-@|0S c$S 40,8 0P0803/P,41/,H048 ,TX pQ:0QQ QS: S  Q R 004 H-4!\ \ 8 Q Q80$SrQ80SS S0Q:\ S\ O-UM`pR, W 31Q B21Q B21Q1 B2A@ (_WP` 0@P@u, @0]P @@ⰠVp*@ ,(0  @唩PJ(PT۩@Uߍ 0 0R RH <\H @`/O-LMMH .@Q '. @0Q *1S$Q堧.@U )P G.@LЍۍpW P!T17/@P@@ P& PHLp L03/P ,P0MP  ;x`  6/P pW:HLp@-8M`@4 00P0PPPJVePTJ J4 00PP U@PoQRQP8Ѝp0H-P a @!@2ePP !@+eP  !@%eoRP0H-G Y . @ @P@-M0@P /PP@/PT " @G!@! @P.@@ /P EЍ@-@ Y . @ @P@@-@  Y . @ @P !@@躿K-M@Y}  p@P.@P@pg@<.@P   !@"Vn.`@P  !@ VTfЍPpp @ (@@ P  @40H-@P Y . @ @P] 0!@ 0HT@-@P@H-M@PYm p `@P.p@?P w]xP`3@ l]- !@ 0&܍G-MP``Y} @ p@P.@@` O]PPp  E]㪘pX6  0!@܍0H-@P2 Y . @ @P0HCA-M`paPP @ ]Y- P.@ @ B !@ 0žP P, PP.@@Ѝ0H-G.@@P P 0Y- P.@ @ Y !@P㞾P0P0K-阇.@@T) `pcP P@T `cPPY- P.@ @ i !@0qPTP H-P.@@P 4w`.p@ \ \`HA-MM@ ;PJP` ] p\{H ពЍۍG-餋.@Pw.p@@T Y iX .@ @!P@`QP 0r@TW.P@@T cp@-@P`0 Y . @ @P+ 0 @p@_0H-@P Y . @ @P@{ P!@ o0   H- oH- oH- o.@P/H-M^ `"P@p 0pp 7@ 0pp !@)P !@"P .@ЍH-CHMH-Mk @.`@(P)P Ѝ$p UP4 P $1/$P  0@:P P@H!L1 0 @1/P !PRP$HQ@PRP @ RQ @F@-Q @T R Q p0S@@P@3 @@P@3s㴱ァ/H-M(P@U m`iw 0C1/P㒱@_Ѝ/H-hMPJ @e a& 8 .`@P! @!0@@pPt P!@ !@P  !@!@ .@P P P%) 9 P! @!0@PSp) ,9 ! @!0@H@9) 0! @.0@dpP G  !@㋼pPhЍ2P/H-n !@!@H///p@-`Q 0@RPU @T00Q0SRpsp@N0H-0M@.@PU ,($`U  z 0Ѝ0//H-Ry `@P!p@TPQ 0aP `Vp@$+. @PUv`U X0H-PR00@^.@Q" % %!$#].@0H-@.@P``P .@( pZ HH-@.@nP 0H-@Ph .@00H-P@, !@ 㦻PV00H-P@HP  !@㒻V!P8! 0O-GM  XZ'P dF R ce) p.@@!@.P@.`@!@P' P c _ [P: _ " !@!@. @n !@NP   !@FM;O GߍK-M !@p2cP!@OoPP @P RvP@T ;aP`ЍG-!M`P@̈Pt!@@:! 9!!@ * @SP2 p  P y@ lP]` _P=P*  P  !@ , !@! @!0@ᛰ 2. b> !@! @!0@ᒰ 2. {> !@! @!0@bተ 2. > !@! @!0@ူ 2. > !@! @!0@wO-$MMPUP @$ p;pk p e0 D`pTHtPPL$WXQ  h` @ PE Pv P P  P%q P  $ 0PP  Q Q m 0P0P p[:  !@P㟳P$ Q:P a0rD`V `VpWs0CQp$ЍۍpO-M-@MpP`PK PF pxp@ d| PpW p PW {>"0@(0\0 XpG(:ϊPh "@ `H `(  B䐄 @ЍЍ/h/p@-M@XP \P `P& dP, hP2 P0 Q&Ѝp / J> !@! @!0@g6 / b> !@! @!0@h- / {> !@! @!0@i$ / > !@! @!0@j / > !@! @!0@kH-R0H #QH-H H-P`/ma@P p@H WPaP:a@P*Q P @ R R@P@@-P @@ / c0 !@! @!0@Ů@-  @!@s@0H- @.@PǽT TDddddd||TT T  T T@ P"T0A-Mk@.`@PP "T*a= s .@.p@Q (` (0S0  R4``U* P& P4PP(" @0@` @$ @ Fhps pr@ @- 0! @\(``@pEЍ0H-[@.P@PqD  Q "P .@Q # (0D. @ S Q4 p0O-$M H 0L rX`0SP\p YPT@QpS 0^0  0T Pp0 yTYp [Pp   ^ T  YP `  PRT r 2H`VPU BZG`@d0P`@@& @ @S@@Y@@Y@ 0VP@S@@@`Y```` PZp^TT@ ` p 0TPTp ^P pY8 P  P   p  p^T T` P @p0SPTp ^Pp Y\q:p $Ѝp@- c @.`@PP`r0Rv+Piv@ 00  S@ pO-$M  .@0 QA ~"p@ P - LP@UP U [ ` 0 H6/P Ko Fo@P  0H  p1/$ЍG-@P# Q 80Q 3/P41/P D0/P@41/@K-딀@p Q"@` 0/P``pWV  .@`ĺ P.@  TR!HA  qKxp@-C .@@Q S `.P@! R 2/`V: .@p@]H- Mepb 0@P UUT @U@00@P` VVU0V  PP@Q Th @0  !`@P!@  ЍO-|M1/H1/4 .@0P1T!sP 0Y, [(0I4p8P0`0 ` ( ,3/PpoH`P ! @ A A40 eQ  DX 3/ p03/pR H L03/PJ QE pH L0p1/>H@$ $p40 ( 8,  7/P\ 8<RLHdh 803/\  p @03/p 0[ypp|ЍO-M⬫ @.@P )`Q(P ЍTP + <0 !@! @!0@4PUa .@Qq x.@  04Fp0| `@@RQ0.@0 P``}p &0PHpTPPP@H@Q@ LP,LPJ4P `P TPQ `" R pQ 2 !08PpW:T`V:P Q TP :@PPT@PT:P($ݢڢ3pY P` @0(C0``.`!0$(0 f`!@$尢$媢H`P A P0 A0S B BP @8 3/P \P@THH`| .@l%@ @ !Q :P@, uH `A 0` `````垖p PፖP@,YP P`;P 7 і3LobP P  P* pHP` L03/P PU:X\P P`(VD`P ?P R 2/@``<.@0S~ T 2!@ BxO-LM@ PpPD@!0i @9 9NXY NU  Q*NQ: [:|M .@@!@ ]9 .@ X9!@ЍO-MPY `$! @! @ @ P / L03/P HP  LPN.@@Pj 0 ?Y= @ 0@ a 0PpW  7/.@. @D@08Rp< +M  0$M 0$ !@{pQ, PT@  04/PP  !pW  P:U "MU E H  e AH  @CߍK-M0PH Hp4(l(A( @00ph@PPS ` P L03/$6(  0@@0p6@0zp. 0@p9"pP 0h Q* ,0p 7/P, qP x]0@.P@ |0| !P oPЍO-M@@PHVH|@嫷P $P"@ ||||"@ `*`@ @P*@H 1/P`@(( @P @ .@ A4PTxP1/\y P0.@P @VpP0@A PP3/PF $&(` d@ @0 6p 0   0 FPȑp) @@Pᇍ pP@, 03/p, x]@@.P@_/$0p@ ! P LpЍO-CMPH@ pP  mP P 0 p*C 0*C00 *AP`*A ` `8V Ȑ3 ޶P @X,P< @  R0u@  A0p 0  pC匑PZ,PH 1/D@P`p L0 3/ `PA PpV:pL@ᆶ8P 8t DP4@T@0X Ph<Ha L0 3/h 0` 6/P> <DP `R@ #X  p@@6/P( X\ 0 hhl 3/8qP  h L0 3/< h4pl0p `D @0JV@pPL[:xM.@@UB %,  PH3pCߍ/O-MPQ `$@@`(P ""@pFU $Q (+ @ Q "F@p@ЍA-@8q X R 2/P Q8q6 1S  `@ R   `0SP P $0S``0 3/< QP0`2 P$pPPVP*8G-Mt.@PP[pN.@@㭛t.@FJP㤛x.@=JP㛛|.@4JP 㒛.@+JPŁ㉛.@"JPł〛.@JPkw.@JP$ R p`(eJ p`P$ V:< 0 RZz P,dp.|>. @.0@Q>0@ b`8pdp``J 7/p.@@P(( 0!@ I@.@ 0I`p.>. @.0@@.@ 0zIp.>. @`.0@.. @ 0 P0iIp.>. @`.0@|0.p@ p !@p.@0p.@ Q x.@ !@ލK-MP1< @Cp(0AS*d`08 6/ 0( 勝08 pp 7/Qh0 83/ލp@-(M@,0/`PPV ( @  RP 0 @ 0  廎`p zAa(ЍpK-0M8q L0 3/P  w@P |@1/ P@ p U`0 P ɱ0ЍK-@M8q L0 3/P  0` P` P@Ѝ /G-FMP @@01/`P `FߍP  C` 0P`PP ĜP p@ 2/Ps` 0`PP 媜P`@-@Q 0 A2/@P   @㶙 @@@-M@8q 0 3/P7 Ѝ@/O-MM !@@ Ps !@dP ~Ph  !@WP ~p# !@@+1C~P  !@ 0!@ @!@ ~ !@@+ C~P ' !@ 0!@㼤0 !@@+B !@ ᭤P: 0" 0!@! @㤤P A P!@@`+BF !@r 0!p@ ᇤs !@+BR !@}0 vue !@nPs)!@ie !@bPgr !@@+Bs !@U 0!@ MPR !@m@+B P!@> A !@5e !@P-P2 !@N묰+ cB !@ dr  @`(@!p@!@ 0w(P  0PE u P +KЍۍ O- Mp`>@T> YP Y8PJP0 r !p@Q:  HP  !@ 0ip@MJPP Y Y  !@0峣< ЍO-MMP/" @`!@ `{pWP P " 0! @P+A PS*Ap/9RPP `P FQ Q/R |P:JP '}P+ P  Xi #{P(J/PIT( 0! @p+A" !@+A P~|P J P+sA P:J?J@ | {J@`ЍۍP /PP) P`P $F`!F PU a !@+1 P*+1 P* j|p j{``J>]J@P`H-*5p@-M P|@PJ  @4{PJ P({`@{ V P: !1qQ0OЍpO-M 0 ` 00 @(8p> DD !DP  0T 3/P\ P) hpAg"80s ` 0S ФP L03/P hl ! PU:P(P"8PpW: ~0@.p@8 ` ` 00 ,`;EY- = @0@0 " X! @P,T0 S q ʳ+p @P`TPG DE Y- @ ` SP0|8P` S" X! @,`0@4$P,0PU} .@ T !@`0 0Xh`@\ .@.@0HH,!<L`AC p` FP U.@ @67CC 8@.@P ?-0Ѝ0B-(MZ@/P@{P1(P(,/ .@(h4 0@Fp`@RQ0.@0 P``Lp,0 ,呉(0(`P,`((`(ЍO-4M@(@ H?P (pU 90@`0 p  0`Qpd@@ 1"0@81,0@ 5 `$ V 0Q P ` L03/P  P U:PU  0`Xp PU@P0,p(EAṈ(E@4Ѝp@-M)@ᶔP8 P `0000S0P`pP %+d@,a$ ! @P0L  ,+O P >  @㔔*F S!@㌔->0 .@Z@, @F%.1 " "@.@! @0ЍpG-pMQJ@PPㅑe: 0 ` V  2.. @p 0tB(: @ r`T P v#& p`! @.@0 WB: " ! @" w! @J& ,Pgԓp" 0! @(H0  R P5 ` p=TX太, @/ P 4 t R8qS TX吪`  P 㟓p" ! @(0 p㔓 `㈿p ㋓" ! @p( 0u p`+0 0@0  J !@pEV dU pЍ8=0p 0h` ap" ! @(02/`P O-M⬫ .@)$qQ `W W PQ% P!T11/PPP(0`o"P P`pH!L1 0 `1/P p$qP P pp`@ L03/P P P@ `V:@V?@ Q<@pR  >p.0@0S P1Ta(h `P0l0S h 3/,Y p @ p0#h`bpdC 0p\%0p`峒p寒hb&T %0 `坒p噒hb '0 !@ד划儒0p`,(P<T  @'|pp` 7@,0@  .@06 0@P 0 :(P$ @<0up `A0` `````|p pkP@,(7ᾆ0ppW PX!\9GP.4|1/``pphl 05P pM`ph@l1! ,1/4pN<p6H@1/0` C(   ```4/Pl`h```!(0l0h 0 Q  01/ Pp 0 0NtPUj xH QpU_ a p!@`@,P6BPo `VppUH ,0 p(pW%  p0UU: ,p`e PUU(PU  BppV+ P^P BG0@ PX SR bpQb 8L0( 3/P px8 0 8p08 ( 7/xPPpP P t0 P |xp``p`ЍpH08 L` H ( 6/P px8 0 8`08 ( 6/x@DxtPv 6# I3 !@! @!0@͘]O-,M`p@.@ PW/0`弓/P PU  &/Z  PoAP pPY _`Ő 㺼PWᳬP( P* pp aتP! `P(pp AfRp:TX ,48Na,ЍO-tMP .@$hO`P @ .P [$P< @  R(`d` ``<<A `u @0H0 ```冄 THTτ1`$P>JP (]P7 P Pa(P!p PP* p`@p@@b"%dhR"p%Pp Fl: @0 8@5Ph  p hl@ 4 h۲ lhֲ`o `tЍ///// O-lMP pP4` Gp Gp G0Pp`@W@R $0 000@ pPp0Q  pTP `*."@?:D  P:R ,0ST0 S Qp 4 .@lЍO  a @ .@P r $,4`X( ,$PQ ` Q 803/P ,(Q  RR(  (  ,Q  P  B p,P P*4Q4$@`Ga !@?P s!@?P GpP,,(($`P P p X:(4,$($P Q 8p` L03/P LPTP P (` V:(8 0 P1 88`p L03/P HLP  08 < P    R pW:H1/` [*k8q p .@Ѐ@pT 0@t0@pW  0!k , P  0 2p@P@0@ X*S 0pP <W!h0$ [ 51 0 7$P5 X*1h2(0 S&*1c20@00@WP,  QP@p`A R80s@0p @X0p0pP0@WPZu$4p W!*!P: 0` f<g [$0`p@Q@`V0 @Q@0@P [#* 0P` A<Y0px /p0S P  2p@@0X0@P0` PN0 @ Dp @P@0@ ? P<0,p@(W :Q*Aa^p q P rPU  P$0 00W* ^ 0@PP;T!g0 lЍO-EMP`0Ud hlQ `80 R0P pQ0s  BYN pPI ࠍpPV p 7hP0 lpp`pPW:!8phP @T pPp 7h L0 l@3/h @T:PlE oq-A&KQP0㩦PX <H1/TPL HRP h D #X`"PPT\P{  0+ @p8q hh( L0 3/l0@TpTLT PHP0 @p;\ PP\lp0`Y:[6*l 勑kD\p< @  0Pp P L P0PHT `:Pp !Re@`DPR` RP PUY4 .@YlPShpd `0r(@Y0 T`0d H1/0W `PP(PPR$Ph SDX\@& @88P @4p,`pq[m P85 P g\p 08 4 pD @ d`3/PM , tp0 Pp\\PU0U p8 0 0( pp00>/ j< J\P A0l0 , 3/p P\ L03/0 $0 P` (  0P`D @0p :Ud`p@p0T:W P T0Xhq P Dp p @p\`Nd0 S`@ P8q0 lpp0Z: hQ~  0Q00TpP`Q0  d`p ````3/Pl Dp @p00TP d`p  ``3/P p\ t l`0p\,ppX pW08 0pT ``;/ g+ Ad0,0R,P}l 03/hp l L0 3/LpHpP`T P0j9Ud`t l`V|*Pp L0 3/Pe l 0`06/PI  PTp0 RP`0  d`p `PP3/P  0`D P@ P  TP d`p6/P t0p p 7/PQ P Pyh@hP lpdP8X Qe`g8p_ 0\ QW PT@@ Q P L03/P  ! #"+ P U: XPT08( @@B`  @- h@ @0@PЍG-(MPp`W/ ㊠PYI 0`0S[!0"C;( 0 00 z@v:{ᜢ (ЍG/X RTpLHP0@T  @pPd(Ѝ p/ @D Ѝp@]/H-ML/H  @Q0.@ h> @-@ @0@ЍA-M@P/ .@Q w@ 6P* .@P i@ 5P/ P.@P P@ 5P{ .@p00 @`CPU PUM pW@h .@ 00A<p8`V 4`V HWQWDc .`@N0A8&04QU 0QU }WE< G 00@  # ! @3NC0$ xP  0P05/-! @P0N@ ``0` `PPPpW XpW,`! VB# ! @$0`P"` PЍH-!RUV 0%S S S80S00 80S0$180S 0|1S 00000 RT $ V7!@! @0@mqH-8QT $ V7!@! @0@mc0H-` .@.@P0D .@@Q QQ   Qa/PU000H-@$P xQ R1/0HTR$ Q:PxJ$P U:H-0M@$P L0 3/P* UO  .@0S0A`0  BR ( .@pWpA`p'`&p  BR @! 0! 0ЍH-0Mp$@`P L03/P $ 803/P $ 0 `Pp7/0Ѝ/H--xM{ @PP` .p@ ϊ@ϊ4$@p@?  ϊ ϊ,⏊`ϼL$,P a㞭@|xЍp@-0M`@8PP Pc$ 0! @P 1/$ 0 x`   06/U U & @# ! @0!@ 0ЍpH-0MPUJ@$p0 x` 0  6/ !@ P xV xP@!0Ѝ0H-Pw@@ 3P i@ 3P# P@ 3P- !@ 3P. ) !@ ὎P0}# !@ ᳎PP @  !@ ᧎PP 4!00B !@ ᖎP 0P   !@0኎P0O-M-MM,pZO-.@P \ 〃 .P@.@P 㛜PyrP D .P@.@P ㋜P\ 㤳 .P@.@P H}PkrP .P@P  o P.@Sr .@(c M.`@d# 0P. @@HC Π.@@Hppp PPX        # . @0 0`00p0 p x` # . @P .@PP0PonppK.@, ϊ,⏊ ϊ `G R @ @0H@pyvp' @phN 5rvP .@$P 0 .@P |QMPPPލڍЍO-M-M0d .`@Q|@.@T  P$P |Q1/$Q}P}QAT !@ .@Pu PC p.@@o  !Qb  i( RU  80 0S N(" 0! @0 .@PU  F2P QU}QU-`T!.P@.}ϊ( )<,L+ "G+0 .@P a/b㛗b+Y [ 0d .`@P }AQ  Q  Qa/@TY@T  0 .@X Pp k0` )!a `R `40@ 0 8儁Xs$Pl  @ P`8 U5*L0 3/P+ &P# _[%  kQ$!   8 @ V P `0$`1/``$PPV, @P P L03/P P _[  kQ  @ 8 @  PU:@|  Z .@P H | .@h0pxtlh ( P.@| \XT0@T d@`@ .@P  | .@@0H .@4,PD@0, L@<@8@ .@P d .@| (0$ y|!0"( @00 } \@ .@00QARQݍЍ!.@Q/Ѵ!/O-Maa8@P fdffDggXhhiQ|Q ( 0" !@ߍOPxpW  R/ 07/P- L03/xPPR 0_Y}  `0 p@; $pR " !@P;   P!@IP!"A P`Ip,!@@h!P RP,1U A  0UP @P 0IP4d% <! @@D$ L0/3/P0T" P  ^ I!@ޤ `.P pP uPIPHRHQP r% I! @ 0@T" @pRo!@P   P8p@T 0x 0SU #_Rz% ! @*R/"IPI`x/ 0! @ 0_Y} @ 0; p@ $pIR !@ ` @lRo$ "@d` "` I  c~Q~`48ѕ00PS `_9% ! @ 0$ R FU Ro @  F!@ $ 0 _Y} @ 0; p@ $pR R/!@0&@~ @w@@.~I  I ߍ.@/O-MMp0 .@`@.@T! P|P $P 1/P $ R  0P1/P 1/P|QAT p.@$`P S 4C.P@~`@ P %  ! @0 -4 @P  !@  !@ 0 !@ pPQ+ XQ(0 LPPTq P0xp `` `7/ .@ PT0 0xp0PS H0.P@ `7/@ Ἦ,! Y+ !@㴮pPPQXQ( 0 PPTq 0xP `` `5/ .@ PT0 0xP0H0 `5/@ ᄮ .@,p! W~  0 $9 !@rT !@n/!@jbS 4.P@l !@ 0P   !@0 P  !@ P   !@ P `NZ .@P_ s † D`.p@!@D@uP <  0P@ PЈP P$PH`YV( 4@0xP  5/ 8 B$0xP0 05/ !@0<  墈P!@Y <P.@P  !@ .@P  O@p.@㐟 HP`  P[  0x BQP !#RN0`(@@`30Q -  P!@\H !@ UP3c 3!@" " 8`@T0`4@ !(0S k' ! @㠿C" !,0S r' ! @㒿C" !Cn00S y' ! @ヿ"0 3 !@0 P0(`Cpp  R' 0,0y0,! @Pn0W"' y0! @\Pn0H"*<( 0@! @(P@06"' y0! @lPn0'"r*P '! @0 "`0@*P 4) ! @0C"N4@CP0S ' ! @">T0S' ! @"0X0S ' ! @׾""`0S ' ! @ɾ"d0S' ! @㻾"h0S ' ! @㭾"' ! @㠾"0吟   !@0),00pWx`!Sp (@0`` @ p HV0`   08Sa`a0` R(@  R   Qx .@P D C~30.@@,QP 0 (@.@`VG $ Q@  L0 3/P @HXP$ Z:* q ) P/P )/D .@ @ )  +P{0P ,0` )@,)TaV{_ 0D 4.@P,PY 0`x A)"  ! @0@) c1 @PY @ P [ !@0 d(@D .@P,00448!0e !@JDc  .`@  !@:P (@D .@(@@TC@Q 1 1Q Io00FF9 !@ $PQ <O.@.@@P PP"<P.@P   !@A  (@4 !@=<@.@@P  4 !@4PP   !@,ߍۍP@-@s .@P@ P!@ @Ѕp@-MP' @$PP# 0PP `HP L0 5/PP !.@$QH`R UPPЍpH-8MP8PFP @ AT A4 @06 P2 $q4$Q wP `P``V Q  ɭP B  D P  S <.@|8ЍT $ V7!@! @0@mᕁG-Mp8Q P `Y A A4 @P bP $A1/Q  01/P P1/P$QPH1/P򘀍@ @ W A A*$"@ 803/P<0S  3/ !`0````X@ 3/Pm d 0 H3/pc h L03/e @ᥬ  p㦸ậ PA @` L03/P |Qxp `V:W$:P" @`p L03/P  |Q h l0"#v` pW:v```,  [.@|ЍT $ V7!@! @0@m᳀T $ V7!@! @0@᪀p@-@`QP <PpP^.@p  @D "T pp@諔O-$M\+& 0 p@`!@.@\ 0 PU PPU 0P 0`傻PU +)P Q` V$ЍOU`$ЍH-M"`A/. @P8@Q`V P {xpP q< .@.@`P   !@!@PPq|ttԅ(tDhad -.@ @P<$*@ @0@ PH L/.@P @>P@@-h@ P @0@9:( 3 .@ 0@043  @  @0@ $  7 .@ 0@06   @ %  @0@# 0} . @000 * < p@p@ @0@PЍO-MP@  `p2f1 8 00  Q7` RQ`V, P&$pW Q 0"  Sp @PF'@au"@8  `@Ѝ uK-MQR@h4Ld|dw` (! !@ " p!@PPP XP 0 ,p! WBw` ! !@ y" p!@PPPXP  l0 h,p! W  @܍Pw$0 "Pw 0Pw 0 Pw 0 Pw 0 Pv 0Pv 0 !@܍KK-HMH`(@@PDPpu 0 0(@ 0k QL b@瀋܋( P.@Pf7 .@ fP/D fDPP$U' P{"!n@ b@b@PPb @0&p[- @~P 0p ]ypNPWHЍO-4M@Q> `PpPP TL0 3/P X o 0P 0r000"P,`! VU $@Q:P P+E⚠+Pd# @. @PJ4ЍH-P 0  0$ AL G-(M.@-p`W Dp"@@Pv$PpGP wppV焎P؏X@u0 @u`QP .. @ 0S$:#  @иp@`@u`Qu g!@0XP  Qu+ 0 @㮸p@> P P$1[- @㞸p@. P P(1[- @㎸p@ P P,1[- @~p@ P P01[- @np@xu0  g!@B(ЍK-MP P@ ,T| P " 0 ```*x /P @ @$! @04#@/QPPePo_PP[ 0.@,!< !0PMPoGPPC o > PP: P7"Io PP0 P-#Jo PP& P#Ko PP P%n0p[- @ַP 0p wLPWPPލ@-@Q f#P p i(# @. @PUX @-@C 4 `I @ 48<PG-M^P`t XVL`ܔ4@p"Q `@!P@P   8p@T@/&#@kt 0#(0S[-  @Q@1,0S[-  @F@2 00S$ ! @;@3Ft 0 !@܍K-JMHP(@@pu 0 0(@ 0ehQ  5b(@(@tdP+P)P  0Pv6b,@7b0@0)p[- @P 0p vKPWPPJߍO-4M`p8` P`f`AP $$ L0 3/P`8@ V V 4Ѝ@-@P$ 0 @\ @4( , EQ"d b !@@A-BM@^P`s P V砘`ęH9@ss 0p:@ls   !@7w;@as`0g@[s`4a=@Us8P`!P^MsP !@ 0XX0Sa( @0@>8A@8s`d>?@2s \0!@/`0S$ ! @@ h0S[- @ @Bl0S[- @@C p0Sa( @@s 0 !@ E@rt`Qr 0!@ BߍK-MP Pe@IbXp4P, $P FP 0.@,!< G0>0Po084Po42P8 P 0u%dPodJb\pKb`pohpMblp0[- @}P 0  \uoJPWލpP PptPotPP P@-@ Q Q p@-@` `Pt` F`@pEQ"d b !@p@蚗p@-@MP@.@P JDP R ,@! po.`@P  TX0P @ЍpG-Ml.@@?X0,@gP pW pW (pArr` rePq @ ,0Ru0U 0 00   fp paSflPJP`,吁!(Q !C A ,R㐁   ލO- p㋺ !@!@P3 DP  8⎏880p W P p 8 P!@p 8!@ pu @  `.`V 0  UPGߍۍO-_MMP .@P  P!@ lu@P _ߍۍ.@+ Z`! @0t@PHㆃP LDh @@(PepaPd `T 0,@$yl<YO8`@p4PpHL\Pe`rPH P [ [) [TP+T ``0\ WP \&eXePP " !@   PX  =P d! 0  2" `T`p  eP @P @ P @ P \P @ęPd^ @ $ H48@W$,L 0 HPp?eP"@ X\㵂HPL9 Y0 PD` T0T0`PP0XԐ4\<8P zT0P<< <R 00p @ePd HLPp <@84,0DP<h 48@<80p@啄0`v?(E#_/`;Dk W/ ,0`0 R 4P @  PPϬPQ088P`8pZ0W P៬P0O@w,0|d[/`L 0plMP<tt~Ppql0 [/ `M`P(x\% Dp0X  !`Ъ040 0#8@ 0#  R `xp W: LD@)q + ; !@! @!0@oq + ; !@! @!0@oK-8MP* +`P! H㤁P @`"@\`Xp`jY80!!!1PppW@ ``8 p<0$ 8Ѝq + <!@! @"0@o/ /H-0`@V PpDRP MP `pV@p@-P 0P@U  ⹴刃`元VP倃p@}q + < !@! @!0@So@-  @!@s@A-o.@.`@p@W P^\#@ @P (  婂PsfP,0 @x@嘩 F P Ѝ0q ( ?!@! @0@gnH-oP.`@P @!@U P`V.@p P `VU TP(\$7 P0X 0P 00 `@d`T 0 Pp U TP(\$0Qz:04Ѝp@-@P b`0Q FQ g ` @,pO-MPU 004 p @X @@p@ > @PU# 0 4 `X `8T 0`8@D` `X`@0`4p`ZpP@p`Zp P0p8`Ѐ`P` p`ZpP[ e  PpPppWPS ЍO-EM8aV) - @#Td"@p@!P@ P  / `*pV * 0!@gpoEߍA-M ?+ ! @oP- @l "@YoP @`P 0@y\|`P@ p@mP  0 IPBᕀ@ЍK-MP`@S  b !@0PL i !@*PL o !@$PT u !@P6 } !@P6  !@P<  !@ P4 @mP. dp` @"@P q P@P@@PP m`P 0@( 8@ ЍD` ЍK (P )PP O-LM4p sP㴐`8  000<0尔,`dDEF$Dg<@"`@ P P 'Z48 p+lPDg<@p"`@P P p'W48 pFGI0H 8$ @Jp4800 p,pK`$` 左LЍG-8MPPPP( 0p @c2P  0p P`8Ѝ(  0  00i @@ p`: P 0 QQ1"2(pDgp"`@@P p'W d I(. 0rp 0O-lMP# D8,p"@@P0  @ ` @ @` ``8  :/p'WlЍ0H-MP .@0!481C !@c  0PJ C !@usd  0H@T 0 4/ᑿЍ0O- M .@ .0LQHA04q8aiTU @ QW X ?V p ?`\p`  0 ЍO/ ЍO-\M RZ d[} @ p@0P ᱥ P0~f:`@>P[M P @@0P ឥ P0kf:p@P @.@P HL0Pd!0 PU@P? 0 0$%PX@! `5/p`\Ѝ@-@.@@P 0H-P@.P@Q Q0 T.@ D 0"QP!@ RUR00H-@P *p- 02 D"@H. - V7!@! @0@i0H-P.@@P  T.@ T TEU P *\"@0T T00|00H-MP.@@P  VkPPT aP # . @QQ Ѝ0QЍ0H  .@Q/^ /0p  @ S :H-M "0 @ ЍH /H-M L#0 @ Ѝ#0 @ 0H-0MB"0T00    000#P0Ѝ0H-M0 ,$  @ 0 ЍH-M00 $  @$P ЍH-M0 $  @ 0 ЍH-M t%  @ 0 ЍO-WMMXPp  @0`p @P |%$0 @ P$`VWߍۍ刵P AP*[S # ! @xQ@[q Z' ! @p0P QH㈠ 娰X\`@dPp{  7) ! @0@0 @;@@PJy LPdFpDw  $`刵P 5- I= !@! @!0@h  &(`(P@ L03/P X( \,0"# #" 0@ T:$` )! @ 0᭣@o0 0xp 7/@`p@-M4  ?0PBT T TT bRPU 0 Q T TT @0  A PCЍpO-R R@>  pTЍO-tM8^PR  4.@0@ SD0AQ0R^a !@L0` p@SY PPTTT  rp 0`:T 0WS 0.P@,0Q0)0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^tЍQ @ P`P ` `P`  T.^Y:^ q110`2plppS 0 pl  40p0 PJlPU4PU8<`Y,P  Q Y  0Q0p 8 .@< @0RD AQ 0pS  0.@@ SD0AQ0R  .@@RD @P QbB`0Dp  W T `V@`8@<`@D 40 P8PP! "A8 PQ o PQ fyP @9 0@ `p0p @Q Q< `V@ & @0D (  T, @% @0DP$00(PP0Q01Q U, $0Y"  PP (PP^ P $040vP 00U* /O "U@@% P $ (0ER@P@D"840 P"5 P`V PV xmgB0PD 0Q  0U @P$ (0 `,0 V R8<V@D408 PPU PU x3 Y P W SvPb U r@@"800P`V PV nx 5 0 D0pP T" PpPP PH` R V R RR Q p`@VP 0S`@ =. J> !@! @!0@dOP$xPUx4 R4 .@A-8R4`U @ x@TxRP2" @ @ @ @/A-(Mp@`P  B0 H@* @`&PP  "0P 0`0oߍۍЍ / ? !@! @!0@ !b / 5!@! @"0@b / V7!@! @0@bO-M-CMPOsP> hdpt@lVpY`? " .0`B4@ f0 ;PJ,dPD(p` Pp@{V$` P PP P! PPP P`p !R RR)0RH " ?0 ,0O@:@B R R R (0"r" " 0 YRX $@ PC;sP T `p W  ,, Ƈp oP" @ g ,峇 pP,| =u `  WU PO `,V (pOP+uPU&u(pXJ)=z&  P4"P/0 L03/PDP%  .@@RD @P Q1/U P @ @ @ @tpCލЍ (p, / ; !@! @!0@`K-8M:rP1 @@ X`"@\PVp pPW p`V?0",.20 $R`p  P 0τa@8Ѝ / ; !@! @!0@9f`O-TM$H0$P L0aPHJ0H L`P4P000 4<($D @0JP.J(?< PP,(ŇO,t'C#u( p;)@0O!!D0C/R" @T#"p^    0zP'"X$! `VQYu  吵" ?@ .@p?`HL Q pWp  ~ 0{L?#"*P%"S ' H0$ 0PJPPL 4p?#"00 H ! `V Q @TЍ/p@-8MPQ2 .@ "d@A`y p ; P5  L03/P- ''+ "+p U3CUE0 0@3CC #1@ 0 0A""` #1 11@"" &<",R*" P&08ЍpO-M4@pPo? FFPP Z QPکPW   pP a !@P JzPP PBPTW ЍG-4pq=pW .@PT \ &0 ?@`RU U UU R, @"0R Y-WӅP  GP:YW mP?6"R 22  G4+O-MMPQ {T4AnpPH 县 @P w  ;㔷pp  t <@XpZw :0P 1/ BT _`r`V|rOPxrPUsr qrЍۍ < !@! @!0@kD^H-MM@0P 1/ ;>p `PpP p :DrK:zЍۍO-MC p.@@.@㸙("@ Q9" @04`'` . @pG0w@0P@PЍQ Q R8 /Q/ AR/1Q/Q//@-@.@P T .@Q @K-Mฃ .@( Q@4`" @ 0ӘsU p- 0! @(@ɘ  .@.@ p0@@p@@ЍK-M4 `㾁RAT V* T`TY pP@T U T TT V `PpUT ^ 0 08Q 4PU* pRUUO`n`Vn4WRU PP  4 W @@P# !@O`yn`VtnO-M@㾁p_`EfPP V QPکP"0@XKQ RY  "(  `FpvPP P[Ѝ @- P0r0222R0+080@ R  @ Q" / ? !@! @!0@Yp@-O@@T  @P`QP?@A@p@P`QP?