08P|i'&<  '|i~P''`'%. %.|i'&P@@<@T 08P|i'&<  '|i~P''`'%. %.|i'&P@@<@TU |i`'%.yA|i|i|iQ$f |i|i|iRA|i|i|i^A|i|i|i_A|i|i|iA|i|i|iA|i|i|iA|i|i|iA|i|i|iA|i|i|imKB%|i|i|iX`hpx$|i|i|i (08@HPXS$K|i|i|i`hpxP$|i|i|i[Q$ |i|i|i (08@\JA|i|i|iC|i|i|iA|i|i|iA|i|i|im|i|i|iHPX`hpx\$|i|i|i$|i|i|i$>|i|i|i$|i|i|i$s|i|i|i$|i|i|iA|i|i|im |i|i|i$|i|i|i $|i|i|iA|i|i|iA|i|i|iA|i|i|iA|i|i|i$`a|i|i|i (08@HP$|i|i|i$|i|i|i$|i|i|i$|i|i|i$|i|i|i$|i|i|i$|i|i|iA|i|i|iA|i|i|iA|i|i|iA|i|i|iA|i|i|iA|i|i|iHP.+;;&-?X*A8+˖M$-B?Yo]2g1fr}w3y.CVT1]̮;vDiys@?>T7lB'e4B|Rȩx8"%. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4?%4 (jjp"p"zzm$228 TTT,,m$22Ptd(QtdNetBSDAPaXU SR ffffUSWVP[?.t$$ujPjjjj0F $u0& Q/tuXuk;(s(9rD$t P%Pz%;s9rHPK%$06v@ Pk USWV [È>.A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[] USWV[û<.; s' ~*u.UE9r^_[]Q SWV[l<.;s9r^_[f$SW&<.5u1ƃ5 tЃ t$k_[SW;.4uYƃ4$t|$<$kt$?t<$ktЃ_[WVD$0tP>tKj/Vt@Ƹ!q"Б&PV`t&uVhp"hp"hv3K(^_`SWVhp"hp"hv3%( 1۸!q"Б&P@CPrFhv3j 7whw%hv3' uhv3j 7jMD$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5,~3y u$1^_[Vhs"Vhs"4 5(~3hs"jlwVhs"j,USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S&@tutD$D$$D$% D$t$@N D$l$h0~3h"$D$ @l$0tD$Phe$j D$  |$\$4t$,s$L$)L >QPhu" D$  L$s()@L$L bQPhu"UL$ D$  s D t 4H&hu")L$ D dtPh v"D$(@9XUj\$D$T$T$9tt$N9BD$4H&5(~3h*u" 1h^_[]t$|ht"+%WS$h>u"h[u"juU5(~3hyu"j芡t$|hs"5(~3hnt"3$hu"jhc 5,~3  u15(~3h-v"j4SWVPD$Hw#t$>(&Wot ub,&$h"s"WJt N1AQhc5,~3 u 1^_[5(~3hBv"j蟠USWVP|$t$7=h>s"WV< fu $<(~3u o3)u (~3uhAs"Is"t (~3hjQn ,~3u 5(~3hRs"Ihu3$(ܔ&SU:t uUh{s"j葟h[s"j赟$NPVS& PVv3PhVv"V Vjjhv"c&ܔ&hv"hv3 ujA5,~3vnWVοVh&}tuVhs"jԞl&^_VPΉj PQ x $9u^Vht"j蛞WVοV&tuVht"jmt &^_USWV\$$1~3 ~3x3 t3sV袣j=P-x<$hjjh0&U 3H F H 3VP3u3t;#=t%{ 3##=uthRw"'3tttzut!tcu3X 3^_[] 3zVhv"W Whw"4$hv"4$h"w"jhlw"hw"D$L$01V1PjPjt$h>z$謇~3~3x3t31PjPjt$hw"|33hw"ja1hjPPt$hx"H33 tjY 1PjPPt$hx",2tZj+ 3u$1PjPjt$h)x"܆x3t3ËD$3h:x"j跛1hjPPt$hPx"螆33h\x"j胛3u$1PjPjt$hsx"d~3~3ËD$~3hx"j?1hjPPt$hx"&~3~31hjPPt$hx"~3~3fSWV3t/ p3l3 t5`3)փ>8F u`3~3d3 h3 ~3~3;~3 ~3r*jZ~3`3~3 ~3 h3d3^_[áh3 d3 t ~3~3hB&h"$j'hB&h"$jh@&h"$jh@&h"$jUSWVt$|$6q7$r#SjSVW趡 u=o3PM3u,3$33X&Ahx"ju3X&1QQPg 3y 53\3 \3 =,2r|3uhNy"롡~3u#~3~3y"3X&13H3X& hQPSg ~3yJ13H 3 hP5~3Q ~3 ~3y 5~3~3~33utS1V t3339x3r_ \3t= 3 ~3E ~3t# \3) t3I ~3" \3ujl~3 `3~33 3t ~3 ~3t 3h`u;5~3 ~3=3 ~35~3VP5~3W 31VhP3覨hjhj5~35~35~3~3h -,2e=33 3 t33339ss$`3 t3tQj QjPs 35t35`353P$ xd5x3-t31‰1 l3 p3d3 h333d3 h33 3xPh"$[+|3u63j5x35t353P  t53h"$3 x3t3 p3l3d3 h33d3 h33C3s p3l3d3 h33d3 h33u@s)t83<3H `3PQQI l3`33~3 ~3j1h3d31p3l3hzy"jPh"$j葔WV3=t=X=zu 73~3 ~3t;~39щ5~3s))Rj5~3 ~3 ~3~3 ~3 u\5 3=3 tJ5~3j5~3 ~3 ~3~3 ~3~3ʉ~3)Ɖ=35 3 t jY=~3u3jPu 8u*35~3Pt^_ho#j^hy"USWV~3|$,t~3~3(p‰D$l$|$,u 3 xT$ 33 t!3jQP5~3R !ƒ~t$VSh~3 $~ D$ `'18D$ Z 33 ʋ-L3H3t>5~35~3QP@3D3 3$31 33T$<$t$ H3-L3l$13L$ (3,3D$11 ~3t,~3u#~35~3h y"T$~3L$ AD$)ʋ$tЃ|1@|p9@|53 3*~31 ~3T$1 uK 3$3I$T$ ~3~3)ѣ~3 ~35~3-~39(3,3$ t ~3)PQ5~3a ~31~3~3 ~3~3 t((3 35,35$3QPVR4 tjhQ%jN]$^_[]5~3h/y"5~3hx"5~3hx"j 5~3h"$j(USWVt$(|$,\$$Uh~3jF] C4WVs(P( n8jUj"] Z8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[hy"j萏V΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu8u F ́Ĵ^v$h"$jVP 9v V蝝VPQ迢 t1$^ÐSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV~3 ~3t/jh2#jZ ~3 ~3tjh2#jpZ 1t$PVFȺMb׋ X3-։+P3D$H T3iى tL$ 1FD$|$ 5,35(35$35 353535353hy"jdW,,WSPWjY <383 t?ƒ ʺѫ%tϥ#RQPhy"jd|$4WWPWj7Y 4303 t?ƒ ʺѫ%tϥ#RQPhy"jd|$4WWPWjX t$ D3@3 t?ƒ ʺѫ%tϥ#RQPhz"jd|$4W8W_PWjX L3D$=H3jPt$ t$VÉiL$it$V)QPRPVSt$Whz"jdt$@V$VPVj X e^_[]EVt$;VmOj3fUSWV|353=t311C3W5\353P$ Mtg3u53h"$3W5\353P$ ݅~|3t )u=t3N{T,2rOH,2d53 t3=3 35x3jVP53W !ƒt^_[]hQz"j躉53h"$j؉WV~3uD5~3 ~3=3 ~35~3jVP5~3W !ƒuuJ~3 ~3ti1135~35~35~3P$ ~J;5~3~3r,f ~3H 3Phm5~3Q xw^_xof@ 3Phm5~3Q tD;5~3~3s5~35~3h~3 3~33 ~3 t5~3h"$j胈fUSWVX $p $l 7%h$r#jRj2hkz"WS H-$&333@33333333u3i33S3G3;3333333=3-$<E3Blj(1Et1EF4Ej,V腳ƅu$p 4=3u#=333.3 3=3uȨthz" Ȩ-o3D$jPh3Ɖ=3u =M=3ui $$ =3u j Vh#t^_[]h#~"h~"hCh.~"h~"hDh}"hL}"jSwSWVt$=3<\$Wj h$r#RQPS)SVhe@$^_[SWV|$13A$3GO ,31ʋ(31 t$(3 ,3jP503  39}3W3 39|_SQQ 33 3u 3503WjPx!9u=(3,353>X0VPh#hv3 h~"'0-Ph#hv3b h~"N^_[W0Ph#hv3- hvJ&hN 3uá3u tjwGjFUSWVj=Ƌ|$11K< @u=$3t?jj503L 503(3,3$3503UjW A)߉n(3 ,3N F53q033-(3F ,30觭Ph#hv3 hvJ&Mrh"]1H,3(30ePh#hv3 h"'0<Ph#hv3q h~"LV,1^_[]Vt$53q0F33^WVL$ 35439})=379}>3829~vRO9G9~-823~Z3΋Nu#82)Ou9~82RN982 43u 3uu82^_É1jDjDVT$3t=31363t@9uхt3uh%hK1^SWV13,3j?̄h"3"tW t|8/uWh9"WhE"h83 83tLPt$hl"P 031ۅu@WHA583h"$Emo"j4mR"PJV^_[V03tAPxG0383t!P? 583831$3,3(3;5830wPVhb&hv3h"I^Vt$03t3Pp83t!P 583183Vjhă3hu3  "x 3331<3@=ujuSVL$D$ T$t$<3<35<3<3~A2<3BI^[fV1@3D3L3H3PkP:_^X3Fu^SWV5D395@3t$@3VjjhX3ut=\3X3X3jjPPNth"h"$[HP30`3@uH3=L3V:tVP G~*h"5_3r0h"h"$G1N1Nyh4"h"$G5D3~@3H @3X31H^_[Ë @3u!T$7D3@31D3xD$Q@3X31HSVփuUP30`3@uX3jjPPuMth"h"$GX3 \3 L3H3aˍX3)QhP3P  _3P30`3@uX3jjPPLth"h"$FVjjhX3ě^[Vt$ @3uD3@31D3x 1H^USWVh"OƊtx<0uFD uh"h"$$EGuȿ|w WjP 1T L ш @u`3hjV P91Fth"h"$De^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$D& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVP3 t uhE"XC^_[]eC$t38u@35 3Nj- 31;-3M1WtÃ=,3tj jwSVVVSt$1Ʌ;L$uWwZ?E;-3|1MV315x35|35l35p35t35t3 3u 3uu ^j:jq;V5p395l3}t3I3P5t3tC5p3t3 3u 3urufL$l3r5l3 1^0.Ph#hv3c hvJ&A 3u‹ 3u tj:j9USWV l$ D$fD$p 1P l3|319t3@u 9u|3Sk3 t$$PPh,  $ 3| t %u3ڃuh2#QRUuhv"Q5jD$P 4Ë $h39}=d3]39|A‰T$R5d3#NjD$h3=d3 3u32$@PSW =3?5ƅt3VPP,+ 38uK=d3뜣|3Gh2#53t:jPDž_"x Q:? ^_[]Í|$0脟Ph#hv3 hvJ&> 3u3utj8y"j&7WV l35|319}'t3FىDuw9@u1=|3^_USWVD$L$9tVl3r=t3~=x39 t9|1Cx3Mu9|1Cx3=t3 9u^_[]fUSWVl$}!uEh32#PhUT1h32#PÅt*t$Sǀ}!u?SQ=z0PUhb&hv3Oh"=eS"x(=3uWh(v"hv3 53+t$00话PUhb&hv3h"=^_[]USWV |$$Wơ3$,3D$31-3-,39-3t\$=3t$ gDž~w11353Y6ts3PPjJ Å 3u3t$ Dž|$$\$9t$utt "<$u=3t!΀"9u ,3 uhv3P?R9¡,3Ƌ 3Ӏu1A9|$t $ 3 ,33t )) 3u 3ut j4 ^_[]j3USWV1|$=3t WrGHOHt uG `-39}3V39rFU53{-33 3u 30u ,3F8Wr<1ۍF-39~N3 39wUQ1{t7-33 3u3uhtk30 F0ePh#hv3 hvJ&9 33j2G @utL30 F38H0Ph#hv3 h"Y9-130=,3=3  )Ɖ^_[]js1USWV|$?!uGh"Pa t$WI,VP Åt2l$t$ US NjD$8!u?SB=k0 PWhb&hv3@h"{8mSx-=3uWh(v"hv3 t D$ )@ʼn30蛘Pt$hb&hv3h"8^_[]USWVPl$Uƃ=3t1ۅtf;l$ `1V$th~;-3u=,3t =3u8 GWPt$ F x4EEs @6;l$ |=3tt$$$^_[]USWV|$\$l$19t[=33t UPrUPFyο0oPh#hv3 h("61^_[]USWVP\$53FEx @u}|~PVq6tj39~l339SPUwgƉ33 3u.3_tO53;^_[]Ë53W53V0 . ,1xщǃ|$uE3| /539$~Z39V53vcÉ533 3u3t 3W53U} ,$+HPS53D( |$tM1BDžh_"4贽0UPh#hv3 hvJ&41 33539} 3|$N339͋|$|MVP[ut0533 3u 3umua(/ 0薔Ph#hv3 hvJ&4 3t13uj-j/,SWV11u3H u37hu3襭u8u3@%fu39uu3H u3ÍF=ȃ39~Y39wW53.t=ȃ33 3u 3t 30u ,3F 3C蠻0APh:"hv3v hE"2%u31t 3033^_[D0Ph#hv3 hvJ&U2 3u3u tj_+j*USWV\$ D$1tt$hW"!D$ l$1uHD50v3J 0v3;@v3у  (v3Q(v3;=D2|h(v3hs%G1GD5 | <\t<0v3H 0v3;@v3h(v3j\(v3H (v3\\5tjj Sh\"腍 tVG\")Ȋe"0v3J 0v3;@v3Vу J (v3Q(v3\$ !00v3H 0v3;@v3h(v3P(v3H (v3D50 0v3Q0v3ɋ\$ ; @v3h(v3P (v3Q(v3D50 0v3Q0v3; @v3h(v3PF (v3Q(v3Dh(v3Q 4 0v3Q0v3; @v3~;ȃ t3 (v3Q(v3D$F9h(v3Qh(v3P똡0v3H 0v3~(v3H (v3 h(v3j 1^_[]fWVD$L$L$$$0| $ |r13hn"t$t$ ] ot9EtzS3ǃxtostypf$<3먡o3  $)D$|$ta$8-uW3D$|<o3b3S 3D35$L$jjthj1FhJVVj޳hkjϳh3ƅux'3|$t$8t$0|$t[hv3hv"C$8u h"_-j-u$hv3hu"Chy"--y =3th̃3h#hv3 3tPh"$ h(v3} xt` 3| 3x51g3QPP M=3=3hv3hv"Bh":,j%u33h_",%u3΃t0hv3hv"Bj蕐5153hv3hv"Ah"+VcQ=3th̃353h"hv3jrjk蚲Ph&hv3 jp=3junh̃353h"hv3f$j0yj謏t$8!$h0h3_ uh̃3h#hv3C jL$ ɸ!3Phht@jt x#$r@2D$ rD2ËL$=3t1@ 3Ql"L$=3t1@ 3Q#WV1F=3t9|$ ?!t!hB#Wrtj/W}th")1^_333 3x>3 3 33 3;t,uQ39;u3빋 3| 33t9t 31Ƀ USWVPp}33DJ@t t@3@DJ@t uHH 3~Ã=w$ &=3!h@"  !=3" 3A1Qptntl  Ӊ 3A˃=3FP”^ U 3@߈\$ ̀1ۈL$QuH 3H1KDB@,Aǡ3 3  Pj  53j$1  ˣ3@̃=3t=3y=36DB@jLǡ3@1Hptntl   ˣ3@̃=3DB@8!h,"=31Hptntl  ˣ3@̋ 31PptntlN  ӣ3@̡3HQPN"3@1Hptntl%  ˣ3@̍H 3 3 p1Pptntl   ӣ3@̡3PPv 3A1Qptntl  Љ 3Aˡ3PPH- 33=3=3 9=3 - 339 9w hq" 3PP 3A1Qptntl  Љ 3Aˡ3PPl@ 3A1Qptntl  Љ 3ADB@;h" 1ЍrЃ sOBj h353D $3w8"% 3 3:o t!gc ptrP  A 3< b=3Ho13PP9  3-3 =3=3 9=3 3-33@1Hptntl  ˣ3@̃=3F1Hptntl  ˣ3@̃=3h" 1@ 3 3AQP2 3<\j h353B @2)8"h"N@2 3x w =33t30h5&& 3x A =3u;.53O1@ 3 3AQP@ 3jPP>3x  1q1ۃ=3Ƀ=3 ˃h% 3x  =3u-535 3 53g 3x ? =3uL-535 3: 3@;3?73-3x =3u , 3IQ T3x =3u, 3 39QPn3x QVP 3y F( 3y 1 3y P535 3g 3A1Qptnt lu  Љ 3Aω 3y  33=@29|PRQ 1=3u 33 ǡ3@1Hptntl  ˣ3@̉3z !3SPhA3x  1@+33uF%3x $<u<2=3t133x =̃3h̃3h#hv3 3x }*x1Hptntlu  ˣ3@У3x '3G13 33@Hptnt lu  ˣ3У3x =33uB#|$Wt"535 3QP';333x ==3uJ)=33u53Q5;3)3h\"h"h"$3h%$31< *5 3y qt(3@PB(3@P =3h%+3x )53j 6'(Y$i*tEEp $A8GMi 3913)@أ3=3t W6U31 3u 3u u^_[]jjSWV=3uj貽L$ɸ!33Pjh"h"Hy|hK#3FtkP$=Yà P-=tGWPO|3/tf/Ved.hDhup53jh"Vj=3ujL$ɸ!3jh3USWVPl$5 3'Ƌ=3 3-39ʼn) u)E1u1$3E@3V}tzP蘹t_3PPj DžtO33H3u 3u[uE6M3@Pi1,$l& 3u 3ut j1^_[]jUSWV$3 3th"ckjP~3L$F$ <39} 83V3839|BVPE5<383 3u 3! 3 u1C1E҃!%=3h3PY}Ɖ$ <39V39V583)E5<383 3" 37 09L$]939|WPD=<383 3]9~[39V583gD/5<383 3u 3yt v83 3 (E 3Q39\u=Q3I ( 83G (E,$s 3L$A 3 (3y @3)9~_39VPCI5<383 3u 3 @383| (3A(EA(3@39r 3L$A 37 33/ 3Q3 ( 3݀ (5D39}(3R3(39|KVPBt]5D3(3 3u 3S583P] (3@3D$1!P0aPh#hv3Ԥ hvJ& 3 3u!u#^_[]h"qhy"gj'jVj6tL$Qq p PIH1]0`Ph#hv33 hvJ&n1^V3t.L$19 P3uP3H3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h̃3kXWV 3 td< uhE"1 Q3I t;8t7P1ǡ3t?=3u6Pj3953h"R53jC53tV353WPGb 3t.h'h̃3QP=53wE33/螇0?_Ph#hv3t hvJ&^_USWV=3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-39}=3M339|KUP ?tYlj-33 3u3uyS53WZ 53=,3tsj jSWme|0^Ph#hv3R hvJ&1 3u*3u(tjh$h"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u3 u3E#t3 uE1^_[]8uP3HЉʀπwRj h353 1w8"uh"1gu@3ErUSWV3H 3H%u,8Xu'33h"t18u=39 3L1}539~[39V53J<#533 3u 3\t Y3 3Q3 u (\t u^38uT3H 3 31< u0=3u't 3| t %u3ى38339|NWP[;t8=33 3u 3uuuw5303M1I0ZPh#hv3Ý hvJ&1 3u 3uu^_[]H3,j'jUSWVPL$3 3193}%3ȃ Eh"Kl$ 3PUVPt$$KǸ1$3PP 331S̪á3tP芬EPPjM Ņtl9u 3l$ u3ue$33+ 39}yF3@3P%Ut$ Pt$$hDž+9 3u13uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=,3tj jvS肮vލD$jPjSut1t$ED$$D$1E $A9T$ 439Ɖ $T$~c3t$ 9V5 3)8\53 3 3t$ T$u3=,3tjj RS藭T$= 3RSWR 4$D$D$ 3 $9~bt$ 3$9V5 3v753 3 3t$ u3=,3tjj t$(S= 3t$SWJR Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu}&D$)D$39~V3 39SQk63 3 3u3|$~#D$$ D$ ud$th"$=,3\$tjj SV賫 3SVPQ 3f |$%C<}04UPh#hv3i hvJ& 3t e^_[]Ë 3u tjjUSWVPt$ =3T$-3E<\<&I,$D$h)39~Y39W5 34=3 3 3T$u3%$9C 31F9uEEπ;D$$,$L$l)39~Y39W5 334>=3 3 3T$u3ml9}C 31F9u,$y^=39} 3_39|W5 33=3 3 3tT$ 3T$M 0E+3;3539} 3J3 39|KVP3t)53 3 3u 3u^u`Iz0\RPh#hv3葕 hvJ& 3u 3uu؃^_[]jjfWV3 39|ld 3j Qh3 tJPQPh#hv3 hvJ&@537133k3L$t$T$ =3@Q葤 33RDVu353@LF533^_SWV33r9 3@<u|L19tWW69u33H23L2^_[USWV=H2=L2=3t 33$3D$j荣33 3ÍS4R4nr@44v\1L1 [ 3\1l1sRt6,lmL)1 3t)|?wt)LI1 3t~l)}L1 3,u44vL1Y 3l1}w4R4Ӆ HA9~R34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=3t׫H23$H2L23D$L21 3u) 3u&tj\h5"$^_[]jlUSWVL\$d3袲hE",J"tNjt$`hU"SV fttu=$<߃u o3r|$L$ D$10&߃"D$PbfƋO9rPSt$ Gg tu;_Յuͅu t$h~"-|$dD$ Du$$1Fl$?uSt$ hZ"jL$j QPh $;Fl$|1ƋD$8u&1zPUy!Uh"$jD$ th"jNjC=m@!sHQPW xs{QPW x4$Uh"Y =muqB dut\$fCShmWf HefD$t$Shmh=m8@u֍D$Phm8@W$ y?60Ph"ӍL$fqQhmW 3Uh:7#D$ukD$Ph"hr" T$"h"T$"h"0v3H 0v3~(v3H (v3 PhU"kh(v3j Et$8t$8t$8t$8t$4h"t$Ht$Ht$Ht$Ht$8h"Ӌt$hЄ"‹t$ h"豋jׂqPh/"hv32 j踂SWV֋|$t #"?t)"VQPd JB80v3H 0v3;@v3h(v3jU(v3H (v3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hV"~'thh"P,cu 3hl"T'thh"Pcu hv"衙jhh"hl"]J 5!Pu h"j*0D$ u h"j<t$,)݉\$D$$D$11D$$h"SU c7~+Hr߃8tlH w&$&$<$뼃4t6맃dtket/1@D$O =$<umWt$aXh"5$<KD$71@D$$+L$ o3 o3T$uAo3$T$uȋ$D$,jj@R:l$L$ $tL$ $L$,1ۋD$P:_CEu S:)St$PʼnD$$  U^l$$T$DtIL$ىL$$U$E L$)QPR 4$^EuED$ush"h%`u]h"bh"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh$3t$ t$,QPRiHt$ |+yj-}=$3y h"|$$tQt$(jVjhS_Py h">jVjh5$36Py h'"h"_ǽt$(1CUVSwD$POUVSw5$3Ot$,1L$XAAA @D$HPQS = 3u'l$hD$h(8jU&k ul$uqDžy hS2#1O~fVS5$3N VSt$VN |$h5$3l$0fE<u1(lu@hWj ul8k18tƉjjU tD$68Ztk8tEVSt$ x )bk8#Thݕ%|$l$8fE= 3ul$0fE9EjD$LPj |$@f9fGfG$3G$jVU tQf|$<tٺtf|$4t?$3L$0u+fD$<= 3ufD$4 j8t$>Nf|$Dt1BuNfD$Dh|$u%j t$h9"jt$jyh#yhh}"Ph>"hv3jyPD$L$jQ5$3_ XUSWVA1K8uSt<։ihU7c ~WUV ~)u1i1ۃ8#ۉ؁^_[]ÐSWVP|$\$WS[ƅu]jjZ tqƉx jPS ǀ;t$8uxfP=(3tD$L$ $QPj@ XWVt$|$ t8Ph"jQ@ 4& ,3A9tL ,3^_SWV\t$lt8|$jYPWq; GYP&Ӄ(Ӄ,P6B60%4z%8l%WVd^_[USWV $8 $4 503VWPV 0W5@&1WWPփ (JWWSփ _ƍ Wh PH& WjjWL& TVP&h <Ƹ jPPV(T& hVU9 VP$E=a==hD$\jPSD& 1Nxr$ SUVǃWe0t^SWP2 tg0$8 h"j=0h "j= 1N ^_[]þh"j=۾Sh"j= ¾h4"V?#=bt =buk $}u+Zt$WSVL$ !1 FYD$t8Shb"#ShV"WVP0 1QQt[0( Lt543tQP!0,tt|@PƉ4P8tg04@tt| r>1A8Љ4DAtt;L5rSh"j; 10hz"WV|$x$t,WDWHDWDW4Dx uW?jtw\wXR=29}5PBt852WVh"#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W.$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP̀ uCt1t RPhL$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PU D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RPp$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph",h"&|$PQt$t$RhQ"jJ*C$t&8$\T$XT$H|$RQt$t$VhЋ"j)$L$l$8h"h "hh"QKUSWV u|$W1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h"j!)NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWP?l1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hSj,PS_D$HPhH& |$0hSj,6S!tND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWh"j%'^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh4" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ @3@3H3H3X35\3D$D$TH Qq T$T$ t$t$QSha"j  11KL$0t.GSPh"ji V53[S343t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1hljP88H H;1D$8<938D$D$ tD$tD$43ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP"PD$tD$t$t$8WSP"PjetD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhX"D$8Ph3Vt$,V'~GD$D$8D$HD$L$PD$LPh3VD$HD$8L$ $\$(\$(u@,(L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L P3T3tt94 S.843T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Ph""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVhŽ"D$8Ph3St$,V~D$@s,D$¹tt;<FG;D$ L$?-Vh" Qh"j $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP;D$DT$@D$(4t$8t$t$t$0|$(WVh" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhv"je1gD$4$DŽ$߬$D$D$D$@$߬$ \&a111CƋD$|$8D$|$H|$LjD$LPh3VL$HL$8t/3ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPhێ"b11ҋt$  t<=X3\3$T$p$1߬$$$߬$@3@3H3H3DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP31A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=3$t1J8D$<D$ۋL$؋3k,L$1T$9|L$$)щL$ Ɖ$D$HPWh "W $PhD$(H& yN;L$ L$tL$L$8]:u*t$ tD$Phd"j ,uh("j uhE"j M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$Pc D$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP菽3D$ t(Gdt;<r61@hPt 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RW޼NJ1 t1t$|$ 9|1t$$*]t$FL$|9 |$t$T$$u Bhu:4$BBRt RPQ4$]0hVPV ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhW"joT$$BRt RP詻RPVWjt$$Vh("t$$k,PmD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph"j@ D$,|$D$T|$XD$TPhH& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =(3yh "je11t$ t$$k,t$D(D$L(L$(}tTt  t1L$(VWt$Q](T&[$t$ D$L$9Éʋ|$S=(3tQPjWhU"j]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh H& 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$QAD$XD$TPh]H& |$t$t$kL$,9 $ ?t$Z#0PVh2"j*D$,]|$t$t$t$L$$QtXt$|9|$11k,D(t P;|$}L$֋L$]t$Qt$D$,TD$, m4$yD$,`14tPP2hS&jT,u׋$e^_[]USWV3tWjjP m 39u 34t0jQ6x!=(3h"jt$ż3xi8tPWhߑ"QV`tPSh"Wej0t8Vhő"j7 1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 2I 21̅3Iu顀2P3 2~ t1@3@9uUSWVD$921A9|G2SƉ<$~ SjVJ 2D$~Q1ɡ3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u53_53$2^_[]V$3 3D$D$ `&T$ t$ 253t$T$L$D$\$ $n"7$^Vt$FtN H N tNHNfr v V 3^VD$`sH) 3ą3 ȅ3HtP4BPQ@@1ҋЅ3v9tԅ33rh"jǼtp4F@Ѕ3^USWVD$T$#253tC=311-39| n-39t%9P4uH$3L$X(3\$ t Fu1^_[]h "h"hhƓ"[USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv {F V>3 ȅ3 29|[5܅3tFNu 35ԅ3t5FNHNFy F4VPV3@31@j@PU1@PF ~4D$F(^$F0^,n#2^83 3t q43^G FtH 7~ F^_[]É ؅3=h"h"hh7"h"hhƓ"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP ؅3H؅3N^,H 3ą3ȅ3H@Ѕ3P Ѕ3 3H3H4I3H89t;tprp3403t4F 3H^hX"hQ"h4hƓ"&USWV}]uuu W@t 31@31HCSuu WW KN0F,xNF4VPe^_[]vjv X fUSWVP|$gX&sT&G4$O,52w0VPww D$0^_[]USWVPt$ffX&sT&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j蚾8p 3HtƒQ 3@ 3^_WVt$ 3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpd,Fhjv v^_USWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=3| t Pt331t 98t@^_[]Ã^_[]`V15353hVh3i 53^ft$ t$ oj&SWVt$frLN4F,=2~0WPvv 1X&t\fv4V1AN4F,=2~0WPvv 1T&1;NuN^_[h"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR补׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSϤ$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h" USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPɠ3T$3D$M u1^_[]USWV(t$F0FF F F$|$0tfhjбljPLtLXt uB\I\$$|$ C$|$4NhӘ"W<1ɺPt`tLtt l$,\$(|$0uej袰ttPzttPPA 芇t u_4u_4_HoL_HoLUS6jjW'hrW>q$ 1=2lj2l$1 UPQSWVhjׯË}Pw Sp P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhj&Njl$hu P P E1PUtA|$4t h"vUSW1^_[]u C4CHKL1}Mt|$4t7hi"Ut$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhʗ":$  $ V 19tQRh "K  1@^USWV |$,\$$t$ tCPPt Ttt4RQhq"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth"-h(v3D$(u KHKpStURQPt$DljT$t h "Ru CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh"b 3VRh"K T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPht" D$L$9tQP$$h"t$Ht$nL$tI9ȋt$ tPQ$$hĖ"襋1t$\^_[]h-"h"hh:"h-"h"hPD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$8"nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ R,LD4@hD$D$D$,$D$ #,@o M|$@ t"D$D$D$$D$$R"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWWƋD$0T$UW;ƋD$0 u$$$UWljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPERP$GW #RPnERP^$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPh"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPh"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW{Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPzt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPzT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPUy|$FV D$t RP8y|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPx t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP#w|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPv$ D$TBL$?ttXLT$BtJ J T$$T$ QP+vL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPuي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV}sD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h~" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hK"h h"h"h h"hZ"h"h"dUSWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p 'A L$H SjQM ^_[]USWVL$T$ B3ulF1G&Uh# ,$0v3H 0v3~(v3H (v3 h(v3j u q1^_[]Vv3PPh"V-Vjjhʞ"蛩"@Ԟ&PhB#hv3&ujsUSWV׉΋*h"U&tCt[PUjhh3s 53r3t233WVS538J^_[]Uh{s"jz53h"$jzUSWV$:$D$VuPO 9$j uP2 1ɉ\$QSu Ƌ88"u11F9Ή$<$1ɉQSu _ ËD$8Չ_8"u !t$$Vhyd53m tbVh"Z^_[]jh"7jh".uh"$h0"hJ"$p hd"h|"jy$053h:7#jyUSWV}E phvJ%VNFh"V8h%V"SD$(P53臶Z#D$0= M$L$A1yyy D$Phwd53# D$tG\$ D$ L$|$j ljL$ NjL$IuɉNjD$ D$|$uhj\D$v1111O w+Ow?u$L$A1AAA D$Phwd539  \$tmt$ NL$,D$(3D$FD$FD$ FD$$~D$(P膮PWt$,t$t$t$hĚ" KuD$1D$|$Ynhxd 53蒺R531111VQRP53h6"]hxd 53J 3LQhg"-ww ww53h"w_G|$9w  jPQ53!¡3tNSVPh"Wt$ 53C $9tR"Q#h(v3SVPh"pكT$;r ZƉ[|$?e^_[]jjSu53h"lh?"h "h"hv3 jQh"WV$u>$jvW螂 s'Wh{dЀ53襸 t^_jh"jt653h:7#jtVPPhtd@53X $t%t53h"1$("u"53Q3$$m"m"s$r#QPhF" 3$$ m"s$r#QPhr" 3$$m"s$r#QPh" 3$$m"s$r#QPh"v 3$$s$r#VPh"V^53h"josWV$u^Vhzd@53 tH$D$PWVh,"$PwwwwVh:"^_%53h"jrUSWV}D$Phd@53荶 tzD$Phd@53j u53hn"m3$|$\$ t$jVSWVRPSWt$h"e^_[]f53h]"j)rSWVP|$uX|$_hq#Slƅthw"SXu+1Qhwd53襵 t ^_[753h:7#jqUSWV|$0t$,1@<o3$1ۉ؉D$h"WV6y qt\$te+$95o31|$7wWh|d53 D$ ;D$t-i9l$sUt$詊ƉD$l$묅h6hPVw3L$ $r#tH#RQPh "o|$ t\ư1P`VvvvvQPh"8 G;|$ ru53h"$t1^_[]W53h"jp53h"jojP|$u1Phd@53足 3tQhD"XD$ 0Qh:7#joSWVP|$t$^h#StDh32#St@h"SttT$da3 D$dD$ tTj/SGtF1;tٍT$d#3D$dD$,t>\$:t$1\$(X4&0&h" u1\^_[]hv"hO"zo3=3uj=3$333 3 3Yh'"5$<h"Ph"jh3= 3u th"0"3 3t uhݟ"t=2uh")ǃ|u D2j=03|$\G1PPL$lQPjW t2t$dIvt"1PPD$lPVjWt52=03u4$P52Cu#$=u03 3 3 $3 3=T3 ɡ2=03t&jQPE5 2u[52h##jhhd3QP~2y"$8hd3h "2d3=03u'L$dQPI52h;"h`3hrdAP  52hx"qah`3hedA52٩ 52h"hd3h(".a$$t(hQP52hE"$$ƒ 3>s1@![Vs ) ȣ3333? 3 333X33\35352=3=`3?w3 3=$3L[V$3? 3) 3>r$r$3 X3\3T3u 22]u1hQP2 2u25T3h"$_52a32j 52|VrX3u Vh!"8 11h\3t1A1A1ۉL$@1h\33 3h3=3u#<33@3 3D3$3 t$\F|$LSSWSjVřt$LqT3n 1QQWPjV蓙y5T3>T352j/V}t@UUUU)ʹ3333!!сisL313t!tt3Z3cԋ"3 ,3031&3‰ 4383@31 <31AhQh(3CG i-(3=<3 / ,3ً03P+==w !r%1H$D$ ʀŸw1D$ $}ȹ"3yt3t  u<31I $L$9 (311O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj 31҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$3- 3=$303D$,3t T$$T$3=,3uu 2; <37=3l3_hM""ET381uh"Q T3L8L$(L8L$$L8L$ L8L$48\$81=2Ɖڋ\$4PVQRXPSt$@t$,t$4t$31K1Kޅ`1PPPPPP =28h1"138LFu=3uRh"%tajhӼ"1"WjWWWP+h"t҉Z3u 3= 3u3u $31g= 3T3D$tD$|D$h" 31N=t 蹵@ 1k"WhVVWP+9tigfff։f53<3L$ȃjP5oD$ u h"jVh"i1HL$ Ajh"N1۾3D$^3tB?t=kWUh" b3L$ DD 3$ D$tD$D$ u3 <31(3|(.tq<(tk{PWh" 03,3(3t (BD$,T(2D$ TL 3$3L$ щtT$ <3T$D$,F9u߃|$~O1l$GVWh" T$ L D3$3L$ tT$FЉT$9uT$1۹˷"VWSSSP)T$ ‰ $DD$Rt3=ue3$@D$ $#D$u D$ 0&1$L$19;ta $Ȣ3=3u3u$3u  3=3t8\3~ h"3~lh͠"]h"=3u1Ih3 ̼3t h"h"t\3o3e$jt1 3"3t 3t3$ D$ 3 u=<35(303,31|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 3|$E9u KD 3D 3D$3DL /X3 \3WQD$lPJ D-L31ۉl$(-D$D$D 3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$03 ,35<3L3D$t$USWVPtDΠ3=,3suVh{"ɸ95<3sh"=3u h"11=3uVhU#z\3WWFuҀ=3u)6"=D3u"=<3%P1=<3131ۨuSh" (3 :503,3tD:փ1VPP3<tX=(3|Oh"迷(3 :-03,3$t D:$1BjUt$VP 3C;<3OXuVh"V1\3P'(3 =03,3tDփ1WP 3u, 3uh"3uh"Mtgh#ʶ3=t$ 蹵@ Rh("蚶 h"苶hQ%~=3uB139x @uuh"LPh="<=3t3PPhY"^_[]á2=3uxPh;"53535`35\35X3hD"ε5\35X35$35 353hm"裵5<3h"萵Ph"聵hZ"t\3 `3525353RQP5X3h"< hz"/ 3 $35\35X3RQP53h"5L35H3ho" USWVPˁˀ $3 3 31"33~t=u3t 9r u֋ <3~:(3”>u~t:t  Iu 3 щ $ $3t&=u3օ4$u 3G3tiP3Ȩuh<"h%˳P3tj 3=u3Ѕ$tNL3=3u"Phq"0h<"Ph"t P3 =P3uQ9$$ty%ty%1P3ti3х $t4$P5L3h"==3u5L3hN"1t"13=u 33^_[]VPD$ L$ $QPFh"菲u3H u3~u3H u30hu3=Ɖ t9tDu3H u3~u3H u3hu3ƒ1Y^h1"j7USWV1=43˃y CS t 35311 uY1ɉNVt11@5C C"t"Ph"2 h"1He^_[]SWVP$2;2u+03u"QhmdP { y h#x211h\3<=P3u;5P3|- P31Puh"V=<3~e1(3111 ,303Pt,(38C;<3|hr"1Sh"1$2;2u+03u"QhmdPy y h#m1^_[USWVP։腗1ɉQPU'2 1O}t#Ë$8u\8"u r1^_[]USWVP։ϋl$=3T+(3 \3tú$r#t%$76PSRh"T$-7St$h²"D$7UPS\$ ShӲ"7PUSh"׮77PUSh"豮7PUSh "虮7?PUSh"~77PUSh."X7PUSh?"@7?PUShQ"%'1PPPUt$(SRh"^_[]USWVˉ1u=(3h"T$$8$43|$͉Wh@&jjSPVh!"h$r#Wh"VN|$>)uh$r#Wh*" |$Z)uh$r#WhM"ۨ D$|$"3:!3 3 3l$M?>"3&3KL$ u}tGE)9H9^_[]USWV,։L$D$DD$Z"tD$u"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h"D $3 3D$HL$LVSQP{D$T$D$PVSUP{D$|$ D$@VSPW{ljӸ1=2ƉT$ L$@PVt$QRE{PSW|$LWVUl$lt$,t$,t$(t$@h߷"r,hu3jdh3δ |h#h33\$ $t < uC{ - p}3DAu<-j D$$Ph3V D$$\$ h&S}6K|$(@D$Ph5"S: $ϋT$ t։t=t$hC&S9 t't$h8"S9 ct$ |$@D$1=2ы5H3jVWRyD$ՋD$D$D$D$D$$t$t$D$$  T$L3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th#S< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhb"=3Vyƀ3t$Vh<"  5H3D$,$t$P։ω,^_[]h1"j'USWV΃ twttu"^T$(|$$+L3уD$ ;,3"L$ 03|.|$,T$0 83|$9=43|=3u|$4u 1^_[]Ë-<3~} ʉ$9tw(3|(tk ,3t( T( (t1+L39\$ \$$}2;T$}#=3u6|$4ttD(OG1nF "t(n9Չػ}n9l$\$QAuƉ3tt  $tt ^"3 ,311 03t$ -<3t$|$$|$}(3] ʀ|(tP ,3t( ;L$T$|L( (9Ή} =3{|$(t ;(3KC 03,30"1$t=t ,3 03S"=3|$(5@35(3 D1D3@3<3834303,3Ɔ3t$ |$(P39@3u85(3C1D3@3<3834303,3(31Ƀ|$(T$3\$1 5<3n (3|+D$Nu (3[\$j5L3,3)؋ (3P|$(t$ hhj<(3VfǀU@3L$ 03D$,3ƋD$$ȉ54383<311<3u(3=3h""u"s"=31|$(9 @3u85(3A1D3@3<3834303,3(3Ju UPQ& <31|$(tD$,3D$03543=83^_[]h"j"WV(3t^ tڋt֋|҉tΡ(34 <3 QPVL& <3ƀ^_USWV T$L$<3@hPh(3   <3(3~C03,3$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR% (3;UjP~ fDŽ;UtZF , M ;M;MU;; ,3 L3T$)ʉUL$  L31 EE=$3 3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M<3 ^_[]h0"jWV1=(3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5p}3<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$xb!1Kl$ 22uhUP4zQ5X3Pb ;2u[jVW52b!1Kt?D$H5X3#$SUPR 52V52 ;2tÉ؃ ^_[]hͿ"jUSWV$0$,1@D$l$D$D$ $1h"WV<% suM~j U5$<+ á$<8=L$90~8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-o3)1<$L$jhQP43hl3hedAPT` =3-:9l$| :@f3UjDž\$ t|0v3H 0v3~(v3H (v3 h(v3j jhl3h(v3 0v3H 0v3~(v3H (v3 h(v3j Ǜ<$ D$tt$r#tS"Ph3"`D$f3l3Waf3gdWPV%_ xnu)D$PhwdV _ h"h"V[1^_[]Ph"25$<h"j4 h"h"Pj̋zPh`"hv3' j譋USWV\T$3< $SE)D$9d$ՉjRPt$ VP^11 Sl$UVe 9 1U\$tL$j@PQN 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW48&h"pT$l$ 31ɺ 31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf 3ŅtMaQ48&h"YT$ t tuf f1113|$ 33T$ 3 3f3l$E<$g\$ttXaQ48&h-"ˑ ;B Q48&h["讑 <$\$t48&h"莑<$l$!F1D4 =3L$o"0o0FPWt$h"jd 3{<|$\$W4$,Wh"h"S4$u h"j< F j/P!:t|4$4$T,j ~USWV\$ l$|$t$1E3t&33h"WV h~n3itVn3Ѓa~.btCd 3봃otBs3띃NuS$<331=33mjSh&5$<m tHP EuAo3)ރu4t$$V41ut$(t^_[]hd"j kPh"hv3( j|$"=3uD$ D$@"3t $P=3u %= 3u "=3u $@P0; h"h*&j WVPh32#Qt1ƉPjPW3 Wt jP{V2\P^_ÐWVt$|$ VWft$?/tWhY"谔Vhr"袔^_WhD"j fWVt$ |$7˧WVUSWV $$l$WVSU$ $ hU3WhXq"6uWVh*"jG D$@tF$j$hh&hV V$$$h3"膃jzUSWV$$$$D$1 h"SU! $D$D$1G$D$ȃ 1$,&N|w5$<Ft|$`N|Z5$<Fx|$Cj$hX&5$<P5$<UFp<$h"SUN Vo3H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]hd"jWh$jGgPhW"hv3* j@xWVPt$jWV 9u9t x^_Vt$h"jEVt$Vt@^h#V^Vt$Vt@^h'%V|^WVPt$jWVE 9t9u x^_Vh"jWVt$|$ VWbt$?/tWhY"ؐVhr"ʐ^_WhD"jfL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QD$ T$M⿪t׋E4D$T9\$E0D$Ds h"i-1VWt$ t$iP:1@PPVVu4u0u)OËPhh&PW: }D@u hh& hh&S2: }D@PE,CEhhs%V~X\$thhs%Vh", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5Ph"+%t9\$t h$"+\$pD$p\$D$D$ 9\$~\$~tShW"+\$9|1} t h~"k+hW5D3h"ƍ}4xME0;E4ru0h" +},u,D$D E4t h"xD$T 1u D$D5 t$ D$$$$L$$$E@$D$,D$(A$AD$|AD$0A $CD$4D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$uttPfFx@HIt$81VRtRRP*t$ tPh"9QL$xtL$tD$8@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

z$WP1HPWh(3Vh"h"&u=o3؃rKVh"hO"jD$t t @@u|$$h"Ћ45P3j/VumT3Vh"h"hS'L$DPSFu"5P3h"hrx%hhT3KP3T3 Ph"Ku = 3hjS覡 |$4tg$y\hh5P3| D$xD=L3~1hSPڟD$ F;5L3|1QQQPD$ u D$y05P3B40 PVu h:7#E 1HD$j5P3Åy'5P330 PVu h:7# $DPS2y'5P330a PVu h:7# $L%=ta= uDH3u DH3L$t$QRPS5P3ul5P3hD&5P3h$"NDŽ$$lfsD$tjV$$!$ $L$ Z$ $ u4h^"L$ u.$$lfst!$$Phhs%4hp"L$|$u$=2|$TtL31L3ɉ\$Hu0L3tL;$$ s5$$ %DŽ$$lfsL3t$$ $$ 1Ҿ9É|$u|$ |$|$ t+|$ u$1Ҿ9s h" h"*ZL$8J#$L= j|$W$($(D$8T$ t$VDN|$(O11VSh$Pt$XxHW D$(+D$L$,L$ ʃ|*5P3h"bY1D$(+D$L$,L$QPVSD$DT$XD$PD$L$L$,D$(D$8L$  L$lD$h1l$h\$8$躽D$\D$8L$\ h&|$D$ fD$Bl$B|$`l$D$`L$d QPhSt$Xx>WFD$(+D$L$,L$ ʃ{1QPWVth5"j81F\$D1VPSh;"GD$XWVPS|%|$$u1Ʌ|$t1ɉAw1@|$Phi"GD$tt$5<35035,3t$\t$dt$<583543Q5$35(352PWt$L@ƃ|$4tVY>USWVӉ $.|$j W\$ SaS Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ -8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$h"jUSWVv31F/WVUhh"WVjh"WVj!h"WVjh"y WVSh"dWVj+h"SWVj;h$"BWVj$h`"1WVUh"!WVjh"WVjh"h"WqGWVj h"WVSh""V;fD$t1B9| 2I 21|3Iu顴2P}3 2~ t1@3@9uUSWVD$921A9|G2S Ɖ<$~ SjV' 2D$~Q1ɡ3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5353$2^_[]V$d3 h3D$D$ `&T$ t$ 25l3t$T$L$D$\$ $n"B$^Vt$FtN H N tNHNfr v 2V) `3^VD$`sH) p3t3 x3HtP4BPQ@@1ҋ3v9t33rh"jCtp4F@3^USWVD$T$#253tC=`311-l39| n-l39t%9P4uH$3L$X(3\$ t Fu1^_[]h "h"hhƓ""USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>`3 x3 29|[53tFNu 353t5FNHNFy F4VPV`3@`31@j@PU1@PF ~4D$F(^$F0^,n#2^83 3t q43^G FtH 7~ F^_[]É 3=h"h"hh7"h"hhƓ"'!Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 3H3N^,H p3t3x3H@3P 3 3H3H4I3H89t;tprp3403t4F 3H^hX"hQ"h4hƓ"USWV}]uuu W@t d31@h31HCSuu WW KN0F,xNF4VPe^_[]vjv ! fUSWVP|$g&s&G4$O,52w0VPww D$0^_[]USWVPt$ff&s&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 3HtƒQ 3@ 3^_WVt$ 3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv  vz^_pUSWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=3| t Pt331t 98t@^_[]Ã^_[]`V15353hVh3 53^ft$ t$ j2SWVt$frLN4F,=2~0WPvv 1&t\fv4V1AN4F,=2~0WPvv 1&1;NuN^_[h"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSK$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h"USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPE3T$3D$M u1^_[]USWV(t$F|F }F u}F F$|$0tfhjLljPLtLXt uB\I\$$|$ C$|$4NhӘ"fc<1ɺPt`tLtt l$,\$(|$0uejttPttP̻A 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=2lj2l$1 UPQSWVhjSË}Pw S P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhj袺Njl$hu P; P E1PUtA|$4t h"`SZWB1^_[]u C4CHKL1}Mt|$4t7hi"`t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhʗ":$  $ Vx19tQRh "+ 1@^USWV |$,\$$t$ tCPPt Ttt4RQhq"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth"*h(v3D$(u KHKpStURQPt$DljT$t h "X^u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" 3VRh" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPht"D$L$9tQP$$h"t$Ht$L$tI9ȋt$ tPQ$$hĖ"V1t$落\^_[]h-"h"hh:")h-"h"hPD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt荚|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$8"nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$R"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWӋƋD$0T$UW跋ƋD$0 u$$$UW|ljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPERP$GW #RPERPڊ$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPh"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPh"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW菆Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP脅T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPф|$FV D$t RP贄|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP< t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP蟂|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP$ D$TBL$?ttXLT$BtJ J T$$T$ QP见L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV~D$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv b t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h~" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hK"h h"h"h h"hZ"h"h"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p 裏A L$H SjQ ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QP91 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jDƉ t,UFtf^81FFH1|$<΋t$ 3uN 3NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPt$|$K\$tSD$ hD$@p$Fx~"1ɋ@ L;H|PHsu"l$ \$ 3{3 3\$L,D(Pl$ tttt$T 1¹pt Ѝ t$@F01FHD$Pt$.KCLLtPQ4$Xtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(3y 33Py`P迬D$@3 3C9݋|$"$( x?$( Z1ىjPySh$PI uSUh" j2PW#W E2$( ;h||$jt\h"@PUW~ $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"WчL$\\L$\\ $\]u^E l&Yt8u1҄tʋ$( t?r QVR V襙q赩8uUh"Ih"Ph"4USWVՉt$hR7 1I t uFjh)#Vk u<^Ft t u^F t tW:PWV/ tt$hU u1I1ɉ^_[]WV׉RhQ t6< ~< t<#t< t >t< u6AWhV\ űD$ 1GtPh"$ ^_V菘1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh/"+C< t< t< uh32#S<ƍD$$VhP L$T$\$PQRSD$0PD$Ph"D$@P t$$$ىh"rC< t< t< uSO=$<rLjShD"Sh`"@Sh"h"qt$<L$D$D$L$ oPStXljo 1tX L@uH~vCtTjhhn" VB$^_[]V) )UjSm D$ D$ CD$CD$C D$C$Cl$Uh&r#VX u D$CV趕)1$<;obD$D$PSh"4 =USWV$0xjW{\ƅ~F$0h$1jUL\~4$hPq C9uЋ$4h32#SwǍ$ىhR"$0St| uƄ$ $0ph"QU蕻D$$0qh"QPsىD$PU艔PUS~ u׋$0EED$1ɍ$D$ $PhS D$PD$PD$PD$Ph%S胁D$L$ T$ ыD$E L$ T$ D $A9L$D$uP舓h"h"a=}Sh"h" Sh"h2"?= $02t$t$h"$@t$Ph" |$W}~14`G;}|V`1^_[]USWVD$(}~;$ ~VE pSN $PjVWjSXD$11D$D$D$D$$D$ D$h<"u VuH H5$\&D$>j 5$<PcN Cr3밋$<$PCrj hq#VXJ ىVvS 1P臭uE$ ~S4VJ $Ph jSPt$VmUuVht" ,Wh)"j+<ÍD$LPSyu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BV~ i8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQg $Phn"Phr<rr h"jhr +rryt$$$PVWU>ލ$P|$xh4"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WPxf $Ph"Phr"tM"PSh"? .1$P;$h"Shrt$VW"9;$PVh"|$$Vh"Ӱh"jhr t$jQ=3:$h"Whrt$ "?c.\$j h"WhrS$d|1$XAA$Pj2PQc $PhV"Phr"a~~;$1Fȋ`&w ̹&QPhX"- G`;$X|΋$\>9rh"$`>ߋN8`&w̹&PVhX"ʮ `Ouet$$P\$ ZSh"蛮h"$P\$;$PPhU"j V|hE"Sh*rt$  09rh"$h"$\>$Th^k% Vh "$X~:$\1j hE$V蓆 "tQC`;$X|j 踬~-h2"$`>Vw`Ouj 臬$X1~$1:t @`9u9u$\Phs")1@\D$,\$H|$PS$hjVِ L$,9F Vh"VhrW h"F0Ph"觬F0Pv,v(v$h"芬j 蠫h&"s$Th"_Ph"h"FhF&%VhD$0L$4$PND$8FhQ"Vh(r WO  FtsShp"$PtPh7%ثh"˫$Tt*Mbi)QRh"薫 j 謪$XqPSh"l ]hJ"Z$X~n$1Wȃw,R"$4&L$7"!""`& 8""PRhb" F`;$X|ۋt$~G$`>G8tu #P`&w &QWhb"虪 `Kut$h"VhrP>U"tj"Pat$1 E$`$d $jj h3`$QPjVyjh`$V= V$`t$Vh"$XMbi)QR$\VhD"趩$|$|$|$|$|$|Vh"~ $\uMH#1wh"]L$!r "$PPV9t$h"!11҉4hӀB9u$r#tH#QPt$h"=3~S$h1h #1PQh"褨 C uߍ_ j 豧 rt$h"Vh&r@t$S>#;$PtF""tM"RPt$h"3t$ USWV`p׉͋$tph"S蕁,$tSÃr t1C1|L$PVQb Ou vu hu Z$1hoVWm owt1$0 j2t W=; F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh0"Wp: Ƈ$L$h1"Qh+rU9uh"jhr U`p^_[]WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jhz%S1< tVjh"S< tBjhTR#S < t.jh"S; jhq#S; u$D$D$h"PhrWh"PhrW=3t?|$"t"PVh)" |$u$4&VhD" ^_[$oWVƿv3Ph"Wb Vh"WS VhW"WD Vhx"W5 Vh"W& Vh"W Vh"W Vh"W Vh"W Vh."Wۦ VhO"W̦ Vht"W车 Vh"W讦 Vh"W蟦 Vh"W萦 Vh"W聦 Vh"Wr Vh "Wc VhA"WT VhX"WE Vho"W6 Vh"W' Vh"W j螚VRhQ) t^Vh"$jI)WVPΉ1WPhPPj PQ u^_Vh"Qj(USWV։ωl$PU\$hjS҆ E9C Sh"ShrW VhH"貢ssss ha"虢ss3h"脢{""t"t$(Ph"] t$4t$4t$4h"D$t$Ht$Ht$Hh"$D$8PhN"$t"Vha"$4&ht"֡$h"¡Ę^_[]t$ t$ t$ k tt$h"j'USWVӉύD$(jP81t$`FFF FFD$h$r#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP$D$HD$PD$P l&5`&|$D$ fD$ l$ \$Tl$+D$Ty1P&Ph"$j($PT$D$ +T$(+D$0хyL$XD$\D$\5p&D$XuT$hL$l+D$$D$ $߬$&ݜ$ܼ$D$pt$t$$߬$&ݜ$݄$T$xL$|l$x&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$P菝 DŽ$ <\$D9r<"ShrQ3h["vh"UhrVuh}"Rt5|$d} r"<$c!r"P"^_[]USWV$`T$$<`$8`t$D$0hE"Ph*rQ 0͉L$9r\$~HT$ |$ $1hWt$ Xu u$8`01@$F`9uӃ<$T$ uU~\T$$$0$$<`hWt$ u u$8`D$1@$C`Mu΃<$t $`^_[]t$h"j "USWV$,hE"9J"tŋ$0h"|93"t 3~?-|$h"VSl) M~%Hwv$& 33ǃDt*MhB#5$<A3u5$<MD 43nNRt 3j W5$<+ 3L$9&-$<23332j W5$< 2L$9]`33}3nP.tWqP.ujjQPh7"jD$كL$l$ umt$>l$ 1  ut$)K3h"5$<h`"p5$<h"` $L$L$GȍQw[sV?PpP--G A6PGu$t L$-AGL$AL$$j=3u"hh"h"h"h"h"h"h"hv3P$WfPh B$Wf bU*yŃ=3u#3MIрK=3u }8$V+ƹV])uV+Wu"$VVY+DžD$u h%"Xul$Vh#hv3ޏ Vh|%h$ PËW(yl$`t$Xt$T1ҋ\$މT$̓=3u3MIрs6=3uA}t']hQ%S"hv3D$+hP$ S  ىV1 D$@W'$WcPhC$Wd $'hv3jjh"?$WdcPh"WUd j)$W.cPh"Wd =3tVhv3jjh"H?3$WbPh"Wc 6WKThv3jjh">33hv3jjh$">3ꍬ$U$PRbGVFb)1;$v7$5<P{3$Pb$$1Ehhv3jjh",>l$WK(_D$h9jUP4L$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=3 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$hQ%S]t jh|#S] t ;/u f. Gf./W[S[9SW]t͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PSYtH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 52 3H $s-t$$tHfHxt P2)1^USWV=3th(v3jjh"2jj9#tvƃ=3th(v3jjh"231GNIIˋ^s 3 tVfV(3ޅu3=31WS"ơ3Krk=3tV$Ph"h(v3> ~uV7dV'%V`v v"3F$53vu;33K^_[]USWVPl$3M1t$"Džt.w w!ƅu h"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=3tW"Ph"h(v3~ W_1l$$ttF9u t G9t$&Qt$h3h"hv3~<$WbWE&F~X|$<th"V_VCbV&vfFt$ t$ t$ h"hv3~EuFufFFV!|$WP`WV&N=31ۈ33|NIL3h3R3ǀ3|NAMǀ3EFNDt$h3h"h(v3P}1N1@=31ۈ33|NIL33W=Rǀ3FNDǀ3|INOW R3ǀ3|NAMǀ3EFNDVdPt$h3h""h(v3|C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=3#~VPt$h/"hv3|1t$h3h"]a >W\Ut$$t$$|$$WX ƃ*Vhg"V%]1@KGufGfG1@=3$ WbPt$h3h""h(v3Z{Ut$$t$$|$$WƀH1@=3ىV_bPWh3hU" |$u V[v vY3F$53Ut$$t$$WDUt$$t$$W.PZN1@=3t-ى,VaPWh3h""h(v3iz؃^_[]S133|NIL3t!h3dOǀ3APEǀ3|ONTt!h3>Oǀ3FNDǀ3|INOt(h3Oǀ3|NAMǀ3EFNDƀ3t(h3Nǀ3|MODǀ3ECHGƀ3[SWV=3th(v3jjh"*3=31VWftmxtg 3W sJX tCf{u7=3tSPh5"h(v3x S\S [빃;=33k53tc~ tWuLfthS"W Z=3tWRPh5"h(v3zx Wy\W9 륋v$^_[SWV=3th(v3jj hk")3tS31{ t$C$Su[SFuՅu53th"VKYv$^_[USWV=3R3utDh(v3jj"h"+),th(v3jjh")53t$G!jj#^ơ83;3<33,׋-3WV]Ɖ׋ <3839sAWV2ÅuWVh"p\ SPh"hv3v c렉1‰1 u`WVÅu h%"%\Cuh;"SXCt SZcSSPCcQPWVh"hv3iv:K39tPt$ ZU-383;3<33^_[]USWV=3th(v3jjhS"|'f03jY9T jj\ʼnT$3 3PQ\D$5<3583J\Ɖt$U9\ʼn$St$p\Él$9$\$<3 839ˉs6f03j8DTk D$;83<3rM\$ -39sI<39583s9-3tS 3E9u<3 839\$ <3 839ΉsZWVÅu h"YSCPh"hv3kt cWV[Ɖס<3 83911 uU9t$D$ rIWV<Åu h"|YSPKAc9-3u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5<3583fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=3th(v3jjhl"$FtVPXfvu݃=3th(v3jj h{"$3=31ҹ$RL$QtMƋhtDEt9VP|$ W6f1ۀ~UiCSPW+W em븋L$$; 33r^_[]SWV=3th(v3jjh"#3=3rc11CWS5t:FfN~u %fFfth"VYSvuȃ;33r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h"VRWh"hv3Lq 1^_[]fUSWV`=3th(v3jjh""535353h."hh2l3 t= 4uFFF%)Fu9rV9=3tJh(v3jjh"9F 3t(t$h(v3jjh"F 31V9vtRPh"h(v3Wk 3th(v3j z$ 9̓>t9߁^_[]á 3tPjt$t$tuù2WVIAfF=,3|C03)f8353jQh43u5,3F143PVQ =03F,3^_ù2Qh/"DO8u"h"hr"53hS"hv3jj^WVjh21t)h 0t 8@ W蘼^_V83 <3t7#43=@u%o>83 <3t43!=@t^USWV$$$ $jhWV0,43tE1M1 tmjWVS$8jWVS$8t$Sh|%hVdV>$ (3U Rh5(3DžtGhQ%P?tSh"hv3h 5(3DžtGhB#PW?tSh)"hv3Ph 5(3[Nj5(31jPP6/+^^$DOGrhPD$PhR"hv3g:hPt$V $(j7V@ (3u D5(3Nj5(3j1PP6/+^^X^_[]SWV׉1jPP1.+FF9tX\$)yWh"hv3)g %؉jQP6.~tF hP6蟸 F^_[USWV|$_ OtGhS7q GO9}vDty)9|n4 ȉG.uFhH%Pi=;-33rv=3tUh"hv3>f \GP1=3t:Ph"hv3f %1=3thv3jjho"l1^_[]USWVD$$PCYD$x/@thH%Qdl1ƀ81Mbi)43H1ًP1 t (3P RVf:5(3At\G9uGSVP:; t5(3Džu*hH%D$Pktƀ8MbE^_[]USWVt$!M1 tFjhRW+,43t(E1M1 tm`ƋU R^_[]ËD$0 USWVX=3th(v3jj&h"3 ߉^_[]USWV|$u h">W}.3u`Ɖˋ- 3UxDžuh"z>- 3)ً39w؉9vlj<3|$3WSJL^_[]USWV։ϋ\$ t;=33rVWh#= -33QPVW{s LK$\=3t%[$tC1K 1 uh#S9^_[]SWVt$f~thy"V9~u(~th"Vg9~ th"VS9FN tkQPDžuh"V)99tt79uNH4~^ SW FtPh"V8.>W,333F$53^_[ËAP 9ttЋR9uIHËIH h#Qt8Vt$V*,33^SWV|$t$Åuh"V,8;^ty^C Fs j/WGS+3 3W W+FV86PD-1ɅF fN^_[USWVd=3th(v3jjh"=3td|$xh"W`Vƅu0:0Ph5"hv3U Wh6";t$ f 331؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6vuݡ3$3؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W[u3$53L$T$9΋$D 1$T$|3~L1\$3 tAD$t$ jjSG39|͋ 3 $53T$|L$<q$Q Ai(3,3QA 33QA3A$t$ Vjj(QF @t380:Phc"hv3oS t$xho"8VE(h^_[]USWV$=3th(v3jjh"e1PPU Džy0 80Ph6"hv3R Uh"88D$,PW7y070lPh"hv3R Uh"7$jSƅu h #7SVW xD$j(PW y0P70Ph"hv3&R UhH#{7Wߤ3RrD$l$,3=(3,$1Չ1 9$hv3jjhj#jj53533jP3u h"6PjPhQ%HĨ^_[]f03D$L$ ,3(3D$L$ 33=3u t$(6t$pPh#S6D$ L$$ 33L$T$ 3<)3؅~ڋUSWV(΃=3|$()1\$@kD$(D$$D$,D$ D$0D$D$4D$D$8D$D$  4^_USWVΡ3$$D$f03=3u h#m#=3Tt h#T# 4ȅ @44$Åu53h##$31~3 $r(1Aω~$$39} $O9sۃ<$u9t53h#"3u:=3u1$3 $D$$P6Z\$ $L$E3 3 ‹T$t61 t@53h#:"+h4Tu)433!4^_[]USWV}u14493u.=3!hp#!1ۃ=3D$$3T3@3L$L$ 39$$531֋=31 u"$35,3$3=(3 iL$QQv3Pht#V; h3~Ph#Vo; U=3t54h#h(v3L; hv3jjh!#4D$QPh8#hv3;3=3v3$3 1A $t=3tPWh= #h(v3`3 = 4 43hQVX 44^_[]t3 PUh= #k s-4hh4U  0Ph #hv32 jL'USWVE3f03T3 P3D$te^_[]á4fD$ < 4L$ < 4}Ph84QPh8453h #hv3.&jSWV|$t$ 48; 4vhK #b  48 4WVP  4^_[53h #hv3% jJUSWV$$=3t$h#h(v3% Z$ $(މ4$9{CKQPh"hl$U1!=3t CU342h#h(v3%tUCKQB+{))σ#WRL$ QP$(ACKQB3{))σ4$#WRL$ QP$,ۼBCKQB;k))΃#Vt$RL$ QP$,wt%=3$(tqUh!#h(v3# \{$(u0jh1#D$ P܄ tFjhl#D$ PĄ tk=3th(v3jjh#!9(jtzwC@D#P$z6C@D#P$9C@_#Pj$$!C@O#Pj$$m u_{C@_#Pj$$!C@O#Pj$$ =3J=3t&$r#;$ t#Ph#h(v3(" =3th(v3j 1^_[]SWV|$t$=3tD 4WVhH 4P =3uWV5@ 40r t^_[Ë583=<330NPSWVhe #hv3!jSWVt$=3tD 4Vt$hH 4P =3ujjV5@ 4!ƒt^_[Ë583=<33#0PSWVh #hv3 j|V33tuf03VVVC ^PD$L$ $QPhv3'% X@hA3>o  UV= 4t114Bu11Bu=Iu1@'535<3583Ph #hv3 1^SWV\$j/StMƊ?SDžu#Sjj0SDPO/F^_[WV|$ th #WWNƃ=3uhVx=3tPVh #hv3r^USWVl$|$\$u0=3uCWSny5L0PSWh\#uuI=3uWSoxB1F=3t\#t"SWPh#h(v36Uh#2$0vPSWh#hv31^_[]PD$L$ $QPhv3 =3uh"s"=tXht#)ujWV|$ =3u1VVhWx!1F=3t8Wh#h(v3 # 0PWh#hv3^_Vt$~th/#V.FσfFVqƃ=3u V(mx=3t8Vho#h(v3x #~0PVhG#hv3S^WVt$ ;53|$3s(WV=t xt@u;53Ή^_WVt$|$ r4VWt xt@u1Ҹ9r^_Vt$144|NIL4Ft,h4ǀ4|REMǀ4OVEDƀ4F t,h4ǀ4|TMPǀ4NAMEƀ4Ft,h4Yǀ4|EXTǀ4RACTƀ4Ft"h4)ǀ4|NEWƀ4Ft$h4ǀ4|KEEfǀ4PF@t(h4ǀ4|EXIǀ4STEDƀ44^WVt$ V蜱1t%t 3P 9щrVhS#hv3< 1^_SWV|$v3Whj#S S3HQP~ Q1 P* t3HQP~ Q P t 3@ tntyg1@1^_[USWV|$$\$ T$l$t$>.u Ft#|$VWjj54 1@VWPj54=4^_[]WhC# j{h)p&joh"h-#j,h #j SWV$$$Vh#hW4S ^_[USWVӉ΋|$-4RPSUb Ss9u ^_[]j\=4uo##j4SWV t$t$4h#jV #jfƅ~'|$01ۍ)QP54dc ~9߉ ^_[jUSWV t$4|$8\$Wh#jSv -4SPSUa WV54a 1Bݕ% ^_[]SWV Ӊύt$sKt$ tVWh:7#0 |$W"[01HFu4h#WUt9h0o%WCt'\$j SW $ 9uy6h#U$~h#Wt@h0o%Wt.\$j SW誌 D$ 9uyvh#j)D$PhU54 u ^_[2h"#jSWV |$t$ >h#W]t9h0o%WKt'\$j SW $ 9uy6h#U$~h#Wt@h0o%Wt.\$j SW貋 D$ 9uyvh#j1D$PhU54 u ^_[:h.#j'USWVhѝ$(1hWD$ P |$ |$ D$~P1ۈD$$,,jUh"\ tjUh7#H tG99ufD$u\$ tR$,4jVhѫ% EjVh=# 4jVhB# 5\$ D$7f@jh0uht$Vj P54D$^ރ9tD$j@hK#P ߉tD$PMDaryDpriml$t?tD$P"D andfD D$PDgrowfDnt$VD defDectsDuVjh#P V54545454h#Et2tR}jh#V H}j1h3#Vk V#}jIh#VF t6Wh"Sh"$UփOut$g h#9^_[]1h#j輋USWV}\$j S54O D$t"NuD$Hj@PjSPhy#jY$j$Vjj54rF=tPh#"D$D$ D$$fD$t$j VE 0 9 1L$81qAQQ a A j QV54-D$t$ *jh#E pN  D$ @L$jhtjPjQ54h#Bh(v3赽D$t$H1D$`D$L'Ƅ$0VhQ`54 $j D$tPS۾ |$'y9D$(ȋL$;&|"@D$Ph=#h(v3 j !ID$$<JD$ D$ L$jhtjPjQ54~e^_[]ÄtH<t<u'54h# 54h #hv3 P54h#hv3hE#h#jE 0h#`USWV $ ~($ 1j4hT#c ?C9u1CCJt$LUPVW CJjh'UVjS54~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P54545454hX# vL$D$$jh'hVjS54Ffȁw$VhU軼 VhU誼 ƅtL$D$jh'h$PjS54]$f1Ɂw$PUhWh#4Wh#vL$D$jh'h$PjS54$f1Ɂwh#s4t$ t$ 1؃;D$ D$4ƜF>|$Ń &h^&hrx%  ~y)L$$<$r],$1D L Tl| D  PW54h#C9$uV:^_[]ËD$,4h#j|h#D$Phd#VD$P H PpRQhj#a tVhs#N^h#?*^VD$P H PpRQhj#  tVhs#^h#)^USWV$Gh4н&V蘉 Vh# r[h#O yj h#O,@tPh'#dO, tPh7#IGȅtPhY#2GȅtPPhl# O W hVbVh#GtPh#$hVjWƅtVh#j t)$1@9}$݀#VJ uC <=%:l2ShV>#$t$މ|$= 4t2=/ 4D$(2L$, T$l$hPRh,4QWVe]MD$(t$=4|$t'p}3@DJ@ut1ɊTAu=4umT$,$uWjSt$8^|$=4(4`΀<$|$tZT$,$VWjSPiUtgHp St$0t$8$PVhD!4h,4у *4T$,$VW1VSP54,4C$$&D$,$D$(D$=4t +1ۉ\$0\$&\$'D$4SPV<7 ljӉT$tD$p!Ѓ͵8"迵0`PVhb&1<==41$1Ct$|$81 t$4t$0D$(t$tt$pj,T$R豀[A1OD$D$1D$ D$j=QuD$ tOAL$ \$ h0#Vt=j,S:AL$D$"h0#V耦21۰D$t$h%V^h>#VHNh^&V2ghM/$Vht&V.hNM$Vc |$$i \$ Ct$ɍQw1$L&>a΀-% plj\$ Cut$BT$ҋ $)|$4S1ɉQD$PS D$ D$ 938*"8\$ L$ D$D$W|$h#S誤Dh&S蔤;h h&S~7h[#Sh3h#?#SR'h(?#S<D$t$ |$@01ɉQD$PSp D$D$ 9؋t$88|$ݱ1ɉQD$PS} L$ 99։D$誱L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh,44t2h&B#v 1<==4 ڍt$81 D$ \$phjSh,4PVT$RoV$1BD$L4JD4`L$p$QRSRPVP4  4u1$P`$w l&Qh,4hA#U  41<=4 j=VN{9=4 j=V.{T$81 D$ t$ hjVh,4PRWLU\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP$$h,4h B#D$49t 8VhMB#S1JD$ $$Qh@#,=4D$t$=4$D$D$,D$\$(V萞GC@D$p9Vh_B#C0Pt$hA#|$oQhA#=4D$WSt$h?#VD$ 81ҸD$ |$\$ Cj"$PZÍD$pWVPSt$ $Pw\$ E $,4jt$tS7 $,4jWV# -.0τPh,4hA# B4  4$Ph,4hb&7D$ $u1@t$2|$ Qh?#(11G|$1\$ tpupth|#Q^D$ t$D$t1@L$ ɉ%t>#PQ^Q|$t 8t1j t$ i4$`St$hM?#FQt$h?#7.l2m2L$ L$ ف$K{8P|$W趎D$ t@j QSW D$ ;$|$8tQtUL$4 T$hjRh,4QWt$ Q l2T$ gL$4D$ ,41ɍAD$4tT8`T$ Q$QRQPWc4  4T$J`$wl&Pt$heA#t$L$ $d$ r $3 $tu¸[#t(?#PQh@#|$D$u |$u |$TF1@]%t>#Pt$h>#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qh/A#d0Pt$hJA#|$L$lj% L$St$hk?#{D$$8&1ɉQD$PS L$ 9t 9St$h?#,D$ D$ D$D$0L$0RPQt$,t$$P}tBD$tUtsD$ |$,4jVPM D$h|$t9811FD$&|$,4VVP  D$'$D$8|$,4jVP D$p,4jVP UD$1=4D$44$Vt$h?# Ph>#=4he^_[]4$h@#ًt$D$t$$t$SY@9s Vt$h6@# S1@D$t$|1ɉQD$PS4( T$tD$pD$ 9t8uǦ8 St$hx@#Qh@#蟦1ɉQD$PS? ƋD$ 9t8t}St$h@#St$h/?#D$t$։D$@L$8`OGL$0d$ rxL$D$nT$L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$hl># j脴j-|Ph,4h># h>#hxA#hA#h,4h6#SWVPD$t$|$L$ $QP67Z9w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS y1Ht$L$ltT$d;WuT$h;W(u Q,Q ŃtD$ppPU1w D$DGXHr PvaoXd^_[]USWV$l248,4t 4/4Sh,4ntW,4މ)ˉESQ|$ Wv DW4VVOfǀ4/SUnu,4Uh4,^_[]USWVhT$D$A7#&1Ch4D$ CL$;rjt$V} ufD$jD$Pjh4V薡t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPTXWt$h!7#|$$j@WVP7XWt$h17#jS@WVPt$=h2聠Ph"Wռ 4t5$4Ph=#5h2貼D$$PV5h2 (4^_V΅tO萡Hw;s14 4tej0 yPh,4h=#M Atʡ4 4t"40xPh,4hb& u =4t^j聰USWV=4ˋ} 4 4 t u tth(v3jVum}ti=4|}t j MO؃thD$VuPs t$UtuRh"t{5p2Rhrx%[ bD$VuPUs tMD$PVh=#( D$VuP"s t+t$ t$ Vh=#]D$ s*P? D$L$ r!QPh`B$ rD$rIPh&r#QPh$xt$hoL$藷}u h=#脷j 蛶e^_[]PhM&USWVP=4u(ˋl$ D$$|$5 4 4 t u^_[]Åtth(v3jt$W0k܅4| t j $^_[]uCuWt$h" K4$~DN1ۅtPh#螶t#=4uPh>#9t4C뿃u,h=#a't+ORh"G#L 딅t~=4|t j 衴^_[]1ɉr $~1Ph#DC9ur4$h9>#*j @tuQh"b5p2Qhrx% IWVD$0L$41|$VVRWQPmqt)L$$<$ug4 4tT$jjvB1A8= 4uQh"jt$t$t$ t$t$h!;#I^_Qh;#j3:USWV4 4=4|$(|$44 4t{\$,1PPQPSWpt`,$tYUHtLƍD$(1QQPVSWbpt&$;D$u,4jPwVXaVXD$8tPh,4h];# ;w1D$$&Ph;#Ph;#Ph;#Ph<#^_[]UWV EMT$ 1|$VVRWQPot@u|$ D$L$ L$D$4 4tT$jj Z1AP 4t!u.=p2D$PpPWVh0&QPh$a t$QPh&<#Le^_]Vh;#j58UWVEMT$ 1VVRWQPnt+M|$ 4 4tjjj1A` 4u5p2Qhrx%贱 4$h t$t$E t Pt$t$h3<#q e^_]Qh;#jZ7USWVD|$huI=4t@D$$1ɍT$QQPRh;<#qD$pt$D$(1N\$$SEŋD$d\$ 1ҹt(t$ RRVQWPdmD$ \$1Ƀt,$t$XL$$9 1 $\$(K1ՃH11D$1D$D$1D$D$ \$|$,Euϋ $q|$,\$]\$\$ ]\$ \$]\$\$]UT$T$UT$}T$UT$T$(Iu$L$HL$ H L$HXPL$Hx L$H$t$X\$(t1E<$tEPhl2VhC<#j\$DS4 4tىjj(A= 4uSh" w$w wwwww ww7hJ<#,D$tM(9ʼnd4$1A1AUTD^_[]Vh;#j4USWV$$|$$u1D$1ɉQQPRh;<#4$$t$V Ctfŋ$L$ 11RRQUSPjtO$D$ ;D$*#L$$l$u1L$$jjUi 1A1AU=4tM<$1\$t$Whl2RhC<#jSL$$jjV G;<$|u 4 4tщjPV= 4uRh"<$~/1t hˉ#ttVh<#߬F;4$|j t$4RĄ^_[]Rh;#j2USWV$=4t  $D$\$ 1ɉD$QQSP$VhjDWUDt3j|Dt$SM$UaD虓8W$h<#{ =4vj11ۍL$l$ PSQU$VNhtct =49$$D$4 4tT1΋$PjU$h<#1Ʌ7_l$ 11΍L$AAQU>D$L$PUh<#jdQr$WPUV to4 4t$jjPDH1L$AAQ\$S D$|$PSh<#jdW$jPW Ā^_[]USWVP\$(|$$1PPUPSWf$P>1PPUVSWftu= 4u5p2t$hrx%ũ $ $ r/1۸$r#WwwPh<#蔩C ˉ#;$rj 蜨1A1AyVN^_[]Ph<#jw/UWV0EMT$1|$ VVRWQPet0M|$4 4tT$ jj1Ay= 4uQh"Ũ1D$ L$ T$$L$l$L$, $$D$T$l$L$(D$L$l$\$\$ \$$<#ce^_]Qh;#jL.USWV@$ @=4t Z$ V3ƍ$ h jU hr%V  t}1ۍ|$1EvSWV輱 L$99=z  hr%j ƅu$ 11L$RUPQ$8@$8@ctIt =4$,@$@4 4t.1T$Ph X1Ʌ1ۅÍL$MP~$@SPUB U$@LtW4 4t$ jh V0$ P$~jPS SK@^_[]؍8"tD$9t 8uVh&=#Vh=#j,h=#h"$j ,USWV \$0|$,1PPUPSWb)4$:1PPUVSWXb= 4ut$ h"聥>rt51t ttt ttth[=#C 9uЋkT ;$tl  1L$D$Sjh" {t+1:LtPh=#Ӥ G,;{r܃TD$@TL$9uj ˣVJ1A ^_[]h,4hq=#+USWV }=4t D$ toh=#W}tc1ɉt$QVW"  T$$9t8u踋8,Wuh=# =4j 11CL$ t$PSQVuu]`tWt =41=4u?=4u6L$1J1ыT$1 u#MUPj h=#1ɅRaMUPjV tK=4u-=4u$1H3$3|$ uMUjj h=#MUjjP e^_[]ÉSWVtp}3q~FDx@uAFX@ut9vp}30Dr@tH^_[USWVPω11s6tUVh<=#S Uh#S t9VG4$Euuh$r#-Ɖ$t^_[]hH=#hC=#j(hH=#hV=#USWV\։ύD$ jPj P贅 1u0D$F|fD$Y|Uh=#j D$ P2$L$D$ L$/Ph#j D$ P [ $fL p}3/LA .sD$ L<u\$ S+jPj S E9[|$ t D$ PVh=#d^_[]WVth΋u\~8tU~4~`N4F8 I9rPF1F0F4F8FXHr PEFX^_fUSWV\$"4"4h(C#sP\su "4vhq"Pyu "4jc"4Jmx &蹶'?c.5"4芓hq"PUyu D]4=D]43C#t]#l$PKrt Pu|Qߋ<-t<+u{uNh &SxtGSM16kh8C#q"4t8u)h?C#q"4Pqt "4#hFC#}q"4Pqt "4OC#1="4tjh^C#~FP7֛j觛N="4u0j_`ujjB=#4t!=`]4u="4ujhuC# C1FVV7=\4uh$#503bwu\~jhC#B jM5\4f:0BuK@"4"4!Ѓt4]4#4Bzu=h]4t0譚|h]4jS=]4u T#4=b4~jhC#u j j 6GWVt$ y5#45#4 #4ut[<|=^4t= #4t|2'V1Wu=WSBV蔓WV|$ W(t@jP:tWP\^_t$t$:tjhC#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@9$#4<(#4U5k4q_=X#4u ,#4X#4U=v====,=XAf2 ,#4i\#4`#4d#4F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff fĹ<D$\#4D$L$d$ `#4 d#4D$D$fD$ D$5k41Pj5k4W $#4,^_[]VPhht@j c t1hC#ktP$t$uչՈ%~h#4hC#rkt(P# h#4 h#42 h#4 h#4u.hD#!kt P;#Tƅ~5l#4hC#jtP# l#4 l#4 l#4 l#4P^V[tP=/4t1H Vn^PL$$p#41Qw$& D#M(uMfp#4 xD#4D#+D#"D#D#D#!D#=YÉ$D#/ufp#4'D#ufp#4p#4WV׉vu1=/4u WV賄^_SWVPh*D#iPi1Ʌ 2hژ%uiO&t/4Qh#4lt/4=D#t/4Vy )+#/4@D#/4CD#/46?&/4#/4FD#|/4q"y/4/4/4/4/4/4/4/4~ 4^4+4o%/4tƹ<ӥ#$r#$r#t /4d#gtlj=/4ID#O#4LD#>XD#t /4iD#!sD#t /4=d]4t8="4u/湄D#/4T&/4=/4u /41/4$r#u /4$r#⹤$/4t8u#4/4$r#S&q/4=/4tt8u#4/4$r#r#:/4t8u#4/4$湇D# /4t 8t1@ /4$r#104$r#D#f%VWWh04h04q#y&V504504h04h 04HR#N%V504504h04h04C&N%V504504h 04h04#;tlj=$04#m(04`2&U#$r#$r#tơ/48t,<$1QQPD PW <$Wj@$hD#,04⹩%=2$r#u$r#u$r#/48t2<$ h#4IQjPȁ PW莈<$W2j@$4#S>004# tÉ404#$r#tƹ"=/4u$r#t‰h$r#Ɖ5804>u ;4^_[É⹲$(04z8{lV t<0 1=/4u V|^USWV׋t$$\$l$;Et*+u(N%$r#t D$ L$M^_[]USWVր9tMτtC1H042U5h#4W0{ H041H04U5h#4V{ ;H04|ut$#4^_[]Ë /4h#4USWVL $։ύl$ D$?hD#Wt)?SWUDK D h! VUpz $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$Bxt$4h! VWy L^_[]Ë /4h#4V=h]4t =#4=]4uF /4h#4/48t!/48t=/4u 0041B #4=]4u /4h#4b=]4t /4h#4H<04=T]4t!=h#4|1Fj 2F;5h#4|^Ë 4041B^ 0041B 4041B=<04ug=h]4t =#4uN=]4t /4h#4=]4u /4h#4=]4u /4h#4<04Ã="4"<04Ë ,041BY 804h#4Ht$j5/4} 1B)=L]4tË $049th#4 =H]4jË /4h#4 /41BV=]4404t0041B5@04t-F=/4/4t/41BV^Ã=/4/4t/41B^_%@04t 041B>@04t 041B'@04t 041B@04t 041B@04WVD$ #=$2 lj Ƌ 04j" 04j 04j=]4ttV$ 04j5@04^_WV|$ 1Ʌ<+u OL$ GWvc-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th%VTctrL$PQV t4uRL$xD# $x2P D#T$x D#$x D#w^1JD#^aD$# $2  @049uVD$ T$5$2! щ щ! ‰ 19^Ã=2thD#Ë (041BSWV@΃=2ttD04tVsatx1Cj S*VGV`SP_GVh%P0 D04=D04!VhD#j@W螆WZ@^_[ËD$H04WV92t#֍|$RQjW\1B$52^_Ãw,&ÉfUSWVPt$ P!уtRPtt jhD#jhD#l$$\$|$Q t^tY9uE}㽭4u <Ճt(ˉ $19u tC ;$u~2KՃujh%E#t jhD#jh E#D ^_[]1ۅs IQRP踒fVt$t=2tjh9E#52^á2xy=L04uE P040@#4@u.L04jhNE#?t k4t2Py25"4b+"4V1N=P04t9t/ P04,@wB$@(@1҉,@Ɖ^USWV=2P04@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh`E#1@$qQ52 9D$}P04럃^_[]USWV-P041|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5k4(P04@9@S P041JЅt8=T04u/@u1u0@4@ '[WVP041t[@t @4v P044@0@{!уt RPF1G)t k4t^_USWVP04t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHP049t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë P04t$@(@ ,@1HUSWV5P041H(@$@9t#H1ًP1 u,@;Hs D^4%D$z9tG1؋O1 D$ ~9 $tG#G=]4t @t2x9 @}lh jtH @1HGG7FGF8~FNOG Fx ~,@;GsN+]4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@VJ!ƒ5P04@@2tOD2Q@u;G  )RQ@w u&P040@4@&OD1@l$1tʼn$yjhE#1="4u 2x~OUQPe 5P04@@o<$t0@D$4@=T04tU=^4u#L$ Qh"$ ^4j2=T04t=]4u q=k45P049>tOOHOP045P04wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhE# ;41H^_[]USWVP04ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H2áP04@u1I4@0@Ë9t1JQQ 9u@o P044@0@1@@(@$@,@PPP@F!ƒtjhE#81PPjt$F!1WVP040@4@!΃t@@9} 0@4@^_SV\$t$ 5"4({P04h8@jP04@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjVE!ƒtP04 P04@P5"4vzP04@u@^[SV5P04@  ˀuH9tPQP P dž @vv Hu5P04@uE u@O5P04dž@tV3 1P04P5"4y^[áP04t@1fWV|$t$ t=X04ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVQ-tD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV h$r#j5hJ#lLh14h14h14h14\$ -uF :tjhJ#]jNbt'.t514bt0:wtptcu+14F&jSh14 14jSQ ,uF14141414141414141414141414141414hoJ#J1tPh?J#J1F$2VhJJ#Wh\04P(hSJ#dJVhaJ#Wh`04P ^_[h{J#>JPJj331B thJ#Jƅu&hJ#IƅuhJ#Iƅt]hH#V/su6hE#Vsu$hH#V suhH#Vrt1BE#w1 p}3TA ruƀd04ƀd04ƀd04@=u=X04D$d04SVt$ 14M1ۅuD14;1Cu12(u!=\]4u2 1ۅÉ^[D$d04ËL$=r!=X04tP5\04j hd14Yt'd04u d14e14ud14ESCd14Ãw@d04uQhkJ#VPt$ u 14ESCuw d04u;Vt V5`04B$14xPV@,@d04uPhkJ#V5\04j h14s14^WVD$L$ =X04=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$l&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=X04t'~3P19wKS>~-19s2C,9r9v)CK$SUCuF8AUjVao ɋl$u9tSv bCt1|$jjSOF ~.EFE0uE^_[]V :4t";T2t1FVh14P/ :4p^USWV\$,=X04tV:4tgفuH:4J :4:419*Qh:4~-:45:41E4:4J:4:41E:4=:4u :4 :41҅; <2t҉օt1PS;H*$&= :4+"(:4Шu*%=tS :41:4]^_[]Ét$ :45 :4 2y9414)É 2n1|$ l9} SWh14T@ uԉn$r#t9414VWo]=94=145* 948u!e0 :4$:4tPr $:4%MD$P>-94E˨ -94E :4  :4? ǃ:4^_[] :4] v :4e :494=14v!x ux ;|94=14w% :494< t 948 t :4 :4  :494B594a :4948r  :494=14wx u 94=14\x tQ 94=14.uD$ L$PjQ课 $T$e^_]Ë :41; :4|14á :4t @@@ 11[1PPUSWV="4׉΋$$L$ D$1AyōD$PU/#D$=xh32#UEcUW$ShU|p 0jhAK#U ShUMp D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShULo S[61PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV="4o=82u=h2u =W4P1TAP6@PjVPGTW5|8QZtQL8h"WaÉ4$pu1ND$PV!x#D$ =uhVh4K#a0tP{ƅdո(2Ex uָX2Fx uhAK#h#S_ T$Z ^VUhUK#S:S44$VWWVzĀ^_[]SWVhxK#/P/tt;^_[&h$#VQ61ۅt+hf%V=6tV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u%qK#+iK#Qh#P^ tWhK#v^ Y=82t"hiK#h#v^ V(2=h2t%hqK#h#vk^ VX2^_[^_[USWVPӋl$D$ $uSP\3SS1tD$ t}t8^_[]StV믉h14jPN SPuSqWV948L$ Ƌ94 l#49}I9u94xtWD$94$94V948t,t$<$PD$948uڃ^_SWV 1494$ l#4+ :4|51ۉ|$8tZO\$l#4+:4$9|Ӏ8t-t$|$D$|$D$$8u$14)ȣ94594^V^_[V59414tR94)Ɗ 0@u 2594A=9414":4=14 1@^À=14t89494 2594:41@á948t AUSWVPQ0$1;t.߉WjU $)ډfu $;uƉ^_[]USWVhK#O+hK#@+VhK#P@ Åt^_[]jhK#Wz@ t VhK#Pe@ U uhK#*VhK#P:@ ÅuVhK#W%@ WV9G t'փtPhK#VZ G?G uG^_Ð@:4i ËD$u5Ã<3PhK#USWVD-#4ÅE\$9uz$1ۀ|tisljDDs9u>rjjx D:4D:4$t,tV#hj:} =k4TeuYÃ=k4e4΃e@:4~o6/=X:4u #=:4 t t =^=X:4;:4Ct}.CЃ jS&ed~hh:4 T:4P:4=@:4t @:45=@:4u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=@:4i@:4ihp%jjS\Fc`$&="4 %t#-l25@:4=ES[jUY  xS@:4H݃t =]4-H:4>!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$& 5@:4 hL#9\#49(#49`#4=X:4SX:4C1Ƀ :4|:4ῃ5X:45X:4@:4/U]VsWWr!2@*="4%I:4@:47^4@:4h#jj|:4:4n="4 5T2@:4 }hK#@:4 _gh4%y1PPv^41; P:4H:4 T:4HT:4P:4/="4 @:4%hL#1PP9\#49(#49`#4؉ك u. u.S莍i:45l2@:4%aih%{jVy|:4:4 PZw H:4 *|:4уBЃ@*? !1҃ ƒ!D$Z=X:4,9\#4t 9(#4h 9`#4W jhM#j#t$(VTKOVrlp1BsRtM&="4=@:473H:4ЩuH:4Mj5<2ùe=k4Iv_*-t%+q1҃¹) |:4:4S\B D$t1< :4D$ D$ PD$PD$ P萪 X:4tjD$D$-<{|Q<`ʃ=:4tR D$HL$@븃@|:4|$ ^s 8eB@:4emhL#1PPL!ùe9\#4e9(#4e9`#4e e 1?PS1FP@/|:4Ph$r#5:45X:4虤 1;5P:4T:4|T:4P:4n蔰VVA 1;P:4T:4  T:4P:4|#4'M1PP5#4 =l]4 :4 t|7ػT 1;P:4T:4|T:4P:4蛻=]4P:4u' T:4|5d:45`:4PP:41QQm1;P:4T:4 T:4P:4|#4|C=]4u5d:45`:4P1PP5#4A T:4P:41҉3P5]41;P:4 T:4|T:4P:4]4聺觮5T:45P:4DT5]4J@:4NVhL#h1PP5 ùe9\#4e9(#4e9`#4e e /йSE*re|褹ʭl>4l:41l>4 \]4 p:4\]4 (^4 t:4(^4h^C#Cjjh+L#T:4݋5P:41ɸd9 jhOL#="4t>t5l:4l>4p:4\]4t:4(^4j)eD$t Pj{@eJr蘬 L$Qh"$1;P:4T:4|T:4P:4)O=]4P:4u' T:4|5d:45`:4zMP:4jjP1;P:4T:4|T:4P:4跷ݫjj蟷ūD$<3D$PhK#="4jhK#VR T:4P:4]4 T:4P:4]4P:41ɉ T:4|T:4P:41@Pe(ejhL#e1;P:4T:4|YP:4T:4 諶Ѫ=]4u5d:45`:4Ljj- T:4P:4ʃEݣ]4c T:4P:4]4x:4  x:41; P:4H:4 T:4|T:4P:4q j5<2?P:415x:4"5x:41;P:4 H:4T:4|T:4P:4 j5<2RCiP:41D5x:4=]4t5d:45`:4J1=W T:4iP:4me5"4V?P/V$P:41ɉ T:4|T:4P:41@PuGjhsL#P:41ɉ T:4|T:4P:41@Pk 2V_e!ֹe5]4RPyJ1A诳է T:4P:41҉AQPcMl>4Nnl>4@:4>X`hL#r1PP?ùe9\#4e9(#4e9`#4e e S賁+̲1PP5]4n豲צ1PP5]4jP#'P:4T:4ؽy蟦=]4t5d:45`:4Gjj5P:4d:0ؔP:4T:4艽*Pjj5P:49; eS贔D$D$Ph M#{豱ӡP:41ɉ T:4|T:4P:41@P"etbt3tFu j11A; P:4T:48L#|$r#L$Qh@L#11%P:41ɉ T:4|T:4P:41@P'"e11A; P:4T:48L#|$r#L$Qh`L#je5"4<h$#P5"41=tjhL#o5l2@:4nvh%1SVUh蠻Ag5"4rSPx]]4 l#4݉P:4 T:4l>49‰}P:45T:4)‰l>4;4e]4 l#4P:4 T:4l>4;4i1T:4P:415]4QPHFjhL#H3D$PhL#d ։u=h:4tP:4 T:4h:4e,5h:45P:4tI~V8JjhK#bUSWVP趮ܢGVD$1Ƀɉlj щ t>4p>4T04=k4uH9ljD$u21xUUjn6 9-k4u;=p>4t>4D$tT04 k42t8teue^_[]USWVPӉơH:4uH:41 r4$0utV4$#H:4H:41ESWPO áH:4 H:4 x:4tu1Fx` sKu j]j%u0SW5H:4 áH:4 H:4 x:4ujhM#t 4$4$^_[]WV=2u=h]4t =#4u袬׮t "4"4!ʃt]5#4QY;4u =2uP5T]4=T04T]4T04u _BLE5T]4=T041jPPB ^_SWV|:4߾Yk&t$#@:4/ V+=:4u V@t hM#t u%4%P1;4PP^_[V蛫ơ@:4"~S.#V$^%="4:4VPujh?M#  tY>!t :4t P V!:4="4M:4.h3M#qF<+t< t "4t Qw V菛"4/7E="4V蜭h9M#Pt% ="4V^XP:4^(N5P:4jF5P:4jQP軯^5|:4V5:45X:4X:473H:4H:4PV"4h3M#h$r#r^SV H:4t s7@:4ZbH:4shEM#iH:4 shPM#QH:4 sh\M#9H:4thhM##H:4 shrM# H:4fyh}M#H:41Ct$‰sShM#jV4VH:4CuϹ"tH% sM#Q;4^[fD$=X04t@WV|$ Wjeƅ~WhVl ^_USWVt$0l$(|$$t U# ,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD X04H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t W! WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f :4 :4 :4 :4USWVi $AD$)< u?FP貛^tP8 9~qN#ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp2hhh2hM#htjPV# jhM#hM#hŋtjhM#hM#hjhM#hM#hŋtjhN#hN#h^Vt$ t:j j tL$HΉp :4:4jhN#荞^Vt$ t:j j tL$HΉp :4:4jh4N#H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃV 1H^_[]hYN# t8tMjQP[ ƅuhK#t98t4jhiN#P/ ǍEjPW We iUUUSWVP1F="4jt$NP#19jV6 n1PPPS!ƒJVWS譄 <$S迅11 ?$:81xM'x+xG1O|E(|n|dȃ|$:4t:4Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW S|1N^_[]4$e |t|uVP11xtɉSWVh:4t$b<ƅui\$h:4e5:4PSh:4I5:4P|:4t:4h:45:4p^_[ËT$ :4t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=]4ÃB1ۃ=]4ÃCɍH9 h#4~Pj#|k;4SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=]4ÃB61ۃ=]4ÃC%|$mu9h#4~HPj#j;4؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$P V0ʼnPD$X9vpG$11Ʌu2~>9sWt$V t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWTV19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQ[^t1=$^4ƃtEuG%t|QhO#hh#0&AVh"$6 Eu ?=u Qh"P#$ u 覣!ƒtVHQhP#^Ã=$^4t$"4tPP&t5"4ËD$t5"4PF$1PUSWVu195"4O"4t_jP%="4tJtWg%W"="4u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =]4uID$xAPt4D$8\$PhN#FًT$WVt$j 1@t="4jWd$5"4t$V$t$5"4g$5"4$h"45"4##4t$ t$ ۨ8^4= ^4111k4D$4PD$,$jUuWPW8 Uڃ,$C^_[]SVt$ h$#V1Ct'h^C#VthN#V1ۅÉ^[WV$ VtVWV/tWt^_USWV 1=]4]="4Pj\h"L#1Ƌ|$ 11@L|uM@-u)Fh$#W7)1%tuQ%t s@AAۃ\$WVW؃D$jPtWVt$PW臵 "Su 1tXt^~u1O\$$D$jPW'd uQD$P4D$(0$#^jhP#4|1 ^_[]ÉOV F;t;VE1|$rɅuŋD$(N#1O;PrS貴 USWV="4t^_[]j荈hP#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jhP#U{PljD$UVtWiS\$Z,8jUHrS\$SVUP 4$ʳ S \W诳 VD V|V$p#N@ |^WV|$=]4taPWp1=]4#D$=Wm*jP`qWPhP2LPW@px#D$=@{WjPqWPUh@2Vo WoƉ|^_V|$PV x D$XT$\1jPPV|^UWV蒊lj5"4# QPxot1GL$ T$3:43 :41@ u,L$3 :4$3:4 u!tL$\9|$X}e^_]ø'Q#Vt$V9vHx/uAΉ^fVn ;41ы5;41 u^ã;4 ;4=H]4t^6~^P~SWV1ۃ=T04t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=;4t;4USWV-^4~ON}=^4~Q111SWuljӉ:}qF;5^4|؃=^4' =^41=^4|=h#4111;5^4| V|ljՉ!<$=^4FD$1;^4ál#4D$ /4D$l>4D$$l#41/4l>4PPSUt$ ljՋD$ l#4D$/4D$l>49pt$j pF1Mh#4H91Z{1@^_[]Vh 2F;5^4uj{ t j2^USWV\$,=;4t;4&|$$t$ l$h#4t  $9~ |]4$x 9} H9$!tT=4^4t ]4tC8;41҃=T04TRQPWV脘WV Ɖ1ND$(D$<$=T]4t7h#4H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=T]4tzmz1@D$/1@D$=|2uu=2t hTQ#\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|2 "4t)!u =T]4u=\4u;4=\4t Xm;49l$"h#4HPj-|1Ot1E1=^4~1VV|{~ VVVD5 -T04t <$tw y|2j@ ^_[]USWV=;4t;441=;4u!x]4y=T]4t h#4'|$t$;D$||$$t D$9h#4~ =^4É!tF=4^4t ]4t08;4,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=;4táx]4y=T]4t h#4ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]Åth#4HPjytm=T04tPay1u11FUvUVRPVjv!уu k4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V h#4~&111RP!уtF h#49| 1 h#419^fVt$tsVGF95"4u#1=2tu1Ɂ2tщ "4AF=2tH ;4v 表 v薨 ^鍨 ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12tá;4USWV\$S@Nj522tv W 6Wק |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@;4VEESËnU9Ë\$sU) SKeFW 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P? w0^_ËD$@0ÐUSWV$|$41ۉl$|$I|$tJ |Ɖk4uEx tu|$t${ʼnh]41FÃ=]4tt t uW{ʼnw t t uw uQ1{ʼnFR l>4IC)݃1l$|$#,$!tD{ʼn)݃11ۃ|$ t =]4t"{RPj F |$  jPV# \$St$V}y=]4t%$ЉWUt$ t$Pt$W=p]4t)|$ t"v t uk4t&1M$^_[]Ãt~$^_[][zUSWV։ $Q1۽t+L$ D$!ʽtjjQPVt$}ʼnt$|$0t$,HQtjjWVt$8t$8}Å u> <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=l>4jjPWV^_USWV,T$Dl$@ظBӃ=4^4t  ]4t08;4 @1)ʉ|ЉjSUQP虊كQP4v=p]4tK uu|| t u+| t uk4ttk4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+tk4ǃ݃ tkwRPW v=]4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N l>4 CfN =l>4=]4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1h]4l$t$1E1!1M,^_[]Ã=]4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjhdQ#c^_[uƉסh#4HPLi11 u^_[8iWV!Ӌ h#4It*QRP4 h#4HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhR#bKy1V[hVjRPUo=]4jusj'hD$ jhD$T$l$ !Ѓtd9}\h#4H94$SW!уRPvlj9Љ $Ah#4H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$h#41VVjt$t$PY95]4^_[]1K16-;4-;4h#4H $)QUjSWP(1K[6=T]4tf"g15;4SW=gh#4HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9,;4QU#>$4,$tt=t|<9,;4|wC^w \$D$ShU#jW$4,$*U#f9,;4u+9,;4}9,;4t9,;4hu_G t t1"~#ut|\tt t tL@?3~|$j=Wԡ9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuU#$r#6$4t$ t t_G칒U#$r#$40tUPctuU#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQV$;4^_[]SWV׉Ή5(;45 ;4h}U#hSd=w )WVRQG$;4S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl2 t^0;40;41;4JtGtO GO 0;41;4l2 t0;4u0;4^_[]ÍZ w6$'tEGЃTZ$'btPeu>f0;4랄tGOm>2#놃>4#w>^&h>`2&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]0;41;4d   >0;4 0;4 1;42;46;4RhU#jh0;4U#0;4_t>$r#vVhU#<=4P+t <=4Ւ"hV#蹻@=4Pt @=4V#jVLD=4jVLH=458;4h=4h=41=4PҎ $u>4^1|$á>4 >4SL=41=4P=4 D=4H=4 P=4P=4@P=4;L=4|1ۉ>4>4>4>4 >4$>4(>4,>40>44>48>4<>4@>41H >4>4h=4#h=4=4P $u>4[USWV\$0l$,1=]4uSUƉס]4 ^4SU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| @>4=]4tU t@>4=4Z=4T=4l=4]4 =49}Q=4ƁT=4 l=4ك=]4WV^! tt$j VRP)NV.1 ]4)~$=4r5=4ƂT=4 l=4Iu܅~+1ɊT 5=4~==4T=4l=4A9uס=4H =4ƀT=4 l=4=4>4^_[]Ë ]4t ]4=]4t1]4@V5L=4P=49}9 H=4<u"D=40Ph=4 H=4P=4F9|Ӌ5L=45P=4=4>4^SWVt$\$u$D$0j?oP/=X04t&v!Ss1҅ SVqt1҃Pn1҅t$StP=4~- H=4Vt[uH=4 P=4LV3Zt P=4t> H=4VtV[t'i=X04tVs1҅ƒK1JFVY# /4#/4#5/4#/4‰^_[QY# /4#/4ʉ# /4#/4áP=4D>4>4H>4áD>4P=4H>4>4ËL$1wQ5<=4x1SVt$ 1ۃw)V5<=4RuV5@=4?1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJ1V#9u!B1@uDA;1A+u%uVt1@^ÃwV5<=4_u߸ع#L$1uj jE1ɉHHo SWV=0>4 u|$t$\$t-1 |15T>45P>4tm1@Z ug0^4t \]4uU=(>4~+\>4 X>4\@`>4(>40>45P>4=T>410>4=X04 (>4%=ua`>4P`>4d>419Rhd>4bmhd>4md>45\>45X>4\>4 X>4H `>4(>4u"`>4d>4x,1WV=X04t `>41At^_[ÉШu-%=tS0l(>4=\>45X>4뢋\>4 X>4`>4(>4USWVӋl$,|$( >4=]4x>4uBu>%j jzC1҉PPx>48>4 >4 >4twQPl'UWS x>4xt<>4Ph=4蔅1x>4 >4u+(^4t\]4A\$l$͉=X041؋5P=4D=4 >4Rk5P=4UWS% 65x>4˃ x>4=4PV軄>4@=4VP诅V荄 >4AVUUUЍ@@>4>4 l>49}oh=4藅ơ>4 l>4Y$gQVlu&D=4P=4PjVPm$>4$#5D=4=49|P=4l$ EVjUek L$ )v %uh=4蚃5x>4节 x>4 P=4; L=4 5D=4|tq=H=40jf jH=49u"_l$\$u4Шx$_l$\$u$5D=4 _ ‰$ u*,^4t =\]4uKuG ڃ^_[]X04m_uiud1UWj>4+=4 t28;491J$;<;4} qɉы4@;4)t _D=4\$ PjSi 1EL$D=4) P=4PjS`i ǡH=4 P=4tW4V)>4~Z$>4t\ [5x2)Й)֋$F UWhp% N1 >4E1- >4$_PdtUW ]X04t6=]4t-QdtQd UWl $UWS t1@1^_[]SWV=`>4~4։1d>4Pd VW u C;`>4|1`>4)^_[Ã=(>4~\>4 X>4(>41WV=(>4~\>4 X>4m(>4|$t$ =0>4uu 15T>45P>4itb=]4tY>4l#49>4|>4>4>4P=4Al#4 >4H9>4}]4 j ]4]4jf=^4>4tL@>4tBx >4 l#49}; j,>4P >4 l#49}@>4ы >4 l#49|L=/4tC/4„u0=]4t't4|$t- 1j1j 1j5P=4958;4 uD=40H=4^_V=]4uajm5<=4tMȺj9D#Fu=<>4u"Ⱥj>V#Fu^SWV։ˋ=P=4GP=49=8;4 uD=48H=44D$ >4; >4~~ >4P=4>4 >4^_[SWVL=4 P=49}1T$5H=4ׁtu Ӊ P=4@9|^_[ËD$L$ T=4l=4VD$ L$=,>4u=]4ttNI1҉ tK1G=49~l=4T=4+5L=4)΋ H=4 D=40 ~^,>4>4USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8k4u/8;4H9| Qu@D=48GO1H^_[]cS D=49t D=4Mtۉ>?SUSWV-8;4\-jSs jSs DžtVtRU5D=4V; H=4UPW& U~z 5D=4pz 5D=4=H=48;41t WMz 1Gt V=z ^_[]USWVL$D$ʃQPO1H…t$=8;4D=4D8OlV tnk4uc~D=4>-8;4u@D=4 (I=8;49rHŠIJD=49s=8;4)\8OVà uQL$ t D=4t=8;491H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= Vx 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15l>41Kl>4|EtESSP tl>4@ԋ=P=49=8;4 4^_[]USWV=l#4l#4jD=h#4~AƉ!ӹt111CRVƋ >49;h#4} C!Љ̓uԉ=l#4)|^_[]SWVL$M1Nx@Nj\$S让@ w+;t1PPSE t2SP1^_[V=]4t'ʁt1|21I9@uzu)u>uS1Hte1ɺ|2:tWAuN1|21I:t?@u21|21I:t%@u1|21I:t @u^ËL$H1Ʌx 2USWV։Q蜨@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=]4u1@$5>4+5>4~1; l#4^USWV։L$|$0\$,Ѓt$>4!t6tC؃T$RjQPWSQ=^4=8>41ۀ=4>4tw4$4>4 >4ىȺVUUUЍ@)I=4~4,I=41E 8Vt$0j* G;}|Cu4$SG @>4tf t>4p>4!Ƴttt$,9} 5p>4=t>44>41ۃtQD=4 P=4T$ 1ۅ~&L$ PjQ\ P=4~H=4\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E>4;l>4uX>4# >4uD$,>4= >4==4~01=4 8jG;==4|h=4t>4;>4~<$~>4 P=4 >4$>4~1 ;j_G9u>41;l>4uD$Ph=4tP=4 L=49~~51ɋD=44*1 H=4444A; L=4|١P=4) $ >4P=4 >4; l>4~(]4 j>4H>4;l>4؉^_[]WV|$t$ =]4u1WVP PV WVt1@1^_Ð>4H ȁDW4r1DW4W4>4W4dW4W4 W4 W4W4W4W4W4W4W4USWVL$0D$,l$$W4$W4W4t-9Br }$r1z3|$( HW4u$$rW4t :=W4W4W4<$:rBJ jl$(jWW4tC:W4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?W4t_ )ϋ,$]}W4tW4tV+BJ NF=W4uW-W4MEu$9ˉ|-W4],$ϋ=W4t sKӋ$JHJ^_[]USWV1=]4tD|$(T$$!t3|0W4W4=W4t'9PH }=W4u11CŋE1ЋM 1 u ]u,W4W4W4EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}k4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[k4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVStW4 11؉^_[]Ã=W4xÃ=]4u ;41]4Ph>V#4VW4xNH W4d|@W4* W45W49|jhVV#z5W4^USWV|$ l$1ɃW4W4tKC9⻌W4W41 W41 5W4v vB1IʅI~nVv 4$9ʼn1I1PPt$R9k4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$Rk4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=h#4~%GW8É!Ѓu O;=h#4|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhQ#2>41111ۉu WVSU1PPWV+k4u Ɖ!Ѓu>4^_[]WVT$D$ = ^4t 5^41)|щƉ^_fUSWV t$ >-uF(s7h%+V+h2#+艣D$1S6]+S)S\^SSjy Wh#À8t>tkV聪tmSʼnD$$U $ȃ$jP'袷t$PSh?%t$U|t$Ai  Sa'Ņu>tVhq"F'U*Ui jWW1FVJ]V'D$$t*P*hoV#y*/j ))3;4t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhV#.1N\$h"S4h%Q)SH)h2#;)3(1S|&S[jj 迦1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSjhV#1KtL tGf;t=ËFHN~ ;F~à tQu VS<V1Vj ԥ1GWZWg%e1=;4VZ^_[]fSWV1W41K4t 5u'#ar'G__ _Gt Pe GF6u^_[ËL$ 1ɅV-$t:\4'W.t7^uM"4\41\4\4\4"4 ]4\41\4\4 \4\4t Pb \4Fu,~1S薺PW豺Fvb ^F~ ^v;"4t PNu VSWh ^_[ËL$t@;"4tjhV#x)1HËA QUSWVD$T$1ɾW4="49~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9\4u \4\4uUSWV\$SκƋ\4t@PPV迕u\4\4a Dž\4Wua u^_[]USWV=]4|$,t$0h#Wp l$\4\4!ʃtWj UQP"\4u\4 h$#V t\4VU\4PhV#Wu^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=h#49Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P_  $FQF^_[]V="4tjhV#&dt$D$tt/uKV"4;m?u7=2xCjh3W#뵃=2x%"4QhZW#l&^jhW#jhNW#{Vơ"4t P_ VޣP"4V^ 5"4蛙 ^3"4VD$$L$ t tC8.@L$$VhVh&Q 2>jhhW#2xxPhW#j V菷V趐||P|0tB D$0PhW#;D$$VhVh&P >t.jh~W#1]4L$QhW#$^ã]42V2x$ h#41Vh@BVPRQ_]4^VD$$L$ t tC8.@L$$Vh#Q 2>jhW#2xxPhW#j VVV}||P|0tB D$0Ph+X#;D$$Vh#P >t.jhW#1]4L$QhX##^ã]42V2x$ l#41Vh@BVPRQ&]4^V|$u%t$jVt0PhOX#N#^V|$u%t$jV؇t0PhlX##^SWVD$L$tP\4p="4tjhX#"VP>PR Zt V踘)X!ЃtV谕5]4SW? ^_[VD$L$tt\uoPe03_Pơ03t=(3t P[ VӟP03VZ 03QhX#!^V|$uJt$ =D]4tV"4-\4hH%_V_h@^^WVD$t t0t$b4l7=tDMtGhuXF 3PX]4b4Qh"$5!Emtwt su!FF3Fb4Fb4F$37Y V^_D$u5]46Ã|$"7VD$Hs^\jhX#7<3V)h͵$&PhX#hX#V艋;3xu'hY#h=Y#haY#hY#hY#hZ#h7<wVȃ=]4utjhZ#$FVPMy0PhZ#^_ÉPhkZ#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;8;4~<;4A9s } uE9u9t},u E&| t28;4+4;4x2 ^_[]WVD$Pt t*$TV詈PVLD$ps D$ stopD$Tab =t2|i1Gt$rVafD,VQ4<;4h&r#Pw7 G;=t2|V%D andD theDen t$V5x2hZ#P'7 0Ph"$D^_à D$t t+uyL$tJQtQytWjhZ#Mà$2L$%2AAD$Ph[#!%1%2$2$2%2 $2%2 V D$t t]D$t$jhS_$QVP46h$#V讈t5>t ]4 $]48]4tP9]4$#L$Qh[#O ^ËD$Hsjh5[#/Åu "4Ã|$u=]4D$u =]4~GT]4ÃD$ u)=]4| PhF[#]4ÃD$ u)=]4| Phs[#]4D$u"=]4t="4t*!ƒÃD$ t t%uCD$ 2^u2@t+$2"2P7Qh[#V D$,L$(t tC1ɉ ^4 ^48,uT@L$,t$Vh|$Ql >tejh[#Ot$5^45^4hG$jV脫0Ph[##t$D$,Vh|$P >tjh[#9 ^ã^4^4D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$'d~&s wR$'s wU$'gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G^41 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh&\#1QZS^4^[ÍD$Ph \#҃=]4=^4=^4Ë ]41 h#4+^4t$4Ph}]#h\41 \4USWVl$,H ]4t&AUjQD$}ol$,7F]$'|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph}]#h\40 \4FVEŅ8D$EH$` 'E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=D]4nAL$,9 ItIT$uWoD$,7\4j+o2Ph}]#\4VN/ T$jV%D$,|$?+"4t PsM GP "4CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WM |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh]4P ]4I]4^_[]É|$|$ u D$Phc\# D$Ph\#͉-]4ōD$8Ph9\#uA0h|]#j*h]4eËI1Ph]#j*h]4JUSWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph]#=j UQ xt-u)%tt0Ph]#1H^_[]SWV9toӉQ}@jP ljtG\$=]4t <\u ~t F <$t)\tPSXt GFFuD$Qh]#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$]4Ph\#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hp#3rtPM~31@USWV\$(|$$1E=<^4uh@^4觹?<^4k49<$l$D$l$ =^4t=>4t=]4u3=t^4ubPjD$P1 D$tD 29PaHD$=T04t=^4tft$,SW <^4=T04u"t18^4@8^4| j=y!΅88#1Hpt9=k4tt^4[1<^4D$ D$D$$PD$Pj: 9=k4t k4t, k4<^4^_[]øjh@^4UVVVe^]USWV\$0\ SuVt,jUVSh:7#UP詛^_[]Vt$Vh\ uVh"p#hu^4# u^4^USWV D$0щL$l$ |$$t$4PWU ƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWV) Ջ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$S׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WPYÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWi)$l$D$ ׋ $D$ՋD$1PPU\$Syыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPe^]fSWVPk4t ;4Z1^4WP(t>1C4$$^4u V WSCu ^_[S=b4tb4 \$3=b4r 3H 3b4[V53^4t(^43VP53 9t ;4^Vt$53^Ã=b4tb4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVoي,p#O u݃|$0xG-Wt$8f ^_[]USWV\$8T$0t$,11|$GUSRVnي,p#O u݃|$0xG-Wt$8 ^_[]SWV|$(L$$\$ 1Ѝt$F,p#NuxF-VQ認^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$Pk ƃ^_[]WV t$RVQ t|$P3GuVqk^_9Hw @sÃtP=USWVPt$|$b4V<$=]4uԇTh=/4 pV#Vt$ P]Eu /448JMp;5l#4| ;4^_[]VWj .^_[]ËL$T$$r#PPh=p# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFub4^_[]WVt$|$ zt!2Ph\p#PhVp#$r#PPh=p# ^_WV|$t$ t%WVra7ft=l#4 ;4 j Qu jF^_fUSWV\$l$=]4u<؉%t1Uh1GWP?[PW1WPPUVd[1 jj1="41Ƀ=k4HPVWR Åt!W5 |$t8jhtp#'D$ tPnZD$ 05 D$ 89t V5 ^_[]Vt$tP.Z65 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQev ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u fD$E ʀ[} ]4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]øaa&fL$tt"u$ h#4h#4HI h#4Ib4ʋTUSWVD$T$ h#45b4|1Gll\G9uTD^_[]SWVD$L$5h#4b4|F|\\|N B^_[áh#4~Ph5b4p USWV h#4; b4b4th!t 1G31K;)1G1I4:tl!GtˉP1  h#4jQJƣb4h#4b4~PhVBp !t\l^_[]USWVPL$\$As h#411H$(uh#41@$1b4<#|tZb44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$b41H; t$z|#=h#4|O1;Ll |C9u^_[]USWV h#4~.b411F1l9޻r G9u1@^_[]USWVL$T$9~1@+5b4A1G1֋l9߻rB9u^_[]ËT$h#4!х1A9HhM '*b4=D]4 't 'P b4h 'b4h '3h ' 3h< '$3USWV \$4j4b4|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$8 '=]4EQ-s4C$ىË $Fw$ '#Fw}$ 'X!уj WRPBBtDt L=]4!15"4h$#P0b1sTu~-]$PuYQA tLу|=RP螽1 $1=j4b47f1=l>4u ÊCCs|,v, l,uȡ#4!ƒtظ:,u5"4资j W5l>4QTу h#45^4n9|$ V5"45"4蛅PtmƉV, +1+5Q ic+Ɖ!уRPUVj4=b4H8 j4H=b4wA5"4kP豄 !уRPaٹ ^4 h#4VQRP\g "45"4,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/15"4Mj WP j W1P9@"@|b4$r#9 j4t b4$r# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5]4Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^53~V5X]41=D]4tȉt 3b40A#4^5$3'SWVQ[Njj4عj49r Ѝj4WVS6 ;j4;^_[VQ!уu$x h#4H9}FV!уtt^^Ð1j4j4j4j4WV|$ =;4t5j4tZ=04ta=h#4|<1W!уtRP虆Ws@Gh#4H9|vuj4覍5j4^_USWV 22D$L$!ȃ2D$2D$ 1H2222=04=;4t4$=h#4|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$h#4H9|u $u^_[]Ã^_[]鍌^_[]Tj4K|$thj4m=j4t1=j4j4j jhp#"V΋At P% FVC^hj4SWVt$>t_w % W% ߅u1F FF1Hj4j4j4j4^_[hj4SWVQ1u(\$|$j4St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-j4Vt;xH|p$x Hȅu^_SWV|$t$u;j4Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=]4uH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^j4U1tHt$ !t Q9y}1I(t(t$=4^4tT$$1=j4uȅt^_[]hj4j4=4^4tUWVjW7!t"j]jRPWV je^_]Ã=j4u ]4k4j4d j4Vj5<2t2j4jVx 1F=4^4u=j4u@11N^USWV(U ]1Nt$ t$tr:tm1j4PSi( 4^41 ]4t)1V5j4hj4 4^4]4ttxq @3j4 4^4t =]4tj)4^4u=j4tj49j4J\$tP1ػ&!Ѓ1ojhp#D$Pj@t$>SD$$PL$Qt$Tt$V>k4$u:j4 j4!