@A@ @ 0$b #b QpO-KM`PT.@@ t .@!@@/p@ pPePfP lP zP<bP eP !@ 0,'. @K @ 0 p<(@pW@T  s5p @ i> ZC XAT? ) F!@ #* @ӫP4 !@N 6 P)   P% '. @`p@ [PI $ '. @pS !@!p+m@Z2 I6pw !@ pʁ !@ P(5 5$5(5 +!@ @0P  !@$ 5$4(40.@ '(@SX. @gS.`@fpF/@@PhDD6p.@P gP !@pI5p !@pʴ !@$ZA5$4(4   !@4 @  4p@P# P( [4pʊQ P 0@T }P t !@dm !@(s4^OY ` P$Q00P0Q0v 1RP V V > -;lP ᕑ@-M@0Y @  (@!@ ႑H- 5 H4@-H(@@pR4.@P@o O-M-RMgwp.`@.p@.@W.P@&5 e J 5 1$AS(aP@V.@ @@@U* k@ Jg.`@P\ y Y5 Pp@4@0@ 8@ ` EH4P. A@0@@: PP.p@ @ @ 4@+4@08@ ` @ E"4P" mP w .p@0S +  @s.@`PV; 1 A ᠋!0 A $ k @  _ dUdP0R`.@Q-pAP pG WE+ `" @ $ @PY @2?G k/ @`TP@p:0 6@ uP[p!E:R :Wp| $ "@k @ P @P.@(A 1$q@DS G -T=IB PpJ 1 A.@㡋0 P @ڃ0 A 0 Q*P @ :0 %Pkp!% :S0:  @` &ed|<a "%"0@$ 1 @!e 0少P.@ R5.@pX(@% R!:Z% e @ Y@.@ R`0 A@1F@ p zW% e @sPY,e @kP.@ P 32RߍЍc PaI* ! e! @PvP% @?eGvQP%.ra(/Ob"(r0r 27"cA % @qe0P.AH-0M0P  B ,PC0Ѝ@-@@H- M  ` A2 ЍG-RS PP7Q ` p@!@: `T 0@`P: A-M`@P@1 sP@(p@P P:PUPP#-P  U   TP V  q`@P@ЍH-`@1Pp  p1P1U7Pp@-P @v1p  `L1@1pp@-M@ 2p D@ЍK-`P* pP  @P pA P0 p@p R R  R@R R #R;RPPr "R#R \R! R  PH-MMa !@"pQЍۍp/H-M`P@R   `P2 pT1Ѝ0H-@  0P  PU P R hhP  R hhPU0HhO-MMRR @P T k p`P H`Vp@U,  0p x !@SP #P,T P$ P U p PFP@ R@ !@ kf !@e7 !@x !@0Ѝۍlp@-@$`PbP 0" 000` Pppp@-M>P`@+p& 47 0@@p  !@!@ 1p D7 0@@p  !@!@ЍpO-lM `KPo2p, @ p <1  1p I0p hP j1h" <0p 0p [ 1 4 / 1 lЍ - 0 z0 v0H-@P q y/PpPPq i/1p000H-P@@0p@P@0p@-pM`0 @p P  z/p @w/pЍpK-Mp@` Pp% jY " @!@T!  !@! @T X p  8# @W @W T @ ! ! @h04ЍG-MMQ07QPp@ ` VPZp` .ЍۍH-MR @P`P pW  R: QpP 5dpP.pP  QQ* eP  P  p0    x; 0@Pp@0ffЍA-MM@P  !@!@ {P3`   [.p, P ` `Px; 0@ @p 2 !@!@4l #V.P pG !@%` P \9P ( 2 !@!@V _Ѝۍp@-xMP`@S   !@!@ j  @.p3  `..p'  (.p!  ".p  .p  P !x; 0@ p  !@!@ !@. !@xЍpp@- % P  @ DZj$$ kTPV  Qp$P%Q%pH-8q%@P :&yP 4P P =U e0A-(MpP@#`r6LP$pP< V} P  - !@!@U PP tPQ` \6tP 8P P a( !@\D PR DH!v ,  @,(ЍAa P? P<PP@P 6P P !@L'k !@(ЍAa, !@ !@Y,( !@DP $P  xpP  !@U(ЍA (ЍAc@-M@tQ0$1p  !@j} !@ЍH-MP@@plP? + 0 - +;P  0 ` Z !@>xP @P RP 0 0 R !@^ PBTP HЍB !@ЍH@-M@pP Q ? pP t 0^ !@Ѝ@-M@ P ЍHD  P Ѝ@#@-@: !@+PP PN@LP,(  P @!@@r+p@-@`LPp ʸ@P$  P: @!$@P p !@A kp !@p@K-M@q ' ` 0 p5P5 PP4 p x P7 @ P  !@9> > >$Q$I **mExP @ P f !@!} !@YPM L !@_Lp8pB@ Q   x@ Rpx  !@DH!@@ *@pV m PBQ   PVb x!pЍH-P@`  !@pp@k@RBH U!@P* 0P P:H O-MM`0 1+p   !@!@ !@ӽ@PbA+)` p!@Y, !@v7P  PP@ `Y , !@\!`1 2PP PxP `@P  T`V+ @P xP h00@x` xQ@ DH!00@ `* `VaxPx  x  !@AЍۍ@-@ xP$ L@@-@$@EA-@Mp@PR `P V :W7 +A @!@@ЍAP"R P U !@0r>pWU% * !P P `*<0 $ p  !@ <0  !@X>P * @ЍH-M@`8!QQ Q.Q@ Q -PnЍH Qg , (pa(  !@!@ЍHQ, Q< Qe  % !@!@! @l0 QJ QW " *% !@!@! @^@p;8 !@ЍH  $ !@!@! @N 0P  ' !@!@! @C8D!\H1Bg  $ !@!@! @1 P0x.p@P  j Ѝ  % !@!@! @x@T e@@ !@ЍHDp@-M@ 0PЍpD1`H y8!@ 0P0@0@00@P 080 P  090 00  Ѝp@O- MxpWI 0@ [ P ` PP PY P [ U0 PP( @` !@_(  G@  0? U    2DQpW ЍK-xP `PdPp88PxPU!  P X `@;P @@WX m&p4  PU  D&P&xPU P X `@P @@WX @&p P88`88`ЍDP Xx`@T !@  0F`  0`xF PX@-@ P@  P @;O-M`PP4`0` @ !@P u !@P) 8p*N[ 8(@!@h0,d4b%pa %p[ %p h `@Q&kNO }0!@!@"p@ @   03v?PMPpb 4P- 6PN@Qf@ Q&d`___(aHa__`a__xa/@h`_`___aaa !@xP !@O`kxG]/@ڜx !@  !@`f<(@,@EP 9 xE 8‑E|Q 0p,P? 8 0&P>pWO6 !@P8@ d 0p P 8 0#PsHI !@ 8 4,u !@pu !@  * %Pu !@ !@"@ Z !@}@ @ `W 00D:* @Qf Y= <& 8 0@! @+00千 @0 00R00Ia !@V%pV !@!@< Pb `2"@0@ krwpT P 8rpP: !@ `J$P OP8% 0 R/q ,8 p@2@T% `P!" p !@Y-  @ @0pP 8 P @<& 8! @+ @c !@r !@!@``< @ p@,@ 89p !@!@ 84 P Q R000 # [8BP [$[8P[3 I(@P [ P@1 !@P @dp x[ (@X[ 8ߍ, m#p( !@!@[ ,pR/,pP/p,: @ !@ 8p AP !@ 8 0p 50@ p 5,0@ pp !@J !@GVV  !@8 @GP  !@!@ @=Q P0 3 P, @ .6 z!@t$p #P E 6' !@!@! @S !@c$p P E S' !@!@! @8rP p*c 8 !@!@ !@  @8ZP   !@!@$0S p P p<J  @x 8 !@+`Pp 8p `ET"@$(d"d18 0@ "p !@!@m1#p P p @,@* !@($ Ad!"d18 0@ p !@!@F P|  !@Oxp !@Y ( $8 @! @ !0@ 0N"@8pp^ +&p> !@20@ pp !@!@ !1R84 P= @P] P Pr !@Z !@@!Tp,@W  0S) QP @ !@8i !@+ !@ !@J !@ !@t# !@h @!pW @ P  @@pW! @8P4` p4p@8*`V p P yjPp`V' !0 S `V0 00@ W!63 R  10@P. !@88  @T YP@ P  0@@Tcp,@ pn !@^"0H-@r!@U!p P1"p/ !@0H\!r@!@0H@-M@^p ttdP :7 !@Ѝ@10@d @Ѝ0H-M@   !@!@, !P p !@<,,!,Ѝ0R  !@!@0  !@!@Ѝ0H<PЍ0HU !@b@-@Q    !@!@-p 7P  P@VPP !@@O-M@PP`Р,(p @R ` `0 P    !  !@D( !@8 P P @ P@Ѝ0H-@LP PPrXLPLPlXPTP PXaXTPTX[XXdP PhPXdPdhJXhRU P 2 ,PPR8XlRU0pP  p,PPplR&Xl0@-@M !@@@-M@Q   d !@!@b p PQ 60@ @ppЍ d !@!@Ѝ@d !@Ѝ@p@-M@Q   u !@!@] p" `PPJ|WRP| 7 !0@ @1pЍp u !@!@Ѝp@y7``u !@sЍp@p@-M@Q    !@!@r_? BPP p  !@UЍp@j!Q| A0S|l(`@XPP `P@` XX  P 60@ @p Ѝp  !@!@Ѝp@p@-@>P PR b_ `L0p`> *>@pH-M@pP tqe9/ P! @*(P pPpVP 9 @!@CQP g !@CM 9/ !@! @U9 >pQ; `l!R pP 0P0  9 !@.'p g !@!@lP >P p *P> {>)VptqЍp !@lx`V >P`lP  !@\>P p *`> P>p@ !@F/K-PH S` X ! R0 !@! @!0@RZBqp@u,PU Q P P Q   PPP  U Pp@ `崑U ! D0 !@! @!0@GBH-P q R 0S +( U B  o D0 !@! @!0@AA-@_0ϑ@`\```3puVp 0H| p CSRH-M\J C\ 0ЍG-PM PUS @ CSV*$`(pW P P p0pW P 4 OpPP# SP( `P Q   Q,p,ppp, D0 !@! @!0@WA 0 !@! @!0@NA 0 !@! @!0@EAH-M0Ѝ@-M@bA̎.à.b@@ 0{Ѝp@-P" (^ @PQ`V`V ^R`V`^`,``4`PP4P p D0 !@! @!0@@H-P PT  D0 !@! @!0@)@H-PT D0 !@! @!0@@//H-P8 D0 !@! @!0@@G-(M@ "@ `T+ @+8 <PpQ G `P8@?P:<"1`V: Pp <PP A p `8 Fp <pW:P(Ѝ v& D0 !@! @!0@Y|@.@ R/ 00.@/0H-XSR@P Pp @P0@4(@, @@@sT0 Mp@- MPO `@V P`q QPpQ   p S@ETHBTU HLP Q   3T Q ,  *T(PQ 4  T0PV Ѝp@ Ѝ/@-@@TO-MP @TP.@P.@P @ @R D2/(`V P P J `P  Qp   `UVPP/ pLP*H P% HLpH R 0s qpp 0P   0Q0000P0  Q UP H0 fP*y7P3 8pW/ `VPTPP P  `F  Q 2/V pWP,1/4P`4`TP\ PЍ\` ( D0 !@! @!0@-?G-M l @O P/p@P@@@30r`T`0@ 0N j kCs T0  0(PU @F`pPp*` ` p@W*P p@ pG PU h LЍMH-M  0 ЍHЍ/G-AMx`(p@@Pp `k 0yp$  VV@ V (@㰀 @ Dc{ A   [AލMH-M  0 ЍHЍ/G-M@P` p 0yJ[+0 @ pۍ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    fЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    HЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    *ЍH Ѝ/(@/p(@/ZA-MM P$`p @ PPP  h(`@  @`Ѝۍ(@/@-H@(@@Z@Zp@-@f h(@(`@ ;P㚵  ` ` ZT VPpZP/@-@6DDu@Q0H-@"Pp ! p ! PpP0@-@q Vp @#A-M P`@p  F㐀H Pp !vw? PP 0pPЍ$ /L r /Q@ !/p@-XM>PU U774V*T @`@Q T TPUA @@P> <0@  !@> "P> *@XЍp@-@TB@A-M`V @P P  nP Q  R0 p B`VЍ SQ/S @-@TB@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB 20^0R030O-aM0@p`F @JPu P!pr XZq  NRRp P$ PP eP ZW@T  P @X @P @X@Tx  T@P(Y PX P TP UT\X @` P \@T\X,LP P P L[LD, o U( Q P[PPP7"P ( !@ PR$R$PLPI (MP @` ,P PU$- 0 @  pp  @0 DL+pA@ 0@S0,PCP !6SR S2 @,PWMP3RdP @h lP d@TX!P( T !@P,PSʇCP%:S!S SU(PT !@P U P(@  T!@XT@,PP ฒ*> @RU q p @ !H ?!pHP}H P! P 00L  !@ _ PN !@R @OPaߍN !@ PA- MP`P` Ѝ@ P P P*:P `  ]p8W p`8  P (@ !00:P PPA`p ``00Q` iP.P  ` ``Q40H-M P@  [~L 0pЍ0H-@MP @P`R gp `V pT P P `V[`@Ѝ xQ/$ /H- M@0 P:`V 0 PpPP `P`V R: R #0xP Q  Ѝp@-@ N PP ` `,PV:PM(`$PP` ` (`,PV:$PM$(pO-G- ]@p`"P@\P `mV? !@ QZ 0  G @GiQ/K-PBxP Q @K@QKP Q @vK@QpKx@P@TF + cKaK_K,(VP K,,PP,(VQK40VP =4,PP40VCK<8VP /<,PP<8V5KD@VP !D,PPD@V'K %K K"K` P T PT@PH-@ D0\  %Dq@ ": 90+Q+\!Q 0\ RHrO0 O-MS p<PQ`(@@  @0N"@%  @! @!@ 0 Mcp 0/@ P @@0Up  @ `p` ЍO-4M1C@P+`   x `0\PX琮ȮԮd ((ԱH(((ijx(($\hԵ(,(Ķ$|t(XDxغ(\hxԻ @d||hxȼ $0,8DT`Ŀtdd\ | !@\  !@!= !@O \| , pP @@,Pu PDP & ! @0@pC IQ \ t !@ @YP  !@SP k @MP P pGP_ pt\ ^ @ @2P "@,P  !@&Po  !@ P\ ( !@ro\c @ 0p[^ !@^[ XU\ ?X\@rR 0@  P0 0 P P  0 PW  !@\ ?OX0\VrB 0 o P 0 \ =@ P; PQ1  p Q QbQ_,0 Pj @P/P< 0@P <, @!0 <,0 PM @Pd/P4 08P 4, 8!0 4 \N XU z X\@ (@P @H 0P `p @P BP  0ApPxH@\ C  u\l 8@ 0P p  !@!@\^ @ 0pV !@\ @Py @և@`r?\  @ PPv 0@ E_0QW $ !@2\ 0!   @ 0 RB C !@\ ?9X\VBr 0 Y PP 0N Pp  P`@PwP \P  \h 0@  P ^0 R _ !@R4 0!A P p !@\C , @cP PpP W  04$ 0 0@ 0@,0Pf  !@\ 4R R 04S 6R 6R R 0 R R RC\ 0@  P f^0 Rx  !@\ nPS Ph\f ,P@``VP" P PF PD HNP/ DV, !DHPB  P PP:`\ L @FᒆPL. !@\ ?&X&`\6p @@pJP P9, !@8 3   P0  +  \R  \G :z wU !@:\XlhPU ${\) P ($\ tg$qxx"  \ @ >P h\  V|\ ?xX\VpBr 0  P 0 P 0 0 PR  !@Kdf$\ X@```VPS P P0F@  P ]0P  !@`VP P PF : PP p0p! pp p\0Q  !@d"\Y @ 0p 4@\@ 0@  P \0 R Y !@*\* 0@  P \0 R r !@\ 0@  P \0 R !@4 !@/j lQ  Q QQ !@PQw Q Q@@@Qp  Q QQh=P p0    @ =\0 RI  0XPhPC @ P  ;1 !@^4O-4*4 40@ 4! S !@ !@ /@ pPP /PP RU /@Pe F@P]? !@U !@Oh@PL !@I !@.P !@< Pp Px  @mLP@  !@fLP @`3 !@]LP @WLP @QLPV X !@KLP c !@DLP P @>LP  !@8LP2  @2LPP o !@+LP - !@%LP 4 !@LP : !@LP B !@LP I !@ LP Q !@LP  @LP  !@KP  !@KP !@KP y !@KQP@P@  !@KP & !@KP  !@KP  !@KP  !@KP 8@KP}  !@Vz Pw P PVp Pm P P^1@e@@ p4TP< !@UQ !@zQ !@K@@ !@L| !@ !@ETP"U !@7  @0p 4P@Z !@ &PL f !@ PV s !@ Pp  !@ PL  !@ PE  !@ P>  !@ P7  !@ P  !@ pPi  !@ Pb  !@ P Bo" U<  P@@P,U  U @*`;TPk !@3H, p4P{Y: 7U  @P@W '@TPW P PDQ  Q QQPw@@ P PPPk P Pc@B !@ PrP < !@lP !@fP !c!cT` J !@XP O !@RPq`lB  Pp4@ 0)Ap P @4; @@ P PPY @P P P !@6@4Ѝr!@P@ P PlP3\45,0@ @5 0@ 50@4m`D !@gPq P PDR@,0 p$ ( Pp D bP ,@ 0 8( pP B  P DpP@U@W@`DPK P PDi`D=U 0D 0@  ` X0,Q  !@U3 , H@p_ P[ 0@P08, KP B  7P P PD&S1 !@iB P$ !@*PP P@PX@@U@@U@@[ \WW\\V  Q PP !@P  P @@  !@ C  W !@T `Q  Q Q Q@ !@`@Q Q Q@@HP ᯀ@P[@P $$ Q` 0S0S  ,`QRV, ,`)P P$ & @ !@@~ W  @ P@ d8`0H\pP @ `P`O- MP`p[@"Py"PP p U [VQ UP X` *`VU\P @mPsPnP: rPXUZ VUPUPS 0P/ bPIUK GtP? xPA(@ p 0pp  @0  P5 U 3  H.U!   0RP P  pHU P U U P X: PpPPU [7 ЍO-MP`P" =@P" U``V? oP @ PL  A Ѝ !@ЍO  !@!@ <p=|@W PP `VP :P p? qBp ?=P     ?  !@DЍO{?H-MRP`@PUT' ``:/,P p   Q !@pU P W /G`T %-PT`U 6- !@`ЍG-M`P~P"  @r,P!  @~P p FP @ q Z,PPP !@ !@ !@>>ЍK-@M P`@P  A p A A A GP t t ;@ЍG-`p V`1@PGP X FGeZ : J 0Qp00@T*H Q3/K-T`V0 TpW5 @LL Q Pbqp ||PPPP HHPQPQP3PhPPPbY 4+ E; !@! @!0@5* 4+ Y; !@! @!0@,*@-@c#@ng#@@i@-@P@H-Q# P" gPP' @ P` TpPdW`9P  \* : !@! @!0@O) \* j: !@! @!0@>)H-P TP gHrH= * 7< !@! @!0@o)0H-P0@ PP T 0H0@-P @c g@ * : !@! @!0@Y)0H- @P0P= PP00H-P g_ P @7@P 0 !@Y@ * : !@! @!0@uh)H-P QT * M; !@! @!0@cY) * 7< !@! @!0@P)@-P @PT@ * M; !@! @!0@>)@-@P ST@H-T R H * : !@! @!0@)H-P @ c_'P` pTPm#W`p@- MQ @T R% R+ Pco;P PQ* `! @ 0c  Ѝp * 7< !@! @!0@z( * : !@! @!0@( * : !@! @!0@(O-MQS pRY P@ < 8P< WPTk t!`@P ` LP HP U!  !@"U  !@t Y  @!@U   !@ !@   !@  !@  0Ѝ m+ u; !@! @!0@]( m+ 7< !@! @!0@T(O-4M@P$#@d#`@p P  !@!@$8`a2+P $ |b=P ̠$`@  p2T Q c P P T8p !@PPO9PPKFPFTc>|X P)|TTQ88uP5  P' >P P P TT R &YP  !@[8 8>YP XX7PxxQpVP !@vc_ P> Ȱ「 `@!@ p`PP,9PP( PT P    )p {P wP !@4mV [P k @p!`@P YR BpP$_\4ЍQ0Q03Q/A-Q TPp Q @8P @PkG`PG TTQtt PPttvP88qPJ + J "@!@W t  t  @p,P S !@ pP b !@+ J "@!@W @p pP q !@@V T$xxQB !@ @ /, 6< !@! @!0@;w&H-P Q/ , < !@! @!0@;b&H-P Q}/ , < !@! @!0@QM&H-P QQob/ , < !@! @!0@}2&@-P @Q QoBF/ - < !@! @!0@&@-P @Q Q@@oB)/ - < !@! @!0@%H- MP9 @PP 00Po Pa!PU ` eP /`P8x.p@P `P  A AXP` Ѝ +- < !@! @!0@% +- 7= !@! @!0@'%K-PP+@~A#`Tǁ `YiT d8h.`@QP/ O- ]= !@! @!0@nj%H-P Q  \L L/o"1!R01 CR #\ H_ - = !@! @!0@I% - = !@! @!0@i@%H-@PUpEa @WgxUȀep@-Q( PR. `@P P pQ  0p@& 0p@!30+ @`Pp w- = !@! @!0@{$ w- = !@! @!0@_$H-P Q!.  - = !@! @!0@v$ - < !@! @!0@$0H- M #@P @!@@3`Q0O-LMHwpP P0*wpP G6w "@PU L"@@`@?P:!@PU "@PU L"@@`@?P:!@PUpv H 0PvU PH LЍM0H-M  P0 ap @'p@@Ѝ0HЍ/G-R'@PU`  R R* R3 `PPPpV' P* wP a ZpP . B> !@! @!0@$YE R  @T:q . .> !@! @!0@#H-Rp`@PWU L 6,( !@"0@p @0P `p``P QH RU p`0H-P@p 0H0H-@Q pPWP @QVn !`@ ]PP_PU: (@XʽA-M@`PPP]  up+ l p!@ 7P( !R0 q !@0 p PP ` 㲴p8|P  @!@7[ !@3'ЍA + @!@&QU [~ !@!p@` !DqPUЍ P PPQ4S  !@/Q ?0 !@  !@O-M`Q @U U&yzOSP" P;@@.  ! @P !@p  !@}p Y  !@ tp  !@pP,  !@P$ ,  @P  !@P k !@P "@zP } !@tP H !@nPY  !@ 3p P#@! !@)p x;@ 0 PP 0S  !@ p @  !@}p DP Rᘼp @Y   PzV/ @! @   !@pl L* G8)!@!0@Q" @0Q#  !@p[ H 0 !@pT P < !@pM $ J !@pF U !@p= PP tQ0$p ^  !@p*  xP h !@p ;@p#@2x`V& P P   P` !@ !@@ЍK ` @@fp D `R_s !@]p  P `  V  "!  @! @]p T @ ]p  `P$p H !@TP8  !@NP-  !@HP' ,  @BP! "@<P  !@6P| k !@0/ P! @ PPj Pf V@V@ V'  @!@ !@pj   !@pc \%P  !@pX w%P x`V G%P`V  !@p? D@  !@p6 PP 0S N !@ 5p! @ N !@pn !@V' @A-R 0S  P`@!p@ wp 0SH-@P@pP'  `P.P$   @P ?  @}P  !@ jP HE .ㆹP`t`P @H-\@'Q(P@(`A p`pP @P` XXpX \`:`pP @P` XX X \ % !@[  !@[ @[  @["#$% &@'( )*+ ,-./ 0 12 !@., !@+3 !@(9 !@%A !@"H !@P !@W !@b !@ @n !@ !@ x !@  !@ !@ !@O  @i[  !@c[  !@][ w @W[ !@Q[`P@`XX X R\XH  L70@0S /A+ R 0S,0pQ l2 R Q,0 /H-QM`@Pkp % >7 ! @ D ! @ !0@Z` *Q pPE E *Q:ǖ`G  >7 !@! @!0@ZQލO-4M$\(P P(s 00 @ Px G`0`, @@p@PPc  !@ P !@ P@U P PY  P.  wJ,P P @T,P(@$PT= P  ]J,P P @T,P&Y# `P$PX  0X  0G @@Pg P 3 3 4Ѝ 30H- R@T0QPP0.T T Q@ @T Q @@@ PP@Q \0\0O-MSVP` @ Z7*@p` `V2 P@PF V :QE TCYP=@Z7@VC*^p [@ @@H.@ Z:pWA @'*^`^@NY Z:`^ ^ N iVf"`Q V`FЍXU7RO-Mp@Q P@(@`X0y[ PkJQp a Q @YQ% \Y PJ \Y V; WW\pG6V0 WN; 0@pG)  `) P /Y YV W6  0pG)\` V W" pG``(@@ U:@`V W  P P@7@ЍA-PpPW(@ e`0.Wp@0.W`!,W W% W Up\ 0 -W_W  >S0p P pfXp H"pH-M`P @P RpW"PP t-Q0#  !@! @W 0*X-ЍO-,MP0@ \p P(P  0 !@# !@p P P* `p P   0 p! 0! @ !@  pG ,`Y:(PW $`    08/P(,`Y:( $0p8/P^ (P $`  R 6 Q S$ 0m(,`Y:$ ($0(pGp8/P- !@=)&p 0p  ! !@! @0,ЍO%+ !@W W!@ ! 0! @#M0,ЍO-GMMPD@`p. ApTNp\   @ XpR T  @XpI ==pD W  @   *BQ+V42 0=p( P p"  tMP   @n    @  0ppAM GߍۍqtW[] @ P@"@ p W p +-36 >@AD h  .0)P    @Wp P PH%R @uWp p.   iWp p" p p ZWp p  2/ 2/Y  @EWp pW:] @s@P`TP0PPEuM 2 epkKg@- @  Q:T  D08@Q Qp@-@ `P` P `,PV:(Pp$P`(`,PV:p ]0 n~9A-M `P+Jp@ Pۍ@@P `)P @///p@-MP #@  (`P? @"3 "p6 0`)`p  !@!@l0@ `p  !@!@] 0" p !@Q `p  !@!@DЍp0H-QU0@p |q.x0Hl.G-FM@>P+ pF`ʼ  .  P ` yqH F?`> * F?;`Fߍ0H-@M@%Qy#@P @ @oQ Q@Ѝ0H-Q  RRP` "" -2 !@! @!0@$ Lo/0H-@QP   Pt 0H-(MP P@ 0 B C ) L0p`P pT !W:7 ြ`(ЍH-MP@ pP @$` A` `冻8(L p!  P(pPP` @ A gL `p`P``ЍK-MP pP@ G `䰐 G:L (P qЍA-M P`p@ǻ - @ЍO-OMMQ @TPP Z @@⫻8`tpTC@BLpHP+p@Lp P TpLpXP3pLpT !Y|0 x HHPpt`(P 0T @x Cp 8LpDT@x@ Y PⲀ @ @ @  Ꮋ`  ቻFV@L ` {FVL@ k Ⲁ @ @ @L  X _@P@@ D$r jpOߍۍ =" 7< !@! @!0@k =" : !@! @!0@b =" : !@! @!0@YG-M"㠀@P`P P 0PPY4p Q *P p 0PPH4p P` P H,4D,0@`P'@xPԑP   "P\P  Pܺ ៷P @T:,TЍ !@A-(M P @`Q Pp(Ѝ0'x Bp WpWtO ᜺  QE ⓺   RQ|@|  8~  Q' Xu0Qx xb pPTPPx!@PT a" k2 !@! @!0@nH-@M`P@  Pp B B0 B G PT !4P$!T@H H@0@ЍA-p@|0Gx0"PWP`R*)P |bx `EpV ৹||@-M|@Q "@ ` Ap | x2"?ЍG-vMM@p$Pp U U``U`QQZ ARr*P(Qw`Z~ $` z xPu   Em? pk SP$  RRRppuQ  RQ  RR^P0 ` @  @ @ Fᅸ!@L pph Q u AR:Q*wP$0`P$R p7 P " ( RiQ QP P) P  &Px`vߍۍxP @@,PPP` [V`P` m`RPRN % &5 ?P ;1P w  !@!@P ,E/F?00 Gp!R^Ⴘ  L |p / $L )H-M 01Ѝp@- @0 Q*P`E`U``@ Tppp@-MQ @P P R xЍp@p&PP&P @/PU ` ax@ PUx@T@Ѝp`>P* yP @TQ/@-P@@@yV@-P@@@jVP/(.# @ FO-M(p@@康$@P'Pb `@@`@P !@4Pp pp!@  0/P #p-pP =pPf D p/ Q(P% (`  lH xp ) pp  7/P$ ep $,#P  !@p (@ЍO-M`(#@P    Q4:  0Qp@T WP pP 㡘P   d 00  R:   q ЍH-Mg H Ѝ@- M^ @*@@ @@  0: Ѝ@-@p e(@b(@-@p  p ~BpH-M@P@ `#@p `P0x *`#@*@ G gUH .# @\a b ..# @\a b+ G   +X!V/ލK-r P #@`@!@!p@XOQ™\ r `!@T 0R ,0TQ :O6™`,p V:T b !`@ *O&,P@TO-MRоpЍ 㮗 @!@!@PU.* U p `p!W*P%W Q  ]PP9Q  0wOpp /Q  nOppppꉾ"G-MMRp @0G`P P Pp   @pPiPЍۍ _PP @/OPp pG` @W _p P OpGpP@-M! @ R r@Ѝ @R S0 00}P Qp@DTD@O-,M`P h,Ѝ@ _ @  y0SP Y @ow 0BPm  !@PP*ٽP`JP=`p  Z8PP6@QP4 Z( Q( o j0$p t$ ( $8  MP`X@: ` P"P ` @v @yht X !@iT`W@ !0PN pJPHP `Q( # Pk ( Q   Q  Qt$ ( 2$/8 , P`pW:0p!R Q 0p$t@P0 jP pP$($ P P(  8  P`W:`O-M P@ḀP"40$4P $Q``pW pWO ^O0   !@>p P"0P` $Q:` `CO0   !@#p 0   !@p P"0P$P $O0   !@p O0 7  !@`p 0lP p$`, L 0!@ `p 0,P $`!@@ @ [ !@ 0p @Q b@#,`@T:4wp@0@ R @`,`@T:pQ lbp,`ppW:  QH B`0 P1 ,@`V:8Q pW Q, P" UP 0&( @p   0@}P(P:0P ("00 B@ ("  0P" @势`p0P0 P"P 06("0@0  0@`,@V: ߍO-MQR @cPPSP VpЍcPl,@P`  p YZ*0S S6 Z `  X4S V R  @  S 0W  Q s"P X H00 ` Q p Ҳ@ ^P  ƲrW z0H-@T P PPPPPP@P*"02S0@"PU 0S, 0 00H-PU0@L0@-@\Q\X\@-@`q``H-M`# @p0 P0p pp" 0 pp 0)p PV @   p @Ѝp@-M`@P5 0hh\P  R :0@@ P  B # !@! @  !@ L m !@L* @Ѝp@p@-@`P`@ >P:&Tx RpRQ TQ   >P:?  !@p@@-@$@@3L* @xp@-`Vp@@PP`*  @0$L W !@]*L @p@SpK-MP@`p$ H`P " 0 `` 0  0@# /@0`P !@HvQ V& !@ `W0`8PP PT:jF  !@@ ` * FH$&L`(i0 !@  !@$L  !@ !@H0:HPbP hO   !@!@RS !@HЍK9$48K  !@j @ `  4P 8P   !@@ ` *  @ ` PdQ Phz $K00  !@P<PPo !@H0p 4 `:0@@28 0@@20 0@@4  80 !@h48@P! h`H.< P dh'P ЍKNЍi`% !@ 50.p; !@su !@BL?K00  !@) !@A-MR @ ` 0Q0@ 0p 0S  R-  . 0P Q :  PN e 0P Q: P3 0` P 0P:U P 0P;J P  60P Q:Ѝ  p' z7 !@! @!0@ H- P@` !@08 @ !@w* @0@ L <  cu+ @`H_0H-@P@   !@( !@i !@hhL0HLH-MP@`p: @P PP dp`  < 0@@ p Ѝ !@XЍH   !@!@ЍHMK-P`p @@P'   P%:G  zP  @  mP % 6 !@! @!0@/   ^P  d#P  $0 H&  @KN !@: !@HKv !@Kp@-@`KPP c SF Q pKpH& @yQ0S/00@0 dQ Q/( !@A-`@VP 0Ap!@1 P i rP P<P $TI  !@N| , 0P\ P PPHPP hPdP   $ AO-YM`Ȑp@R L@P@QP1PP}LP奄 @P[ @W( ! @) PS @W( ! @&# ! @# ! @ #@ R 0S #@ R 0S T0` @ !@  T0C !@P`p (P !@ R? !@8`h4P KKPP 8dP GQ* W8 (R8Q cR R SRcQ8h > B(P* 冭0`  Pp WWY8T04cSF @ $0,S D`VW W8d\ 8h``S 2 8$,00CS*( !@f8`51p0$0S D0SGo<QW-, @P:8  x"@ `O*` @*A-n8 FP ((!