ƒt&9L$L$|D$;j4D$j4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$dj4T$X/ t$ t$  \$(T$_CtN4$jjD$xP$Pt$4t$5j45j42$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$: V1 T$1H#E t0E t L$PL$THD$$e^_[]Ã=4^4u?hj4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ l>4L$l>4L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$l>4}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8l>4;4t$ t$  }tEL$L$H1USWV8=j4j45j4j4D$$8u=k4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}j4 j4ȉT$!Ѓtsu!9t$ƄuYj45j4;t$T$$|@Ut$ 9D$ЉʋD$4$8;4@Ehj4hj4}!8;4 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># j4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=j4j4!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$j4 j4!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ j4D$j4D$$j4D$ j4e^_[]1JЋ4$|$9ωL$}@D$ 8;4 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=k4 USWVt$hj4tH>tC\$1EjU1GGGUSxLk4G=k4-5k4t~'V$ uk4;4^_[]W USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5j4jjSt$DPV5j45j4s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9 =s4Ӏ"\$\$s4хu$4P(*t tD$HL$ uf=3tGWh%r#qO\$D$)É;L3JSD$P$8T 9ths#3s4D$D$ t$D$)Ƌ$0tVPW  9t hs#f=3t!j+D$ T$RPh)r# hhq4Vj  jh\t45q4覡 t$Vi3W^_[]WVjPh t4hr#% t h\k4h t4Hrhs#&}u \k4`k4`k4PhhP x1Ɖ5\k4hr#hWnLh#r#VW b5`k4hq#M^_USWV1L$\$1Eފ t uFt1\>t t tG1҃Єtt>D><>u^_[]'#1@s4Phk4hUSWV T$(\$$t$ 1`3PURS#)ˉ<à uVh"$Lt$|$u u)u%u!1ɃtsQl3Ph"s#Lt Dht#y^_[]SWV \$ hSh@r## uPths#4 ^_[xEhShq#o# 4$it t$Yj V讠hs#뙿 hZm W053t$S jW0|$Wg[9uR1Vt$4$ܠjShs#LVsBWV|$ 53j/Vt@jWh'Q#QVdO^_1@s4Pj/ÊD$0v3J 0v3;@v3~{у ts (v3Q(v3jPhs4hq#" ths4h32#PMt:j53P? f=3u58q4豪h(v3QPhs4hPr#>JUSWVt$81GWh~z"5q4+ 1-s4ho S.D$hq4SD$U Wh\t45q4! tLtFPFuf=38q4tjQP P۩j!t$4l$0jD$T$1D$EHM~EHMU"ڃÃ=s4uf=|3u0Iڃ% tM 1f=|3@ ЈD$P D$ƒ t|f=|3Qq f=|3uf=3tT$j \$Ct,j Cu\$T$f=|3x댉\$ 넻 $f=3tD$ @D$ Ph%r#Hڃf=3s45l3ijW58q4( s4 s4 u61=s4#$ |39uj5$t hs#{jڀ tf=|3u j ttFPFujÉUt$j+f=3t'+\$|$f=|3)r#tbr#WSP jh\t45q4 hhq4jj(^_[]USWVP\$D$jP58q4 f=31=s45l3jD$P58q4赚 W9=s4ttػ1FU Phr#0FKtMVhXk458q4- =s45l3VD$P58q4A Wh9=s4u^_[]WVjPh t4hyr#% t ^_h\k4h t4Hrhs#yы \k4u `k4Q[h32#PiHtAf=3`k4r#tr#PQhWCWhr#V \WhPr#ELhu j)s4USWV$0v3J 0v3;@v3у  (v3Q(v3t$hVh@r# 1GWh~z"5q4n WS/)Wj$)hq4Sj Wh\t45q4p x>jƉ׉Uv_~*9u$h(v3QJEhs#w11f=3tjd)RPhr# jh\t45q4蜖 1hhq4VWV WVL(WjA(^_[]j58q4vW1Sj (SW(VVhr# CS1:USWV$0v3J 0v3;@v3у  (v3Q(v3t$hVh@r# 1GWh~z"5q4莕 WSO'WjD'hq4Sj4 Wh\t45q4萖 x>jƉ׉U]~*9u$h(v3Q.HEhs#u11f=3tj)RPhr# jh\t45q4輔 1hhq4VWv WVl&Wja&^_[]1W58q4j58q4SWj&WS&VVhr#AWB8USWVPh t#u1GWj%Wj%9mtDƅtZWJ\9uht#t1Vj%Vj|% ^_[]hv3Wjh#hr#Z1SjN%SV?%-3j/U t@SQUD hv3WVh#Fhr#WHWVPjhJK$5q4 f=3t%53>t=q4VPVW 1FVh2#5q4͒ |$VW5q4 ?nu53hr#? ^_VPjPVhs# t=q4u.5 3VyVh s#E?ht#8sP^Vt$j5q4VtVhs#?ht#rEj6WV5,3t)>t$=8q4VPVWϑ jUj{VhVh+s# V3t$3jh3`$5q4l 3u3$3%3t$3t$3f=3t53t$$53f=<3RV#t~"Pn3t$33t43t$3j3t$$3f=3RV#t~"P^WV,|$8V58q4h~"Wt! $#hq4 $ hq4hq41GVW58q4 hhq4Wj8^_WV,t$8W58q4h~"Vk1Ʌ#G OWj58q48^_V1Vh{t 58q4 j/Vhzt 58q4{ ^S\$1uPjP([ESWV|$\$1FtCWPt1^_[fUSWVl$$1tt4`t4$p4%PhP3hmu#t$4U1I~1L$$D$=o48O>HЃ sX 4HЉ5$p4jhP3hmu#t$4U賽߃ufH1K$ '$<tt4뷃EF$<jh"S jh"S h#SD$QPuV$<h|%SOh}#S9zh#S#$_=o4$<(q41@D$<$XD$t4=`t4$<j/S,`t4k<$$YxD$ P1PhPjPP5$<@ $p4L$ !P5$<hu#QT0q4t44q4=$<W6*Sh%h`t4m 1@1H1HD$1@$D$~1HD$$o3)t5|$L$(4hY%V_t5(q40q4t44q4 VjxVjmVjbVjWo45$p4hiv#j V6V4$jh(v3PN#w@ 'P_ D$tu1=o4 1A111ɣ<3 333=t4t 3=0q4t5$p4 uW6uB=0q4u5$p4 u3^_[]xVh%v#Hh}v#Ahnv#:hv#jD5$p4hv#!hu#hu#hDv# hu#hu#jhv3jj@hv#j".hv3jhhv#j.fUSWV,|$@h+ jW^1ۅo4=0q4ho4AQu.j 1=4q4ȍPU8q4j8q4x3=o4u?jP 8q4teQ腋8q4Uh"${o4WŅ?1GVj=o4t1O,^_[]ÉVQ=4q4uL$ @Vj58q4n 1Vh t 58q4x VjM1@o4jho4RPfWVP=p4t 5p4t$uhny#ƅhy#t8/u33y# P Vh3P) %1 '9uQPt$詼 L 'uڃ=$p4u%h$p4h9$t$ u $p4%ht4h%t$޾ u t4=t4j:hy#t$ 1Ʌuǡ`t4u'>/5`t4jV:`t4tt45t40q4t4=$p4u $p4%t4Y1ɉ t4`t4t=tt4utt4t =(q4lj:h]$t$I 1Ʌ t4=0q4u6tt4t=t4tP5`t4 10q45t4j:hS&t$ t 3j:hy&t$ð t 3j:hS>#t$袰 t 3j:hv#t$聰 t 3j:h%t$` t 3j:h~#t$? t 3j:h#t$ t 3j:hU#t$ t 3j:h%t$ܯ t <3j:hf%t$軯 t <3j:h^"t$蚯 t |3j:h]$t$y t 3j:h#t$X t4q4j:h #t$: t 3=t4u t43=t4u t43t4tPh",t4tPh2"t4tPhy&t4tPhq%ht4h.z#t$3 u t4ht4hr#t$ u t4ht4ha0#t$ u t4 5`t45p4p4t%j,V^tA1ɉ5`t4 p4^_Vhy# Vhz#hsy#jttu$Vhy##@hy#hy# @j&fSWV t$ |$6;S p4p4p4+p4h4z#P p4VW8=4q41h p4ō HЉ$p4봡o3)ǃG<1p}3DHu0WE=r$hhmz#`hr#j耳SGhWh(p4 ?t GG?u(q4(p45$p4hz#j V+ WjWjWjWjVtuhnv#h}v#jh(v3hz#`3t ,q4 h#=0q4t53u,u5=0q453{53hz#jPhz# WV?ƿv3Ph:{#W. Vh_{#W}. j#=q4thq4htj jSWV53t>u+t$s4t P Vƣs43h#Vtss4h}#VtahV#VtSh\H%Vteh|%Vt1v3Vh{#W- Wrs4$11ɺ30 ߈s4Bu^_[ñ1WV,|$8V58q4WV肋WVȋ#NF=4q4t L$f=3t D$#$d$d$ wfD$ f=<3t $Vj58q48^_hhq4jj SVPf=3tjot$R 30utztD$=p4„u30u1f=33몈D$< t< u>jV58q4z f=3t|$ 4#t$r#P@]`u 2 <3tu 3tt A8u1f=3t p}3DAt d}3DAD$jV58q4 f=3D$P'/hWأt4NI$ 'Wh6#t4@t4N Q1f~ @t40v3H 0v3t;@v3lh(v3j!#lt4v Wh{#> `Wh6#.t4@t4N tEPPt4V(v3H (v3!6h"$t4#|t4h4#P^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n{#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uhG%SNuW 1@WhljR1^_[SWV31t8ϻ3WPt!CtWPt Cuމ^_[USWV׉A tS^؃H$ 'n tWUtjPu Uk WqF tQfB t Ȳth{#N*N 1?!9~ t~ N 9tF N^_[]h{#fSWV,1f=3t h|#c|$Wh~#!+t%th:# |$ DXf|$rL$I#fw ('L$T$ t$"VRQPh#hď#h#jo~D$f=313hjD$$P, fD$|$<3fD$ $T$3h"$H$'L$f|$#t}#PD$=ufD$L$IL$}1|$D$L$ tp}314/Drt#E9uT$ЃDPhv#?~|$ujjPP诂 jt$t$ VA VhiW u hZ#D$(|$ u,$PD$D$,$|$ 1hSW GG?t$>hSD$$P G$0hSW jl$UW肩 whݒ#h(v35Wh:it$V袿 uO j.h(v3j;Wh:iV] u Cw8)|$##P%)$rkLPD$$PQ $<1|$Vh#t$kL4t4'h/#hF#48~1D=PG9uh#(4 D$4!4"4#4$4%PSWRQt$h\#54(h#!444,40k<SWPRQPh#4`h#h&#4\t h5#t h:#h#'4d6|$1A t$t&u/7t$t nu Qh?#FFL9Mt$ $t$qVHP$t$RVmHh#+Ph#hv3{ jUSWV։1hUS jWSW sUPP~ t'Sh9iP~ tVGĔ^_[]hY)&h#jxUSWV׉1hVU$ jSUإ }VPP~ tAUh:iP uGPh^#hs1FSLGĐ^_[]hY)&jwVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Phv#[^WVhY#Hf>r1D~Ph^&-GH9|j]:^_WVhY#f>r91D>Ph# 9} j:G9|h#^_WV$fGjRWC WhiV脺 t Đ^_hg#jvfUSWVu }6h$r#ji h#VW~ Hw$@'v4v4ԃBu|1PP5$<Tr v4불v4v4v4v4v4v4너v4v4sjh(v3軄_v4S3=o3=v4u.1L$A AAAQj j]D =v4v4v4v4v4v4u31O=tv4$3tch$#VPt^=v4ukjjV6C ƅD$ PV螲D$(!=<\$yB  u3u1PPVB Ɖx\$v46v3=tv45v4PL$Q8B ƅ~E1v4VPS@ i)u5v45v4t$A ƿy5v4h"$ov4u31O=\$t$9ȉQBL$5v4u ύD$ PS=5v4r*V v4Vh#-v4v4v4v4v4V'B3h"$(nv43VA3h#ˋ$B65v49Ph#hv3 1@v4$;u3t=h$#Wt1̜#=v4u32#PW;? \$u3\$=v4 1$ӋFHN~ HVrƒ =v4u u u1G1=v4up=v4u< u7 =v4>h$r#h#h(v3 4v3@t>$@$Ph#h(v3ڃ 4v3@ t_  =v40v3H 0v3;@v3h(v3j$  =v4x0v3H 0v3;@v3h(v3j^k:=v4,0v3H 0v3;@v3h(v3jMڃ(v3H (v3$(v3H (v3^0v3H 0v3!;@v3h(v3jI (v3H (v3I (v3H (v3M0v3H 0v3%;@v3h(v3j-Pڃu!(v3H (v3-p}3DPuW0v3H 0v3;@v3~ƒ t(v3H (v3h(v3Rڃ0v3H 0v3";@v3h(v3j^ڃuv(v3H (v3^?tЃ@Ӌ 0v3Q0v3; @v3~ ȃ t (v3Q(v3Vh(v3P.=F @t5v4h"$Ziv4f 4v3@uiu3\$t VA(u3%u3Wh"$iv41;`h(v3uv4e^_[]hy"j~mh$fUSWV$$0 h$r#jF 11E1D$D$D$D$$׉jh 3h#$ViQ~Hw@$'ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$j$<$ىY1ɉPXuG o3$T:-u"j9uzuI o3 u o3)t u <$u|$uM1ۋD$Ã<$D$ tD$ $4u9>WB uTWh`#D$u5t뢍D$PW6Hu!Whz#Mh+#jGk$1 |$ $jSVy, u hD&P51u8V#1CHHf wy$'|$uhU5Åu뼋ss  PVh:7# |$u.jSUA ss ٣ PVh:7# 1F $tCPpQ|$t KP;AmPsT$Z|$Osh"$e1F7hD&j/j:PPh#hv3jfUSWV$$6M1h$r#Uݟ -z4-z4-z4-z41Ch#VWsq e'H wu$'z4-z4-z4Ńo'filz4뙃prvz4oaz4z4z4%z4-z4-z47z4-z4-z4z4 z4z4z4z4z4z4z4u o3)ǃ=z4z4u-tX1Ƀ=z4=z4tL$H=z4=z4=z4=z4tʉT$4y{4jy{4Pyt$lVUhH3Eu 9rUh#\hH3H3 @3QT$/u>t$|9A@3A @3I3vy/th#h;#jft$ D3Dh j=z4u$PhH3C$PhH3Cu@F8uT\=z4u=z4t@z4 z4t3D$ P6-C1#$=@txUhH3D$ P6zCu6h"$jDf#D$=@uz4 z41ۉ  t1ۀ|$/uhH3h#.t9U蒷r|/u (IHr IH9/touɉt$P{4USWVT$juQ& P0D$1t$CHfw?$H'ss ] PVt$ h:7#2 Psh# >|$(5D3C,H3)=|5TShH3hĖ# t$Vg/1Ga{DuO|$u C(D$?Cj/D$ P-t L$)@L$D$hB#QȷT$CS(L$)ʀ</t ~/t/FD$щT$H3)rPhH3h#t$PV_ L$@3@3=I3vx/u H@3=z4tD$PhH3@D$PhH3O@T$KP3Qt$31 u@T$(3Qt$$3q u.shH3h#{ CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH3h-# 1Gt$#KPqt$1BD$ $l'=z4L$ QP T$ z4 z4sHtbffM 4Q 4T$  {4t$/D$ !=@8fusha# jSt$ V9 1G)=z4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=z4t$tjQ\ 4H 4<{4tICPphH334sh#'D$ PhH3=1u=z4thH3sh" Vf+Åc1G1+8uFV*e^_[]h#hܗ#h6h#h#h?h#i7h"$hD&jT`hH3fWVt$$D$(H0JH(x,z H4x8J z@/uD$PV1/\#X$hSW"` W]t?$ VPh%hWD$PW.u#t VQtMD$PW6/Å(5WVU/PV~t@\$L$/PW^t@L$ Q\$Su)D$ )=|\$=5u=5h(v3蛄Wh#hv3 u3H u3~u3H u3hu3趣É؃t9 t4u3H u3~u3H u3hu3vƒ߃Y=5u#D$=@uWvdW>u8=(5u WV 5 PWQVQV!tW#1ۀ=,5$-5VPWhÙ#hv3jj h#}9D$t$QVPʄ Ƅ fDŽ$.$$PQ^,\$4$9|$ t#t$WPw$ D$Ƅ fDŽ$.$PQ,$3$$3$ $3$$3$  WVh# fD$L$TTPQGËD$L$TTPQ.USWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP̡^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPf^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP蚠^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP4^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQPΟ^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP胟^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP8^_[]USWV |$87h$r#j证 j5t7D$Phht@j] uD$tL 385<5@5]u D5t$41۽h#WVR HσG$'@51H5185l5p5<51H5@5L5P5`5낃w55^5O5@d5105"55@185l5p5X5\5t5d5h5 D5=T5t T5L5551Vx5G|551C+L51H5@5P5<5T5H51@5L51@5L51H5@5P5<555851M55r05c\5X5J185l5p54P51H5@5L5<5o3D$=<5u=P5u =H5thD#_tPL 3=T5u T5x5 L5L$$ ȉD$5 `55 05L$D$ ыt5 T$ L$u1 T$ =5t ŋ$u|$u|$ t+uh|5j-|5 |5=505tL$t*t,uw kL$t;t=u^Z R K( =\5u==X5\ t/ ( ! =\5u=X5 t 5)θ =@5u/ =P5u!{ =L5u=H5 t 5t1AT 3U445 ^_[]GPh#hv3 jUSWV΋\$=h5a t1PSR ~jP1ɉ=t5tW( L݉t$=d5D$WHÉL$ CHHf$'ks ~ PUh:7#e 45{Dt{T.u =D5tw=5uL=5u%sh#߾1TSh# L|$|sh#賾5VWrʼnى=d5ut jSW WEÅ0W 08u ^_[]jhD&j_DWVD$ qH1ftYT$zHftIf t$f tf9t=t5uyDt,RQ51f Duf u RQ^_fu1@fu1HUSWVL$dx5D$ L5u =5D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$P&| PSl$$h:7#t$X 1@F F45Z|$dt~T.u-=D5t"fu=t5uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=L5t-T$$L$(=5t-shM&j $Wv$D$\l$t$0Kjs֓Džt=5tshM&j $U-jsŅtщ|$W;‹L$@D$9ʉT$@l$ UʼnD$<9L$<=5t/h$#sl_ D$TPT$ 9щL$ 1|$PN  à t$P Ct$ Pد=5t +Cl$TUP踯U_ ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=5tD$|t$ |$ n|5ʃQPRWk$RPh"jVJVqD$|=5t$ |$ tHVUUUȉD$|$D$<$$SWh`B$VUU $t$hM&VUöU$=5tDŽ$Mt$4t$4RPVSh#jr6USWVD$PPm,#tƿD> 0v3J 0v3;@v3~у t (v3Q(v3Guh(v3Q=5tXD>0v3J 0v3;@v3~!у t (v3Q(v3Gu7h(v3Q蘵L$D$ ρÃ5T$95}`;L$}XD>0v3J 0v3;@v3~!у t (v3Q(v3Guh(v3Q0v3H 0v3;@v3h(v3j ״(v3H (v3 1D>0v3J 0v3;@v3~!у t (v3Q(v3Guh(v3Qq0v3H 0v3;@v3h(v3j F(v3H (v3 e^_[]SWV΃=5t vrhH%c1TVO^_[SWV΃=5t vhH%1TV^_[Ã=5tATPqh%Z ÃTQh"$HÍ` f w5$'0v3H 0v3;@v3h(v3j@I/0v3H 0v3;@v3h(v3j*0v3H 0v3;@v3h(v3j=k0v3H 0v3;@v3h(v3j%D0v3H 0v3w;@v3oh(v3j|!0v3H 0v3g;@v3_h(v3j/[1@á(v3H (v3@(v3H (v3=֡(v3H (v3%á(v3H (v3|밡(v3H (v3/1á(v3H (v3*USWVl$(}=x5tE G=5t=5t(DG`51 5Í4^69L 3} ^_[]{E ;\ 3~*P55J tM \ 3554FMt%$Q  Qt $ B$Iu$ L 3șƉșD$$t$D$ D$|$1ۋt$=5t( 5 U tt$ ;4$}Z;D$}El$)š0v3H 0v3;@v3h(v3j G(v3H (v3 MuC;\$r0v3H 0v3~(v3H (v3 h(v3j D$@D$;D$ ^_[]j+LUSWVt$~=x5tF G=5t=5t(G`51 5Í,C L 3-9} ^_[][Gșljș|$$.1E  E;|$|60v3H 0v3~(v3H (v3 h(v3j 1V =5t(41;$}D$)á0v3H 0v3;@v3h(v3j 苮(v3H (v3 KuGm=0v3H 0v3~(v3H (v3 h(v3j 2^_[]USWV|$=x5t_ C1ۃ=5t=5t(C=`571F  F0v3H 0v3;@v3h(v3j,蜭(v3H (v3, +N,0v3P0v3; L 3} 0;@v3(h(v3j L;~&(v3H (v3 "(v3H (v3 h(v3j 1W =5t(4_ŋv0v3H 0v3~(v3H (v3 h(v3j 諬^_[]fSWV|$p5W-~t pSP*; t81PWV Vh"$VwK ^_[hu#Wh#j+USWV$U}4(F$$1 |$1 9$)덄$PSUD$Pp] tXǃt-tat$_ ?tL$T$d$.?T$O$E1 $ ;z3r9vL$?T$$$^_[]SWV ΉRQS] 1t4u t|uHth(v3PjSXt V_ lj ^_[fUSWV$$31h$r#W` W<%$ D$D$ hSY%SV2 mu05$<tChPU$WjI 뼃pu D$ 뭃u o3,uk5$<h`#j)#D$=@u.$VtP5 9r*th#j$'|WP: ty/t AƄ/@L$M$D$Sx|/uH9tx/@tj/S~kޅt@VlxL$rSh#1A $'@PVt$ )+ ٍ$Ct1@$Mg4$lwPPhϜ#hv3ƢjL؋5USWV։π=ȋ5ujVt~VWt9臇8uR\$@SVt{SW 9Wh"$1ۀ=Ћ5VWh"舟 VWhǬ#  w=̋5u=jWkuWhћ#H#D$H=@V;9=ԋ5/jV!D$@PVjWuD$1Pt$L#D$2x $r#tp%D$1Pt$\w1Pt$`+yVPSt$D$BPhۛ#hv3#D$H=u}1PPW t$HhV \$D$܋55VCVh#x1C؍e^_[]ÉVh#hv3k u3H u3~u3H u3hu3yvÃtH tC u3I u3~u3Pu3hu3:v u3 tuÃ߉1ۃYM@Vh"$'$܋5S1 5t$|$SPt$ 9 Å11S55t$ 9x߉=؋5t{\$(t$,l$( `&$$L$$D$ l$ |$T$ fT$l$\$l$T$؋5RQPVSt$(t$(h*#hv3՞$5܋555t$ k Å6|$W\$St$uVh%#`SGD$hL$l$JD$pBD$tB D$xBD$|BRWtVh# t$\t$\W 8tVh ##D$HD$Ht$\$ \$D$t$Ph"$VtVh#t$kSb1Vb5܋5t$@t$ЋD$HPW tVh4#*$W t>8-t$VhA# WtV|$W7t Wh#H1ۀ=Ћ5DVt$SWVP׉6jWP t$t-h\#h{#,h\#ho#[1@^_[%tPh\#h# Z6jWP t$thÜ#hÜ#%tPhÜ#1돸d#=Ћ5uj#\#jWVh &Phq"S臝Sh"$jÜ#jVh &h˜#hq"WRWUSWV8` 3t PU` 3155555P53it$L$ 'hjV ` 3%Vh#0jG` 3hhV ` 35hjV ` 3VhK#0jͳ5u 31` 35d 31t~5ttja` 35l 31@5` 35l 31@D#Vh0#0jE` 3t5tj` 3 76tQ` 3h5P[xC 5%= ts=`=@55h}#j許 i~55hk#0j膲5` 3` 351HPhm8@5` 3h` 1ɅA 5-`55\55ˋ 3u\76`76 3v$4'=\76=`76>1jSS5` 3_!ƒux}8f5-`55\5 a1H 33=l5Gt =}r t~=`76`76q˃u#=\76tPWUV ~jWUV tw߿(=`76u `76~~= 3| 318^_[]111RSWV։ωS1 3D$t,t\$W3p04$t$ctjt$E0'Q#1@jt$-0#1PW04$Qt$EjSVV8x^_[h֥# h#h#jVP=` 3x=86 86t}=5ut=86tD86HQP~'Q &P5155$Pj e586h#586輕 586L=5uKh55` 3Wu4# 5=u"`5 \5u55衴5=3w=86t 3~ jPd5` 3 3~jQP 86 86t4=5u+586hM#86586K` 3=5u 5tP155x86t 3 86 86t'=86tG86HQP~Q P5Pj ؗ86x86tZ586hޝ#kuC586 |76x76 u l76h76jhQPgRPh#Vۓ1V586J5P5^USWV=3(v3tv3D$WO+5 5 u1@1ɉ$L$=x863\$5|765x76h#hS%<$t$W5|765x76g$h#RPWh#hV$VSh#hWˎ}WgPW}tf=5t]t$5555h#hV$Vh5h#hW_WgPWj 3u_5P5<$t$WjV/f$h$RPWh#hS$S]Vh̤#hPx86D$= 3OP5D$ #D$5|765x76VSP衍$5l765h76VSP胍l76 h76 x76|764$t$VPQbe$h#RPVh#hS8$S]$QL$Qt$Wt$$hݤ#hP$t$V fPVjT "$PW586h:7#t$e^_[]V~=5u(=| 3~h~V5` 39 | 3~^V51=5uE1jVV5` 3WxRP5` 3 c yAuh#0jd 1N^Ã=5uh#jI&1=5u5865`76hB#j!1HUSWV1|$\$l$WSUk ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5| 3=5t$t$5` 3 ƃu*~35;5`76tc5`76tU5L~ 5?5| 3x5 3h#j, 1s5 3h#0j^_USWVP5| 3|$l$1ۡ` 3$WUt$ ƅ~)tދD$9u55!| 35Hs-Es8 uc1hž#Vh5| 3:~\%tS1jPP5` 3oUx})RP5` 3` yPbr8tDr8t:r8t0Ty:r8t r8u | 31r8Eu | 3xt 515=5uh#j腥`tx>x86Ht)t hz#5 3h#jL 1%hD#jr5 3h!#0j^_[]USWV1N=5=| 3 3uh#j٤5<u5-5sg5l51jWW5` 3SxXͽuWURP荎)jWU5` 3SyQu t#5@5=| 3:h۟#Ff@Phm5` 3"S x| 3h #j1^_[]USWV \$$|$ l$(1uu5| 351jVV5` 3Rx\D$ljT$Ӄ=5D$`5\59L$ujRP5` 3mRx+D$T$EU,=5u#oh?#0j | 31N ^_[]USWV~=| 3$(~$$~5t)ho#j蔢I1u)1ɍ|$h~W5` 3 0|$fGWhm5` 3VQ fD$D$Whm5` 3+Q \$h~S5` 3[ $h~S5` 3< GfD$D$Whm5` 3P | 3t1<$uzfD$D$Whm5` 3P f $ `7611F$$~jQUR( ы$ʉD$ ʋ$$~) h#b1F|?1jPP5` 3Pxg)y11= 3|!hˠ#11Fs1osmh.#RjRP5` 3O1yKOmh#.Cmh#"7mh#+mhV# mh#0jB 1N5| 3~^_[]fD$D$ D$Shm5` 3&O ylt$hA#lt$h#0j٠SWV Vh86jK ylhf#0j袠 jVj ySlh#0jv 1N=55=5=D96u586h#趟=5hl 3W]hd 3W]o 5aXΡ#t# 3#t:#QWPA S8 3d#t2#P586h#h#hע#h#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5555hO#sWh0#T586h#Ah#4hע#'h#<=D96th#j{5 3h#586ḥ#ҝh#ŝ|$h Wf|$.|$t+D$5..L$f tWY= r@h@# h#h#Y586ḥ#Fh#9sWy\Why#5| 3586h"#86 ^_[hm#М5t P& W 5t 515| 3h_#j|53mtt$11Hfhh5eth5X51dhh)#0j臜 1Ht$5hhF#0jX 1HVt$VuhVhZ#0j*^\SWV|$$W6ƃu[g1~tHNtt 9 tu/gPWt#D$=@t vg1N|^_[USWV1Fx86PH{x86P kj%Ɖ+L5Hw> x86SPh5Q@ 85$ <5L$QPh5\h5Cjuh5[jh5^uH=5/u+-Bu"5PmVPh55PI  h(v3WVh5M<4v3@ub85@5 <5 D5QP.t x86P(jh86j xsZ1e^_[]eho#0jՙ USWV ( 3x&, 3kL 39|׋yM1II1T51PQÅy19}WDu=3hѨ#j.hhT5OÅy1ۉ9|( 3x(, 3kLShT5 3y݅u=3tehѨ#j迗T51E$sVhU5T5Ph )؍T51Eh#ji1IkFL 3x86ShT5#1ɉ^_[]USWV D$x86xGD$S5$1F1T5SQ291Cx86hT5h5P$ x86Qu*D$PUhT5Q8 T5tu=3h#j耖t$hU5hT5E $W1CttUtB:x9u=3tFhW#j,WhT5Q19uh#j1H ^_[]h4#th5Q<t P51h}#USWV1Cx86PHx86P yj8Ɖ׃=76t/53}tbh#0j4 e=86t Rrx7t$t4x86P(jh86j lzbV1ۉ؍e^_[]Ít$\$D$L5Hw5 x86VPh5Q@ 85D$ <5L$ h5kWeh5duy=86tSh5t^86 86tSh5h5Ujh5Xt@h5Em85@5 <5 D5QP=5/u+?<u"5PPPh55P[ 86 86tSh5 86tp86|NPWt$h5)6Q=8686D$L;5D$P5Ph58865t@t=86u Pl=3t1L5Hr@tZ tUh5l'9D$X;5D$\5?uD$Ph5$Ã|$=86ut$h5Åx86VSh5P@ =86uSh5/!؃=86\$C=866D$86HQPQ 86=86D$L;5D$P585@5 <5 D5QPDy h5j=86\$^=86Q86HQPQ D$L;5D$P5D$X;5D$\5OPj {86D$u85D$ <5L$ QPp5x53586.85@5 <5 D5QPh5ji\$=D$L;5D$P5Pj ${86USWVj/h5?1Uh5Vt>55h5UcM /tOGh5WUh5h#jjO1N,K|/t1Nuh5h#jj^_[]SWV=x8601F x86t9t71h#jێmQHbx86P R=86t i<x86x t `m#86 86t#586h#586!v 86ujh5^t(85@5 <5 D5QPu1=86th5hxuth5lyx86P(ljgSW, xa86 86t&=86t586hM#2861G*ƃuejh86j ^_[USWV $x86xu d?*1Fx86P,x86@0D$ jD$T$=86jSh59]jh5Q$=86th5~gh5+th52dL5 w's1PP55 $jh5Pƀ=5/u+4u"5PHPh55P =86t4$h5Z' 86t:86|Pt$t$h5s.Ph5086P5h5T$t8=86=8686HQP~dQ cx86L$Qt$5SPD ƉPS?&=86tc=86tZ86HQP~3Q 2Pj u86Ph5%dPj u86D$L$ʃ|QP  <585ʃ|QPxnh5*1C@TPh5Z%V55hf#0jh58ch5)t x86P4 jh86j. =86tn)11Fe^_[]þ5PV$Vb뙉Ph5$뇃=86t cxIxx86PHx11@USWV $$h 586S = u$ /,4ŏ4/t EƄ4/FED$P586#D$=@`1Gxv%xmlxd=86t exRh5!(ttjh86j Gm'1586hަ#j 1GĐ ^_[]T586h#0j҈586h##뻸 )D$ )D$$h5 X86 86tV1=5/5t$PUc ;D$vh5hE#jN _D$PSE5WT&W^jh5Kt'h5K`h5&'VSh5NR xơ86 86tD$Ph5 I=86t586h5+86P5=86tEh5C=8686D$D;5D$H5h5{L5Ht 1PP55脿 $jh5#Pt$h5 Wh5D$P;5D$T57wD$ Ph5;86tk=86tbD$D;5D$H5Nh5h5^^D$D;5D$H5D$P;5D$T5xQ55hf#0j蕅P5WWWh5!Ph5=86e=86X86HQP~ Q Pj go86 D$D;5D$H5UfX76X5\76u x86@\76=~| h~Ph!#thPhR#j蜃1Hã`76 355y x1l76h76 X76\76ʉp76 t76X76X5=3u=\76t4=~| h~Ph#thPh#j1H55 y xX76`76p76t761|76x76X76X5~ 3`76USWV=86thߩ#j艂1I^_[]Ã=\76`76 3u\761IxՋ=p76+=t76|$\$5 3UVSWJl)9|11UV$)݃X76|Jt76 3p76~H5`76Pt76t76;p76r֋ X76 3p76t761)ȉQPx[X76Ɖ5t76 3ȣp76)=x76|76 `761l76h7631h#jWV1N= 3=3uhB#jy1|76x765 35X76Z1 3~9} G{u'Phw#j~ xI1=|76=x765 35X76~ X76 t76x76|76 p761^_ËD$L$t76)ʉt76QPR1  USWVu ]1D$ D$ D$p76 t76)ȉ9؉| t76)։ `76QPVSi)ЍT$RPQ 1ID$L$ )x76 |76|~ p76t76)ЅqxUtX p76t76D$9ؿ|‰t76)ظ|D$L$ 1H1@D$D$e^_[]V1=765 35X76~# X76 t76x76 p76|76V1xC=x86t/x&5|765x765 35X76~761 861H^Vt76;X76v*5p76)QjPG 5t765 3^USWVt$76 76ƒ|]; h76l76}O1hҫ#W}=l76=h76$-X76 3 ( p769)1 -X761ۡ 31PUK; 3tS1l76h76SX76 3p769)QP륉h76 l76Nj-X76S5p76U +t76 3)USh76l76X76 )VQS t76x86Htt861O1^_[]É-t76USWVP\$1~cl$p76$5t76<$)"5 33x3ǡp76$5t769|WUV 5t76)11H^_[]USWVPD$~Z\$ p76 $5t76ŋ<$)Dž~9p76$5t769|WVS 5t76)D$^_[]ËD$)USWV\$ l$؃|~p76D$=t76t$)#5 34x\ơp76D$=t7619|VQWD$ C =t76)Éظ|$1H$$^_[]USWV$  $x$|$D$|=86t7P$#y#G$ hk#0j.{$|r t761Np76)ȅ5 3  t769غ|PQ$> ~|)à t76 t76ظ| uXP$"$3D$8$3L$4 $ hϪ#jUy hx$ h#j5y LE$ h#0j z'E$ hk#0jy111o^_[]USWV$$x$|$$D$x-D$PQ!t"NE4$h#0jny L$|L$1$p0L$1p76 t76)ȅ\$^ t769|4$ST$ RT$RPQ$P~R|$ =86 t76tP;CJ t76)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=86t% u!$9$t4$h##jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=86$4t1PWy#4Chk#0jQw1HD$sD$$P$<b4$tBVh#0jw $l$ l$\$ 5 35X76WL lj\$11ËD$ 9D$D$D$X76}$4$t$ L$ QL$,QWP$PWP$@ ى9u15 35X76$<® ljޅz11 ͉$03x$3|$ uRD$$P$85$3D$\$3L$X $0<$\$t*Wh#<$Whr#jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]"A$0h#0j8u1K<$@<$W$4hM#0j uUSWV|$7t6|>/u/1N=76MWh#js 76.|$tjh WV V $=7676_Shq#VP"W$tzƅE<$8$S x<Shq#P$V$'zyw?0=86t586$h{#Vjs1576$J $y?QhZ#0js1N^_[É;USWV|$?/tGj/P ƳUW賺u/Fj/Vp ƅuhW=86t$$W jW]y3UWEu%D$ PW)jUPWV/Fj/V 1ۅA4t*PWit1K#D$1=@ۉ؃|^_[]/WVD$t$ $P軫yu~=Wh#0j r$tDPwy=$h#0jq$Y 1$76^_USWVD$Et$$^߅tPyN=Wh#0jpq=86t<$8$W 1 86tt)$($u7=76uj76P7676!UW3 3t%1PPL$H$X$T$W$tJSW蓫y!g<SWh#0jpW~v$ 1$76^_[]WVP1uA|$ t$t$W̫ t(586 ;Wh0#0jp1N^_Vt$#D$ PV裫t%586 ;VhN#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=3t =3D$PVնt);Vh#0jKo_=3u&D$DL$HL$$Mbl$L‰T$=3u'D$PL$TL$D$ Mbl$X‰T$WVt6:8Nu} u&WV/u:Vh#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PV褵t%#D$=@uVh׬#jm 1HjW |^_[USWV׉L$]D$PS;t6St$*th~90wwS tՃ} tL1@_1=86uTG3D$ 3L$ uKG3D$O 3L$ u9t$h#jUl 1St$h7#Vj6m1He^_[]ø#D$=@u%hQ%S*tS/0Sr} D8Sh&#0jl댋D$$u1@Ë $jPUWV}wPV1@xN=86t1A$$3L$ $3$ u*0$3L$,$3T$ uVh#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $H'586h+#B)uu=86tlD$PUuZD$ !=uHhWU袣 ƄD$PW裲uD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUeUt$6 4$Uy6L$ t uu$UFD$y)Q8=86us<$8$U xZL$ A$6t$Uh5#0j3j1H=86t2<$8$U Uh{#Wji1ɡ86tt1Ƀ$ !($t($t$$586hޝ#?'jUSxN1=86=3=3Uh#Uh^#j7h 1OD$PU茰x=1$ ?#D$ PU1@=86u;L$ ($/4t$h#0jh$ PU1@Pt$6UK31 3t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW裯1x1K=86t މ|^_[]ø#D$=@u5hQ%W%1EtXWyĉέ#$t Wmy586U#x3WU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5X96T96 P96L96L$T$tI AQP DUVP 9t_L$ xZjPUQҋT$0y@oEP Džt<$\$MQVPw D$8+$T$0)+|$$>h{#jJe* 2t$8h#1t$8hk#0jf1O ^_[]SWV1|$tQ\$1OjWWS,xjh76S y%##\$1SV0je^_[Vt$ xFP%=86t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(肝 ~H111Ã1T |A9uV$P$(M ǀ$1111틴$(3x$3|$ uUP$( xLX$3D$8T$3L$4 uF1VVV$(xE$($\h#0hk#.hͮ#j%c #/$(h#0jc1N|(^_[]V=86t76=86t76=86t@76=76uh 76t01x&=86tDyhQ#jhb1N^WV76tP176761N76t 76tqA76uj1u3H u3~u3H u3hu3tN;4 3u1tB 769G= |+76xx76 PW1t-768j576h76܍ 76&1^_SWV|$tR?tMj L tSƋ\$WH~ </u>ۉ^F=76t%76p!h#j`1Hh#5765761^_[á76t@=86t76=86u0=86t'D$$u76tjP576բ WV=86tB576t;11G~u)uh¯#jA`6h#hv3G vu^_USWV =76u%761N76u76}$ $ $L$P蠕76t#HHf w=$d'phE##"ph#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$pE + 76qhY#0 ph #p j_e=86t\@PL$QL$ Qpp p09Bx876jjt$t$t$t$ph)#p j[_ 761N1 $'LJ$Ƅ  LJ$LJ$=86twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G 76 VqPb  76VqPA 586hޝ#1u76@e^_[]fUSWVT\$tl$h=86P($NT$L$X$1V8$V<$T$r#$r#t4$tVjQjRD$Phs#S.D $u2@$%  RPh#Uh#^|$x$h#SCEPD$Ph%SC$Hs Uh#u# Uh"SC S^X^_[]Sj .SUSWV@L$E\$CD$PS2{3j;9#|#L$QPj@t$Vue^_[]SWVT|$dT$t$X$hS($pWVSh#t[d^_[SWVt$F=u1H|$Pt6t)G\$QjPSB~VSGu܃^_[Ã^_[ܴUSWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V86~1F1u86h#j9W^ÐSWVL$D$t$|$$<76t76tt\^_[O}\1KZ76teSP ti:tdx:o39}j $<@o3sPVW hV76:-u/76È76n7676`S6h#o3=S6h#hv3=?^_[f1Ã=76u1áx860h#jV 76t"H 76p0h#hv3=586h+#pu_sUSWVd|$|j/786t@l$x86h+#P686+#1C|86D96D$ D$1D$$jh 3h´#WUHЃJw$';t$$@$'$<5묡3t 3863r3t c3P=3#\$86! $<k\76 \765]#5J% 3865$<R3t 33\$86t53e|8686L53=86.86 Pt$9 * NL$ $< 76$LF5353535376$<765n$86q5$<[Z 3@K 38$<8-u x5D$ =`86u 8686335z#863765$<WO 86D96s 96d3U86`86?51@D$ )3 L$ ƒ ʺv3t(v3 o386ƒu 9u , l$D$kL 3x8676 86q"1$jh8 3h#WU/~HЃJS$X'4 3ƍHw$@' 96뫅!$<53D96|5n$m86@X86ˀC8615z#"86 $<@Ƀl~mtKotRpd86SatDeJ1A 86 86 3 3 3"386 3@{pe$<5SH863 $< 76761ɉ5$<"]8686$<L$hy jLjh 3Q+x86bl 5$<Vh# V  3486 86@5$< i@865865J%865$<9i $<E \76N86486 $! $< }86865$< =86@86  3%=386(v3 0akG1A11|$<$t86D$tGNutNj]]hG#SW 1t[hl#SC uE7676j576S^ 1AL$y#$]176<$D$h$#S l$\$th32#S03Džu u31 ðt5hl#Sy u376SG I 1urL$tP؅uAJjho#Sr uP76D$t t P CPىQ ؉D$1ES#jt$ S 1AL$"1ED$\$t t P h$#St W=d86<$l$S|$;76,31ɺ G1Fmفt#u41A 03<1A 03!531ɺ.1!# $ 4u x86 3=rnFr0s9-o3D86PMo39}j4NxPo3@o3 3o39 1VV4b xo3@o39| Qh7#j?H 1FPh޳#V(H Vj$5$<h!#h<#jHjD$5$<h~#hh#5$<hM#jG v3Vhc#w%5 3WVa/ 5 3WVQ/ Vh$5$<h!#0h#jjG!j#mh#jCGt$h#jjP$t,(XN8@tUjP$yFD$8UhG#Wu1D$h.D$1$h$#UBth32#U.Džu Ju3tkðtAhl#Stjho#S+ tj1ujSðuh$#Ut W=d86Uhs#l$}$l$hl#WY]tjWB\$rt D$W 3|$ td^_[]á5t8uhE":5t8u5J"UhJ#j E USWV|$H%UWoZUV豼NJ00ht$跩tAtZ/UV/ZUWq488ht$vuYt$h#0jxE1H1^_[]á76t H 76hv3hϸ#覞j WVv31FWVhh#aWVhh7#MWVhh#9WVhh#%V, USWVPˉjPQ: փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Qa$1>tj,VÅtj=Vtmj 茼 tdAE0H@76=76t \86s\86uh(#j6B1O^_[]h<#he#h<#j B4$ ɋD$L$01WV586h|#hv3) t(ο#Ph$hv3a) !uءv3H v3~v3H v3 hv3j ,^_SWVPωPQDMt4Ƌ$| tC$SE t'ǍCPVWS DG d86 d861^_[USWV$t%t_݊M\tS8uEEhV#j@Ej譺 UEƃjSV t3l$hUVPXWUh#j\@S $EE<\t:uCCU貰 $AStRC1fGt,PtStgtstp1B ы$J@u $A=h86tZl86HVV4$ Who#ji? 1H^_[]V{V h# h86 l861VO4$ Wh#USWV\$tK;tFj tLNjl$1pSG woD$G95p86t%t86x!h #j>1Nh!#=p86=t86^_[]WV5p86t;11GFu)uhN#j^>6h#hv3& vu^_USWVp861 l$$=86Kt(=86t!9t)@tB9uKKt8?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=86tGtlD$@1G8D$@1D$\1GEt$ h#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh7#j59tNjE|$tDD$@t:$t$PVhp#hv3VhZ#hv3| $t+Et$h PV蕭 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7?<86v3WVVj辢uD$L$ L$$Vj耱Vj蕢uD$L$ L$$VjWVjluD$L$ L$$Vj.VjCuD$L$ L$$Vjh#踵861969696P 86t$,NFF FF} |$WVjN y|$ujWj6 WVj" y|$ujWj  WVj y|$ujWj WVj y|$ujWj TWVj y|$ujWj (D$,WVj j  WVjV 0=3t3i=)‹1@?9 tR=96t3<$/>3i=)‹1@9 tR 961QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=96ujh=褱 96#t\u#uGW螥 tjxGj jW - />3i=)Ë 96,t 98t#@u $je t!8h $1(Wh#j9- h#hU#j!-^_[]USWVP|$1N=96ujh=觰 96#t\u#uGW~ tjxGj jW 跟 />3i=)Ë 96,t 98t#@u $jh t!8h $1(Wh#j<, h&#h˽#j$,^_[]USWVt$totij/V1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉhJ#j+1H^_[]1j腥 ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjӑS CS>tKt^?tYڃCKt6C;C C})VWh#j*S h#C=96t$96X Vhb#jW* 4Vhо#96961Wh#j** S譴 h+#}VQh#j*USWVPϊۉ$tsp}311JDhu.e[YAuۉ4$Åt>V,FN4A1R113WN1J 4$$'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1= 96u*jh   96uhb#j1(1N^USWV 961Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj膡 Ël$EP $$$KCs{ D$C $C1^_[]Ët$ h 3P  1$$CHC1FwCE3\ SS SH h#j&1NwUSWV 96t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j莚 tx@ LHDh#jY 1^_[]USWV,96CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj| J1ɉHT$, $$$P HN HF F t$1 H;@u ,96-496096096-496Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@096=496l$T$s}ډD$0! umщjt[496=096 tIji t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Phl#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=896u*jh=p 896uh#j1N^WV896t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j( t^t$dtAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W h#jj ^_[]USWV 8961Kt$/>3i=)‹/uPVDžj$y tWWtN$$QVQ4y8~V Q(y,~VIlNF <96F5<963Wh^#!Wh^#j V耥 VhG#j ^_WV5<96t~1F<96=86u~ t v6蚫3 3tWWvvvv 6踫=3t v6ά6 V 5<96u^_jhÀ=@96u1WVL$T$t$ @9611H<>u5Guu%P=D96t@9611@^_V|$ |et$>t\jh)#P t 3=3t#h#j|j 31H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh{#j^_[]SWVh1Njh#Sgu3h#WRu!3u9H96Džu91FWSh#Voh#h#h#V WShK#jL1N^_[USWV\$hSb1N|$1h$UW O$LJ4$<rD ShP96hL96   PhX96hT96  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ׎ 7\ 1D$ereRPQ討 ^_[USWV $ $Hw.$' e| Rh#{=H96x1ۃd|Rh#Q1l$ hVU5 $ jdPU$, $$$Hrjtr$@ L$ D /f@ 0 whq#h#h#h#$F1 $F2 jdPVZ fF0 $j j0PP 76 76t86T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U] $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R t$ h7#$%$ $LJ$m9rD$ )yQj0U 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%hT#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh)#WI t1H^_jhy#W/ u(=D96u\96u\96h#jjUSWVl$hUh1N\$1h$WS K$ǃ4$Yt"Yh PQ蒈 Ǎ A/G<rH )UhP96hL96o   PhX96hT96G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPyEtQQP  ƅ(8$VP~yElQQP˳ 1D$@$$$$$ȃJ-σwY$'<2ǃ$)$Qgtxu,&-u~t6h32#VHDžu'0{ PVhG#jHu31FUW t5Ë$rt$VhZ#j$_Ft1N1u3t W@^_[]fVjh%##:xKh"P蟹h96t)h32#V船l961u;5h96ݼV:=86th%#h#j 1H1^WVPD$$|$t 86t$86 86t"=86thv3j :86v3586h"WW 4$VW Wj  ^_Ph96t$L$T$ $RQP 5h96XSWV|$1N|5l96t,\$OPWS t;j SQ1t^_[SWVPD$ $|$t 86|$t$86 86t"=86th(v3j 986v3586h"SV 4$WS ~V Phe$hv3) hv3j  ^_[fUSWV} u7h$r#ju \$1h$WVq LtPt߃95o3D$h4#ǀƀ8/h2#Vushz#Vua$PVEtKD$PhQ%hEt4$3D$ $3L$ u$3D$$3L$ t1PPƅu j02V;h(v3讛4v3@ujKhy"j?hJPh6#hv3 j USWV$$6ah$r#j 11ChG#VUo e~%q~3كrtރvt_x96ŃV.PtrكRtwftAit96x96뒃Wt6duqp96z96lt96x96W96I|96;uo39|=t96u 1Ĉ^_[] D$h j$D$,$Sh I9v9/u؃@]9v8/@tj/S8t@À;.uCt<.u{t0\$u h#qC\$96EHu]j$8u 96P#j謣96a$8tӋD$t$ VWC 96tRtD$W5=t96u58ts+8?ti!8t_Wh"$`Htj諞 PWh:7# +D$@uDp96u;Wh#W96;;=96uWڀ=t96utV/tD$%=@t/==|96u uWkWx t96 x96х ˉ4=96u Ő=96t@jPt$~% u hQ#7P.u8V-NjGHHf wO$<'=t96WOwP"{jWV: GG \=t96uWOwP:GHftIfgft9G =t96u P莜 PW}G  Gw(wt968=t96uG ?tow  PUh:7# c=|96uO1zuSwdt)t96t 8t18?t' 8ut/wh"$]96V-Dž6=96u =96t96ww 2hD&jbww , PVh:7#jaPh#hv3N j96USWV΀=x96uLVha#hv3 hv3u3H u3u3H u301C=96l$$#E=jR 8D$Pu:>=|96uvVho#1Zhu3袳Ɖt9 t4u3H u3~u3H u3hu3bƒ1ۃYÉ؃^_[]ÍD$x $r#tp%1Pui1PuɴVPWSD$Ph#hv3USWVAӉ΅:#K1jhVh. $ǍD$PWϝ.D$3CL$3 D$(3CL$$3K #D$ =D$WV.1PPPWp D$$h PQ KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PW+ D$L$D$)T$T$ 9D$t;$SV<96Vh"$Z)<96Vh"$YW-1@e^_[](+WB-u1PPPW` uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW* D$L$D$)T$T$ 9D$t1*W,1PPPW趡 h j$Pg KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW:* D$L$D$)T$ T$9D$t)W+j1PPPW Th j$P趺 CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW* ;D$t$$P$!P9 L$)L$L$L$ |$D$ h(W*|1PPPW fCXK\D$L$ȃ|or \$9ËD$| S$PW( 9D$)؋L$D$ظL$|0(W*1USWV\$l$UEtMƊAuA)k')l:6j赸UGG SѸG96<96 l:6t^_[]Ã=p:6t^_[]USWV\$tKƊAuA)k')Ƌ,961Gt?uS׭tmt&uS辭u496jVJ1^_[]ËD$t @ъ@uA)k')96WVt$ >tVG t|$u G?l:6wy wx Wx  l:6u=p:6t^_WVt$ l:61<96t96VPs8uG'u l:6t^_Ã=p:6t^_:USWV|$tWBuA)k')961t(l$sWPtu tC uމ^_[]jt$ }t@1ËD$L$ pqSWVl:6ƍ1P腶1 96tQ:t @ C'u9 l:6u=p:6t)h jVW|~R1ۋph0#)p43HQPP@%3Q C9uW荶^_[h#WV11 96t)96Q:ujPuFȋ G'uƉ^_USWVjB68H B6(11C}t$Ej=Pt)AQUkh:#537(TjUt_Uh0#p(w23HQPP$3Q B6H B6(S UhO#53' u1^_[]VhB#tauj4B6t$1Pc ơB6H B6@u1^fWVP5@:6p}3DBuF.''ut t- 8:6]$d'NF밉jWV輙 L:6H:6 .''j8:6P:61D>G.''uGPVH:6WVP H:68^|~u$PPh#P~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5@:6^_ÊVF|uܹո ѹ Ǹ É)B$:@B.''uVPQhd# fUSWV|$,t$(S脲=8:6jLVlt:xIuxNt@jLPj VK1tE@j P8)=8:65<:65@:6"1,=D:6uƉS;^_[]ù#V=D:6)u ^5<:6Qh#*WV$r#|$ |$wL3 P3 B6>t'F B6QB6RN@>vuڋ7 B6QB6t& @뭅+L3@P15G6VrƉRPh$# 1 ^_USWV8׉ˋ H:6L:6D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh"jVjVt$ % USWV Ջ\$$St$$tƉ׃=D:6%up1҉  ډD$$=D:6&uU1ۉ D$H:6 L:6ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$'  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹J#[#>#wSWVP=G6P:6G6Q5)Ɖ=G6=3ttxt>u{&艰1ۉSPV Ɖo9u$8t*^8u+$t@.'' t$@u^_[ùh#n%USWVPՋ\$St$gƉ׃=D:6uKh$H:6 L:6MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաD:6HwSjP ljաD:6uND$H:6 L:6N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THH:6 L:6N"ىWP1Eكra$"ى=D:6#ÉD:6݅~hD:6 H:62É׃'1HH:6 L:6NLىWP1 1H:6 L:6NىWPÉD:6LH:6 L:6NىWPe$É׍EكwD:6|$4t;~l-D:6b1A1Ǎt$WSh"jVjV5H:60't1I1@1l$QPh"jUjU6  ؉^_[]ù#T#J,#@USWV֋] $t$ơH:6 L:6L$ D$T$uPV֋=D:6Ww,@+'8H+'}uPW ֋=D:6ȃ}tً$VPt$ ֍GwH+';E Qȉe^_[]fUSWVb3$D$ h#t=etuD$ jB60hT:6GVS?S]UR@P谧áT:6)QPSp~ T:6)١B6pQdV PS%$jhK##ƅ<.u 1~.D0t/ua$PhQ%tGPVt6$3D$$3 $ u$$3L$3D$ 1e^]Sh$5t/h$"uB68LtjB68j*5T:6uj=T:653[3f`5T:633HQPP3Q 53 3@u1[h8#[r0{ Phm#AhL#7SWVWϟWPIu2\$Vm 8"u6W蝟WPtVLT:6V1^_[Åuܢ0}z Ph#jT:6tjPh4# hx#ÐUSWVD$ 3fa1Ƀ|$‰tpыLh$S5$thd7#S u 1t$.4NJ]taM\uNEU\rw$$'\0u!11ЃwxAunjt$>3HQPPe 3Q t$.PN    ȉš3HQPP 3Q<$t*3HQPP 3Q 53W 3Hu 1^_[]ÁfHh#jfd:6u.L$ h:6jPV=l:6t p:6K15p:60ppp VPj  95@6t =3ujVdV苞^jpPT$=:6u :6D$ $1APVp:6l:6t1It$aVPL$T$ D$$PD$:6jWVP|$t$D$$腟4$ WWV׉ΡX3t L39ty u hL3 =:6:6u蹝Ph"h`3 =:6t5:6h"h`3 t*t$ Wh`3 x4h%w%h`3xVev Ph"$h`3] 3HQPPj 3Q h`3 ^_SWV|$t$\$YSWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$ӝWY^_PT$D$ $1IP>XËT$1It$)Vf'T$ L$9upu'0fuQhH&j ht:6 t:6@^1:6:6:6:6WV|$ |t|$wL3 P3 B6>t'F B6QB6FN@>vuڋ7 B6QB6t  @:615+L3@Pơ:6PV :6^_USWV\$0t$,|$W̙5G6jVi j=83thƉ؃$1t7=3u.D$0t Nf $uQVi=:6u"W这j螵=83u11EPiWcu :6D$0u^_[]jUSWVL$,|$(306̓VԘ$l'Uw1ۀ=3_=:6Mjw1ۀ=31=:6$=:6jwH1ۀ=3=:6=:6uQ=D6tTjw1ۀ=3=:6=:6t  u8V31tu :61l=D6tUW_j\$0SWh a=D6tWD$,E=D6tt$,WK_=D6tst$,WE\$,SW=D6t@UW=D6t)UWyPh&#e hL3k=D6twww. :6@jw1=:6:6 jwa=:6t :61V谖VuL$,=`E6t l=r3t :6tu u^_[]PNjUSWV@|$T5d:6D$$w=*3tttn F65G6P$Ph6#Gtj P53[ Kȅuhn#53Rl$jUth5d:65h:6jm<$t&4$hhu#[53|$:6\$Xl:6-d:6j wD$ l:6u=p:6tSwl:65d:6j l:6u=p:6t]<$t&4$h#538@^_[]j5d:6USWV\$;s3=*3{ F65G6PP'h6#stj V53 vhJ#u hY#3HQPP3Q 53Vl$l:6ttQu {tF1ۃjU_|Sl$SP~ tuQV{:6Ju l:6u=p:6tjsUsV言:6 l:6u=p:6ttJ=*3tA{t; F65G6PHPh]#539^_[]SWV|$:6jw1=3t :65:6^_[Ë\$1:6u/? :6ut΅tSw5:6:6t"u8:6H :6K:6jw=3tru+:6H :6:61 1@65:6+USWV1=3t5:6|$0D$Pm[thUS- =:6tiD$:6,$\$4>GG6=*3 F6PQPh2"w 3HQPP3Q=u3HQPP3Q 53juw  Sw5:6=3uZ:6t"u*:6H :69:6m"u:6H :6 :6 :65:6D$P襏 ^_[]USWV|$0t$VR@O G6jPw+ _1=:61{t'GG6$pW Wuuޡ:6[tZtT1=:6uI=3u@l$41; u{CG6Us t=:6u =3tʋ-:6-:6V譎 ^_[]USWV\$K1t@ l:6PSwƋk1OuD$}t 1{PuVy uR l:6u=p:6t~ jW|$x4$ jt$jux W<$t$mE{t V[v1 Vh{:6 l:6u=p:6tA^_[]Åx W{賏0Tg Ph#USWV$$D$1t$ E6D$$E6D$DE6D$Ht$05:6$P辌5:6EG6L$XIEtH1F\$XljtwuGG6hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjGG6w誸tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P$D$XtH$r4$ ȅu$1ɉL$@=3t=:6u|$ ~ $@D$@D$ )$=*3 F65G6PDPl$41dz=u)3HQPP3Q9}j=WXƉt>u#3HQPP03QFPU 1Ո`1t$XtOË$t)3HQPP3Qv É΅u$u t(PV53 مt ȋN΅uء3HQPPS3Q 53|$ +t$4~jh'WQ} u|$$ƅuf|$# L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$-8 fD$D$# f=D6t*fsD$=` t= u ft$}u$D$@f%Lu D$l:6jU[qD$,ED$D$tD$L$` =z3u f|$t$Ut$4r t@:6|$D$D$`t$dD$,F L$l:6=p:6tYD$t;=:6ul:6=p:6t.t$`qjt$hL$D$Hs*|$# toD$ t$,t:6.u D$ 1@t$,ol:6=p:6  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]F6D$(F6:6=<NjD$ d:6? D$(F6=:6:6Y1PPW 1ɅȉD$PPVB6\$pfB6D$ HB6$B61B6l:6 F6L$( :6L$LF6D$D$hP l:6u=p:6t$jV貹0d:6D$ 5d:6|$t&D$1f|$tH E6E6$:6h t$8:6H :6=t$L$QPy :6l:6t$D$(F6D$DE6D$HE6D$L:6hB6B6t$pD$ d:6|$Pt jK l:6u=p:6t=:6u 1:6:6D$@z$jW_d:6D$ =d:6h!t$85:6t$Ut$8nWt$Ut$8VpD$ffD$0fD$8D$L$D$u#x33t3|3@L$D$:6D$pySD$ld:6D$ 1D$T$PWYt+h:6D$|$D$:6=d:6D$$ E69t;D$=* t=-8 u)F6D$(1F6D$TL$$PQt$u |$ uD$0ufD$D$4:61f|$ˆQP$:6$B6B61@<o3D$:63f`4$t$T$$L$t:6D$ d:63L33`3T|$TtD$(F6:6D$tD$p:6D$D$tFD$t D$f|$t$lQl:6=p:6t|$# t jD$u3F t3)N3|$@tht$DhYk&m $P薀^_[]h#5:6t$1=:6ȍPu =:6u"D$4thB pȅu5:6t$ t$,Pt$=h:6uS葕'h#hB6xB6t$p|$Pt jt$h)D$(F6D$DE6D$HE6D$L:6D$ d:6jP50 l:6u=p:6tVJY Ph#xh:6u:6j):6t:61WVt$tr|$w$'j Wv M $@Fvu;Ftj WP( $jpVg ыF @v 빃^_V t$t8>u3Ft,ptF E6QjRp ^SWVQj5t1OS jjP t6>F1"jjP tv^^_[USWV|$41GGG =3l$0\$S]}l:6AjUfjUPCh uAl:6=p:6t 4$Q1CSt$SU\$t$'$w l:6u=p:6tS|^_[]h#VP:6u1PPVPjh3T tF$P{:6t.1QQVPjh3S t:6@=PATH5:6t< :6 3 3^á:6SVh$r#ZB68uj21^[1ۈ335:6thB v|65B6 E6SSQPV:6á:6ËD$ :6:6PËD$@:6 :61:6:6Vt$ |$|vXPh#1@ :69~1Ҁ8cB:6 :61^WV15:6VDB690t\WzB60PjPfH5:65:6:6@:6jw5:6JWz:6^_USWV$E6$j/WMHt@D$PWD$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UVuD$ %=`uVyjWS ƅuWh%Wh# Wh#L$:6x :6V|$|D$ p膇:6:65:6uu~9} ~ :6:6^11@1USWV4h$r#c|$$WvT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h#53(14^_[]UWV׉΋ :6uj'I k< :611D$ T$l$ t&D$ $,$<$\$ D$##D$薑?6u0uFjh^$W& %Wj|80uHx.t x0@te^_]fUSWV|$7j/VEu#$jVP uaK$$WV4y Pu 1@Ɖ$m=:6ud$$UVuG~y8t8oy8t.ey8 uPVwt >yV{vju$P OfSƒrtt~ :67PSCPVh:7#jSWVt$|$t$VW1 xt x^_[Ã|$u0jWC6tB6:6V蝈jUSWVPD$tnt$ t%1;t <:t9tGt$?h,89-P3}@v,; L3t,WSQL$ NKL$ |9/u 1xAA/D$PL$Q/:6E9u,;E-:6L$Et <:tEL$<:t1ED$(Qg $+ L3AQs^_[]USWV$1C1D$ 1D$D$D$\$h(#Hw5$'\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ B69AB693t$$1CjWtV@wM$\'|$t&|$ t4t=03x'@ |$uB6H B68uE6PVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿ:6/tPEȃw?$l'|$u/|$ u&u |$tf<u t$Um묃@;6r533$@th2#1@$$$$^_[]SWVt$l:6:6t5Hftfu9503| Pz2 9p}Ëu̓@;6r l:6t^_[Ã=p:6t^_[USWV$G$$|'oE6EjWS PqqM䃼$$twh^#Vh#FGPh"$l:6w>PQ^ l:6u=p:6t h#D$Ph#/thv#h#GPh"$Q t*3HQPP3Q*3HQPP3Q ^_[]ÃPWh#SWV|$tWȊ Bu%iC)ʾ!)