(R0`WW zDW 0`DPnW0 , @P:20 W 8`W4Q , AQ:30, @P:7 ` PT 00 $(`4` `4``P` 0`W`:Q $ `,`VK `$00, S:, AP;+  Ⴌ ~, AQ*:8`6 <:0$lPD h&$0 S$0`Pv0U Q: P'a 4`0` 00 ` P 0400P0 W:Q ,$0Q 00l0$0, ^:$0 `4W ,@P:90p` DP 4Y ,APM  8`(P , AP8 `=( (W0`  4WDP , AP| < ë 0`P : 4 Z, @P^:P0`WP L 4 < CP Q ` Q6 , (P P@8w`P(P3 `8 z`, AR"QV 0`C!  ` 0`PW DPL+JP EK Kh(PP\ `pj p8`>P_ (` )8D  p PGE㐁w@ 8\P 0pEw0 !@@(P2@P' #:|"@H 0dP $` / PPU`P !@(PX  0@Yߍ<`P}:"#DNP!$#DH! r \/ @( @<R8XTPLHND@<<TaDp !@O{G, AP2 p y*4^, @P:0`]K-M`pP@P P( G !@!@0ЍKnpG bW:@Q Q ЍqW:<Q:Pp R:pP P p pUP E S !@9P  0 `  a006ov 1P0 /r B @H-`P@R : PD0A !@ HpPd⍩@ 0Hp@- P`P @T PD0} !@ p@p !@p@Q \Qp0 p@0 p@O-M@p xPU& `;U PQPUT P> R* ἊP !@C 0Ѝ0H-@PU  (@xP0P QQq dp 00H-M@@J PP@ P  Ry  @>P: ' P 0+' P P0    }PZ !@@  0+S=0@ @Ѝ0Ѝ0HzDO-M M⸐@  @(P8p= pL PUP P` i`!@ȀHp 0@Pp@@ ((q2 `DQ* P(  ᗨ5'p < 0@@Ep  !@!@3 /p !@Ѝ ۍO  O>@tP(\ @((*(> ` (P >Q * 2㓯 !@ 2㊯ !@pF @L@ @@ _) ` iP) 4 !@  4h*taP( (((1pt! !@ !@Ѝ ۍO !@ (@$P,Pp UJ b, !@! @!3PP +  @ ;@  50|SP   ̧b !@P PP   cQ0S0SS 0 PcQP $P0 O@Pk cQQSQcQ0p i P P{ cQQvSQcPq n@TP PL ^P , `EP PR cQQSQcP~$0B !@* X 0<;@Qk q20@h !`( P `PP  #h hdP y0cSacSPcPfc S  2 !@a@k  r 0 `0 P0R !@ 5$@ @@4 B80A0 C48XB !@$A m !@ Ѝ ۍ=0@ ,  @0H-@- @0PUhP00HO-MP@pWQЍP PdP  0!@x( d!@  P@Q P<帠8 <h $Qhhd@ P   Q $) !@HHP P PA !@``@ `{P P  0 Q 00S A AR:T   `K-M@`p@ P P$PQ9@ !@i2@P/  1PP  0UP ( !@H]< 8 H t80@ @Ѝ hhg* @b0H-M@0P <Q  RU 1Ѝ0+ @Ep@-M`P@\P Ѝp@ @]P\ 0<0@ P p  !@!@kꦭP  (@ !@o@@+ @!@R@ 3H-AMMp@Q\P   ) !@!@M `$p 0 pW\PU  P +) @!@{Aލڍ0H-hM M@ TXP PP0 A R CP0 X C  6 !@!@U ` p T6 !@hЍ ۍ0RQ:0AQQp,R| p/O-MḀPPT@1P> R *ԅP  0ЍO P ( LQ Pf0 q W 0S: @a? p !@wDQ  0Hv a Vf 0S:  50P Q  Q P !@@P P !@@ !@) @!@$ @ @pLP`p0  0PPO`VP6`@L   60PPA@G !@9 @> !@ЍOP`00  0PPP6V`VP l 0?PT  P PL P @; !@:@R !@ 0  7P PW !@  P# :N !@ iP t80@倿PP < <Q 1P  @!@ 0`ЍP@P! 0`g* ! @ #JPK?0; 0 @@PP !@ 0 2  P `W !@ RT ( !@i 0>t8 0@WP PP) P`$Q QC Q\PQ`@`Q$DU   60PL QI:<G !@6 !@ 0 P hh  0t80@ þRP-   P0|P  !@Qb Q !@ !@/<`:   P0\P   ? !@ 0 w: !@ 0 o Q*P D  P叢:BL* @ 0ှPQ  @ R <0@S,  @1 QP * P   PY 0@L !@X P !@-`- H ```\PPO-IM R p!@P HPLa p` X" <RP& !@IߍO P @a Pp ,0? 60$@@$ o0R03p 40@'P $ R ", R QP $`!@@ @0 P<Z @ ? !@ `W H!@@C @@ ` P<Z / !@@ / !@A R @!@0 ؿ Iߍ& !@IߍOH-M0080)@P PU`PЍ P  pm@0H-0M@: 0XP P ,,P    ,)<  !@# 0P 0K*0Ѝ00H-@P _ !@ hL 0H, @ H-p@`@PQ ]P P P( !PHN !@Ͽ !@HH0H-@P  !@¿vhLh0H00Po ap/A-`@ P:P P@qP kfP 0p !R P/H-0S ^Q0 SR 0 S QQ/) 03?#R/Q/@-x^0S\ 0Q @T 0S @-x\ R0S @ " 0S@-x\ R0S@ @$ 0SQ h R/dP/0S Q/SQ /   R \/\hh0QQ R\/cQQ cPPSPcP/SQcQ SPcPcQQSQcQO-\MxPUt @@ P ȐY PhP dPe  #@&d P PV `d|Hp  |Hd H 9 ϝP$  ȝP" p8`PP(  `}8 | o ଝpP p $  4P Hp`Hd8dX CWp  ~P ` ̜|xp |dXrP t.  a`P$ @PUNH#@ホ LP P. P* 8 P% 7p @oW W  P P 0<  # P  PȀX  P@$p<` 5$S`h0O Pe pttXX 8` X`dxQ XSh07 Y` ҜP ` H VH P `Hp t 㲜`P5  < m S !@e5  < a + !@Y\Ѝ . > !@! @!0@*sp@-PH P ] !@@p1P P }P yP P- ! @ + @2`V  R 0S `Vp0QP   QU dPdh P- = !@! @!0@@-Q @q P x !@K-Mp@PP# @PP`V4K P ` P  `QmV !@@OT  R P` }8000Po @ a, ! @5$pl8= 0@@0 !@ A4p  ``@깥P  !@!@t@ ЍK-M`pVq @P $dPP4( ,0 dP  h d@ L|PHPPU !@B>hP dPH1 R PQ PU( R, R !@㽻XQhdPPH周pЍPP  Q  /G-MPPU @ `xq 00   0 TPЍO- MR0x!@<R  P PP p`PP"Y Y V' P PC 2ԤѤ ЍV P PP3T? 0S= Q4P7 0` P0` ` 67000Po, a ! @4[P: `Y ЍOy `` !@ ЍO5@-P@TQ   c P@] p@-PA `D.@@.@\@ H(@.@ Q(  P:Q0Q` 0@PP@\Q @ @CQ:Q`VQ`C`Qp@H.@@P  D.@p  pp@-0S# P:S`@T V P 0`@TVET@V :RV :VV@PppH-M0   0ЍO-\`E: Q@ TXp.P@ '\T.@/00S :S|S000n`P P \`[`Ѝۍ  R\R   K-= P{ pdBPx Pd]Q\Q R:Rd 0Q0@T0A&  @ `0V  p^Q Q:QK pQ:QE ppaRMRB0BS `,lpqP%mRb0BS`,l:NR RR TR nR rR tR     @E dP PP E P ꏠ P P   PA-= qP- `dP* Pcpd R:R pd :@@P d`Pd@ `wd  eP J H dp@-`# 2P  0Q  xR  p0/@0PC U:aPCV@U:APC6@U0S2 pH-X.@P P \P.@@-XHp.@@.@ P ,w *!@ @0PO-Mp.@P ReXqx.@.p@ UZ  PM oO\`@@.@ ㆍP( p[ bPP  P J Q  P Q   P@Z Pp6PZp.@Ѝt|0.p@ p+P ,P S 00P P P S0RS00H-PS :@P0 a D@0p@-@8P  PG@l.@P Xhp.`@.@PP Y\T.@pp0H-XHp.@@.@PPP0YP0p@-@ P  P@l.@P Xhp.`@.@PP Y\T.@ppH-Pl.@@-@Pl.@@O- M`p[ pPPl.@[@ @P! X P aP P[ X Q UPXHp.@@.@``P eY`P Ѝ//////@-M.@PP O .@.@@ 0PЍ@-O.@@/@ P  *!@ @I/PO-M-M`/@ QT@Pp.@ P[ V``P Poo`@ P;  pϊϊoZ ›P(eaP  sPJQ @oP JP  \PJQ  P@X PpP,e @!P e@P e@P P  P P$ :nPP/@ЍЍH-MP.@@`pP$P  0p`1PPoPЍH-M/.@. @;PЍK-M`p@PP  0pp(`Poo/@P .@/@pP XU@@Ѝ0H-O.@@/@PPP0XP0H-M/.@. @;PЍK-M`p@PP  0pp(`Poo/@P .@/@pP WU@@ЍH-P/@@-@P/@@H-@P`pᅘ  y s H0H-M@7PT PP /@P Ѝ0 @ P@@/@P @/@P  P (@@WEY-  @!@04/FO-,MM@/@P ,Ѝۍ~C,(/@@(0 a p}#/@/ @@0PY oMm] @(p/@(@@(`@(P@P P P !@+*p /@X  !@$P sP (H@2Q7 $@LXdp/@aAP] P` (@pD q9 !@ 0@7/Q/@MPI/@EAP?AP8/@4/@1/@*/@'P@%P@ /@/@/@/@/@ /@ P@ /@/@/@^(pP6 /@ Q t d/p@R/`@ 20pPpdp/`@pdP/`@P T30/P@0(4`/0@`3/0@P4 /0@ 3 /0@t0 /p@ $t&/p@ 4/0@c $,4/ @1 /0@/`@ 0q04/0@7   A/@4$/ @Q4 O8#@@/@HPH/@L/@P/@T/@8Pd/@PS@/P@P jP@/@tH @*v$  @@-@4/@P*@l/@P @iO-M@`PDP"V(:U3UE3CF @ @ P*T@/@Pcf@pW*/@PL ` P /@P= `P/@W4P/@:W/@P `V `P/@P Ѝ#/ @ 000 0[:S[ 1pBW /@`Xb$d/@/@[ pp1Y /@Y /@ P `$/@;H< H/@` FZ0r ! Z 8G088S B! 00P "QQV  /@00#0QJ 1q R ? ts F/p@Z00&  aJT` d(`+ +!+ +8!+ +!+ +9!`Q0  @0#0Q 1q R /@0#/@Pm /@P( ?lp/@/@@P@P@Y pGP `H H <` W G-8 /@ `/@P/ /@PԐ @ ` @u (@@ B !@ (@@B !@Y- @04/@P`o  㤐H-MP`pP4FPTA Q:Pp)4/@P*P P/@PH/@U:P/@U :/@P. PP h p/@P  P@/@P Ѝ/@PV@U  @ P@ (@@AY- 0 @!@04/ᆔO-MP@Q T `4/@P *$P/@p**!%`/@P;PeF    P E1o 3   P "2//o 3R= HP H/@PRP/@PMPv pU  1P :/@Q *Q$*/@P PQ:/@(@ 0 2!0R /@P /@P pH/@Pc P5 Up`1 5) 8/@@R8/@ i( /@ 0 %p# p 8 /@勌/@PR /@PT W/@P-  p/@P Ѝ8 /@jnP/@P T 8PSPP p @  (@@@Y- ] @!@04/~Uw*FZ "wUuE qU*KZ UEA-M`$/@P  F/@ 2!1 pWQUr  BA/@ PpP{ $GFW& # @)8T/P@`ᤋ@Ἄ/@Pe d/@@=~W/# @   W#@'Q0S 0R!p  RP Q ဌQ Q Q T*P ⧋@Ѝ  #/ @ AR  ЍAQЍA茋Z p~ Z kZ f@-M@/@P TKЍ  @@@-M$/@Q #/ @ @2> RNT C 8/@Ѝ///O-M/@P ЍYM (@ @@p !@ 07/p,!@@ @07/3/0@/@0,cS @ @/`@a35%P`!0@" @  m> p @ 0@V0!@7/3/0@;!0'/@cPS" @!@/`@.sU` @ @/p@>+Vp!0@ @*` 9 P!`@ 0@W05//@gv\ ` fvF\L `@R Q5B1/! A  @!Y - @ @!@ 0 Tp`@  (@@9<!@ 0@ 4//@P4 D/@@Pd/@Q lTp/P@/@ @P@P @Q PT /@PIDЍePL/@ R@u (@/ (@/Q/P  P/Q/P  P///////Q/ 0S/Q/Q/ 0S/Q//\/0SQ/0P/H-^0`SQ0CP1S 0Q  /1S 0Q  /((@/lpL0pS C  S \ 00 / !p(@/p(@/p(@ /p(@/p(@/p(@/p(@/p(@ /p(@ /p(@@/p(@/p(@ /p(@@/p@-$aP@#`@]P @ T@pQ Q$!# @//Q R !R/ R/ RQ/r(@ P/P/p(@ /P/@ RRR/@-@R !p(@/p(@/p@-MY] @ P@P@`G 7 (@=!0@V0"@  Ѝp R/QQD (@/" Y @ @3P/H-0A Lr RA C 2r R 02 |s R|s Q QO-MP `R,V@Qw r& rl[n $ Rj`Q@g8@#@ pU `W:` 㖆`pG`PP`@~T~ Pu 0ЍO6[ @PE:`QC `8p `#@P$[ P   X( Q   zL@U @  O[P`~Y `XP,@[([@Q @Ѝ8>#0@pR `~Q-@ 0Q Q@0@U Z 1V U XX  #@Q>!@/(@/X #@QS!@/(@////MH-M  0 ЍHЍ/0H- P(@@o @WP V @ +0H+}MH-M 0 ЍHЍ/ MH-M 0 ЍHЍ/ ///H-M  ЍH-M  ЍH-M  Ѝ //////P/@-M UUE3333C@@!??@!11@0! S Q:P @ᦍ@꣍Ѝp@-f@P#`@>P P UppQ/&# @/O-MpP `@ PP:P@L pP TUAU$* #P$  P$p`ㄐ( @,峄Wp @!D  @@@ <T@ 0pP0 0 PD00 0p4p ` G E$[@   P * @ p P:Pt/@  $ A  .Y`P Vpp@ P0pP"=SM` LLLLLLLL(LLtLtt< [Q< Jp0p @ =Q P90 p @4< ["Q<"Jp0p @" `~  >#Q>#"R RRW<0 [Q<Jp0p[ Q P0p @  p0 @>3S<P[; P,4 [8p ` >3S P:/Vt `/@` < Q:8@TY H` V` < Pp` <`0qp`[kP  P A,K Aq P ` P8 @[  AP, 0 B P *PK0pW q1Wp! Sq:0CR A1S0!A1 R PL*Q Q: Q:D 0aqPWP1pQ Ap60 >#R R0S0CRS 0`00HE2 er0@0 p0 tR`/@` V ^YppЍ`8`;P`p2`1A-M@``>Q$A QI    `  T 0 (  (e]Q?Q" [Q \Q(V:td/`@P`>Q* <Q-&'^Q {Q |QP<9P7 4V:Pt/@ @`@` V $P*)P )  V LP*`)P Pt/@`Q(**0@SpP p@{P0S * 3(0@000,R Q t/@VQ t/@>P *PW +P0@ E_?P` {P^`0P*0,Q(@< H0VP t/@ cQ* }R X b. `? $   $ uPh0  @+0  @&0@  @P!A>#" P   ?Q^`!p^ ]@#  x(@'Q`QP ] P  }RP P t/@P* *0BS p` p@ P t/@ {R P*(@ЍK-M @\Y P:Pt/@```JY0JIPB  $ $ $ $ $ $ $ $ $   /y`qPLP  O$ ( F*YV .Yz [Y]&}Pt/@ Dq{YKP2 / @`@` V $P *Q*\P)P \) ( V LP2Q1* \R)Q Pt/@3&. +P td/`@P` `QHV x(@'Q`Q|t/@ {  P#*0*SPh 0n @0 c @Q*\S{Q $YЍo`0Q* 0,R<Q*(@ V0VP t/@ q RQ1*0\S0}S+ R *Q * Q\R }R P P^ ]@&`P{P t/@p @-@P*^Q  $   $ @-@P @ (  (p@-`P pP@P:Pp   !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QPt/@tPo u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AM  R0@0 @1>3 " :]P Pt/@PP  1 B>3 ! A ЍO-# " P   pPp  iPpG0H S@@X@P >F 08  0 @ oP!A># " aP   PF 0  @ GEt/@H-(q`(p@@PPQ  , (OP+ ,( , P<P! (@0Q1 Sr1`#Q( @ Pr0P t/@@-@ P*Q* [R .R. Q 2R1:Qt/@Pt/@0.S ]RA-@X 2R1 :Pt/@q`0pSWp]W `00S:xwq#@P!p@ cPg~P pPWVPA-@((@PPQ 801 ,P #(@( @ (0# RR: -'R:0********************************p >Q>"P P P Q`qQ` O-lMPe"@Q` 0E P  lЍ((@,0Q : P  T},0  X8P= D},0 ; @Z:,p$QX 4Q8P Rp.*$pJ @P< [:$aZ,0P pKZ+pP(P0 },0 .@ Z:, p$P  4Q8P \ p*$ p J @P< X:$(Z,0P pHZ @P$j:,P Q 4Q8P$PR* P@pp@P< [: Y,0P $PKP<@ pB$ W B*d@ W'*P p W:(P0P``@CPE@T`VV[0V 0A`1T@1@(P,0p W: p <@ pB$ W Bt*d @ Wj*P p0(P`@P@0C@T`VVXVN A `T@10p(P,0 W:pD#RR>p&A Q CFFCCFFCFDF#p!>3 S @ 0@+`8  0# FPP @   0 @pPZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#SpHlGlGH\IdIIIJlGlGlGlGlGlGlGlGlG4KTKKKKlGlGlGlGlGLM2 Q@  0p@ @P>  X@:3 !0@P HMhM|MMMNhNN>S 0pm `Rd\hA^c p @ \S0PW@[ >># R0^B*(@ _Q7^ ^/^*_Q',0^! 0^ ^*#0( @  pp_S0^0 0^0^ _S^   0^* Q(@_Q 0^^(@_P ^s (@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >(!( @ `SRP 8010 Cp <@T6 P(@P"  @-(@_P# Q@P`Xx:?^  y_Qv(@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`TQX PX p0@0'$   |(p-+R0QdQPQQQQQQSSSSSSSSSRR(RQ !0 >s W  >3 01>s W >000 0!># R  {\q upri$Ph lPdh(Q cq P[ _pW [ ~QR V\OZS\QJ(!>( @  s(RP 8 7  000>0HpW2qQ@, B<.Y PPB((@ PP((@PPBPP  @T" ,ЍH-@((@PPQ 801 ,P #(@( @ (0<pQ ` u`R* w u`R# 0P4P 0 QR RP$P `p P$p`W:88oO-DM0@h` 3 (pP* 0lP p Pp  P Yl P   /$@Y p<<p@h` Sl @Q~@Q40p,@8 Q$@ $@$$@<(qQ@ @ Q  (pP8P@PX y  X0yp Q@Q# (@8P 8=(@4p 8_P @P <@ p_R 8Y 4 (@r  8 _Y ppr \ @ R < r @_QpqQw  0pY@P"Y <(@q@_P4@P 4(@q_Yo#wP'< (@^rP4pr o w@ $@  w /opP"Q~  R0(, o0` PPP SY @V#RR>p&A Q [`^`^[[`^`^[`^t\`^]8]X]R p>#p!>3 S @ 0@I`8  0A FPP @   0 @p2PZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp`H_H_`8a@a`aabH_H_H_H_H_H_H_H_H_c0chcccH_H_H_H_H_(e2 Q@  0p@ @P>  X@:3 !0@P_eDeXeeeeDff>S 0pm `Rd\hA^c p @ eM0PW@[ >># R0^B*(@ _Q7^ ^/^*_Q',0^! 0^ ^*#0( @  pp_S0^0 0^0^ _S^   0^* Q(@_Q 0^^(@_P ^s (@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >(!( @ `SRP 8010 Cp <@T6 P(@P"  @-(@_P# Q@P`Xx:?^  y_Qv(@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`pT@ QV,ЍXP 0 0"$  ~(p-+Rq0h$ihLiTidiiiiiiiiiiiiiiiii jhhhdjhhhhhL> AGE !0 > Q  > 1> Q@4>  >@ PA*^# $p!P$P P(Q qP p  zQ ^J @`∀Vc^J(!>( @  (RP 8 1 >083@8Q` <@Y PP((@ 2PP((@ 'PPPP @ O-DMP, 04(`  i   0Dh  lP  Ti 8P PU8l@ Q ! U <<$l@PP  _JP@8(@p0S S@  @$@@<qPU U  (@hpp S4P0 @U,0@T {B  0@T?{p Q40P,\$ (@,0P^ hp(4,4(@8p _^ \ <_\p ^hp(8 (@r hp ( _^ @qQ?@0p s0RtB  0(@@ p0P 4(p^\!^ < (@r _\2\ 8 (@r _ ^ o"pP&#<0( @^ s8@s0 0otp0P0 hp0 0t0 ?o4 2 Rq B 0kPo@p pP4 @ UIP@Q( $@[$P h h<@0h tB @@8@@ @@P\a < r [_\fXlP h@P DЍO-M8@S*P`  >#RR>p&A Q @ruu@r@ruutru$susstR p>#p!>3 S @ 0@+`8  0# FPP @   0 @pPZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#SpHwuulwwwx0xDyuuuuuuuuuyyzTzdzuuuuu{2 Q@  0p@ @P>  X@:3 !0@Pv|{|||||\}>S 0pm `Rd\hA^c p @ G0PW@[ >># R0^B*(@ _Q7^ ^/^*_Q',0^! 0^ ^*#0( @  pp_S0^0 0^0^ _S^   0^* Q(@_Q 0^^(@_P ^s (@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >(!( @ `SRP 8010 Cp <@5T6 P(@*P"  @-(@_P# Q@P`Xx:?^  y_Qv(@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`TQX PX p0@0'$   |(p-+R0\4<L`p$$$$$$$$$ȀԀ\\\(t\\\t    000>Q !0 >s W  >3 01>s W >000 0!># R  {\q upri$Ph lPdh(Q cq P[ _pW [ ~QR V\OZS\QJ(!>( @  s(RP 8 7  000>0HpW2qQ@, B<Y PPB((@}PP((@qPPBPP  @T" ,Ѝ///H-[ // //0H-T@/P@P/@k Q0P00H-T@/P@P/@kPTP00H-P@PP0mg@P/Y@P@   // /////@-P E $/@@0! @PD!@@P P/$Q/ 0  /<$K-M@Q% Q 壟4`0_8p%pG_Ə%_YoP/rP  A/"?'3-YЍ؈K-M@Q$ Q4P0<8o ş&``FWoo/b o Ao/"?&B-WЍO-$M@0LpH` 0 R*PV*V 0CLP # !PpW !@P*`FP 0V:P A TP 0Z ?'/Q3Q3 ^2w3QP ^*p@ 0 0p@ pW@@2P W*VJ3oPP& Z V0`FV|:ZPP P `FPV 0V*eUY TP  Y w: Q:VK U! E\ *@P:0 A R9Q0S EQ1 L PM 01P`F1`FPTP 0P  Q* 0 <    0V$ЍT^ Z 0H-M(P @PPP PЍ0,@-M@(2<FPZdЍ@r "Q  *4>HQT QD  Q , Q P  P P  P P  P P  P| P d PT P Ѝ X X w X ` OX G X ? W W W O-MQ`P@T ॿP p ᗿP P nPoPoPa@PThhhhhhhhhhhhhhLh  fP  fPZ U fPZ T fPZ Uhp fPZj UZ< fPE ( {fP?  ufP  ofP  ifPhZV U4 [fP'  UfP!  OfP | IfP h CfPBZ6 UZ UZ UT13TTTT TTU  ЍW V W V ;h w X 7 U T T  T H yT iT p@-`MP0 ` B@ @F?Q @@@@@:+h0"1P p$ 0H ep Idp  @p@@@hHP ehPg P ИgP`ЍpO-DMMp yX@@? Әp FDP D`ݘv P `e $($ ;r$ P@ p @ '@q⨱8`pp tpW1 @ 0ᦘ?X A  =凘p P= PPᨘP op ygPX*rg@ @ pTP  @ h\Y @ 2 @U gH ẙDЍۍ Q P P P 0H-MP @ 00Fp $HPp U 8i PP .Ѝ00H-p @@眙PT 0Py!p xS P gP\@@P HUD  @ f@P0wowooDw,wpoG-CMH@T@P@T /TP@!1@0@ 0 P:f?,@@㸗@p)  `᪗pfPP志w !0  0+XP@U VU P fP@fPCލ oM M 0H-MMQ@PPp\ T /ATP=@!1@@ 0k P:mf?AXp L dP :4p%@@i/Hp- +]˘ 0@ p 0@ ]p   zPp,f@)f@PЍۍ0"fP#P/p @fPqt mtt0L 5L llDt(t HlsH-nPO-M@Ppe`eU^T, `!kbP P`k:P P`@0P   H $ +8``0@PP X 0@ @l0? A0? ?0@ @(P EP ȿ 0X\ WA q *   0TS dS S Q  QTQ tQ "h"S"b .R  Z    zRLQ @I We !pOeP=LHX[p zQ \!~ ? y? r?(  j?$  b ر  0pv6P XP\QH RPQP@dPRPj LP 0p/ /"l@P}d`P```3V@EPp3W@VPW P@`@LdPPP !$` AlF(!@ `L0$T 8R PT "0pP PT@P$ b(RV@ ! $QQ0!3QTРPS "baZI@0Bxd!@@ 0!$ < "i$ PR]d 0P $#@X  V(PU P Fd@DdP @,ߍP *+ TP/PxP`E T PXP d@` J wuPL  \p2g'o0Sr"y/0S!0T 7 0@m_l'0@ 1 "p'# !D@R!'p`%Px )Lu@BLt#(|@r@c1SP8 )|5@rL7 7 0@@`P@3cT`cP |`Qųc`w @!)4  L!HDB@P! !BP : :BRSBq/Dr AC!/@2 `L"HS p 0! MscPPPA HP>hc@ Ѐw PB v:  ;K!S-5:0`X/ ^Tptp`VzQ p@P@%g'E# Q "q` 2pG`Vp, @NPJ" 2"pq 2apRp cTc@P4/@!  iP! !BaP * *BSRCq?Dr0AB1/@2 `L"HS p 0! , @PqܕO-M`2ᜐ嘐@P p P ` @P8p,00@8L@DHXPPXH`<Cp(d$4T@Ud aV$uʘ ~_P `PP PN QJQEaV 4Vi F3Phx$L$DLXp @   8 ( D 0ll@"0 "eK p  02p;0s0 0p3@P@ 0 L   00 R&@ptp*#pRp`p $ L @$' r0'$0S(ʁW@@CR@dB¯ " p!" Z"@"B \0 @p 0@m@ 0 p/"?'P:@p`!< !0 @3$0SʁW@@CR@dB¯ "@O!" Z"@"B \0 @ 0 7@  0/"?#P:@ p`!< !0@2a ppTx QpQp tp pT\$P ?/?#/"pSp"B"r"BB"r@@Tp:  0 PpЍH-M?  0 : p ЍH-M8  0I pЍ P   /??H-y0H-@MPP :W? $  0 PP :V? $  0 @-Z@P   2/ |>0H-@PT U0 03/0G 0>p@-@P|T`UpV  0 fTQ@S04`@@017qUpST| <`V*,4`|*YvWP pVb4`Y> I@<?Qm Ri pa2! Q'3!Q @4Q <P*, 4;(`P< R< 4080CS7:04 R*>(4 8 `0B4 S  @4P*# 4 4 @R*`4 @ 0 P@0<08 4 0@@V*<4`@ @FY4Fp`   4  4P 0Q:Q*=  4 4 P0@ P@p P@ SP`44(P< R 4080CSQ*P pP*< 4@ 4  44 R 0P: (pQ<0S 8 @P:40S*>(408 40@S 0@4P*# 44P*pp404 R*>(4 8 p0B4 S  @4P*# 4 4 @R*p4 @ 0 P@0<08 4 10@@/ @ P`4` @ `P P J(P< R`PQP@ `P pP @4P4P80FS: R4 *>(4 8 `0B4 S  @4P*# 4 4 R*`4 @ 0 `P@0<08 4 0@@p  @Q@p(04p8`4@Q @4P*# 44P*4 Q@<84pA 4  4  P0R:Y @4 Pj R*>0 R04 R*#004  4 (P4 80pBW  @4P* #004 4 R*004  0R@0<08 4 *04  4 R$P: #  @P:  R*004  4 R P: #  @P   @4 QBLЍH-M007ЍH-MPЍhO-MR @ `pPJP/` f`V4 Q Pp @±T`,@  V Y封: *><^vXP\p 'P  R*11P0 c0 P C/A-M @`pP+հ`(P Up- ?P$3,1dP`Q >㷰<㴰^㱰v㮰8#㫰:㨰0'㥰#㢰 #㞰H#㚰p-㖰-㒰`_㎰|㊰oㆰpグr~yzzv{rM|nh}j{` *`.J`j`/` ` `pH  %  % C % % %80@01/0 !Af%,ϪA 8<% `# # (% P$% x4% ,% %   # # d" j*AnJArjAvNϊAh`M ez @  R 0S  pW) sPU1PPQ1W8SpU0U0 SQ  00D' 0'~C g&~C*gp(KS0 GKp*C0 Pp0Ѝ fghijklmnopqrstuvwxyz{|}+,-.`I u ǥ  KH-D' 0   b*`(K @ Q*BK$ $0000000/JO- T "Q P AX`T!Q JIIJXH HIGG0H-@ ,Pf@p 0H0F0H-@PY@p 0H0O-M,vᘴTp    E@pPi|Z p 5 P`v Z p  `!DZ P ! 4E! `@PQ0H P EP p P`v @TQ p   `!?!>0@Q QJ q" R R `!0Qu  0㒭Q`Q| 0 ᄭpyAT `Ta  0r`pe @Qb ᘴ/. A<Z P  E P EP- p8 Pi`vW @UTQ % p(   ` 0on`0C10 "p;@`!0Q J`C! @Pp$ @)!Ab ?>0 B0R!!`p P@P`Ѝ/. @@ <0!P+FD|DlBLBA\ @Ad@O-M@$f P `R`P Y0 R LZ 0 R LPk Ex!(0$0R  Dlh<p$(.P  CKT.P  7PC XR$T0pd` x$ @ld00PQ\pP PP QoPHP QLQd_TqP@〱V,@P `p PS @Wm LATj 58ğPd P``p$V <P>=*PV8⤟P P`@`p$V <P>*@PV 冎@ L JT [  9PEQ 9P E W 9PO L `C@pP `P@ \[ P UP&  ZЍ\[  9PP@Y9P@PPV 9P@Q 9PP @Y  9P@ P PV x9P@ äK {r ޳ =L>8>=0H-H@_9PI 4Y9PC Q7Q08QP@Q7 P  79P*mQ+P P PmQ 0 A R;A"o!!!0Q 1 A R:;A@o;Q 0A@ P3@00, p@-"TX@lP`@`000  xpPp ,0\``0PD00 p@tW8877878(Q  X//7t7p@-P@`` V PJpQ PPPUp@O-MM@h``&P _ }D2ʽ@<"0 Gy Gu@ Gq Gm Gi Ge Ga G] GY GU GQ GM GI GE GA Gp Gp Gp Gp Gp Gp Gp Gp Gtp Gdp GTp GDp G4p G$p Gp Gp`b` G``  0"`@T( QU )6 V#N1 6pP`pGWP 0PU"`Ѝۍ$ tD<< ԩ 3O-M@PP LsPp8$Q  BQ   BQQ8& P U#P  0 P 0`0Q 0`02`N  cQ @8LЍ Q A  AP +ԡ oQ8<Q q ] Q* q.)p  P@ x"@@; 9P7SP2 L&p  <PJ!p VP  XYm X PO@`<{,4@22t22$1011x1@- $@:p@ 0@-@:p@H-M08 R   ЍD0O-M(@`pPP U PJpQ Q 0Q[ЍK-Q1Q+ PY# 4@Pp@DT P` 0`V"p 0"@/K-`Pp Pp W PJpAP P QO-M` PE@蓟 ` QPLU V V Pp ếppp@ ~8P\P D<b0|  @Z p\ w q!  P( PU tpB vp P~ wb U pp6 0,q/". @@" 8" Q3! !@10q! PQ  RJr0"1pW XpA0S 10S0p1\\! Tq0poq&.  C 4R p@ 7P`S`P tl|`Ѝ |0 % -LP*))4,x,,8,,,<8 XPZ *hd\(p@-P@p p@@ 7PHPcPP 0(gLp)L((H-PPQ @ S pሞcP 00A B  @(H-PPQ @ S pWcP 00A B @'H-M< R 0 Ѝ'(Q  T//&%A-pqP` q@@P| P      @a@VA`N VQPT _ } Ay Au Aq Am Ai Ae Aa A] AY AU AQ AM AI AE AA A A A A A A A A At Ad AT AD A4 A$ A A APtt0T <<0 4$+ x$A s $\#G-PM @,  !q!1saqQ P `V PEPjW *  0 c00 GW:W`D0H |-p apW 0@B @- $@77p@!