!:63tFWPGdtc6|$tTl:6WgbPSnƉf@@ WP芀 l:6u=p:6t u1@;6^_[l:6@;6Q/  l:6u =p:66USWV$$$j/$=turfEE^E69tth#VDžt $j$q1Ʌt@@t`tm$umtisD$ P$%xfE$Kp8p8p$ u=03x $u  \u =03y& u $MƋ$1Mtfyu03YL$$j$P 1OD$V`mG:6tAPh#m{t$t-'5:6h#>{t>/u19}-9j$$PM ƅvvD$ PVx3D$(!D$ =u8=:6$Nu$Mo8tCo8t 9oD$}o$E$\$|$$t$t'53jS\P$hb&VfEo$T$pƋ$$l:6|$ÍD$ uj$HfxT$ ufBuω7 l:6u=p:6t ׅt"G GfEG EG fEGE fEEĜ^_[]l:6T$ Éuj$fxE$ufBj l:6tbiV]C+L3P%jV$ij$t3fxu*SVm$=p:6V$h#SWVP''1t8|$''L$8u%tWP^L$ t us^_[SWVP('1t3|$('L$8uWP^L$ t us^_[V('t%('jPf@NHu^V:6 03trft fuxB =@;6r^USWVP\$=E61N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#3wt1<:CG럡03y x5031Ʌx $y $Q503^_[]SWVl:6:6>t+fuwW) ߉?u׃@;6r l:6t^_[Ã=p:6t^_[WV|$D$ l:6jP+@ft*fu vfFGF GF GF l:6t^_Ã=p:6t^_WV t$D$L$ l:6fO 3fOPtGWVU l:6t ^_Ã=p:6t ^_jt$itfxupE%1USWV t$811G$1D$h#ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШPB6:KBB6*#$1\$ D$4$߅u U='t,]''8uUP[ujUNƃ<$t0vh#4$B6H B6(t|hN#-j v(4tuh\#vh#B684$t3HQPPJ3Q l4$t%Uh#SPhl#+h9#,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$'D$j/U3jU~ug0? Ph>#:uhh#Yuh#Bu h#7t.Uh#3+E6 t$|$tJHh#_t$B6H B6(ouh|$돡E6D$ FjUD$PK PcN<$u$r#|$ty#Phr#~Sh#pt$ct$1 ^_[]h#+#ct$r#RVh#Vh#1PPt$  5L3@PubUSWV|$D$\$=3tD;6H H;6 L3 L;6 P3 B61ɉ P;6 `;6H G6SpB6tH B6~L;6L;6dH L;6L;6+L3Pah;6d;6u%Vjap h;6h;6sd;6UVWh;6-h;65d;6x=tEd;60va5h;6΅u!cL;6B62V'h;6d;6t Oh;6G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ tE6t D$3 E6D$L;6+L3D$?~uЃtRWT$4$ D$1@D$ wy< B6H B6fL;6e$!PVVST$0/>u!y@u=D$ D$D;6$B6H B6RL;6Q=D;6unL;6+ L3;L$~[xuUHL;6QB6H B6L;6B6H B6L;6$ |$D$5ЉD$$ B6H B6L;6`T$,H L;6>~=u|$ D$ RV"T$4| uG6B6H B6~#L;6%J`T$,H L;6 X.`T$,H L;6$9Ut$ ,T$4L;6+L3jPHPuT$8 _T$,H L;6>B6H B6~L;6 _T$,H L;68 G6w_T$,H L;6G6V_T$,H L;6$^4_T$,H L;6D$$ 4|$tu^_[]USWVt$,\$(=`;6tE6t$D$ 3&j[XNFE6D$ P;61oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=h;6l:6l;6u(QVM9P7Yl;6NQP5l;6 l;6 l:6u=p:6tPh;69t31Ʌt AuQP!u=h;67vA h;66^_Vt$t"h;60v5h;6΅u^V5P;6t1l:66P 5P;6 l:6uۃ=p:6t莻1`;6P;6^USWVt$(PnYL;6+L3PmXL3Gtr}t  KvC#:t /tQ t7=3tAL$,u8 B6QB6ZO@랃tPY^_[]Ã=B6u ZB6L38t!PR tx PXu$hK#ljPXGËD$,tÊ*%'$< t< s4< w*B6H B6~L;6ZH L;6B6H B6~L;6YH L;6Gw/u}/uE P7 USWV,D$DD$L$@9A|$$D$t1.''‰T$D$D%D$ j=L$Q[%D$pD$$L$(<$ L$ u:|$L$D$ PQ 1ڋ\$L$ 0F6T$)11GL;6+L3D$D$<$u \$H l%t$l$UPRTT$LQT$L$ t,1t}y;@ڋL$ uD;6L;6+L3=3\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =B6t1C L$@11ۃ9|$t$ |$Wt$T$RV WUL$(/<$ }D$1|@uD$B6H B6~ L;6ՍQL;6VL;6MPL;6EK1ۋl$$]|$ D$EÊ*%'$< u.B6H B6~L;6 tVT$H L;6B6H B6~L;6 FVT$H L;6]EuKl$ u% L;6L3)L;6 B6\$\$L$ D$E< w.B6H B6~L;6 UT$H L;6B6H B6~L;6 UT$H L;6]Eu1L$ }D$n $Ip$'|$tB6H B6~TL;6R1G>L$u0L$ QV1>t5L;6UL;6ۋ\$uhT\$H L;6=L;6+=L3t$ t$(St$ WV-uL;6=L3L;6)=B6Sg1GL;6+L3t$PS <$t[1@Ftuրut܋ H;6 H;6̀tuŠQ1ۀ؉Hu,^_[]ÉRPh#d Q)Ѓ5G6h#F׊t!#u(HL$IQWP5G6h9#D$ƃHQWP5G6h\#USWV5L;6+L3D$l:6P;6D$ T;6D$$X;6D$(\;6D$,=`;6H;6l$0U+Q+L3P-PD$ P$jU3QD$,\;6D$(X;6D$ L$$ T;6P;6=`;6H;6D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 l:6u=p:6tfhWt$胿 yR8tl:6HD$EEt< uD$C낉$L$}1A9B6} RL$ƅ~N$ B6 FK1:B6H B6Q FK1Ƀ=B6 Q1ɉƋ$|$t*%'$< t$< s< w B6F$ B6Fl:6D$ x P蚿D$t P D$tP5=:6$u+L3jPt$$ 5L;6 l:6u=p:6t^_[]USWV D$4L$@-L;65L3l$)hP?D$B6H B6~L;6qPH L;6=L3UEWD$ P[NL;6+L3PZM5G6W蝛ljӍD$ P]NL3 L;6L;6) B6 B6 PL;6SWh"jPL;6xt$GF9Iu|$"tjVU0 L;6A L;6B6)B6D$ ^_[]SWVt$|$\$`;6t#9Xu 9p ux2jK `;6P;6`;6`;6Xxp ^_[WV=`;6t$ 95X;6~?=P;6l:6?P= =P;6 l:6u׃=p:6tѮP;6`;6t?9p|l:68P `;68 l:6u=p:6t芮 `;6u9q~)q$95T;6~ `;6`;6P;65X;6^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) t`B6H B6~L;6TBH L;6E63:65L;61L;6^_[ÃЃ wBj PV@ B8ű$<=tuw~;5B6B6bE6D$5B6ØD$D$‰؃AD$$Z|$ T$L$T$|$,*%'$< u*B6H B6~L;6AH L;6B6H B6~$H $ L;6QL;6 @L;6 $Q$ PL;6$eØt2L;6 $Q$ PL;6$eØt2H L;6B6H B6~$H $ L;6QL;6 .>L;6 $Q$ PL;6$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-GB6PB6~=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rl;69tH9u H%8/t FQ%Q襻D$;5l;6tF/}tEEGXـxs@<$uokt$tdǀx .u.uN jWt$G t8tG@u@/UPWVUJ5l;6=p:6tt$2tWE/Q l;6߀xruX@8tB@9tD$P5l;6x5l;6,Ą^_[]ËD$1Ʌt AuQPFWV|$ WO+@P7WPIj7p h;6h;6^_USWV\$D$|nOʼnmIWP)|$SUÉps,x 7u߅u҉3D$^_[]SWVt$(\$$W7C H;6L3L;6P3B6`;6js2B6H B6~L;6h9H L;6L;6+L3Px6jVP W7^_[USWVt$FPh&r#ĩ3HQPPu3|$Q1ۃ|11E4)E9uSh#j3HQPP3Q|=1C4膤3HQPPޤ3QC9u1^_[]Ðh#辘h#贘;6H ;6~;6H ;6#=~u;6H ;6USWVP83H ;6t+u y;6H ;6~xhL3蛤h`3莤 ;6183~PX;6hSp胤 {e78t_83xL78#>WjW !Pjj  h6#683p;683@1ҋ;6  ;6@@P t 1+;6;683{tXAˋ-;6M ;6~ @لt;6أ;6=3t$5;6D$p53D$;6H ;60~^_[]ø;6;61;6;6h#,USWV=83w l:6^t)kUE&~D(< t< u 83Hc F;6F;6F ;6G $9t V  l:6t^_[]Ã=p:6t^_[]-V ;61~^Ë83r t ~6u1@1z;6 ;6SWV\$t$|$l:6 83y tja1 83I  83A$A ;6H ;6H ;6H XtK =;65;6 l:6t^_[Ã=p:6t^_[RWV$l:6jW衡ƍD$PV uT#D$ =uD1PPPV u2jPV u <$ELF1PPPV uZV9t:$Ph l:6u=p:6t菓Ā^_Wh#Vh#ؓV计Wh#ēV蚡Wh#谓Vt$l:6ho VjjV  |$ t83H~Q83pxuh/ 83A1;6;643 l:6t^Ã=p:6t^馒83tL$T$9PuHuá;6 83A ;6A;6A43Aj8. 83@1ɉH H$H83WVt$|$ l:6|$t=;6W";6;6543 l:6t^_Ã=p:6t^_V583l:6Fx PϊFtP ~ u83V 83H ;6H ;6H ;6@43 l:6t^Ã=p:6t^U83Vt$ 839tp;6tPu^h#莑=83p;6t-Ã|$t=83p;6ux;6~P83@fWV|$ 9=?6=@6@3t P袉jh%#@3MPȈ@3hs P=5@3n?6B9t jj1Vj莕Vj胕Vjx诠 |@69tQj1|@6P5@3萧O00 hV ?69tQj?6P5@375@3m@31Vj躔Vj诔Vj褔=?6@1V tV胠@3FuhS#J3^_p/0 hPh#:Q/0 h;/0 hPh#@3;D$u D$@3h$r#DB6SWV=?6jQEƋPh"$Ǟ|-1GPhqK$蠞G;|ۡ3HQPPB3Q O5@3otJl:6V[V l:6u=p:6t{^_[h#ۍh#э-0 hPh#貍Vt$ h$r#C^USWVh$r#vC=?6B61FjPlj+?6i5rO@QPh#Q |,PhqK$+E;|ۡ3HQPP͘3Q ڛWB68tH B6@(1^_[]h#臌h#}USWV\$n;%u(sVd8V7H#KS?8#dS7 ?6M5?6At#~i9:0#I {?6#4$D$D$=?6C1tQ~H$8?uEt$P?uUt$6t #tl#K\$ueZ*t%tS-tU+E#D3x+;?6}#5?6it /#\$1|$ t5^_[]áD3t ?6i#뚽#SU~USWV?6)i5rO=D39u=D3)?6~9ut Ku ]t]tu`ǁTtCiu3itit0 5D3^_[]SWVt$l:6~X1tttG9uމjQeuX)19}q~5@tu ƆH l:6t^_[Ã=p:6t^_[^+5?6i5rO@Ph#賈+5?6i5rO@PhG#蘈PV Ph.#脈WV11Fhi#_>kt!Zu忀ރlt puԉпɁuB6tg8tbPh"$/dm=3u =3u@B6tA53jPvW:B6H B6@ujcW53 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh5&Wߖ\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th #jD$P ] ?6)i5rOC-D3+9tti-;)t RPh#jl$ Ue\$D$PG$t+,D$0h#jS0S\$ŋCt:tBuM ,%Ph #jQD,ingD,Runn}=tQL l$ ,j SP0 D$xxl$ ?Syl$ ō,@)QPh#w0 h%jQR ݍ,P4WD$P}݃FD$ ݋\$GHO W謐H EuݍCWP2$u/1M|t؁PhqK$W@ N1MM|FGHO WBH GHOl$  WH|1GHO WH ~T$KWiD$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =3$tCt>5@39t%5@3PV莚$=?6~y\$t$1=?6tEt*t t.<$u u/S0=?6u WE;-?6| $^_[]"0] hjPh#膂USWVD$4\$,tl$0|$WUS ƃug"8=`E6tl:6?6?6D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o?6D$ ?6$iD$ 9T$tcu tQ=@6t 1=3uL$,uP9tPtu 3P l:6u=p:6t^_[]Vt$l:69tP džƆ1z l:6t^Ã=p:6t^oWVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$hm#5t$ntpuB6D$D$D$t B68D$t(1PPSȑ EjS==?6u|$1?6-B6~6@ ?6D$u}t!AH Et{1jPƅt9u ED$u :u G EuB6t Dt111D$uD$?6L$L$t$D$\$l$|$ ?6@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$?6C$jU9 L$tc|$tNuJD$1rȋi4h&r#jD$(Pv3l$D$D$L$D$u U D$\$l$t0~Ot)D$?6y\$l$D$tUD$tMjPSD ?jVDžtjuS# =3u V 4Ń퀉0^_[]hq#{Sh#{Sh#{{USWVP1$1C11h#J1it"gu$ڃjt puЉ̉( B6t yjPƅt,1t?6)i5rO@Ph#H$t#tH~1i0 tPh5&轊11G^_[]Ã~1i4hv#腊3HQP~G ;| Z %PG ;| 3Z;|lh#yh#yV1=?6ujt$ St1+^V1=?6t. ?6~$A?61F:uI}^V=3tO=@6tFD$t+ ?6i5rOA1ɋ3u0VQh=#R^USWV=?6u65?6~%=?6Ft WN?6l$?6~"5?6HI}l:6tfiPƋ-?6=?6iPUV ~ ;uKuU* l$hnƋ=?65?6i 1҉AJw)׉=?6 l:6u=p:6tmwl:6fdž=31?61B|iP l:6u=p:6tv^_[]SWV\$|$Eƅtt.VSt$W\$<$D$ #^_['0 PhG#vUSWV|$ @6tWdW~*15@6d:6D@6V>V}5?6l$t$t%t =3ttttk0hWj~Wj~t uu`mul1VVhf%&tOhf%h#vkVjuV5@3>tTWjzWjzt*=3t!WjzWjzWjzu?6^_[]0N hPh#wuUSWVt$ l$|$1ۃ=@6t/t*=3t!ttSVu5<3tEL$ji4DDt QP ^_[]WVD$t$ N ?6=3u=32t=?6jP=?6~?6>f@..@.^_WVt$ 蘄l:6NJujVj 瀾tW5@3r<u%+?6i5rO9D3t mjVt=tu  ρπtt=ttu ju VK l:6u=p:6tr^_z0 hPh#DsSVD$L$ =3t1ۅ SPj^ ^[Ët$1҅tހu1=?6u2?6u) ?6~?6:tzt IuhX#~?61@SWVt$$1@=?6|$(1@U$r #$<'Wh#bjvu h4V#hp%tjjvjv 1~ hZ#21@^tjs%;th}#hε$jvh%1Wvhp#1Wvhu#Wvh#jvu h4V#xhZ#kjvm~ t+u h4V#Gh#:jv <u h4V#h##Rjvu h4V#h#7h2"v h;r#jvh#jvu h4V#h h%;h#kFp]h;r#P~tF1SwJhO#.Sw 1> #t#P uh#h`$vh#v#'1D#1###1#N9tQh&r#jWWSxuF x%Ph&r#jVRVjv S h$#51^_[hz#hz#jvUSWV fD$ ?6 ?6l$ 1D$U$u1!" $']1x&~'t!=\t_"t $Q\$ \|$ B]ڃ # t#,$$׃߻@&!$}D$##} u#$%)4$<$zT$tvӃux<'t ur>u<'_pE~FЃ r# ,$t#\$҉Ӄ9uG8,$"2D$1&<':'$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I ?6?6 ^_[]WVt$ tG|$t jV~t'hp%hp%jVvu^_USWV$t ?6 =?6D$P E6t E6E6 $=?6z1jh'St `P>;Hx@u8/UD$PV諆x D$pL$t 1D$tD$p1ɋ?69?6:6tH1 8t:tGt89=P3Z 9=P3~:65L3WPVh >?2#<=B6l V: fiDle cDhangD ged߉V~v3HQPPvv3Q D$pL$t ?6?6E;-?61-?6D$PĔ^_[]fUSWV<1Uj[D$hhh UPju DM9u K9È8@6j U8w <@6j @@6h$r#U) h@#輿3,$UhD@6;t$T|$Pd:6D@6蠭|@6@6@fD$PVWVW~=8@6 Àu {=3n$hP#h:6ttQu :6 :6<$B=35=@6(ȃu6Ŭ|@6@6B6$h:6u7=h:6u73HQPPt3Q h`3tD$Pl:6=p:6tcg$$=8@6u>hK#J't1Ph]#QPP[V$=3u3 8@6t N=8@6uEt$(Vhg#t8t$PTPV$G6=3t =B6tj('kuD$PB6u/jM=3tFh2#|rh`3s*1ɀ=3ˆQPj=3u=B6t43G65:6+p$$#uSWVD$8t^l:6jP sƅx jVO l:6u=p:6tvex"1=3t=*3t*31G ^_[11=3t 31j蜉V3V芉=3tt*3u3^_[USWV|$(V11C=`E6tn1=3u4t0j53ujh`3q3P=83t.te=3u\1Ƀ=?6 ?6jPPi1;tW1R=3uIu=3t7=3t.hk#hpEVuu$u蔆V#^_[]Vt$l:6jV;qx1jP l:6u=p:6tcj^Vh#ct1Ã|$|D$pPmmft$ th#ct$t$ th#cWV|$ W@Pְ tWP^_h#ZcSWV|$P39~b9l:6؃P| tr H3 L3P3H3 l:6u=p:6t wbP3l:65L3>L3)P3 l:6u=p:6t?b^_[h#bD$t L3) P3L3j h#jm D$ H3 L3H P3H B6H B6HB6ËD$l:6H B6P l:6u =p:6aVt$l:6H3;t H3P FL3FP3F B6 l:6t^Ã=p:6t^=aUSWVP3<kl:6-L35H3@6t|F9uuH3PV謹  H3H3+ P3 B6L3=P3B6tG90uC H3 L3H+HH x@WSUPm 5L3=P3 l:6t^_[]Ã=p:6t^_[]S`h#`D$l:6L3)P3 l:6u =p:6`V5P3P3B65L3^V5P3+5B6P3)B65L3^ËD$ L3) P3 P3L3+D$ȣB6USWV(L$@D$D$@t-΍i11P%wDGÉ,$Eu1ۋD$b USWV1\$@<uPƋtPEu1ۉ]hB6B6=B65B6B6^_[]SWVP\$t$t2uhe%V1C$"h#^Z%w%(,3u*23v#03RQPh#^ˉ#uȡ3HQPPtZ3Q (,3t"23RV#t~"QPh#h^ u.$(,3tPVtuv#VPh#M<$u#13t(813uƁ23u숟23h#1 [3t$Y3t(813uƆ23u Z3@uă^_[V(D$ T$039tuv#RPh#Lt#13t(813uƆ23u숁23^WVt$ ~t)~tPZ uvF ^_USWV jA B6t_y 8-uUD$$B61B6P  B6y8-@P1F PơB6)l:6B6=B6~-B6Ft7聩 B61N࡜B61ɋuB6 l:6=p:6J1F5B6P)ƅB699Sl:6 B6B6lj4$މt$\$)1*C/5B69rL$ 9v!\$ۋ4$ P; B6w4$ 9vQ9wB6 l:6u=p:6tIW1 ^_[]h #2Jh#(Jh#Jh#JSWVT$ B6tstm8u'1z:trrD8uAÀ~:u"9u B6QB6 tf B61ɉ B6D5B6>1t6?-u1t+O^B6-uta5B61^_[Ph}#:IPh#/I|$u1PjPPgel:6jwB68t PI l:6u=p:6tjH1ËD$Ѓ w#j jP芃 uB6B6ËL$~ND$tH  B6=B6u B6B6B6hB6hB6Qpph!#CHUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh$r#hD#Y J|$:uUD$8@?jPhD#Y ^jUhD#Y 1|$D$0)@<PhK#h`3V jhD#f1?\$D$01@11T$4*l$Ph&r#j UVhUhv#Y D$EEjUt$0X u0^_[]À|$:uD$8@:Ph_#K1L$0L$4@UjEfVD$ 831qqA1Ʌ ?60PQ83p ]t u 1%8383@j* 83 u^qqhl#EPD$?6/$aQXUSWV'ơ83@tu'tƃ 83 x,$@D$t.$xk$18uWPtG'uD$tKjD$p4*t6NjpVWPVl E$ht83@^_[]USWV83@|$u 83A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq83@@|$Fu6|$uD83@ 83Ap8 u|$u83@^_[]jjX 83ASWVƻt u j pxʡ83@^_[USWV83kE1͋ 83x t*?6,PqN83@ C1Ƀ8Qs s j@83HOH O oKy K9t?U1CSpt ^Sh($'P= 83HO@ G 蝯83!^_[]WV@t$P 83A uyW wWhn#4H'h#j"Q Wh#j"PQWuL$Lx4H'h#Vh#jPQWUSWV83@1u 1=3tMtݡ83@xuUj @jtÉGpj`aC+t83@tj,(pƉ^_[]h#83t$p0h#O@USWV83@$ u83@$EŃCߡ83@$'$ 83APUj já831Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt83xJjG B u083x,u%@.''t@/@.''uh#jÀ=3tjjj 83H0+H8O U 83p0j^@ 83QPI H pGu583~ h%v^m|$F83xujD$ 83Hu 83H L$ qx0j@83HKH K {@;u.83x }83x|$ T@0GjG 83@t(HS u 83@83x\$\$j 83HK @0Cku83x ux,uh%pjP@<31ɉH H 83Q0PCAHrAAtejC9t jW\G @:83@ u83@$EŃ!ߡ83@E<$t!t;tj pXÉ{؃^_[]/ uS\$|$83X0j2x@ 83QPI H X t\$|$D$C 83APsVL 83jj 5jj,jj#jj jjh%jjjjWV83x$G Hs83jpW$ uq83p(x,u~ 83At8 u @A8 @tHA~րxru\tuՀh#83p0+p8j@ 83QPI H pG .Pt83@F 83t1^_jjVt$&9u^jVVL$1.''tA1B1t A.''u^uVt$j@ 83QPI H p^USWV |$$tD$ D$$D$l$E1$83xc 83x0$t $j\ƃF 83QVI N ~ut. 83I.''tAt=t A.''u1c83H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc43 83A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j(83 $+H8N~L$NL$$N @0FEPrj/vɡuG43 83+A8FF83@4 ^_[]jjjjh#L$1.''tAt=t A.''u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;@@6}X;<@6~P<@6I;-u{tBuG83x0+x8j@ 83QPI H xF^_[F h#lUSWV|$43D$=u ?vl$$5L3P3B6G$|$ t u Ǜ t19uD訛 $ tC9u?,$ u4383HH }yMt9t u>u:<$ t=u葞$)jWP萞 |$l$$uS\uNB6H B63\F u%B6H B6  F43#áB6H B6ƈF t詚=v43菚=t h' u4383HH B6H B6r=L3)FV,83x43+D$^_[]USWV$$1҉T$ T$$D$(54383r0=($'t1$|$ fw|$1/fFn D$j8fNL3 P3 B6=,&'u ƒ=B6‹nD>  $P'=&#'u f|>z B643Bס83=&#'Xf|>LCD>fT$ T!uhЃoĘ0N,諘05,/L>=*%'fu B6Bn׍MN|$=@01fD T.fTT.fTT.fTD*%'fD1AL$!(ljƒ(M B6FD B6BvNO|$s@81ɃfD T7fTD,&'DfDfD> 0 = B6\G_T$ t$>Hff B6T$ Bf|>D>u6t$3 nMn B6}f|>  B6BFfL D$$D$f|>tD>t B6Bf|>u D>v B6BW B6B*Ã{t .'' B6}E+=L3 B6E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $ nMnD.=&#'u B6 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD($'fD B6T$ B1AL$ I) NjFfL B6B) 4383@8xt ?6 ?6$8W Nf|F\=`4" $"}f|  B6T$ BFu6$( Ft$HFuЖD$$D$ Poſ1۹$'D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD($'fDu6t $ FHF B6B赕= t]H\t 'u 4 t =u 43831Ƀxɉ ?6$6 B6T$ 'uF|&#' B6F$ *%'$< u B6T$ BT$ B6 cʔ,t$@  4383xD?6?.''L$ p}3DAD$D$E|$}~*%'f|t B6 B6B\*%' u B6BNf|t B6B1@D$ B6 B6B݉ý {"XŃ', D$0$躆 nt$T$ Mn B6B1@D$t$C?6$4#U ̏` Ń< ?\u袏\ 0 \$1CHЃ w&Hw ÃHÃéOu M B6vNO|$@81BfD T7fTT7fTT7fTD*%'fDőL$ uk%=I =B6 D$ wF B6P?ˀ B6@ww B6 x?ɀtw B6@ B6W?ˀul B6GXT$ W B6x ?ʀtw B6E B6O?ʀ B6Gw7 B6x?ʀtw B6E B6O ?ʀtw B6G B6A?ʀtw B6A B6H?ˀa*B6B6D$D$$B6B1z.''t.B6H B6LjGq .''u\KЃ w4B6H B6LjG; ÃЃ D$ u t B6׃Z B6H B6]=Gt/ up}tkB6J B6/#@ǽh#tE%t@Ń:bD$D$$'3¸U1#,W9uڍ1|$Nf|uf|t Ms@ L39T$ vNK؃|$ @11fT T3fTT3|3|t3ft1BfTft|&#'fq fq ƋT$ ;6H ;6~;6H ;6 ډËFD\$D$$'֕Q1')G B6x?ʀtw B6E B6O?ʀtw B6G B6A ?ʀtw B6A B6H?ʀtw B6@ B6A?ˀa2 B6AD$ ??B6H B6~2G:B6H B6~$_1c:B ˆB1=&#'nD=,&'G=&#'tf|cf|.3B6H B6莿5L3Gf|uNT$ ؃t 4$t$nŀ>ts4$flPT$ )B83L$H,L$H $վ83pM tΉ$I} Nu83xĨ^_[]1HE;@@6} ;<@6~<@6>uxkjy1$&tu>tyu6EBE9E0E"EEEA }83h$ Ή$| Nu=tuS$##$:#43 83A0$b#u$G#b$#V$u#J$F#>$]#2V 83xt@@ ^Ãx t#?6$@)83@ @8 43H0;6H ;6~;6H ;60諄ƃ~0:=F $'> t=u럃F~t\u^ 43@43 83A0yt?6 K?6$S(*;|u0d|83@=t*ʆ4$D$D$&#'Kuۡ83@1v u4383HH @1@Q&83@-83@83@&tQ;ub83@ 83@؅83@83@ 觅83@u:\u?0 u64383@81Ƀxɉ ?6P&Bjjhc"A ځVȋ 83y8~0 B6QB6@ 83Q8rq8^USWV\ӉΡ83@D$ 1,$d:6D$^+L3D$$UPLl:6$~S"ʼn$S5L3PU l$|$tD$$d:6 l:6u=p:6t?w43D$-L3P3B683x t*?6PL%83@ 蠀ǃ[~!\u9菀ǃ[C tJ$Q u"4383HH s`un=ub\tX`tS43 83QQ NDt""u$B6H B6~E\E \@ŋ B6AB6@B6H B6ٷEL3@|$t~Pt$jP荅 D$pŋȅut$ j轴E83xtH@1D$43D$jNǡ43D$Kt5 83At$ D$AExK83@t$ Ex P39ًl$踵 P39~=L3B6t1SUW辊 )B6l:6Uu $ l:6t\$=p:6\$t 83T$ Qd:6Nf|u%Du B6QB66@Vt$+t$ B6QB6@~.FB6BB6ȅAJ։ȃՃ\^_[]á83L$H0h#W~<$t 4$ t /83@D$d:6jPjj#jjVtQs N^V 83$r#ytA5?6t7t u(E6HF6543P5?6#^USWVt$,|$0l$U5P31BW;L3u(VuGB69w&B6WVS蘈 Uڲ^_[]Áw: t9v$P5B6 m tãB6$B6랾#뤾#USWVT$L$ -d:6҂Ɗ*3:6D$1|$083D$|$ljWtJD$83*3V艂-d:6D$:6h:6$r#jU\$t$l$=d:61F5:6D$083$V\$S7 !{Vh($'P 83A |$t|$t=3u #@݅u:T$1rIJ$JB *3VVRM -L3=83D$*3t$臁D$d:6D$:6؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV C61t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu B6tu(Mxju PQ.Ex P< U4p uF^_[]USWVl$ t$\$|$t|h@VSf VSfDžt9u 9t S9u95D3}5D3^_[]Åy0葉 PVShD#WWVSh^#USWVt$ |$\$l$jMEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!jl@ C6$C6M|$];@@6};<@6~<@6Eu9] uC6tX9X5C6t-pt 9^t6SLF9t S| C61tF9Yt? C6tHt 9Y jjS PkD$($@t 9XjS1xl:6C6  bC6 <@69|AQjSU ǃt;=D3~=D3x jjW/ jݫ$JBXxp l:6|$u=p:6tuB6t$(WUN mCg1O ntuK5C6jS DžD*8t 8ujjSq Dž0蠆 PSh#\$t 3t3|$t 3t3^_[]j _ PSh#裮0 C61tT$9Qt uÉVt$5C6j V u C6|Qj V u8FPj V u$j j V ujj Vw t;D3~D3^h# WV|$ t;G;C6|.GPSƋG9tVPWwww^_WV H3 A H31F |71FPWW y w;D3~D3Pgfff  C6^_USWV$$$~l:6 8k$$'n  C6t9i V C6tQt 9j b Y<(O8=3tNnjU>ƍD$PV襈#D$ =nhh]n$SUoƅtjVC!SjV3 $/nhh nhh U ƅV;5D3~5D3|'u" 39uu-jjW 9t1jPWV l:6uQ=p:6tH A1jPWUy v 0謂 PWVPW l:6t Ā^_[]Ã=p:6tĀ^_[]< hh j Z PWUh# 蝪0> PWh#k 1F5:6tV0 PUhG#A X8VH8:67j0 PUh/# USWVP^xa|$\$;D3~D3oU = VUS 1jSSQ t!t$v$^_[]h# 4$V1EUj踦Uj警UU裦Uj蘦Sj 荦Vwt$ g SVD$5C6l:6PV]C6Vf  l:6t^Ã=p:6t^t1=B6SWV5C6t4|$t^tCx PjV6u^_[SWV|$ D39|ȋt$|9}9| D39tV7jjVW 9u^_[WWS PVhz#WVC6 |;@@6| pC6t$ Pj Vl y28t 8u>C6 jjV8 ;D3~=D39t Vy^_Vj 迣tL$ T$5C60C6PH^áC6tT$C69Pt uPe  USWV$|$<\$81D$ $D$1F5<5o3h#WSRM !1tbh$Wvh$#W`uo1<C6tEl:64C6] C6t jV l:6u=p:6tF@uD6>h$Wؐthv}"WƐt D$1p@|MD$K}h &W莐t8D$D$h# j531CKD$D$u}h:# v11 t=t8<C6u.u h#v VaPhw%  GF@uh2#A F@uu=D6tk1uu莩ND$E11P@É|$t<C6tW4C6h#Ah1#<C6t4C6 h$#{SfPh# Eluh#53 Cu|$tE1F-l:6D$t P1<C6D$t4C66Z D$C6t jS< l:6u=p:6tEt h2#11<C6t:C68u.u h&#aVLPhw%   GF@uh2#/F@ut h2#1<C6t?C68t3h1#4C6VPh#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=D6t61B=@6tbu^1Ƀ~7t@tuH1=34 C6t1Ҁ9ƒ (u1=3B1ɉσu1BD61t)9t`tbփub1^։PjSI $u=3d1@ָ PS!t^uD6u jS1D$ D$D$$K?r 诙 1@ jPjN ^_[À=3u=B6u =3=31@Vl:6C6>t8t6V D6rD6 l:6t^Ã=p:6t^eSWVt$u D61ۃÿC6t6C68t+l:6SP l:6u=p:6tC6=D6ru^_[,^_[V1=D6u#C61A:t2>u D6r^WV|$ 30D6u"t$=l:6tg=\D6u^p:6WuS = C6tӃ<C6t>C68t2t-`D6`E6=3tu=l:6u"詗0^_WV|$t$ D6uWVjD6<rjV袔uƆD6^_áhC6=D6t1Åt8uUSWV\D61G`E6<`D6u@@uu`D6=D6u΋4C6tãdE6S-:6V.jPaVT t<$tS-:6m \D6^_[]ù@rA<\D6tøWVt$ 95hE6t)1Wj;Wj0Wj%5hE6^_ËD$lE6pE6USWVhD$=lE6upE6)=\D6tdE6t D$D$:6pE6:6=`E6tt$,jVu 5d:6et$,jVu45d:6=D6u%=C6t?t,1C6PWl:6jVuu5d:6Bjc|$wfs 5pE6˓1ۍD$X XXPj`FSW&\$\$ \$\$O?r ؔ1@ DD$jPjr 8VPuf53t$WVt$|$ ?t*FHN V>Qu953u V^_53t$WVt$ NfutE6FNtF t0fu^~l:6 ?NQPF N)Nl:6vՏF FF l:6u=p:6t V N^_Vt$F t-)t'VfxQPR yNFN F^53t$USWVP|$t$j'V^t~th#V=<k>t!h'V1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=3uUWMGHO W]H"WVGHO W3H"^_[]WVh'Qj'V\t)19<>^_hL3oh`3bUSWVD$~@|$l$1SWU& t 踐8tF r)~1H^_[]ËD$)D$l:6X3tP3N 1X3P3 l:6u =p:6PD$L$ T$$RQP XVPt$t$V tt$ P4$M ^h#PD$L$ $QP53 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+G6+E6Pqq hd#jhF6-F6SWVPE6T 'C PVw u,$$w2CGσCGCuhLF6Vh#8 u*$ @F6@F6DF6HF6^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUv  t61^_[]ËD$t8SV ڡƋDF6`uHF6$K DF6#t#$#t&1HF6㟉DF6t$D$$^# ^[WV<5d:61$|$PW葿t $D$PL$LT$H=d:6PQR 5d:6$<^_USWVL$T$tHtA|$9t91.''Írjt/9t+1.''tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U|V藈Ƌ $A$~ C@ $Q$f=t @UP赚WVp ^_[]SVh#WV<5d:6:6$|$jW%u"D$LL$H=d:6:6PQ5d:6$:6<^_USWVD$ èu|$=Z3uÍD$PQW Ƌ@l:6Nt$݁ uF @SPуF`u vH F~tuF1Ɏ! s%t É^~E6tE6uE6t j~ l:6uk=p:6tb[r2j賆XxL$H @ $  $#`uW&H `u WH fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=B6u0@=B6tc@=:6tf@=3ti@=3tl@=8@6tp@=3ts@jPh#,WVt$|$ l:6twхVP? l:6t^_Ã=p:6t^_WVt$ t|$Wv 6u^_USWVP\$l:6j2ƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFRSP}j=SSS迄UPu< ؉G@543S543hT3P[ ~ F1gjt$,F6uQG L$<=u5E6HE62UjS $81F FFE6,F6~F65F6 l:6u=p:6t^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ :6t8Q12<08uF=u =ut j=RhRF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVTF61tr:1҃ЉuF6r׍P辂ƻTF6Nj+t7Mȃu%EttUЃuEmŃF6r^_[]SWVTF6>tLGu% uwmC Gu#W]C @tw݁Gg;uF6r^_[2SWV|$tfh#W>0Wcu9uWh"$V't*tUj'WPt8)WPh# h# Gh.#Wh%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPh`Y$tUh`Y$>=uD3HQP~ j( P 3j)n~=uGutha\#EU3HQPP3Q ^_[]USWVPF6uF6 hF6T$ t$\$TF61<$?tIOt !T$ ttуt݋ F69|QPT$(F6%F6)uF Gt/1Ix t#t0u51>j1ɀ>g1AbPAXI1>?f u%PV1u%#L$1PV1t1Ʌȃ|^_1@Ow$ '1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$Î t$8O19{USWVӉϋuG6fx@$P!'$PW1ۅD$PV{r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW1ۅD$PV$L$$t$<|$@11$;D$D9t$ aZ$PWM1ۅBD$PV5,$3D$ $3L$ $$3L$3D$1 dVWj1ۅTVWj1ۅfVWjVWuj1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]ZtQ9-u1tQyt8ytBÄth#Q}i"'t1h* jjh"'Qh* jjh!'h+ jj h<"'RËD$L$  )VL$D$ 2)u AJ)^USWVPwj PV貛 ljv8t"vځ8"u 11E9s:$9t( p}3@DQ@uuN9t ڃ^_[]Vh#yVh#nUSWV׉]t 9Fup  ^^J9uM1PPJ~ōP@rPUJ~ LH;NuS3 #~^_[]ÐUSWVt$(h$r#j]J D$,^H $x?-Ok-u)sstdluu~xwGW軮Åu"p}3DHt'1Ʌ Sكh)#Ehp}3DH\ƃ~ƀtVmtV迯Vh#jQރ $h{&SXf1Ʌt:S蹭u+$891V53V|-$K$8ʉT$h &We1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWu.N&|" $4Ph% 1@D$l$t jW_sj D$PUU ljӋD$9t-ف8ur1u s8tQ#x$r#UPho#3 1@D$\$ $4hJ#1@D$F \$ t$Ph#j:6PPPPh#532jWVPΉj WQU 9u=у|=}^_VhY#jQh#dj53j`WV@h;6;6;65=>t)j=WG=thW>uPh&r#j@V蔈jVh~# Vh3ht" 12$VWhv# @#t&VQh^# j,h#h#q VWh#bL^_=h:6t 1;6;6T?83B61B6B6B69C6tj=C6u3L33`33tPf. 3Vjz15:6 ><35?695T3t\3@8@u jRl:6jD\D6uƀ\D6@u l:6u=p:6tx^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$ *'$@)'Vw vVw d_ t"Vst Vw?w@_N@F1Vw q#w _N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u *'E$)'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t* Ã|$~* USWVPu }G6 G63f`|j%v7m O1@ 0$G6D$,(G6|$@t$(q%v>%L$ h#V<*u C hu#S蠴1N .u{*u{ 1HD$Chu#Sl1HD$  t$CD$'C`L$&~QF0 $t*'. D$׋L$ jj D$tfL$tjWt$QPh@G6TFu$X*'$G6l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Ph@G6j$G6L$ Q0|$$G6H $G6T$ l$= G6uM|$L$ jL D$tbL$l$tf|$ L$D$$@G6bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$@G6L$\$L$$X8G$G60$G6E ƋL$ cjl |$D$VPt$w$G6$G6$G6$G61  $G6 $G6Wt$*|$$@G6 \$$G6T$ j54G6F54G6{ p}31:DYt 7GuF54G6\$DF54G6ȋ\$+1L$ jlD$t1L$t5WQgG6L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ h@G6 PRQt$QP  G6FP 0G6 VjxPa 7s0G6T$t t$L$ t PVRQh,G6bMT$L$ t1PRQh,G6C.VWh@G61PQ*t$P PQh,G6 t,G68G6T$z \trB<]*<0tu$+' ?$*'."'#Eu uShA#G6 4$p}3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h#G6\),ҋ4$u|$ uWh#G6 ^_[]WVP$G60tp$G6M`1ɉQPV菂 Nj p}3#DQt$c#r& $G6+ (G6VQP4 G61^_SVˡ8G6H 8G6 u:3Prp~r0 P{3Q 밅u8G6)3HQPPD3Q^[SWVP$G60t"$G6<'t<"u1B^_[11f_1ɉQPVA lj+t:<-t6 p}3DAu)$G6+(G6VPhn# G6 $ڃ^_[SWVӉQNǃArVh_#G6GPVh@G6w D$=G6>G6Ƈ?G6^_[USWVP׉1PPP趣 ,>UJN@PUQ蚣 x$tG9tC$G6+(G6VPh#.$G6+(G6VPhw#п G6$^_[]WV9t"΀:t9$G6+(G69t\VPh#Z$G6+(G6Ph#賿Dl]8"uD=$G6+=(G6j"4 PVWh_#~RPh<#m G6^_USWV\$$8l$}hbF j jh+'Umƅu!hbF j jhl,'UimƅH h]#LD$uE#-w؃uL#D$uT#[#u=G6tj eG6G6c#w %u j# 0' q#u D$u y#Uw %@u#4fD$u# D$u #D$u#D$u#D$u#G6tj CdG6G6#+'tX+'|$FTPSh#jdW{c,^ u΃=G6tj cG6G6tj cG6G6+'1+' tN$L :Ntl P#PSQb#uFj PVe B8u$8u؃^_[Vh"$j"WVhq#jUSWV fm6G6b m6ƒ m6G6 m6€ш m6G6 m6G6G6h~#+t h#t8ƿ5'#PV3tG uVh#j  $$1ɉh #SU P6$1'G6kj j5$<c ƃuQA8"5G6G6v $<fG6Wj j5$<Sc ƃ _%G6j j5$<c ƃu@8"G5G6G6G6G61A5$<5$<hS>#V2tch8#V1KG6G6BG6G6/G6#?8"tD5G6  9uG6rCjh#5$<hm##Vh*#5$<hT# 5$<h;#ju h# G6t 1ҁ‰G6m6փ95G6u<9G6u2m69G6u#m69 3t 3G6G6=G6u\1ɅQNh# o3=G6t)ͅt=G6ut 1jhhG6P4 $yhG6h"$j=G6u1D$(Pt$[u#D$0=u G6G61N1$1' $$h"3"t$h#Qh%hVmTVwth"P)$Ph"$G6tM6 $=tM6=G6pK6B=h32#t8Xt1@$$Phmdt$ hh#h|tWEWh"# $=lL6u lL6 =pL6u pL6 4$hK6 TG6 $$1 uWhPhK6$ 1K6K6L6L6tjVhK6 hK6\ $RhSK6hG6VW0 5G6VWF5 W+l$t$D$ 1ɉHHD$UD$ Pjͦ Džy#:8#Bjژx߉DžVnx9ujUjy 1|$nh32#$PU<hjhK66 ^ WB*t $h#Rh(v3 u3H u3~u3H u38hu32+ljt9 t4u3H u3~u3H u3hu3*ƒ߃NyjUje hS2#h1K6(v3hG6VW4. 5G6VWj3 hK6dtd($Ph"$ $PYs1@PHjUjӤ [P=Ph?C# #tǍ$PWh%V؄D$uh"Z$PrX%jPh'Q#QQJƃu W VGWVθE#2'PV<*t uVh,#jG G6裨G6GG6GG6O1|m6t^_^_WV΃=|m6 m6t>G6t49t08#8#9tS>#9tS>#QPh#;` 5G6|m6m6^_SWV# 67'7'VSh#hv3MR;#ujFVPjj"Pս th#_1Q1@2'$ =uh~ jj"t$ #1$43F"u4$ 1@^WVκ u1H3 r1P^_V΀=G6u6=G6t񺣂 t41t)PhK60hK6hedAV xk^Ã=G6u񺣂 Jt=G6t7G6t.hK6hedAVp thK6hrdAVY t=tM6ujJEh.#j>h?#jUSWVPύAPjh#h(v3PGw47'h $Ph'#h(v3\P (v3w(h3#VFP w,h:#V5P w0hA#V$P w8hH#VP w4hO#VP W4O<W8#9tQh#hV#h(v3O$r#OHtQPh_#h(v3O$r#OJtQPhi#h(v3O$r#OLtQPhs#h(v3oO$r#ONtQPh}#h(v3NO$r#OPtQPh#h(v3.O$r#OTtQPh#h(v3O<$f$1۽a(v3Pjjh#LwVh#(v3PNwVh#(v3PNGtmÈJ9|6{u;[tVPWh#YD$(ffL$(D$ 1ۉa)D$u!)tPt$ha#YL$4 <)ǘ΋I<9vt$h#hY$N<.”T$9vt$h#tYj:WD$AL$\$h#Sw,1tD$h^&W!tkhNM$W !hN#W \D$Php#W  D$q;G6efjL6ujhO&l$!U l$7'1tUPP QFx7'r܉1hD$ Pj <$Wh#VD$ D$t$ <$}trÉD$h"U t:h'"U t/h,"U t$UWh8#oV F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhX#UD$ D$t.WDLt t uPUW Á2'r D$p}3MDHu D$"91hD$ Pj t4$h#1PD$ \$"r)Ut$h#P h#PD$1ۋD$L6ND$L6Wl4(t$|t%h#Vo L$1Ҁ<tʉT$D$< w'<$$2'L$ L$|L6<$tL$$L$ L$|L6|$m6cL$$t D$|$m6L$|L616FL$<$C fF|$m6L$! L$|L6|$m6t8L$$ D$|$m6tL$|L611A<$D$ hK61D$ ȁ(^_[]4$h#=ND$ WVPθWEVK6dL6fhL6hK6 fhL6=G6u=G6u#$}hK6hgdV 1hK6hfdV y#%8t %8uv$=G6u(PhmdVn xX53h}~ 91=G6u$hK6hgdV2 y #1G^_ù#h# 뙃=3tt$ t$ t$  e$1HVD$ t$=K6thPhK6 ^D$L$01V$t,uVh#-t"uVhl#Vh"$譽Vh%#Vh#XL^hm6hmd53& USWV8 $RPh hxM6Qcxm6 G6v|Pt$h#K lj D$T$1D$ XƉ 11 ‹l$ O6 xm6xM69xM6hWD$P- $;D$$r#=tM6t =}t=}uЉD$$#=G6tȋ G6=WEVuT$tf9G6rD$Pftt=G6%4$t$Uh#J D$t=VEW=G6$t=VEW4$t$UVh#jJ=G6|4$t$UVh#FJ=tM6$D$PSt$Ut$VhI#9=G6u $hG6S(v3V 5G6SVI SGSt$VhVW tM6D$ L$D$11t4$h]#贺8^_[]USWV T$ $11F1Ń=G6|Uh#6I QPWD$Pt$c9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=G6tUPh!#pH Ɖ ^_[]Ã=G6tUh#船=G6tUh#2HċL$T$tPhK611@Phi#t"j QPA uM8"t1HG61Yhy#j讽Ph#Ct"j QPaA u8"t1HG61Yh#jeSWV։ϋ\$+G6tItEuG61tGtBxM6 O6xm69w1xM6 1tthK6QA1@^_[VhA#j蚼L$1=G6T$ PG1ɅɉWVxm6~( WRPhxM6Q誏 xm69u ^_hr#uQVh#jPPQVh#jUSWVPӉ΋l$|$uj WV? Eu"9"t:M";L$ w,O>t" t9tp}3DJ@t1^_[]WV1t>΀9t7h#V<t#ƍFh#Pe1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh#Wh#@E1۹m6؃^_[]ËL$9/upL6D$\$A/jPU u$D$ L6D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh#mDm6!Wh#WDm61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh#gD$$Th#Sut]"08'W PWS  '> uۀ$U-$T149'D$XP tpC"uD$TPh)#72$T$끹 #9'j" $eFMu SQЃ {Sh#1h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h*#舯/$PQhC#R~$  tSh#+$fw(h<#S t*VhM&S tShW#+뾋$G(w,hq#S t*VhM&S tSh#V+뾋$G,w0h#SI qt*VhM&Sa tSh#+뾋$G0w8h#S )t*VhM&S tSh#*뾋$G8w4hB#S t*VhM&S tShW#~*뾋$G4w$u ~ˍ|$@WVs9t"b&J~PH k$7'1OJH w@$7' x&B(D$ D$$l$ CtGtngtbcB8D$D$l$cx&ɋB(D$(D$,l$(Bx&ɋB(D$8D$<l$8x&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=m6uHr8jVSWD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph##h&##~USWV|$t$t$h"V& Gw49'h:"Ph"V% GPSh"V%GPSh"V%VjjhS&6GXtVjj h"GXtVjjh&"GXtVjjh+"Vj 5w(h4"VO% w,hF"V>% w0hY"V-% w8hn"V% w4h"V % wu 1<1A71Au01<  $jj@PD$P(YD$ Ph"$C9u<$u40v3H 0v3~(v3H (v3 h(v3j 1^_[]h#jjfUSWV $ $ D$-@1m6m6m6m6m6m6$m6m6m6t$ h#US迧 c~!P$:' m6˃PtdT]=$<?1AJ5$<Wfm6뒹 .$<m6h$r#n m6b m6D$m6T$:@=m6l$<D$ Tnt uBxou D$ 1Ɉ m6hr%V+"tm6h$r#`ء$<$j:WC-m6tWutm繨m6S c$ \Wm6tm6t m6o39$ 1ɉL$tVh$P tj/Uu Uh"hrx%h$ ULV3DžuVTDž7h$P蓝 ƋohX#Wt(h^"Wth#WpV 1QQ$ 4PU7L$9C9$ $ 9tU蕊lj?,$u1QhD$PQV+ hm6hzd@P tq$ PhedAWs Wk|$ W$D8$9",;'uWkxn6,$h h 5m6P Ġ ^_[]h#jʛ$Ph"$jVh#j詛h{"hz"ʍD$ Ph# D$ Ph#j讛D$ Ph#롍D$ Ph#땍L$ Q4$;'h$USWV։ϋl$j` Vա Uʡ CCCOK G^_[]Eh<<'PhK$hv3j USWVP׉΋tASW4$4(VSc Whk$Vt$ P; W0 É^_[]USWV|$1_hX#St$h^"Sth#Su\m6toU3t[u=m6t .=m6t%m6toU3xt [u^_[]USWV$D$|$m6$r#tW30t CÅush(D$t$ uD$0r%D$ m6t L$ mt L$ ^$D$ D$hK $$ t$hFn%hV$0|$D$4$L$hr%Q?1G@΍K9|,SPb Ŋt><-u(GD$tj=Vt>FD$ GD#thr%D$Pu|$1F1B,$֋$$$,$Dm6tP$r#tw"P$h$# xF1Ë$4hw%C9uj gt2ƅ|$t t$ 4$ tA710h4#|$t t$Զ 4$ɶ ^_[]ÍD$jPVC x!L$ȃtuuhs#膒묁tlP^ PUh:7#! 끉 m6utD$P$uW$P$+u2#tˉ#Pv vvh $hv364z$SWV։ϋY Wss ss҃ Ds6t~j 8JWss ssԅuA Ds6^_[ÐWV1t$|$ ɉ @4u9|ȉXȉX\ȉ\ȉ{{{ PQ40m{40<8M{<8D@-{D@LH {LHTPzTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40Sz40<83z<8D@zD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7yVw wyV FwwryVFww^yVF^_USWV\$l$EffEffCEffCEffCu u yS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuAxSCuu-xSCu$u xS$C EDȉCDu,u(wS,C(E@ȉC@u4u0wS4C0EHȉCHudh$VŋFNt6tbSQP t6x 8u6~,=u6tffOfGG@ Չn,~$N()ǃ~$N(=8u69<$D$hP-8u6>N,ș)N,)n$F(teh$V$FNt6tbSQP t6HT$<L=u6tAf=u6t4f.<$ ^_[]s68u6F,)F$N($fOt@ s6븋D$L$t$ QPQPUSWV$$$ $$$(h`Y$SV\1j D$SVWUhPD؃r_4u6950u6rPSV Pt7=u6tf%"=@t4n#WQh|%d Whm$T^_[]USWVP|$\$s s@=u6tf9uRu6t=s6t=t6tj:D$1PPPs sQs s6OLs63C Hs63K u 3&=u6tf%"=@t4n#Qh|$胣s s/)SUh$D s6u =t6t:yj Dh$s6th$&=s6uh$u=t6u6t7t;f5s6D$u6jhv$S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=u6tf=u6tGf"@t4n#Ph$/SVz.=s6t)1=t6L L h4$$h$$p$l tRQf@ Ls6Hs6 1VW 3L$@D$DD$ t$|$ t6pt95u6tʋ t65u6T$Htt tɉL$LL$QPh$=s6uh$5153PPPjLs6Hs6  53RPjjt:t6=s6h)$j#D$L$ Ls6Hs65Ls6=Hs6 tYjj=t6Hu6tt,fI=u6tftfI=u6tfIfHVW51Ls6Hs69s6t-j  Ls6Hs6 djjQP Ls6Hs6 AQP=u6tf%=@5Ls65Hs68,$t$R=4u60u6 t# Fjj WSq9ݹÉrFND$P9|$P$d닔$hjj RSq )ˀ0^N9wh$訞h;$Ntf5Ls6Hs6153WWWjLs6Hs6 CRP53jj_h$hF$1s61P^_[]Ë$d#Hs6 Ls6$tҍt$PtV$lSUQP4$SUfH1G@u5Ls65Hs6hB#SUu.$l#$pthB#5Ls65Hs6SUq5Ls65Hs6H=t6u6fA=u6fh$s6hg$h2#jj5Ls65Hs6D$DD$?M t$\$ VS@@PD$PQVSf@5Ls65Hs6tfA=u6tfA$l$p!fHG5Ls65Hs6qf@5Ls65Hs6SU5SUh$ t$p$ph$ =s6j USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡt6@4 1WjPQWWRS 9=u6f3 8u6ff3=u6twf3 8u6ff3=u6tjf33f3=t6t3ȃ=u6t]D$ Yf3 8u6f3f3 8u6f3f33f3=t6t37D$ G UV=t6l$$tApQt=u6tRP+aA(=u6t1ҋ t6I4-t6teQRP t6xtt$V/11jWps =8u6=u6tf=8u6f3t6;x4})}jh3WTs =8u6E t6A49rE =u6t<$fGj \$l$u6_=u6tf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=u6tfUVfXW|$$Wf@t$$W=t6Hu6tt,fA=u6tftfA=u6tfAfH ^_[]UUSWV$$1Q 4u60u69;$$߃9։$PU$T$L1 B(B $BjZr1B$J$=t6pt$ =u6t ɋ=t6u6L$xtt tɋ=t65u61L$|1ɅDT t$t RP]58u6UVRP腯 tE{[|$t}SWv]ljUVSWH)SWN]lj_{[ |$t]SW1]ljUVSW)SW ]lj?UVSWٮ)Ӌ$xX#UVSW贮)Ӌ$xX D$4PS $$W$VWVhPWV t61ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =u6t SW%\ t6L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =t6<$\$T$|$(t$,DpLtL|Dx=u6RS:[TtDpt6D$0X0vv[RP[VFvvZ RSZVFt|tx|$8ZD$T$Rl$$D(D,=u6tFB\pTtt6B0FN FNDxD$L|׉L$L$؉D(MU =u6t]RQBZ t6I0VP&ZU EMhɡt6@0 ȃ=u6t3ȃ=u6EhD,t($t6@0MU EhEhD,=t6L$ tL$D$D$=t6,$\$ 1QOP\$  t19}#8@#pLp0l$$ t6ɋD$taVt$P= t6x4ƍ$58u6pS5 t6@0fPt$t$ t6x58u6Sp 8u6=u6tf؋8u6f3t6B09}+^jh3S`k 8u6t6B0N9rF =t6tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL t6taPt$t$$ t6x=t6t$,|$(DxL|DpLt1҉TxT|FN=t6<$09u6QPW)RPWVF^vv{W )RPjWL$(D,D(D,EM =u6\$QP0W t6I0)RPWU EEhhȋ5t6N0 )ȃ=u6t^ȋ5t6T)FN^FV )S\$L$4$*5t6V0)EM Ehh )ЋL$Ev8QS s61Ą^_[]Éjh3p"i $Ph$k=s6thC$7h$߻F & t6@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(F ^nFD$hF$D$pFD$lFt6pt =u6tɡt6=u6L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=u6tf)9F=u6\$tAf)=u6t4f=u6t'fL$=u6fVT$Rt)f~T$JR>>fD>=t6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=s6=u6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=s6t Vt$t$Ut$h$f1Ƀȃ^_[]1A=s6t1=u6<$\$ HfUSWV $8$4}tE1ɉM4M019 t6‹DT 9 u6tRPPM$U(E$f M$E$U( u ^_[]%=uLIt6(9‰|ǃ=s6t<|u=t6tFNFh1 tt6tD$hVP> |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =u6t RPO t6I0VQRP[։D$D$ ЉT$t t6=t6Q8k=t6L$$tL$D$ =u6t QPUO t6#8t@DQL!!IT u‹$8U t#DT tE=u6t!RPND t(=u6t1҉EU}@U=}@|$s6EM QPQPh$3WWhO$聇hs$'uQ{u u t6y0ƃ=t6u6t:tMPWN?UUlCD$T$NQt PWM~V ~V hG$ u6t6@ 뛋5t6F8E -t6T$$tT$D$ =u6t RPmMv0 I)؉$ʉT$t*DT tZ=u6t RP!M$8D t6=u6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|Ws6E$8I QPQPh$3UUhO$薅hs$<$<t7t6Ht)$|$-t6Cq qƃ=t6t0FV=u6|$$tJRPK)RPK4FV =u6|$$t&RPK)RPK)FV )FV hG$u6t6@ USWV|$ \$t4u690u6aTs6 Ps6 ‹-t6t9ˉrux9ˉ\$؉jL$QWPVց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$סt6t`v0WUL t6t6pxjV|$(WS)Љ Ps6Ts6=t6jVPS t6A^_[]WSh$t6@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$t6p0vv_ $G t6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPT19rÃ=u6$t$ \$ti=t6t,ۉ~A1_t4HT\$F9uۉ~1O ɋW @9uG W5u6萲t$ D$x#- t6;Xt|$#=t6t JًL B tmt$v vh&$hWWVt=t6t$$B1ɉL s6t$ $$Bt$ B Ct6;Xt`R5u6踱T$\$1ۃ=t6t%JًT tN=u6t#RPOGBt/=u6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tbs6L$AI QPQPh$7W]WhO$hs$|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=t6t+FV=u6tGRP6F+D$RP&F1FV =u6t*RP F+D$RPE+D$ډFV +D$ډFV hG$u6t6@ 1@$5USWV\$41F~3|$0l$,|!$u6 u69|)S9у} ȃ^_[]Éދt6K89}=s6tOI.A!1‰9)=s6l$,|$0t!t$4PWUh$t6PVWU蝣Nj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=s6!$l$|$ T|$0tN# $ND$T$RPWUh$ t6<$\Ttq!qIVPt$ Sh$$@l$19=s6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh$5t6t$Sh$1Al$,|$0USWVD$,\$( ds6`s6փσ5`s6=ds611 J ls69hs66 ts6ps6Xs69xs6@D$ xs6=t6\$jD$ PL$QT$R/Nց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =|s6s6ts68s6T$ts6‹D$ȉps6ts6s6WUS5s65t6贬= u6l$$-ps6+l$(=t6|$`5s61VV=u6tf%=tjvdv`@VdF`vlvh@VlFht4@TCut4@TCuG9a=s6t< t6(1s6SS=u6tf%=u1=t6u(x$CS =u6t RP?9Ƹs& ɉ @u ɉ @uG9wt$t$t$5s65u6襬s61Ƀ=t6 Xs6^_[]PSh?$awUSWVl$|$t6jVUW' 1ƒ hs6ls6Ts6Ps6=`s6-ds6=ps6-ts6xs69s68#{H1ۃ=t6(=s6-s61|s6s6ډs6t@|s6 -s6=s6Wh s6t^_[]UWhb$Tvh$Jvs6t Pk s6USWV l$ =t61ɅDT =u6t RP= t6Y0މD$ʃQSRV臜 wÉD$4t,PZ 1ơt6$t6QPt$0t$0d$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ t6; t6u3P5t6d =t6t-t6t6d t6t6Qt64 ^_[]h$\tSWV|$t$t6t6QPWV tH 1P1 t^_[WVh$ tVt6tR t6~%t646ci ;5t6s롬t6PJi 5t6=t6RMT$=u6HRP(9L$0ơt6@0 T$D$=t6D$0T$T$4=u6t$$t RPq(Mt$t$$=u6tȋMD(t6@0T$,‹t$(΃=t6u6t+tMVR (uVFt$t$ '7KVR'MQ AD$:MQqD$T$AQ!EL$DT=u6t1ҋ t6q0RP耐 ƋL$ jWSQ'Ӄ=t6D$ t7~SPt$t$$NjT=u6t RP/'|$)~SPt$t$$̅=u6tȋ|$1҉\$$ t/f t6q0RPݏ xËD$L$ L$0|át6@0 T$ʋL$ȃ=t6L$0T$D$t!D$4=u6t)PQj&D$ T$8=u6t@ɉL$ D$ #W艅h8#Wsqs6Ns6?s6b%j 5$<fs6Ph$s6=$<h$Wh$Wc$j Ws6s6Ph$Xs6s6~m_f#j5$<3=mPh$ĪAs6s6/s6$w6$<D$ s6s6s6s6s6s6s6D$ L$uD$t/=s6t=s6D$th$)D$1o3)hD$=s6t s6jj菎th2n j{=s6thIn jchά jT |$D$ D$4CD$=s6u PZP4Džu6h:$%Z|$ tND$Pjt$6譧xND$t$eZL$9|ȉD$t$> (L$9|ȉD$6hJ$$*W N K;D$={6D$te^_[] Ph$jU.萎Phe $hv3 jfUSWVP׉΋\$t$US|* M9t 9u^_[]WVhd$j-USWV Ӊ5s6QW=s6t=s6t h{$X1SW[u=s6h$Xu6=s6u<t6Ph${XCWt h$eXh$XXV=t6t>=s6t h$X=t6t h $Xh0 $X/=s6u hT $WX=s6u hr $W3=s6u h $W6=s6u h $W<=t6t=s6u h $WT t6|$Y8֋T$  SP5Du65@u65Lu65Hu6h $Wd,$kdыt6@DWSQPp|D$T$iщډWSUR5|jj RP胪RPt$t$t$t$t$VD$Ph $V$=s6 t6+0u6 4u6Hu6 Lu6Hu6 Lu6 tQPhJ $ =s6-t6KC)s, @u6-Du6Ջs4HS8\$ ډD$$+ u6$T$$u6 $ $ډ Љ @u6Du6tRQh^ $A =t6t8hs $+5t6tvvh $ 6j =t6t8h $5t6tvvh $ͣ 6j ߢ15t65t65t695t6tmjD% t6405t6h QV-. 5t6Vʍ=u6tt6PPҞ5t6zt6=u6t s6j t6y,t+t61TtRaH t6 t6F;q,rt6P@H t6=u6t =u6th $S{61=t6=s6u h $S=u6t h, $SGRtgD$PhH%vu1D$t)L$ jQPhH%h0r%e<t-=s6u hL $S  ^_[]1USWVt6D$45t6~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B (u6l$9؉|5t6|$0G;~,$LHN4H~KT$މ)1@ (u69׋T$9|5t61҉t$L1F#- Du6@u6Lu6Hu69S,SދD$4HxL$HD$81ۋjV t6ׁ\Tډ\$tQ!QЃQ SPh@t6Et65\t6|$D$Xt1NPSWUlʼnFظ|߃\$ <$w4Ft6<$t LX FuWFsT$ Hu6Lu6$@=u6tfL$fAf|$l$$j * hX t6t6T$ =s6t| $=u6t RP@ RPh $l=s6gq$ʋT=u6t RP WURPVh $($DX=u6tPh $ؔs6h $Eh $frT$ '|$@@u' T$t$SUt$A Pu6t$D$, F=t6=t6$@=u6tffu$@=u6tfft}SU{$@=u6t?f=u6t/ȃ=u6 $ApfAAt$f=u6t $ApfAA $AtfA1ɉ v6 v6 v6 v6l$T\$Xt6pt4$9 u6t ʡt6 u6$tt4$tʡt6 u61ɉ$dtX$t $D$LPt$衹=t6=t6t=s6u,$$@\=u6tȅSUh $C h$,p~SUؾ19 u6t1ɉH\H`HdHhHl$f!B=t6,$(E\=u6tȅƄ$E\=u6tȋ t6I0H111҉,$L$ D$t ߋ t6Y8Om\=u6t͋ t6#8߉@DYL!!ÊIT u,$\$lD`Td t<=u6t RP7 D$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9t6H4 D$|$׉D$|$=t6t݋AQ=u6t-RP!Eh=u6tȋt$|$1҉11 ˉl$$WVRPSUhA$uA=s6th$Ah/$m|$t;SU蕼ƃ=t6D$|t1$=u6t RPFVs6=u6tȉFhܽ$|$jj$$$$SU z $A`Id=u6tEQP` $plphG1$D=u6tWUPVhb $  $AhQl D\$C5t6;^,T$$L$ v6v6׃ƃ=v65v6 t69˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-t6t$| ؋T$(tu3D$1 Kl$@؃,Ut$H . ƋD$9\$(s+l$ Uh. $>jÄSWUt$@hR $h' $m=j[sUSWV |$ ow@u Xw VUp D$t|VUh$w wv6 v6ʃǃv6=v6|$ |:w wh $= =s6h $qjG $D$|$tjVU¾ (u6<)1CVUh$D$,p p*v6 v6ʃǃv6=v6 j hp t6tHt6 t69tDy1Y1 t 9u,@u6Du6$|$ ,t6t6Q1I1 ы|$ tt6$G0W4L$Aڃ]D$ p ph $J< =s6t)h$1C+s6h $;h $h1Ct ؃ ^_[]s6jpjfUSWVP$T$1B@B51 t6v6t6x,11=Tu6t>Q:t6x,$kd1PWSQh$hv3Tu6t61ۃVU聶tzljl$ t$t6pt=u6tʡt6 u61ɉT$HtttȉD$LVUz8tD$PWbu(Ct6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$v6ŅtTM1ًU1 u3VSh$w wv6HPUMpXv6 t69tmu1 t6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $(='h$F9h;$eh$ejj聴=t6u6f@=u6fh$8h=$eeU1hPVPVҜ1Bh$8h;$'et21VWhVWVW莜1 tah$+7s6h $du<tf@=u6tf @f=t6tjjxfhh; j5t65t61T$1B@B{; -t6t6  $Tu6$Wt>E6+5t6=t6kdPWVQhM$hv3шTu6uF$hp$vv 躑 8u6A1ڍF$h$cvv 6ǃ=t6F$ u6&jP1 8u6I F NQPQPhSt=t6F$ 8u6t%QjPSh$$h$>6#s6QjPSh$$h$36=s6th$=s61F$8u6 I1)щN$uh$b-vv *ǃ=t6F$ u6$Wt jPw1҉GW1҉GW }hjD$\PJh =t6u6D$tt7fD$T@jv$-fD$T@jv$fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=t6$tD$\=u6tL$Lu$D$PD$PD$XPyTu6;,$/s6$W=u6vu65t6;4$]|$T{$AhjW*f -t6=u6tt0fD$T@js$&tPfD$T@js$FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=t6$|$TtD$\=u6tD$L$|$TtD$\D$PD$PW٧;4$=t6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h$ss QPTh$(^t~s sqf@fNCKK CQPhB#ss oOCK =s6th$ss QPCKhB#QPss fN s6;<$=t6t64~^1ۋ/uu q]]8u9rۋ=t6/CK tS  StQP HKX9rjj轄`^_[]s6j&ejcvPh1$/L$D$@, +A,USWV $0 n8$=t6ui=t6t`E=u6tȅtNE=u6t$;0u64u6s&E=u6tjPo@E$F0N4 utEhQ%PW)$0 F=u6tȍL$A=t6AAhhQ%Q t6 u6tD$D$L$L$D$h$v v薉 E=u6tfM9v%}EPh($.O$h$4[4/E=u6f)=u6f=u6fEtf=u6t΋$0 AI 1 h$QP辈 h$Z$0 F=u6tȉE$$PpZEL$fAWQUZ $)fEPUV8 =u6tfD$fXWPU $0 G0W4w wmfH$Xs6$0 =t6t>}t8h$v v贇 h$Yu EBs6F0N411G9 v vGD$@=u6tȍL$A=t6AAhhB#QO u6 t6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=u6t2f)=u6t%ffD$=u6ffu6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=u6tfPjUZ^ D$fEutEhB#PSl$L$Aq $0 JR ωtljhx$RQUW݅l$EMك9v%}EPh$*$h$qWD$$0 T$ 3F0V4=s6h$rڃD$=u6t΋D$p@ =t6X}$0 ~h`$v vڄ Eh$VJs6B$$0 1GPVtXD$T$ F0V4=s6h$褬ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV D$fXSPU E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQUy $EtMw\}.uVV4~0|Juh$ } .u8h$v v% Eh$ U4$F0V4=u6tȋ 4u690u6s5h$juv v݂h$T4$=t6E=u6tȃu}uE=u6tȃtb}u\FN U=u6tʋ4$h$jRQPX=u6t}Eh$T1 u6EtjPgC$0 A4y0$$0 t=s6$=t6JR u=u6tPjVRQ菁h$cSƋE=u6tjP1Ƀ=u6t fu61ہ@€@t f u6fGs64$Crv $0 A4y0AI U=u6tʋ4$h$jRQP褀h$xRs6zE=u6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=u6l$\$tȋM=u6t1퍜$UQUPhScSh?$$"Ph5$ %9-s6th$ڧl$\$ h$zQƃl$\$$0 A4y0| AI KC=t6taEO9tU$0 AI U=u6thg$jRQP%GEh$Pu $ s6fO4$E  ^_[]ËM PShv$"ȃ=u6tUSWVT t6t6,=Tu6t>)"=t6kdPWVQh$hv3uTu6}ww cO W $T$ WGO ƀÄ:1=s6t4=u6t+=t6t"uGO 1F9ƺw1 tbQPc8uS=Pu6xJ1v6KNj@ $GD$wOG tQPb8u E;-Pu6|E;-Pu6=4$h$b"h$ORv6话11|$D$HNL$D$D$D$$D$D$ p D$TD$Dt6pt =u6t ɡt6-u6L$Ltt tȉ݉D$PD$PRmu h$!D$TPv6t$t$~tyD$ K v6ΜL$QPt4t$t$af@jw wt$t$~t Ls6Hs61JQPFafpt69)T^_[]fUSWVT1ۍT$1B?M t6x,@=Tu6t;t6p,kd1PVSQh$hv3rTu6t6 t6<\$11ۃVU衛VUm`$t$l$ t6pt<=u6tϋ t6u61҉|$Ltt<8tϋ t6u61҉|$PdtX 8Džtɋ$L$HQ$@='xtCVU誓tV=s6VUhE$^1=t6L L tOjh$st6tuQ1y1 t6 u_VUYdtl=s6tHVUho$m7jh$$PxyQ t6P, jhv$D$P Ct6L$;JWD$ Pt6t6tDŽ$@t$`$L$$8t$ٍ؉$<P ={6jj030^_SWV301GW蜑WS0jS030^_[USWV$t6u6=s6$XPVm=s6u6#$`= t#Vh "oh $)jV۟ t6R=s6<$8u6=s6t h'$Vh7$Kw61t6Ls6Hs6t61I t6 t6t65t6t6t6h$h$ udt6ǀh P5t6g 5t65t6,=u6tt6PP>5t6t6t6@ t6HHщ8<=s6th $o=s6uh$u_h 5t65t6} 5t65t6&=u6tt6PP75t6't6t6t6ǀ,04ǀ(<HHPLщ8<҉@Dh P5t6e 5t65t6"=u6tt6PP45t6t6 <:e=t6s6ht6h $=s6z녀x 1=t6t6t6h V5t6У 5t65t6h=u6tt6PPp5t6zt6hs65u6hdt65u65t6 h@t65u65\t6=s61t?s6t71FW5u6ms赽S謽ts6uˡs6)1t6t69s6t6=s6th!$h+!$=s6t6ƀ1TPXh P5t6J 5t65t695u6tt6PP5t6t6hs65u6R=s6uh"$!K s6=s6h"$Jt6h 5t65t6蘡 5t65t60=u6tt6PP85t6Bt6hs65u6=s6hm"$jJt6h 5t65t6 5t65t6=u6tt6PP5t6t6hs65u6=s6t" }65}6kdPVQhB!$:5t6%k u60k ^_[Ph $VD$\TL$ 0P   Lu5PP\RQP艟 ^SWV׉΋\$=s6u j SWVhY"$h $Ct^_[j USWV$L$8t6D$X81޺)Ήt$ A$u65 u6)‰t$T$Ѓt6$=(u6AD$1\$|$ xk1ɍ1݀s A;L$ |9T$ l$|$8|XA\$rAKu.\$މ1;t$L$nd11[l$D$遽\TtM!M\$8M VPh@t6t65\t6t$ u6u6ttut5t6t$5\t6{ $xU t$U tWh$5t6D$T$|$$D$ D$T$1Elj (u6р $yU L$ u$K`ى BGNu5t6\$8|$@u6Du69^8u?$JLL8N`D$jPRV 5t6 $)Y$) L)\8 h V5t6% 5t65t6=u6tt6PP 5t6t6h@t6`t6D$T$ $^_[]Vt$t65t6v =u6t5t6v5t6 ^USWVLt$h\$`l$d1jZr R:P^_[]USWVTt$xl$tL$p|$lȃ u D$|uWhH%mUQ=}6uR<sJ}61\$|11 ʍT$ ٰBPVQ D>/|)Ot$L$6}62}6$!D$h8J}6$ D$tB?JL$h)PRQxSWVD$t$ 4u6950u6r==t6 t6jSPV\)޹394v t^_[PVh!$CWV|$ wu$='1XD$@uPw w Ph"$*=s6th"$Ah!$t ^_Ph!$趽Tu6USWV$\TM@$ 5uh`Xh`VP =s6t h"$;A= u61ۃL뀃=u6t\,L$UPQ  DPPz$\, u6L$L$UPQ |$u $PP@1LDffLD@9u=u6t8PP\u6L$UQP~ t"PP\L$UQPX  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h"$(USWV\$t$=t6!ߋ,t9Xt6@u|$t&jt1ɉH HHXh1^_[]h="$VD$ L$5t6#p9tыR9u @^USWVt$|$VW/t6!t7^Fu+11 33 1u{ t6tqt$0|$,\$(l$$T$}6t9PtjRQ }6(Xxp L$ }6t9HtjQ5t6 }6(Xxp ^_[]WV t61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$h@'$1Aȋ$sY9UD>'< >'Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$='4  <Qh(#$h #$脹D$P`wZL$ D$$='1B(ɀ!1Rh4#$h #$SD$H`wPD$T$ $>'1C%   [QhD#$h #$衸SD$H`wND$T$ $>'1C%  [QhQ#$h #$6USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tW%ƅuWhu"j$$<$4D$Phd@UD tj1OLVhedAU5 F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;%t$U 1 Sh"U詩 CPh8"UG C Ph"U5 CPh"U# CPh"U CK,C,Qh/"U C0PhD"U $@D$t P@ 1-Uhzd@$<W t1 VhedAW hjU D$ P$4eD$, 9L$ L$9u0$S11:"8tx$0h"܃b$11҉ $ƅ*ŰP$ j PUؕ ^_[]$0h"jUSWV81ۍD$4ShPSu0 1NtAljSPSWuWV uMU D$t$$$Q1e^_[]fUSWV]D$D$ PSd$1NHD$ D$(%=@= j/Sxr)ك$0PSQh^#$hRUD$jPiǻ\$$0PS: Ou\$ |E tÉ\$D$D$ D$|$$D$ PSc1@$D$hh ST ƅ%D$ PVD$3D$ 3|$$  D$uH$0PS $8$P$TRPV VT D$4@D$1$Vht#$jSVjSS ƅxc1GD$ PhFV&  8u;V{T Wht#$jSjjS}S Gy D$t P9<$t t$ 1Ox VT e^_[]D$(%= tn=@u$0Shf#$hPSY Ɖ\$1@$D$:\$ D$ PS`B$D$jSR }tSntN$PhF|@V x4D$t P.U$$JhF V$USWVP1hUU= ƉRP)9-u6t1@fCM+PUUSF t6;A0u $ytWVC^_[]Ë\$-t65u6SUqRPX$@ `t6ؔؐh P5t6s 5t65t6 =u6tt6PP5t6t6[USWVt$(~Oholu6tUQ5tՉ 1=t6L$$t| tWVsƉt$$H$át6@05u6QPWVsUC cMhml=u6tUQsՋt$( }t6@0ˉ9Éʉ\$4$rQPUt$@LPDTGlOh|$ wL$,=u6tȋ|$t61ɉSh$$=s6th)$+h$lt$" t6QP#T$1RQQD$P1Aát6;X0t$~~1Ƀ=t6T$DT =u6|$t RP oL$ pL$QSRPzǍP֋}6$|$1D$D$t1)ÉعF@jPDD`r9w<$r$l$T1C @<$9uG<$;|$}t6X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡt6@0)ȃ`T$1ۡ}6ـ#h$$b=s6th $.)h$ ع`֋,$L$t1ɉȉD$ օt$ tH t6i0T$,RQUt$> t6;A0l$,} $L$l$l$,t6@0D$Mt$ |1TT1PD$T$ ʃ=u6t RPAlL$(ωQM D$H 9tet$C9\$t$$h$$ s64$F4$;t$SD$`1s60^_[]ËL$ ʋ t6f9u Sh$$褤D$`,t$$h$$lj t6Ph.$$CUSWVT$L$D$0(D$ X=u6tSUjʼnӉ OD$$t6@09ʼn} t$t$5D$PSUt$< t6;A0 t$~QPSU~t$4SUWt$T$LtL$A L$ Q5u6t9RPt$ƉT$ 7jt$1ӋT$1 t<$G RQjD11 u5\$$9t ;D$t`GPD$ GPWTt RPi$<$G L$;L$t9ta щʼn$;D$t`1h%$辢^_[]USWV t6$t6x0UWt$0t$0=uƉt$ыt$$)‹\$(19r11 $p|$ )Qj`PRt }6T$4$1B srl$,$ ȈU1wX=u6t t6!9GX=u6tȋL$,1Ph%$蚡 }6L$ $  h%$y=s6th $E$h$t$D$OPWTP1GTGP^_[]s61USWV|$,u$tz$t61@$t6sll$t6tt6 L$  ƍD$1PQQVK9 t6;A0-T$zu D$`1]l$z$Ń1EGpD$hn D$ Pt$ u&xMt(T$hn D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh%$џ=s6th&$"h;%$Et3s ss3st$Vn[E;,$us6'%t#Ph$$0jRUSWV0\$T|$HOX=u6t1D$,D$(D$$D$ D$D$PL$Qs tPst$OGu6҉L$D$td$PQeÉ׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQʇC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h($'h'$h%($h h&$Ph($O4$V0Vh'$h'$h h'$hn'$hWVt$ F,t@}6th($>F,P裆1~,>d9~8uv0腆^_h'$h'$h h&$%D$x,u@Pt POGh'$h&$h h&$WV΋I01t*N8~2IN8tPQP PN0G;~4vɃ~8u^_h'$h'$h, h&$h'$h'$h2 USWVEH1Bx,T$1huM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vSe^_[]h'$h'$hF h&$USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hJ($h($hK h&$螿USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h'$h0'$h` hF'$h0'$ha h&$USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h'$h\'$hq hF'$h\'$hs h&$+USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hJ($h7($h~ h&$肽fUSWV\$$|$ l$t$}6t5u6SWUh($ USWV5u6 1^_[]USWV\$$|$ l$t$}6t5t6SWUh)$USWV5t61^_[]V=s6th5)$Œ2j5}6Htahj)$腌h $+tS}6xL~61 }6 s"@Pt4h)$@ }6}6F;pL|^5}6vjC}6t'x,tP}6P}6á}6t x,tt$t$t$t$P1WVt$|$ VW=t6dtX=u6ts,t6`uau33 u1@1^_WV s6t1 }6 t61!`u/aʀs2hlpx1Ph)$ԊPh)$h $gJh)$蹊t6 ǀdƀah P5t6'd 5t65t6=u6tt6PP5t6Ѱt6t6!1111QWRPjh}6hh *$h $艶lh)$ۉt6 ǀdh P5t6Pc 5t65t6=u6tt6PP5t6t6 t6dPs+aʀu Ph)$PhC*$h $蟵h+*$t6ǀdƀah P5t6ib 5t65t6=u6tt6PP 5t6t6^_jUSWV1L$ AL$HAL$@AL$<L$ PP'L$A LP'AHP'ADP']u }h*$SVd ka~(bt@it YltAsttuJD$PW,5uVPD$DPD$DPD$,PW(D$HPWC# D$ PW$uh@'jƉe^_[]Ãu95o3ujhDP'D$P9 u1PPD$Pje95o3t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQjXRPt$8t$@t$8t$@W1u2h+$R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]S^kt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ S t$\D$Ph&r#hV^D$@w ww7VPh~+$S 1h+$+hY+$WfUSWV1L$(AL$$t$@L$ D$ }] h+$WS` aLuKVbtit'cD$ Pu D$(Pu3 D$$Pu udt AuZD$ 9o3u~]#D1غ$Phzd@  tN|$$tOh@'j[t$ Swt$@Gw1Oe^_[]h@'j'11J$THPT$,L$(HL$x1VVVVV]PeT$4 @T$ƋD$(D$8D$,D$4D$$D$$\$STjPjt$ t$jjW: X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPNDE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q to H @AQ@A$Q @QHALh1$SYh1$h1$USWVP\$|$tus$" $"$jcRtQ1@PVSjPt$8t$8W E1u>4$h,4$W VXSh3$W4$h 4$W 1H^_[]UWV} uOʃ$<|RQPh2$VJPREx& $T$W1ٹ|$5$<h#2$ 5$<h"VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhDP'V 1OujV5$<>uW?,VQ>~Ih32$Q1$VQ7 t1PhE2$Qx 1O^_SWVP|$1N?u;j S5$<Ż 8u1u5$<h"t$ ^_[WV|$1N?t5$<<1t^_h3$t$USWV 1O1;B։ˍD$ j P5$< уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5$<8Cx(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,jhDP't$$ tjVt$$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0wh^2$VIz1t^_[]1;BB  FjhDP'P 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hn2$W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Phx2$Q 1HUSWVt$|$ t)l$\$$jWUS= tWUSh2$1h2$V*l$(\$$jWUS  tWUSh2$V1H^_[]Ã|jWUS011USWV\$1s3hr%5$< t^1WTE'tuWh"3$t$ 1N\E'XE' Chr%jj Džu^_[]WV|$ `E'TE'Wh>3$u^_USWV t$@\$RPh 6$ h6$zjV p FQPh6$L v,v(h;6$ v4v0hO6$ F8Ph&r#hWU3Whb6$vPht6$1$hTE'jIĈh6$1HĀ^_fUSWV)L$T$PXh L$$AH $HtAh 8$t$$1N ^_[]Åt.yt?hH8$9}ۅyh8$h$8$h7$t$$룋Br t$qD$Ƌy |$ tj $SUWV)׉T$1Љ\$1 uc։[)1yqy Kh8$0A)ډI 9Љ}Lh8$rz ABAtP9։}mWVSRhi8$t$4)ً$BJ l$$+]\$] l$*l$$Z u $AEAthnu} l$$u)Љى} $KS)‹C ȉC ЉSZًCECD$ $t|$$L$|$t$,t$4RQBL$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh=$P%1D$Bh=$ D$_$ӃD$DL$H(X,EP!t$@E X,L$H(u4$t$w7t$Hh>$u1fUSWVPM(,|$8O] D$1h>>$uS sujsWVVuutqD$9o31t$$u_hM'jwOt$$S4T$,D$$\$(ju)t Hth>$u_1Ne^_[]ÉD$H@ D$ juVjVH A D$ $Y$jV jV tuh>$uD$3D$3L$ u41D$Bh>$u-hN0$h>$V\$D|$ ]HL$H L$p $HTHP1ۿ $9s611jhDP'V" tN(F,9ˉ|ىˉǃ;4$rΉD$+D$T$щߋ\$9ljD$ +D$L$,9t$L$;L$|$D$11CT$09Ӌ\$49щ;L$$|$( $$T$u11҃]|r tht^1B$D$the?$SG 0+T$x|$yRt$h?$udh8?$D$t$th?$S11A $1A;L$0D$4D$,L$ |L$Vt$VjS @L$)΋T$׋jp jRQWVS 6 $p q @  yq @N F$FV0~4j\V軻FSȾ H @AQ@Q A$Pƃ׃q0y4QLAHS?D$ ulD$ \$$ $L$(|T$ |D$ fft$Hu1h?$h?$Sh?$SfUSWV0u1L$ L$AL$AD$] }D$h7@$VS a~bt1iugD$ PW*u5D$PW$D$PWut3NT$T${lh^&_1D$|$|HWt;L$L$(L$L$$xupt3L$(P3T$$ t @ut$ t 9o3uD$L$ t!T$ T$th0M'jve^_[]t$t$ QPt$WߐUSWV}u 1L$ \$CD$hY@$WV t4H w]$DM'SuF D$ Puuut%xL$룃L$뜃L$땃L$뎃L$뇃95o3j}Wqu hiB$ \$D$|$|=W`t0L$T$xuXt01΋x1 }@u؋\$ mWt9^\vuShB$W 1HhM'je^_[]þc@$h2q% VE hM/$ V1 hB$$WD$p@$D$i@$v6 \$Sv v S΀0v3H 0v3;@v3h(v3j Ն(v3H (v3 \$'0v3H 0v3;@v3h(v3j 蕆(v3H (v3 FtHPhw@$=N1v6v C 0v3H 0v3~a(v3H (v3 ]h #N1v6v  0v3H 0v3 (v3H (v3 h(v3j օ^ Sh"$P|$3W \$Sh&r#P$ S SWXuhhO&W) Wh}@$;~u(h,~6h&r#hSe Sh@$)Sh@$~D$Ph&r#hS, }Sh@$~hA$~$f~ jj h$r#RPj|$7WW xWh"$~"$f~ RPh~"a~ 0v3H 0v3~(v3H (v3 h(v3j ]|$G8jm$Sj$P蟴Sh(A$~hTA$}G0O4 tQPh$PPhB$ñ}qh(v3j ߃FHsF 8-uJF $1҉QQ$$Ph&r#hSSh@$M}vG1c@$h2q% V"} hM/$ V} hB$WpD$p@$D$tD$i@$1ot$w7] V|w w V|0v3H 0v3;@v3h(v3j 謂(v3H (v3 \$0v3H 0v3;@v3h(v3j l(v3H (v3 GtPheB$| h #|0v3H 0v3;@v3h(v3j (v3H (v3 0v3H 0v3;@v3h(v3j Ё(v3H (v3 Ow7w  0v3H 0v3~(v3H (v3 h(v3j thF D$Sh0B${$1۹GB$v6SJ $|$5$v vS, \$'Wh"$PS$Wh&r#PVVS7TuhhO&Sp VShMB$z GPh&r#hVVh@$\zG8$jmVj$PҰVhIA$6zhuA$)zG0O4 t#$QPhRP\$ RhB$USWVӋ$$$$tM'hA$" Ft hA$yhA$yF ~1ɋӉ13$ 6@uhA$hA$hA$=yl8|$Vh&r#hWaWuQh B$yĘ> t hA$xhZ-$x 1A AAt$Qh&r#hVVhA$hA$hA$xĔhA$nx|$uhusuqVhB$ohn-$FxuuulhA$A$t$r#PRhnp%xĜ;8jmWj$VzVh&r#hWWhA$wĐ^_[]USWV΋\$$|$ ʉl$͍L$jj h$r#UPjQ< yD$SWVh\B$cw|$tUhe$Nwj dv ^_[]USWVDt$`l$\\$XT$1 PP'A LP'AHP'ADP'B0B$` h C$VU k)Hw]r$uStJPSu7HsutPD$PS uhM'jD^_[]1Hu߅tjhDP'D$P t9-o3uPhsDD$PS벃luh^&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uhHC$SW a~bt)iuRt7D$PV"uUt$D$PVtD$PV8uhM'jռe^_[]Ãluh^&1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=o3d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H H~6H D~6@@~6 <~6h<~61H~6FD~6F@~6F<~6F^Vt$|$uD$ hL~60X~6FDT~6F@P~6F+H$tQt "hF$Pg )j$PK hG$Vg hG$D$ Pzg jhPK D$0Ph*$t$D D$0$L$ 11t$ L$ D$PhG$t$ bD$\Pt$ tpt$hH$S 1O1P V膡 0h6H$hWH$S辥V` hyH$S袥t$A ֋D$+D$ L$,D$D$@L$$L$u$L$4fL$fB$PhG$SI $PhG$S( t$( Åt$(> $fǀU1PPPE(!ƒ[u$t$V ;$4t$8螋 D$t$膟 fËt$01 |$lD$Ph^&S( D$lPt$WD$PhG$S D$|Pt$#$Ph2q%SM `$Ph$S/ B$Ph@ #S $D$Ph$Sf tj$$Pt$ 蛔 D$DPh)C$Sy D$D9M$ $ȃhL$pQP t$" Åt$L U$61QQP&!ƒ~t$ M$$VPa 9U]$|$$D$jRP?&!ƒ=M$$VP 9E$1SP|$W? GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$2Dn }71ۀ=6jU ED$E\$S1QQhWPU$thh$r#W% WhFJ$7XjU ~11ɋ\$luAu꺀UtPBD$ 1ۉs KuT$ )ڃt rKu\$t| It11ҋ\$RhǍ"WF$;td~jW Ƅ$;t$1QQh$KQPW$W#thh$r#W WhPJ$0WjvhWJ$h$LUaUhJ$WD$tPhJ$VjL ZjNh jl$ U: jvU F QPD$0P Uhji W  tpD$4 D$,L$0 L$( $;jljhJ$AVT$0L$4 tH)Љ|M1K=8/$;=81$;tyhJ$mjhJ$UPhk%UhJ$UL$(D$, t )|1hJ$UWhk%U$;|$tv vSj T6D$1P@ ^_[]h;J$h-J$ h\$hY)&jM USWV $ShQ'U  ǾR'󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAHT3qL1ATAPAXkiA\J$A`i AdJ$Ah!i AlK$Ap~fQ$0$0 ^_[]ËL$L$ USWVuE X8D$Ph#V' |$V V (C 1Љً(L$I$1 sD$P^D$D$ t2t$ ^ {uWv,u{u C $\$uoh8M$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSP 0t,hTM$ MHtU4uL9rRQP t$|$t%u@uhVq tI181tSul|$tDEM9rQWPJ u@u`V+ u@yu@u`V teEptUt$8ЃtEu8uXV t, ^_[]hL$hK$AhL$h-J$5hL$h M$)u\u\hjM$udShM$j wlh"$j fUSWVt$H 1tvt$I t[Sĉ tCPS Vt$K tPUWL uWj S 1S贉 WG ^_[]USWVu]PhM$S t$f1j?1Nt}ǍD$ Phk$S td\$ t\hjD$Pe+ jS\$Se ShiWV t$E L$Uf jQhM$P je^_[]PPhk$t$N u1$YVPt$ t$t$V tPhk$V u1$^USWVt$t$0I t Nj\$ Pd 9vA.? 4.1N*Ƌl$Wd VPUr )SjUB* ^_[]USWVt$t$H t?Nj\$ Pc 9s9Ƌl$Wc VPU )SjU) - -?1N^_[]UPh'&u t$U-1H]USWV@uPhqM$Vk ] hM$VG tPc |$ P\$$ShiV\@ |$ jSKa PhM$u I VM ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP` t!PhM$SmI V 1He^_[]hq%hM$hhzM$%WV|$$hM$WF t;Pa u1Va jPVG VhiWQ? t^_hM$hM$jVhzM$4%hN$j( Vt~6h3V V |~6hvV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh6N$hV>tVhlN$FCV FߋD$t$j7QPh6N$hVd>tVhN$CVF߁^UVuPhU$V t3$L$ AQhiV= u hU$1e^]hq%hU$hhP$#UVuPhU$VI t3$L$ AQhiVe= u hU$1e^]hq%hU$hhP$6#UWV}W#ƉPhǝ$W tZt4$P<tW@PV] tGPhXU$u WF t>V1e^_]hq%hU$hhP$"hAU$hU$hU$ hU$hV$jq htU$t$C tPhXU$t$E Hh4E&hSU$hhP$,"WVPt$|$D$PVW tKD$tUhL$WKC tPhL$VxE H^_h4E&h`U$hhP$!h`U$h M$j hM$ju SWV$h]Q$SB t]P] GAsdW*t^WPh]Q$StNpxPhiS3; u?Vn1'1HĐ^_[hIV$h^V$hwV$j hQ$j USWV 1CCj7Shxi P  uhT$?,$P^uhT$#Ɖl$D$Shxi WL  u hU$jh $L$9~D$~*1t j 4>Sh"$?G;|$|j >VZj6USWVH]'D$@]'D$<]'D$85 6u#D$1D$11D$=6D$(Pju h5T$|$T$(L$,T$։L$ ȉƒ\$06eĉL$T$|$|$ɚ; t$D$\$=6u11D$\$W|$|$ |$|$|$ |$ ʚ;||$t$ L$ӋD$D$t$\$\$Ë|$t$ D$$Pvzu h\$j t$ D$D$t$$1|$\$F =3@O9t uGtMF L$u@T$(\$,T$ 3T$3L$ u L$9L$0 L$9L$ \$ \$} VЃuGt^VЃtTjD$ t-P`Y fxPV5t'P1^_h4E&h7U$hhP$hAU$j WVPt$|$D$PVW\ tThtU$W= t)T$~$tXU$PQV? H^_h4E&hoU$hhP$!hoU$h M$j SWV\$,hS$SK= t`P>X GWt\WPhS$STtL@xpPhiS5 t5V1"1H^_[hV$h0V$j< hQ$j` USWV8}D$PhQO$W u \$Sc1OtjL$D$ x L$, D$0!1҉ƒt$u !L$,T$ !D$0j SU t$PhR$VV> D$Sv |$Oe^_[]hq%hT$hfhP$USWVuPhWO$V- tg|$ WhiVO4 t$L$x f D$1H01҉ʉ$T$Hf!D$WhiV4 1؍e^_[]hq%h~U$h0hP$UVuPh^O$V t,jt$V 4 1u"h)U$h"$  1He^]WVPt$V't&ǍD$Pt$V> u WhQ$jJ P=/D$L$AËD$L$AËD$L$AËD$L$AËD$ 331ËD$ 331ËD$ 331ËD$ 331ËD$H@3 31SV\$ Sh3euCЃ r"CrCr 01H^[h3H?r  ؈31ыL$t ă61ÍAЃ r)Aw AwÉO1HUSWV1t$ D$hVPe 3x̃6t8u^ă6ǁȃ6̃6Ѓ6ԃ6؃6܃66666666@wh3R&uhCT$0h39&uhfT$ht3 &u h~T$jĻ $53tvh3%616663tt3$h3$U! ƃV B~>CN6F v/FwD$\T' 6Au"hO$E$,T'6xu>Wu4D$P1VhVVj V5$< 69t$:*ƀă6l `C Lvms33u$366r6 6D$P1VhVVj V5$<< 69t$taY6>6O 6CatTl5$3+wtz39t3 3$ÿ3؉$3o3 6$u = 6uB=ڃ6=6=6u|t = 6u =Ӄ6uftu^ 6uS$ttH)ŋ$L$ T$ RQL$QWPU%u(0 u&h{"hO$,5$<hy%j> t$PD$P & u hO$D$t,DtVPyDžuh{"hO$JW WtS)uh{"hK$Wuh{"h-J$3t H9t@h{"hO$$@ t%VWЃ$Wjm(heP$h{"h*hP$TUSWV[. uhV$hO$j/ Ƹ3jmP$r#$r#thT$j2 hpQ$b1ÃD$ 1ɉJJJ JJ BRhiP) t1hQ$jٴ $1ɉJJRhiP) u 1ĐhQ$j蚴 Qh3USWV΅t R- + + 0($D$Pj!\$D$1t$$tsVpsD$tVPSVhk$W< trC=6D$uCt\=6uCuM= 6uCt>= 6uLhj$VD VhiWn( t!$uۋt$$4u=6t ~ j %,h(v3s5Wt& 3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhR$h$VVUhR$>, jl$U$V' Vhit$ t$,$t!PhR$+VhR$d,$jt$Vҷ Vh~it$ t$tPhR$+j *ꍄ$P$$ j:QPhR$h$P蕻$t'$UhMS$&+UE}uj:$$hR$h$P:$t'$Uh_S$*UE}u-34$tVWUmuj|$W$V脶 $$ DŽ$@Vhit$VX u$ hlS$@*1@Pl$U%jWl$0U 1@D$81D$ƉPV56蠞 ǣ6V1u 6$h#Z1H^_h%hZ$hhY$AWVPt$T$hX$Vt tbP: VZ: PWtIƉPV56 ǣ6V1u! 6$h#61H^_USWVt$T$1hZ$V thƋ-6P9 V9 PWt6ƉPWwt>Vx ݉-611H^_[]h%hZ$h2hY$h_f#fSWV|$ ta1H>t$|$\$jcB PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$VO7 tE$$PwCt/$F ~G F1 ~ 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP Ɖ׃с11E9r 8"t$8t1H^_[];sC| C 9s} "WV t/t$ L$Ps(,tD$$F ^C F1w USWVuD$ tV} ]CtP7  tEC tP7 u/D$ Ph'&7N u$D$1$1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$Vdt|$,$hr%W)"D${&tD$1{tj/t$ltAL$L$4yyyyy D$AAD$ PQt$ t$ <tsË|$D$4t'u#D$XPt$ED$4D$4D$ PD$8Pt$ t$ ÅuD$ xo1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr1X \$TfD$t7|$0j WPO t9t1ۉD$=r"11HD$$P&|$1OL$L$D$L$T$PQRh[$V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$PªNjD$fVSP sD$ t P4$W1 W<4$uM S]s {te|$t^t$Vt$t_@PWR1 W舺tNVsE0 ߉VuBR ۉt3EF ^C F1Vt$hD[$h%[$hD[$hU$ hD[$hV$j՚ WVt$tVer81H^_Vf t3t$L$|$ Pwt΋D$F ~G F1 USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'<$t@1@>.1-t P)P 1GG GGq1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7 t+{0t>-uUst>Vszt)u {1H^_[]Ís s(CtP7# uCtP7  t1@뿋C$1$_'4v6G !6^ P8  v6 tMtk $t$ 4$UQ$t^hmb$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh`$jM 1Hx^_[]hQb$h>b$j WV0t$<|$jWh]$V萴t8W t7HfJBRhiV t!10^_ha$ha$Wha$j h]$j裀 SWV\6h3VSd6h3W@VgW^l6hV3t6hW|6hSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UWJ Whi$ U $!hb$$HQPۍ\$4|$fGWhiU t$b$f|$*ub$=6t PfD$(WhiU t$b$f|$*ub$=6t P{|$fG WhiU t2D$*=) Phb$C=6t hc$+fD$(IWhiU> t2D$*=) Phc$=6t hc$1Shi8U |$Dhc$1tPDL@uShi8U t$HuM1|TuD@uD$L|Cp}3L$P9Dzty:t|$jQh\b$肍 uVh c$11t j,DLxPtT h\b$v<u h"$j $PhiU tDh$c$$t$h0c$l hRV#]j sPhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR PhJc$$=tPhTc$j $=tPh@c$^_[]Phb$j{ hv3jhh]c$蓩ÃD$1ɉJJ JJ fBRhiPm t1h]$jZ{ 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h`$j{ USWV,$@$PhiV tr$A jjj"蒀 xgljj2 xi$-hSWH xB$/uE$0uf$Ciu.h^$u1H hS^$uhm^$uWuI 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h^$hʘ%h^$h^$h`$h]$h_$QL$4Qh^$3(D$f($-D$](E!L$:!PS E P $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q 6t 6E6tIAtcAtCAtPA tSA@tBAyAAT$h6UWt$PVt$D$VPRRh^$,l$ }"E!Ê<)\<$Pa'=6`Cs|$[VPWl$Ph_$hN_$T#<*<0<2=6<$ _$<t_$sQh"$D#1L;$r#y3`$QRPhC<#Gr%9u<]K%C=Ph:_$h"$=6S<$CPhr_$jKPhw_$TK s k t?L$D$F~_$PWhrx% N4%܋L$D$(Mu} L$D$D$F_$PtPtPu_$_$ _$"QPhrx% N4%D$ŋL$D$(ȉ</=6%<C<$a'W`$=6CPh_$=6CKSRQPh&_$hW_$C~@sFNuQPhk_$ IRQPha_$Muj>l$ L=6?CPh/_$Y(shI_$h"$>=6<$CPhr_$KPhw_$Ck tAt$D$x~_$\PVhrx% O4%܋D$t$)E}twt$D$p_$ttu_$_$ _$"QPhrx%V N4%D$<t$)ƃl$ rPh_$j>.<$€5`$$pa'>`$rQ=PuJC<u;h?_$h"$=6yCKQPh_$ ]=6PȹD_$6<"<`$G`$ L`$b`$l`$t`$|`$`$`$`$`$`$`$h?_$h"$=6<$CPh_$1D3 $r#t(`$T3 ׃l3 URWPQ4e'h_$euj>sl$ <`$`$CPCHÃ)gj .EŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]h)^$h^$jIp WVD$(1www ww7fWfGfGwWhiQ6 uh|^${k1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQ} ;l$D$tD...P[^_[]WhO$QW} 1<$tɍGrD$X1.Ph#SXp E;,$sGwUSWV։ϋ\$Qh"$W)Ǎ 9~)j<t+~'K1.Ph#9t OE܄u j-j>^_[]ø we'ø"øSw f'ø"VPt$ D$Ph7a$V菋 tD$P^hq%h4a$hh`$HVPt$ D$Phb$VB tD$P^hq%h@a$hh`$WVt$(|$WhiV tgD$Phaa$Vڊ t7D$D$WhiV 1uhka$h1H^_hq%h\a$hh`$shLa$jgm fUSWV8 y h d$hhz%-R y h$d$|hjhTd$t\qiL$jQPC D$tPh=f$$hjhTd$ D31 VPh  VPUSWQRPh;`$1EVRQUhgBVWhr. 1H\$(C CCVWPPUPP P P PPPPS8VSj9 |$www wwVWj# VWj V: S: W: D$ @ )T$VVQRWPء1I9u 8tމ56 D3tщ1@8^_[]hTf$cfj 9jj hf$ u8"f$jVt,f$jh$h9f$Vhq"hX% j j USWV`~ZD$=6tIt@ƍD$H@ L$1jQRRjPڠut$Vhe$< 1t$HFFF FF1G>\$SVj l$ UVW ^fƅZD31OjUj" t:9uB$=h>e$jV78  8uh D39tttn1VSj VD$$Pj D3vhd$@jjj 1VSj VU6h e$1=D3u$=|$ u'1VSjk VWj_ `^_[]Ét҃t̓ u1Ht$8F FFV5 PhXe$u1Gd$WVctTd$D$8x xx8WPV5 q"{jhad$h# X%SW6f Whd$j~'V5SWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP; $H $u˃^_[á6H 6t$Vt$V辠Ph6d$ij&VD3VPD$$Ht5t$ I?r$ !P$Ѕuσ^PD$L$ $QPjv GXWV1N=6tED$@ L$1҉RRQWjP,t4$ he$^_VQ6 jh$f'4 jV4 tP]t^Vhe$>jfVhe$)jQPD$L$ $QPj蔟 eXPD$L$ $QPju FjN%XÐUSWV$$D$D$D$,1H$11D$hjf$WSFm f~/P w`1A$0f'5$< D$u[FtR=5$<D$,D$낃g$<8#u(@j L$ QP%a $D$8L$<PNl@$)$<8#u)@j L$ QP` D$D$8$<L$QPO j D$ P5$<` D$D$8c1Fj D$ P5$<Y` $D$85$<hf$8o3<=6u-6~q561ۋtVPuJVh"$yFtPhDh$cFtPhXh$Mj c-6C 9|?,u)É\$(k <D$jhu D$P[u Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$01ɉQD$ P4( D4D$8u 8tz`Xt$76u 6-6CPVZt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UPh j|s |$tt$ VUWfu  UW1 8C|$$8D$@PW >tD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWOt!t$ VUWt #|$$tS9u$UWP1 RW'3 $D$utSPW2 uWhg$[1ļ^_[]Ë p}3DQu8$hSVRf j/V7t@V'@9vHH9wr$jP& ƃh6hzd@V iD$PhedAV VW' 1tS觩DaFk<$$P$ 4蜳 D$tVF u=V5E u0$ 4E u$ 4 E HŋxhX#W辪t(h^"W謪th#W蚪!mhi$Uu8t(ʼnD$u$ ʼnD$G$w utƉD$u$ ƉD$z$PD tNjhi$SթtG Ƥ1$UhS:V  1ۉSSSWt$t$t$D$jP9 Dž~11D$4$P u L$ Ou1wV% 1=p6t3p6,$9ȉ}!w 4h'1 i't1PPPPt$t$$ tʼnĨ ^_[]hh$j U VSh"$j&U $ 4h0i$hu$ዄ$ 4hYi$뻍$PSh#shi$SWVP΋9tRWhk$S&]Ws R [^_[说PPPhl$hv3jUSWV11C:nu~ou 1@$1$QZhr%D$P.1 t<18nuxot,$VPMthr%j0 ut$3s^_[]USWVPωjP6 1~:Ë,$WPtWPt Ku^_[]USWVӉ͋$|$(WV7 t2\$$$ $t([u%D$ =Vh~i$sNd)h"S1ɅL$ $|$ uf|$(/u $]h&K$D$$jP5 Él$|$$jhi$V ōjZD$ PD$0P u-t L$PVQӤ  Ku|$(l$$t TR#t X# t ^"ẽ{% i'$, PW tq$ mhu$D$ ^"1ۀ=6u =6hi$Pj t$Whi$% i'jj@WXD$|$ tjhi$U謣 t?$ٺ"st$(Uhi$ $(Uh$hP;$DŽ$0ffsDŽ$,t_puDŽ$(moun$D$$(D$D$$(hr%P1G@F9NjD$|,6VPW ɉD$t3o-uj=S}t6CD$#hr%$,P Åu 1G 1GD$D$D$L$ D$L$(LD$D=6$u 6tQhi$R|&1G1D$4hw%,F9uj =1ۀ=6$tD$Pe u hV#eJmK|$(t_ƅ$t P.nt$"n$u |$ $H$tt4$2hS2#I$t Pmt$m$(t$ jj WSt$p ~)D$ u|$ jWt$H 탼$u$(h(v3P=|$($(jPV> t"$(؃tTu*tGhs# I1C؁^_[]ÁttPنPWh:7# 1ۃ$u1ۃ=6u 6t$, Pt$,VO t$, Vhj$=6ujN$t7t$K 1FV? Vt$b u hi$0Ht%f'$($(SPh%hW#t$WJ 8tD$(PWhu#G u8u$(QD$,PQhi$Gj聬USWV ˁD$Pj VL$ Qhj$#+t$1g'Gt6t =6t#͵$tˉ#FwPhrx% G!Ņt G h'rt4͵$tˉ#U$r#tH#FUQPh&j$R1tK͵$tˉ#FPh;j$(Xt 0h"$ h&r#=6͵$tˉ#FstspPhIj$=6͵$tˉ#Ph"$sds`sTsPh[j$slshs\sXhwj$o=6|Ut$ 1|$$hVPPh"Pt$u(|$ t!j VGwtVWhj$ h%2#t $Ph"$^_[]WVt$t-t|$ PWJtu預64 16^_WVD$ 18nuxou 6PNt_1,tu@AP'XtCƉ8j,WFv1Gt@Gj,P,v'h)p&tDh"eDWMh1^_fWVt$ |$7O WVUSWV$$l$WVSU$$hhU3Whq"\ uWVh*"jH D$@t.D$t$QPhj'hV{_V"jHUSWV$$$1hWSۥ 8D$$81G=<=o3D$ C|D$D$1D$hl$UVO T~H wV$$i' $׃Gt!M5$<L$ 뱀L$5$<-$Ax|$뎃UL$5$<($At|$_ $V $M5$<L$|$0P$h\i'5$<'E&PD $o3)ƃ|$|$t L$T$ ttL$ T$|$u 1AL$t$St$V$r$$Ap\$t t|$uSD$PV"t\uD$0$AtuD$4$Ax|$u#D$ L$ L$Ĕ^_[]hd"jE Vh$譥Phl$hv3 j胶fWVPt$jWVA 9u9t x^_Vt$h"jE Vt$VLt@^h#V^Vt$VQt@^h'%V|^WVPt$jWVA 9t9u x^_Vh"jD WVt$|$ VW t$?/tWhY"Vhr"^_WhD"jwD fWVt$ |$7 WVSWV$D$\$VPWS$,$,njS7Vh0r%5X u$舥tu!D$"t$"jo"V0|PVt$ h"jC USWV\$ l$|$t$1E1@<o3h'"WVFK ou%jSh@k'5$<AtEP^AǃuAo3)ރu4t$$V4Nut$(t;^_[]hd"jC Ph"hv3i jfWVt$|$ VW諞 t$?/tWhY"Vhr"^_WhD"jB fWVt$ |$7 WVUSWV $$l$WVSU$ $ hU3Whzi%ZV uWVh*"j$B D$@tY$$QPhn'hVYV$$$$$h.m$藻j轲USWVMu1} ]hD$ PVJ D$ FxD$D$D$D$D$hm$WS I L~)Hw;$ m'5$<Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5$<L$1@D$kjuh\m'5$<>P>=N|45$</1@D$5$<Fp1@D$5$<L$ 1@D$o3H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ 2tuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ W:W.t@$N|dže^_[]hd"j ? t$h$ Phjm$hv3[ jWVPt$jWV: 9u9t x^_Vt$h"ju> Vt$VFt@^h#V^Vt$VKt@^h'%V|^WVPt$jWVu: 9t9u x^_Vh"j= WVt$|$ VWߙ t$?/tWhY"Vhr"^_WhD"j= fWVt$ |$7# WV1^_USWVp|$o$o\$WVUS$$jHSuWh$Q uIޞ8KD$  = 6%D$ Vt$S jHSt$D$@D$ $p QPhr'hV TD$tS\$O$oj j ShWt$ PtPՒPhn$t$ SWhn$bt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@hn$$81p^_[]WVh*"j6< j/SWV\$D$@u+t$hAt;SP t7V<[1 6C6C^_[h)p&j; jìUSWVPL$$T$ l$\$1$13֍zhm$US=C @~7M$o'OӃ23=6 6먀'룋 $<DF@N@늋 $<IF(NnOe $<R3KF ? 30O' $<aF8N 6O $<g\PlD$ p4t$ N @OPt$(ho'5$<`8Ƌ$t 6t'tOt@tO t=6 6 s= 66g@tOy  3sg st1A T$ J sh#V&6$6$fyh_%V 6L$ A$I$shm$V5L$ A I$shm$V5L$ A$I$shn$V5L$ A t$ hr$-1$^_[Vhq$jA* WVt$ |$7 WV1^_U0E\$D$,1ɍT$ QQPRhr$0 uUD$ L$$L$D$l$&\$ D$L$ |$D$ fD$l$|$l$D$T$]hr$j) WVPt$jWV% 9u9t x^_Vt$h"j) Vt$V0t@^h#V^Vt$V5t@^h'%V|^WVPt$jWV% 9t9u x^_Vh"j( WVt$|$ VW臄 t$?/tWhY"谲Vhr"袲^_WhD"j( fWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉy PQ40E40<8%<8D@D@LHLHTPTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40+40<8 <8D@D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7qVw w^V FwwJVFww6VF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuSCuuSCu$u S$C EDȉCDu,u(S,C(E@ȉC@u4u0S4C0EHȉCHu#Wph8#Wp<$t=$<W)@,$<1Uz$PPhPPVІ6Yjj5$< D$,9$<1z$PPhPj؆6 =6=$<jh܆6h$3WPr $<1{z$PPhPj 6$<1>z$PPhPhŏ6r$<6a1@D$(S$<10%PPhPj%Ȇ6($<1Z{$PPjcPPh3=$<h'%Wnh#Wn 66=66=6=$<yW"@$<17{$PPhPj?6B$<10t$PPhPjp31Ghv3Wj>hs$H=6<$=$<hc1%Wmu6G=$<1$#PPjPPd31@D$$$<1"PPjPPj6m$<1y$PPhPh<6P9$<1Mt$PPhPj6 =$<=6j:WFAj/WqF.?y6$<Fv$l$0UU݋\$UW|$Pv 66sp}3DH,WD$h$WBlhZ&W,lԆ6W 6N1z$PPhPj l3,6 p}3DHWD$<$Ԇ6ht$o3=d3_=6tVhu$z5$<ht$j5$<h t$Zht$Phd"j Wht$9Wh|$.D$ =6u1=6@6$1󫍄$B܆6Al$$+D$ -6t1$ 1D$$$MljL$$ PWR?t$h|u$6l$Ul$RQP e $׉ȉ 6=61| h2v$$t/$$T$9‰sQt$t$WPhWv$tFtA 6WPUHc u5656t$hv$|$(F=$PU uRt$hv$ A#$=`h 6hu$1=6 $VhNu Vhv$al$VjD$Pp 6-6-6݃=6~VUWt$hv$Ì|>9|Pt$t$ )̓ }4$1\$l$ Ȇ6̆6ɋ|$  Ȇ6=6 656σ|,@σ|1ҿ9  69|щ Ȇ6|$ D=6Ejjh 68 .h 6hu$Ȇ6=6t̆66t&hQh:w$} 6̆6t=|hPh{w$T =؆6u1=̆61@؆6=6u Ȇ66=h3,=Ԇ6t#jhw$hw$hw$Ԇ6= 6u=d3̆6 6t$t$ t$4Ut$$Vt$t 9t V t U =69$PtE tƃhss$Ej +Phx$jd$ P聈" jB j8 j. hH%& $6$66ApQt܆6@jxQP$Phss$# gq0艀Vhx$jd$ P$\ $|$8jxU$PG $PSbu/jZ$P$dPa u$<mfsjWV? 9uD$8%PGP$Phx$h,w$|$D$D$4jP{ $u/h 6hu$$Phj$jX^ hs#j R /dev3 6 $6/ D$ %6tD$ 6<$~~l$4 $jWh"` u ƃrl$Wl$$U@aMGWU-a:l$ ʼn\$4Ë$H$|$6\$L$ u D6$dT$dž,<tx(=6dž dž,dž(Ɔ l3p3u(jh }$褁=6-5,6u"jh3}$x=6,5,6 ̆6N0Ȇ6F4Qt$Qhf}$?=6w,5,6F4Ht$Ph}$=6S,5,6F4 69}"QPh}$ =6+,5,6F0=)hPh}$赀 =6+5,6F0=|)hPh~$腀 =6+5,6F0N49}QPh?~$Y =6+І6,6;̆6|QUUUU)ʹ3333!!сis{09\~\{0\\5؆6sXș9}%CX=6~Qhz~$,6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$h~$~=6**,6{4$=611F9tA uPh$jo $Kd=656 u։<8=d3[ WVh~$~ =6),6<$C4$8=6`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPnSNjs8ƒPVRW誁)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh${=6'6tm ,6yxH1҉$q1ҋ8$$)$<$$1C$I8$ 6=,6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$WIQ1C1 t׉Ë$$QPV$$VE9s($$$VPÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRP0ƒ$$$$$$׋$$$RPVQ$9wȃr$9‹$֋$r‰$$$$$B1WRQPNË$Ë$ʃQPRSM|)ÍC4$$W$$P$Q@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQLj$P$$@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh2$&u =6 ,6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d3$_|HL!ʉG41SSjhjPS<6N ,6I4QSPW ,6H @6 <6 D6P44Q5H6щ L6`@#HL 9| Hh h3H< ؆6HX 6H\ Ԇ6PTXH fǀ$<%=,6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d35O _(HLJ$6$$$t!LJ^F=6$$߬$$ڌ$d&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$P$o ,6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$$bo=,6O0 9| IУP6T6=6u\Tu))УT61VVjhjPVLX6uP69T6T65T6jPR =6G6 61ظ|(RQh$n =66 65X656~ ș)dہ|4Xw'GuȹC=6tL1$PP$$56V1=6VhZN 61u;1$VhjVu  =X65,6h`VWj( =6tWV5,6x\X6hhP Q 1@$=6h$=6|o5,6N,I\Tt~!NȃN׊Nd1 t1WPh`B$RR%k$6v39u1H$Whht@PU6 PPftu!ѡ6t $ Q$=6u$|&,6H,$$DŽ$%$ ,6I,$1$ DŽ$1h(v3%,6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hi$b=6Y ,6j506)N 506FU $F +$^,6$~J`^p=d3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=6uFh$ NlK`ڍOȃ$ډFd;v&hK$蟜=6,6506F $11ہ~U uv`щSA,6$~!ـ1@ 06Il ,6506F=d3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\506N uҋ,6B8H!tk)D4,6B8)Nj506$9sE)ȉـ1B~U uv`506F$CHu͋,6B8$؋N9ȉ$J`~U uv`щS,6$~!ـ1@ 06Il ,6506F=d3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD4506;Vs2р1@~U uv`506F$Bɋ,6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$D6H D6V$P V PV~x; H6up=6tL6s4PP ,6@6@@6Kd15L6s4L6D6 ,6q4jPF ,6506{0 9 X6PVQ =6tX65,6P506g ,6y0X6$ryxtG$\H%TuCl$AP$ ,6Ou$ց\TtQ!QЃyId t15X65P63 5,6\TG~8^xN`1?9'T6+$~0lj$Ɖ$)ى$=X6$5%GlX6T69wߋ$9w$,6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=6} $H$$$~A=62$=|j. _扄$$r#tp% ,6ׁ\TtQ!QЃYId t1RP$Vh$]_$$;$$|W=69,6H,t =6 $$ DŽ$j ^DŽ$C,6;X,/$~ j ]=6 $hjPB d3 6+ɋMt@U@f$$hM$lCɋuM@EfDŽ$AY$h8$ld3fDŽ$!3tt3$_ lj$DŽ$,6H4$ $ H5,6D@VL!! $`Nd8YfAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t3@ lj$DŽ$ ,6H4$ $l$h  5,6D@~L!! $߉$Nd t1$Sv4$j2,6@0p9w Au1H$$DŽ$1$$tOWǡ6,6@056V$SQP$h$l 6ɉ$$$t RP>$CPKT$l$hߍ$󥃼$$tA$ȃ=6CX$tFDŽ$PQ18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$"$pthj$P= ,6\T$$i$$ $$$$DŽ$H0$$_$ ,6@$D$@L!! $`T$hC$l$  ,6Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h ,6@$D$ @L!! $$S$#$$h$l,6Hd t1$S6j$$V ,6$ȔȐG$11F$t =6$$=,640=d30w4w+_1X6$`SWP $PjS: =6t$W\=6tX6ǀ\8 ,6=X6x\hhPR: 6QP,WV=6t<6 ,6q4PP׸ 5,6HLNd t15<6v4t5L695D6vG=6t,6p4VVx 5L6@6@@6=,6Od1Vw45T65X6f,6@4P5<6Me^_[]ÿWjV49 1=6VW\hB#UBh$ j&0Lj%)Lj("L$6j Lj Lj'LjKh$Lh$BjKjKjKjKjKjKjKjKjKjKj KUSWV=6ua΋\$=6t6$6St$P 4׋ 6UPSt$$586d 9u^_[];0DPWVh$Sj$KUSWV"=6΅ \6u,6H4H P6 \6 =6;66,6;}FWh hw'1I!;HtG#P;Pt;H uV9R_1ڍ_5X6P=6Wh De^_[]USWV΋L$l$=6t=6teUjQk6p׋ 6SPUt$$546ܫ 9t?90PWVh$)Rj"OI6$6UPQ ^_[]SI`wD$$$w'1C:Qh$hv3nT .  [SWV1ۃ=6։ SjQd5 =d3@fF F)f ^_[USWV Ӊϋ5,6F Nd t1506G=6t065,6PP跳 06yU +y/\$|$y1U =,61=U L$D$uq`|$ G`Ӊ $u щw*l$$4w'р4l$skPh4$hv3R =,606D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah$ h$h$t11҉ ^_[]ÉՁ|$U u L$I` L$w$Dw'ʉـ1@BPhQ$hv3Q 8ʍ 6ʍ   1$5,6$~3%)1@ 06Il 5,606K=<6Od$sC=d3CNdЋT$ t1҉t$VQPR${U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRRL$|$ щT$ՉD$ȋL$D$VW|$RPBRыt$ʋL$Vt$QRP#$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45,6;F8|$}X1Bσ) 06yU uI`1@5,6;F8|$|=6t06VPP 5,6F Nd t1506USWV$΋=,6G Od t1506=6t065,6PP胮 06xU t)h$z=6(06xU ‹l$(H $t@\$=6t065,6PP =,6G Od t1506w,6<6HC, $9r%UQho$J =6V,6 $\D$jT$RPQ=D$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5X6W,6\TudX6jpxt$0t$ T$<=6WV1L(ɉL(@ u1LXɉLX@ul$X6jpxt$0t$ $,;=6trUV胪1tttpTtDpC u1Cu) n% $D l$hVU n% $D9Pl$,6T$5X6p0^_[]jk?j d?WV։σ=d3ȃ@PQR =6t'ȉGffF=d3u GffF^_fUSWV$8tWI ƅuWhu"j $$<$4D$Phd@Uh tj1OLVhedAUY F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;%t$yI 1 Sh"U CPh8"Uk C Ph"UY CPh"UG CPh"U5 CK,C,Qh/"U C0PhD"U $@D$t P裃 1-Uhzd@$<W3 t1 VhedAW hjU) D$ P$4軨D$, 9L$L$9u0$S11:F-8tx$0h"b$11҉ $ƅ*ŰPHj PU ^_[]$0h"j) USWV81ۍD$4ShPSuT1NtAljSPSWuW uMU D$t$$$Q1e^_[]fWVt$|$ VWk& t$?/tWhY"TVhr"T^_WhD"jc fUSWV|$$\$(SWt$(t$( )jj`SW~XNjL$t$AhQl11 mTTDPD$T$ |$,t RP觻E`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVf' 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^z$VVhVhd6S<V|$<"VVjVV[l6s<vE$<h680$<Mt$VVhVj|6p$<7{$VVhVjx6G$<Z{$VVjcVV#3"$<$#VVjVV#31@D$p6=l6l61@D$$<y$VVhVh!t6Pم$<1H$Fv$t$VV11KSU$P66 $+Ph<$5o3)=l6u l6$1|$(hjW" ttt=t6u t61;6 69p6u  hPVc ueVhiu${ohk$ 5$<h t$j 1Phh6PVxō$PUu1h6hu$ō$PUfu?Vh|u$jq =p6jjh6趑 h6hu$ljt$1=p6 |$u =66)j5t65656wף661҉|`$$P$T u$$j5t6QP' $׉ȉ 6=61| h2v$$t.$$$9‰sQt$t$ WPhWv$qt$Vj$u Vhv$ t66%6ʼn߃=l6~VWUt$hv$9|>9|Pt$t$Ì )σ}4$ d6-`6uU-d6uY56=6t6@19lj| 19ǃ| d6u `6͋56=6t6ˉjURP=|6l$ x6uA@19lj$ $t$u h6hv$jPVW-v|$wext23$2fs3$ Wh="h6hx'Vh6hu$} 19ǃ} h,w$ |6t$VUt$  UZ t 9t VH j.USWVӉ $m|$j W\$ SD Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ 8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$h"jO WVv3Ph$V8 1GVWjh"CVhHx'UW<-USWVu} D$8jP[=6565d6%UUUU)3333!!щ%i`6Bt699#3#3T$u tv|$΍Q6656 6VT$ 66ډ6P…Ƅ!) 61f1ҁ‰t$$r=66\$9D$ 6T$61t$$ËT$ u׍؉)9H1D$ 1|6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ|6566#3t$ƺQ=6D$6D$ 66D$661 656D$86ď6ȏ6S̏6Џ6ԏ6N5؏6܏666[6-f6W f66 #3f6\$H$SW訄 93rWh6 5h6|$t"V YjVh6 166\6X6܏6D$6 6+ 6 1҃r1I156~σRVPW>56H19w+56|$OL$)9r΅u 6f5^65d656V6YVjP GD$AD$ 11L$\$66tn6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 6@6t ^6 6@ 61H6L2 6D1\$;|$t6)á6f\0 6D1 6u\$fT1 6T1fD1L$ G;|$tD$ ܏6|$11t$66=l6~i d6 i{5`6Q5656PRuh$6/ 6 d656PQWh$/6@6ĕ61QQjhjPQ6ȕ6I 5ĕ6jP =p6uk6 61! V5t6 1N1Ƀ *&Fu  1@D$$=l6|>h$5b=l6|(L$ 6 61PQh`B$PP,D$$6v39u1H|$LWhht@P PPftu!ыt$l6tL$QT$=p6uL$L$D$ 1D$L$ 11T$h(v3=܏6t$tX6tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f56616 5ȕ6D$ hh6P 566P56Vt$ =6=6 615t6ǡĕ6)؉1t$ P =6Wjh̕65 6H9|$u_656 6)ʍZ9s1Gр̕6B9r)̕6VhP t$ 1Ƀr!11ƃ̕6Cω 9rωp 9ǿs"ˀ̕6CI 9rޡ6L$  61Ҹ̕6Pt$ 56Vj̕6P ̕6 6L$)QhP u1̕6@ u6L$ D 61Ҿ̕6Vt$# 56jV =6tb1=6t 1#3P06F;56r6L$ D 61h̕656 G;=6r=l6t$|\tX=܏6te6t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=p6|$T$T$|ʉj.(t$몸$r#|$|$tp% 6 6jQt$,Ph$@)T$;D$_=l6* 6t=p6u&D$ D$D$j (1hB#(~ j '=p6d=܏616$hjV}  fF쀁$fFD$8FFFy fF56 ׉؉t$ ֍$fBt 6$,F܉VDF81 L$ F4D$4z 61CL$ =6W诼D$(\W蚼D$S56tPjt$0p  ^6 9`L$97|$0N6L$,ʋL$(T$61GL$ T$D$ 6D$6D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjPJ  L$ D$1t$V 61CL$ \$^6 6=6t$,9sD$()QjP  t$ML$ D$41ҋt$(VW'V($Yj=܏6t6t &3'3&3@1=6à r t$hhjV4  fFA fF6ÉFD$8FFF% 6fFfFV 6AFmlj\$r*D$p1ۋ 61zC9uߊ 61h̕65656f5(3|$D$1ۉt$ (3x1ɉt$)r͕6RQP- Wh(3̕6V9 (3̕6D$ fЕ6 61Vt$ \9\$t56(3D$ CiL$T 1VhVD$pP 95܏6t6t#3$3%3fD$TAfD$V#3ƉD$XD$8D$\D$`D$da fD$lfD$n 61@D$pAD$| 61h̕656iL$Tj f61ۃ=6 5ȕ6<hh6W 566P56V 56 615t6ơĕ6)؉1WP5ĕ65ȕ6Je^_[]h $h$ _$hX$P0"h$Ph $h$Vh$Rh݂$PRh$hVh5$hVh_$RVh$Whă$VPh$h$vjVWt$h$gh.$`h^$Yh$RhF$KRQh$B/$1$'h $h$"h $h=$h $hm$ h $h$j- USWV6=܏6tr6tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(6Ѓ6t ^6 6Ѓ^_[]SWV=p6u0׉΋ t6\$QPSt$ 56y 9u^_[WVhއ$h$jv USWV=p6΁ ̕7u=61 6 ̕7t611;6-6ǡd669v@1Shz'8!;HtH#P;Pt1A xVWh07h$ h$hv3ė81B h8ԗ8@ė8888888̗8 ȗ8 uCء8x88t8 8 p8̗8 ȗ8З8 ؉+88D$HT$Ll$HЗ8+8D$8D$85|&v?|$ D$ fD$l$\$4l$ D$4Ӊ ȗ8̗8؝&wh7 88 ȗ8̗88З8ʚ; ȗ8̗86eĉЗ811ۋ88D$T$ ؋88D$8D$8D$5З8L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05|&؝&t$v ȗ8̗85З8=8|$(t$(|$D$ fD$ l$ \$,l$|$,=З8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5ȗ8 ̗8=З8ؕ7t 1Aؕ7y7D7 @79}(8i-@=B'7@9u8e^_[]hb$h$j USWVh8j 7&\$Du{'-88D$hD$h5|&\$Dݜ$݄$h8jN u{(-88D$dD$d5|&݄$\$Dė8;ܕ7D$D̗8 ȗ8 t]+ 88$$߬$З8+8D$\D$\5|&&s=ԗ8uZؕ7tQ̗8 ȗ8 t5+ 88L$xD$|l$xЗ8+8D$XD$X5|&wD$DD$Dؗ87 &w١8 8 t>+ 88$$߬$8+8D$`D$`5|&D$Dw\$8Е7$fDŽ$jh8jT D$8 &|$&D$& fD$Bl$B\$Tl$&t$Tj$PPU SD$lD$lPD$,Pj5H75L75Е7T <h8j L7D$8<BC97)؉D$D$8 T${'\$A9P8I؉L$A ė8Iff9uԗ88@88<8888H8 L8u8P88L88H88ؕ7 1D$18 8l1A h}$踀hv3Aؕ7<1A t$, PVh$ ΍T$(jt$>Ph$D$ ؕ7t$؉T$΍T$(jt$F$@|'h$΍T$(jt$JhϏ$΍T$(jt$bF$0|'hݏ$΍T$(jt$$Fft$NfQPho$ ΍T$(jt$؉t$h$΍T$(jt$^؉t$h$v΍T$(jt$z0FT_h$G΍T$(jt$9FPh $΍T$(jt$ ؉t$h/$΍T$(jt$؉t$h9$΍T$(jt$d؉t$hI$΍T$(jt$9؉t$h%T΍T$(jt$X؉t$h]$)΍T$(jt$-؉t$hr$hѐ$Ph$L$lL$AQ D$iPhC$Th$ h$h!$7Nh|8hZ$t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظŒ$L$dT$C; 8u#Ph8QD$X ^L$$ D$L 8PQh8Y T$ҸŒ$u1GÌ$T$PL$r |$ rI0v3H 0v3~(v3H (v3 h(v3j (  }T$A{^N2D$ˀ) hȌ$euPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh͌$h$9 |$ sS0v3H 0v3~(v3H (v3 h(v3j   }KF߉Ήs(T$h$CL$T$؅t%0v3H 0v3~(v3H (v3 1I h(v3j "h(v3eء8;ܕ7*؅tءؕ7!^L$AQ T$Q=<8 88 t+)|$L$p|$tl$p@8)ЉD$PD$P5|&X8X8`8`8)3v)3ؗ8vؗ8\$CfK%h8f!th8 8T$ .KfKfh8D$ 8@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$J8@)t2(uK l8ؕ7t1 l8hƋ$ l8 ؕ7 PVh$ Ph$h8$hU$hv$AfPh$h$h̎$h$h$h$h-$hD$hT$he$wh~$mh$c l8h$1BD$D$pf)3@)f~\ؕ7tSωL$!