@-@-7p@0H-(M$ P@$ \(Ѝ0!0H-(M P@ O(Ѝ0p@-(MP D@7p ` :(Ѝp(Ѝp!p@-(MP@6p ` &(Ѝp(ЍpH-M   ЍH-M@  ,00   ЍD H-M ,0 0 1 00 0 Ѝ0H-MP `@6p  ,0 00  PЍ0Ѝ00H-MP@6p  ,0 00  PЍ0Ѝ0$Q/`ϱ`@-@@@p$l m 0K-@4P`Pc&pP PY&P `#  e0Ja*e CJA*ClPPR aP*c20Jb CJA*EF c4<mJe?OJ@*a @,*A   PP(@-@@P d 0 T  "4 ` 01SPP0`@-@@ P b `2P01S`` PP@-@@P <l   R0 @T P` wP<A-As@P   # R6 ``: P P 0 02;8 PCQ0"``@ r8PT ` 8P+P\@-t@@P  R  8 PP(p@-@@PP"``P   P 0 `V P` P p(P8<@8ph0H-PPQ n@Q%  "+ 8 PP Q R@Q  ,-  0@-X@@Q 6Q ,-  0H-PPQ @Q% @BK@8 P]P Q @Q  ,-  0|@-D@@Q Q0 .pC-`P`Q @Q+ @-P,@P@P@8 P P Q @Q  ,-  pDH-0P LH-0P DH-@@P n R0LPH @ m   t PPK-@@P = R DP@ 0lP@0L0Ll (00PmP@-P@@Q Q,@0A,@1A@0L (00P@< X0H-P2 P@PP  R0 T, 0P,0P,800L PP00l@-P@@Q Q,@0A,@1A@0L (00P@|H-M@ P mQ DQZ QP1DQ吔PP@DQ 0p  pPP050  5:  < 005PqЍ`PP/H-H-@ R/P"P\H-D QPLP $ Rs/$ Ru/4 0S s/\(# Ru#/#/ p@- M@@ P` `` `wa `` `maa ea ЍpH- MRPQ  R Ѝ ЍoP!A@PY,P -t! Qh -TLA@P p% 0  Bp(qp|P  5P: 8  5@@ 5 X54 0@ @4# PdP Ѝ4 įx`h   p T A-Mb`Pe A@P+PP! 0 C00d-hD P-bp QP3D<@4PQQ   QQ  4P! Pv0CЍl  0S 0S@@H R 3PP P\P\PH   @-4@@P$H+耫`@-(@@P5+4 0H-MP@ PPhDapP QT  LDPP  Ѝ01/Ѝ0|H-M\P ЍHPD 0 C00,ЍXH-M\P ~,8  Q, s,ЍܩH-@ R/PC P\H-0 PPH-,/4P$ P@-P tQ |@Px@P <  >40#@@|4/0H-PQP @ Q Q0t l0L0Q00,  4g0@-@@P P P tPl P H  3@:$ P TH-P" p8 68P, (@0`P0`` 0C`V@`V0PpW0H-P0^, 0 (P@PP 0PUPAU^P/0 S,Х/p@-P! 0QJPURJ0ES R,!(@0`P0`` 0C`V@@T0 Q0pp@-P= Q;J@T8R6J`DV R0``` Q(S,@( A`P```V  P B`V , (!@PU``U`( @PU``U pp@-P! 0QJPURJ0ES R,!(@0`P0`` 0C`V@@T0 Q0pQ  R/, B0BR P/0H-^, 0 (P@PP 0PUPAU^000H-^, 0 (P@PP 0PUPAU^000H-\,  \ 0(@TPPTP( @TPPT00p@-0QS, (@`P `` `V`@PF`VP0SpH-(, 0P Q00H-P+ Q\$ Q, 0A@CS0^0, 0 (P@PP 0PUPAU^0P/  ꘔP/0H-PX@tQT X0 P#P/  P3P/" P#P/  P3P/d P#P/4 $P3P/ 0@-tP MpP @pQ 7@c1tP #t@$P#P/ D< R/Q3 0S 0/ PP/PP/H-4PPp H|H-@T& mpP @tQ 6H0tP |Q pPpPp|Uw tH80 pO- MPE ZCp P=S;pR0@P @Qp @&`p 0nPJ3P  `FPGP  J0  Ѝ7  PP/O-MPpW! @`  0ፚ* P  0`做p   0}PP ˓Ѝp@-]P D|P @`緓|`0@V尓xp& @P@0|fP Q @XPPpD X|$pp@pAp؍p@-@P P P`l`0PVp@dA-P @pPP  X `A0@ PS S'0,01N0oC0000\L0|X, 0cl00`S00C`VXP PUPP`np`P VO-M  p BT P P%`p 00PBJa [`Fp P bP P P(@ PJ J P QP@U  !J@W  e! J@Z   ! @ЍO-TM$p R TЍ]p!R @0 0t 4TЍO /tATV |! BR8   `,P% 0TЍ 1€ ,``VS@4p  LpʀY`t 0@  Qp p࿙ t1 Q 0 0+p 筙 YpG-` PPp ᤙ@PAA@Y ZXT  8PP ᑙQK-P `P:@GP3pP:aP,J]P P$p @ @ WP`W ` @$ A` !pPX@ i `.PW 'PW  P@-p0@ SP 1 @  !0 b D *c *A  PK 0H-@ P  R!4hP PUXP R 0P R 0 0R00H0F,D`Q Q QP /-0H/$8  R/P@0?30Q@ ( /$P/Q@0?30R@/Q/ R/Q/ (\R/#R/p@-@,P?`HpS/p@-@?`PHpH-QPQX-@0 8@0 8 R #@( @ H-R^X=@ 0(@ 080S03@@MK0H-@xPU XTP@? @48P@@$00H-@PP XTP@? @h08P@@0hp@-Pw @XP`TQG  Q@@ Q@@ Q@@  Q@@ Q@@ Q@@Q@@4Q@@ Q@ @@Q@@@Q@@@Q@@  (QP   8QP  @pX0m@ 0(@ 080S@pp0H-PO @XPTP/  @ @ @ @ @ @ @ @ @ @ @ @@@@@ @ @@@@@@@@@    @0(8Q@@00P@/0H-TP  0R  QS\ UA ^ T (!R !R 8!R !R  R0LQ0p@-TP&  0R@ S 1T S1 AS0 T4! S`RQV U@@^\(!R !R 8!R !R  RpLQp0H-@ P! 0Hb`0H-@PR J 0 P  S ! 0HH0H-P@w! 0H>0H-@PQP J P  Q _! 0H&0H-@ 8P 'p L! 0H040H-@P&p P J Q  P0.! 0H0H-@P&p !! 0H0p@-@ l`P&p V J P  V p  p@4O-M-MPl@P( p0T`$, ϊ ϊ0ϊ@ϊPϊ` ϊÊϊ2p! p Š ϊϊ ϊϊϊϊ ϊ$ 0ᰀ @D PT ( 0GpP ЍЍO-M-Mp`P(Pp U$0 ϊ ϊ0ϊ@ϊPϊ` ϊ Šϊ4@% p ϊϊϊϊϊ ϊ Šϊ$ 0 GPE`U ڨ 0pP ЍЍO-M-Mp$P@P( p0T ϊ ϊ0ϊ@ϊPϊ` ϊÊϊ2`! p Š ϊϊ ϊϊϊϊ ϊ $0ᰀ @D PT ( 0ᅓpP ЍЍH-M 0 0ЍO-M-M@px%pR P( ap0V$ϊ  ϊ0ϊ@ϊPϊ`ϊÊϊ4P"$p Š ϊ ϊ ϊϊϊϊϊ 0y `F @V( 0pP ЍЍO-M-Mp(`PP0 ,0p0U$ϊ  ϊ0ϊ@ϊPϊ`ϊÊϊ2@!$p Š ϊ ϊ ϊϊϊϊϊ, 0(帐PE`U 0 0᳒pP ЍЍO-4MP, X q\@Qa @QB \(YIP귓PK X@PzwPX @ X` T@ U`F8  PV p pf `VTU8P   ]ꃓP X@ T P8P  DpaX@T PP*  @T  (0 p0Q Q 0jPPh @Uq0,D 0|@ 縐yp  HLPEpG @U(0@  X@ QZCAZNTQ8P ' (0  p0S0 RP|D3p HLP`P 0A( @p Q0@ TP,X@` (0 P P , p@ s@H@PPU㰡080pP:Xp@@ P5PO pW@@ ZX@PpG pG0?W P P  Q%Q{ `Vjp,@Qp_|Dpp `HL V!PMP[PT R 8P R P P@0@(  pP0@ TP,0(  A% PPP Q `B@0F(  Q  ;P4Ѝ,, a ,O-M-MP ( PpP IP4$$x Q A X@T`XPEP8  P4 0P8  `,p,ϊ (ϊ0$ϊ@ ϊPϊ`ϊp ŠϊB@!,p Šϊ(ϊϊ$ϊ ϊϊϊ0 40 g pG @W ڸ 0PpPxt  Qh  T P 8 O H, Y@ $@`p0s@ (@po0`@p`S0 p`S0 YD0`@  S1 HpQ! 080! p0pp CQ -ЍЍQfLP/88!R!RQ@@/(P/48!R!RQ@@/P<Q/(!R@ ,@ /P/$!R@ ,@ /LP/X-(!R!RQ@@/P/X-(!R!RQ@@/P@/TP@/A-P@P8 `@Q Pp fj 4P n P@@L40S \/A R QPT/4\ Q/A0SRPT /$  RP00T/PP00T/$QQ/$QQ/ O-M@T Q lP\PH@X P\T \ AAR `hPVTV[Z IQpI W @ Z+ Y  0@;IYʔ ` 0!!G`F Wp,0P!PPPPPP,!PJ ZQ`p,D |    wpM p`WQI P pIV 0!!>`V,0 S!PPPPPP!,Z!p WPP`,D |  㰡 /p `PVЍP U 0@PYP )ЍH-^a^ 0S,P@ Q( ,APq`0SPQPQ RA/Q R  A/P/P/P/P /P/P/<O-MPF @P H@, DP 0 p@Y* !Xaq | Pp pW:0@  ЍЍ@-T0 0SQR,@(r @@@ÃAdPdPd@-(^^*,@ Q 0+0N,2*PA 0r%r@P c`0Sfffaj(bb 0+ 0NR@0S QR@@O- MP6,`p@蠟 @T*Q QPPaBHQ0 0A  P !(R p(X! 2/p < 0 Ѝ ЍHc$cؾhbXbA-@(P $Pp(pWa,Q Q 0aBa,pPq0 p,Pp@-@(Pp0P`1(`Vpp@-00S S* $pPPCP @P `ACfHd$b`kk@k@k@@ PU`0K0CP`V P0Sp`PTPHP@ U PU`P V `V`%P P0 S0 `0V `` BV` V`Q R @ R RP p h $P P@ @p $踺 h O- M@ZX'PQW Z A(O 00!,PP`,PaE`a0ZpPppa Pqp5, PPm 0 ,jPe Q,4܂PY !0H!0p4,PPpZ P4P0PJTPP*`pPY, PPDp`ʊ| `3p ⰱPZPPQ P ЍPU 0p S0G0$ p  `0GVQ 0QPC 0p0WC R R .PU  RQ/$0$\/ P/dp@-`@P#0P`T0p$ R Q P8UCPp0G-P@Q訡 $ Q P P0  @`$ VQI0S R H@p 4  0p$` WQI RPUPH p P I p$ 0 `S R0 HSPU P@p x@hT @T :q@p@t̵|0H-P0S 0@@T@PU @^8PtVx 8P,0 00@ PU @P@U@S 0A-PP QJ@Xp0$`SRJ p`V` p`ApBX 0S0P P _PU   TPUP;0 P CP8 @ #8 /0H-MP @0@0Ѝ0K-MP P@Q E0Y  `I  `V PЍp`^p `V`4pP `0pD QH0 P$D H0` 0 R Q B(P,0 qB,0 0 !0PU(p0H-MP @0@0Ѝ0p@-MP @lP`0 ``F oob` P `PЍpPxدO-MSP8U[SZЍ@<@`PP p @p8 V0$ @  AY  bP kPDQH `$H(PPPX`@p *pW ,[D 0`0S@P"  Pܮ8ԭhH-M  @ 0Ѝ$P Q/H-M$000lЍЭO- MQ@pR Ѝ`P{P @{P, KP0v 4`P# 4<0EL0P00 `8|Q@`  P$pH* P@lp\8 @P4C `{P< 0@0(Q?  Q8^U80@@8 SR$0p@8pSV0 @8  R  R| !R$Rv RdQ8p  @f8(^00 4 U ``  y 4` 0, @, `4U" 0 `H-MPЍA-@  Q@(0`p,0 Pa B,0 !0P P 0pW(`p@-X ]80 @^_O` P8`Q p$0 T8R0Q08Qp Q !R$R RdQ8pP:/p@-M `0 B 0C@ P  L 00N```ЍpO-DMPP@QDЍt¿pPlW`GSA@?Q`0C@C00h0QpRL@\ K@P op0K P0@ P0 0VPbxp` V` , YPPYZ |@ N $P   0 0P  Q:긦إP/H-Mp@pQo : 0 tx P`a%P:9 D 0` FA/   Ѝ@(H-M0   ЍO-\MX0P8  P0$ G  `RPR0J J0pR  0pPP CJ 0P@  8 @ 8 8@88 ,8 80 8 : `v q`R 0z S(0sp pqs4E R :[,@``v@[P PpP,0PE1PPP0PP 0P0,p0C1@@@000~`P4@4t (@0SK$,p(@,04q0 ,p$`Q(0 pR ppW8` p@(p@W@ ppW8`(@" p BR`p@@ F` 0V (0  B0s`Tq t@A@T00T@0p 0sP8 Px Y3,4t00 IY) @!0 `@p,p qPV@T `pvP @Tp`, !0ꨘ @ R0,D,p0NX0@!1 0`00&04 ,0`0@PC1p0U( 0 " #@ <04P  @\$@@p@<Ѝ 0, `@  AVA00Poꀗp P0@, @Q 0`B!@R@ V0$ 0R(0@P(pT,(;P@ U&X ,,`pP Xp`p 0$ 0@P UW  S0(p00 Q\ 0L0 98 P`$! @V, 0 p P EDP P% Ȍ|p Pp` ` VpP L D0|0p9H pP8 UD $갔( U :k ` PE U k`;+0   0Y,AH娫P u {p00 `P 0B(`YPp R P 1A, P -A P 0 + 0, @`  P /Pܓ `0$C,p(,Q, ($9 0 `V1V Q 1Q/J,V,0 ,PQpVP* Q pAPP pW P @ . ,V- `,Q&PU :Oq  ,PE |GU!   0A $0V P,Z' H,pzl\4L4P$Pp R,0 `<P ( ,0  R P i( @wp `0 PU iY$P \' &YT 0  H@_@ P ,0@   RQW@ ' =  @BT<[S8P%  gPCAlP '  xP l N`PCAP < 900@@ TAWgP ` lP PG@T*lP  PZP  PCApPJPP  [-FVf@P`  [PJKxPP PCAEU@P|Q A i PPZ@P> 4up0@P9 e`  L @pPUG/@TPP nPCAx \4tpD@,Y```T P \@T`pppJ WF, $ 0S!`q 30S0@?3S P  P PCA W5 @<# F@ P    Ѝ@PTP D" 4P ( PCA  @T(QpaP` s qpWNGxPP PCApp2cp\Hdb$x 0(Had =0H-@ 0Pp  0Hn0H90H-@Pp  0H`0p@-P 4@`p  p@Mp80H-@Pp  0H?0Q 0H-M@ P UQ U PQ, 0 Ѝ0H/ P@$PUPp@T@O-MS H`Pp NpOOpq0Pp0.Qp  pP0000pEp` 00`B/Q *Q@`hq Un HD 2/`P$U<P.X@>P [.Q  >?O  D.Q `0000F 00BH/QDp *Q@`` `Q PQ` Q'qr PP@7/@DTPH`PDp PPЍ P qprP@7/@DT7 6Q H-M0 R!R Q L ЍH/ $ R p\3H-M<<000  0ЍH-M0@@ (Ѝ20H-MP@PQ PQ   PЍ0dQ\QD  << x0 0Ѝ0t3L02H-M@Qqp@P> Pu0 @!N+A2"!K``!a  % a!`paXP `V $Pp`Vp fPEP@ @Ѝl2 H H-M  @R  qp P= P 0 k,'@2" C`` a   ? @paP `V $Pp`Vp nPPOЍ1 0 K-MPQ| PPV `0 ?-( ?,DC2" @ pA$` $a ! "*#E"!`qP* aV$ @T $P pp@T WsP P`V X PU v`}PЍ/ 0 O-DM4jl[Pj P @ @ A4@:3@P2 `4:P) P Q5 21=Q< #Qr Q+1 780 8q<N{A''!K0`!a$ % a!`pq PPz =(P p"@kPi180 q8-x ?|D<S'' @ 0A$` $a# "*#E"!`qP5  Px-1 80  98k|<w@'' C0` a# ?@pq PP \ P P1  P- x P) d P% P P! < yP ( sP  mP  gP   pKY F P P ^P6V, t`Y  t `U z``堀,=@D t PpᲐQ7t P`t`DЍU Q`DЍ L  | n {  n  6 "  Զ O- M` pZP @0p     00.R A*R 0Sf Pp%p+c p  00SB   RX%S ,S  RQ p00\00000+0AGS`1ppppp  pppppppppp$ppppDppppppppppppppppppppppppppppppp ppppppppppppp  R P       0  dQ00  00p  d V  QP` `0cp        p)0iQpp0pppp6 QP 0p0000Pe Pt%0Bp %/C0  `%%G +%|%+%+Ccp  p PB  p `*`  A0 *@ P,pD Oa0@@W:P\Q P^P  P \[$ `J P^ @ $< pWr/> Ѝ' 0H-0 ^^ \^& 00NS* 000 0 ^\00@ P Q0E   C ~0 % ,  PP ,S 'S\S/{ dS :) aPP0P! S :@bPP%aB0  b0PP%! N0 00}0:S ' 0000 0 O-Mp@`PDQp$ %QpPp1@ Q:PsPplP T TX  @0@@T`ЍMH-M00  0ЍHЍ/O-sM`Q pPP  Z W|Z 00`4`P@WP, 0@@PP @ P A`K QP$ %QpPP1@ Q:qsPPlP [ [f 0@[ `8 P00V @ @ @D Ax @`Vp Q Sc ,Pf  4 @`@%T TRp%W`40 P:P,H[PK 4,0P%P 0 T-p@ p0Pp @@Q* 0G@XSe Pa0d.Y08 0 AR Pl00Pp0Y \ !G]P@xxTxxxxxxxxxXxX4`xXxXxx P @ aP @  ` P&GVQ \888,48<8D888888888888\l|888888888888888888888888888888888888888888888888888888888`4 P @ A P @ ~W !Wo|@ Y4 `0 P*,P Vp,YP 4,0p 0W`p 4P4) PP*    P 'PP'PH P @  P @ A ;R ?R%Q Q P* @a@Q OQII/P88P@@ P @@ APP  PT*1@P OQ$80p!! !P  P @ PpW | P4 10 P*,P P @ P 0 0p0@   PQ*    P +@`>`@<V9 ᆶ`6P``2@ob.P``*PV``$``!` V x``P}P}PBl~W OQ  ` OPa  P &A@Q# OQGa ARI/A AR 6@40 P*,P b`,YXP\ 4,0`T @4 @ APT&:%Q Q  ;R ?R eRP$ P" @PT*Y `,XP 4,0`  0Ԁp44, 4 ,``sߍ MH-M  0  0ЍH Ѝ/ MH-M  0  0ЍH Ѝ//ἥK-Mp`PQt~`P# P WpPpBWP  @TpC Q& X.pX,EX#< T tXd- P XG X: X7 Ѝh D"pP Q  (P P  _ap(P  SapXЍ@8, ڬD x x [ У\ [ @-M0S C@P  ЍA-P`P p N@XT  DpW_P YP SP MP GP |AP 0A꾀 < o ^ O- MM \pP /P  0 ЍۍOKP= Q/Q9 P6 @`KXV.ݗ`P& @=XT  Pp  0`)XA V Wg@3 P$ `@Pt@:PUppGTP:PW g U g  0PF[P P9 P 0 ~P 0DP% @`P@t@:PppGTP:PW g U gw  0PF P P Ѝۍж  ~ ~ {~ _ } } O-MR `@P pP P!  A @%RUP P  !EUP  P (6UP  GP UP   rPp R  pPpP ?@p  `p[ `Q'pQQpQpQ [ P `A0Uup  !P 岐$ Q$P r $P` PPR V$POV$ TP$E `YC [ PP0 0Ss0  r0P, psP nP fP0p pSpp1[pp2Xpp[ `Ѝ/ p`P[Aqr 0Xp`G-MtPp!` 0} P4 @P~pP+G Q@P  0pp RnЍ P 0P  0pP Pp p\x ȮH-@`P! V PPP` |P p@U oQWU oO-M- M@P  PP,PPP  `,`3@UPH p|P  倣P  Pl @@P,P ^`OP  P`c  _PPFp@SPe  IU[ pU P  p及WL ` P(, (, `pW> 岀PPUZPUJ  $Z @TP SP &P!OP ( $@Z㰀( ( PPP]@H .U@B]&U @ @及T3 Pp`sV nV fV   P 0&  rP @T pT ЍЍ:s u > s A-@P P|``P,PvPOP  pP{ wq q: A-@p` PUP RPPNP !Vpఀ  O-M`#8P. LpW @@fP@pW PPr @sP nP P@@U PZ  0{pW: 0Pn4sY nY fY  P H DPUP @RRP'@P#MNP H @DP pH@HHsY@ H  nY fY+H @(0H0$P& ,Q@?H P00@H 0ఀH @ H  H@H HHLPLЍd o }o 0H-@ PU0P QMP!0@- \ s\ 0@T sR nR fR 0S00A- pW `@`pW P'`P sP nP fP` P`k`M0H-M@P 0^ TBЍ0HЍ/K-Pp@P @P ` `(8 H0kMP* `p Q`   p@Q  p岐Q   pP p@ @,@P ,@(`  `<@P <@8`0 `L@P L@@HP PA@-0@@@@ @@0 @DS @ ES0x0t@\T0:Q0@ 0S S ^S@@\S@ B A-@pP `VP PP!PLP A pP  H-@`PpWP zPPPuLP `  P  O-DMp @ P  ,P ^P00\P`00V I<I|KP@|P@P: DЍZ P: 0 T xP:d 0bPPOP `< P`P,PKPI  PeT<`P$Z5 @ PA ` ,P> ^P00\Pp00W `F2``P,PKP  P*<`P P eQ<@bQ`Q^Q@\QZQ XQ0VQTQn `FYP HQ nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- @P+ PP.P, 2PP(P! K P P"P PP P  @PPPP P P P PPP PPPR0Ѝ0H-PqUp@@P1 Q|,``tP | p` `Q  fW|`pQ  YP|37`2`F``Hp@-P@kLiLgL eL$cL,aL_L Q舊t/\Q/H) @-Q R$ R R 0S4?0LS 0 S00004p@@4?PT <@$0@-Q R$ R R 0S4?0LS 0 S00004p@@4?PT,04 <@$0A-P@P P$ RpW P`4@Pv0V&`v`fVP8Q(P(` (2/(`8 P $PP Q4/AQ 9@Rp 0 4%04? ,@0@4@ @p <@@@$@@pP T @@@H-`R @1P8S T* 0PS(00 0$+P$(3/P `p8`@4nP P$ (2/`H-PQ @1P8R T) 0S(00 0$+P$(3/P P`8P@41P p$ (2/PH-^ 0S$0S\ 0S4?0NSQ q Q@0 S@0<0<<@O-lM`Yph P $PPUhPlЍ P`4@Q \ Q + 4 / 4% ` ??<P B, \ / t ( X  p  D @@P  D 0 T$@L`\P4 @RX !|8HX|$p @H ( <`$ | P P XT*[ T 0KT*S T0@K 0T0T*X[ T KT*R T @K T XTXT  X T*X0pS T` CT*R  CTR  CTR `0CT`X0@T:X[6 T KT*R T T K Ry T T K @TT*X[ T KT$*R_ T @K T `lXQ.:`Q08< XA p w:l(X PpA`G P 0QL`<88l`H@LTXP@PR H0S*` V p`F0S:8L TX!^ PNHa Q TX0S T 0CT*S T0T  X00CS T0T  X00C{S T0 @ 0T0X@Xr XXT @+X z!P2B@PX`P  CP`V XV`V`Vk T  H@@ p PTNHH@@L`p?L`XUP  @ p"D@0?,PQ:P N@:XT[ TKT@  AG pPp0`Ph  `T 4 p:X``pp@CL`Jp\T8 1`T*XT0[ K0 `S:<<0TX@ 4@@X@ 2&q@pW-pT P  @X@T p 2&A@^DQ@D⪡QL`<8XH@p40G:岀L`0C:@   LpBT:4`P @A:^  8 @I T`/Q>Q    Q 8P R R 0S/$0S\ 0S/ 4? BR $0/A-M|P R $ R\ PЍ R 4?0BS0S@@T:SRl.@ <030<  P0b 0P!@ l@PE`0,@p0WfV03ST*@Q`: l,0 @S Q@`PpV@PaQp3WPT*U:PlPU  0A  PKri @,P Q0P04P4 PPP``0?pPPPTPP<@$`P lQ R/$ R R 0S/4?0ASA?Q@o/K-Qp 0`S@$PPU P4@PT (+3/pP 8P ( 0( 3/P$ (2/0 a *b ga Jb+*AJA AgA4P@Q :o-QT04%A 0C PT pYA4p ( 8 8Q R/$ R R 0S4?AQ/ / R 0S/$0S\ 0S 4? BR/ Q P /Q OR/$ R R 0S4?0AS/ 0ȠLQ C0QD0D0A /Q R/$ R R 0S4?AQ/p4@@@/O-MP`80R 0` C C<4 @P0PU0pppP[ 8PQ0 Q, Q( Q$ Q  QQQQQ QQQ f U PV U@PV6p@Q/@Q+@Q'@Q#@Q@Q@Q @Q @Q @Q  @Q @QQ @UP1vqQnPQS2JhQ6QcPQS+J0,`QQ`PQS"J($`QQ`PQSJ `QQ`PQSJ`QQ`PQSJ `QkPQSZ Ѝ(Q0 4o,0$0 0R0000 0d <0@0R pW p`4P P Uqpppp 8 $p 0,(`40P :W``0C`00 Dp, ; 0`@ D000 04P$p`(`F`0@ 0  TL <@T` V \ D T*0 J pAQ 0 P:0  0@p  P0%S00 018C!! `Pp[ @ 8 PPopD U@P [80P  Զ @ O-TM{ a04P Hp0C,@0G0GX\083LAP,` Tp P@@<4 8D0(`$T 0P @Lp a @D1V @\&qa@D1V  PU\* ^:Y< Ⲑ T040@22@D 1T 0 @00D ` Q @D1 @/%aQ@D1 `T *PPU*0@P@P@6p@D N1W10`GV, R 8 RI Ri*0F$  B`40YVPp`: ^ 50G0 0 0[1:0 pP` k R N 4R80 NPPg` 0p`FS PPYm pI0WPbc( Y40 B<VPp]: ^@ 50G0 0 0[1U: P p0`P k R N SKy40 BYVPpg: ^@ 50G0 0 0[1_: P p0`P k R N SUX pY : I Y    Y  Y   <P< p0P ` PU ) p P804 `V  IY#S#: U 0[1:  k R E S P p0P ` PU  ILPY: P0 R0 L8 IY*?/  <PpH Q/ H`0Iq0E 0P0C @ <TЍ< 0 ( H-M  00ЍO- MP8@P 1P<8P  Ѝ@U p 040S(\20 0$PL$xwWpGwpgJQRWWXJ XYJYo(&3/W@ pP `* 0qk  (40p2tP  P`,L0TXp @ 0   ,QP @0B 0  pWpW   0 LQP$ IpY  , QP @0 0 IPH  P- , R P0 @0  0pWpW  t 0 LQQ0 p 0 00Q ,P P  [$PF  P- , R P0 @0  0BpWpW  % 0 LQQ0 p $0 00Q ,P Pg,P7   R!pWpW   0 LQP?00 0 0 "$00  ' 0q pWpW   0 LQP PtPg P^ Qe Q>P tPtP9 8l 0` 00 00t0l C 0tQl\ 0R8UP @C l\_ pWpW  B 0 LQ)VP_ P t P*)tPV P P`l2`lX- 80 pSW) W W$ WgWfWeWdWc Wb Wa  W^ X8{8 00 00 00t0l C 0tQl\ 0R8UP @C8 l\ pWpW  塿 0 LQk      B! R R` :0000B p0uppp 0uppp`  tppGl0tp p`Ql-D 2/4V= V\0l P8U BP l\@ pWpW  # 0 LQQQ P<V V6  0p V L D pᠾtP\l pWpW  ھ 0  QLP7 VQ60Q7 000 "$00 #00 3 00  00  "$00  00  (ЍЍDv 00 < 0 000 00"4000 `~ pWpW  a 0 LQP`oЍ  @0 0A @0 0P. \PJ8l 0 B l\4 pWpW   0 LQPQ(Ѝ4iiT@-\ @T$@T^ @ T9@L8T;AB\*\|0 p@-1"!4P#4 P%0U $PU^S p@T9@@8T;A*PBPP% P Pl@ T@T PPU `V$PU `V,@T0@PPTU T0!&!'pQ0pO- MP 6, 0AS00Y @ *R:1\lp B`pGoQo`1V` V *0EV ?o 2 RiUg Ve&%o ᠒ 0z `@&@@! @P @T@T  堼 0 LQW W8p\  ᄼ`F\ P \, C0 PV   0  B0t@ `R' , V&*<l@P 80Al0 TlPP8 0 CEl, l@V` l 8A2,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l lP ,R@ T@T 8  0l, l@T@ p *pP,0qB\5/WA 1R0Q*pEQ0o0`r0S?U= 00S9Q7Q@@`U0Qpp0o`8 0 op\P\@T@T  奻 0 LQV` ЍA-Q`P P$P@T P9 @8R;!"P*PU 0 b *`J` gb&*@J@( A0 0gA3/`P p&p 0 (,P3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 , @@ L DD ߺ !ں| 00 `$   B`p@-P@P@T `@ ᷺P P 0 0 0pO-MP tP tQQ P P:8 lH` X@4 TP0"Dp @H p0Q , @ BPp`Pr: @l0`pp`0C0p pd```#d` C;P<;p0 S0CR @ B C`V @B@^ X+0=r<t@`T !`FRPQ p^ N p尀PX%P@Dp^ @ @`pPRP`b` PRP`b`1P`Rpc # `Qsq1#!@TcJ$ Q 1 R `pPP`P `F pVPʰ DЍO-M6v`0{Vp | @$@p^*@\" Pd$pAඐb@ᰂ`dW3`p p!`` $`pf@@D9ᰂ q@$PbpEB`gU`PP@P!`@@`$@Pdp@GRppS /SFPPQ PpP`p,`>PX` P\ ryP/Q PY (>Q (>QP AQx PQq  Q&  Q@=R(  P R0!,PP"Q qR  PR "R $PP>Q  0 0G H .H O-MpQo*8`QP@ QT "QM  \Q _ " @SRH 0!Php| ePWeh _ \ Y V @P !? 6 P 7 P P ?+7 R!$,O RRRR R *T# !,! "T  0,#  "P0""900#0  ,   PW [*  P$ W Qy*  P W Qp*  P W Qg*  &R @R[ <R\ W Q]*  @a BRL0!D(((((x(((((((( pR% mR3 pR ;R.& @ tR ;R&> @ tR ;R< @ uR oR tR ;R"  oR  sR ;R' @X@\PЍX\@ 0 0CA ;B RB O-M-JMp` V'pP80gPP3 <V<Vp V! VP  P#P`~G`@  ŠP AQ  @ PZQ+[0A S2@1X@60?"Q2 6+Q09 6-Q05 60A P00:PaQlQsQeQ ( PrQuQeQ (60@50 @P5"Q0(50I $3/Py $ F/ 0PO 1A $4/Pe $〠@@ @Q p<Pl` P"  P  P^PR PM -R-P >Rpp<pP> >P p PP4  0 0CS! IF/G?PPcP! `IFGP1A P4/ 0POP Q PP JߍЍ< pPP (PP Q uP[ PP P~FGo@P{`t"u%FQ8 d!t!FQ7 dcGPdP01  uP'   uPO }uPDH ruP9< $0I $3/P $  0P 1A $4/P $ aPV\   'P PSPIF/G?``P PIFG`1A `4/ 0`uP> x> k> |ld< 79 QH0z\ؘH|ܩ]: O-MPy`,@p> Pjp F0f pW*/    0P~z  J[   0~p j@  2 Ѝ G-p0\WF@0uSBA0IS*V0 a0IS:00I S3'P `A0ES:a0E⩏S:00E S%'pA0GS:a0G⩯S:00G S'@A0DS:a0DS*o00D S '` 0000H-@@P 0P2P,

 `^ 0 0  0 02 0 0{W 0 0rhd d0 0iH8IddcDcbbaa\a+ 5 , + . M, ]+ ~. . + ~. . + 4, P 80 SQ 0 S /꬙O- MP @D`Q Ѝ'8.4P* ,婰 PqW& P PIQ0 S `C!z4<@4<   ЍOD@ @0 0,v( (0 0La) L, ) =) , , P 4 0 SQ/ 0 S /P , 0 SQ 0S /4ꔗP/ R/pP/ R/HP , 0 SQ 0S /$A-`P @@PP xp/ o(P,<P ApP 0p A* 萖K-M`Pp@P 4"Q& }Q_b APV 0! +P ,P\N0`! P@ ,P(P;"P5 0 ]P, P3*P "Q :Q  P  P pp 0p P pЍ,( (0 0& J I 4 1% ) ')   fp@-M@004 R;P,S Q R& `V8 P)  0Q 4,A4P. j `ЍpQ j 0 0Ѝp`ЍppZl l0 0XyT T0 0x@c< <0 0o$ $ $ # =$ # # $ A* u# # v$ H-4Q , 0A40Q H @< <0 0M($ $0 0D" $ !$ " # # O-M@T*P` 24P  peP pIP P Ѝ ЍOP PL `P <  *@P<Pe4P,Q\ @ pPX pP\ នP PHpWpWw  @P$W-  lP% P  P  P  2/P 4T!  R! P  ph { @  pP^ 0pX\X!X1 0n )!1 0e!1 0\ 0 0S 0 0J 0 0AD@ @0 08| , t    I  !  + D M ) ! q \"   t! ! K-P? P`VA@V U1U144P pP 5 , !$ ,,P  Q,Q 0S pN Qp D!@ @0 0,7( (0 0@      @-@@H-HH6,QBlQH-$1وTQ`Q4VSp@-@P ``QPwP Q `< R4 Q ,  aaphd d0 0XP)L L0 0O84 40 0Fꄊ    q   M  0H-@P4P L R< 0H%  0 0L1   @-L@}P*0  0 0lO   H- Q 8H  0 0q   @o/K-S, `Pp@V  ]P  P,Q 0K_ ~ 1 0 0m u  H-Pp@P `M W  P  `h`N xH-P@`P oop,% W@PP @؆H-P@`P oop, W@PP @lH-P@PpQPP T@ p`P  @ pA-@P PQ P`@V pPW lP  PP\P (`@P 萅Q/ 0 S /ᬄQ/ 0 S/ငH-0S L RQ R0SRដLH-@P  R  `PV U  P  pႊ@U D@ @0 0,( (0 0m   I   Q/ 0 S/ P , 0 SQ 0S /H-^ 40 S 0S Qlko蜂H-MPm (PPi@P* !0 2P$P\ g  `p ["PL $ PF"P 0,!,1 0# 0 BP1 `ppP+ `0 2P Q P P` pPPP \` p ЍV Ps ( ; O-Mp(`  P@pW=Q@10 A /Qh U P V T0* A U UP V P * A!!  P V P* A!"  V T7* AP y-* pGZ@X$ pЍ R U:0p0@ `BV  =R p0`0@ p AR<Q Ѝ @-@P ,*G-MP*P P(PE 0 Pv Z%:`p@P &P5 $ P- % P% ? P JZZD pZpp:0 S 0P1:p  `Q CZ  ЍG~ P@`- J0Q0@ p@P`'P % P Z=& P =P L ЍG Ѝ,t( (0 0q}t 8 {  - H-0S RR hioP P@< <0 0I($ $0 0@%  0    0H-@44 (T$PPP0%??@-@T  RyQ  0 S/P/hyQ  0 S/P/0yP , 0 SQ 0S /gy0H-P 0(PP @0  P |PP 0h  P XPPTT vP040 00 0e x>> X>X#\ V i p@-@@@P@PU,``Np=w=/0 0 Q \ww R ,0 S/Q 0 SBo/ $     m H-4QA4 0 0+   O-MY*@P`4P  pOP p3P P P ЍDЍOP ` PV < Y*! Q8< Q%4P;,qW P  2/P 4Y@! Z!P p @ pP 3pQ 0 0V 0 0w 0 0xt t0 084 40 0xiih_ ,h 6 I i Z d  @ ( K-P! PpW2@W U1MU1H4`4P`P>< , $! ,LH H0 0$ 0 0` k P @-@@ p@-@P ``QPP Q `< R4 Q,  aphid d0 0PQL L0 08V4 40 0ex  T 0  p@-@P ``QPP Q< p@D@ @0 0,w( (0 0`d|  X K-S1 p@W' `V" QP |` vV 8PL,Q K'%  0 0T|cD  6  //H-MPp 0 0> : I O-GM  ^EF  0PV QUU Q 1/`@LP pP T 4/  2/pT 4/W LW WqqW@ PQ 1/`@LPPB  2/P T 4/LPPpp& T 4/U3 1/Gߍ 0 0 0 0 0 0 0 0pl l0 0XT T0 0 C  { W k r # N h j * P/ O-KMP( @p$T QQFGE 0`6/P( P  JI/ 0P $q(QP6 1$!( vP qQ$q(Q Q T JI/0P @J_Io($  2/ 0PKߍ# 0 0B //@-@@#0H- R PP @Q!IP  ,  @00d9` `0 0L:H H0 04;0 00 0d @  \ 0H- R @PrP  R00G-MPP*@PlԂp/W5`x (08<<bp\W W  0P `pXPX Ptpnpfprp\HPH CPC @QC ;P; @;Q <Q >Q&.`P. g&Q&#`P# aP mP p &`P l P tP ;P`Ѝ`  0 0 f - 0H-@ P P P PU:000H-Q@P 0HPpP P0H-@P@*pPPQP5 `pPP. P*<`PP# P ppP PV  P P `pP P>H~I 0 0v A p@-@P1*`PPQP& `p^PP P<TPP /NP P `pDP P>p@;pE 0 03 5 H-@PP*`P%PQG P ppP> P QP,PQP0 `pPP) P%<PP P `pP P/P >HppP PY 0 04 D A-`PY P @TT pQQPM  lPC W` p 4/P5  P0 P" P( `)@<pP P  P  P @LP  tP` S SK-MPP @*pUPP. p  Q:t?` o`kPfgPۍ Ob@@6Rp  `P Hp `ķ· Ꮇp pd`P`pp6P :W t.PЁP @Q/Q /Q @P*U @U P/Q Ac pP`1 }) on/A-`@PpP !P P @*QrP@ TBP P0 0A 0 0G s @-AT\ T%@QARS ^ DQ B@R S ^  Z 0 0^G G-(MRP@U tP0  ` p  8P PT(ЍD d     /     / 2/ / /     / 2/ / /     /K-(MP@`PP(ЍK5Tᅀ$P-P (Ѝ 0   0 B  ppuQ P QPT T (ЍUPQ @/@-@㴵Tp00$ꤶ@-@P @-@PH-P 㴀[H-P 㩀[H-P 㞀|[H-P 㓀P[H-P ㈀$[H-P }ZH-P rZH-P gZH-P \tZH-P QHZ@-?^ ʎ 0! @T 0 @S^# 0@T 0 ^# 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@5z P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@P~8UUE@33C @ @ /  Љ **B"6 S d18@HHPHXHtH|Hpc? b Aa-lsww -   r !=-  S - Sx s S  w -   r -  $0 S- Sx s S  w -  r -  "  R-RxtT /G-tP( puP5  pMtP-*@t`qP t`@pW   ^P =P qP긁Up@qPTZupQ0H-M, (2P$R0H PD@P<80( P @@pn  p t|d xtNp PPP A P\ࡳoBK ~ ~?@QP(P(d(0(t8 0 㨲Ptp(U 4P L@ `gp*P L ~ ~d L@Ѝ0fy  0O" 00OO-MP@R D "P XptЍ`{P+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0b@I" 0김 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Ql00LO-MP@R D "P fXptЍ`4{P+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0qa@I" 0" 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Qlp@-M0`(04@0`,@ 08PpЍpPJO- M@pPP@pQ`PR` D#P:`@?D`  0ErP 4@0`P Q Y:8`<@ V*P"PPV WY :80< S3P `@ ЍA-Mldp`P@|@@@P p@ R |0RЍ' <<Gfp@-M,`0@(4PpЍpO-MPL0@HX"  `A@*  pP!"P "T" oPi b ARE0!X    t            $w t!/w' %w' u*w' z wTp!w' qPQ( xQ*Q@  0D L p0 Q'! P! ` L0Ѝ P L  @pD0 W 0  0 ЍG 'K  $ mD9  //O-M 0 칟 pWpp 0)șS  Pԙp  @尹 pp0XYSPL `V< WN A@-P`V  p`P+P -Pl H@t/ 䨟 z `J Gp ?Q  ?Q   @@BY \ P p0 R @@f0S QQ pG@ܧ z J P@ >Q >Q  @@BY \ P 0a R@@k0S qa`q4`@`@@ @Sq qp-V@@PD =BkPp@r `@s:V +@o.kP WV;Q :Q`& Q XPP:P>`?`t@```Ѝ쵟 {x U pDPK 1>Q +>Q D PBZ[ \V P 0a R@@i0S Qa`Q x`@Tt Ppp@T  zPxP> u  0S 0S QPZ* `P:PI D nC ``yP+ppWL$PkPu BP$[" PP:PHQ p-P+P[VpP:P ?`< @R_[J S:P*  \TP:Pg<WppWX P:PO`-P+P:`:Q :P?`P!10 PP  `P``@PPx`P:P \ Q @ 8! A-P+PW DDB4(8Bm<0@DMA(XxC4 ?Lw ?`;}|r ;@: |r ;@|!==u <H<s <<=;;; :s x::;t K-p`P+ 00P!-Q@⤂@PPU% -U -PR)p"l2 00<<PU (@$" P@::U 1A -P@@-#iP P iP! :Q1Q @:P P>A!1 00@P00 ?`P:P P # 0 :`:P ?`P # 0P8\x4 yxx 7D w w[ 7 H-MP`QzP3@P P p0P 0PPP PPP `PPz`Pz`Pz`ЍhA-@` Q0 pS P1Q*P pEq Pp pAWp r Q  1 H-Q Q Q-s& 0 0sAQ6zT  0 0Ϡq  0 R1 R010 zƿ   j H- X P30 X030/o" F 0F/o;" F@-M@ 0EPЍ0 H-`@pj0VVQ UPqkA-@`pQ PTPPT {P  ?D 0PpB,@yO-M@`pPU( ĠT (VWp` @ @V@@V {P \/ @D P $(,ЍiycЍ4r!#/H-R @P`pw0 !#3/p pW@T@ /0H-@P5U 0H/0p@-M0`@PP ,P  p$P  p toЍp0H-@P i0P @ P 0 P  QQ$8j0x 0p@-0`P@P ,P  p$P  p Fop0H-@iP@P3Pj0MH-M  0 YEЍHЍ/MH-M 0 00DЍHЍ/@- MP @Q ;t  @PJpQhLH"t@  D !< ЍF $ z,P,E@/A$Q//) ) `A-8M@PP 4 i`uPu uPq uPp uPl uPh xuPd duP` PuP\ <uPX (uPT uPP uPL uPH uPD uP@ uP< uP8 a`<0< RR `1R `2 n)0!0$! 000000 0 0 0 0 00000`  `2JspT  on4P8Ѝ+ i  #  ( 7 C J X c V m u H-M`Ѝ@-M@P@ЍO-MMĄ`P@p$q p0 U P 0д @4 ͂P @崂 4@WQ D,@n@̔D,P; P8i@l8 ;sTppP8lP5 x0 㒨p6Y p0 ㉨p-p@Wp*pP. |Y t %]x@ 0@\PЍۍ @@xҧ|㛨PJ㖨p|ƧY㍨pt㇨pp寧t孧WpP$l P"?tP# :tPl$QPQ/P}x!P @46l ,, 2/`}P`Y  CB[ [    00   0 2 Rᩨ'. +{Wڶ = G X L 0 O ж ?HN$ŵ LzxW? O-tMM$`ᬅ@pp叨P @0 @HDLۦp `@,ph,<d $@$@T=  pPJ ަ pTߦu0P ,@,u#Pnu=PQ0 up 4 h]}P 0 $lup @ 4h E}P  $gl j@X T.a@@Ꜥ,Z@,; , EPU(Jㅧ,``@# 0d q 1@qTXXP崅PpXu PAPLLuPj ]ipz  ,pP@p p p ` P`PP `P P  ` P Y7 4$h( x iPP( h0`|P&`ݙ P!( `,ԥp0 㟥pPtЍۍc렀Y$@t]D0  p" #  _ q _0`C w  = 4@-M@P@ЍG-PMP`,p@!Lq p0 q P x0 A( P @ @tpQ `p,p"kp 0,@LPPЍ|H K   K-Mȑ@PPU `0 AP A@ A0 A  A Ap C C U&R```R`  a @ PAP:JUpU ayp ڲp)s/$s@s@ Pp ps0P @ Pդs#ͤPЍA-(M`P Pp0 C C0001P@T  0PP @T (Ѝ O-MMLHP `RlP  0@Pp@.WQ PH D ;@P^DP[ NN+*j+Zԥ bD D JD@2P pNH⏥pP  P~H♥pdPDPP @@@  0P:@l@- P堤ᡤPЍۍ7\;    զ ֦ ̦ F @- MT@ P@0 0 A !H Q ЍO-M0  r- 0 [P PP@ R PK  - 0DP g`P 0 0 p ,p P``PPK BP[ U@a880` PK R RprQrQ  @@T -P +P,!P- @P-P P  0  !PP @PPP Pp  0 `   -P +P&TP- @P,T" 0pf*TP! @P3T" 0pS`oo `rooZP p z ZP! - 0OP XoP pK@Y 0Pߍ p<@- MP@P@   0 0 B !  Q ЍtG-!M!`ሡ@ 4P @<;D@@ yPI@; 4p@yP= P  0 C0@4@ pp@|P)P:@;`pPU  4:``xP nP@ ; P0PP00@|<P!ݍO LϠ K-8MM8P`3 @ 4p43D@xP5 P0` C0@ F 0p @h|P" `V 2@3Pp`V  42PPxxPtnP @ @5|4P8ЍۍL G-@PDh0 @P p`0@ZA*` p00F Sa0FSWFA0FS7F V W0A0CS:ppP W @ 0X4@dLppt\LLLX2@ 0 @0@0 J J@J!P%K-(a@`p?PU ?U` ?`# @0 <`P >U.:W$ .P p?0P V*pW:V'B71@4P1*p@@V *p`ppQ:,?V35 | p@-<`P@`}(00 ✉@tp  H-M0@P`(p( pr Ѝ?@-(M d 0@0@@ {<Q ,P 0@(Ѝ軛 +O-dMB@`0p`P"F  `Pll[ @  0@@Pz `,Pp  o~  0@*`Pc mP# , 0 P<P,0pF @eA=l oH0aAeap@`o&|@o&bA&eAܜ 㐰o```ba @ `H o&@o&O&@cacAabA\p@tp ` &`''tpoeq@`p`a}<@ P`qcqp`o$o& &`Ob! <@-8@ a!`!aq $@x`'@'pOc1 8@-e1 @e!a! 00?#`?##p?`i!00e!i1  ,0 ?#` ?#`#x?ad!,0i!d1  $0?#` ?#|`#?$0e1 `1-P p`!d! 0?#?# P?#l0oi1 `-a1 `a!`! (0?# ?#?#0/d1(  g1- g!a! 40?#t ?#?#0/` 4 @ fgf!0h l/"0/"" |?a0 n0nf" !!h/g hhn dp!p !_!@P/f c  ch`!x@!!on``i ciq`\p'ba'h'pOhqbqiq\@@p@`o&o&&`aOc10`qbq@@@p<`=0o&@o&t@&do<`iapaa} aq`qp8`o&@o&@o&Ob!@@ 0`cq-aq'o&|@ p'to&A &bJL_`0P Pp,@lc _$$@_% % _a,PpPbl! !_$@_%O%@oPc1x@ 08`?#@`jb!?#!#@堐l1p(p`1'@j1#0#'l@'(b! 40xp-p?#d@f!?#p#P`!"l_%?_%p_%0j1 "O`@$P tPa1O$f1#0#֡ O$_$h1-bL a1#O0#fa 0ba ha&|p@&`= 04Po&po&&poahp`@`aO$ba&O$ $`&pOhAp`cAm`A$ \`@$o&po&&poPpb!@` aA-o&pcA$ @$o&p&o`<` o&(p @la o&p& oc1` b1o&lp l1#0#o&dp&$Poa0`o&tp_& 0%,Pd_%4pb!o!la_%`a%da&_ `&b! p8`- D o&pkQP o&&PcQ``Q%dAP%@HPM p @dQ Pp aQcQ%" P%'L '`P `qx pkq_" aq'p'_%X _%_c10= 0ppdqk!'p" /"Tp/"/"/a Ѝ ( aL @ / #EgܺvT2K-P`@Q5025Б@P:@pi  ^)P*@pP:p  D^H-MpP@p  02/  ~ P `` ~ P U  0`0360 R PЍx e A-M✀pPQ)pP `\ V@"2 0d@ p (PЍpHO-GMM R@P㎗@PjJD`@u pZ xp|X  0T]qG W+  RUA_⠰ W+  RL\@P  WpW afPe]fPTP@P(JY)P AOP T p"2 0g@ p  @( ?PP@P94PP@PGߍۍd\H-M 0  jЍA-xM⼀` @pPt+ 7W)8pP `P \ U@"2 0d@ p (tPxЍ"p|( a @L/ #EgܺvT2K-`P@!0!@`YpPp  m] p@P @pPW( D W]O-lM@P `0p%(   e+$L00  "$p d; p b)`0#ek0`{"d8e;Pp'hpbk#d[ @gzd{@&P@ `c['`m<`k` P%@g[&8@` b b+P%, f[ T,Xc+c;P% @0`["<@;g;g{P%$@pH@zf[b{#fkp'(@p\@y`kc{%` p',@e{&0@` b b+p' f{ (c+@'0pDpc;4p04pc=eK`;"e[0#0R/0H-MP @IZP(JDU ?P :\ ?P:\h P 1 @ P 1  ZЍ0褼x/ Mp@-M@A`0T` P P mP J 0`0 YPL  ]@@`Q Ѝp@ Ѝ/0~~}ą0H-I \  PX0BS# A0,,,,,,,,,,,,,,x,,,,,,,,,,,,1+R -R& !3 P0 S@@PSPQP@S 0301  0O-S$_p@-@PpPU aPU` P  pH-\50? CR,0!|Q 0SS *SG-@`p 0 ZEP  P= PP JPPPŐpѵP U    `W  0  0   QPtRlDO-MMx@܄ؔP Q$ /0@Q `W'*qq` Qp/Q VE/Q@0T*/Q Q   P1/ @w$ 2/Q    Q  :R/T/Q   7   /$QЍۍ0  Q Q  0pp 0 Q@#( 2/P   PT*/ԓO-MM@0Q< PH@@ H@QX8@ **@PP X:8`LP0    Q 00 @P$ P2/QOX QKP    Q 00+?H @D 1/@P @pxp7/P $`*<`(PF 4@0pI<`(u pP4@0p7/P   U R00*  .R   .R R .R R H Y RYP H8P $P HL@@QT I@P /3!1 0@(PH@H5尰@P:[ oHP r@@`v` V ` V P#@@  z?PV" [ V$(P J`r `V  P 3 pr` ,`R+D @D oR P{ RP HQ \ QP P ᰰPor:[3D s5r RD PD,pR 0`{Vs`rPD V D 5 @ .R*( p00 p  W oH r@ P0uP 0 U P U L@ P# /?@U [ U"D%P Jpr ,pW  P 3 pⰰr [*, @ B/o"P { R HQ S Q    @?orL0P:T@ D {P<`r UPp[  `r VD r`{ R V <`嶰@PP$ P2/P{X Pw H<`q|괐YL@QFP$ LH< @0 `Pe$@T  $ P PUP>P. LHP< 0F0 P?IHob8mO4/Q. )`OP/H帠 PP㘠 ꌠP 4@ @@U 1/U>OP $QЍۍn@Ԑ|0H-PT@P LP(P 0 PPY O- M@P 0P$P; N % 0圴DP@" ܴ` TP#Q$ܷN 0兴P Q 0 pp@ QNP HԿ8 *PP "PP P P cp⠃堓`C @  PP  LP@P  LP@vPt   KP@kPi  KP@`P^  KP@TPR L KP@HPF  KP@<P:  KP@0P.  KP=P(  KP=P& d10P\\\! g c ` ] Z @W T Q=;PK=;PD#PP P P P P};P Ѝ|PlP 8P(PPhO O(ON1..dgd c3Q PL   H-0Pc  PJJ0H-.0"S S, ^\S P  @"T P @^P CP: S #S 0@0 0CS   \0#0H-RM@a` %P kPRލl P  0 ppp x PP 0\PDP%QRލlI<PIH  xxO-M⌘PpQ  XLP U  8@@}8Pp@<8a x`$@M>p04P  fH Ja0*f*AJA  C0T`OTp  p`3 x, D04PW EH i}[ p ̯Pe p`  ( @   `,GA@ `0px@8<04PGP0 V ( HHL@M}pC P7 G B}P; GRRQ RRQ RRQ RRQ RRQ RRQ RRQ\ RRQU RRQ RRQ RRQ RRQ RRQ R 0R4PQP 04PQ RRQ RRQGY :[ ,P\GP]Y[ I PYoP{P pP PGGP Gt \GPG G0 G GA@Q PP 4P " G P  l3|4Pd +|0Y IP  |A@ |YA@P  |x 㼑`@p )P `㘑@pp '!K<KY `@p  Kx 4GdPGpKppV   4{$P J4G{GPJPV P[  GJFB0PPֳPЍ~=# vg w tyy(yxBxOwvvH-M;0Ѝp@-MP@Q@ ``+  0P@ЍpF(`<v` ̭ QD?4?0?>>O-MPP  `e|p- Q  Z|p L㜰   RQ ZppᏭ`P  <|p``Ѝ>>`>D>,> >>>@-h`@@PP{PJ4@T@@ p=Y=== p@-@P``Pp{pTE"`P<?`I` zp <<<< H-{   8<G-MP ;P`LP<pU !p Z@Ѝ PJ00P Q lY`q@pp/Pd P4 .PbP_ X, TZ X/PW&[R! \R R %V  q *R$q *RV  p/^1 ^1R  V 00 0  @.P  R pX T  X/R q/QT /Y4P T TV     @p^0A!Ao?o2@|Y]Y8Qp@0V PP P\PpP_oR=p\Q /Q IQ 0V  pQ9 P-UV @@ @P\Y@PU |0S$ SQp@V 00 00W V   rQ'pp @P@@[^ <p8p6Q pP//3pPp(pV  p@T 0  P/TP  p/P Pp$Ѝg 4p 00 4tp0P  LP0  (P0 P P0 T p 00 0ppbfotᔐ&$P"a``\ pT^*@ @@@!@%@ep  ]p VPP   Lp =  @P`  P`J `D P `Q eF  ứ`p_qvP$@p d&0% `P \1% P `2% P d3% P h4%W VHPln@@(P,ЍV$)i^O#b^[?CAChR`1~6.yc>tNLcAPA|b(AAA@@@@@@YAǗS@?@@>?p@-@`T' PU$ ;D`p Q/R DP@Q Q/RP @@`P PF/R SVP@X/UT@@@P4``T ( ; pfD(K-MP;P@ @`t,@?` 㯖`P* pPP$@Q?"P$T *Ѝb@ Pd88880888h8p?Ѝ !Ѝ,J0J pp@-P`@PV@ ;P @Q/Q /VpP1 R0r/S@CPU@(P ;P pʐH-@M04 $ (8 pp Q@Ѝ@Ѝp@-P` @p T&pp Vp@U pph @ pp P@pppUppsqꝀzO-M ЍpFF|~pqOU1hpqpq1`pp@-  /oQ 0?o? #'S @c\ \ ) p(CHSScP`S&0c0NEUFQPS@ Pc0@^1Q1SP10#  pp@-  /oQ 0?o? #'S @c\ \ +  p(CHSScP`S&0c0NEUFQPS@ Pc0@^1Q1SP10#   p  0%D1B0D q1 A 0/0 0%D1B0D q1 A p0 Q/ 0H-   ?!/Po? So?`'P @`Q Q ? , (@HP! S@``pP&`2TVfWQ`SP ``2 P&T3$Q30 0SR@$!/ @b +  H-   ?!/Po? So?`'P @`Q Q ? .  (@HP! S@``pP&`2TVfWQ`SP ``2 P&T3$Q30 0SR@$!/ @b +     0D ` p1 A 0/ A0  0D ` p1 A p0 Q/A0@ ZH-@ 3p/ A@ ZH-@ (p$@ ZH-@ p @ ZH-@ pPPH-r=`dn [n?0/R//R/?0S/R/P/R/H-9@-MP @T   4Ѝt@p : @@@P@@T4$ moL@ |xpx Q  QoH-(5=PHn갵00>O-M0pᔯW q   Pϟ Wb PU] @l%Uq@ P%EUPL0aXXXXXXXXXXXXXXXXXXXXXXXXXXXX P XXX4XdXXP$h$XXXXXX X X$ H X\ X  Xx @@pG@@TUy  `8h@7P <P @7P x<P @7P n<P @7P d<P @7P Z<P @7P P<P @7P F<P @7P <<P @7P 2<P $@7P (<P (@7P <P ,@}7P <P Z p B`@e7P ;PI @[7P ;PC @Q7P ;P= @G7P ;P7 @=7P ;P1 @37P ;P, @)7P ;P& Y `p#  0@ Q`/^0 `6R  3:^ 03  ϟ0Bp5Q p UUpt}zU3pG @)0 @ R0`/SP` UPP3`:SP0ϟP3`0 Cp0B S pApG@7T 0@ P[pl  0 @ R;0`/SP`<UPP3:S0ϟ`PP3` p0 C;R% "[ P0 @ R0`/SP`>UPP3:S0ϟ`PP3` p0 C=R Dp2 PW0@ Q. a0/RP06UPP30:RPP30 p0BA4QP8llW 0`@ V_ 0PUR0SP::SPN* 0PA`0SE0VC:9VA 0PA0`V80S6:9S 0PA1P0@ Q a0/RP0dUPP30:RPP30 p0BcQ^ 00@ S Q`nA R0V::V * 0 B0nAaPU0S:9S0 A 0 @ R0`/SP`UPP3:S0Ο`PP3`p0 C R  pt 0@ Pa0 /QP0 UPP3:Q0 3 0Ap@ Qp0 0@ Q `0/RP` UPP3:R`030 ϟ0B Ap R p 0CBp`@G5P 9PW @=5P 9(ϟP MJ P50`@ Vp` 00Fs Q1 FR0 r0%pc#tBwpp#4#11C r  0 @ RR py P? 0Uϟp g 0@ Pa0 /QP0dUPP3:Q0 3 0ApcPp P 51ESr?dp0C+0A/S@`!0=<>||`0@ V:T@`  V@0A`@ T T.a0 /QP0dUPP3:Q0 3 0ApcPpdl'@ R  51ESb?!a  `$@00C P \ \L @PUp9 0C\0@0S0/ $0`0pC W@B ḷ<̟P@p u P k˟  0  Sʁ pXEQdpOh9 MR`0 TR R XK@@@@@CR 0 R (k`` @ ˟R w 0``@rQ 00@ @R @ R @ R @  8P7 p  8P2  @8P, l  8P& T  8P*   7P%  @7P   7P @G3` 7P @;3` 7P   @ɟ A0A S *@0A  p$(ȟ L`AVJ*MQM0a a$p( +'# 48pȟ  s 7  ̧p <ȟ  [ǟ V\7RA 0``@( JQ> %P Ul lWEXǟ p< 0B0S  B  p.%!ER2?d a;QP.a! @QH \a $p( Ɵ Q JQ@ ak<6 `f5 @ Q` ` 00@P*Q  δP P@ PԳ$(P/pş şzU :0@@@A.ap$(@@@LA >a $ 0p%a ! Qe  Q*%!ER3/>bK/)<b!qp'qqpWQq ""q R3$40 #0 A62Pu4 `l0pEPQ0"/dqaQ "p Bqpv AqA%)b8/0!bB$I"IqRBq/!B !b B AQ>%!ER3/>g 0K5)lB6#sP%Q7sP0UQ>sp'r6sp0W03b4p`gpA W B R:4 b0 G B 1 \11%!ER3/>bK/)<b!qp'qqpWQq ""q R3!40 # 0C +pE0Q0"/dqaQ$ "p Bqpv AqA%)c Rx?1CqJ 0Q0 R00 "QߍP8 )l5@bL6# g `@cr0W030P8 )l5@bL6# g `@cr0W03/D] ,'+',8'8++D(*% |l@%d($#l%.|&[ Z P8 Լ()'(O-M@DPTHPP% 0 P R `1 0Q1GV耟l S  P  1 P `O*` @*@ L  qq`F`P:@TP4PЍT Y X 20? @-0M@ >P0Ѝ@-0M@P0ЍH-PH~1p@-0M``0,0 0@ b*b 0PJd@*C0 D0JE00Q Q Q ,Hf ,Hf,Hfu4, Q0Ѝp0 RB/R/K-@T$ `/PpPEV QG PEQ G 0S  SQpp@-R0@@T 0R@B@Q+O-M@`@&PT4p=Pp'P8  z&p1 /  X Z  X&P  >&P lpp P #&  += +'p'Ѝ@-MQRЍ@-TP @PЍ3@3 ЍO-uMMTp W3@AP` d@p7 @P:3/@~⠥$E EO#WdE`E \E5 0 K x pE匥pEE:@PJWx"P@Puߍۍ(0 $MH-M  0 ЍHЍ/MH-M 0 00MЍHЍ/G-MP@R `UUYSJ#"0P @ P 0p` aa``  \pUC) #Yp ` X +P `p Y{U iPL$Ѝ` Y `P l@-M@#(P " " (0 1/`p) p 0`VQ <`V#2`p eP @`#ЍЀ`#p@-M@G#(P !  (0 1/`p, p 0`VQ <`V#R2eP @`# >2T`ЍЀ~#0H-e"Q& @T# E" Q0 Q   P Q P0 (  PU* 0 ,P 4P 8P 0H0H-(P@Ps(R0Hl@- @@eQ@_ܫd0H-,@@X RPQ0訫0O-M  `P0V ` xQ9`p@ V `W%6p@ V P`pV 00 !.2`0@P080C?o2k#0PC` Y*U .VPp@ VЍV @ P  BPR P P  P 4  R  *4 8/ 0X\S 040:8 R РS /a,xBH-P`@H DpV  &kXp@-@P`1 0 H-  |`V|Pa@<lHd `\Q`T T %QR|Ps:|P Pn V 0AnS{`1 $,4<DLT\d0A&0-Qj ^Qf00 0`?Q`00S 0 00 00R 4q0000 3q0000 `3`q0`0 0   # WAq0 S S~ h3q`0000 `{ `` ` q` V0 Vp =V Pq0#SP)q`0;V_ 20000U 10A@,\, ^ |2010S0+D200WA%0@0q`;`V`cT@SPQ^"PvpU# Pt@dT@dT 0A \Z ( &Q& Tpa``00 `"0Dq@ @>0A 10  =Q )`` " 00000       h  T 4   C |C xB 4 O- MP`U 7 p@  0 PV. `FPp(p(V `FPU P&. V `F.@V D.@ Ѝ0  00  _A-qPpW1 /C!=QdaV P $QPXDP* V(ӑ`,1/P- V;  $P_%@`@`P=CpWpQ 1/xpV@V T  0 $PWX@ H8ОA-qPpW1  HQdaV P $QPXDP* V(]`,1/P- V;  $P$@`@`P͔pWpQ 1/xpV@V T  0 $PX@<x8h/G-@P_ `t)PZ qPpW  U` /C"=!i QU ZZ+PB @P U& P0=cpWpQ 1/U(㼐PP   O$1/P $@Z $41/P PTHhG-@P_ `(PZ qPpW  U`  H i QU Z*PB @P U& P0pWpQ 1/U(=PP   #1/P $@Z $41/P XĘ`TpG-R`SPP 0/` {O`V @@ P ``@@T p P l``` \0Xp T@0p`@`P谗(ȖЖ̖K-R@SPP 0/``V ppGw P ```ppW `Fv P Kl`\ \0Xp T0P`p `P@TT4DtxltO-MMP `Q SP P/P P , ,~ ]pu 'P PPi ``p/P PY @@/QQ.P`T T.P  PU P/ # "^p@  P /Q P G Z P z/P P P? #e \P"J @PO'  P0 p R#p'p/P  P Z/ .ᇔ Ѝۍ+? Z/ y+hv+>es+?bp@-P Q @X]p@p 㛎@TC K]ppX+9T+"P/げPP- 5]ppC+"P p`P $]pp2+"P_@P ]p@pp@-PE `&\EH\E 88 Q,  Q' P:Q0Q` 0@@CQ PP@\Q@:Q`VQ`C`Qp@P ȓ0,  p* px`Xl` p@-V" 0S P:S`@T V P 0`@TVET@V :RV :Vp@PppH-M0   0ЍO-LMM(tt` W0H4W XPU p@ R 0S Q:Q |Q T @DQ:Q @|Qp P4 0S 4@ ,VJ 0!'HP ) 0Pr [`VJ$H4Pp(0`KpU:H+Z@P`HP P1W Y4 ppQ 4#Q 4p$ 0S @ T  R:RU |RS QA R :R |Rp$0`0`0`W9P P P :P \PpYp  p,[:4`,@KPK ,K40`(PU ZtY $`@0SW4咒`% %$0`, ⿌P @Ħ 4@,( @P 씟t4@ P p@:PtPP P0SRS@@Rn =R R@ @Rf @:R  RD@H 0$H@Z zz:$dZ  G B 0S:S0 AP,pS:W:P $ AR$p0`4`P PAp4P ,D4@E$PA0`p G0 @   @0@@ @(4P,pP Y WJh"P  @Ƒ(  W," XN(@4峑(@D`4孑p@R$@8P pD 07/p P 8p@T <@p@1/H! #2$PΉP  M 1/p#Doᠢ  1/o(   HP LЍۍ^( @P 0aYX(@(P WY4LX  G(P 0KY@@ p  Hl~x D | /TH-0 R ^  R:R |R S 0C R:R 0|R 0H-PX@P D8044  0000HpX<@@H-LP <00,,  000O-$MM̳ CP@ # 砓堃Rs pस P pP 0SL `# S P   AQ (30000@:R#R'P\@o" R`PU ᯸PK"  P aP xP Q R  R\R    ` Qs pAQ\Q  PQPU :Q gP 匱 G`A:\  P6DaB `00S :S|S0BPP P `` P$Ѝۍx l`L808v\4j, hT  @K-@PP `@:P 0S R p  0SR@GS@R =Rp@W dd`ӉP P]W\W P:P| 0Q-0@ 00Sd00@ 0R_@0@pp ^W P:Pb p@W:W\ @p`V PE d⛍Pe Pd`p]WB@@2QE p:p@ppp p p p ppV E &  8P  K-@PPE `@:P 0S R p  0SR@GS@R. =Rp@W) dd` P @P p`V PE dP Pd`pW:WV E %  P  ᨎp@-0S< P:S0`V S P @0`VSEV@S% #S0@Sp 0S xP0P/`0@E T:a@EV`T:A@E6`T`V`#0pO-MM`$ P @P /P,D 0d  4 p J2|KP$`N p4 @YQ:Q(d P8@`@ ` I P U U U(d:K$N ;K/$N 0,D(dWp U$P @P9LL:P 4P+$P$  P ☀ pAР B`o U\$PK4 :Pm $   }v'xkx* H-  2 MH-MPP@  00@  @@@ @0T 00@MР0    R0 mU QKHЍ/| O-$Mlr`p TT DP"  0 `币GPP U: @ &P  E p pAPX qp Xp VQ!