ȹT$V!RPt$ hA$T$ D$,ؕ7t1RT$D$fxf5)3ؕ7ruTt$, L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B@7C9D$=ؕ7 ؉T$5D7|$77)RQPLW GD$9L$~D$8:7uG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E5D7)7t$>RQPhv$D7;@7}0u h$Php$Cы\$1B\$D$\$D$T$jh$jx 1Ah9"WV"88~b88 0v3Q0v3; @v3h(v3j.c8 (v3Q(v3.H 8by`)88 0v3Q0v3; @v3h(v3j8 (v3Q(v3H 8|tN=8t40v3H 0v3~(v3H (v3 h(v3j 88h(v3Ǫhv3躪8888888^_jj1A1=8PUSWV׉E\$1AMؕ7]E uWVh$t h$Sh$ؕ7t5@D$ &\$D$$$Iؕ7fyuhv3je^_[]UVh1AtD$07$$ė8D$$9$8D$$R$h8tD$$h$ė8t9+ 8} $y$!L$LD$L `&D$Ht$H\$$$p$  8ؕ7 h8L$DD$D=X8@|-`8& )3 ؗ8\$,D$(\$ D$\$D$\$D$$$ؕ7<8 88 t5+ H8L8L$XD$\l$X@8+P8D$@D$@5|&8 8 t7+ p8t8L$PD$Tl$P8+x8D$L> QPh$lؕ7tkD>L> QPhˑ$F|>uGD>ؕ7ufPh$\"L> ffPQh$8 ^_[WVٕ7u8jjV! t'86 PWh$hh|8"6 Ph"$hh|8m^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h*$f$t$t$ t$SPh$E UPh5$+ t$t$t$ hA$t$ PhS$t$ Ph_Y$r0G9s'GPh#| KG9r߃$^_[]fUSWVƀ8-uFh3#V u 8h3#V1u 8T$,11CD$D$hh$Rt$0 w Hw؉$|'\$̃duE뻁뱀=8t\랉\$떁댁낃u1 o31;L$(ujy}1L$ 1ɉT$Љ $P,L$Au $AP+}D$t2ڋL$ PWJ W߿f uމ$DxuY|$ujQ Džu P_{`$t8=8uIj Vh3#& Whq$T1FVڦPh"$Vsm SU\> h3#=8Mj Vh3#Ц Wh~$Vɦ \$$r#"$VWSo jjVWSa\$u9 1GWWWjWjWjWVWj VWu; u h$jl jjX; u+$8j, u*9 j+ j j; t)qtOQ+ j j: uה$8t1Aj jh3#臥 ukWh$jh$t$U< $Q>gf0WW}: $t$r#VPShrx%Wk SWh$jAVpz&=8u$r#VPh4$hv3jkfD$tPh$e]h~'Ph $hv3j.USWVPu } h~'WVr cR~5StET ԡ8͍Hw4$|'ġ8벃L8̡8둃ftTdL 8tȡ8eء8VС8Gܡ888) o3o8=ء8tjjhf%l8 8ND$ jjj"o 8jL$$Qh@hP. u h"% e8i )ލ<S H $|'=8t1Aj D$<1CPŚD$D$ PS趁D$D$$PS蟁D$D$(PS舁D$ D$,PSqD$D$0PSZD$D$4PSCD$8|$ |$z |$o |$ d |$Y |$N F 8D$8gtj588 rD$ D$$r#D$D$$r#_;-8S.t.H$1ۃ=ȡ8uWh$hn$h% >h{&Sg =ȡ8uhY$hA$h% 1C8FLCSS H3 VT$W$}' \$@1ɍP$}'81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 128#8L$L$# 1AD$ PD$@PD$ D$<+8R D$ Pj$8+38+38+3 88׋t$#D$ Pj8d$zT$ ED$ L$TL$@JL$C8"+3-L$#d$d$d$L$׋t$ 8:88@.@8"(808 H8\$ X888 t 8t 81SSP L$Y\=8j$)/jD$D$ D$$r#D$$r#8L$9a|$u q8 8ta|$  ‰4 D$=8T$tD$1@D$ 1ۉD$0hxSh`8 atgcuL$c8 h8b88@8t88l888 X8 8tJt$(~A|t18t|$ ObT8آ8tPt$ tH@WVhآ8f آ8=ܡ8t=С8uu$8tMD$tH@Vt$ W`f =ܡ8t=С8uL$$8tDD$(tIAVPWf =ܡ8t=С8uL$(${8tDD$,tIAVPWe =ܡ8t=С8uL$,$.8tDD$4tIAVPWwe =ܡ8t=С8uL$4$8 tDD$0tIAVPW*e =ܡ8t=С8uL$0$`8)f=`8=ܡ8tP=С8uG=8t40v3H 0v3~(v3H (v3 h(v3j `81=8IWh`858, u+_87tUt)7|$t+u-$/9|$Ph>$!$|$*$ P赘Ph $83u=8t"1ۃ8=81ۀ?D$#{t$ |t$$|t$(|t$,|t$0|t$4|t$8|e^_[]jhY)&j7] ShC#h$ hǛ$h$j\ WV)3t#|$ )3WPUtFu)3F^_USWV,׉1l$u58V58, D$ VPUh8WSS|$G"ww Gw\$VVSVjWD$t2Pk1PPSVjW貒l$=ܡ8t'h$ =8tt$ h $1|$94D$=ܡ8tCхL$% D$@8t Ky9=8Cx$CD$CPS58;( uμ87t 9D$=ȡ8u{=ܡ8t i5ġ8jt$ Pg$P$tH@$5ġ8P|Pg$Ph!h%9VyEt7tu$$*$ P萓Ph $j1G,^_[]Ph>$hӘ$ h"h$j(Z USWV0=ܡ8AuF8,r!4~'h"Phq$aPh$Ph$F<5$~'vvvhϚ$YF|$(QPh~'RWp(v3PWhHh$F(B'QPSPWLp(v3PW-Hh$F QPSPWp(v3PWGV xdvvh$ V!̀'t@'~ 'tF\$(RPQhSoh(v3SGV e^_[]FPhޙ$*Ffhǚ$F h$r#Ph$ F|$(QPh 'hW"oh(v3WGVƘFPhޙ$FHfw6$t~'h$ch$yPh$fPh$S6h$'h$ h$hT"/h$1H9vh&$-NT$(PQR FHfrCfD$(L$)T$*t$+|$,\$-SWVRQPh)$D$(D$$D$)D$ D$*D$D$+D$D$,D$D$-D$D$.D$ D$/D$D$0D$\$1|$2T$3L$4D$5PQRWSt$t$ t$(t$0t$8t$@t$Ht$Pt$XhL$PSVh$/h(v3^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV莂+D$  PZ1PPWSjVV|$dt$ \$h$} D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9+3tE+3P{y$L$t ha$h$QQh%PPhK$ C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP$#PPh$  0v3H 0v3~(v3H (v3 h(v3j T$h9t$,i h$ L^_[]hӘ$ jh3$jI D$t'T$tt ha$h$QQh%PPhK$@ ËD$t%u$%tup$Ph$g$z$Ph#USWV|$<\$8D$4t$0~u/jU.d u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhW~"PPh"$@PWh#/ ^_[]USWV|$4t$0=8uM8hh8Nt 8'j.h8tt@hPh8U t"^tCt0Wv`rhhe%h8bU ^_[]1w)ȉPjQA SVUT| fEu jUb WUu&Vh8Sh$hh8蜿8^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh8Shѝ$hh8,8[SWV$L$4D$1G|'t$"tZ@:t9rD$Ph$?,^_[SWV|$t^D$uFD$jjP t1Nj0j.V%st@h8P耙u7ut$臦 e%hVh8S 8^_[VD$L$ 1Ҁ0QRRhh8VPЋ thh%h8s 8^Au yuyt$Qtu ȃP Q APh$hh8誽8SWVD$8Q4۝$R84۝$R8ƄR8.r|I1AFL$ t Vh2$W/ VhQ$W  Vhl$W Vh$W Vh$W Vhǡ$W jjUSWV|׉΍l$|QhU<9 PUxsD$tVhΞ$.D$tVh$= 8u 8tL$|=8t@ 81C=8u WUj%K yVh"$41ۉ؁|^_[]j蚩SWVΉQhSq8 t!1G=8u%5$8SjJ yVh"$31^_[USWV 1t$ >WWVWh'[ u;D$ D$ PFWWVD$Ph', tt$WĨ ^_[]hp%t$  tԉ1|$l$Vh$PVSNHt$t$Wh|dD$PD{ \$tN1D$;D$ 2i9t$sVt$Pt!ʼnD$t$Wh|dt$z ul$$WhedAPz f$a$>ukSt$h"h%h$W+Ƅ$t$85$ ğ$t蓖$QPWD $Kà9Éu|$$P 1hp%j( Å~A1ۉh"PiujVh"hrx%h$WUƄ$|$t$8\$ ğ$t躕$QPWk C;\$ mUT|$l$|$$PUSWV " ujGD$$D$<$sh$V}thj%Vk3hU4 Ƅ$hj%s3ut s hj%V螪tt s h$V~t P> $8D$ h$VUtHá(8th$P訇(j,S%atZ Sp9,PD$PUxD$!=`ÉUh"$,/ S9Dž?tG<$tSWUh $h?%h$VV tEUh$芽Zh$x?Uh-$h%h$P賫15(8tD$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h$h$S芟\$ =08uD$$D$ P$P h8\$t$Ph$"08PU uUh"$!1@$~#Qh$葰1@$\$$$Ĕ ^_[]$Ph"$jD& OPhƣ$hv3蟢 j%USWV L$48$T$t-88*jh48 88š48$T$1i E$48t!u6$t$PxT$ uF$t$PxT$ tEM<ǃ hu$ 1 ^_[]ËD$ t 048$4$݋D$ t 048$$ؾ<8Phh<8$ uh<8h"$j$ fVD$t.})zhza9h$5l8, TY9Tp%%'PQhrx%5l8}#u5l8hOL$vTY9^ËD$ H^WVθ%'PVwt)uVh$5l8臠 TY9SGt8tPwh%$j wh0$Xuj whza9u1 Ga9a9^_WVD$ t;5a9D$=8 |8u 8';pt8@uVh $j*# @u=b9thb9Ph%$赀 Ph0$襀u5a9=8^_Ã|$t 8$WTY9Ã|$t %6TY9Ã|$t ?$rTY9Ã|$uha9hE$5l8 TY9Ã|$uha9hf$5l8Ҟ 賱TY9Ã|$uha9h$5l8衞 肱TY9SWV$$DŽ$HH$pmƋ$ ƒtS!=@Y9Ф$tˤ$Ƥ$atσ=LY9 =PY9 PSj $;rtr1Auu($$h$PQ te$P$$h$PQa t8$(1;BQPVW7V@TY9^_[USWVx֋$$t{tp11@=p}3D_t1z\t r9΅t<΄t45p}3AҀ|Vy5h}3TVP5p}3@u΋$ $t`1HhjY9trʄt<$1ۊXY9t8tCu 9siY9B+$=FFu4$D$|$ 1 zY9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ z]9<$؉D$z]9$to\[$uvz$\$-p}3BDEJ<0HB,t ]tVрy$t[p}3BDC$G)=~"B $tG)=BJB5Ap}3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$5l8h$^ <$?uhVW) x^_[]USWV0$Du%$H$Dhդ$PQH y1E-hj9h(jUh@8\ t$H4$=8I1VV$P Í|$0;=8=hj9$H5PY95LY95HY9s =@Y9Ф$tˤ$9ƒ=8RPSQGy=hj9uE=h8t<88$Hcthj98 hj9VV$P Å 4$jhj9辩TY90^_[]Ã$D|Ã=8t=8;1 T$󫋄$HRjh4h |$D$=8ʉǃ=hj9$H[L$05PY95LY9j =@Y9Ф$tˤ$9Ã=8VPRQw=hj9u9=h8t0588$H1thj958G=8-=hj9$H$HL$05PY95LY9j ƃ=@Y9Ф$tˤ$$H9=8PVRQv=hj9u_=h8tV=88$H1thj9=8$$H4h$"D$P E;$Dnj =h8t#l8@=u1Hjh2#P jh@8蝫 WV=hj9t@=h8t758=989158=9u hj9^_USWV1@=8S=9Fϻۮ$ͅtUSh$5l8{5l8MJt$PhVhu3xdh}3L$DH?uUSWV $ u{$$h32#w1trƉj h%S (Y9 ,Y9"t$l$ jhUVx!|$ toSjWj@@!V=a whn$5l85 TY9 ^_[]Ã|$RV#t~"Ã|$t!h$h$h$5l81ɞ1HTY9WVt$D$ tu51>1Hk8Y9RV#Ph#$5l8. =8Y9t508h9$5l8  5l8h`$ 8Y9t 8TY9^_vh$5l8ȉ mhO$h8t$t$TY9h\$h8t$t$TY9hr$h8t$t$TY9=8t 8Y9h$h8t$t$aTY9WVD$ t+}&}.1=88RV#ޛ1Ht$u8vh~"VBt\hRV#VBu$8RV#Wv8vx8hVW =d888=d8t?~"?t5 l85d8>T#t58RPhǦ$Q+8#5l8jj6h$981TY9^_h$h8t$t$ TY9h$h 8t$t$TY9WVD$ tZ}UuZt$~h~"WTAtOhRV#WBAtBWy7vh$5l8W 81H_1=|81@1|8 x81ҾRV#t~" щ x8PVh)$5l81=|8TY9^_ËD$uD$L$hC$PQ tvD$ph$gu<=TY9u0=8t5l8hT$ D$ph~$fgu+4b9`f9`j9TY9VD$ L$TY9t u]H 8HQtsP t8O=`b9l8t5h`b9h$P軅 TY9(^鑘Vh${Pjj$h$7VO(^ËD$tIDuD$L$h$PQ? t$D$phէ$Gfu4b9TY9SWVD$-uD$L$h5$PQ  1G=hj9h(j谴Wh@8 t D$1VVt$4 ǀ?tx=hj9tyD$thWhէ$teu 4b9=hj9uB=h8t9=88D$bthj9=8 hj9VVt$ DžaSj˳hj9–TY9^_[ËD$uD$L$hݧ$PQ tmD$_D$L$h$PQl tI|$BD$ph$mdu8D$ph$Tdu4b9ÃtTY9USWVt$ |$.E1ۈ$5l8jj,h$D3% u v1.蒔TY9^_[]TY9USWV D$ #D$$L$ h5$PQG L$ ȃ#D$$L$ h$PQ D$ L$$|<$Dh$#t$Wt3$8|t+4$ $H$B$ 3D$$hX$0WD$1E-hj9h(j{Uh@8軗 t D$$\t$=hj91D$ H9=8"tB#7$9t$t$$T$$VVP4t$Qhj9u?=h8t688D$$" hj9tA hj98E_t$j蚯hj9$9t4$o"TY9 ^_[]SWV$tKjjEKtK~S+ 9uWj1uho$ 1HTY9^_[þV FujjϮh# X%tj/VF t@hQW =|8t85l8V: l8HQP~ Q Pj |j5Y9h'Q#WV  jWV Vh\$TY9jrSWVPD$D$t&D$t$h$PV rԐTY9^_[ËD$ph$^u|$h$ tD$x|$Wh$^WRPjW^ uP|$h$R t D$x |$WhĨ$;^WTRPjWh^ 1ۃuM|$ Àu*D$p VhĨ$]VRPjV(^ 85l8h̨$Q D$TY9}=`j9t =`f9u=`f9t#h`f9h$5l8]| TY95l8jj%hۨ$-ËD$TY9 =`b9u=`b9t#h`b9h$5l8{ TY95l8jj$h$R-ËD$uD$L$h,$PQ茺 teD$phf$\u<=TY9u0=8t5l8h;$ D$phe$S\u4b9TY9ËD$uD$L$h,$PQ teD$ph$[u<=TY9u0=8t5l8hm$Q D$ph$[u4b9pTY9ËD$t8uD$L$h$PQE tD$L$QPh$r# TY9USWVh$VL $|F$$h1Gh4V 9}hhp%V G9$uVh"$Zu jLT4b9^_[]ËD$t8uD$L$h$PQP tD$L$QPhΩ$ +TY9ËD$thuD$L$h_f#PQ tHD$:D$L$h$PQܷ t$|$D$pphԩ$Y Ãt請TY9VD$t$588u h$Y%nTY9D$ ph$rY58^VD$Hr4TY9>588uh$*YD$ ph$Y58^VD$t$588u h$X%越TY9D$ ph$X58^Ã|$u|$t{TY9Ã=8t 1PP)jE=8t 1PP jk|$u|$t"TY9Ã=8th"$%X{V1VVcVkVPD$ D$t}uD$p*TY9V>,U褲UWP Uhp%S3 UVS( S TY9S V {TY9^_[]USWVPD$uD$L$h$PQ裧 h<$Ϗtǀ8uq"W=ÃPб|@CSWP =8Y9(Y9$-,Y98188Y9(Y9,Y9L$Pjh$qVh0$h=8Y9-,Y9$(Y98V zTY9^_[]SWV|$uvt$>hc$W!t+hJ%Wt!t hj$Wb!u: 1Cvѻtu&6hr$5l8`g Cz1HTY9^_[t8u88P58h$5l8g1VD$ L$TY9ʃuCuD<23tKD23V$r#tQPj h$5l8fu^yjpp TY9^WV|$ W3tQƋ|$@tP< FW訮F=8t3|$t,P6hح$5l82fWh­$5l8f ^_WV|$D$ TY9uIw裈tAƋ@tPF6h$5l8e TY9^_xwh­$5l8e ^_V|$t.=h$PY(t$Dh$$t$4 $t|$@t$t$@ЃD$; 8t|$tt$D$L$d).$`.$Y.$tM.|$Htt$HD$H|$Ptt$PD$P$t$qDŽ$$t$MDŽ$D$Te^_[]ËD$lt8uu L$DUuD= 8t;P聡D$HL$H+ 8tD$Ej/t$L:! t@Pt$Dh$t$H5D$t$% 8L$D|$D$81,Y9(Y9$Y9 Y9$$9$8t1$Pt$襸u$\$` ,Y9(Y9|$py4Y9$h32#t$LD$|$t$͸$QPvu5$8$<$$$\$` $Y9 Y9(Y9 ,Y9t+t$jj5,Y95(Y9PY=8tPt$Hh=$5l8uW ,Y9(Y9 tQPhH$5l8OW5l8h2# 1O$=8K8 1O$*|$pu D$TQhܱ$yd8ht$hW =Tb9|$Lu:|$LD$puuh$t$Hh,$*uh$}D$L4Y9^$|$LD$L8|$dD$t$h $d}8Pj$$W4+$<hq%V\1A$<$ǀ?tvj:W t=@j $QP] ~޻t?$9u3;$u*W*9$<r$)PWR t/hq%V \Džm1Ft$Hh"$1$t P$$u |$p$$(Y9 ,Y9t$Lt Vhh$t$dخt|$dj%W/t Wh$1$GGG fG$P$xPW# $u2$t'8t"$tJ?t1hH%W+tVh&$a$(2WDŽ$t$D/$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB X8JBB D$(PRW$8- t ]=80RtD$(Z$$PN-j j WhSvv t%h"PS j "PW =8t+D$(xt!~X$tl$WSP5l8Rv jv Åx`=8u~PvvS躬x)$P$P$Ph$r#ykSޤ 1KW$Ph~$ Nȉޅɍ$P+ PW$4h?$Y_h1N=8tJ$t$uPҙ$$t$uP譙$8~Rlj9Wh$+(tNu1h@h$h8X it\8059ދ$tPDŽ$$t4W%PjW 2 $tPzDŽ$$t4W%PjW1 $tP;DŽ$D$(t P.* |$D$$hj$8<tQh$$D$$\t$ εj~8tVj=8tWh$5l8O t$$tI=8D$tPt$hh̵$hе$5l8_O1@t$ht$hh$f |$dwh$VP #h$V9h$V+p8tph {#V ȅu(Y9 ,Y95l8h̵$c 5,Y95(Y9h"$Vɭ5,Y95(Y9h7$5l8N1F&1t$lhܵ$V菭 $`#=8t"D$$q$t^$QPT|$h$S tPh$W0 h$h$h$WD$$0$|$Pt1$t̵$tˉ#tD=8$tPh$5l8M FWh$$8W襬 $$0t-=8tPhҶ$5l8TM FSh$Wd t=8t5l8h $Ŀ h#t$ 3t$̭1V|\$D$Lt$P523.Ɖ$$ىD$ډ׋$$|$8‹$4$8$ 48ˉƉ$D$@1S$P$+$$$$+$ى|g@By)Qj$P#$+$$$$+$ΉЃ||$`t$@$Dt$襟$|$`tCt$5858ߢ h#58M|$`=$@$Dt$h;#:|h$#t$7D$8|jj n$D$@h"Pl D$@|$@DŽ$H,Y9 (Y9 m!ڃt9}M#$H5$Y9 Y9$$!;$$=8t5l8jj hƲ$D$T}D$@(v3=8Y9=8,8 (8ƒ089}%l8HQP ;HQ#l8HQP<Q 8tB$ڋ$!t  Y95$Y91ϋ$H1 D$hB#P h"t$<D$@|$@tDŽ$ t$D$@Ph\$hN$Vhp$O !"8)PSh$׺h$%Pt$HhԲ$jkh$hܳ$aIbh*$UIL$D$ D$8t$4D$ D$0D$D$,T$1@މPj ?t$+th$=jct$@"$= $#$1V$W$$$$$$t$@Ѓt$@Wt$r u.5l8$P'P薊Ph $V: ,8=(8| jj$Y9x& (Y9 (8,Y9,8; Y9u1,8(8D1\$  (Y9 ,Y9PL$T$ T$8t$4\$0r\$ 81tt$hu$5l89 L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Wh$FD$L$ L$8t$4\$0ËD$D$,T$1@t$~Pj#<7tt$h$5l88 T$d|$pD$TD$L$ L$8t$4\$0ËD$D$,T$1@h$GFD$L$ L$8t$4\$0h$FD$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$h&$$SE$D$8$D$4$D$0t$,$$1@މjh$ ED$L$ L$8\$4$$ًT$ t$\$|$|ljL$xL$D$$"$$ω$$$h>$h4$hh$grUSWVD1D$ D$D$D$fD$D$0D$8D$4jh`$QP t}D$V~ƉD$j@Pt%L$L$4t8@P~ƉD$j:V@Pn~D$ t$D$0|$"$jPW4 D$4t 8D$t{8tvD$ t8tj;P th$P`h$WJh$W4VWhK$B Vh?$B1C)1C>l$,|$ $tc?tTj/W! L$9uut$@jhH%V @L$ǃuC=8taD$t$uI$t>thk$V1Ʌ $t}thk$U1ɉL$<=t8=8t 1PPӼ=t8|$DhPW? |$L$D$L$D$ tD$ D$$=88L$QPp=88t=ut$8t$8t$ 2s t D$,t>D$Pj3D$T$"tQPhr$@ "D$Pj詓<$l$,|$u'j/V~tG1|$t>tFhhS&l$LU l$t$1l$ -4b9D$Pj«9-4b9*x1l$,1Kd}Z<$t3$DSVW ShH%WF SUW; <$hh%t$LV[ t$l$D$ D$<4uT588=$8V$tB$hP|$LW |$D$Pj58 8uj/U t@ʼnD$ D$$=$8tAD$Pj?>uP=TY9uDhv3jhh$)1D$PjV8TY91ۃcÍL$%L$0d؁D^_[]1Eh$z>Ph$h$j USWV օ\$ |$$jhP$Q@ l$t=jh`$U( t;jhX$U t9T$(.C fCPC fC C 1}Gt$j/Ur$t9lj)CS0yS\$$UP { uG<$WxC Uwj@V|$$tZ{ u t8w@PwƋ_j:St@PwG_Ot[uUnj]U$tYÊ@t<:uL)SUV$ V ,$}:1j:VStEt$t$Vh$1ۋ\$ t3tHj PU5 }t $9ut=s fCt$t$Uhɴ$;CC tWt_uk8KUVht$; t$t$Vh$;\$ n1HJ38(u$r#U.vC{u{ I%tH%P vC1 ^_[]hM$j WV։2uvuGvuGF G FfG^_USWVȀ%t u7Qt*5p}3|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]VdjU\=h8t<3Ph$jdV(~ l8Iu1IPVQ| jh8C Vd8j[=h8t<Ph$jdV(~ l8Iu1IPVQf| jh8gC V΋tPFtPFFtP|F^WV΋AtP_F~t,WPjW  FtP,F^_SWV׉΋j:StDS}sP;tj%StShS$V SShJ$V G tu)GfPu G=tPhص$Vщ h#VÉ^_[USWVP։ϋ\$l$ 8<tP%ZPUVW誏j Z x.1tETw4s,I  $8 u@$PhӸ$71@^_[]USWVPӉRlj4$6Mw sEWSU耽 1uCL=ʀw һru$wsME$(^_[]fUSWVL$d$`1@D$1ɉ 8 8 8 8 8 8 8 8 8 8 8 8 $8 (8T$(JJJJ5X8rBJ PRSW t u 0b$@t0hP.P@ PSWhź$ 6TY9hWh8螹 Tb98<$l$\$HWj j UhSww t h"VSG j VU; =8t*$xt!X$tl$USP5l8'w jw x6ư=8uPwwVyWVPz USh~$O #$d$dh$4 TY94$ xwwh8 G84$ $8D$HSh8V{T D$H8=8uD$jUjjV h32#V*9h"V9=9=8t5Tb9h&$5l8[& j}^\$WSjUV WShUV Tb9c$d$dh޺$ݤ 1h$39t P9t PTY9Vx 1L^_[]VD$xuGxuAHyu8y u2yu)Qq@ffqQ1҉Q Q@^USWV81ۍ|$4,8l8hnj UD$(D$ hڝjTD$,D$D$p8D$D$$$TY911L$8L$\$0D$t$$ 8<tP^TW59=W59r&wW59݁tPhW59tPhhhZ_$59$59Cà u $E8uw|$5uprk=8ub= 59p8h"$Wh1ɅQǃ=,8t @w3t.Vj%Nh8$+TY91^_jփUSWVu} 1D$(D$ 08T$L$4Y9"D$,8(81K$Y9 Y9 8L$,98t7}t1?-tWhz$5l8 tVhR$5l8w =8tVu u a99a9t jP }D$ \$\$jhx8S4 t=8jhjLhjLD$h$#} WtM?|jj LD$_h32#SUK D$|$n8D$ D$u38} Njhx83 t$jLD$=88xPn 8|$tt$D$jTY9,8=(8jKh32#WD$|$t~D$ D$fxtD$XD$0PS}x.#D$8=u$$ $Y9 Y9u h$5l8* Sh\$Wh,$TY9D$tt$jJD$tt$j J8xPm 8|$ t|$t D$ t$Ѓ|$t t$D$,81,Y9(Y9,8(8e^_[]Ë,Y9 (Y9" t^L$$hФ$W0thƤ$W"u3a9HD$fxL$$D$@щ˅tVWh% Wh"$4b9SlD$|$Y8;p8v+ t8tQK8p8Pbt8j AD$ujj #ID$=8Y9tD08=8t $Y9!ȉ'D$$jSPt$\1a9HsoL$1HfytL$IT$fztD$PW5<85p85t8^:u hQ#Y%\$(St$uƃ t0ti,8 (8;L$D$|Tl8HQP;H~0Q#5l808L$D$L$Pj#j͍D$ Pt$ j u D$@ @(8,8D$ Pt$ Vu ttD$@ @uj(8,81HjSQPЅx,5,Y95(Y9h$I $'8u h"$ } tc,8 (8;L$D$}%l8HQP ;HQ#l8HQP~ Q Pj ;D$@ @tt$(0WhQ#hD$@ @t/t$ 0{8 t h$<1H,8(8j=|$ tD$ t$ЃD$t$ 1t$V,8=(84Pj#zh$hۻ$h6h$YSWV |$$D$h0$Wt D$0$=DY9Ф$tˤ$D$a9ƅu=Xb9=\b9 4F95a9t jV#uh+$Dj$=895a9t jVthp8h@$t$ jh48, jhx8+ h.jD08h0$W 8|t1@v5l8h$ M5l8h($ j#TY9!hjD$ ,Y9(Y9 tQPh$ \$$SWh% jV j"D$ ,Y9(Y9 tQPh$ Vt$h% 081WW>"W4$j,Cj"=08SVhH$5l8'4$jBj! ^_[Åu1t P!=8t jB  |$1=8P!=8t j  |$1=8Pb!=8tV 91j C$,y h^$6=8t TY9joYVV=8t j j =8t TY94$jAVt$h% t)Vt$h% u=8 jx =8{jlWVd81VA5hj95,84Y9rt suY$$dWPVm Wh$V l8Iu1IPVQna jhx8o( Ph$jB USWVD$=8p888jjP 8x8tL$jQjhPd 8<<=D8w=L8j=8=|8u 8h$+Ɖ=8~&t =8u!h{9h#5l8 =8tCTY9=$ 5l8h$S h׼$聎1A =H8=P8=8=|8u 8h$eƉ=8~&t =8u%h{9h#5l8' =8yTY9=tT$ wJ5l8h$葁 ?$tgL8h+$=8 +$3$t2P8h0$=80$PASV3Q LPSV3Q QEPSV3I1  $TY9=t$$ <$$T$$$VRQPWhv$hp8 $$:$:$:$88D$ff8k=858:` 88=8188u f88t P_ 8jjPc 8=8u(QT$ RQhP 8 8Qh8P x8tjD$ Pjh58r D$1888Ĵ8ȴ8̴8д8D$Ph8589 OD$8j58iy h$=8" 8$t#/=D8=L8=H8=P81)L$ ׾8󥀼$u DŽ$$j j $Qh$QPR =8=|8u 8$P$Pt$h&$Ɖ=8~&t =8u.h{9h#5l8  =8+L8 8tPV8 8858=88SWVRQPh6$o8$8$´8D$|ô8D$xĴ8D$tŴ8D$pƴ8D$lǴ8D$hȴ8D$dɴ8D$`ʴ8D$\-˴8̴8=ʹ85δ8ϴ8 88PQjRVWSUt$|$$$$$$$$$$jjhM$VX=8[=8N81ۉh׼$1A#h$hؾ$u 81ɀ=8D$jD$ Pjj58 1Ƀ5l8h5$"{ 1E=8TY9=$ w5l8hy$h$58Z 81AJ8;TY9=t+$ w!5l8h$W5l8Qrz 뗠8<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,PhA$hp8 , |$ |$|$1-8-д8-̴8-ȴ8-Ĵ8-8-8f8D$L$  ȋL$$ D$( ȣ8D$ $ fD$ L$$T$(t$\$VWRQPShJ$hp8N 1-8-д8-̴8-ȴ8-Ĵ8-8-8f8D$L$  ȋL$$ D$( ȣ8D$ $ f8f 8;88jPh858s`1ɀ=8uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph$hp8 \|$ |$|$18д8̴8ȴ8Ĵ888f8L8@uD$ $ ff 8jh8h8e 5l8hֽ$5l8hL$5l8h$5l8h\$5l8hֽ$=8USWVX=88tuPjjPV ƃPj58aV t$8D$fD$D$jP蕘8<D$T$ |$ Mbt$1PWeT$L$+T$ +L$(x@Biy1PjV` uS8tI8#th$uh$8t$4\$8VS58U ǃu+8t 8#uoVS58U t׉58U =8t$jWU ut:|$9uD$0jPjjWk V58Ehտ$B58$U 81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$xM=DY9u E h$#u E 8|uj/u v8tl8 st ;u t"E "} H%tQ%jPH%jP/]'=DY9u+ 8 uhu 7S ]=DY9t8  |$ a9tEa99t jP\jS:I$Y9 Y9TY9=t jjC\{jhx8y jhx8b u$h.j+=8tCt$k TY9,8=(8|&j,u h $zTY9D$$tt$$j+D$ tt$ j {+8xPYN 8|$ t<$t D$ 4$Ѓ|$t t$CD$88D$4 81,8(8e^_[]Ã|$t) ,Y9(Y9 tQPh$ 4t;tSuh% uh"$h32#vD$|$k}t1uu $<$t{D$ u h$h$#u UtbE 8|ujj -*D$ E @h"P( $<$C18 8D$ (u h,$x$(v318 8$fxt$xD$`PW=t#D$h=t 18 88;8v+ 8tQU88PB8j!=8Y9t08=8t $Y9!1ǡa9Hs:|$ ,Y9(Y9 $fzh$R_~|$0|$,Y9 (Y91PPPt$ <,Y9=(Y9|N1ÉD$,D$Pt$U t un\$,;=(Y9,Y9|1jPPt$ <:\$(|$0St$U  tti,8 (8;L$D$|Tl8HQP;H~0Q#5l8蛮08L$D$L$Pj#(̓(8,8St$Tƃ u|$<t?D$Pt$j WU tV$@ @uM @ t" D$ D$Pt$QU t(8,8]',8 (8;L$D$}%l8HQP ;HQ#l8HQPQ 1JjQPRL$1HfytL$I$fzt$PW5485858-8 t h9$t1H,8(8u h"$tE @Ph\$Pj ]D$@ @t2t$(08 t h9$t1H,8(8]$@ @tt$0]u h;#Jtj|$ tD$ 4$Ѓ$t$*1t$V9t$t*t$hN$5l8 5l8h$g ,8% (8|$| j%= 8D$ = jSuBT$DD$@!у։1\$HPSKs{ 1CSu  5l8} D$@PŬP4DPWh$V,^Pj#]h>$h-$h?h$USWV\$j/S t"H%9tjP</H%tQ%jPDžxx8hSh8΄ ƀ8.ue8G1dMt[G09tÉ؉jh8x.0uO.u1GOtSh $r1^_[]5l8h$e SWVd|$t1F58j"jdh$S l8Iu1IPSQ&C W9Vhx8 SWV9 f$D$@=u1H$jjSP{t h$*qhh$592 59 9j Dž,y h$p=8t TY9j9t+t&1ONthSPeC jTu=TY9(u j9j/'h$ =8t TY9j8^_[VY08j ,880^USWVP,8hj |$ 8te$Դ8\81@K$\8Դ8188E8 Tb9CthQPہ ETb9 <88<88󥡬9<<99@@9a9DDa9a9HHa98LL8@Y9PP@Y9DY9TTDY9HY9XXHY9LY9\\LY9`;XY9VQP裀 VWXY9P葀 q;iY9VQPy VWiY9Pg PY9PY9;zY9VQP4 VWzY9P" z]9VPS VUz]9P 4$Vj=,8t,8jփ^_[]8j$=h8t#l8@=u1Hjh2#P> 81hj9,8jh48 WV׉΅tF=u1H$fD$1@1L$tWu1JfD@iQPR/K ~%tD$t1ɅLɃ ȃ^_V|$u&|$ t5l8h$` TY9Q 911j1xt5V 91Vh{$lTY9jP4^5l8h$_ ÐUSWV(Q1h$r#St$@0 88U%8U%8h $և $t 81@88888 88888 8$8,8(850848588<85@8D8H8L8P8T8X8Y8h!$ tVPhY8} 9 J\8h" 3"t `8h7$Ɔ h$PBtFh7%V0tJh$Vt$hv321@(^_[]Ãl$t$ 11GVWV5l8 o3)$<$@5858=88t:D$(ppppp  X8Hx8h8PVS 5858hK#袀 t8tP-8L tPuuƅuz P5vƅt=8O6e-8=Y88uetahPhY8.v =wVh$hY8v 9r&58j?sPVh$L Y88uhH%,8 V-Vh$Pu Vh|i$W\v h$ tlj1WQh$} $VV $r#$r#tWQVz} $V- مtWQVY} $V  مtWQV8} $V~ مtWQV} h$~ q"tWQh<$| h$~ $tWQhrb#| h$}~ مtWQh$| h$Y~ tWSh$| U܅W6VjVjVjVjhj9$<|$|$ $@j:0t$@0<jh8 hj+hfj $@0j@V訒txGp5 <h[$ <?u D$PPPh>$h(v31PhG$F 8P*81\$(ht$Sr t$~$@@FF =8t 1t88$<@VP=8 8tȃujUS 8ȉ8t=u98Ph$5l8 58# =8d8|$|$ t&WWWv$@$@jh8 hj^hfj O5$<h$Y5$<h$L5$<h$?Phq$75$<j?PVh:7#5$<h1$j?PWh'$jXc ރ uR0蝜Jt$$D$D ƃ=8tjWWV/PI PVh$WV =h8t>5l8h8R K=8th8h`Y$5l8B 5l8jh@h8hu3'tEt W=9k\80t&ƅu'E$Y$5l8P]Q /0$~ tq$=8t9j 6Wo \88\8059V =9t'~t!l8HQP;H~Q~ z Pjhj hfj ^_Ã=h8tl8HQP~Q fPj XfV58u<<23t!@23hrb#P`tFuh$j` 58$tPhh83 8^SWV|$1t*<23t!<23WPt Cuމ^_[V58u<<23t!@23h$P赖tFuh7$j4` 58$r#tPhh8P3 8^V98 Y9 91Y9 \8A95P5\8d;t9^USWV1|$-+3t}D$+3111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,hV$D$P膲t uu ^_[]eP:ơl8=8m#t$Qhy$PF +3t7+3 8ttPl#PV: 8uV-jV D$E3Vxtǃu&Vt$h$ Vt$h$5l8E|$tw7j h$5l8"j 7t$Vk t$D$PjW Mr^_[]USWVP 9 Y9$t!uLY9t.u=Y9A99!2323Y9 Y9A t tu Y9Y9tu$Y91BY9 Y9$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5 Y9 9;$ Y9 91tu Y9Y9Y9^_[]WVt$ t8<23tD23VPxtuVh $j[ G^_h$f=23u - 23l8@=u1HP4 1;23USWV}uCjh9l999999(Y9 ,Y9 99|$(jWl(Y9(8 ,Y9 ,8w+959G1;9)ʉT$t$999s?D$09D$(L$, 999=9D$8D$"8ʃ|;D$L$y =8`E\$ |$tY1${ {{;{{WSWm ;{{{ {{|$$PS\$jƺU$O1ۉ___ __$PWj薺 1@G ____SW|$ S\$Om =8fDŽ$ 0Y9t$Ph"$hQ1F$Y9 Y9ƒ\$x|$|l$x&ݜ$݄$ `&L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)Wh2$QPkY99|ӡ0Y9tPL$ lL$ )΅~DQ4))h$r#Sht'Rh9$QPƋ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4\'QPhC$SWsL$(+ 9T$,9\$0+9x@BD$ډL$hT$ll$h|$@,8 (81G؃D$@5p&vqL$`\$dl$`&ݜ$ܼ$&1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4\'RSt$DhP$QP $Y9 Y9ȃ,8(8D$u݄$|9s0;T$ D$r$|$\$|?؍<)hr$؍<)he$QP_ N+(Y9 ,Y9T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh8 VD$ B J1rrJVRVg $^Ã0D$4L$8T$ 1ɉJJJ JJQRP x$1H0V0jڴ0^USWVh=8u=8u }t$XjV_d+9~=9N+ 9y@BD$HT$Ll$HL$$D$$5p&,8 (8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и$r#tH#|$d54Y9PRQh$hW|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ$r#rH#+|$QRh$Pt$!$ų i)s<$*<$Hrr޸t1@D$))kd΍ 9HQP~ Q PʍHr̃t"19HQP~ Q P蹚\t"u59HQP~ QPz9Gdu91G 9HQP~ Q P,[~#\uE9HQP~%Q'H wr? t:,u3Pt%9Gdzh$$ 1N9=9ie%'h9P:tu :v2USWVՉh9Q|tDj.Vs1ۅt6UP|u&)Wh9VV u1ۀ91C^_[]SWVD$=8t5Tb9h=$5l8 nD$t$h$PV` uA 88t8t$~Vt. d89PQ TY9^_[Pv蠘t=8t"=8t5d8h$5l8 1G=8 Sh%hza9R =a9=a9Sh$ha9R =a9Sht&ha9R = b9Sh@"ha9R =a9Sh<&hb9R 0b9=81PPv hh$jtD WVPh87ơl8?snt$h$P Ɔ8 8?)PRQhu35 x?t$|$ 91; \8 ^_Ph$3 ^h$t$hk$5l8[ =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=t8tDt Wbh$.$t Vbh$PD$D$ L$PQRSm:4$uu|$l$ 8l8tQShP$PkSh_$PZ D$WjPUhu3tU58sƉ$t=8t`V;S0<WFWt$P!P Wh|i$VP WSVP $t Pa4$Vh$貟uD$uqh$$ t66hs2#t$hk$5l8_TY9kt$VD$VfPjVz D$Ph$$Ƌ|$W9PjWM u{D$ u?h$# tt$VD$ VPjV D$ 8PhĨ$覞Ƌ|$ W軒PjWϞ 1ۃD$  ˀuPhĨ$bu_4$dj91F=8uR8,=8lj9Sh$Ouh|$ 1$tP_$|$t.WPjW D$tPo_D$|$ t&W赑PjWɝ D$ t P9_d^_[]h@h$h8M \8059Xhh`b9; u`b9`f9`j9V58=|8u 8hM$ߜt>h$h{9K r1ɀ{9.)h{9Ph$5l8舻jh$h{94O tfjhh$h{9O tN=8Xb9t\b9j h$h{9# uh5l8h$- S=8Xb9t\b9a9j h8$hza9L thza9h$5l8跺 1HPb9Lb9Hb9Db9@b9$fO gK9uX u3I u3~u3Pu3hu3" u3 tuÅt^$g t^_[]Vt$VHt^Vh$j: hh`b9蛘 t`b9USWV=hj98t`=8tW$twD9PhhD9 j hD9fD9tJD91PʊD9H9tNjwtH9H9t$h5`8VF |0/thhH%VgG hh$VTG V5$$P  8L$88Y9$-818Y98$ t1=8PGt*"1SSQPVh7$jB#u8TY9d$$r t{9$ t1=8PPD$8$8Y9-8h32#V迴D9VD9t2$75D9 D9Vh$2 h$ 1^_[]USWV,=8t8l$@11 SjhU tUh$< ",^_[]<$tދD$0S ,^_[]WVP58=|8u 8|$=Lb9tft$h1$7uqj h{9c@j WP  =p}3LO@1 5l8jj(h$7dru=TY9u=Lb9u Lb91HtJ=|8uA5l8h{9 % l8HQP~ Q Pj ӵ1H‰58^_USWV458=|8u 8\$L=TY9=@b9!t$Hhb$+j h{9Rbt|$j.h{98bth{9Ԇ{94$uY{9519 {91f u>h{9hn$5l8d f{920h{9h$5l8C {9t$1 UVVh$UL D$(Vq!у $ 85l8jj(h9$;bu=TY9u=@b9u @b9tj=|8ua5l8h{9# l8HQP~ Q 0Pj ٳ# |8tUh$5l8+ 4$|$58=TY91Hƒ4^_[]t$h$j2hL9\tL9h$j:3 USWV\$l$jWQihm#WAiUh*$S2K Džu&UhD$SK DžuUh^$SK Vjh^_[]SWV`j958=|8u 8=TY9h4#7`f9u_j h{9_tL8tGx"uAHt.1Ҁ"ux"u"@`f9ZHt@r1Ӎ`f958=TY9^_[SWV$h$V? VQ= hQ%Pa1Fta\$SW輍 t?|$/uH$VqPVSd 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh{&P ƅu 4$y 1$^USWVHuI\$ $Cj j ShWuu n t "hVWw6 j VSk6 8]t/M I9Nt vuvvS)c jjSS ƃPjS9 \$fD$=8~%|$@jWm98O$Cuu S( VjP 1D$ PWhpq" D$ PWhfa$h$#281\$@jPPhSvvm thh"S.5 8Shu$"-D$ PWh$̈8$\$=8~N1PD$Pd8T$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,F8t<8#tj}ud&8AuZku<FD$ t:D$L$ PQhhuj t\$ ۋEu Y ɇD$ PWh$! 1He^_[]d t$a\ SWV|$GHO~H0^_[Ë\$1NWxu4G `f@uH8t >8#ug GHO~막뭅tUSWV|$\$GHO~H^_[]1M;G~ uWSSu4G `f@u<蹆8t 识8#ug GHO~렉륋t$t 膆WV|$h12$WMxt.h{&W;xt!t$?tt$ h$ 1F1^_臢 th5$j$ Vt$ Vt$ t^Vh^$jp$ USWVHE ML$8t$QPVn DUt$F|$$G(EK9u61Cl$WSSUt|$ ut$G( t^_[]USWV}hr"Ppt+hr"Vpthr"Vpu99u }h$VW$ Hσ s У23߃c u19σdt ltntH9뵈99맃t Vu'o39u=9q1z4$9-u yt$$PQ1ۅtw<$ua9tX}8uNWmƃP*VWP Q 3.gz$PS߉ޅu4$h$\1$tE=@Vh$t$$=9159=9jV DžD$PWHY$$P Vh$D$V=9$=90Ɂ==11BWjV. $=9$uXh$Vhrx%PW9r DŽ$.gz=9uhh W |<$D$D$P_D$ T$Wl =9D$ #D$H=`t= ujVV xLVVh$;Vh`"*$Vh`"Vh$t$ u h3$VD$ !=t D$D$pD$59hVW& Wj|<ǍWh$iltI=9uC9u:Vh$$Wh$-hu3jjD$P|$W t $Vh$1PPPWb\=9$uL=9uLhh W ƒu 1@P D$ 1@P^ T$1=9uW4$T$WjVh$$P t$t S7N| $T$ V1PPPD$T$4$ t h$D$ tP t h3$L$#L$9tKfjjW tT$PQL$TtDWh$b4$u W蛲VhI$Wh`"KWh_$*$l$pT$ 3T$ϋD$1 u VO4$ $Qt$Pt$h$s4$ $W|h"$1B1PW 59'h.'h#hv3胒 j Vv3h.'h#Vc uPh$VO jՆUSWV΍D$PQSx#L$D$xt$h?"1L$h $tS&$ǀ=9u$h!$jى\$9r<$SWV: t*t)u1ۋD$)؃tǃwh:$ h)$@<$D$1Bh!$PW|$ WW3e^_[]h"+PD$L$ $QP{=9u 9XPD$L$ $QPPjVUSWV׉ˀ=9u h3$ t$9jjjSX!ƒt7jPS) tuhZ$Tl$hZ$11PUVWht$虍؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph$jV褋L0L0D0.Vh$h(v3脏 Wh#֌^_[]PD$L$ $QP軞 =9u 9XUSWVpT$hL$lhx!}ha!D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0RmT$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$ȅ'1@ɽ9jD$0P{Ń|$<T$1D$ D$,8@D$,O|$01PPD$(PT$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0 |$_ $D'Cىt KDP@uD$ p}3|$1 ,,C t ^DH@ujGt-Ê p}3DA@CCu 1OD$" 8p}3L$C CDP@uʃ;K}/ K>C<\W O Cj$jGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E9ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$9$$ D$ PhWZ  h)G1$C<\  Cٍ$ j  H$$ j  Êtp}3DH@tKCu$ D$VVD$PV5z Ǎ$$ D$ VVD$PV5T 94$ =z31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$9L$ QhP 911 |$ 1 $Rg4t1BuڋD$8L$ Qj P94 Ǎ$Pj t$4 ^ŃuuD$ L$ }D$HPQ4xWt$ PD6 $(4$hUt$P"6 L$l$ ȉD$<9 ɽ|$Xp}3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't p}3DQ@tVFu$$  Qσ s[aj $( PS a8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A p}3CDP@t Cu;|kwp}3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VE =9 hh V EKCDH@uٺ$yG=9 GKoCDH@uٺ$KfCDH@uٺ$ GQC t _DH@u%ƋD$pW|O@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVSƍ$ jhU0 uG1,9t!9}uEpVO*mj 9xt$p@ 9>GWVt$F1Ejhh9f Å1|$څ,5959h$|$t5959hf$9 911<9t6 uGp5959h$m W߅uFu49t@Py89\9P``9(^_[]R5959h$j 5959h$5959h$VQR5959h$$P5959hY$$P5959h$jjUj 5959h$lV5959h!$UP5959h$>5959hn$(5959h$Q5959h$5959h7$5959h$jj 5959h$5959hf$5959h$5959h$n5959hZ$X5959h$B5959h$,$P5959h&$Sh"$95959h$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u49_NSFJ1<9tJ9ouwvSKt?G $pSH|$698^_[]Ë$@S5959h$j SWV׉HЃ s%j SVl{ G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S0 uC9\9s\9؃^_[]Ë59=9SP PWVh$j USWVP׉΋$1m~ w]$t' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x 2323>u)jH1҉P523 235ojnH@238 23>u j59h(v3=Au 9P`hy"j OPPh$hv3lj`USWV\$|$t$ 91EtB5Ė9WVy 995Ė9@199Ht8h32#pkĖ9 9I 9KphU#jh̖9Cgrf9"9 ...9̖99@Ȗ9 9 =9uȖ98#uxnu 9  Ȗ9W1 t,E-Ȗ9@J}99R)ʉ1ɉ99‹\$k91m1 9Q9u>#u~nu 9tĖ91B C1ɾ8f 9@Ȗ91ɋ\$u9\$t1A ^_[]ÉVKQh"$j9 USWV|9uN 919u:=9u9u3u39$ 9(v39y"91NHQPPa?9=u3P==9tC9S S59聽 th959 o9=9tM 9t=(v3tPy=V 959h9蔼 99=9t99 9@99=9QPrf|$󡨖98t0W599V W59V =<W59$V W59$U VH Uv PWVh$Wh9Kc9h9v 9޻t=(v3t P<h"h9tg 9rH9tt$t$Pj 9H9tȋL$!QPd 99=9u99 9(v39y"h32#Pf959h"$) 99$@1Q59P: 59h9h92 ƅttb9|0 uNt$@ $@ $QV59P91@|^_[]59h"$j 59h#h$h$59h$j h$h$ =9uh$ h9QjYh$벡9@ u:HQP~ QP;t59P 1=9t 9t SWV9X1t^h32#3dt&Nj@HOW:uWB9[뾋HWPi W 91F^_[Vt$Vgt^Vh$j Vt$ D$tVP)uVh$jk V^WV|$t$ WVt^_WVh$j7 SWVP\$|$9t P]D$jPSW PL9VPSW 9^_[USWV9jh991FD$ 99<9JBtOz T$R uW|$+;A 99d9ыR L$y th|$ 9)щ;HT$7D$t{T$A 99+d9. 9;H@ 99|$tod9u1ۉ91;A91;AT$t1~T$ d9=`91ۉ__ WjWSQPZE|$t4JT$B8 9;H`<9T$d95`91~>~ VjVWQPD1FT$1d9=`91ۉ__ WjWSQPDT$t tCsBtt$u 9;Hr<9xt$t91BtȉÅQJA7$,'= 959$=9FPj We @) 9QPW 9Ҿ5=X9 X9R҉Y = 59h(v"5 90_ u 1Pjh2#9S1P5D95@9)1Pjh2#@9S1P5959S%1Pjh2#9S1PS = 9 T$9=9GPj S ƅ $9D$4)أ9$9 509499a89j5D95@9h9j5959h@9 4 5 9ru  T$99D$<= 9(v3=2311 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;523r5 9jjhs%5 9j$l 5 9j l 1-RL$ tKQD$ ;23r5 9jjhs%115 9WjSt$ tsQ5tejPh '" tQF;23r5 9jjhs% 1 ')$Ph$5 9"\ Z;23r5 9jjhs%{ 1t$ D$13Ph$5 9[ F9ut$ t$L$)423F9r5 9jjhs% 5 9j$>k 5 9j .k  9@ @9  ֡9  9u55 959j59 =$9t5 9j j n jh9Y  95 = 9( 5 959j59> =$9t5 9j ej 볋50949989+9T$JQd9T$ut Q;P 9T$Id9D= 9yBu%hh r F 5959PY ;9 jh2#r9  _ T$=@9ujjh$r#h@9  9D$09D$,9D$($9(9,99@9$9L$(t$, @95D9L$0 H9L9T9P9= 9_ 9QZ=z399 @ 9 99r 89֍49@PQ89509 F@+6vFt PҠ uF6^_ËFp vh"$jf USWV ՉL$l9h9щT$Љ$ p}3`9E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B |99r7 |9P5x9x9h9l9$`90D$SPt$V it}ŋ4$L$]\4$L$t&uE\|99r+|9P5x9ƣx9h95l9F1C4$l9l9\$D$ |99ȋ$r+ |9Q5x9;x9h9l9 ^_[]USWV`}$111D$h $u WB uu5$<>ut0Gtg$<;u$<$8u o3ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1hr%SQ t+8ttDGh$jb 1E L$3 thQ% u3h"$jR tD$PW uh7$ۃ|$ tt$脞 uhA$뼅tt$ uha$렋Cu/h# X%tjhH$VV VeSPK QVhK$ -Php$hv3J j>UVQt@t $e^]Vh]$j WVP։.1ɉQPW苪 V?t$8t.1H^_}.8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pVo Cf{~a11C403t?L$qPt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPF tvPv cF vvFF^USWVP1k<j@3~4j@3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<j@3j@3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)op phv3jjCh$j:V1=9 P7W t*i jjj. VPV藂5X<Y95X<f9j5X<@9jP9t#1ɺX@3A<.u91 1@^USWV D$0f 99Z 9,I fEE!f ufE(Mt!U1f~ t @9ufE,$~ZtE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? p}3DAhv3jP W@$T'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$d'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuLTr=m$ 5T<Ǡ5T<נ1QQPS9't$V5T<75X< c1U)19}1ۋ$p$)ŊEt9}1< ˊEE5X<*h*$1VV5X<胄UVj5X<qVj5X< 5X<R5X<d2= h}3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&hv3jM bxu+=9 9σqt$VaVVu5X<Ihv3j@M ,$,$fUuE 9|)BfUhv3jM ,$T$4xut EfEuGza|1x(| E9}ED ufMhv3jL !}Eu)u E t uP訹uf;}]D; jtQD; tt$4UЃF4; ~ttt$4WZunE tuP u sE uNusE9,Et)uE t uP諸uEtPQEEf~3M1tR'MEGЃ9|׋E4t t$4UЃusEE tPrE ^_[]SPt$59t$t$h$hv3:Z(P$@ t$St$t$ t$UPh$'P $A It$U59t$SQPh3$hv3v:$j.USWVT$qЉD$ qGud$ T$T$ $P$ǽ)j P|)1Ƀ QWl$ U|$ WD$p4tS;tNt$Cj S7)؃ QSVWD$p~t G}uo $ $l$Atl$|$q趚KL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufth $VSw}|$Gu1PPwu|$ GL$G)VQw  wy ^_[]D$L$9 fAËL$1x9 9~9USWVl$0.99}=9DP59wǍ PjQm =9ۉ9t @tFj-9Ep}3\Jك@to@uwt uDZ@t< ty< =̟9u =ȟ9tI59xttj 59=̟9uj 5999ȟ9̟9?=̟9u"59ttj 59j 591̟9ȟ999̟9 ȟ9f)91ۈD$u9C59st$L$4 59s9Ƌt$|259sVUUU9}j 59|$uCj 59KVW59Z E߃ @ Ȣ99=̟9uW59rt7j 59b%5959Vȟ9̟99959? ^_[]t$Ph"$VPt$D$ L$ $PVP1A4$^h$r#t$t$t$t$USWVP|$ \$$l$(t$59899D$,$VpUPp1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW蚢j59Z1ɉV,$E|$@t[D$@8tRD$u:hY%59|Tt$@59jTh#59WTWt$Dt$ h%w%591T4$59vpD$ 59p59p‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US59T59ppth4%US59gT/)PS59 59D59VÃ~0L$ZD$  #! L$X1)<(x1 p}3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP蛕 QtRD$(υ~] $9I\$)RPQF KOuLuH|$@tAt$t$D|$W7 Whv3j D$z19Dzf tN;L$$} p}3DXuhv3jO  $9A)RPQ蕔 $8GED$t+)j Pt$59L$99D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P2 4$踮0^_[]h$r#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(59m59l$tKۋ|$,;S|$0L$Dȃ19AD$LD$Ut$HP1t$PQQŹt3;|$,t.D$DE9}SŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j PߺtC@j PɺuL$$)݃} 9WUQS59藅ƅ|$ V}ƅtV5T<4$59#PW'59JPWF1PPW2 WYD$E|$ GWUPS59Pŋ=9VPW=9VJPW:F59|99#WUt$ ShX%59貫1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV4$tWV蘅Vo@WUPT@WK@^_[]h$r#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]h$r#t$t$t$t$USWVP|$ \$$l$(t$59 99D$,$VAUPA14$SWt$(^_[]h$r#t$VPt$D$ L$ $PVP1ɉ4$ ^V59g59!h^fUSWV $$$ `915:5:9zi%5:W9WVP h'Ft(=9tvvP軗 vh9&B>vuɸ( :9:::hژ%\ D$|$ hLY%SUY e~o~1pKrtCGD9붃fg5$<h32#V!PhWh \$h#W.3 D jPh# t \$Sh|$W u4 lZ%h'WZPWVf t }u몋}tE$th#S2 <=u͍4@h#P2 Fho]%V 04$VW Hd9h:h:hWY%5$< bSa$$$ Fm$<D$/J1Wht]%Vdu#D$=uD$h|$d}:h]%'h t61WƑ t@ < uFrWJ` 1W=` jh12$h$ AR5X<dǃ5X<d1FVVPWWz 9$t5:5:W5 9h-j #VjJVj?hKj05X<&节hh9;cD$D$@VljD$ VD$1Åj2PSL$t|$ o u*t$ Q%n ut$ [%n j|rjUtc1L$ <:B @9u1PPPPPjPPj jUVPb4t(jt$W-WA11Vl|$ t$~14S4HC9uW:V1j tPjպjVhJ#西 ![`9j:j"9$u誸t`=d9t jǡ jjGȜ/П91 ^_[]Ét$ hT1GQWP Ph#hv3y VAW =hv3jj,hY%ϱj Źhv3Vjh]Y%讱V V1Fhv3VhEh[%茱V UWVV hK# P芙 6|[#=9t>V萙Ph/]%W 59v59x9=9t>VHPhA]%W\ 59.5909=П9uhv3jjhX]%藰e^_]Ã=9tá:tt$P ju jn hK# tPw t hH%f Zjh.w hjUSWVB L$Qb  P! Ń j h[%U$_ ~ uF t$|$ W~ W%fD/UW] Wjŋ>7Ptn,$n ;nu:FUWњt^FPv蹚tFljFn ~D$PA4$3UV S ŅSY ^_[]ËD$L$I41@fUSWV1t$d9j%Vt$t$ t$t$4$jjVP;=d9P~t$Vj >hj]jYj߄{jVf4ʁVIVjj^4?15d9 {, :VPX~Bjhy, :jPWyjhx=9V/Vbu%, :ǀ$jhxupsz, :Ph"$jX jtO, :)tTPCu2PKu#PuajhxP辚^_[]Ë$l$ D$jP輖tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uVYfVKfSWV1t$t$t$ t$t$4$5d9jV#jr4PVf8 , :$*tKuKt!Pуt, :$P, :L$$Q3 tXD$t$VSVx)VOu]%u]%t*VB^_[À)ujhbsu Vt5T<w1WW5X< 5X<Y5X<wSj X9;xhj_jZjC]jVkJ]%]%!}E'USWVο$WQS袈 Wh]%SS WSU膈 Wh%U7 S1tGUt0VVVVVVVVVVVh"h41PP/t US^_[]SWV$SQV Sh]%V襈 SVW؇ Sh%W艈 Wit VW^_[WV1t$t$t$ t$t$4$5d9jxVtkjo4PV[5xG, :*tD$$tL$PQ^t$VfLtV誕^_ÉWj $?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QND$l$1@$4V9D$pPt$V Z$DaD$|$ $%t ump}3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5p}3t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8up}3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV: \$ 9tOL(tu(D, $ $ rt04 Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW=q 59t@WPh/]%V 59ݨ599shB#h]%A 9t*W蚋Ph]%V 59耨.5 90AtPhQW#hrx%j[1e^_]Ph]%hv3T j UWVVGp =9t>V1PhA]%V݄ 595959wh"hq^%N 9t81h^%W莄V虊Ph^%Wv 59$0FPh^%hrx%j[1e^_]V1hhPhHPjjPj jjhU3hи4xjP訪V輹^hv3jjh]%荡9tPjjh]%rjx SWVD$x1|$9t9Ps1; P]PVh:7#WW^_[USWV$$$L$$QPhV) $h32#V $D$Wj1K4$R 1G9r6|$  WUŋ$(\5F4$ ÃugD$ PVNuH|$dh32#V $t:|$G=9tVh:^%h#^%PE 1KS1D5$$t 4$! 4$u9tVh:^%hB^%P 1ۉ؁Ĉ^_[]U袐$$$1KyQ USWVu ED$l|$(PVW4  ED$8D$1ۉΊ<'t  j Fj'Vǝu Vjljt$ t$PSW D$ t$ )VPh"L$Q h^%Vb t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/W趴 tWP É@/ WP É|$PD$tSz ND$+D$D$ .t Vt$W; tSy Džu]D$T$L$;ȉD$Pt$ SD$L$Wt$t$ h^%P 뒋D$L$T$;t RPSG |$\$$hp%S G|$\$1\$L$<t$0Vhht@W色 fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=X<jP|$ W 5X<tj:5X<j5X<\5X<fjX<D$D$(D$$1WSݫD$ L$VWSPQ31N|$p$ 9h9hptt$$Z =U3\$hU3hbtt$(3 us=U3ujjh_2&j%: hU3hf@t$$ =U3t0U3hU3hbtt$(ְ ^%\$U39t P*9t Pi£:1t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@59L$@EL$D$D$9}=D$hP(>dFod|$u9Mx{;5X<tVEjP|$ۋ|$t h2#N(hP8(du3H u3~u3#hu3l9Nj|$tcj' ;5X<t V|$ t E%u15X<A5X<j5X<CUkct$(胆twPquW_D$td$8u-e^_[]D$t$ h^%jf VhU^%P 1S6 1FV6 Sjhf%5 VS| st$5 $ D$pL$|PSt$( t$ ]9t*t$h_%P 59蛷99t*t$h#P 59h9hS&D$ 0Ku.h*_%D$ p3ut$vm t$e s h9REtt8tjP8 u%t$V6c 6h?_%` j3L$1Ph-_%` USWV։5X<1@P5X< S5X<l$ah 1PSUh& :hP%:hPS1CS-& 9Wh"$R:h$$FPU芄`5X<A@)VUPRQ5X<K\tcjPZRt05X<PV5X<[!PV1PPVt V+`^_[]hv3Sj+h^%近S fUSWV-1@=ԟ9$hd%Pjq h:rD$1D$ $ $?$V9;%VWo PWt$ 臝 VWo G|$ e%'p}3D$W藴PWt$ 臵 uD$L$DAu >uD$ |$O 4$ ))ht$P1 39none1 79 tlf=39 tb=39t`h39h؟9hg%jtCh؟9hg%Sj~$$'|39ؠ9hhg%HOh"Ifh؟9hg%hg%hL [ 8 ؠ9h_%D$ Pj3 ~ht$ hܠ9i t$n{j hܠ9th_%D$ Pj ~ht$ hN :i t${j hN :辈t=N :t ؠ9h|`%D$ Pj ~ht$ hۡ99i t$z=ۡ9u:h`%D$ Pj@ ~ht$ hۡ9h t${zj hۡ9t=ۡ9t ؠ9hhڢ9au=ڢ9t ؠ9D$1@$" h/9S$Wph Vڢ9PPjxVۡ9PPjw SWt%ؠ9|$$|$ t |$uj٣9PPjye|$t j9PPjz^h٣9 =9u=a%=r!ƒa%t๖a%=ujQh9g j9PPj{hܠ9PPj}ؠ9u4D$D$Pj|$uhN :PPj|=N :]$]$tN :=39a%t39=٣9t٣9|$ti=9]$]$t9=9]$t9=ܠ9tܠ9SVWQRh؟9Phڢ9hۡ9h"h,$L=9]$]$t9=ܠ9tܠ9WVQRh؟9Phڢ9hۡ9h"h(jjj@^ xP' 29a%Ph"$hb ha}<h؟9h7g%hS S"jrjQ$H1WWV$Ph)e%8 t( ;$P$Tsh;e%jPbt^DŽ$ 1WWV$PhZe%7 ? ;$0$4&hne%jPh`uq5: 1H t$t$6v1t$t$vha%j<$t$jԟ91@$F=N :h"ha%^ ha%jft$(VQ VlPh#b%hb%Wtf=ۡ9thۡ9h@b%WXf =N :thN :hKb%Wt<:1ɀ=9/9QPh%hh9r 1^ËL$1Bh :WVt$=ԟ9u jG7Wj 螄u1@l:5:o1ɀ=9/9%QPVWh: =1ɀ=9/9QPVWh9 1^_Vt$V dЉh9$^WV D$Ph9 u:$nfsu-Vh9h:Z Vh9h9oZ tWj 蔃1F?t[h9h :h[c%jPu>:c%h9VWh: h9VWh9 1 ^_SWV=ԟ9hUؠ9u(h-%Q\u9h/9hc%U=N :t ha%˵=09t hfg%赵|$h؟9hc%hW h"WƅVWPhc%j[h$V[=39th39hc%Vy[ hZb%jj[ؠ9uGWPhc%jK[=39tDh39h9h٣9hc%V%[=ؠ9tCh3d%Th؟9h?d%h9h٣9hc%VZhZb%jZhB#hc%XPhc%jZ f%SWZhcf%WZSWZ=ۡ9thۡ9h~f%WcZ h٣9hf%WPZ =ۡ9tPh/9h`Y$W/Z hڢ9h#WZ W:hZb%jZhd%Zuhܠ9h d%nS=09thVd%XSh؟9hjd%FSt VӚj|^_[USWV։ϸjPPO tCËl$hjW ojh؟9WV WVS݌ SB 1H^_[]USWV$΋$PhU%,u tW$r#V ^l$PSU 9<$u:PVUWhLf%hC1Ʌȁ^_[]ÿHf%fT$L$t$q"u/Átuss$Ãt6u8h6h/u uh%!w@'hhV D$L$FFhV~ ȃ ^SWVP1ۉSSWSjh' ~t{4$6V1ۅtjSSWPjh'}tEhp%V:$ t&|$\$PS׃thp%j$ uVXf VKf1ۉ؃^_[USWV'h%'\$|$jSP=6 ƅt Eu$wS7mT whB#7U G^_[]WV̎'|$u܎'t%|$ jWQ5 t u1^_ËL$U34USWV1td։σSʗPSW轘 t u6P1PhPPj D$PU. D$t΀8uɃ<$uð1^_[]ËL$U3w4USWVl$\$1}$hmW6StOD$SWPHDWWRt.ljFt(V$'E3h%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQܡ $V1VPȡ 95d9D$40$X@hc$P@tt$45X<*?hu3W 5X<!9r d9ɉt$ =1MD$Ni8D$$11t=i8,4:tǍXUS蔖N݉|$|$l$$9, :ƀyH1ۉLPTXVUQP , :" .hQPnP VUhh9_P ,, :L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP, :$()1HD,048Ƃ(1 d9<596W:|$c[ 9P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً d9ɋD$L$ӾV W$r#QSPSl$GU% , :$H@ VW$r#RPQSD$BP 9t% , :QUHDRhh%P襼 =, :$0@ơ, :$p&L$*QUPVWjj:WD$ D$D$ PjvD$ t.-d9L$QP5, : u<5, :h_R$Pdž$l$, :()8 9 :VM9VjP辜 L$ D$@D$9 d9yuƇy$u4P4 44S*$똋D$, :$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$8:D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ48:El$L$),$|4xfDŽ4DŽ48:T4E,$DB8t$ 9zt$D$tj$DxZfDŽDŽ8:D4B=ND$?P1D$ +D$D$$|$y+DxXfDŽDŽ8:D4B1hPPPPjPPjjR$Pjz4$1K|$$8h"$jW D$Wt$%sD$tvl4u^u3h1PPPPQPPQjt$,$Pj4ÃtCD$WSrD$lxSŁ1H$^_[]1M4$见$<t4u/h誢hPh2V3!I , :V31@멃=d9yud9d9s19dL$w BsÁt1USWVD$$, :*t1G.$ )$Phh%hV 0r%jt(hfMVhh%h% j$ iH%W踢, :$Ph%hV茲 WVh i%蜥 ]hH%Vjj\Q1PP3Ah jl1q|^$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S6t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$'hi%D$P? i%D$i%X3|$0tPhh%hWհ Whh%D$P 0r%D$i%zhni%D$P zi%D$i%i3|$0tPhi%hWT D3t#Phi%j\$S7 S\$W D3t#Ph"i%j\$S S\$W L3q"t12$c1%tWRh)i%D$ P D3@i%tBi%D$0r%D3|$0tL3tQhOi%hW WhUi%D$P hs%D$hi%Q|3i%ti%PD$P\ i%D$i%!hi%D$P9 i%D$i%D3 $t!t$PQh%h7t)$j4$UtQtUd3U$ :=d9t$ $QD3$t<|$t4øSZS$PW^$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRh@n%U EtjP2 t4$T؁ ^_[]Ê$ h0r%W聈$D$jVg ù D$jQQPSE S  9uU$d=Tt=Tu@$x6D$8;$du)Vl$UhZn%SSVUhnn%SC$ Pu1Vt$hNn%P4$S$ l$Sh&r#U5 h:UWVjPK1PSG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQ^_[9rwًz89y8rw19HUSWV , :1G*ZƄ$hi%进h"hP$菞Phi%jVC 59t , :QPhj%Ve 5hGj%SC, :)\$J$WPZx$L$@PQ舢 $d$ PVp D$@Phj%SB D$0PV`Y"D$0L$8L$D$h"P茅w\$D$H$194$h"WYFuށǐW$Wǡ SQ;t$$ *h^9tPjjh+j%_1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#t$r#$j%\$t7ȉL$7 T$wXzi%D$ 0r%D$$'$r#$uht$$P.