&H@ 0 P"" 3q Q$ЍE8 P9$ P2 @P QX" 0# " !  P !PHP  P*} H "[ ,pp P $Ѝ upp B/tt  H-89F, , _r@-M$@;0@07P@Ѝб@ /  +` @a p  / = @ /  +` @a p  /=@ /  `A ` p  /=0 A@ /  +` @a p  / =@-0M@Q 0 !   0 T  PT,0 0#0ЍH- M SP ЍH- M SP ЍH-M  SЍ T T0TG-MⰀp@`PA$Q QRO{dQ`Q\Qqpqs@  0tPa!Qލ 4/K-rMⰀ` pP@qAAOH\AXATAxaha@D | 0lZ@$-!Qrߍ h$ p@-P@`N( 0@p H-`@Pp: 0@O-M俟P`p 0Q@$ 4<`Z<``V`  @P Q AQLP Pp%Vp@0 p@WzP4!   0t|,8DPp00@y@pv@ps lKpkKphJpeJpbpPPVA$Q AQzP -P%`    <       <<尀 < 00 $0 R P0ሱP% $$L00g@00 @m00@i`-00^[ @ `Y[ p*(8(-8 , p-Q*-(][ , oO`@PJpp W  pp pP-8Q ]Q( 000000I 00@0000I 4PP J f _P< P@P0Z? @-΍D<`Q  `T 0A DD `Qz $Q 0D @B D `V P @^P D QG0Z@<`D@ PZD A``D P4P DHD$$00Ϡ mCDP<#0S +@MQ llLLLLLLL8888888888884 QYm-8m4 4%@M @` 4  BRA:m4 = D@V(0 Q6l044Ql 4m mD D P@h@P00Te0` @@F⟎ϰ T@l# ,0( ( T8@R*8@`+Vd -Vb Z] $4< <+VPIF%P:$$0  P P,VK0V_ xP8( 08@( @8Q V VQ @Q(@( }P?8T aQNdVEV PV" N P @ _8 8 @ UpV eV80 @PV 6( 80 @8 8 8( 9()V @    P@_V w nQ @  o(V( @j0 @  lP 8 0 kPQ 8 `P@`RP@(`T8@:; pFp @( @ P08RJ @э[ P0 0H0`@ F `  F0` F@`p FP` B8 F`` B FAp P  p0 `  ` 0 `P80P8  B8P@ P [0 $$帷 ,<``@8ZK s[ PH0  B B0 B@ BP B` B D@p B8 B p P0` p 88 8`p -P ,JP`8`0``PP [rV ,@P $8  0 @8<`)P 0PV8$$̵ @R`B@W P TA-NQL  R `Z0A Q9P @P@` @`PZ0A QP @ꄴ ʪĪ(`@K(Z*TZ:<`@Z D t`D  _D nX ᆌ[ `PH0A@  B B0 B@ BP p B` A8 B Ap P p 88 ЌP0JP88PP ZP0Z-`@0@ )D n PD P$`$W `$Q}T` 0`@kϠZ@TV] $$<`=4D[q XRDt D 4 0r<` 4 0     <` <`<`<`$`$D H  @T @kV3@T0`[ @l P$ QADQT $ Rߍ D Ŀ  L n > qC_  O-Mp- P@Pg 0`PU   PO0`puW  P7> QR@0BP#*@W  ᭂP' ` (0@pQ ~P #JPJ ЍT 0H-@P  ف@ 0@-M0$ @ 4/P @.@Ѝ@-M <$ 0@04/P @@Ѝx @-M $ 0$@00 04/P @@Ѝ@-M D0$ @$@0 04/P @@Ѝ @-M $ 0(@00 04/P @@Ѝ@-M D0$ @(@0 04/P @@Ѝ @-M $ 04@00 04/P @@Ѝ@-M D0$ @4@0 04/P @@ЍH K-M(]\$!'`";)|{}0 S* p R*` V:*Zl  Q* (0@}4{ yw@PQߍ`\ 娐PpP (@a4_]\ 0 0.lpl l0 0%lȰ Ĭ ` $ T ` ;GmGuGGIGwGH%I9IAABoAAAH- MlpЍH-M   0 0.ЍH-M $P Ѝ@-M$ (@@Ѝ0H-MhhP P@ @  00 Q CQЍ0پ H- Mpp8`p@dP@P  (0`Q CQ Ѝ똤 9p@-MP@`Q0  0  PA Ѝpp@-MP@`R0 0  PAЍp9H-Mp`@PQ0p 0  `ЍH-M ,  0 0wЍH-M0 fЍM@-M0 $@@UЍH-@`pPхP'EP:!U _U$U 0HB,<% %00 H-`pP@ Q 0H'P V V P dP!U D<% =00 =U ~U\dO-M@@pPiP @ 8`-A@Jz j ZS92P 0Qp opZ?P1r3pQ^{ vW$4D\` V P P\M`΄PP ^V@?K '# 0!\00 @?\00P, P(᷄P)\a\b\t\n\v \f\r\s@  0P \VPh EP @ PЍ  U꬜ H- M EE H-G-MM   P` P p@ nw@P0  0pp + PT "}"P RQ P U`P P PU ` PT }Pލڍ XPP[O-$M Q_*0PzP  pC【(PW, P `PQPP P P@xQ@P    @vP P`` @vPb @\0RLeUW ``$PX@L   PUP`` qW8 )P0 @vPk \`Q  X $  R0@ @L$@`P P PPMPO< P Y :  P,``VovP$  % P V e \0$PX  Dp,,Y|U @|TP|| { $Ѝ:pO-M@,XP P 4EP# `9EP ` `U ?   &EP `$`2  `Ѝp P.  P.  P.РP\`8@,.V HP]P`U .U^PU P`L\ZPLp؃ #"@+*P` ```A-`$P@P*(  pp}P $T @@T(0 U@ U Q00p@-@P  (UCLQJPUPD{LpP<{P P7{UP 0{.{,.DPp`&`*C{V P`p{pA-`PV@ ,@ < %P P P R P, P%R+PAP&@ @ 0Dp"0'5P  0 P PU$ RPU4 zLPH P`U #3 0f (BP pzWP P, PzLp\ ,  LP[ b2 0T,jCP_0\` ,)/P P]Q p  0 P ,P>zUPPG-` Bp(& zPP@,BCP=P%,6(CP2 `(B`, ,$ Ap(" dP0 , @/Q/\0  P(A$PP$?v+++ʟH-M,`0@prPAPp$ C`p 8  "! @  "!B`tʒ@A@`ЍO-DMP, pHP `W@p ,QH @GToT㠂<W,+WsT$mG@o㠂  0P  P?$9,,<@ ,  @,0/Q/ @ $ LpP4@ I0@p `@P@P ,  .Q) P@`㺐(p +sP p\ T X  8@4`0@R 0 @ P$ @!Q .QQ     vP @T  ,$$@I0@P `P8, Q,L <P $ /<Q QP, , 0  $C w<QP& <@<YZ (@pX@p(pP" Q  \0R 0  B   RLQJ  \0R 0  B   R Lq,  $0T C4`0V0R TP5WT LP2 0 0JP!(PT"   DЍOr w8 `P pwWo@P, , DЍ,@PJH-R3%18A-@  p`PP-2P P-P PwU W, ,LP/P ,t P?p p@`?VPPP&p@-d`@`P (PP (((cwawp@g?꤃   \ H-(M$qP `p@P @P p 0 a C$ 0A | P5"# (ЍAQ  4<H$ K $GG (Ѝ @ P  R/R  /  00؂ O-MP@R D "P XptЍ`P+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0@I" 0  0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Qlp@-@M@ P ` 0P @ЍpP 0`B~@Ѝp0H-P`@8>@t  !P0; P?>7 P0p@-P`@` >@t  Pp# P'> PpG-MMd`p 0Gp@P# 8  P :pP() vP >P J  P  p Ppns@ P p$p=P P P PP (R(u uu @PPЍۍ~ } 0H-M P?@p   P  =p  @ Ѝ0O-Mp`$@PK W  PP@oP V PP pp `P`&Y P sP: `E 0-  a>p `FPP PP Fu 0ePPpP ?='=` p  + P\`   pL@ Z p`*` pp W * IQ  Tq`T;o@P`(0 0`V `V P  P  QQt` GPP$P Ѝy 0H-@ t P PtU 0 ^ O-TMR TЍZ1 @ P 4 nP ZPPL@? @dZ,@x LpHZp L Y ` VP`x 8/ PL R* 0@  dW*c C*DL PWH ,@ 0 RPP0JT D 8d,@:L 8`Hp8`Y/ Px  8/P'L R*  0@  cW*d D*CL PWH ,@ 0 RPP00L@Lp8W0LP`H8 PY%x  8/PL R*  0@  cV*d D*CL PVH ,@ 0 RPP0 HL8Y/L P`8p P[%x  8/PL R*  0@  cV*d D*CL P,@V 0 RPP0LD HPLP8U @ L`x $8/Z$P@DpPP8冰p  k<0 D8p'X* \*8P@`(Hp@ x P0 3/HpPQ `@ Y: T*,x `P03/PHp' DD0# L@`X*T:X0V1 : 0 f0S*h H *FP  0 R``0PP0& ,<X*L R:X0Q1: 0 a0S*h H *AL^D Q00 8 T*:,x 5/P0Hp $ L@2Lp8PV`x 8/PL R* 0@  cW*d D*CL P,@W 0 RPP0 P@x P $(<  P p W  p@p @ R  P  Q0A ` @`P\3 pE PS \*Sp0  Y  3 \3 Y1*  D`8/DP P P H@8<P3  Zq*H` x 8/8`P Pᄠ Zj*x P0 @3/PLTT< `x P0 3/LPPѤQ@: PPL@x0tP U<=*H 8/8P8P U5*H 8/8P.P U+*H 8/8P$P U!*H 8/8PP U*H 8/8PP U *H 8/8DP8H4-D,L@x`V P0 3/8DP`[<H8KOx d%P03/ P`[0 PxPD PP0H P 4@P6 U ARO:UW @00\1H:`0 l0S GV@C4@Ph U AR:UW @00Y1{:`0 i0S GDVru U P0:U00  W02\1%: !`0 l0S GR   P:T: Q 0Y1:(0p i0S A($0Q   Q: 0 R0p0 p0S U P1:U00  W02Y1&: !`0 i0S GDR   P:T: Q 0\1:(0p l0S A($0Q   P: 0 R0p^0 p0STpR 4@P! Z  AR)* pQ 4P3 @`V ARU* @ Z P,* pZ W @00Y1o:`0 i0S GVpg@` V P8* @qZ0 0  W02Y1O: !`0 i0S GRpEV PW@00U1?:@0 e0S G^p7V00  PW02U1-:@  0 e0S G^p#x p  Q:n p  Q:d@p  Q:Z@p  Q:PpY B roTЍO-TMRlTЍX P@4 iP XL@HP@ X@e,u HpZn H,XP, U`PL 2/ PH R* 0@  dW*c C*DH @W 0 R``0HpeUD ,pH ` P@,p Y` PL  2/PH R*  0p  cT*g G*CH TP 0 Rpp00HP`P-  ( `P  @Y P @ ` 0@ `U Q 0A P  @8P`[3 pF`S T*S8L `0 p @p W  3 T3 W1*9/P @@@ @VPDp> H Q.*PPL 2/H`Pڊ Q!*P加L P2/PHP<@ZL@ZPP$ `p;/<PѪT:$`b,` VHPL:/P `AHP` ^Q*Pp `:/P"` V3*p9/P9p W)*Pp9/P/p W*Pp9/P%p W*P`9/P` Y*P :/P LHP[PKe' :/P`[ `@@PP! 4LHPP0Dp< ^ ARW:^X@00T1P:`0 d0S HV `FI4LHPP0Dpn ^ AR:^X@00W1:`0 g0S HV `x{ ^ P3:^00  X02T1(: !`0 d0S HR `  P:U : Q 0W1:(08 g0S A( 0Q  Q: 0 R0@80 80S ^ P&:^00  X02W1: !`0 g0S HR `  P:U*0 8(  P: 0 R0p8v`" 8Q 0T1 :(0 d0S A( 0Q`0 0S@pU` 8 ` pR 4P2 [  ARP:[ X@00W1I:`0 g0S HV `0@AQ 4PK Z `P  ARP*@~ [ P(:[0 0  X02W1: !`0 g0S HR `0@0@ `  Q:0@ `  Q:Z ` P P*@:Z X@00T1&:p0 d0S H@W8Z0 0  X02T1: q 0 d0S H@W8 q@8  Q:h@8  Q:_H@ T.H`PP,p Y `#L  2/PH R*  0p  cU*g G*CH UP 0 Rpp0PH Y-H `P,p [ `@#L  2/PH R*  0p  cU*g G*CH U 0 Rpp0HD PPH` V`@ HPL (2/[$Pp⅐<p @ PiP80@ J p'X* Z*P@Dp< `L 2/DpPQ @@ `PV: U@830@P ,  X * A H`V* P 0 R c*c *H CP R 0 R``0  Z>*, L P2/PDp' 88J0 P PX*H R*X0U1: 0 e0S*h H *EH0 P0 RPP00@P& , X *H R:X0Q1:P0  a0S*h H *AHP0S Q00  Z3:, L 2/P0Dp (()T ] @jTЍH@,p U`PL 2/PH R* 0p  cT*g G*CH T 0 Rpp0 @p@-@8P! (| `V PPU 0# "  0S/tdP* !P` P 0" `V PPU 0# "  0SpSdP !P` P 0pP(|pp O H- P@U !P `'p&pW(dP !P  0p@-M P@PUUU  P 0#" `` R`P QЍpO- M@P pRR$$1  0n  2p! P J `0`F`V @ 0 T 0S $0wt Ѝ0H-@DP ({P({00HlK A-@PpSQ``P ({`P  ({ xP p `+P V%"VPPJ p@-MP ` 0@ @@pp@ P@`ЍpH-p0PP<  J J H-p0\P L@ <4,@(  xJ XJ &&&R&0H-R0P000@0@P@PUS  R0tuA0DJ K-L{D@!P F 0 Y_t0INH@aOUEHOa!QA0SY  10"@PPT1S! A`VS0!V A`p@Pp1@@S10!Q0(KzH $   x  O-MttBp@z`Q XT" BB!!0PW}:PD W*"2 r B0p@f@W P*0@P 0W*@P W?@P03@3P3!q  p@P0$01_pDPNH@Q/O0\Lfb)YIpW `!pS   !Q P!p !` @pP@1ppQ1 ! R 0 0 @@X%zЍ T | | 0 $ $  l x ` K-@P z L R!qE 000CC11  0@PP0ଐP ` 1Q` @P0 lh  T!P yH p H L H 4  0H-yP   00 0@R@PP1P@1R@!P@@8m.!D902!A@0y0 t h l T < D $ UH-00 ?O 0DMO-M-P!B(Z_O@p`qqFGyOoyZOXPTqXq\q! y눱P ` T P@Q2 @X@P[`P? P @7~@P@P`ϊ0ϊ ϊϊʊ`a0pax0O%y0@DZXPTTaXa\a0 /O D@=yЍ@@,6lA T A-@(Z _O@p`qqFxOxZOXPTqXq\q(((  4<? G--P`PEU6PeM`P+ @X@'PPPT@@Pϊ0ϊ ϊϊʊ0pnx0Ox0PEZX@UTX\D O-}Mb(Pp`cPo @cPo hbJx\XP LŸLL" H2D 0  (3x    .@PP `0.0D` 88(P, > D= H< [iP/X H-MppLKפp K.@.`P.p0@ `S0KL!Qލ/: /0$! /p@-0M@PB0  $`0 PP d >P  4 $`P.0 $P P 1/00GSQ 1/0Ѝp H-XM$p@P=  ` P00Hb0 aH-P@a`P  >bP paP P `P  H/`P H`0H-P@aP P P`P 0H{`00H{ap@-MP@p`P `paP P ,0 0BbЍpЍp! H-@p`P PG`P HaP =`P 8`P H2` R R R#0!/ R R / /   /00 //   / / / / @-T/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/0H-PP! 0@T 0\\ 0@PU @U S000O-MM4J`pQ00PߍڍHPP*\*X t`X`X\^Q:[pZUY iYi# @[Z|q0(  @TJ T*0S? (I PWJ X3: Q:[ZPQQ Qs QQ}:@ 0S <( pXo'p BPf [`2Q Z, p500P ǟ B  B4  @ ``   NP p0 P0!00p& x!p P*0 Cn&w00p b  PppAQ :`&  x60DPnJ Pl*T&@pIH6 04P^JW\(&@pG6 0$PNJWL%@pG5 0P>JW<%@pG5 0P.JW,%@pGt5 0PJWH%@pG<5 0PJW % 5 @G0ԆPJpTppZ @ `X`4 \ 0pP0ᴆPPJYI`pZa0pS\ ?I#s0p P}J| PI:y 0 ` 8o  W0`2(P P$0"R0p0P01P PP P p PP0 Q0P0UpY 00 0  P @OP( @p P  pB@X10  0PppU YpW W WApX5  0`pPp!0 0  bPJP TP X> bpPP4@ @` H B谝ppW@/ H`V,PTpPP$ Q @@oZQ@dZp RRv pQP Q@P= QZP0 N"< 8X. @<4 偲 @D|8@P P>  a*a @*@ .0 Ê及䐝Y& S Y p<`,@ P00@pPT*P  RP pq0PD `*` @P*@UU pg#Np a0ϊ ϊ0ϊ@ϊPϊ`ϊŠ ϊ oAH0 ! "PkJ# @!PcJ  `"pZ ,PPQ P?  `*` @*@  ⏊ R'   W R <`,@ Ppp@PT*Q 00 SQ q0spQD R Rp 0` p 0 BaP@P40pRP PP,(P$@P`N# >мI L P"P @ 1 4@`00 P`V XP Q @@XQ XR@XQ U; X8P6  x ( FdO O s` @-@ VPt  @ H-P P%0S PP$ PP+ SQ R  R RRQ/R RQQ RQp@-@0T S p S0P `V \ \ TS^ R8 R0SBP0U S @0@PU S P0= S SVJ V \J\000S ```SP pD D0S0 S@T D@D0SD0D R^ 0S D0DPU S K-MQL @`PpPD PP9*P  EEP P PYJY'yP 0 P P aP X QQ P PPЍ蛧`TO-\MMP`200X00   B 0 By@Tllq@Pp X*0FPj X*0 FP` #P P P [ pp P P P YP  |P8 40 `*` @*@8P4PU ppW  ᰖPWWP pP W@Z  `ZzZT ˨,QDX Q\Ѝڍ)  K M= O-M`XV  P@P @@@ 2DpP P PWJ@P> P  @ A A4 @@  AP A6 DH 0FX@P* 0 G P JP  0 A B!0 0[P t@P@`V`X@ nVP& pH 0P 0L  PJP  0 A B!0 0%P DVd1St`)x@d1#^*t R q PZ?[oXp @P R P P pt` @9Vj `Pd P 0XPp E EP E E0S S SK0d00 Xp`0\@00`@X0` 0xP` V @ N`( dP6:0,d` X**V  Z[O`0  `V pWp Pp R ` XV `Ѝ`,`` VX@Q507Ѝ[*4 K-XM,PᢀP @8PP AP A,p<004   ᮀP 8PpXЍp  ` *`4 B*B pP TpPP8P4IU,@004   P W pXЍ4 P4Tp,UWGXXЍ軙 O-YMM0 `P `4LOPN @FOPF P8p4@ @Q @pU`M  ,@(pX0pQ P .QPRPP@.@oU_ <P@P  @dP P`(p,@ ZTWdU*:]$Q :W0P  PZP` 0@`.Pd#_` p{  PxʬWT $Y$G D DQ= _`H@$"0 h{ PW  PH`zW=Y Q Q Q $$ 1Q  0@$R $UF*$Q:KW<P 0@.P!p_p {  \P(\a P`(p,@ 0  PP TPP4Q 0 0PTPSS!pw Wp$P W 倠P (p,@ VH (p,@SSP`PYߍۍ Omk kk x O-4MM,0Q0p @$P ( e , 00 o`PK D 0 8`P:  0  8 >`P+0 0p D(  !$PU 0 #"(0? / r `ZVL0P4Ѝ؍p `V$P`2 0 O-M-rM M<iPP‐`@ Q @ @90Q Q TQ !QP90pwpP( (0 0 0*UPJ< (1/P ,P&`RR@PUU@&@àR '@p0S @0T*o0` $BoPpBo $40 @, 08PTP}JP< ( 1/Ps PUU`U @V9K oP*0`!,0 TPSJ@< !(1/PH !PCPP@!  ) 8P@ P[ [ @ 8P0`40S%T#*0CP ["[ ![^ [P `qwPD %%0 [@8PK40P  oKP` `%H%0 Z408P @ 0`S [R @8P[40BR@ @TTPT@!,00 SPJ`< ! TP !Y PKP !$@wT8PU  PP PP[PPf W" %^ P0 S^ d VY0V^P $RM RL dVI `P[@@ `*` @*@ d@OPP  ` !0[*` B *A@  @UP PoUPp@pM   8PUA PQi ԁP@@` ⏊0 `< D`堠L`P pP P P P[ PW @P  Q[S@ ,@@S@@d``Prߍ ۍ ЍPS[ u -  00@AAQ3 S_0@ 3?o20-0@?o2  .0\0/.P0 P/.Q RO-LMP( @ @p @La`0 ` *` @*@P! a[`7  PPP(  Q Q Q WpP`V PPU  ỏV ``VW DLЍLЍmO-MbP<@p` @ 0P@QQX P; m`Pt4PmpbP@P`i@ MPU `0 `! @t@*`@@  0*A D p0ps  0P8 @P pH`P8pDaP@P`4@ fMP `0 `! @t@*`@@  0*A D p0p>  0P @@ 8 P `@d``PЍ@dOU` PP \Ol  O-Mr`@Pp   *p p P P Q pP Q[ P pg@P`[ @PV XQp 1娲   0 P8Q4:Zp Z.  Ǿ P&P# pp Wpp Q  p WY ᨾP 0 SPpp8pp Pߍ   x  a @/ #EgܺvT2K-P`@!> Б@piWp  D2  , )P*@pP:O-MP0 $pp @R P x$ j'MT0H00 X` 0 V7 8N p\@b* `0`0p0p tB0D7`p<p`pn aLpdgehp p|uO0P8p0 p *v wD lb*,P0P0V0XJ0Ppǂ( `P` Pe FmOPteL `  ` h iFx`4 ` gDkH @b ` `  Od  B|@◊ pူ p  w \yH bu `  `"akFl PPQ]O aZ 003y6J7@p@p@!x yD@Hp`dE`p`buvO`PpmPp0P@s @pLPpD[0p@0Qz^vB0p8c9@p`@w yN@pF0H-@ TLT`D?QrR P0T  TA  TB  TX0"T= T> T80T:  T 0 T6  T0 T2 T0T01P PG000000000p0P0H0H0{Dq|DnDMDD[CCCCCCCCCCUCjD0H-@BYP @p0 G0*8Mp@-8M`HP`@4@IPH .07d00. g@U PE >Q04P8Ѝp@Ѝ/|된 BO-MP`PP@p RQP QP 0-P0+P 0\@.P *@q0Q00@C000A.Ppp  p!p >?O p  !.Bd0 p#"0f 0`@@@ Q *PP00@@UP:Al) Q 3T Q*``V 0  3@ V`:A@PR 0@ 0@1`00@`d.T``  ``i O   @ Q  P* P B `V  30@PV:IU< VP * Y 0  3@ Y:@R,  0@@.T P,@1`00A`d.TP`` P ``  O PRJ!.@P!.A` Q  P*. P †P@T  30@`T:EV T@ *PU 0  3@ UP:@R  0p.W p)@R P90p1`00A`d.Wp`` p `` O p!.A `P@ Q  P*p P @PP)) ) + + + ... P @Ѝ贛 O- 40`00pppPqp@0pG``rg``p@@@ @PA@p0@D```R PP@ BpEF2X<`Q `bfqoq' 2X c `bfqloOq' G2XY`pQXXXXXXXX\XXXX\XXXXXXXXXXXXXXXXXXXXXXXX\XXXX\XXXp!pPRq `0pF```.UPu``) `dPP@]_OY PPBpp@  @ P iaࠔ` KP0EP E`PP@ 4 `PP@.@ O-DMCQ @@R  `*` @*@̀ !scp51 Bcr !51Aq%!E"d Rf@ <8p 0C a@)bpE%!Aqdbeyp 0C a@xp*bd%!AqdRfyp$ 0|CypW& @Z4 Y 0,8gObA00R0PQb$8cs D(01<000!pa `f 0EPW@#?n`H0UaCQAWU"/"bAY DRBZ/ NP@ 2/r!" bSPPVFSo.eP`U2?2c1FVR0FWo`P2`1FB / CY 9Z 9W 9DЍULQ76,M6fd3p@-M`-P1 P:P( Q@0@P0SP?83j8V3jaF``P+0;  0@P.U QR0*A0oPB P.PЍpK- MPPO lG00@@04 P_ `.`P% Ѝ1H-M@Pl^PK f^xaP`F t^^PB `X^P> LR^P: 8L^P6 $F^P2  ;`pP,$ pp O&`PV3opP $0<H`pTvpЍFp~ ~ 0 S))))H-M`@P]P( Q PpP pp %PP U3opPpTupЍD 1H p@-P@@Pu`Pu` V P``p 0R0p0Rp \ 0 /`0H-M@tP 0Q IPnЍ0!0H-Q  Q  P@@PPHP0@@P0 ԅ | @-@<p ,X0@<  0H-P8@p0,00H p@-`<@Ppp 0p@ꌄ ` H-M`p@Pp 0@<8 40 0  p0oЍ:Ѝ0 ă ܃ H-M`lp@PUp p 00Ѝ:Ѝ舃 8 P / /  H-M`Tp@P#p p$ 0rЍЍ h H-M`lp@Pp p 004Ѝ5:Ѝ@  H-M`tp@Pp , (0p0Ѝ:Ѝ贁 \ t H-M0  0sЍ H-<p H9  4 E} G- M@ἠD`Vt@@P,0 @ p   H ЍbO-M M$XpP嘋K⨻⤛ Pd JP Tq  ppD Q`P `Y  2PP `\P P .PP`FP V& VD*  p p@DKY{P P.P T, p pT(.@DK`{TD p p @ @3.PPV$*T:f  @P;;k0C;0; ;S* K{TD { {K } PJ`G  !@ ?+ 0d @@ P+ s  + A @P˞@3{& W:`  @P;;k@K`Fk ;S* @{ KvWo   +Ao{`KDP!!\!| X X\ X(!p!'!!D!hX|l!!!(p !!!8!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!%H   /$ ;hP NJ  @I`V`FP0 W): p7d @?0+ %P P'+   +A@W: G7@ p >7`  )?+ 0d `@` Pu+   +A@`P p: 7?+ 0d `P PJ+L   +A` 6i?0d P P$+L ]`  +A` 6d 0?0uP P + 8  +A `  /$ ;uP JP : IWP  P :   h +Ap W#: j6P + 0;?+ 0d @ P+ P:  +A P I PJP  P:    +Apr   / ?iPh Jlo` +R  T   +A Pr / ?@P? J@꜀ d ` >+ 0@ P+\ a  +Ad ` >0|@ P~+\ >`  +A`  5d =0SP PU+    +A` @T _+lPd 0)p P+ @D T  +A    P*n O _` p    +A P* 0vPu J  P* P S $@돎 _ / pk 0 PV J P  0   +A  /bTW: 4d P?0+ @ P + X  +AP? p @4 J Y  Q* WT$V5U5E I!R/0 SP ZP@JP PL :   ~ +ApW p d @ =+ 0#P P +   +A@ `VvP$J! P*P@PPb @ ſ+;+K V;A+  Q* Pf :    +A   /$;   /$ ; P= J P     +A  3 3 K 3 9 K   / ? P J_  !WW: 3d @?0+ SP PU +  p  +A 돎 @_ /$@k fW :;+6*KpP?+0{Bp + d p @ P + ξ  +AP  P*| +\ p@`?+ P0d @ P + 塾  +AP)W;+)Kv +A l3 2@  2P +( <>(0@@ P ( XV5U5E  +AP I!R/0 SgQx :-A b+ 'B  @    /$ ;s P J Q*+\‰    $Q6 Dp$p@ W+ P   [d 0!` P#    +AY   $Q:FC O _ /$p `;P@ Pu J P     +A /;P@ PV J P      +A IQp1+ Q+  @ p+0?A`0p+ d @ P + NT  +A`k{*W:d  @P;;KP[PD[ ;S*j {kV   +Ap!~P@ @ P_P   +AW!*n`p5d ` ?+ 04 @ P6+\   +Ad ` ?0 @ P+ Թp  +Ap  P* +\ @d 0 ` P 嬹  +Ap  P:?zjz?+ d 0@@ P PK+ 兹W  +A@( +\@ 0 d 0 ` P' apW  +A@   P :0 i i@@ )`   P  u P2JP PP *p  +A p Q"* 럎 O _P:@ ` ⴀp$ ;OPJ Q:P* p Q LdX:{P  PJP P:    +Apl P* d 0p ` P 堸@D  +Ap∀  T P ) )@@ @ ⴐ Zfp P@`` P f0U  +A`0` P O0@0PEZ  +A%ZL~p P@&` Pk ,0U  +A`0` PT 0@0PEZ  +AZ P::    +A>+ P0P; P:)   +AiwX:X:?d + 0` P P}+L ᶷ  +Ad ` @?0 P PZ+L ᓷ`  +Ad ` >0 P P6+ p  +A` PP   |  P:.   +AXo`/#\X  Pr-   +A 3P  PZ =+ =C +0;A+`k0 p~==pSi`:k0ScPA<@A@@@A@x@PA%S@@Q@@@@@@@@B@e@PA%S@@Q@@@@@@P@%RR@@@@@@Ky@PA%S@@Q@@@@@@P@%RR@@P@SP@@@TA@@@@A@'@PA%S@@Q@@@@@@P@%RR@@P@SP@@@TA@@P@RQ@@@@@@J[UJjРKPEkS[ZK[:J`0CkS[gZ?x~p P@9` P~ ?0U  +A`0` Pg (0@0PEZ  +AZ PM:   A#8m `Lm`<\X pJ }pP@߹` P 0U  +A`0` PP ͵0@0PEX  +AX Py:    +Aa[W   +A Qh  A 0+ B 0)+ Q+ ;  A+PP-JP+@K`Bk$*V:`  @P;;{P[pG{ ;S*kV'*+\‰    $ R5 Dp$p@ W+ P   }d 0C` PE   +AY   $`kV:;+) Kи +A+ z;+ KṸ +A+     /$;PpJ P*IV5U5E!R/0 SjP PJP PT:   hw +ApqpZk4wp P@e` P1 k0U  +A`0` PP S0@0PEZ  +AZ1 P** w2Vp   +A Q^% A;  h* C ;(+ Q+C ;  A+PJP+@K`Bk*V:`  @P;;{P[pG{ ;S*'V   +AQt2y:@A+ 0;0r5F0+(+ Q+ ;  A+yPVJP+@K`Bk*VB:`  @P;;{P[pG{ ;S*'V   +A Qx A 0+ B 0'+ Q+s ;  A+PJ+ BR+Y ) P+0; B+  K[!*U:`  @P;;{`kpG{ ;S*8[U!   +A P: @+ m B + PdPߍ ۍ>c7$Llg*iJ[a'h6 O-M(,P p`@@0&P7J PP PW PLP P\P P .PP E,P R P W R  R.R 0S.  P*`@Ѝ@ .R R   B Ѝ R U@O-M@P[O:"Z ` B 00 0* ` 0S*R' p` P P,:\ AP:pGW A`P :"A  FЍ-``*`Ѝ "1/ A-PSp@`p@DTR%pVp P1pW(GA-PQ!@ Q/ ڲ Q/ ڴ Q(2?0 Q(2/ p Qqй( S p` %ppG`WVVJ R p`$PJ PpGW1`VVJP p`$PJ PpGW1`VVJP p`$PJ PpGW1`VVJ  X ($ ,O- MQ)*@$pPP $P,(w(pWJW(W$P,(, W0GP` `p Ѝ1`HX  S$p U`  P V(VJ,(p , 40 0($pPJ, `,`P$ 0,0U/ ,/   R  `,`2/$ ,?2/0"(RǸ(, p( ( P Rp$ (,O- MQ)*@$pPP $P,(w(pWJW(W$P,(, W0GP` `|p Ѝ1`HX  #p U`  P V^(VJ,(p , <| 0&pPJ, 0,0P` , Uh6oa0,83?1 0S 0`,`3? 