> j%Pt$hj%t=uD7L7qQPhk%u`$$#d%D#t $D$ hs% $T$hH%RfT$ D$L$ 1@D$h6k%RT$i%D$L$ hH%RuD7#t$$D7$r#@tek%$r#yjk%$r#trk%T$($r#tyk%T$ |$$$r#tk%L$,$r#tk%$r#tk% $r#tk%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h=k%t$D?@غRPhj%t$>ClE;F{Pp\$CPW茞 SMt$0|$4hh褕L$0QjP7. P8WMtVhj%t$y> SvM=9u#D$@9@@hPihk%\$ S0>hk%S">hk%S>=9th9hk%S= $ 1|$@VVPWh3n% ;w$r#r#t#Qhl%S= h@l%ٕhFl%̕hLl%迕=9t hUl%評h\l%蜕1hZb%WL=Sj~WQ`e^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ 'hel%U- Ueuhi%hel%Uj- U>FjVD1Ktljt$"htl%1G$G0r%G 3w"Ghl%j1G ${$0r%C(s4C8'hl%@1C<{@0r%CDsP$sT'Shel%U, UstlShl%U, "U0F$F^ 3FShl%UO, F'U0F $F$^(3F48ihi%hel%U , Utli%Whl%U+ "UJ0F$F~ J^Whl%U+ F'U0F $F$~(^48+4$iƷm۶|$9U91Khi%賙tzhP$臙tiD$hP$Pj記 XWl$UVt$t$]I6NIOu4$=I, :Ph"$h 1PP}#, :)t5Ph%hU 鋔$ 1$ 91APuDFl9Ɖr:, :Ph"$h6 1PP"969ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhbh*m%hm%hhl%荃L$T$jt$oËL$T$jt$XWV׉κ0r%jujWZh$r#Vh22#蘔 ^_V091ɾ 9r^^VD$09tU@8xtlIuAH1FVVjjhh090QRx tjh09j : t09^À=09tjh09j9 09USWV 1WWj9 &iP 6SPj 9 t$ xáp}3D$1/dev4$D$iƋ1N/ u1FSt$$PA/dev uDL$DAt|tER|$$t.jVj8 t p}3L$Nj4$D$/devG4$D$M[1O4$1O1VyE ^_[]USWVPD$tPpP11OFtFhH%P]yt.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|TPm%w]m%PhR"h%V ^_[]Vt$D$QPbLt(D$t%t!hhPQID$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$5:.@ujP =D$1҅D$t 9tL$BuT$ЋT$P]1hPPh"h"jjAPjQQhU3w i4WPZw 8CM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@hc$PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPk;D$1҅ӅtwU0vt\P,40U5t5L${|$P=$tL$ST$Dځ8Nut/$E t$AЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W9ŅjW9{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ b0D$$@$;E tL$ A;L$tI1۸hSSh0ShjU>~`^_[]USWVϋ@PD$ P-hFPt$V x1|$T$RtPQL =`91PWt$$t$$?oD$T$1PWt$,t$,#o t$t$RPqhn%|$dWi D$,tjPpW, t$ Wt$ , |$F;pRw =D$G e^_[]WV|$ tt$F fG ^_Q^_SWV|$D$XhƋ1ɀxQPVh:7#S<^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6<^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVhjm%h:1^_[USWVu 'h%Ў'jVP uh8j}wy jVw) U3OU3Ot 5D$PQ0CG1*QP菂D$,W D$($D$$(D$ ,D$L$40$VRB$$(QVPhm%hSv Zy|8^k|8PG@$QP"B'$HffsWBD$Bjhm%1ۃt$D$hm%hm%WD Vhm%SC Shm%WŘ SL$Ph}Dt$VW6W}#V:ۻ$Phm%$9 1ۄ$hm%$hn%PߕL$LQh^&PB t$,04t$jj h$r#RPjV |$LWjp}3r \DZ@uWQVt$h n%ht$ b 1C}$.1ۿ09PSW~v t$L^^^F~ FFVhQt$ ? t |$dJSjV#v $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj h$r#RPjVR VSh$ht$ }G8@É؍e^_[]09=}t'fy"f9 g9NuEt FuXt1€1ɾi9( Ӏu A'w'h9 ' Àu A&r  uȃsƄ\$,04t$jj h$r#RPjV4 $PVShn%ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj h$r#RPjS W$mPSVh$n%ht$ L -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ hkk%q͊ Y|$hH%u !hDžtoh'6 htkDŽ$v/rDŽ$/dev,$$VuP" D$/devf@/VuP" Q踃낋E\tu xt@@AED$5:$ttt$PуuN, :덬$WPU" t$/devfF/, :WPV! [Se\asta9aO$CQPU! {PWV, :$t(tt$Pуt Nj5, :,$1D$0$h@hc$P5tt$G, :PUftTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVS# $WD$pVK l$ Uhr%VV ǰD$h^"Wdh#WdtyhX#Wdtgh$WdtUhj%WydtCh"Wgdt1r%D$t|n%tD$VPSM VWSB Uhr%jU DžED$4$v PS} t"vh"$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=`9SWt$t$P`$1PWt$t$7`|$u1@G:A5s9%VPWSh: wsVPWSh9 1^_[USWV |$ faa@D$U$1C$r#=:thq%j:VrPWhrx%h:vD$PUAD$h6959h0t%j訙x:rW!9u:QWh9Vt$D$PWhNt%SR$'D$D$ =mdt2Vh9h: Vh9h9 1$hVSf t$t$t$D$ 9jVVE ~;Ƹ PV;!D$i jQP e9]D$|$h]Ww'o ~#u4h9h9Kx 21jio9ލ$9Hf@8:tJu1SSSSSjSSjjUVjlL4jmoPV>VMkt9Ph9w u`~*=:t!hq%jU1:Pjn)D$WjS>\$tt21ۅ1C؁ļ^_[]ht%hyt%h'hs%!bUSWV|1ۀ=9t}h9ht%jŕ ue:Ht%%:h9VWSU; h9VWSh9& VUJ#N@1 É؃|^_[]ËD$L$I1@Ã=:thq%j(:Vt$ D$t PmVj=m5 9b^USWVPWj<1F?tihh9h:huo%j讔uL:9Ht%o%h9VWSUh:~ h9VWSUh9 ~ 1^_[]SWVPVj`<>u1@;9o%h9VWSh:} h9VWSh9} 1^_[ù1@t U9It1ùtA?9t 1ùD$?9Au49ËD$49SWVhflhy1$hWVNb 㹔W3WSChWWh =Wj65|9WjWPVWXI4SP5;VIJİ^_[USWV|$1i/t\1tW49tI1r rr2`0u&1q1ur1ۃ0݃/ar @뜃|$tB aBBa^_[]USWV|$D$L$BJ 0uQ=x91۾O&-p9B0t#1urF49tux99u'Cϸp99t049l9th90 5t9|$Q-jVPho%W'"^_[]WV|$t$ Nt tuho%Cko%o%2tH%jjPWV^_USWV|$=:t h9j;WWG9u:l$}QWVh[f%hUz 1PP` ơ:t3Ѓ<PUuu#D$=ueߋ$$$t\ :P{jۉt{uho%jz$t]PUho%h[Z$t` :hhSjP2 jP W V jUho%h VM Ve tP$td :Uh"$hi jj7ah5 91@|^_[]Ã=:t=:tUh#p%ju C491$th :Vt$h5*%VStV:t 99^t$-9u:USWVt$,VQD$j$t$V-to1\$l$t$GSVhVVj UPw L$Vtu(;D$0s"L$44eQL$|$)L$OGj$W,DžuD$@PPDžj$t$0j,|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$V3 1D$44Un D$44P$D$D$ j$S+Ņm<$t$ >tV\$Sn VOP$|$);\$u ^_[]ht%hs%h hs%sYSV5W31/t.T$ W39u9t 49t q/u^[V1ɍt$QQPVh)p%S y1t1^USWV|$(1$PPWVh)p% $D$(1PPWVh)p% Z$LF1d$Pj%J4$>$ 'h}d$Ueh~.hht%ehhUdW5 9;D$h jU5 9NO r'PPqhVjU5 9&V?Nt PVW WD$ PSt$5 9N 5 9*5 9Sjhu% j D$ PU U[hQ%c D$(SSWVh)p%+ $j5 hQ%fMuQ1AtCjVz{ u4Vh u%"1ɉtjVV{ uVhu%j) D$(SSWVh)p% u$~h=p%jTȁĐ^_[]1USWVhhHt%9tPjjhXp%(1l :h :d :` :\ :X :W3/u D$8W3ڃ9t49u@X :Q/uD$/u.h :X :19haj讹 W31@|$>Z49M \ :L$ d :L$j5T<5X<@5X<=:thq%j聈:l :h :6P5X :hlp%jaa:Wj b0D$ttRN1ҋ0t1t /u oBrg49uƃ49l :149uAuVD$u,D$ \ :D$d :1@49l :^/ d :FX :h :QR5\ :5l :5` :Phsp%h` jj\/_5 9]1C9tvhp%hu>h,_t$FVj.~thp%j軆hp%j謆hq%j蝆1G@9@9th8q%jfhH%_L$QP$u{hQq%_$QPuYD$3$L$3$ t?hVq%huq%Mft!hq%jޅhuq%hq%a迪1=:thq%j訅:]$1L$VVPQh)p% }t|$ th=p%jTGjS"e^_[]1F]VD$FVj/-F^SWVPD$$hB#h r%{at@Ƌ|$]1Phr%S9 4$WV VJGhZb%S^_[USWV-Y3ta1FY3t&U7Jd1tUh"$h] 111Fo u1tjh1@1^_[]VhPr%]t$hPV hhȷ9V% x(ȷ9ƀȷ9hcr%Qj j/P!@_r%t :^SWVhlr%&]Ǹ9hPVm VTFȹ9K5t : ̹9й9PVhrx%hWl jWh%4#M/ hMVSj< 1hhr%WWhMjHj j j jVWW$94ƣlZ3WP*lZ3V9W> jjRt$5̹9hr%WV4l hPr% \$WPSU SLSVj jj-R1@^_[UWVj WW8( W |$ hPW j W tZt : ̹9tV("RWQPhJ%hhe^_]1PPj< USWV=9uj5_3 ǣ959u_3P>ƣ9^V=9~GtO9Ǹ9W WC;ȹ9t19h-Y 9A f9$Ǹ9$V y))L$H 9Jx .@ SPt$< D$PhǸ9=9-_39|uP59 9QjPN P59 9 QjPN -_3D$%=@t=ut-9D e19D8 ft$hH%t$ =9-9ȹ9Ǹ9P  9D G=9V V3 $$9B 9fJh1gjQPĄ^_[]VPt$D$ L$ $tt$VPp 9t 4$VPp ^PD$L$ T$$RQP XUSWV$01D$$h r%WL$Ph"$Q hr%WL$Ph"$Qۜ hr%WPh"$Q赜 4$PAh$t$ k D$ t$訊h"P<D$\$t$ hSx tt1h#S襘 4$0P@P$4V@ u <.=tSh"$t$t t$ hSgx ut$ u?t$i?4$t$ 蒾t3h0Ut$FVj$~t$t$Kt$t$.1Ʌ2jQ#D$t P D$t P Wh"$h3CU jj$T5 9]1N^_[]t$ a>t$ V>V-11N4$茈t$耈t$ t$ 4$ VD$FVjw#F^SWVPD$$hB#h s%Wt@Ƌ|$4T1Phs%S 4$WV6 V=hZb%S]^_[hvK0"PVWhls%hv3e s%^_WVt$ 0PprPGt$>FFVj F^_SWV=W3/t/t$W3GtPVY<t /u?É^_[USWVj$t$ 1ۅtKƉ|$\$FUShSSj WV1 $Vtu;D$ rj$Vtƅu1؃^_[]VPT$ D$t$4$sVP ^USWVӉϋl$jUtMƅtPt$V S3OVUP tP׃S.V%^_[]VPT$ D$t$4$ɫVPv ^À=к9uaк9gq"P :t%|:&t%T :D$x:G$p :&q":SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP $LL $UT4L$ L8L$T$T@Lƽ$$hVWU5 uD5<w |5L Ku1PPD$P菰 )ƍD$Phd@V% |$D$|PhedAV% Vf$1 GaD$P$,ht%t$VL 1PPV迯 $C]su PUhhغ9t$致t.ٺ9CD001 ݺ91 u=غ9tZF9|4$)ja$,hB~%$0u EPPP jOh9D$4P D${O1ɳ$$uƒrL+1Ht$,D04$葯t$$,hB~%u EVPh$P EtE @E w-G$9@  V0؁^_[]1D$L$I@P49wʀu?9Au49 491USWV$$1$hWV$= E jShWWh =Wh5|9Wj jPVW$$4SPV%1Ĭ^_[]ËD$1ɋ0t1ur49A1ËD$1ɋ0t1ur49A1USWV ։D$ $E1$ * D$$ ,$D$u%/ $E1u%uMu%D$$&u%@u%uuu%F\$$x :M \$\$$&HD$\$$)|$=h9=:=x :$ <$D$D$u%H<$q|$4$D$ x :D$% |$D$ h9D$:D$u%=ԟ9u$ByD$1Ƀ _3\$pZ3C|$D$$$$D\$$({|$!<$D$x :D$pZ3{=_3$r#|$l$ D$D$u%$kljl$4$9L K=ԟ9u $fxD$|$D$$.$$C\$$'|$u1= :=9=x :$ <$D$D$u%z<$t|$4$D$ x :D$%R |$D$ 9D$ :D$u%$juLl$ t$<$D$Bx%i$ \$<$D$}x%i$ l$4$J > ^_[]Á=m]3ftp]Hf%=]3PFSWV|$ty̹9GO4VS-tRV t{S5̹9й9VhǸ95ȹ9h^%hSR jSh%4#' fGlZ3~"PptVzzVQ1^_[ËD$ ȹ9ƁǸ9 9fH 9fH1SWVt$ȹ9Ǹ9V~)S4:Qa F9F9F1^_[ËD$L$01,fSWV1ۉShPS$ tD$$P  t Vk:8VW:81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6fu61^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW3V腧y 981ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=`91SWt$ t$L$ T$<'D$T$SWt$ t$"'D$ ׋9t$ t$(2v%L$\PSWt$t$,t$RPPQN $`91WSt$t$&D$T$WSVt$&É֋=9t$Ht$H迍$PWVSt$t$v%PPPQaN $VD$`Pjhq1@USWV u C(D$|$8hjWe3 wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@Ǿ'|$D$u$ԏ'B Џ'B̏'Bȏ'QP׾؏'B@ tu Ǿ'pЋ$+L$L$8L$9ǾH'HQQQQRPRPjD$ tjp}31҉tDH@tӉOGڄu܅tEۋl$0t/t)h$#SD$ L$ tEH/uj#EH@EH`L1^_[]/EHjSP EHHLSWV t$ vDhM&WSvE 1WSSPPjjh= S%FDNHA`1 ^_[ËL$Ahh1USWVL$Ayt&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vD$F@ F5:me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|ڂ94$ukGllPwYGX FPv3t~C $i)ىQRP 1D7D77qfD7 D7 ڂ4$~Efn'  V)RQP fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A jOu\$ 9fA |$tAqfAAڂ 1AA tAfAA A UAufAA) 91jEVVhhˉhrjJVjVQPh@94C(OL$<@C,SPm{,BD$$4D$+{tR[L11HD$Cu5{t/t*ChH%PuF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0%ƋEp%PVjWOUBƃu4UtU%ƃuEtDjUуƃu:C(C,SPJ{,1s$C$10s$mC$s(!C(1ۅÉ؃^_[]hZv%hEv%hlhu%USWVt$ kFllPvuNj\$FFi )tkllklPRQ% ,$kl11CPsNj$ /L$s)RQt$  1/D/D/D/ j{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh- WP1^_USWV, :t$ 1$V[/} Vٞ$T$GD$ pjVD$D$ 1ɺ<t$#t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$L$wA;L$D$4|$HD$0G9GjRWjPy D$1Ex tjSWjPO Ã|$tjTWjP0 jUWjP ۉt$t2t.$L$ PRVSƋ|$Whv%QW t$$|t%L$ PSƋ|$ Whv%QW t$St-$L$ PRVƋ|$Whv%QUW t$ "L$ PƋ|$Whv%Q1W t$PSVW`9D$D$] ٹ}$L$ |D$ L$L$<1jPWSRPh`B$j$P}! t">tt$ Vhv%D$DP}V D$8D$ D$8t$XjVt$(1IQjFj QPS D$89D$ t PV$P |$YtZV6o MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV% )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ`9}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQP VGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋`91щT$1)΋EM M1WRQPSljT$1Pt$uu8)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$h`B$jV C `L$rL$DPhv%uL$DPhv%jQD D$D---D$D$s9CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVhv%PP SVhv%PP VjWaSX`9D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`h`B$j$P t"?tt$ Whv%D$LPO D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t Pg$PWu{{ t|$uuxD$t HL>@D> >jhEV> wE%rhD $uR1jPPPhhPj jjj%VjMF4x!t$PW0Va1@^_[]hv%hv%hhu%WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ 'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; Ȑ'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh#jS[ t$]EIfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=<9t@u.1}hGju tEx y%rty%ty%M u@=Uu,>t'D$ L$, :;\M`|ˀuK(Ѓt tu tPjbjW TƍD$(PVu$1 $$QPVS $VT9$ul$`=u]tP$PS $5fǃU'VTWh"$hy% uQe^_[]SWV0\$@1҉1 F FFF =89tjP4D$VjRRS0<^_[USWV, :(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$hy%jkt1e^]USWV8=89EM 0~klP1 ËE E8؃lklQSPˇ ߾T', :$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$USWV D$ =|9u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS| F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h~%h~%hehG~%USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]hb\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$:u Hp:D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$'d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth{A1Ot1L$D1 L$8ɋT$]t"9tjQPx T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(:u fn:D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$'t$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh{11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQv |$ƄE C ^_[]WVt$ hjP_ ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut~%1^_[]Ãt ux(tth~ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPVs >uD$ D$iousD$fictO4uQG4 t51ҋ5p}3D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuDk l$(Ph%U+f h"U [Ɖ$Uh%jYu D$Ph%VFu wXw\w`hC%V/uPwdhZ%VuwThk%Vu f1ۍ{aE4'WuWuWhv%Vt E< t<uEMPWQWh%Vt$<Is%9|2#PVwtC9z1hZb%WTtVr D$PD$Pt$\$4Sh%h%WS 1(^_[]hw%h_%hBh%h_%h1h%h_%h h%h_%hh%h_%hhG~%mUSWVhj{{1O1ۍD$ShPS$4qz9+ōF,PhedAUզ l$$4$0$($<$8у|1҉$$g F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$謱t98t4 .jPL$Q}o D 9D$ u D$4$8,$F n$9Љ} 1F$F )ЃF n$,$G9t$0$$hÀ%jP r=t31>t9>u 9>t0uk9uV.V&OVU01@19$,|;ЃVt$/؁^_[]USWVHD$1PuهRhjx;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d4'ud FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[hw%hӀ%jg6h%hӀ%jh(h%hӀ%jih%hӀ%jj h%hӀ%jkhG~%BD$T$ L$DrRQPk ËD$Djt$ P舋 USWVl$j/U蒢 1NtbNj\$)CDWPUu uHD/t(t+t!u GF "u^_[USWVPӉ΃=|9ui"sv|$4L$0Rt$`VQW ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=:u [:~V19|(1@@89|~@w1A^_[USWVP=:|$(L$111=4'"\$uӀt0t u@tӋ;ܒ'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h4't$(t$(t$(PPt$0ܒ' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVDnhh4'h 9ʊ  9k9p11KjdƃwD'DtGCuޅtH=:PGd:t)1ɀ<t 'AuVt^_[1V :t(:1t ҡ: :F9r:PPt^fUSWVPt$ 1h4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$hrx%jQQWRjjh%(,1^_[]USWVhu}WWPHD$T$, :L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv, :@u ǀ@>1t$(F F>D$,Vt$<|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP2|$4r!1FD$0P2F;t$4rD$0=0訷D$p藷D$6艷D$vzD$  $r#1ۺL$#PWVSh0RQ t$kPW$r#PShPV , :VL$'Qt$t$t$ t$PPh`g$h$Ǻ, :$0Ͷ$, :$p謶Ft$uD$D$\$(1t1D$pT$xPRVу t\$8CfCCffC C CfCC=:rC fC*C,G1ۍD$(huSSSSSSSjjWPh貓48P胓@,st$VWrW膔FuQ1K59mt Pmt$A59mm1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h%h%hyh%趠USWV$(E]0輬ƋEp謬ljl$E@ t P蓬$r#PWVSjh\1U5`9|$ ww谕w%t$R59RPSQV臽 U5`9w$w zl$459RPSPUV G\$skhSjPD P迹Vc9j!h:%Vuy V,h裫%L$59PRUQͼ hv$59P%PUS袼 hKPSD$Ph[%hh9w 1҃9Q9A \߉$4PWhd@$j$W2 hWh9R Nw@EƆ9 Ft3N$t.1@Ƅ9-H9s Nr,Ŕ9$EBL$ ;QU9Vhm%WQ Vh9WQ h$&İ^_[]USWVX] E81h$r#PPPPhr%PPQ 9_ vSL$QSWPL t@D$ tWD$8uN 9uhƩ 9D$9H*h$r#Vhe@$Epa+D$8u RPt QPVW҃`91VSt$t$覒D$$VSt$t$荒L$8QRPt$ t$hr%Ep#aD$V9p1h$YQVu WPTtY$UtOwGD$VPF)vVQj PO W@ )Q$YQPO H LCF;puD$VPh"$Epn` e^_[]USWVLt$`T$d\$1*kvs0C41GPjhta3  9u vEL$QVUPL 1hPPhQhIhj6Pjjt$(SP衅4ōt$ VPqwU腆S_~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 59c_|$.9L$`ʉAfAD$ 1Ƀx fJ1O S _1L^_[]USWVpU t$01^F4jjX1AǾ 'D$ǃ@\'SPHD$ $, :L1OًP|T$|$`1 |$0jP4D$DD$ `9|$ 9ϋ$|$1HPPVt$t$WRQjD$ D$PW41u!ha%VPWhU%j跿1EWhk%jA hW hJ%W赘$hPS[> D$PS u"hu%WPShU%jA1Eh~%还hPW > Whx%j 0l$Sh~%h%jt D$<%PV$SPW= h%VٗU%1PWQU虾h%V踗SPWi= h%V蟗PWU%PUa<%PVPh%UC ahi%VZPh%j ;h%薗hPW< h%VPWhU%jڽh;%ShPW< h<%VՖ1BP$hу%V趖Ph%jy hЃ%hPW>< hу%Vtƻ$a3Wh%hUȦ 1tVUhU%juŃ|$tjh+'$Ą ^_[]USWV ։Q 1Ht L$ L$$W8 $f} r= jhۃ%U8 u&USh%D$P uh{#( W7 Ņu>L$4t&t u$Ut$ t$ h߃%jt$_LW $ ^_[]USWVՉfD$/D$jhQ%BD$5謔t&裔8t虔SPh%hU VSUG: 991j/U"q t5ÍD$9tK9vH8/t@PrB CߍD$ PWY D$%= h$PW FƄ$/u&踓$QPhrx%hU1 /h$PUV9 hhQ%U>9 e=@uWA x*|$VW$P 9 9r>Ό?Ì0|$W Wn覌01Ĉ^_[]hU蚉 t}/u }$$tcD$Uq|Wf|Ɓ`|$tVhH%U 9 9=VWU8 9%|$W> x(W7ԋ>1F1S躋0jh*#j SWVύD$ PQ1xVD$)tOjWOx@ljj PW W u $=rɁ uƉĜ^_[USWV h讐ljPhW@jDm \$hjS jh%D$ƍD$ PhW@Vl t$1hUSʆ ,$'tWPP|u-9D$C fE,$ !u1L$PPPPhjPPjjj!Qhm4t$t%j=t$VWf_Wzn6V ^_[]VD$@t(L$ 4@|'VhW1l F 91@^ËD$ 9fH 9tPPQQQh%j跶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj f^>D$48T$y:D$ػ˺e{$L$~D$<P t3$r#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$$r#t$DRQPhg%jV D$ T$Bj5`9QPu$r#t4%t$DQRPhg%jV̝ D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o59t$hrx%jt$hVD$XP1WWjjj0賕,`9|$4D$0, :L$QW<W,D$DPV[~ljӍD$DPVx|$߉څu D$$H؋Pٸ"D$<ho%t$w|$,] {t+[1hH%Swt Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#ΊPt$hrx%jt$hVD$XP1PPjjj0?,j D$DPV  D$׋D$@tp}3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSWq )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5`9PQ|$ RPh`B$jW裙 ;9CVDSjP jPPh9. V8@(^_[WVt$ 5X<Q5X<~$uFjP59F$1O~(1h9QQh"h!hRjFj WjPv$h9{e4F(x;F,VPOWv(afv$?F(F$~,v$n?F$1^_USWV4ˋA@Pjq$} C{$t%K0 u G fG lJu'fG G5G.G G,50G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPc+{$4^_[]V$j)藆Nv811Fu >tlIut5t.j+ȅj,輅L$PVh%jPQ 'u tEj,j+荅L$jPPQ, h2#7j*fL$QjPT6 h$j-?t$R59Ph$jFVn j.h'PVhn%hh9F İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5`9RQmL$RPh$jQ͕ G<(\(|(Pu#]j#]L$>PSWhw%j&Q%j5`9SWmL$t$>QRPhg%j&Vi $F|(,u)|$hgPh%j(W6 <$1e<(Ou*?D(Ltۍt$h趃PWh%t$t(Tt(PPWh$j(Vє 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPh%v>;t 4$@;|$|$upd^_[]1؍L$>PWh%j&Q8  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&h脂t$PWh%j(V踓 4$h^VjP lj|$D(dph-PVh%j(We *USWV, :$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá, :H1WjHDWWQZơ, :$1$ , :@u <@TX uDHXT=d9tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W W$r#WRPPQ1ҍD$*W Q$r#QRhQPmD$$W Q$r#Q1Qh0QPE&)ߋ, :0D$pL$$QL$.QL$QPt$SPW/ , :0uNjpfL$$QL$.QL$QPWSSj'B0 h$0+|$pG$DŽ$$T$0<$tT$@BfBB2ffJ B 2BfJB2B fJ*B,2=:r~(uB0fB:B<2@1L$0huWWWWWWWjjPQh\4t8P[@,s$PSMS\$X(؃u , :TXK$'V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VP.D$0VP.VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u hH%P hT$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV5, :R t@D$4D$8GD$ D$,fXC]~1K؃^_[]1USWVH, :L$1$QD$`x_jS(Ņ~ #IuD=T$ ׋D$`B01huVVh"VjjAVjjSUhT4G(WPFw(UU.9w0$CPPs$J)NjT$\C$BCHfJkllPs)ʼnCD$DklL$s)Ɖ)$ى@RQP T$*lklQt$P 1DDD $1D50 D58j D5dtIL$ HL$T$PD=hD$PJSL$`D=4(D$P6D=hD$PL$`1|$DT$\fBA.1NH^_[]ËD$@1ËD$@1ËD$@1ËD$@1ËD$@1USWVxˋuyD$1 |$$B9T$Ju UD$})Ɖߋ] ˉt$w\$_ }}} ދ\$CKT$,9‰|$}+D$,L$D$L$CK CjlP%CtH{hhX'P B =rID$$t?x,u xPtlIu&5:t1IHH Pt$$VW5, :, >|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!8 L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,OhH%D$ P_t5ho%t$ ^u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0X9)ދ\9\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$臀 L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$( L$)։t$ t$A5: 1Fh4%h#%h]h%[L$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4S tt<1^_[USWVGD$5:l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1:9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX8:AL$D$~@ 1ø11OT$LhuQQQQjj PWWSRh649tBƍ|$WPZ(Vn7x#9}`9k<4LE1UЍe^_[]USWV1:T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=T :t*=(:11M<t9\@u 9DDMHEr=P :tO:D$PP1ipt$1t9 :ut$P9t:,@uލEpr=x::J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@(:D WVu)y8u.q$t"y8uqxu Hu^h4#hu%hm h%BD$x8u@h4#hu%hm h%BV 9; , :tD:t99t‹9u€:2t :^WV΋$tRttyu):9tЋ9u:0u1H|$5:,1C1҉T TTCD k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D $k 5:.$r#t22#PS5 >tiD$Pt>Sh%hfT$\$ :$DL$4L$0:0|]t$VPh%WS :( ( PQVh%WSt$\$ CCa5:.> >,>(>$> D$)Pt>Sh%hTS$$(t$,t$(r 9t P `91`9tWWhG%CUWh%hv3@ 9t8Wh%Pm@ 91Ntjh]%PQ@ ^_[]1N =:tt$h%jPuR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ , :V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$i$ytPmptYWtDžtFE tWPV" u WVkjVS E t VPV1HPPS| ƃx`90^_[]h4#hu%hm h% USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4<'jP8 D$$tIWV<VH /11 11$? t1$@$J1$A( 1tiu`$B,\$ D$4h&r#US* 1USSVVjjt$" Sx xL$1^_[]WV|$ 1uOG Pt/1; }ON"h:x 71^_WVt$ F1hWPC dž dž dž$dž(dž,P40^_USWV$h^2t$hPV詾 $$$'D$@{tUhp%V$ USV 8Ouڋ$xhLuhMSPh%V}C(~Ph&r#hV( }hNHC,~Ph&r#hV( }hO#C0~Ph%hV}( }hP#VPh%W^_[]USWV$b3u*11IhuPPPPjj PQQjha3P4b3Nw'$R($'WP\1N1jWWVVjjhQ lS, T0D$4h&r#QP' 1PD$PPVVjjU D$Pu x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP  Qkd)Qhň%Vծ ^_USWV$h^|$hPWq $$$'{hV VPh%{hWvvPḧ%W[hXp1~,t[hYS1~0W[hZ6ǃ4V uh^V0FT~Ph^#hW>% sh[[h^1~`{h\vXPh؈%WF\~Ph%hW$ sh]mFd~Ph&r#hW$ sh_HFh~Ph&r#hW$ sh`#Fl~Ph^#hWk$ shaWPh%V/[hb1~pPPWh%S^_[]USWV$@1N R$fT$' 1jWWVVjjhc|Gl=Ol, :,1۹dWS<S1,G,10G041jWWVVjjhe] 1`G`gX"h\id jhD$4h&r#QP" 1PD$PPVVjjU D$Pp x1pGp1^_[]1wwVt$F~|F P t1@1FF^SWVT$1ۉZBr 1Bl@Zp萘Qkd)Qh%Vl ^_[Vu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_h%h%hh4% SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F|'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$9uh9s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IP sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPWg 6Pw$$$H'@21^_[Ã!t*Wp1@<QKWPVʪ rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Ph%Q蒐 D$D$uPh%j[t1ۉ؁^_[]E@USWVt$ $=p :$Whz%jP 1t t^_[]Ë 9! ÍD$XWh%Pj1~jDjjtD$$2#Vt$\kVjkD$(KD$T\$`C D$\D$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h#W1 ƀ8tt1tCuVL$ D$ j jVp É$qj jVp t#D$Zj jVhp D$T$C\$ \$D$|$u\$uthhp%SΛ hVS进 \$E61ۉSt$,j SVo É$ tbD$ ʉ $tQD$ D$tGjhA$t$}V`j tOjhA$VLj tdjhA$V8j te|$ush2#jiD$(kzT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j hӜ'l$}Ui hj蠤$tJ@j`PQT$諙 T$ $B0Z,D$B8D$B4D$Du0|$`t)Ѓt$\P T$uD$DЋL$Ht D$ D$,D$ T$HD$TD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPv<fWW߅uvF^_[;h%h%hh4% D$phЏ%j iSWV=t95|9t^s3ߥt$#$t$j(PV 4$蝣_u9hsj|$0VPh$jxW WVV &t Ĩ^_h1&h~%hh4% USWVσ=t9u hI 1t0?t+t9t!-|9E WP tt/|$thhr%S݌ !hvSȌ u4$$$$$St$h%j ^_[]SWVD$Qt$Rh%Pj h2#t$Z$jh'Pl uWh2#jZ$tAt$h#W 8tjt$2h2#jeZ$ut$補1ۉ؃^_[USWVӉ΋|$|$tBh%S h&%S~ h,%Sh h2%SR h:%S< h@%S& hG%S \$hˉ#S ǀ?t(+$'WP uE F@j`WV蹉 -j(W tj)Pۨ t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3h&r#WU WUUjU(= H>wѻPD$x0h&r#SU SUUjiU< H=wˉ, :DD$H1Ƀ|1M1҉$PVRUs 1Q\$ SRPa 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á9tq.9Vt$ 9u W. 919vFt=N|:wu1w<: J:^ËD$Hs-s 4'.h4#h֐%hh% Vt$ =9u-(t;u2L$ rȃsT'$tu@:1 J:\:^WVP|$t$=9uI-j PV =v1t-h;t @:t4<:^_Ë $9u։^_-=86:t46:ù^-D$1ËL$T$t$ h5.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh@-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G WhH,^_USWVP} uD$Phf,D$PhH,1\$}UM;t;Gs} Sh%q} ~Sh%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPWw L$D$ T$VQPRt$Vh%h$P $L1QhPjV袇x`WhydP D$Vp?|$t;jWS} \$;MU}h%h%h h% 1e^_[]RSQ} Shh%RQ7 ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSv )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H<:)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV" )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SUަ @$\Cǃ1:k0hWV D$4WhPW$XbmD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$((tÉ|$UFd#D$0jPUQt$((1 Ⱦu#\$,hPt$  Wnt|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,PX P轢D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjjtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14pFuUpt$D$l$x P tn{ C K$;}sL$4QjSPL t_D$HtW<:)1ɉAw Puu2S"j@jP贮 fdžUS#p1ۉ؁4^_[]hf%he%hh%跫 USWV4D$L D$PhjiƋl$X\$T|$H'WU F|11Kn^؃N$F Fdž?džjh>US蕠 @džPWtwt%D$ D$D$D$F114^_[]hf%h%hh%褪 USWVhED$$11@D$|$ t&1ɀ8>@,19QYvPWN D$vP6N 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h%hx%hxh%~ USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D715Da:5@a:5Ha:D$D$ D$1D$hē%WU ? pu $<Ha:e~ft$lt*zD$ƒbtCeubD$벡$<D$ ChjVV5$<hϓ%!Da:@a:zVhVV5$<hq$!D$Vu=o39}4D$$D$l$ t%1PPU D$yUh"$IL$ tHt$(Uhړ%V h32#6ZuRh%fD$0Pt$s #D$8=$$ Da:@a:jÍt$0ShV u UPVy UjD$0y Da:@a:Sy h%t$(T1|$PKy h(%1 y h2%vuWjt$*K1St$K4$Pt$DJ%Sh#PP/3t1h@%t$t$J4$t$5Ta:5Pa:Xa:(v3|$tv3\a:6v3tv3=l$u1HL$(Qhht@P.x PtL$* `a:t$BuhO%lʼnPJyh%Tr0 D$ yhe%@$uBL$$4jPI4$$t$V6轱6hz%j3Phj W j|$WUt$ x>tq1.SPt$ P y 19u2Pa:Ta:)u 8t1FVh%1FVSh%V3t$HD$D$L$D$ L$ D$|$tvD$ P!ƋT$ уƉǃtωÁtt؉D$ u  8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj  UQL$ɋD$tP2 V< Pă h$r#PVh%hv3{ j V jV裐 jR7 VPz^Ð= b3u f b3\a:@=u1HP 1; b3USWV}uCjhxa:B xa:a:|a:a:a:a:ha: la: ta:pa:|$(jWsB 5ha:5Pa:la:Ta:?X+=a:a:@1;a:)ω|$$\$ ta:95pa:T$s;D$0a:D$(L$, a:a:pa:D$ta:D$$D$ =Xa:EtQ1$w ww7wwVWVC 7www ww$PWj趐 M$1~~~ ~~$PVj膐 1@F ~~~~WVWGC =Xa:B5fDŽ$ Ha:t$Ph"$hQ 1FDa: @a:ƒ\$\$xT$T$|l$x&ݜ$݄$ `&L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Wh2$QP] `a:9|ӡHa:tPL$^ L$)΅~DQ4))h$r#Sh'Rh9$QP Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4t'QPhC$SWg L$(+ xa:T$,|a:NjD$0+a:x@B‰L$hT$ll$h\$@Ta: Pa:1F؃D$@5p&|$vqL$`\$dl$`&ݜ$ܼ$&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4t'RSt$DhP$QP  Da:@a:ȃ||=Ta:Pa:݄$|=s4;T$D$r(|$$\$ ؍4)hr$؍4)he$QPU ƃ}u 4)h2#QP/ ơ\a:@=u1H$VQPx e^_[]+ha: la:T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$=$^ÐUSWVl$tD$ t|$ 9vE0 71C~7|$1ۋl$tE:ED$4FFPh%jU C9rED$^_[]USWVP|$D$\$1l$ȃ t :t-u GGuZD$OL$p}3DBt1DJt*u?t!tjjU% C1Fu K 1^_[]USWVjt$ 1Kt.Ƌl$Ut$P V9u 7߉^_[]WVt$ht$ t"t$t$P Vq1H^_Ã|P$ t$L$4T$8P11H|USWV\$ tol$}Wj Q\ t A)WjV\ t:)1ɉ}  t uFt t #t;uu111"~ #t\uAu $ u t QA^_[]Á PhH%t $  USWV}t]M t Cu(1N41CC{uSj{ 1VQSI )re^_[]ÐWVt$ Fv 1Iv NtHN V~tbOtHON t wqEWhENjOtHON  t w?EW6E~u^_%EUSWV$$$$1ɍt$t1G$)ljƉ>umFOKu$t$1VQ$Ppr"u%h)%Tچ 8tІ 8#u$SjVIZ tGtV $1E48FB$)Ex t$7@[h)%hL%,V h)%h%? 7h)%h:%eS^_[]$Vj$A3t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhMjPEuh%hX%{RÉhPKt4VhhjPMEuh%hX%-R1H^_[USWVp $$$!19L$PVW1Hl$Ut ƃUѾ VD$PW] tb$UtM$dtD $dPUt t$jWX tu)$-j4'WUI 1Hp^_[]Ë$j-UP*0 D$L$PjD$L$PjSVt$ t P닆t>PD=džW1ۃ1ۋt9PlDdž- t^[V V* 1u 19^SWVlT$|$$VPC1Nt/ǍD$Pr PSW1 t W?l^_[USWVӉjh0jQ ǃt{jjjV~ L$ F[I#t$r#V=1H^_[SWV$uShŕ%hl%EM $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6 8  89h%hٕ%LNF G8~ ~u3FVh "jv S?uh%hX%3Lt6hWv  t%uh%LPWVu  s V^_[WVp׉$ftPh%hl%K jL$PQW\ jjP PjW tnjjW t\PjW tHD$|PWV t2Ph "jp >u6h%hX%J"h%JW h%Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Sbڃs tAt1t% t&%S@ su^_[]USWVt$48`ځ% t0ty@ !ȉف tV @t !ف tVat ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jWg0jW\05^_WVPt$4%@5@u^t8tW%V$%8Vh'j?#45@u`V,2<jP,M u h=%G,dž,sh&%|Gj?3 t1t3u5$0$ $1Ph%F $ $1PWh%F^_WVt$ h#pG8r4@84^_8t8t uh/%W譬jJ>^_USWVD\$\t$XFtt+NQT$PQhj@RuhN%FD$n D$SPU69Vt)ǍFxۉ,$t1j@SP% SUhu%F SUhc%E 1KNދl$Xue^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uVr'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j$(ǃ,f@K(1ɉHHH HrF>rD&>C5F $Pg w_ǍCWt$PGJ ;)QjPs h7%Cu^_[]ËFUSWV |$8t$4l$Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQh%d> SWVt$~ t^_[ËD$|$F @PWDr( ~ t͉^_[gV6uYh%Q肣~PtVAt(t NLt }#t%PV9^WVt$ >~Lxw16tЄuOF$uItV@u h%4=jjAV? u h%=^_vF$ljjVz? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph%;G$C$G>C>>-ك**PWQpB WtHAt[ƃx t PhM%p;d%KFNtTHNUhm%;n 1On 1OOWt#QWtJV<1V\$ GtIO9tA t1Uh%:@1ۉSSD% 1G|$ ~UVt$$H? { t S^\$ HPtQPV P-<uV[+US?^_[]USWV׉΋A Ph%6:11BU/%tPVVUU1n 6ujn1^_[]USWV $ D$PQhhO t$h%h%9$1Phї%91F\$ MbihS$( EuVh%?9u/l 87t %l 8 uF띃tVh%9D$$ \XPW>&Ƌt8t* SV>uSj$( ҋ>$ 1GOtHONG Pt=7uFGGtIO9tA t3@UUD" 7WQjj.>jV(t0<t$VtSB< t<=VS= h%7 ^_[]Vt$N Qt<tv$vLP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/j 7 Vh(%h:7#!7T$1|$`F(f9t(~ tωӍV QPRh<%6ڋL$tf~(^>8u(F*4$QPω ~ tcF D$F*|$ <UWSPωT$ P\$Shl%6 <PUt$WPSh%5T$ V>t*4$QVn< H^_[]WVt$4rDD$ tN8tCt;D$ jP,( u!h%hٕ%5 j-^_Ã~+ajjjE ̓kh%hߘ%h%5 1m9h%h %h%4 <6Rh%5@hΘ%hט%h%4 111dh %h%h%w4 @+X1BWDPU hΘ%hǘ%h%14 11G1=a:a:6u P9W+a:zh%h%h%3 t0S vPh'%44WVP1PPPVCD@PjVlN48@t @ sfyt ‰48WV{K^_USWVP$t8D$ \$9}$w ŋD$4VW tE9u݋D$ 9t9 u~<$h%Wm1PPt$$ sUVW s W@W;9t>G 1PPt$$ UWD$$ W42D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1G@8u^_[]USWV \$@l$8;h\%WFV .hm%W0V !h}%WV D$$D$h%WU |$t$<t$T ǃt1Fl$<4S GF9uW$t$<l$US WUD$P E t=1FߋD$@D$PwS Wt$Uw EE F9t$@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[]_ |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tWUQ tFt$9t$V_Ѓ с u VXV{^USWV$1t$t$($|/xh%W1O h\%WO \$,hVS`Y jǃ0Ù%$b31O$$0@4jV9u11@PP$u1Ajj uD$l$(D$ D$D$$dՙ%tԙ%Uh`'P$V?u$duiM)4tQ6uD$ 럍Hv H w?$'$<$\w$'D$%D$[D$ PxGD$ژ%D$2 $d 1@D$D$D$$h5$< $hD$%D$D$%1@D$x ˀD$D$FD$9o3t$bS{($h($$p$lo3)$艄$\$,Su1VVVS6$U$PjSA\$hL%: D$9o3$4$|$0W ?o31VV4Wo6&$$Pjl$|$t\UHrBPt$ho%# t$\$ SgV 8$U $`$d$`$do3T$ QR$4 $$`h{"hJ%l$,<$茄D$ t<t,<ulh}%l D@Ug uDh_%F LHUL hl%$ TPUCs D$1DU Vh""4$h{"hY%"D$1Cl$,$bu Uuh{"h%d"D$PU'$tCt)QqtrqpQ#$PDŽ$WU':$t PD $ }$nUqq$VU# U+A$;$b3t P%$dP@1uh% !$dt3$Xt'L$jQP{ uh{"hٕ%#!$j"$hh(v3% $$d ؁^_[]Ë$r,u'o3Qj$4 $u*$`1PQQw $$c@u h%$VUI hɚ%$`5 $d$`$dUh\jj$=t'Uh\j$($}h{"h%h{"hњ%D$L$Ph%U$"h#((R 8th{"h%3$`R L$aQ 8 S$`$d$dl$,hh% u!Q 8th%h{"h,% hh:% u!XQ 8th:%h{"h,%^ U膺tUh{"hJ%Uh%1k$`r;$d@ щ$`$dU&tePh{"hԛ%KD$ Pjh0j,y hS2#yUPh_% U$`$d҃ ց uK$`$dr>1ro3$L$ QPUM W$`$d%r o3$$r#$r#t% t %VQRh0&藋U{\$,1D$WhPiu h%%ShRYj$$nuh{"hX%N$u($`r$d$d$`L$$PQS!$"$1l$,~O$4P t x uY%A%$4PF$$9|t$t׃z Ru$dh%P_S[$bh%JhK*&yD$ L$$$XP裻Uh`Xj$d$ uh{"hX%x $dh%`$dD$ L$$$XQ Uh`Xj$d$W uh{"hX%7S$D$xh{"h%`_h%h{"h%9h{"h%*h{"h1%h{"h% $O Ph%$`m$8l$,t01 t$VV$ uً$t$VPS VSmD$$b@t S$$1t*1G{ tS!u΋[uً$`<$$r>$1Ʌt z uRl$,<$$l$,<$$u@u0$d@hŜ%PJD$,PB't#%@tD$,Ph'Qj$dWD$0P"0$01~ tVh1jj$$vSJI WVjhf%jt*VPuVh3%MWhf%h#0^_Vt$V8t$pApdr$Ph;%NjjtVhWjdj ^WVPt$D$uPh%hl% jP,M tuIh%h8uM, ,*dž,>wt=D$|$ffN(ffOfujX ȉG_1_F*N>QPS F>)^_[USWV$lt pvhz%PWj t=wM$lDA 8thz%h"$h$u)h%hz%hh% $$l~>1ɀhL QSP ƍl$hUPt$ ͵U<1 =wfD @PUhhz%W=udh%h'%htI{>tA,$fEC(ffEEK*S>RQP C>4() PR1pČ^_[]ÍF Ph%n tt {>u[[ht h%? ~>t$fF(ffCCN*V>RQPm F>4)mC Phԣ% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#f? 1HXju V >8t~L$ T$pFhf@H X@fPFM1^_[]h%h\%hGh%h\%hHh=%T8 D$tFL$tt 9Jt >  > 1HBH@M1@h%h%hh=%7 USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;v= 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$h%h%h h%h%hh*%h%hh=%6 L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]h%hä%h|h=% 5 D$t L$HH@Lh%hڤ%hh=%4 D$t@Lh%h%hh=%4 11WVD$ t!L$T$t$|$x0p4P8H<1^_h%h%hh=%n4 USWV(l$<\$߾0'1|$ |$|$<$E4t.1FM0 I?r: E4  G9rՉt$@Pj5 1Nt91D$ D$D$D$9E4t$1E0jS4C9 t G;}4r1(^_[]h%h]%hYh=%3 a:tD$ a:Qa:a:WVjPj1tMƃPj8- t/1vN F NN F N$(F(N,FH VL^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t PզNSv@1F@FDFMF t@PtQPV P؋PtQPV$ PjF uPtQPV, PBF(uFN^_[jt$USWVu-~L =a:t'a:H a:a:N8tv|x| @t,'\$$v3SVUS Uj ^ (f3 s SVW  ^_[]PL$T$ D$$PXUSWV։3 $VhUwJ SV PUh:7#W3 ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXá,f3ËD$,f3r SWVhS$  1OtFƃ ||t U2 +D$HP0f3Ph"$Q] 0f3^_[á(f3ËD$(f3@P )f3 SVt$ - hjh(b3hv3(f3 s1fà 90 jSP  t1 V1H1@^[_ fVt$tNVV{VcV.jVPVO6v^^SVt$ V1Kt=jhjN t!jhj2 1ۃۉ^[ Vt$t'P[džtP=dž^靄D$t$t$t$ SWV$hjWl, C jPWM WhiW 1NtF$$T$ !fD$f9t hWhi t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv c/ 7 V/ V1H11Ʌtm $BD<IG9uލ|$$ ^ F>L$jPWVt uF>*PWV) 1T^_[]VD$0tVUjV v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8`VGw}uM ufE O $PJt $jSVPUQt$4Vjt$8]$?=^_[]ËL$1t$VËD$t 0蒈 VD$0tVBVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV,) Fjŋ$@V $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP tًv\$~;1$D$0Pt tF9u19D$$"$8ЃD$P1~11TjT$4R4肹 t GP9|PX~11\jT$4R4G t FX9|XD$ 9D$H$~11LjT$4R4 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$WuVhi%t$ 0|$w$H;D$t$\hjSKlj$w jD$4PV` CG$C D$ jt$ VU; C yQPD$|PN D$lD$ @D$pUhi$ l$D$m@t$ FGF<<y<$l$D$0P$0% R`~/1djT$4R4 F;`|ӰD$|$0WQe~t$\yWh%e$_w ɺ@r <t5<(<$L$ 1@ut$h%$1@fG(FG>O*VTPRQ $t$6@u<$tW{tmWqG@WfGDGȉGHW~t GPGH$G sW}GLGMO9EVh%W%$7t)|$ jVW w_ jVS r& 1N^_[]j:S t/@1UQhQQj QPF G8mtd& (G8GjSPx O t p}3DPu:pKCu1l$PVhVVj US G0Et=it.u1@1QVhVVj VP <$ O4G4SWV$WjS! F jPS WSh~i tD$Đ^_[USWVPʏ!D a: a: a:a:hȨ%Fa: a: $<  O+VQP 9v1 LJ\$ I;<j,jU@t ǃD h%Vj,j&Ht ǃL h%'j,jPt ǃT h%t$$Whح'V D$9rh%h%[H$|$ 7D$PWD$t$h#D$PB ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW螖D$u?\$S J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0WAqD$t|#t3=w&AL$0h%h:7# HD$1D$S0Wq 1ɍD$D$$D$ 01D$ύD$PD$$PD$h#D$P @ ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h$U h %U h_#U $D1)h$%Ui 1Ʌ<$t$V H9t- t u!H\Ht$9u1@$D$$<jPS٪ 1Ʌ $1@D$S$@tXtT$@S $1B*$Dt,t($DSw $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$迿 `Dd<t A`Nh%<$Dt&u"t$ $< 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U0' tu;uHUhר%4'D$uuUh#t$$t$$P<'t$$^_[]USWVt$ t-tQN  8uP5|$t-tQ uPtt*t$1PPU t xTuXTj卆jPW5 $@DtW,Du싾@WXHLtW,Lu싾HW&PTtW,Tu싾PWX\tWg,\u싾XW(V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(o3|$$t)`#L$# $ 1CƋl$ \$18ՙ%sԙ%Sh`'Pt$ujt$\L$,1VSWPUAjt$\t$ VSWUkU#jt$\t$$VSWUMUjt$\t$(VSWU|$Xj=|$\W Ê@tC< t< u CCu1j h%Wa j h%WI jh%W1 jhɪ%W jhª%W jh%W jh%W jh%W jh%W Pjh%W 8j h%Wq ?L$P1T$XPfL$T$t$XVY(1Kj/Vs uD$|$PjP L$r L$rL$T$t$XV'1Kj/V uD$|$P jPX XL$ r  L$ r  |$XDD$Pi4$PTt$X'TCD$P@3|$X D$P$;$b3t PB11j|$\W6!ƉD$V茼yjW t>thf%V V$ǀl@F |$X L$P T$Xj #' D$X |$PjP^ <7h%h)%OD$Xt$P jP h%|$Xx D$P$<t$Xб  $<PU D$PX|$X hΆ#|$\W t$1VWjWWWWP讔 L$P9>t$XhS% |$X t$1VWhWWWWt$t& L$PA 9>t$Xhr% |$Xt $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV"$6?mjt$\D$ 0USWVcO jt$\t$$USWVEOjt$\t$(D$Pt$P1t$X#džD$X= 84 j/P 1|$Pt@j/P tƍt$X.#t/PF1V #6 |$X t$1VWjWWWWt$t諒 L$P9>t$Xh% L$P ЉT$jt$\# h/%~|$Xq j,|$\W * ƀx 9l$Ps%ƅ |$1WShSjSSt$t ,9h%T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFuu냃|$X0t$1VWjWWWWt$t L$P9>:t$Xh% |$XD$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1Vl @jP   L$j ZP< t< lGG|$Xt$P$ft$Xi $h%|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P&$Ɛjt$\V3u7D$0J| 8Ut$XhU%011IT$P  =D$P-D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hP fFPfFSfFVfF^fdžƆ D$P f$6l$Ptu|$Xt h%@D$X  y@Uh%D$P |$X D$P D$P D$P |$Xn$6t$Pvih%fl$P@Dil$PPTT*BE$ E|$X.E$$(i1|$Xl$PX$\@D$P` D$P D$P D$P" D$P  D$P D$P u |$X4t$XVڪ@@ $dD |$X|$XG\$PH  @D$P D$P D$P@ D$P |$X$; l$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV|Fu8jt$\t$ USWVbFujt$\t$,USWVHF t$Xhר%l$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tV 9]Vh>%'D$PG D$P7 D$P ' D$P D$Pƀ D$P@|$Xt$1VWjWWWWt$tf L$P9>t$Xhݭ%|$Xtut$1VWjWWWWt$t% L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$t L$P9>At$Xh%Qh(% %P C t$Xh+%W à \$S螮ƅ|$PPh8%SV0  jvVj/t$\ AL$1|$P# KD$ɋl$t t OGuhO% N|$XoE1j:W l$t2At$1VUhUUUUQV 9.Mh^% j=W  ED$(@1 t H@WhΩ%+D$Pƀ 1K1t$P # $D$P1t$P D$X.U$ D$L$t$X3d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu `XNul$P(BjRQ Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/U SGJVh׫%>nT$P   xUh%=D$(h%J h>%Ɔ <hn% D$Pǀh% 1K$dVh|%D1DDD DD.u h6% 1D$(1h$WjhB%W1xh%Wh)C$Wphh"WZPh%WDJh%W.h[#Wzh+%Wh=#Wh%W hĴ%W> t$ h˴%W hѴ%V hٴ%Vs h%V] h%VGY h="V1Z h%VT h%VE h%V6 h%V' h#%V h%V h%V h0%V h9%Vk h#VU Vhݬ%  t KC  t KCWh~%Ɔ  xt$P1$ƀhuh%XttC< t< Cuh%0ǃh%D$,Kǃ%1CƆ 1CL$PTGt$P jW l 륉h %W t-h%W th[%W t hͭ%W t@Ch&V thӭ%V D$P@ tsFH t t@@1 t H@ttC< t< Cuh%Ƈhh%wsF< < F1$SUjJ tUh@%1C CC"$f8l$1USjxSjSSW~ $D9]$ƃWh%ttC< t< CuhǬ%Ɔ L$P1S=flF D$PV<  7Ƈh'D$Pǀ 1'S #؄  H@เsƇhD$PǀFt< t< u GGu1L$l$S$ L$1W F 4$VÍD$PSN#CUPA#؃8L$QP.#D$PVSP SL$PT$Xj 6t$PjPja 1Ӄ  (jVtZl$P  h;# 1F؄t  H@hw%1K؃<^_[]ù@D$PǀǍ0PVjG wh%F -{]< < ChѪ%G11|Kh@ ыD$* * h% C{K< t< tC C{< < Cht$1VWjWjDWWSz L$P9>sSh%8l$1S 1K;4$(ƍ|$WPQ FWPD 8UP5 D$P4$VP L$PT$XjCut$PjPFCt+j/Sk tIGC1L$P4 1D$PVSjVD u7tb\$1SVhVVVVWx L$P93tQUh%tGSh@%1F FF@dD$PƀMG=6 @/@(!  t$ %|$(t u$Wh%t$蜽t$1D$( s$t %@uh %j?suh&%ItF1tC< t< CuhE$Wt)Wד Åu"=1rWhA%31ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP/ t(t$Qk,1҉T(T$T T!h%S螬IVD$0D$ FD$(F^ t8U ljD$FWUP >)QjP 1FFL$TT$`r|$\s72USWV׉ˋt$$VC >"u y"uIFA $Vj"ct*Ń!9 VSb ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=p}3DWtCT41Fu|$ D$ |$jjD$PL T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v 71M^_[]USWVՉϋRs j=P ,$|$D$ V 1ۉ\$t?t9D$ 1j=S輶 )9uWVS[ D$\EuVި4$ t5ƍEjPt$  4DL$hG%UhG%hS% |$$t#4$p tzSRD$h% D$tHTMPR订hư%hQ%hh% Vt$t#1PPV t@Tt$ V0 ^Vt$t$Ƙ^ho%h%hdh%{ SWV1SSQ輧 t&WV̤W蔠SSV蘧 Džu^_[WV|$ t^ǘ1PPWq tPW聤hƅthjV ^_h%y1ho%h%huh% D$t L$tHThư%h!%hhܯ%h!%hh%| Vt$t61tpT^hܯ%h*%hh%G WVt$D$ L$zVP͠9tV 1^_ËD$HTt1Pt$ h>%h1%hh% USWV\$tF+1PPU t.jVU 9^TuVUV_u^_[]SWV D$4toHTty9|$0uPLjPW荞t<Ƌ\$8PW虢Sh{%j W VNV ^_[hư%hY%h h>%hY%hhc%hY%hh% USWVa$c$L$<D$ VPU }W D$]8D$HVPS SVËET%t Etuu 8Vt h%跨ňjjUU jWU? Gt ;D$TG9t ;D$TWU/WVurGTL$tIѺ!! tD%WWj03u! 8t 8t h%ާW߅11SSVo tLWVWU赙9t!y h%舧WSSV% Džu1VD$PVD$ PD^_[]t$ t$ hËT$11;T$ tэ HUSWVӉ΋BTx tt /4u$SGtCP7t1Wl$SVlDžGT;CTuQGt ;CtuFSWnu8GttCtuGKQPNuG8K8QP:&tٰ%SGtr7tCtt-SjJ1 8t h%Wj1u2 8t(h%ե&tٰ%ScSj0u 8th%菥1ɅtWVNW^_[]ËCT@$u Cx;GxѰ%WhŰ%h%h;h% D$t%@<t <u ø /1hu%hg%j;h"%A D$t%@<t <u ø /1hu%h%jQh"% D$tBHttu#xðÃxux uxux= /1hu%h%j}h"% D$t>Ht4t uxjh'PR  /1hu%h%hh"%? D$tEHt;tu&xÃxu x uxux{ /1hu%h%hh"% USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^ Wo1=u!GB9r1ɍ|$0+ /1NjB1ɉÀthAu_1ۀ=a:uD1FFFF FFGFa:SVrVW_uPa:މ^_[]Åt 1u19[:Rt1hu%h%hh"% hƱ%h%h'USWVP|$G<t<$ $ l$W)Ã|WhV ۋ|$t(ٸF\$$)؃|PjV 1=a:u+a:W9u!a:3 /1N^_[]h%hޱ%hnh"% SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQO ^_[h %h%hh,%h%hh"% USWV|$t$)Ã|UhVw t(ٸFx)PjVH ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQaGSKWVPQ* ^_[CPh$WVw 1t߉h&h%h{h%h%h|h"% D$tL$tf Hhu%h8%hha(&h8%hh"% VD$t&L$ t/fqPp QPI H^hu%hC%hha(&hC%hh"%/ fV$'PhO% u^USWVD$t$V@1Ij0VY1|$/ooo WV5't-1C 'I?r    DE9u֋-'t/11C 'I?r   DF9uWt$V 1ɉt$\T$\RVQ2PπVt 81I $ȃD^_[]WVP|$D$L$ $QPW tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP٪ tbL$1tHhIJ%h%hM8| /IG?uWG9rD$^_[]h%h%hhW% USWVl$t$|$t1ۅu>t7NL%t`& }#tÉS1ۃ1Ct:tV>tXtShز%t؉8txt@HtPt؉CjV.t.Vt!th%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPV|L 1H^_SWVD$1t^|${t 1NA~0jh%W蓾 uW Wz G9rh(v3 ^_[USWV |$ 7u ;l$$Ujh%U \$C UPWh%NS$t^DžtnjSWc  8thv%ho#荙9h%~1HzSlt$hv%h:7#R tG11CGt0WJ ؃uh%h% ?Ņu1 ^_[]Ë$t|$u%tPWh%h% =mQ[PWh%h%辘KUSWVӊB D$ L$$t Wt *QPtNjD$$7@uMh#0\%tQhT%W %o Phz%We |$ t$h%W@ {D$ D$h%$U\ t$hز%UB Uq |(6h%U 1>h%Q h }#$U 5h%U˻ hg%U赻  h`&U蟻 hd%U艻 h/%Us 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Ph%W I4'h%W +7$@D$o|$L$ uMD$@tBL$qPSh%W"A%D$ E|$tSh%W <$tBt88t/SQt"D$pHpDSh%WAM|$ tSW3D$ t7t1Ph"$W D$ 0uW Wlǀ|$ WD$(P D$ 4#tZ%Ph%W; vKLۖ%t $O&tRh%W AsHhdz%W 'CPPhӳ%W  s$h%W SmPh%W {Pt;CQt$(stPhhV tVh%WT {xtCxPh%W3 tr7@OǀD$(hP'P't0ts~ t!V^t&PD$,P9uvh_%Oh_%B1OĨ^_[]D$D$D$h %W t1PPt$0V袉 tc1PPV菉 9thp%h"$W oET Ph"$Wz QjUt$0VA Ņu1UVWU h/%$V h%V h%V h }#Vյ h`&V迵 h%$裵 tzhg%$苵 Z%tn|$"D$<u D$xuT|$t Su@|$"$<u D$xDu'|$ tjSuZ%4#(4#4#D$ 4#4#tZ%Uh%W Vh$%Wv S,E%tPh/%WP 3E%t= t1tVD%u vuPh?%W ?Q@thM%W|$"D$<uMD$@tBL$q PSh%W0;%D$ S|$"$<D$@LL$qPPSh%Wtl{USWVl$t2E1Ft/׉˃PWhp%S tEu11N^_[]USWV\$l$|$ttUPWem 1tk<.tghT#W tUh$W tCj h%W t/tj.WM tUWe 1t^_[]D=|Vt$ 'Bء0v3H 0v3;@v3h(v3j (v3H (v3 Fut$0v3H 0v3;@v3h(v3j (v3H (v3 Fsh%_ Fsh%I Fsh(C$3 F sh" Fô%ʴ%д%ش%ߴ% %@uwxn%rh<"r]%rR% rG%r<%r1%r&fZ#r*%r%QP F sh/%: F sh8%$ Fth$ Fs hA% 0v3H 0v3~(v3H (v3 h(v3j h(v39 ^ù"%TVT$ L$\tX9t(,Nu2l1th9t,Ju^USWV$$VMtg$$QPVhf%h%%hR%US 1N@t+9w');@MQP'At9w :)߉hf%h%%hL%USX ^_[]USWVD$<Pa t$ $hˉ#V ]NjD$@HD$?1jhm%W! ujhi%W u|$D$4Njt$0tNF tA.t;\$SP薮 D$P1U1HPUUUUSC 9l$u9t[,OuD$,Njt$(\$Sv A t-D$P1U1HPUUUUSTC 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ hˉ#V Dž4$~y14$oy覻 1H^_[]4$Ny腻 USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQI t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$a V T "1H|$0t1rЃ^_[])  7 USWVT$$D$ |$\$,ۉ$l$(1\$]fsuyp}3DHesp}3DH@O\txp}3DH` \\$ $2f\\ $$۝$T$$۝$O$sZ/t uPȷ tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$16 T$$t4<$t s%|$$u1F 71N^_[]USWV Ί p}3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMEl 1 ^_[]ÿ 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3Va 18k 1H(D$ a%t{%L$QSPWV+ Ą^_[]USWVt$HD$DD$L$%NyD$j Pjj"u h,%#yjjj,{ F1uh,%hQ%x^_[]WVt$ tOtPpGtPYGWJidžt2i^_USWV$4$,8G>UjSw C@G jPSQW fC $4CCD V$4PX~ UShip. C O*W>RQP!~ UShip 蝪 1N^_[]WV%hɶ%hhc%hɶ%hhe%觝 Vt1t>PRQqw ~u~uF $`19؁Ĭ^_[]h%{oUSWV(ˋl$uG*SVP tuȓ 1^_[]fD$fx(t1ËL$ D$fx(uD$y V1ËL$ D$fx(u D$K V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS |$jjI`Ƌ$(@h@h{%ljFuJ1ۍl$Sh%j Uq h@USFuCb 8tǍ\$($PhqB@Wt f<$f|$ jUS>> ShlBWOt txD$PhpBW1t tZ$$VЃuBD$PhfB@vs t(D$FP>F u+ h%^Ft P1V)O1ĸ^_[]USWVt$fFtV)vv v AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ d FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBPr ^USWV L$@T$*@h t$ Vh%U $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@莦ËD$D$ PSCL$QP ؃8L$QPSt$@车9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PUNEL$QP=8L$QP*Ut$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $PsPVh%S1I/ދ$0$4Wj$@U t|$r $,84$GPP$0Vhɷ%WwSYGPVh۷%WR$0$4|$WjU $,t|$w1Ћ $ QyPVh%$4$4#]SGPVh%$4轴T$ }ltE$u?ClhPhhWWVh%$4i{,t=u8C,j@Ph@hWWVh)%$4$$0t1WPC,;r鋆Dt%@1W"C,;Drlth1WC,;lrF $'1|$TPÀsE,$0;rT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$Phz"Vt$$@$@$L0 >}k|$`$0PDL$L$QWhz"Pt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$Phz"St$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ VS t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$&   V1(^_[]ËL$DtD$L$tPVQFS D$ƅu SWVD$ L$tT$$w .11t$|$X+9sy "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p @v\F\^VF`t# P?v`uF`^SWVjh0jM 1NǍ\$PSPhWGatrjSjjW2at]jSh@hWatBD$$1ɉ $L$ L$L$D$fD$DtD$jPWW t W^_[USWVt$+VjUAChu,$t#tVh%Pj@^  r%s%PShg%>|PSh;%I 1Bh% ^_[]WV΋tF>rD&H GTt tB9tt9BTtI䋆tÀ~>r QVh %I ^_ËD$$POL$1Bh%` SWVt$tgw]Vh%j @^ w${PSh%%H GLhS ^_[USWVhuD$D$G$D$GH t-wa9GGGG G _G_1ɉO OG_T$SPwD$@tGHѸ%_0wF SPh%H _0G89+\$8D$<l$8 &|$ D$ fD$l$|$Xl$ D$XG8N PQh%G w$yw(<PSVh%KGG0GH% w$_yPVh%G G0GHʸ%c1HG8G4 w$&yPVhٸ%F 8\$0D$4l$0 &|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( \&|$D$ fD$l$|$Hl$D$HG4N PQhS%xF ?G0D$ D$$l$ \&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu P xw0PVh%E w$ww0PVh%Et$6u$HujGtGht:?%tP%I%GHPuXj<c@O;Au<t %?u%GH0ts]Sh%w4Q;Sh-w8P;Sh-w0Py;C w8w4PhŹ%yD 1HG8G4]@uPD$u>C wiVPh%8D wwhV3uVh %DOhD$L$u2wHS3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;th&%CjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]hH%h>%hh~%n SWVt$^ ShV%'BG0+G8PShz%A VhSj81G?6uN%EHPV VhW%|? ^_[]WV։h,j")t/L$ PǀcSc tfǀ 1 ,^_ËL$he0VD$tF9tAtIdtI;u D$ th,%P^USWVPt$t1t+l$$# uVjj4^_[] GiP6mVKAtAt;<t5^ w$oPShܺ%= j1VUjt4/w L.o ow;.GOGO oo_H,$uGdGhSV VU=w-1GG G$^_[]USWVxT$΋}D$t$(HL @r@t‹D$PLih讵 D$ɀT$wȈBBV*QRP@ T$(  D$tz tA<t]<tYD$PPj`D$ 1SPD$XP. 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Ph%9t$*]tVSt$Dj/e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ K ً\$T$ |$D$0 tQL$\$)9C=|$ BRQPK> Ã\$T$L$\$- AW |$ L$\$)9!D$ C<AQWP= Ã\$L$\$T$|$ ‰ʹ ыT$ L$\$)9t$(D$ C+AQVP8= L$t$(Ã\$T$\$ D$0hL$|$0ʋ6D$@@ZD$L$)ȃfPL$ы\$tD$0t,ˋD$L$)ȃf2AL$كt,ˋD$L$)ȃnf3ȉAL$D$L$)ȃDf7t$(1D$ ˋ\$$X\$,\$8u1L$,1C\$4t$\$8\ˉt$(r\$$[L$,1C\$4L$\$8LPL$4\$$u4|$u L$,:t!L$\$ 9L$uC\$ \$,B,;A*ыT$ D$x\$ShP# t|$ tsjPhL$\$|$ PPW PL$|$)9 OGPSQe: ߃<øHT$|$)9QGD$ $ GfGGPS0ǃT$L$D$ L$DD$8D$D$D@1T$ D$,D$ЉT$ | T$D8 B9rKruڋT$$T$4u+L$$1BT$@t$T$4Tʋt$(r6L$$1BT$@L$T$4LPL$@u|$u$L$$:uT$ D$,@,;D$8F)9D$T$ 2BL$$D$DD$8NjT$ L$AЈAL$AWu"D$)Ѓf9ffz׋\$  T$tQAY uK˃L$)9 GM AQSPR8 L$D$T$\$ |$fG G|$L$\$T$|$ |$0t>D$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSPt7 ǃL$D$؋L$؋T$B)Á+),PjR ` ,L$1OAhT|$ 1|$CD$PjsǃSt$ P6 G D$G D$ GGDCff_f_1ۉT$SfGEh1 fGG@D$ffGSf f_ t$WhD$ p\W F Ph%/b ΃]w'6uhZ&V VjjA&1gydA$jD$PVo$ D$D$uD$H%+3tx\u#UWSUWS^_[]USWVj͋ttw։ύB$A D$9t[tQ8tL9hTuGC>wK*PQt$ u)C Pt$h%* ىt$ t$ [u^_[]WVt$ Vt>wwvw k ]WT6ttt9uq@苆t'P{džtPdž1^_UWV}tuPG><r 'u#r G(ftf u  s% u`h% ƍG 4$D$,$5&D$\$$n%u(WhFVjde^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0jw* u&h4j@`GH%GP_iVjhStSE0, pLJ  twAQ \ BjWhbjP[h%hX%7'sY EX>@P, UB( A J*R>RQP-  ]rts4 t*Mq @T$hRQPPV]h%2C>t2Mq M*T$hRPQPV]h%% PjL1wLw w wL$u]rruG XixiF SPh%F% D$h$PS6ΪNRh%%@u3EpCP t: @ NH M plYh%(%u Vh%%h%v$u3=u1HL$h$QP_ t=w:F hK%Ph3%$ wW 1Ƀ8tmF SPh:7#$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQP* hK%C$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6hL$ <G cSc{ ni;`CLsu%1C &cMScq s$SPVhr%! M1C1G G\$"O0)G4)G8uL$YME Ph% A}w s$(RPVhV% WuWVt$ VhFjtht j66t^_USWVt$ ~3E(L$tW9ud G N Qt$(Ph%>W0Edh,%WWNttxV1ɄutZE tS@;FuK_ PQPSh% uWt W+8#4 uE$;FuUhudEh>t ^_[]Ër^tuMEEVF $PE}t\$G$u=EH%j7~ruHWЃ댋Et {WZtstـT$sO$tPЃ8u)ʃAr P N@H@USWV׉΋D$$E t @9u ;M$^ P OPSh%L EiP6r$u!}@uHhjjWV Džt jWVjj|$$tD,%EHPVK#8#4 u2j1Vhe$jj؃^_[]ËL$hSWVP֋T$D$WPt$ 1Ht<$u 1t ɉ^_ËL$hgSSWV1{\t^_[ÉjhQ蟻 C\t4WhATjpuh%hX%YN 8u"54f3hݼ% Wh%h:7#> 1NcD$T$ PUSWV$$($$$$_\ftPh%hl% ch$USY t'sPUV`t3_\t,Ct$?tF Ph%h:7# V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%hl%  t `jW0 tD$ WV h%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r PBJPVhY%$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@sϾ%n1ɋl$ T$Et*u4%& Vh%"%L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$ ;%t$\$SWVStǍF WPh@% WQ} /6uh7%VEiP6ΛVhe$uPj EP'uD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S蜈 t$@4$teSPh["Vt$Wh(%t$( ["ۋD$t$0% PC@4$L$ t/PUVt$Wh%QSPh["t$Wh%t$$7 $PUt$ Wh;%Q  h%V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EPtUWP +މ^_[]SWV(΋6ulVjj3K AuA jQV_ t=Ht*ub 4$?PVhh% OVD|$ss D$L$ q qQPWV8  >(^_[VD$ PhH% v B1F FFL^L$hbWËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Ph% N%GHPVq^_[WVt$ F Ph%g OhGL^_D$ȅtȰ (1SWV\$C rW> 1H4t${GPhVm: ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0hP'D$(PEdx t]SXƀH|EdH #HL$|$WVrhEd@ D$WPYhF9VD$(PY1VVPJ VVP/ ƍF8Pbuz3WMhVP SWWG| WD$(PXjVP ƅuSD$(P臮C$t{tlSWD$|$WP@gFWP3gF8MdQP gXMdQP gVD$(PWS蔭1PPD$,P toVD$(P~xF| uF|FXMdQPfVt$|9tV;UVqT1PPD$,P ƅuC$t$xhP'D$PK1PPV^ ƍC D$~dV`Sn8U`?1PP$  9tC9t?UWd T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$} + PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u&L0 G<0 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ uw.L$( Ʌt ѹ )QPh%jW?F ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]h% VD$t:t0t!PtQPV PuVj^WV|$ 1u7jt @1H1N^_USWV $ yr>. t$ $ q>YtiDD$ \$fl$Ӌl$ h%WU_ - 8th %h%t$@s"j@{Dž@7k D>1ɨ1QSV PQFRC F CFKN\$l$ {g ! Fqg ! F D$(t8tjVW uʋu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF j( oUSWVD$1tW8tQ\$l$G@tjUP u8u@$Vu4jjt @H h%1^USWV0hjdƅT$PL$LD$H|$D~Ӄ^dNdžu`P VLPVH@FDV@PQ5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUtNj.PUj,s t:NhVRPh%j.Q1 @jPW t&@`F`Nd#h%Vy1F`F`uNd 0^_[]WVt$ 1WWV# t1@WWVL9 1^_USWVD$$t8tb\$(勇tK0tEFPU#t.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]USWVD$t81t7\$t(tEPjSP蘕 tmu^_[]SWV|$\$L$Ƌ@t9Xu9x t)jtXx N HF 1h%K1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP_ t&hPt$ h%t$-H1Ƀ H1ËD$1t' t!1Qd(u Q` uSWV|$uuu jPW t$H:u @`PUjPVWTtaQPAHd1IH H$ǀjPj781Fuhز%W0J1N^_[11SVt$ ^d؃ FdF`u uhF Ph% F NhQPh% u2 tQd s((thز%PI^[USWV |$41G$ujjWT t ^_[]ËsWt׋trNf(@_>t .o*Sh'U* Sh'U TD$ 1L$A AAPj@QWj1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU, U V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS譐 t=m<$hj.PSjl 1T$ JO9zPWE`t.tRD$@D$,$KU5E hUPh,%3 4$ f4$ 1SWVt$\$Gt!PtQPW Pt1jPWtt2jP4%W51VPj4^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPUڎ tKd(1tD$ @`C`|$u%CdtC KhQt$(Ph%C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JSN0t4$ 1H1^_[]SWV\${C KhQPWkƋD$džuC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUy?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPt t u"GPt$,hp% GdD$ D$1xG O4SQPt t $tsOdtYG %t%OhQRPh%hWj[u!M 81tC 8t h%Sw$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPwYs t $t8$C O0QPh% OtHO\$u4$FTjPS NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$ D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRhQj螽D$ t;t$(h% j6Qh%V,e^_[]SWVt$Vjj艽tj11G9quƁjmمuިt?5j6  sh%V+^_[USWV] D$@Cxt$rj.VL$0QjQ |$,wVh%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh%h %e^_[]T$rRQPh%ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQ t8D$ L$rQPh%h RQh% \Rh%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVPEs L$  uhj/ËD$CNC KFCF CCj.L$vQP) Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RGTD$0Pj $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$hA%<<tj<uŃt$h%|$$HL$Xpx jP$P D$<t$h%|$rst$h%$p΁Vt$ hV%t$$C$x|$D$ƀt$h%B1|$t +D$(t$( 4XPjQ Vt$D$`P \$Zt$h%t$ 訾 $A D$PAD$LIL$HD$DD$xdt4D$t!t$ut$ha%赺|$$t$L$U@AH|$u D$&D$6D$t0t$ t$<t$0V)j6t$ \$1ɿSQWҰV1QW轰h%t$D$u%D$6j D$@`L@O|$ut$h%몋sLߋD$,9CPut$,t$V6h VGPD$$t$,XGLtbt$,Vt$Pa wPD$(À|$$.&D$$h%ø|$$3WQ%t$4q t$h%Etk,΋D$9t ,JutVt$4q t$h%U|$u/j |$u$jt$ut$h%$t$et$4t$t$h%|$$tL$11BL$jSD$(D$$UWV}u WYh0 ƍG 4$D$,$5&D$\$$o%ԶWhuVjíe^_]WVt$ VhWۭVhuWĭVhFW譭^_SWV|$G Ph%聶ujj蛠Ɖ6GF_>tC FPjTt.t+@JAH *RWP臼 tF F^_[h% ^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh%袴L$jQS u h%%$BHJAWhFjj*G Ph%+WhFW iSh8%|Yjt7UhjPs@h%%hX%O)h%%=d^_[]USWV׉΋A1PUSͪFVUS跪t!NtHNVJFxUUt$Pt$PtQP P9vL,V#^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUh%! t#@uUh%' S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h%j봋4$VUh`%. WjDu!K 81tA 8t h%QL$o@G WQSRPU踶tDD$GdՃGdD$ j.PUj= t'OQPh%j.V h%ر)h*  WhPj)8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW$` uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPw{ Odt Od tY?uŋFuh%Pch%PMt-u~`?w#F0gF Ph:%^_[]jt$趾USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPhV%hl% jSWN tD$ SVk hV%詯p^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uhh%v PUn!D$C,9r|$t"w 7hh%@ PW8!,Nu^_[]WVt$ tqwgVhjj胥1GGG G XGft[^_# Vh%h:7#w ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUWh u?u^_[]USWVD$t81t9\$l$tp|tSUV u6u1^_[]1USWV$.FX|$ j.WUj8 \$wWhp%腭$$tXjVWr ÅFD$Pjt$ L$QƋ ulp|$NjSW: tL$9uPWV[ t0 D$ PSh%+ ^_[]h%蟬jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PSh%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh%$ WSh%藫 F PShD%ت t){4t#D$} t*tu Vh5% Vh %蔪jjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]E%fȹ'9t Qf9Au<< <\$H $̸'|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh%oD D$ PD$p Vha%% D$ PD$p Vh% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPh%wD$`$T$B"pF L$ QPh%P 1Br&$F  $QL$$QPhk%<$tD$x%$l$ |$$ PD$$PVh%蓥D$w 1L$ T$t$QPR SWVPjh0j 1NtKljjSj hPkt $jSjj)WOt WF^_[WV jh0jt ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW达D$jPV t?jWj$j)V蓺t"$jWh@hVqu%hh%螤V6E hh%艤1N ^_SWV\$|$1tD$'1ۃ ʾrft1ۋhDj͍H(H,| t1ۉfǀ<fǀ?WjhP jjW t W G Phv%ߢWhW購 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ Wh%P E]1@EEE,E ]$z t($Vhj jWh%h:7#t^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$<'D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPShjPh%hX%Ġ$1ۋ6<$tD$D$$t;F SPh%Ο D$$hPS6V%Ch%6Jh%蘟u3=u1HL$$hQP? Ã37@$:VL$QRP% \$\$TSjj{l D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Ph%~T$E|$wD藏S GDtL$$SQP _Hbh%Ğߋ$t|1QhQP芰T$R6#\$sD$1CDCH%-ۅt}u2? 8tn5 8tdD$ Ph %h:7#6 FD$ u9H|t;A`t"ftftAdu y  Љe^_[]1ɉH1BPP@ H~ WhT%\ot/Vhj jۓ1Whv%h:7#b vF Ph*%h*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjPwcE <$L$ V諟txEtptk8] 1ɉHH@H HH$7RE%$P67!11Ӌ$PR*uLjEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 t%tPV"ELPu4 u<Udž6ttFtu7@t'P;dž ^_[]à Vh%h:7#ٚL$1jSWV|$WhjdtxWhAS>WhS'WhGSWh$Sws^_[SWVt${Du ?~ Wh%P 1@1ɉKCCS(C|S KtHd sHdit x`t^_[Wh%h:7#k ^_[ønL$x`tBL$$4SWV|$t$_u~G`ux{ ur 6ugtXuG@Psmt3O WhjP迋uh%hX%蟘t|t$WPV6^_[D$T$J P&)USWV$1@|$D{l$Hw" C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1WoC,$;lrD$Vh%Py D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P. D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hWt$$t$$t$PD$\0 t0L$ D$ PQhVt$$t$$t$PD$\0 D$ L$)1H t$|1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s a 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP贅G4 w$'   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP  D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUPP D$Ãx3 t 11A9r1Ë71$1 $P'D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ Ph%虐1l$S3qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N (H (H (H (|$ t*G>r!D& D$H<D$@ VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh % D$P4 uOt$ pffBfBpɋ<$tXQlR ڃ p7t$ffBfB<$tD$WVPR覕 ڃ L$t3D$fffBt$tVWRωm ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQP |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHP dtKWUP D=l$_D$ fǀ<蘶 1fw ')h%葃R|$Qh%j WH D$l$ f9<t1}~ QWh%PEt$sf< fu.Wh%z(Ex(Et(Ep(El6tj!zD$0^_[]USWV΃|$$w Vh%躂1H׋g 1ۉt$$S1ItUB $]h]d]`\$,Džu\$Sj膨ƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh%&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph%蒀k(UPh8%& ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,VhR%4},WVhl%Ȁ ^_[]V΋QhjFw1ɉHH@@ @ @$t ^D Vh%h:7#* ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth$%VtP6jVjj`v-wx9Dth%Vu Vh%<^_É1jVUSWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPhJ%Q|1%8WjjVuD$$Pjۤ<$w$'8uJb%=ǃ8%8u+%8u%8u i%8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ hq%} ؋?ut$u {`<$uhs`t$ h%{} 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h %u:fD$D$D$PjUVD$0T$4)̓w!f t$hU%ufjPD$DP{ D$LȉD$LD$PȋL$LD$P9v) t$Pt$Pt$hu%ul$4D$h|tjD$@PUF upmjhD$DPt$<ǀ'fD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h-%]sP t$h%ws|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPh%r wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Ph%rt}u^_[]8V6)^_[]SWV΋y Wh%q 1CCCC CC$kt^_[Wh%h:7#q ^_[Vt$F Ph%q1B^L$Vt$?N Qh%Po 1B^jL$WVt'׉΃|jt$RPKt j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV1t:ǀ'L/艈L/f$HC;,T^_[]SWVt$Vh[jg1CC C XCC~ ;u Wh%p Wh%ot^_[Wh8%h:7#o ^_[ËL$Vt$VhjifF Ph;%o1B^hVt$?N Qh%Prm 1B^2L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh%hl%n tjS0  tD$ WSV h%vn`^_[]ËL$aVt$?N Qh%P?l Vhjd1^L$RL$@h#%P1|$L$8jQj*j)5Pb<yvu h%a<rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5Pb<uy h@%Qa<t+DŽ$j$Pj&j)5Pb<ouuK1ۃ|$$8f3D$,tD$t3S?hb<uht%hY%ƣa:a:|$$tF1FFFFF  F)F.N,a:a:9rF t$ƃ|$t.t$L$Aut$h%+8f3D$,|$,tF)F/8f3F a<@;DŽ$jjj5 y h%b<uj.h"W: WSh%K Sh%; C9u\$,t$ |$d|$h19wƉ΅h(v3wC (Mb<T$p1Ʌu9Q V&jVn  VPpjƀ 50b<h%胉 5b<h$%p 5b<h>%] b<tPhU%F b<tI b<9~hy$& 0D$D$L$d$ `& \$$$ 0v3H 0v3~(v3H (v3 h(v3j b<Tb<tzb<$$b<|-b<@f3b<$\$\$\$ \$$g%= $h(v3A h(v3A USWV $$919gՉ $t$ $;8t$hhQ%$,n =&GШu+$ ؃?9?)9K9si p}3LA $sv%PQhV =hV$, =GC~ 9r9$$ul&hhQ%$,V =wDG$8:$ t-؍L$VSthV$,= 1 ^_[]USWVP։1|$4$u9|.HPh%` %wS$'W )1@1sC9uÅu.PhM& t$߉E1 `^_[]USWV4)ȃ'h%跅 :։ϋ ˉ h%莹ˉ $Wf_oUSRQt$Ph%O Gl$j.UPj uj.h"U Uh% Gj.UPjuj.h"U _U()|c؉<+<'ueh%0<9#<,uth %謄 '<+ugh% <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5І<t$PV;hD$$HL$L$ 1x1PPPW K jh@Pf 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$Ԇ<D$PVPt L$@D$D$ 1 G|$<$D$=Xf3$TD$j=hS&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hS&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSP SVU |$|$t$ "+Hj=hS&P Ņt$,]d 04$Q"d 0D$$0'߈FHGNm&Þw$D':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4:^ "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H U] dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=<u t11jNt<1<<t P}1@h32#h%w <1USWV1=<MT$ l$(L$DžD$5<hh<评  |$t$#j h<9' D$<h#V[}<tUPxM uTWV:}<WV+}t7j L$QP} x#L$9u<;D$ D$uL$us <8 <APQ~ PQ@L  < tuQhh<譃  |$u<1^_[]<<<1Ҋ+~,u"1t$L$t' t" t΅tAL$= <u < t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=<u#<<tPI <t <1^<<tPwI <VtJT$1Aj<ƃ=<u#<<tP-I <t <1^t <t D$<1@1USWV D$,L$(l$$~ )$1H$`t <1A\$9|ωL$ tgp9tX tt$ PlJ t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$<<tP H <D$,L$$ ^_[]f11f11Ã=$<u /t((<11hhX<PjNt(<1\<$<t Pł1@h32#h%r $<1USWVT$1=\<+\$0L$ D$D$|$(D$5$<t$8S l$,D$ D$D$t$j S~" \$1 h#VxE|$tt$(PH u~#WVoxEWVbxt^j L$QPx xJL$9uAE;D$ D$<u/h#V!xtj L$QPx x L$9t[ $<8 $<APQ~ PQPG  $< tuQt$8S~ E h#VwEth#Vwwh#Viwah#VSwEHh#V:wE /h#V!wE$j:t$ 1@|$ u\<1^_[]WV=$<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhhX<h(<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=X<u+\<$<tPL$AD L$$<D$$tˉ01C؃^_[\<$<tPC $<PPhhX<h(<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=X<u+\<$<tPL$mC L$$<D$$tˉ01C؃^_[t X<t D$X<1@1fUSWV\$l$t$V:C PVWj U!C PUWV S C PSWB t$ VB PVW* ^_[]WV t$uRt>DžtA=b<t ^_Épxj Ph" ؀=`<u1F1=a<tPR 1맋5\f3P $r#QQh%PփN USWV1ۀ=p<t ؁^_[]Q D$ |$GSSPhd<jW&u d<W t< x<r1H|<$r#1ۃt2u3hWh% D5l<~ȍQ2w$X'<PAu <?$D$-\f3O h?#L$Qh%PՃ<`f3@<df3 |<I9@hf3 |<I9@b<`<a<<<y<p<g`f3 |<A9~WH`f3O<Fdf3|t%ƍC!t2)É$)t*<L$ <$)PD$p xPh<=<=<WjD$hpj Ph"轷 5\f3G $r#QQh%5\f3G $r#QQhV%PփE 111{PZDWhVME ESWV 1L$ |$ ru\95<s(>tGǀ=<u.;=В<rN;=ؒ<rDh< DžtVjWD =a<t^]H 1ހ=b<t& ^_[À=`<u1Ffu]pxj Ph"I 뺋5\f3F $r#QQh%PփrD NUSWV|$4t$0Ë <9s&<9 8Ս1ʅ/<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95В<95ؒ<H_ŋ <!9r؅ <9s9s_x< 8!9t.M9wI9rE<8! df3!9u!=<=<h<Rf ʼn9rPVU^  8!!ōD$p <PVL$D$PVt$8<Pt$jUV螳thŋ$L$Ai Qh<=<=<u=a<IE 1=b<tM^_[]t$h<PO=`<1GDu3t몍D$0xhj Ph" 5\f3FC $r#QQh%Pփ/A 9U7)SjZP)MPjS@ :9/ $)QjZP)PjS@ tƉ111USWVˡ<!9ta)‹ |<h t u9=,$)<l u=<OE$)ÍFu\wlǽ'xD$X <PWaPWu=<N V<5<w(H' wǽ'1É;GsG1B TGHO;Mu9}tAtDEWP5u%E9tt9sMxt MPQ}-E $ut=<tGV^_[]ÃWU VjZS> vjZv > VjZS> V t$=b<tt ^É01ɉHHj Ph"E ҋL$SWVȋ<!9t+)֋ |<| u 9t%)D @A Qh<y@D^_[USWV=<t^_[]þ$r#VVVh<%\f3Vh2#h"h]%\f3B#=<uB#[%=<uVh&8#=<uo&RQPhi%\f3Z9&=b<u%"=`<u3#]%=a<uqL$%=<u$VRQP\f3\f3$ d<|$gfff̉ҍ4މ劄1u#GO wһ$r#2#SUWh%T$t$|$f4SUWh%\f3\f3$ <Ggfff̉ҍ<߉劄9u#FN wh$r#h2#Vh%T$\f3$ <|$gfff̉ҍ4މ劄1u#GO wh$r#h2#Wh%T$\f3$ <|$gfff̉ҍ4މ劄1u#GO wҸ$r#PPWh%T$\f3$ `f3|$gfff̉ҍ4މ劄1u#GO wҾ$r#Vh $Wh%T$VVVh%\f3USWV΃=Ԓ<tPt <3!1P`ǡ< <!)ȉ9r1Ud`Ԓ<9tEuótP-x<!1PPjhjUP t(<t<=<=<-<1ۉ^_[]V΃?< ; <v$1u<Ɖ <^USWVP<<< 0trƃh4'PF,=t<=<4$t|n011FEEhD'PـEEC<(9r:5\f3w; $r#QQh%Pփ=<h<11<9s[ $,0EEhD'P=s+<C<]ǡ<<(9r<9$sj,Ѓ0EEhD'P< <s <)ÉE;ǡ<<<(9r$^_[]]8 L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡt<D$<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9<s$5x<!։Ņ9<v6J Љ  ȉ  F1r{@p9<sBJ Љ  ȉ  F<< hf3u%1I#5<!֡< df3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU  tPU$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=<t=<uVj1^_[]VhU3 USWV5<1!-<t E<1-<E@;<v@uW-<E@<tE3t,ÉE uUh</=<t"=<t!<E-<^_[]VhVjS3 USWVΊ |<T$ T$FD$t$V$D$9Btr$u$…<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S~VSSD$x,t @,KZ <tjNjD$G G< <)ʉWOT1Nt TtWt$-<T$ |<^_[]1USWVȋ5<!) |<L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ<94$1PPhܒ< Åk jSܒ<Wn SW<<;-В<r ;-ؒ<1WWjhj\$SU t\tV9tRSP uE24 j@\$S0 -\f32 h2#Sh%PՃ=<1lj1<4$9v(< 1QQjPjVQX @wg1=Ԓ<jUŋ5<!Ɖ)tPUԒ<9tut݉<$/ؒ<u1]4$D$x Phܒ<atA<$ܒ<C 9r09$v+jSV SV<<uɉD^_[]j/ Vd< h<r!1F<u. h<d<F9r^USWVP $1N=<1!׉) |<D$)ot +t=<;<v|u+HL)͉ll+;<s| ullD +lD;G,$vuWVDGWV;_s_u.G WP=<u.M,t <-},^_[]jPR 5<^_[]USWV@׉9 В<95ؒ<jS;ؒ<u >9uPnS;ؒ<FjWV *1ۡ<t  <8<H@; <v@j<H@ < 3H <HPhܒ<<9rWV۫ u=0 j@S0r -\f3/ h2#Sh%PՃ=<9=<u]<t  <6<H@; <v@u,<H@ <t=<p xPhܒ<$@^_[]9Ԓ<u)Ԓ<ؒ<^, flf3ølf3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[áz3D$t$PXWVL$T$ ‹q~y ;q~ t 1~9 QPvL ^_D$ p}3DAD$ p}3DAD$ p}3DA%D$ p}3DAD$ p}3DAD$ p}3DAD$ p}3DAD$ p}3DA%D$ p}3DA D$ p}3DA@D$ p}3DA%D$ p}3DA%D$ p}3DA@WV1F|$ 4H'W tF u1^_ËD$t w$L'1ËL$1t9t1ҍB|uËL$1t# t|$tp}3LH1H rËD$t p}3DA$H1ËL$tT$At9ut1VD$t$tPt$VQ ^D$ h}3DAD$ d}3DAWVD$ $r#$r#tƀ>t%w%+ 0DPWVh-&hv3wF ^_Ð1|$w L$t9tøf3f|$3H#t$r#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[] 1۾$$T$$IwL$I`q|$ \$߉t`r<'j`PS `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ P% t F;@'tm@'D$d'D$'1FthPt$$V V Ft$N tVD$PS |$ut$`e|$ \$|$u,1F|$uu1;`'t$`=u-( 01H^_[]Ë\' r ,$'t u‰,$''<$t9rPQt$ 1t/<$t9ve( |fL$%9 (v`}3fL$%9 (vxp3føÃD$L$L$ L$D$Vt$ t$Vhv3TG hԒ"VF<t"' 0kPhe$hv3B v3Vj PRVg ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t& 0 % 1$^ÐWV|$ W4h' tFu1 ^_D$ftL$Q'1USWV$п$$ u V  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#r?4$Y(111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$<L$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$' j F H @(N]_?[\;^r~uFF<<C><% ^q{t|~F~F ;^r~uF<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF<F^9րրw t$rI{i9s <$=p}3]D_\,<$t~uF F<<Au~uF <F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=Ap}3IDJt"m9~~uF <NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF <F"{u@9s p}3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup p}3DAu f'tf`uW~F=@9t8}@u~uF ~uF <FЉL<$USWV t$ ^h.\u/;nr~uFF<<EMŁ'$~]$'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uF<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF<FωωD$$xt~uF <.n~EFx p}3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s2p}3 DJt"r 9~~uF <N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF <FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! ljh}3TXL$21@u"d}3TXL$1t$1ɅtT$T$1=z3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8u<F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 p}3LAtx d}3uh}3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQI F^_[USWV1y19sC11-p}3D]t#=k)CB9u1Bt=|yuA <Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$<')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' F<FUSWV\$1=z39v1@(ϋF,@jPv(> t|F(N,QV,fH~<t}h}3Dh z31҃9v1B z3d}3Dh1҃9v)1BuG <G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF<<<^_Ã~uF<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF<F1^_[]É؉D$%p't$t$U u U t/uՃt~uFG롋$USWV 1=z39v413A8 $A,tI h}3L$ d}3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQo o^_[]SWV1G9Qs7ӉjRq tF^~uF <F1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=z3|$ r3GtD$WT$ou]t$S |$Qo ]GtD$wt$wt$wSA |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4E L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ Uk ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf p}3>|$u l$`\$\z p}3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" p}3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA p}3D$¿!DQf_֋D$ !DAf|$$_8tV|$up}3L$ DHuf|$$_u3|$up}3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4" L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ 2F ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf p}3>|$u l$`\$\z p}3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" p}3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA p}3D$¿!DQf_֋D$ !DAf|$$_8tV|$up}3L$ DHuf|$$_u3|$up}3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t VE @wj/V腃 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPhY%jPh<h<ø%Vt$1Ʌ1t э^fffffVYT$ws^ÐUSWV[øl$,D$(u1T$|$;D$ T$$75@PW. EPW @PW PW tPWҝ |$D$ tH@PW虝 PW聝 @PWi iPWQ tPW= |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [$ @$ $ ,1 9r 胼$ t+$ $$ FhPWT $D$ D$jD$$ xfD$4D$dzV /$$ AfAfIĕQPRhW2t$ VPj $D$ $PѾ1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ V艘hPWS j:Wr D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVPgt Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃK D$ $t1L$ L9s ዄ$ @<CLL$|It$tjhQPR*D$4 2qPh$P$$9s|$$$9s$$[1 $L9s D$HL$H P RQt$ Ph$P$$9sD$42qPh$P蝺${$_9sD$hI$/9s狄$ @2PQh$P$$9s獃%t$Ph$P躹$$ o9sD$ tW2QPh$PR$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ %$$$9sD$dL$HL$PL$pRt$t$t$$h$PD$L$HL$HL$HL$,HL$(HL$$H @ T$0PQt$,t$4t$h < 9u8jj5 tl P 1 4N 0ǃh ǃƃl t 01^_[ÐUSWV[å$01l uut!j/V8c uSl tƅu: ƍ|$VPQhWz=ry ?h@VCǍD$ jPW 9 D$$WtLD, L$Pjhjjj QD$(Ps Ƌ<$t'Vu D$8 tߖ 8 і L$^_[]ÐSWV[Vl uL=Pƪ6ƃl $tj/Va uA Ɖ獃VPQhW$=r# ?t"l VP tEFu7hh%@V l hVPA 9 h jj\ t=jjjw !ƒt"h P!J 1uR 0F 0^_[. 8#uVt׉ ƐS[î>[ÐS[Ît$[ÐUSWV[`u }蚔 D$<$茔 t$u$$D$Pj.ut=k<T$JL$|D$x$L$x$PQh$$$Pt$glH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$\1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$ D$@j PW, ۑ 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $ \$ 8u$$>$0։證 D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ<]|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPRNѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6W8G4jjdv6g jjdRPەWPGLjh'v6eg W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$< ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJt9u1^_[ÐUSWV[L$tEׁu$C t+t9u11ՉL$!։1^_[]ÐUSWV[k|$GtB#l$%t$P:<t!G t7t9uӾ^_[]ÐUSWV[tC#l$ t$P;t!G t7t9uӾ^_[]ÐUSWV[ËtC#l$ t$PZ;t!G t7t9uӾ^_[]ÐUSWV[t$0t$, Ǎ~VP‰t$D$(%D$1퍃D$ <$l$tg|$ !RP:tG t@/t;L$uЃt'D$ t$j…<$uNt$0t><$9tRU PUW >&t1<$W#^_[]fUSWV[ےt$D$hEt'1PV9t%D=u1p u VPjD$@ 8^_[]ÐUSWV[X|$ D$hEt$1PW-9t%D5up ^_[]ËD$@ 40tM7d D$jPt$V ŋD$18t|d r"u##p uX(B"tt$p al(4$WPjуH WPjSV[-t$ v'!v !V!^[ÐUSWV[D$,8tD$,1퐐8@uj<HƋ|$(W F$"jUF D$ D$,F>~D$Pt$1}nu1ɀ}ouL$D$j=U- tǃ|$D$,t1PU6tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jGŅ8p t 4$xVo1^_[]Í UPjUSWV[5$4$,ga 0(jPU uj:U, (jPU tKt$}/3t$UhV( jVPUP Pt$UD$PQ|$ jjWjjV5mt$ jjWPjVd5t$/|D$PVǍ*$0VPW  FD$ GL$ jjQPjRL4tqVUW%  R(_ 0$0X_ 0(k_ 8uj/UBŃt$ $0UW  ^ 0(QPW  111^ 0$0P$4  11,$j$4V$4WjU0P7PWrt$t8HPQl&^ 0($0P$40  1,$D$PU] 0^_[]Í(,$UPVWt1] ('WP$8$8~tVCfffffffS[D$D$ $L$T$jjPQjR52yD$[fffffS[ûD$D$ >$L$T$jjPQjR1yD$[ÐS[[D$D$ ?$L$T$jjPQjRu1yD$[ÐS[$L$(jjPQRyD$[fffffYT$u|vÐS[~t$:kSWV[\|$Wt$t$ 9r[ ?(WVPj^_[ÐSWV[ |$Wt$t$/ 9r1[ ?&)WVPj^_[ÐSV[ýt$ ƅu])Pj^[ÐSV[}t$t$ƅu])Pj^[ÐSWV[<|$Wƅtup)WPj ^_[ÐUSWV[l$|$UW,ƅttu)UWPj^_[]ÐSWV[ì|$Wt$ ƅtu)WPj ^_[ÐUSWV[[l$|$UWt$- tY 0)UWPj^_[]ÐSWV[ |$t$Wtƅu)WPj ^_[ÐSVP[̆D$L$T$$RQP蚤 ƃu*Pj^[ÐSV[}t$t$t$Q ƃu*Pj^[USWVP[:Pt$0t$0t$0t$0t$0jt$4-5 Ɖ׋,$t1JX (*t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[úPt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1W (g*t$,t$,t$,t$,t$,t$,Pj ^_[]fX?L$"wÍ0ffffffUSWVDXD$4T$dt$XL$l|$`1ۈ$<uЋT$\l$ht$T$l$D$L$D$D$ D$$D$(D$,D$0|$ L$` tt  %ju %#jo%#jxD$X|$L$t \$4UVWRP \$4UVWjjkm~D$$<$|$ D$81$|$ <,PL$4 GD$ =u <$fa :u <$FR 8I O3L$8 =u!L$$;L$sD$=D$ L$$L$$HL$ D$$*D$$y|$ ;D$sߋL$L$ D$$ΐO? G<@ fu  $t$T$։t$81 tl$81 u<@* <$&  |$ $O?1ҸGD$ $ t1#T$#t$ b|$0D$$<D$,;D$s L$,D$$D$$;ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$,w|$$T$()9eD$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP;L$s D$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)yD$\$4VRT$$RQPr;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9l$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$Pjje $~D$$|$ $1\$4WRD$$PjjMe $ˋ\$4VRD$$Pjj$e1Ʌl$<릋\$4WRD$$Pjjd~D$$$D$ x@ut$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$PjjbD$$u|$0L$$tB;L$s5T$ >#\$4K L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS[xjt$t$t$t$t$[fS[wL$T$ Pt$t$t$[ÐUSWV[Øw|$$t$|$0t$(aD$ j/U  ,$t|.UPt$ WVt$8IuUlI 8uFNt$ t$Pt$t$@t$E 8*$t8ru)~$tVPUt$\1`^_[]D 㐐USWV|[År$l$|hUW3 thD||$|/t`j/W'tQ)ύG=7=w{l$|<|VUPc WVU tNPUT 1tU#D$= u:$$0PU=1tC 1 C O|^_[]ffffS[kqD$D$ $L$T$jjPQjRyD$[fffffD$tH8T$ ʉP81øffffffSP[pD$ L$ $QP2[ÐUSWV[ëpl$tPm QPtEt$t$Pb Džt,t)M uWUy ^_[]ÉSP[oD$ tL$T$$RQP' [øSP[ýot$t$u2uD$L$ $QP2 [ÐSVP[lot$t$t$V2 uD$L$ $QPV~ ^[ffUSWV([ot$@8Ut$@œVUW 4^_[]ÐUSWV([nt$<|$DUt$D艓WUV4^_[]ÐUSWV([Øn0t$@t$@V1 t |$HUt$H/WUVt (^_[]ÐUSWV([8nt$It4L$ʁtPD@t1t ʁPH^Ë6u吐V^HD$t4L$ ʁtPD@t1t ʁPH^Ë6u吐S[~Ht$0[ÐUSWV _HHD$ T$$сtHD@ t16|$t сHHPT$~YP$1;|$t<<$~P,R4$Z! ˉZfBtBtXDۋ\$jPZ1 ^_[]ø񐐐WVZ]GD$ t9pH@?t;:u@D ^_øS[Ft$0[ÐUSWV0[F|$D:D$Hx,pL$L|$DGDD$GHD$ fD$$GLfD$,D$(G|$D$Pw|w|u8t EGDt$2t Pd2t75c29lju2V"Z3390uV^_[fffUSWV[Û= t$@+@+@+@+@+@+@++ uǃ$ >ǃ( <ǃ, ^ǃ0 vǃ8 #ǃ :ǃ 'ǃ #ǃ #ǃ #ǃ< -ǃ4 -ǃD _ǃX |ǃp oǃ8 -ǃ@ -ǃ\ <ǃ` >ǃd *ǃh !ǃl f2Ot^t8tjtfxx ؋tvQjPW+ 1 QTpQTtQTxT|=u^_[]ÐVY;1 T$tpqttqtxqt|1=u^ÐUSWVP[j; l$j+AGG(ujjyQPE u0Pjj3xQPej>8 j<` j^ jv j# j:| j'lp j#\ j#L j#< j-,( j- j_ x j|@ jo0 jp jrP jyh jz j{ j| j}| ǃ8 !ǃ$ +ǃ` !ǃ( ,ǃ !ǃ, -ǃ !ǃ0 .ǃ %ǃ8 0ǃ %ǃ `ǃ %ǃ aǃp ǃ fǃ ǃ gǃ %ǃ hǃ &ǃ iǃ %ǃ jǃ8 %ǃ$ kǃ` %ǃ( lǃ %ǃ, mǃ <%ǃ0 nǃ( %ǃ< qǃ #ǃ4 oǃx #ǃD sǃ %ǃH tǃ $%ǃL uǃ 4%ǃP vǃ ,%ǃT wǃ@ %ǃX xǃ0 ǃp ~ǃ #ǃ8 pǃP #ǃ@ rǃh d"ǃ\ yǃ e"ǃ` zǃ ǃd {ǃ `"ǃh |ǃ ǃl }2NthtBt'zxÀ z ϋtuQjPVpx | 꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVX6x l$+4+ع x( PPu^_[]fffffffX5L$fǀx ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[n5t$0[ÐUSWV@[85|$TED$G8$u!O9OuO9Ou 9u_uWEt Wա|$XE3t:`10KEǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3D/1j ‰PD$<x-.D$8|$AG $tJt PwW' W~"G @t;  8u1E3t%`10EEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u_*E2$t L$Xu$ L$Xt$AsiSV[10t$t$V tt$Vj^[ÐSV[Í1t$ t$t$V tt$V^[ÐUSWVL$[D1|$0D$(T$ 2D$ED$4D$D$x f!tW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃx ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4x ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃx D$4Pjjj 4449)4L$ 4QWPt$4;4}2Dž4t(D$4PVt$ t$x 1|$0fx 4)Ɖ4fǃx ff9t |$ u |$ t)Q)RK* t$VUF @f|$tG&D$@ 4444H44L$ 4QjPt$$e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4fx f1jD$` `4rփփ19‰4 4fx fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4fx f1*Pjj!Q j S[*t$j[ffS[)0t$ [ÐUSWV$[ø)|$u2t PjP2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(+P谰tjjP/ ,GT+P膰tjjP GX!2@@xGX GXO <W$` OT d2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V P.D$$<$$u$P HuǐuU P赥D$$鐐<$$u$}P Huǐul$Ut$Vz VU践$|$~"14;>|ްVհ^_[ÐUSWV[å fǃ hu$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$!j T<TV$2@!4tV =wlj<$hVt$ V V 1rNj2Z1퐐T,jj L,LNp9u^_[]Í+PjS[0[ÐUSWV [|$ EG8$u%O9OuO9Ou9$uxWO/t Wb`8tUEHAIL$WW9uOO 9L$u-O OQRt$ P8GGMIAG GAE3t4`10|xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R G4$膣=u8 $A @11 $<xD$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a qUR 8uE3 $tԋ`10vL$Eǀ3뤐SV[í0t$t$V t V^[ÐSV[mt$ t$t$V t Vr^[ÐSWVP[+$t&T$t$2PWj $^_[ÐUSWVP[1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[ T$9D$P= 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[%1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[ØD$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9  f$t|$u!|$t'QL$ )RWlŃuRG @tG 8u=D$3t.`10IrD$ǀ3G @|$tmG  f Hȃ  fftVWa=Vt Hȃ 9 Hȃ f9ufǃ f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f D$DhhA Qʃʃ19 f ^_[]ýG @tB 8u8t$3t)`10oǀ3g 룸+Pjj Q賳 