1 ,(2/! R&( , p( ( P Rp$ (,G-MQ pp:PpWZpA`Q&B`B'?p @)sap``P@GGEQ8 @Q@@:`PVP0P1 :@Pp `pW FQP@A`@T`@TpQ=`†= R )R'q`ppPP@T371 QЍ_X* ilhG-@` p P0QS @=QR A QJ  18pP T W=*AT W5* A!" p W*T W'* A!! p W *pP pP PP  T W *Ap  U: Q @ Q=QQ @T W*Q) gO-00S0 0xS@PUR0q*`p0uP @PU8u^Jpupఀ PPPPPఀ P  0pK0 W P"S ppp0ಀx0pp `pp 00C S003020PU @\ : & % % % A-PpP`p7X 0V@W`.P 0` V7@0@3&b`7@`` V0@3```@V@µ/$o/##///%O-TM.L%)$Bc`$H P 0"  I J㢕  @Z :M F32 W0!P PP``f3 KP$g  A$`Q 2D0p2 @ PeI3 KP"pIX 2H02 @ PI,3KP@aAV 1M02 `@ P) 3KP @JP @ZWXV a`P10S02 @ P``"2P``PP  00P ppWJppppA EP QTЍ]# RR Q)Q! }P ! ! H-p@`PPc(2U  E PE Aq 0 .S R:0pS\WR: S\R   . A-MMx`P$`@P J$PJgCoBPЍۍU] @-Mr @ 0DPJP*Ѝ 'Ѝq]p@-RPPp@`PP  p@ p@-RPP״p@q`PP j p@0H-@PP  0Hp@-Q P@J`P pP > p@0H-P @PP :Q QP h0w0H-PQ RRg0H-P^ PA@?PYPP\P\\\P\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0P  TT P @000H-P @PP  D`P @00  d O-M-M`@pt@#PuP P P P0 0 00 0 |@x@D`@P DQ:*T T T 3+T -T/@T 0T+ xQdP 0 ` Cp t0`pe` P t R h5}htip xh01 w@0T @0H Q40, 8<00 Q ! 0B ``0 H R *Q! 00B0 pX R `PPU `R ` d@0X X' @ Q ` (p` I0X  ` PP0X  1`H Vp`(3*0H P+0X  ^P a P p0 aPp PPU   `P0P Ѐℰ (p(ppEWO@VR $```P+X -XP``0pH W 0X ``0^ `F0T㄰1pNWppDP0NP 0pE W q0PH0N UP:L$`DpLO^^pWDpDW$`i <V :VP p@ PQ U S/ !R a@ p0K\ IRk80TW (PV IH%PS@DDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD gP$ @ gPG0K\@pI8V/W WW&`Z` @@DX ` Z` ЍЍ@8w `Z`@ o% fW_ F$``4 R Z , R,[V<'P / ! a0+\ PUG MU4 P  V:_&B`PP `T@  a0+\ v, )pfP $/ ! 0K\ P 'U,   vWn'Rj `|/, ` ^P   a0K\  , 0 $ eP# `iy<@ P(PT$EgP4` 0, @P ˟۟P4 | Pw q lgDjg hg0 egg0P D0!  ٨ PhjPt p=hP P,lh p@@0(6 boO0PPS o`FO B S060000L@`C`$0@@0C X ``V`Q [hP  hP PgtPPHQh@PD Pt@D Q:h P JQh8 P{8DQ @h4` 0Pp4`D `iPP  @i<0Qp^P ceI C X /GJ `O`A A5?55?pg LeK  KNN @ `   Q @,P |G@PR<B0k2@BKFE0 0 0H-P@P P Q080QQ R:00@e< <0 0(f$ $0 0l@-@ !oO- Rc p@`0S00CSSP1DDDDDDDDDDDDDDDDDDDDDDDDDDW.p!W)0V S$`pWpW0T S@pWp p R[Z^\H-Qʢ 0P*w-r--x荬  0vS-S rS  wS xS S //H-\:i  P/P/ Q Q/@-@P AQ@ R RP//@oo//@oo/H-/RRp 0 0ꥤH-/RRp 0 0YP/P PQ/Q /H- AR*Q *QQp 0 0ꙣأH-PQ˫0H- P @ PᳫP屫P P멫P@0p@-MP@ AP ڤ`ᔫ`咫PЍpQЍpP/0H-@P QQ pP:PiPU:c0H`H-`V p@PP p`VO-M[# Pp@aP @[X 4 P*K! !@PK ЍA-MMpRl@`hdP@`R P@SP Pp Ủe7I DH-0 O-MM│`xpKlBPh@PҜPAPP AB+Q8 PPPPPRD@VP0000 XpЍ  03/P [ | 0 3/U PZ p pp p*p=M$H(#eH-M@`P+ PP P P p07/P  2/`` p 2/`P  2/P`ЍH-M@`P+ PP P P p07/P  2/`` p 2/`P  2/P`ЍH-M@`P+ PP P P p07/P  2/`` p 2/`P  2/P`ЍH-M@`P+ PP P P p07/P  2/`` p 2/`P  2/P`ЍH-M@`P+ PP P P p07/P  2/`` p 2/`P  2/P`ЍH-M@`P+ PP P P p07/P  2/`` p 2/`P  2/P`Ѝ@-M@000P.QЍ@-M@pAЍ\/. 0A0CS00B" S#:0 .R .S .\\ 0A0CS:-R00B S/\//\I *\' RD .R"\/. \9 0 .R .S.\\0A0CS:00B S:'0A0CS:-R00B S. \ 0 .R .S.\\0A0CS:00B S:0A0CS:-R00B S/ R: !B]Q0S.R P \ " /o2! @^R : /\ . 0A0CS00A" S#:0 .Q .S .\\ 0A0CS:-Q00A S/ \ //Q/!A^Q#/!  /  / /0//0/O-MQ p\ Q* P0 @ P*.000@@P PAS0P1!0P*@P1AQY YcY !P*\ `x@pY: P PJ`EpUPGPP` ! ~S p@"0D:SG`10S\*@AQD!0D^S:0SO*)0d`cͰ lX #V#6Fnea\`D0~Pv` e@@e`P3*@ P|`  UP$J`p LPJ@p \ pQ PR . P* @Ѝƒ(ЍA:C0O-M@ 0`pW  \W .W9  [* R Q.R @[W+  P sQp P PQ ` P Ed @ F!p W`` X*p@]"P LQxQp   (@QP2 U1*@0/R# ]R* PbS````  P0R| z ^x@T " @` Vh* Uf* 0pS P[  `O]QST(@ Q U1I*P Q@@0 @ ;A@.P- P2  [ *P X*P @ Qđ(Ѝ RЍQ X* H Q@(@㪑@꧑ /A-R8P0U9  0 PU. U'*PP`@V VAU`PVQ!P`V*UPPE`Upw`VJ@@@@@`c(C( H-MPЍO-MRD:pR@* 0PU@ 8 @G   i` P @PAU(0`Pa!`0[0Z1*P ׈  Q*?0 0P `T@@XPU(@ @ <00P0 B  T @A@ЍO-,M`S PY 0SPP  0S*p@WpAS@pTq!pp P SP@ P@(TYTpQX @QUAPT Pq!pMpZ]*@0@D>Q Z:h0@D?P* C P $`pW?  RW4$R$p$AK^AL 2P 2 \p R$ PR@PJ@p P-*@ (`W(p@FpPP Q* H P(P}  ( up, XY#(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P +pPP Pލ+8` H-BMhp`@P 0p'p  0!QBߍ 8ԉ Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0S(00S00H-Q 0S AQ:Q B}z(G-@pTWo᠂P` P0 P1*T`P ᘏP@pTWMJ(H-@QSP`p R xPpGP`W@A-PA@T  #QQ*(Ap`PJPQ`@?@-Q 0SAQ:Q @(@@ MH-M   ЍH Ѝ/@-M@  p TЍЍH-R0Sb 000S 0s 00긅 O-M`PR@ E @"PXЍptP+W -W p0W xP `0W`U`0@ Qa@"Q#L*@`pQZQaSVeZUP@@D"ap00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PR=@pX QЍA@QuG-M⤀pP`@Q$A A O O | 0xdA`A\Aqpqp@!Qލ96Ă K-rM⤀` @PpAqqa O \qOXqtTq xa 0ha|pZ(hp!Qrߍ 6 @ MG-sMⴀp@P`{1A$a a. OW O | 0xda`a\aqpqRp`!QsߍGЍ/5L MK-M⸀`P@p!1Q$q qO$ dqO`q|\q a 0pax0pp!QލKЍ/5뀀 O-MP@Q Y@@`ЍpP0Q  UAp/W UHP%p@ |P@UT@p`*VJV:@V@3D    @CP @`@V PH-`p@P} 0P8~0H-x@x@P dd XPP P P0P E@0d} ! hx <| 0H-@PỌ 0HH-`p@t5h dPW  ?8 0zE HoV} 'nG-CMr@Pp,@ PO  `0P!0D 020" 00@P5`P A4@P+ PP1 !, 0J P',pP! mP  03/$P QFHP  @,PCލg4O !  NP  !0P f!0` B` 0 0 w@P ( R $2/`P Q ,0 0wt| `8| ,'' | XO-MXq@T1 p0DR0PD (Q$a$qP `p X0*P        ЍOIS5$Vv`R$$$#H-@@P P`4qpP( ` PV: ` P  pdP q0G0 PP Q `ApP +V p$dEt`@O-TM@R  SpxY `P T@,@Q PU PQ$$$ ( jUQ P"$0L $( 0U@8 0($" jPM ZRp P@p@ XJ VAQ@@0! LPQ 0 40|0<P  P QKK0S | 3/@x Q@Z@At@P $Q(( xxAT@TЍu H <  ̻Ȼ` 4`T4x Ps   O-Md\ op D@ D 420S$Pq QPP! ``V*AT pW W P P U \pXppHDQPP `4p`W*V P  R  2/P U  @@ 8xDQ 0 0IuttlЍ ~ظȸ 2lxr phL< p ض  0H-P@P00HK-MpP`e@ @ \00 pp2P `@FQ@M"ЍXp G-MpP`0? 4@ 0p @p P `@F,@("ЍO-|M`x$ P V %P0, %pAUW@q(HhX ,lp|h4 XT ` X$ x  0 < D 8 0 0,0UQE@mW ` 0(p#/~7h@JpJ.mPSr`U)<S%mu0Q#17pP%Rs0pPn3Sn( `ᓴ0II;U (Lr E! /@!B BpNp T(T P(JmqR3/>`%)<#"mqr0Q#1'p0#2r pPnq3Rnq P V: PD P@!gQ VQH@, 0  V4* P `@\oIHP% V&: P+x V,:E)@P"d cspgG'v2br r#18?Oc0Q ?H@ 0 V*P `@\/ H@, 0  V*P `@\ B/H@Q 0@ P ,0  Vs*Po `@\H@, 0 w V[*PW `@\H@, 0 \ V@*P< `@\PH@AIIP(@!, 0 9 V*P `@\H@ `P IIP@!, 0  V*P `@\w$RE)PP"d cspgW'v2brpwY1(/Oc QTdp=H@ 0V$*P  `@Q` PJʆ @p Po P V*Q `R`ᰆp=P8 V8:$ H@, 0  V*P `@\ H@D,  0 Vn*Pj `@\H@,  (0p VT*PP `@\H@,  0W V;*P7 `@\ B+H@Q 0@ P , 05 V*P `@\H@, 0  V*P `@\} V* 7 V* P$Q `\h$C  apH @0 D pX \0-)2@  V*P `@\D V*  V> H@D9 P 0 V*P `@\# 0 {`H@8  0 V*P~ `@\$ HH0 U`HPPa)pEQ"d aq0cw#6aq r1OcPd PBJH  `@p *` Jd @JG*@ p/ JdP `*` @JG*@ !   p P$ /1n $8 V*Q `\P d0p"sgb {tgYP#c  sqRdP d0p"sgb {tgY#brpwP@dp 5H@ 0V:*P6 `@Q`0 $ V*Q `\3$h V*Q `\%1x0OQR0d Br V*- Q 0` V 18 ?OQW dpGw V*- Q 0` V $ Va*Q] `\18R?OdAP3QH@ aB0 ` VD*P@ `@\Qd@RQ PH@H3`B 0C V'*P# `@\IBϫW  PCdpG; w9ʠ V|*-Qv 0`Vq o yAYA3 |2Q 0 Q!00C -Bo R `V*02R,0 R `W`H@HR2/3 !Q1IP2aB%d   , <0 V*P `@\0O `81H@ W0 pgBp V*P `@\`0H@ W0 pgBp V*P} `@\ `w `xP|Ѝ+km<Sw WבZ j0ӚHX G-MPp/`O@ @ p 0p pP `@F;@7" Ѝ$X V X W G-M@pc` 0P  0p PpP `PF P"Ѝ\W V V @-0Sm& h@T@R @0S\  H-\ m60 R0\pς@-$@@t@ VH- tH V@-@@@P O-MBPP@ H~ P3P tAPЍPJT@0T@  P  -h0@Y,A@T1!0 TM 0SKa-P` mplh0@瀁 P @ha Q R 0SR( 0S%-dh0@Qp aW``aPPePP UW R 0S  R\\ Ѝ P<<  $ lК0H-P@P  P Pہ@P0 A-@Q `P& P P:P  P|PP `phPFWS}PpTP|h aUPC@ DPPPPVhp@@_@E qPp`V }0 O-MРP @P `PZ Q  P R `PZN V P W P X(P  PZP p_pqa`ZpppW RBah P( P^ lh> m  X ( R t1Q0!Md  b GZP`O 0x| h )' 0 Z0v @0pZpppW 0 P 0 !P R܀ P0VP .0@"0pZp S  Ѝ  1< 0H-LP@P<r00, 0(@}0L vN$0H-PX@qLP@r4 0 @_0 M 0H-PX@RLQ8I 0m P(0d h@ @-@ ] PT  (DH@-@X#PQ<40 0= P(  H،0H-Pl@`QLD0 0 P0(T$  (0( , ȐDHp@-`lP@\QH 0 Pp$T  (p l 0H-@q0  R 0phQTL 0v@4P0 6K\ ̐ x @-@P X H@Q,v$ 0@I  @-Q @ R TH[@Q,R$ 0@% d LP 0H-PP@ D9<Q(0  00H  O-M@PU8V pP 90 07 @7P `0P? 0 @7`P 0P0 R/JY( QN@uv P-@, $PN/8P(pplh0@@@0S0`Va`` `V0pP@`~P8Pߍ'W\,07`$m& PR Sh@p@@7`8P  0Aop,m&2 0Q 倁S h&,?o 2B(P p 0 0`Y @7P 7 0L @7P 0`0PTPTP@`XG HD $D K-8M@$ a`P0 F 0p (P0p,8Q/S~ 0PP7 `7P p 0 `7pP(PJ`p-~ PJ eJa*e DJA*D8Ѝ  t0H-X \ @LA@RP pR0H-P@PoHxP X0" Q `A B0U0pPUO x xCT O-pXB`Q ЀA`FPR Pp`oXPQ @APE`\ `pPP\`U`pX@P\_`Q`+PQ@APE`\ `RPR pX@\OR `\P @QРA@DZB!% \ !$ R 0H-Pd@3XPLAo@P  0vP@ 0 Aą O-MFMXP`<-  p:Pp/PP,0x?@PV n&o/Bp ` @ G.jP P PP/Q.Q .jPEQ/Q`P +p*@@ݭp$`& `ѭ+P p|@@ݭPJ o nT8h<hmHP`-$3,, @ (xP@wHTX`p@0xph@u}P@v7'\~s0u`@ 8vP4w@0r'Ty`0dpQr84z` 4p0{`41W 1PZJ\pZWJ}WQJ1QSJSUJU@L00D@4#@0>#0`,0Y}0NX?o2  ,<`(0 @ 4XP{ ^|:wL`PV VpU UmW @Pi$ P@ \p1@P W> 0U^`s@ 0UhpUtU40ȟ0UhpUtU4U0UUhd `V8htX p4P'T10@R@ `B1@0pT p\p X   WPU㤇ZL` H00 S0~PpRPZ,4E@PL`@PZ0p@`PsHtp tqRp @R0  T0@Z@PL` @<T T*0@0P00h~300Q1 : P0` a`V E@PTL`0 T h>0P]0p P BPD p0 0RI \ X` pV `(Pp@$ Ϡ`(Pp@$ XD `V(h d `$<&̂TX ` @Pv($  ^ HW@PL`\ R P A0 R'P80pqR V 0S8pS01R 00 R U 0SS0ꬃzP ߍFۍ"l P Y` PI` QQ` 00  P  @Z5h`P\ `X\p\T Y#XlTp㉁hP pxP pTpv1[ThP@\\ Po @P. @0p0pW0@P  Q >X p0p `0@U0P@!0P`00@pW$ ` `1@0P2VР`F0C T T20@/%o0% RJP!! R }P\p|W `h pW@00!@PP? nT\8 \9 5 D6 \5 5 3 2 O-|MpPQ <Q ` RV >R `0 A R+A"Q#:Q`@PF@Qx/P W APDh @  "Oq H  @UP @ADhpQH@X @㰡Q <Q,  R >R0 @pxl0t`hp  0q@Z P q 0 A R+A"Q#:Q<@<J@QQ ,Q;QxAtp\8 0 RP] ;P,Pu`p,0Pm ,QjLPe Pb8x@0t d@Gb0p0 dpET.Ao% . /O/,,pWtJD00SH000@@vS00(0hDA7P,0m&0ppq@T 0St8,8 Pw|Ѝx3haxPH*0@mD4@0P p  R H A K 4˿ m Rh&aHp,0Dp,0 k  8pt` (@ @p@P )@L!(<2@a!Ra  @P3  /'0'PJjD00QH00a[ 0 `00$@ L0 00P ),@"L,(,"@l1S00 ' l @Q3" ! @ P  @\8^6GR@$ `(00 ÿ '?'Q JD^H >P ($0?''P'JD00^H  @@$@< \@a(@' 'Q J0(pSt$@00P8 ,0,@ CP,0ɡ$rpml@- +R -R 00B S; 1 0B\8 00B S:|/. :R2 00B S%01 00B<S! 0@B T:s"c P:R 00B S01 00B=S  0@B T:s 4w1wT@^ l @- MR JRQ@@00 C Rj n! 0 B Rj00@C T:Ra@R 00 C RY ! 0 B RV00@C T:RM @ .RS00 C R? ! 0 BR@00@C T:R7 @ P.R=00 C R) ! 0 BR+00@C T:0 B@ R* 00 C R n! 0 B R00@C T:r  /R@1vvvT ,@  K-P8 )|5@rL7#(lb@cqW w c2p@S30S Sr10@x\U@QEjd0UnJ @Vr`: :BSp?01D@COR@_gf0@pPcVp@CI?4I2ISCA?1CB@X@BY(1Pi02@ 1P0I`V0S@@\@-Ԁ`LPV:P[P;2Pp@JcpW*d d`V;0K0 p@ `rqP`V0# > q?Op@;P7&0^0QQQQ0edO-MR`Xp0" Q A B@pT pQ0 T  P< 0 0@<倁@ 0Fq`.LHn౪lW@RG8?hgBh/ B  -) ,* -CR BབkCBx/ (( BSw?*f 0qp)` O0Pza`q."b@(97dd 0V%.0`QV[/!@ `@ *),8"L\?H\_UO!Q8 5@!.+N 0#q"!? 0U(<2@0:.+NQ( %@!".  pCP  @  3(@PMSK@P@ᠯmP2 ʏpYPyd 0pV'.0@QhV@Pyc p0 y Op@.0p@P[p{}P{c p0 { oup`.0opvl[ & &J/0 !!0@ [!iIIQ p@A!AP{d 0V(.0@A VtTЍp{d 0'OU@D.0U pI>@HII%Q 咓cAs AB@  @C0p 0R00p Z *) 8L\?H#" # N Q @ ao"!/\O P( @  : NQ @  "2p C>! Q  @ 3l0 0W ` ` @ 1pG@W$`  @Ѝap]O-M, (  $ ` $0Q H1R/@"b1Cs@T<00< 0o `0QDO o* *BS D/PBl?H?UP dHꤟ P dP dP dP `4P `)PP dP q` -Pu`B?P  @ ` @0 @@ @P @` @p A A0PpM PH B?P @ @0 @@ @P @` @p A` A0 hp) )Pa daP` d`Pa dPP  hYTPD7 V J XP @ZddHd@X`p0PLP FPQ*P4P .9PP P& p-`P`%P `P `<H<P R  pP p 00| <`P 0PP pLQ R R( R %2^ !2 @!S(  08R 8S p0L8 @p" `8R 80Q |L 8 `8H @eZ_dP`Pd0@X`p W RQ\ T<JP`@D`TPETC Tp?P00 +:TPQ- hUP' 9 E UP/ P :gQ hfUP0 0TP09g0P    Q  :P h>UPg0gP     0 Q :PU hUP`g0V o`OVoT`H TP` /:TPQ5 hTP6g0-ꢡNF E UPP`0:gQ hTP0 TPgV g GR9RpP` A:TPQ hTPppg0 ! 6 E UPP`0:gQ hTP0 p H Q&:\P0) hnT TP  @ P`V<:0\0H  S 0T:g^Q h\0,fPJD4H @`@ V `VXDQj:P. h-TPppsg0&H00 %( H00\ 00S %B/ 0:g^PK h T0P00D npg  PP: `0 S0):\Q0- hS0P00' M`p a^!q @WS0R 0 qTp8\004SH A    :g^Q hS P  P 4FP<P#0(2>PF V`  R  :g^Q hS0P   5><R0000:hg^Q iS0P00 00P,S:P hMSTPPppg0'a0 TP0 0 `\F! E0 k%L X  p` 0 R e: 0P` px`! p F\000j X0`0S Y  0V0 T  gX 0S X ppg IR8Rj`P` -:TPQN hRPpp*g0F E UPP`0:gQ hRP0 i`%TP"00gP  ( S :Q hR P pgHL` P XQPQӦ h``P PEXpU`PpGLWXp`Pӏ LP@R L:Q h`bRPg 0g L@` `FV`VR p`:Q h=RPg 0` g Lp@PHgP` R` +:Q+ hR P Ug0E U PR`0 :gQ hQ0P  6 b g ]@pTPZHHLP\0 ,0( Q %B/0  :P hQPpp %pgP 0 ` g0s*0P  D4HpP@UPUpQP:Pp3 hQPpp(g0+Pp(p%cs0 E U PR`0 :gQ hgQ0P   pg JR2R\P` ):TPQgp&` E UPP`0:gQ h/QP0 \ꀊ d TP: T8ڼT$#P ,:<@gQ4 hQ0Ppp, k@E Uڸ"P P :gQ hPP0 O<@gQ hP0Ppp>p0R` :P hPPpp+gpgꄁ\"ph`\Ph`DPU'(DPh`P PPh`DP  DPh`U  PDPh`hb 䀟U ]@PpP TP ߍۍ h`@T`@$8DP\]| L D  h ` ~ @   z tz H-`@PpR 0@bSO-,MPPp(( @00 @pWP  %Pp R *` A 0`B0 @ R :$Pnp `BZVU AL L L L L L L L lL L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L hL L `0L 8 L L L @*P2 0 @ p R0 @ R:}`0A P2@!`0A P:$Q?V*:vi @@@ca [ YWU`0A P:!p`0A P:$QJV1:O$Q@V :  p00p (Vp^7*^ :  `00p (^ $QV :(  00po (Vp(^*^ :( `00pV (^ p(^*^ : @`00p8 ( ^*^ : @`00p$ ( !^     c^*^ : @`i00p (^*^ : @`V00p ( L : K \  ^*^ : @`700p (   , = ^b*^ : @`00p ( ^O*^ : @`00p ( ^<*^ : @`00p ( ^)*^ : @`00py ( ^*^ : @`00pd (^*^ : @`00pQ (  e ~  @ ^*^:^*^ : @`00p( ( ^*^ : @`y00p ( o^*^ : @`f00p ( \P^*^ : @`O00p ( E^*^*$^~*^ : @`400p ( *^k* ^: @` 00p (^A^R*^ : @`00p ( !^(^9*^*^1*^ : @`00p ( [^* ^*^*^: @`^*^*[*(@PTTX :PI ``X:  00P0( !R0!hhhh0 P0pp00 0 P (@P(@,Ѝ@H-R R RT 0p Sppa r A`PqQPBVS0U0 P0a0p , ,L"!1@00a$gF fFF PU:PR0^Ba/a`E0p`pf pSW Ua0`V0YK-MP`pV`U fW@ ^@^Q Ѝ pWW@^@^P ^@^@Ѝ g*g @*@FaU`ЍG--@ VP bP(0,&/O0dL &  */O ( Q!UPUppGP `UGU P GI`GWP  !G@Q@W"Ppu @Q P USPO P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P:  X`qmm%O-M-HM<Px `@0pP P> P@ P0p0Qq   JG R    @ P qWp0    HЍЍOf0p00W0H @D40P *ʠ* Q0  L D @0OSA$  8AC@ 0+QA 0p1+A; q+ `+b p r a @  0C  AR00 `0BBD (q`a`pS$@Jp`Fc U@PU  BU@PR80, ` p 4X8\<`P<Q<`P<`CP/ 4, [o Q Ѡ 8V \   !,H "\ = l0 "Q h( "2-  pQ0   `t   Q T-0  pS  +a Q:a  ZVQ@L ` @ Q +`q1 R %B1 B +PP$ ;P+  ;r p0a :Z0(p$`yPD?aCoc?`(?+ pa @ (p@$` ; p@  b0  Q + ` ; p@ *0 P+;qc $.+QA;KraK#JP$ `@ Ka0 pa Za@a Z (p$`H ora ZPUPE0P 8@(p$`@P%J\#ʜ (p$` <pQ* A + ++`b+x@+;pc+NAB000@@+\ RJ " BQ D3$6PaQP%P @ P@QJ ``1P8@ P 0TRT B@DPES Q" MP 0P p00p, R[ [ r``P0(pP P  Q P 0p,Q!4QX QI o  pQ ` `  `P:@0P @ <P8T; ZZ 3P0P @QPn PPN [ e PF  P**0P/(p$`Pp9Q^018E80W8U0PWPpR0P PP' T` P[ HЍЍ,P,P0P@PJ r` (pP$`8pPP`@0p0EP0PV 0  M0P `FP  A0P 8@8P   1 PYP p! DQP 0@PO` &@9P~ p4PQ @P<@ 0@P`0,[ @o <4PJ,P P PP,PeQ `[XE4   P3 @  0@Z Y'   P$ Y  0@` @ HPpP 48 Q0@ (pQ$`A 0P 0 P18 04"j(p$` PUPE0P z(p$`@3i}mQ? [=P 0 sP2/ 9Y 1*9Y(p9$`E'% 8 0@u9QS1 8 @P ?<P1EQ 9Y 1E p@E,@ T ܸ < ж RR:S S/*/*/0H-@PP:P PQMPP@0H-P`@Rp:ppP6P p@Q   R@U0 12 hO- MP QepB`  @ U T@-P 0@` `0V00R@P @ `PA ` P @PQ@JP@PP J0 `P` 0`PU0P0W Q @ PQ@J P ЍH-UA-RM(P@OD@, ` ( yL 0 P ` B` &USH-TH-p@-@PQ P PQP⬺`P  $Opp@-@ SP᛺`P  OpH-M/ЍP H-M D" -b@/  5ЍH//8 H-M  0 pЍ0H-@ 00: P:P P P! N; @0000 0S P/!C/H-P@Qb  @P `Q P QpAG,NGV f1 O-M-MP`d0@pSR  t p l h`Y NR:*^ ^ ^ !+^ -^@@x^ 0^ xRQd xl00Ph@xh@xI@x0^ 0 H 0 C R`\@TP X ! 0B 0x000 C R *X! 0PBP  @XSD R p`@@T `R0  x 00S S B0 x 0X pP@LpK0S p0pxpp0p0S p1 CL R@P2*0 C R*0S @ \` p1 V P 1V VpW` ` p `pVPV Ёx0P@Lp pPppEQPPP x0`+Sf -Sg`bhPr X0h\ 0 P 0P0a0^ hx0Zh@ P@@X T P a@ p0kP 0kPLG`P05Q ph pQ[ [[V`  50DV h0 p AX6PP px00C Q0Se0x0 0R C_pxPPPH0^`? T: IC%P7llx P x@xx PpxTx\@BPd p  04PEpG 1BpQxh@0pB@@`0D Q`x`0 0C0pB Q@:`F0P{ p&@ h p%`[h`!K a `pp  p0d 0P T`\@Bh@0S)   a p#W /#C HSDt0Ctp P t`1VW0A@p/ps0c    p#W /#C HS`|0Ctp P t`1VW0A@pKt`0# tVPpAY 0RN   a `0OR F~h@Q@~QpgPcx P Xpd0x (Px xXT\@KxT\@t`0# tVPpA 0R   a  |< Pl | `@ | pAW@ |@ | XpB`00VpT`\@l0S"XdWO HP> lPC@@`V pBW>l PlG D IpD h 08@@m {k Y. DP ``,($@˰ ۶7l R0 @]S"[l xTR Tl ЍЍ`W Lt r hp n $@ P  ! Jl P lP Pl |倀@|H  P s P qQ ' Pa tlT  l  P`l W. pg P`l  Q `A@`TOW, `pPpF0 W* I4PI R `A@`pT*8@Pp@@ l|p|@@Il\ ؟ <l Pl@ |p@|@@@<0 <PM4 | `P/0P, J+h  hb#J`#` y`ZT1D wPlg`@ @plHp|@P @@@PlT`d@P\@@@ T`\@dW U!WJ5dU!4PW8@ R - P h P=U W2 0l rqR#*`v PB PUAU9E P49aQ `pY "@@U!@ 0"@PP!@  eP X!@@@ Q @Q vK"P@  P /K-`p@ R 9C P0Q @P*  YppA PI`V0 A P PUpGpHY pY @D` 0 @P @Tp`0H--M@PF  B ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A0PP@Q@@ P :Q```F `F`PU PPR*  T:  @ Q`Ap bpW CU P(PࠁN#B0S " R10\  R/ R /@9+-A357A4013Aa 00A /pA-`V 0K@R!0 R1*@Q c@`@6`V: `0S00CC X* 0# 0Q0!p1S`0F`C&11T&11210Q1:(`Q1!ppW a DX 0R: SA@-MQ @ R @P:@ {@ЍH- a@`P TQU  t4PU P v xtPtPEQLUPP $Vr r <Dp L q hr 0H-P @!P:0H轲dPPQ T:L0!S A0,0H- ! A0p xq Hq @-  #"!rQo"(r^2"$^@\""0"!0S    O-M?Y a_ pA pp\0[ `QY `H8P `! @!P : @6!P: :`3Q% 0!S  PPQ `0!S  `h! Ѝ$`! Pn o |n n do Թ4o LP31P"0"11P 31P 31PA/A /0H-@PPP@0O-M` @R@` [P4 P[ PA@@Z   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` L P@P &Pq r&apW!RPP qpW EP` pqpP 똡 猁PP$ fPG pT !P:-Q 1 0RA   A@[ p`WP pW3P pPP HPQP LrPЍ\pk 0l (xk j k k \j K-` rW WPl  V:RUP+?0`! fP@VPPS5Q:UP)p`V AA Q*pV` `F`FP`pPp0p2V1 :0!q1P fPU @^pS:YL! !P: ylPPQ \T0!S  4$! g `h в0h  0P/00 R @A P/3/G-P pR 0!p`VpA BQPJ   pp3WAPAP0 /0A P`p`pPpVpp PpW: p P*`@``PVP@0@P T0:@ @R p@- P`03P@P3H1T"D1"1T 3B1T 3A1TJ  R @b@P SP b 0A5 S>0 R N+b S 1@2@@pK-- |P kQ Q*Q&V  KL&a@R% 0_G"!0Zv@T0Oo&8RspWB#4WB\@#2p@#1#pW. @`T+r0S`?o"hBvpW2&dWP2U0&bp0&apW" 0 `T @` `@  0 @ 0d302$`R` `Q 3$A5d# 0 @`` Q20DpQ031Q""11Q2 31Q 31QJ ```C R/  R/H-MPUE@: eP3 ` @vP,JpQ Q( /xp   P GP @`  \XPP  L00@ 0$( ,@ЍEEO(b a a 8a w0H-@b6P@PP60Q A  /@- aR rR wR:<?0,0 e@BT APx%0R +R$0+0 3Ep@-@P3 5 P0 QQ }4P Q 1/pPӼ 0P @ P 00`aaF6`O` pD p@-@0Q QA 0H-@PGP HD @H0P @ P 0<PPP80   4P%Pn4 PPtGo!$P  5/PP0 @ P0^ ,]   Q/3H-M1?A hDЍ0\ \ \6@@ ,Ѝ6@@ dЍ6@@ Ѝ  //O-OMP.DYPwpPP @[Q    ^vP DPDP D[ 0  j p x|Z : `,DpP (8 4 EK;[  &vP P `X P Q P4P PQ Q$Q4@@P3 P!0! P$fnP 0 @, !P2#(0<  R5PX Q [0$4$㰦P P"Ÿr b 2p `0P @XA/QX At123P7` 5 602 p37 $1$(1(,1,010414818<1<@1@ D03?D0 @Q3B0B,H-Q p!B@-@S B,  0@@-@ B,  S 0@AG-M@So`pi $PJW $( $ ($PQV !R WW(0Q(( $QU 0P;  !Q(PU((U$QJ(q 0PU(00S0P  (0S Q$ $|A,Ѝ(qPpP P 0PnQ !R U0 :pW$Ѝ pWP G C (QЍ0H-Q BA0@P P4P  OP 00ZP@0A0O-M@(0P!(P5R%p5Xaꇑ HP.  pؑ ` # m8 pa§P (! ! PD  , U , 0 ЍOfЍ@- 1@3/, (P0G-M4P Ha5 !0@ 02/%'()*+#,"-!. /'0&1%2$3+4*5)6(7/8.9-:,;3<2=1>0?7@6A5B4C;D:E9F8G?H>I=@ J<` KC0P ``  LB 0P` 0 `P  MA` `0 0PP   N@`0`0 PP$ E O!0"`#&P`Fppp DPE@G``G`@Pp0`@Q0`A/ }p APP`P@U 8Q 0,`9jP ލ?O?,ލO-MP@ ! `2/,V( o0Q 0 Py  @ᰀX]:@ `YTZ :FW P*Z 0 pkPy@!lP1   0P @ `㲀VoY ) Q] QA0 lP ;@ @P 5g R  Ѝ dP  g P  dP (@Y TP ( B  ($ @$:O-Mp`@S [2`p PW  ҄p Pp`P PB6$@P X |ğ xV lhd `\40 0P Q Q)  00 p Q0p     woPJPb "@ Qa y}>`V` VlVh# [ pF W a ppF^;@pQwWp1R;0 *PS 0" F* *+P_ PPPQ +    p9  5 ( "!$ !(!00 p3 ($`7, P 6$>, P ` F P, =O@T p n@Ѝ 2$( "r*==P=  )P ` )P pPH ` B5 "+ ~ F 0G G F E D E D `D LE \B C 0H-@Q P+P 0=0A-M@`pQ P*PW w=PЍ P ` P r 0P!@ P *P *O- Qi +01A3?450@  Q Qp^ 00s^PO@1 `@@@``pp P@ @@@pp `PpP`pP00P@ 0 P@ @0  P P 0 0 PP00PP0 @0Pp^^ 00s^VPO5_@%@@@`Pp`Pp ` @ P p @ P ` pO-M  QX   Q Qp[ 00s[`8_PPp@@p `P Pp@@p `p@p`@`00`@ 0 `P@ @0  ` ` 0 0 ``00``0P @0`Ѝp\2 00s\'@@@@P`pPP`pP @ p @ ` P@ ` p P@013Q7a Ѝp@-P@Q `(`'`p" (p P ~ P wP pajhol`P`pp@-MP@Q `(`T T;Ѝp & $   1(P b@!@ @ b b20 + @'@((P Ѝp  Ѝp@-Rq0 @x2rspqpp @R*R/0Q:/H-Q  0 th\PD8,"0"0"0"0"0"0"0"^ O-MPR pW0 Pp-0!13@`0 p0 o2W$`@ T0( `pP YP TDtpo `0W ! q  p u~ 000T `pWp@W@ ppdPf  `q6"01qA S 00`1 ZO `p0` t P P@P 0pdd`P5` `  0S0`[đ ` o02cP pp[ p Ѝ0H-  0 A1à\1#!K-M`qWWЍ@P ̢ppW R T T  0cP U P 1嫢ЍЍ 00 !     /p@-`j@p PV kp p9`j9`pA-CMHaP@`,kQ \+!P1 P00,] P:_9?- $ *j,/Pp ,kp  Djp T kp  j 79@ j7j/9@P,PCލd 0 kpO-DMpp` @@Q P&P XXwP 0S@PP%8@ QDЍ2X(P 8 <p ,0 0P(p4( 0S 'p $80 P8 ` 0<  PX  %P 1 0p7 0cPE %P0  0A P0Q &:PP  p P ; PJ   %u䱄崲 P\   %  P` X0P  %TP        A Q *0  0 + ԱP 7R@ 0R B 00  @ 0q P ( PQP"!P P PR  @pQ!  N% X     P`oe. , , + 4* O- M@`PQ p!%p dUe Uf NP PP @p0 P   R BP  Qr 0A A0/oᢲ  0P 0 ]pu P@   $[dPb P PPOG7(A7 Ѝ "$P P@P $ P `QE $ #PP 1 `@% P  a$Y     Q$Po"D$P, :$[Z qWD  2! #P| / @`W qQ  $qW!P0ZP0 pJu !1 P P# w#PH `W pGPP #  e#P6 `QV{ P( `QZF  #qW;  2! >#P `WP  #qWP@ X01P  u P# #P `X !/P @PP #  #`PO-M(p `Q R Qn Pp  p   }p  G p? P BUP0P1Q@ @ & 0_ 0C0sPU*Ps 0{P  B@0@TOJccRa@HVMJA\ ?P BUP0PAQ(E Q R QAʁЍ ( CWR [ K   `;PY O@@p P   `)Pe [I p PQ @I"P2 APN  "W㰱 ` 갱 `   0P((5   0ᰱ `uP Ѝ(('Q "P    P  v"(( ( (  g" O-M,pA T  2! !P TP`@  dp7 @P P% {Pv P p  p~X 0 0CR 0 1P0  6 "I?A@  '   Br0S*0r/{ @ 0 A@ @TOJbcRa@HVMJE\  ?PAUP0PB AD !P !p pP qpPpЍp@-@PQ ,!P    !Q `!P    !pppH-M 0PЍO-MM`RPQP pSJGO@ PJ P3? F @Y:@/!P 34P Ѝۍ @XP>IY*;F  @nYFG    U -dp JT$ epD3P P p尀? #P P0PpPeP! Pw3 /P HXe/P   P _3{yY3@oᠲst d]h\ @-R@QPTP*A-MĀ`|.P(p@h AL  a@ *` @*@P9 T P T |PЍK$ '  t 0 H-(MQ@PD&fPQ `P" x @0PP   ң Q p T(Ѝ qfP& `#/` 0sp  `dpd`ὮVeP ! `P` @ A ZK-M⨑$P@ Q "PHp` A  a *` @*@%*@ V9  V. *]PHp` A{0 a@ *` @*@ ` *a @*@c V V `  S PЍm$$ I $$ D ७d  O-TMP$PP @A`FZ @BZ p  ' )?@T:$p@`   Wp@p@`:X p   )  @ PPTЍ   O-M-M@|dq/Ph(`P   ϊ  `@ *a A*Ap W:U l U K/T| PЍ Ѝ$  X 8  p@-(M|` P`$w @T L T $P(Ѝp $ < ܴ O-M @p P 0 QH  @ .@` ᨰT P AP0 a@ *a  @ aJaJ@ @*@8  0 p.  P+ P@ p Y @  @`. h   ` *`*@ D Pz (PЍ,4T A-(M℀` pP$ @mT L T $P(Ѝ $ 8 0 O-M-MxP P@   @ @ J< T0PRpA?qRxy0 `zP p*`  *G Gϊ ` fP@ *e*G K   ϊ . a@ K f @O a @ e G~   ϊ  e@ *d G*Ko  6 P2 `D *` @*@ZP F  P  @P@e PfdPЍ ЍU+  P(P|O @-@@Ⴋ $ @  y u H-@ P ` p$ #,H&bO-dM(2e0bGpF,te kF @H Pp0 $@X@ @0,THL n$ #CP\PP`` 0 pPp "`X %Ha `h!TDfP"4e< 8`zXe' P %a8 #i @aX `\e<P@,i#d(nʌ dH,k a("i `a ``i *d,Tn "|fl'f8#afx.g` @ |Q[F (PC    BR0!@d @! 0 P @ ! 0  P P!@ @!  P``F( 0@( QP*ppzp R* @vo^_PP@ @zYDp  w00@p pzY.zu R pPAQ0 @\p  u qR,ЍT&O-M@`Q PP VJ FP*(FP:$PPg**  0p P !0! 0 P7P  VaVc V V, V, "P @ P 0 s0Qp B`1a0` p P, P p@  K1!0P`a`崠P ^ P)V4 V9(9!@ Pu R,V,`QQU  E! 3 P  U Pu R 6xB 崱q(P+ P@Q(` 0 Y!u0p0PPqp`pq0  mPC  Vv,PaV2  F!  TP+ VP 0 @_P@1rp`p ! ` ! p 5P  0 ! [$Q`P - (rQ=`( i !@  Ѝ `PyV  P\ `kV  P   PHp@-@`PP  (aP(pO-Mp P{@Pi `P;  O嶰pPpQ  +붰p崀X @Q= R   P? @@@@  P PP  R PU  @jP! @ PQ  嶰ᴀp@Ѝ@Q @O-MPp, @7Pi  ^{ 0 @㴰10`01   PK @ @`tᠰ ἰ P `P@D@T` v[F   ' @vQQ @P  @ Q(  T` @ЍQ P @  Q/  /  @* q Wg  2! P / @WqQ.  q@0W-  ` q Wh @ 2! kPc WP4  q`W3 T01崀  pDx! @ ᴰ@ ?Pj W pG1   @d@@V 01@  pt @  P `V !/@ @q@@   @7R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/00/ P LP(  *aJa BH JA $8 BX *@ B @/t*O-0M p0$` P (,pp `PD@$,  @$0@  $iA`F$iK$Pq (e+@!@ 0S (p  @,@0(Pp@pAq@$ ' sdy'A'pp@eC!E$L$   (`0Q @ $@ @) @ p$cAF$ cK$ @ ` pP@0 ` 0Ѝ)(O-MRV `@Q @Pa(UA (F`@D @T,:(P@0p *g `0J` j` j@ @ *@J@+@@D` ?Tp@T :@p@@D ?TpT ( ЍH- M- `@PE РP  Q (p7Q7a(P\X(I @9 @) @?Q ?!(P 4 @ @0 GD(@(P ( P2/ PPd @@ @0 @ @` D FP LP(  *aJa BH JA $8 BX *@ B @/%H-'H- P# PP  Bp  B 0 B  B  B0 *c  B  B ϊa0JcJA jb@ AjA`*@ B @/\%O-MhX P< `T 8 H4L0@D(< P40(\  $ `L,0|0 00@@\P@TXp@Pl ` 8$pxp,PP t `p Pph @ @堐` 吰l 9)7+g i @ @ ')) #;4 "+9 70&kd0#`0 ` p`0t` d@` @ ` `0b  t%n0! 0#?'10&l@(c0#`@'.`$O%A" "LC "t@ ` 0|0|x 0xZ@t@@@tdd `hl @ ppp堐0xP!p0||@地P#t_b@p%"T\#'P$,0 %P@@1@pPA琰A&pN) "Ay#3%#"Nv=P@P@'p0$Q0t@P+7 P I)GP w)y 9p$KDp'+I G0#KDt0# @ d  0@p @ p0@ @0 0 0xPB| (NhpP%Pp %_&Q p"P$LCp% @&^p'OR(A@%\S@$P@ p@pሠ@@@P0x@P^PP|PP[ @PL@@P 9xPPU 0/PUXv0+DPPU 0/PU$[0k k k lk Lk ,k H-MdP ЍL    0㹏pЍX4H-M  0ЍA-M@R(p* `PX!@ R˅PG  ]  0Q Ѝ  `V $PX!@$  QP   , 0 qQЍ Ѝp@-M@0PSP# 0 Q  s ro 0@Q Ѝp!2/Ѝp @- ^  1R 0@T R ND0H-  P 001S @PUS P200G- PpP`P*@P% `P A P Dp U @@1  * PU  `pPO- M@ AP- Dp@ X PP1  YW   X X  `Pp  ЍA- @p T P  Pa`FW B P PpGqW 0H-M P,@( @ @OЍ0P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*G-xMr@ᤂRpptPm8PPm`4Q 'PP8a P 8 @ ` @0 0 @@ @P A A`04ÌP PF U㪪J 8„ 8 @ P: P)8P5 L10"` 04 R4PB  P80 0Pp80``V08800`XP40R:PtPxЍ@8}~@8 ~PP8 ` 0bP Pi@8de@8P8_ P H@/O-M0 , $ ̖4Q 8Q  PP QP 8P XPP y @ (P` @0 @@ @| B4 BXB(@I~`  0p P(pT*@ 7 J` 0!C`W48:\\  0P@T( (0S`P\h`WE:^?  Z5*Y3* 0S@"8@PpU(p(PUS4p04p0P0P88PW pPPP @p`PW: Z: Z: Z * L 8800S P`Y* PNB}`@PU048`i@ X@AP.QBXc/y[P  P `J V  0  !P*8@$@ `/PP p$ pP ! R PP3P@@3P8`V( p 8`V 4@T U P @ P @T``nXPX@c/3 c/ p.X@X c/%U Pc/ `Z( X sbpX 0RPU @U p X^P@-Pߍ Xp @ pP T (!G4b@V P p0BPTT y#`|P ` P(@P@8@ y=Pf0BPT$T& y!0BPT%T? y0BPT*T, y'0BPT)T+ & y P 0"~ y0BPTT y yPf P?\ y@PUꀷ @] \ \ (\ tx[ xY tiV 0H-P @P8PU04P 4`P8U:܁80@-@ 1! " @ 0@<0H-P@Q P   ! 00HTp@-@P` VP|p0-P@  P 0S RP0/OP *0?c0 3??oPP0/0/A-M Q$ 0S) @0A   Q `rPV*`V@@T Pr`U*PU"Pߍ 2RߍA L O-TMP0R`0ob@"YHP Q Y8`<@ VP"PPV WY 80< SP `@ Ѝ0H-@5P PP J@00A-@p P P`P 4P  "P`P* P `Pp@-@P P@`P U =Q@p=Q @p@-,P@@v' & 0H-@pP P$ @00& @-@$P Q#& O-Mⴑ@ ZpWpX_ ZP dpZ`! Q*PK VI`P@  P=P= q@W P UZ Lv    `@ `> P!  u`/ `- P E@@  P pЍ4 `TK-8p4  p R Q A@'PpQ P @P@VP  `P  udQ uX T 4  )lP~ 0$ # # HldK-p@TpWP`  C P=P q`FWV| K-pP PP`=PtP@T p  P=P ApTWJpp4| @-$=@P ^ @o! @-$0@P Q @o! @-$#@P D @oh! Q3/ BR3/@-@?P=PJ% 0%/H-MP@`   0Pp  P /P ЍH<Ѝ@-M@P0 s* Ѝ?  ЍP<  /A-`V p@ PF4/P aVPK-@T `p PD9/P pP@W PGK-@T `p PD9/P pAP@W PGO-MT  `D ;/P QU  `E;/P@}  0P0Zp  @0p T00   0 TZ 0 PpWpGooqbW@NqY pPp⅐pppp pp@p$P1p%p@qP$PWPP  0Q0   !Q0p#QqppP0ppp@ p$p1P'P1P!0%00R0 V Ѝ \0S  P `VqW@pFob A- 0 DR! V!  Q@P$0 Q;  Q BEpP^P a@TV UppAV /opR`!@W G ppW Q p PPU pT  U   A@ Q"PPQU``@ooQb QAAPp pp^ p% Q`` @@ AAPP PPPpP`pPPP@``Pp@pWppXpp|H-Q 0"!R !R @Q@^  S AA-1S0#" 1@T@@T@ @ ``R   B S+ - <`@R0Pa%P P@ a$0S `\`00 P P P@'\`@&QA@P@`PPPpP'P ap%ppap' 1pppP p0R0p000 @ppRp aqpp`pppP0p%p`'``0&000P \ ;R00 B-~x` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*Ap@-(M $ @T) 0S- P P` EPA FP@@@P`APV@A00S A000SA $ Q(Ѝp@% RRA$ Q(Ѝpi ϧ00h O-M`PpR E"P ^X Ѝ@,P+T -T @0T xP `0T`U`0@ Qa@"Q#m*`@P?U  p 0됶kU[ @pI"  !@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" Sʐ @T "/P  P" S! @T "Q/@X QppЍA@QNH-MP`@pVUoPPP Q:RmP PpЍPTPH- P,Б .e 0H-MlP0@P\  U :7P PЍ00d H-  PБjH- P,Б 0c H-  PБH- P,Б lc H-  PБ vH- P,Б y<b H-  PБgH- P,Б VTb H-  PБDH- P,Б 3Ha H-  PБ!H- P,Б J P /I I H-'@-D@@4@@p k@//////D //G-(M`PaP`9@1 A-dP@X P`ppGX`WڼP 5/@0= K-@Q" QK QH 0 Q0B pW pBqW s`V`PUpW`W+ qW' `V$P wP pP`V QPP R R R RQ O-MM  pP' @t P@IY  0gQJ`PUhheh XP  FP $QЍۍe; ; O-MMPa@ PU`p Q RЍۍL ' 2 ' 2, qpqpQ&`0HX& 0'gPJ`PUh h   0 `qP`` ``: 9 |9 O-MMԏ@`Pxt  PP Pʬd`a @ Xp0 0  Uh\d尰[m PbpPX` R 0RSR R!RKQ F!RA JP; p* J.-P0JP P  Q#Q Q QQ  QX P  P Zd܏Ph%dᴏh P!?` QP0QaRpW p g @ d`p  PDQ `U  dVXT `J @uf【 D  a @ DJ XKQ U  A`FU  wJd `T @ XἏh\QP\P,dJ(<$ l_P H L Qp @ Q Q 0lS!S 0"vD!<8p4qpl@x`W )Pt  07/PU qPE_PPd` l  40PX4 0\ @DPS@ pP p8PsxP<`\tPPPPq `\ 0¢ P P``p k0 / f\ 0pP* PHPa8P `J(V0`J ЀTt$4J  00`XT\P头PPdPpЀX 0TP pd 0d. |#DQ@ (A)/"|*P Pu&Jh0 u*P Ph`P\p% aL  _PX01 JP 0 !\h ,09P`aL  P_PHX0 aL x ^PX0 *X0hY 1Le! m+p `  **4PJ`  X0 P0j 對+@P  Pp` j0 ``- ʉpf\`'LFP``8 j0  - .`  Xࢉx \L($!  X0L P`` Tj0 XX, }`Q \ hYJ d\PP  P0H8 \$}P{p` j0 \\+ Glp\h l " XP\ 0F 0Y M \LhPU PhZP4  `  XP 00Z Y  P `P \`L  L r\L  X0  L\\P  @ 4PV@P8Pこx XHtP$` P PD T<H9 zp{ y $6`pX6PPaP6J/ | |JC*PJPP PPP 9 P( <|P @ PJ5  )P|u7D  x( WpPJTpzcJ^ 5 X-d  (PP@` p`hPq 1(PfPAhac Y`` 6 6  `X0hPq R :q (PPAV hI q  RJ,#'PڴAXh1 `a  0 XP 00hY $Pp` yh0 $ ࢇ(UP5 5 $`\`p`!! QX0 `a  p X0 R ` "\ R  F qW )P6t xl0p00 07/PU qPEP P, $`SP4 t$qPop` h0 # ;`p RP缂hf-U$RPPp` g0 ``" +@Ph d 9P7p` g0 ! (p$`$$! 0D d`QP X ($@`Y$`刁hQP< H  H R\ \$@PLP <+P&p( <@U @=P P`` tgX0T  `< @n &Qߍۍ|aD! ) s$ # L* ' # \2& OH" <# `. . / qq, 4. d$Tx. W 1 T0 W, \+ @+ 4, , P+ 0 \& - $% -K-8MMp`P4j@* X  3 4ppP 3+r `*`*@ A3fP30p <:@4P8Ѝۍp L< / /@-@ J 0KCR  FeDL 0  p@-@ R P 0@R^`C `@^`F@BpP  QC/Rq/0H- M P@'P P'p  ? Ѝ0 e D Ѝ0PPP Ѝ0 /0H- M P@&P P&p  ? Ѝ0 e D Ѝ0PPP Ѝ0bA \L/O-$MM@H Pp  xL D 0Ʉ  0  P`PK D L ;`P8   ; `P(L  0y`p% D  !P$  J` P$Ѝۍ_P  !(?/  pP 0 h/#xs0?r wps0pDPP`P`2   I  O-4MMp0`` _ R 0.RS  Q`Q@.AobP/ 4P@ X 0\ Pd(ppP# R(  0X\$  $PPp$ T @ @ p@V pY (`U DPO $ @H P .PP@X 0\ `P^\=Pe Q Q Q  X1 R 04S  R PH$P PI T @RT@(PX  \0 PU q [ (_P0P4Ѝۍ> Fp??,A???<??$F?`AEtlE`E`A@@@@TE?FFDש ,D,DDDCCCxCTFdCCBBBDBBp<?B8BAAdAhAʤH-MP,$a$`@ P@DQ DuP% =uP P p3uP pW:POZpЍ  !XX X 0XЍ44 4 (=gw"̢H=8=B-O-M ̭Q = R  MP @ P XtQ h- P T HD- 04}p0,}p0- } p \P   :R 0B6S<0<0 0PR ` ;R`ۧr@v0vPTD@̟ 8 4 Q`,< L0 , ` + k` QQ + 0 S;000Q PLK@[P,P ;0 00, pk`VPV@[P(P , @P:FRF00@2U1:@0P `PU B PPFP 0@  :,P `0  EPPP; @R LP1 F`8 ` P  UZ#P$ `@ ҟp P ) @U@pH P   @@I) `  p90u@\ T@P+H _vPy ,P(   80u@T@ ]=vP@8T0( @V @, xt80l( dH@ `V@PL  P  D 0  짟 \`PP# PP @`Pb@ \HT`lx(\ \0 70 UPW* P  RP ^ P0A06P PQ `;Q`ۧq@v0vPT85 R0(0/   R& 0`AS006V ``P``Q `;Q`ۧ0q0vPv0@@PPL A6PLD0Q p 0 P :RSFß  |P l40d^ ( P 040``B6P  @R P ;RPۧr0u`u@S P$NPHT2 0LH@5ЍЍAЍЍЍЍP) @P P p堁 p`V *PXЍЍ4@BЍhUЍt0(p <<p<X<<<,< < <<;;;;;;;<0>n=>?X;<;1;;>:::;t:`:4:p > : :0 /Hx/D0h0\009999h99P9322$2222622x5p011<984T8N7l7l7`7,7 77656J6666476P6X6L6 6@6(5555(6555 5$555444 433`1\111053373*W0H-P @@ D R08PIP P @P @0EDP044 0 00(,,,@,,,,l,x,A-0`EPD @ `EP= P`Pmp`P,PQ!0`0P` PP 0`0` P( dP6p,d+\+H+<+D+8+* +*/O-MP稱qP㤡 ࠑp  AT `Px@hdA`T ,PQ!000 @P(P P$ |x  `1PPP00ЍL*P*8*H**,**))p))))$))((H-  tro@-@P !RR  00 !0!000T \hh0A 0 X HH0@0@('(''''''`'t'DP/@-@\P PQ@  P  PV Z Ѝ Ѝ   ЍO- M!R*>DP/ b R ["*V&*P !@0p@@p@W*Q0`P "K  0 P [b Ѝ Ѝ   ЍG-MbV* BR P*pQ pTpG  0 P ` VЍ  ЍЍH-@P`Q ppV VP PP2@ P. ` 7oP"U'(pP $ @P ` oP"U $@$ P K-P`p ɾpR  @? `FR 0 1a_p@ P@   BP % 0o0s`V*0`s 0KP  B0p`pWOJfcRa@HVMJA\ ?p BWp0pAaF@p@-`@Q PGPPp   P UP  @ p勖PPpPpO-,M@P`Q pp U,ЍO; P Q !P2/p  0[P ,Ѝ !$#p(  $07/P0    1 Pp  07/P p  07/P   Pp 07/P p$  0 p 0ᖕP P H-MP@S  `QpMBP: q `V P! @ #r_s 0Q Ѝ1QBP ⬽ЍЍO-M`, P= 0   * P* 2/ @0 Pps 0  @s W P PU 1 B@Ypq Y Y0 Y@paV @ F ЍPYP 2! [P V!000 aVG-pPP GR`  QE@AZ  @tPڰ8 A8 E A APʲ0 S A O-\M@ 0 H?X`PV  03P P  , R$`  ^:`<pD8@4P*, V0ᰀᰐ@z格4Pp ఠ0 @@@Jt擼 0J!p @@A<<崀p W,*P?Vx@PK  ͘HPD4P0A @ KtgV 80@D@@D80080D<<D0B:!p 0AP$ \Ѝ$P  p@`,000<0( s0000AQ&w R D0 J:"p00 B  P @ P`DQ @$@0 0,( HL PPP0$S LpW TP ,0`(p p0 P!Q#*wQ: p0`R P  t0U/ Aq@U@U@st  `@v/ PUpb"`qB` P pЍЍK-@P`pVP& W Q" Qp  RpQ R  0P ;`U  0Q:0pPp0A 0ppSpS0@V0 UU 8@8O-Mp (P @p` V P P@P ᚬP" 0P p PEP @p` VU zP ЍЍЍp@- @P0`P᱘ P 0SQ 0`V 0S `Q`! p pO-M(`P@Q  0Pᄘ`PbQ 0PuPV 张`Ა# 0S 0[p0G ) R-$p q(9 ᱐0㲀R ἠNP/  Hp 0,pp% P  ͵pQ 0p+P  (P$p q$pЍO-Mp` @PP @R'PP@P ;9P> [+ (P  0PP . P$ $ 0PٗP   0PP@P P  U Ѝp@-M`@ PpPЍpO- Mp` PP @0P0P V; 9@P. 0 0P% 0Pw@P 0 0P P  @%@ ЍO-M@P 0 ps  @,`p@ 0P7pP  RQ 0S R Q Q  0PEp<`V 8` 0  @ 0t@@ s@@ B  0 P:@q ` P p`<Qp ЍA-MP`pQ @@!P VY,\\,\\\/H!R*8PD -0"A(/ $p``pW`ppW! `WC `pW W4! !2/p W'!  $ЍBS4P " @y@W 0"P ! :G 0P Ѝ V Vp$p  0 ЍO-$M8rP@p wQ *p  @ U U   P 3 `PW p@U U@ `L P  cpJ  tP `A Q*  0p`P务p`Pp,`' R B K 0!B pp; "   ֽ`8pp P$Ѝx  ȽȍԋH-4QP 3 ċDH-<Q $P (3 |2 H-tQ\P PP  R 400 HH2 ܇0|H/O-MM10 RUP @ 0 B B0 B@ BP C  C0  `@p- `Z*:Ԑ嫊 `p ઊJ@0pp@T@``![*pPZP TSH P 800PЍۍwpb<aaЈA-0S  pp2l  P@`p@@`p R *PU U```\`@-M @JJJЍ@-MlP ЍX T@ 0 @ p P OЍP$/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/}*/z*/w*/ct*/2q*/n*/k*/9h*/e*/b*/8_*/\*/Y*/V*/S*/ P*/M*/J*/0G*/QD*/A*/)>*/{;*/|8*/#5*/)2*/=/*/,*/)*/"&*/#*/ */*/*/////^*/*/ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ */*/ */~*/{*/x*/Ku*/+/jp*/Om*/hj*/ig*/vd*/a*/ ^*/[*/X*/U*/R*/O*/p/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*//7*/>*/ 4T*///*/@-@u@*/*/*/*/xG6ps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openUsage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/netbsd-11-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-11-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.LinkFile%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-pv] directory ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %s | %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if then else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALLeq!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %spgrpbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalshiftPPID20220122 BUILD:202603042102Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeoleol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupMACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfscgdflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] unknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/netbsd-11-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-11-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRdestroy[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]o:/home/source/ab/netbsd-11-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u %s: getifnamein_status inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). atalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspec%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)swaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260207%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldReading `%s'Writing to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... 123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameLESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%sLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotestildeno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %s%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_RC2 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_RC2 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_RC2 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_RC2 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_RC2 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.0_RC2 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_RC2 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.0_RC2xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlolo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES sshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPED%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelink%s: config file changed, expiring leasesInterface options: DHCPv4 options:Compiled in features: INETusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimerebindpersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrclientidnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %sinvalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtopbuf != NULLlen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initaddr != NULL - %s /home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeepairfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/a.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/netbsd-11-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitincorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist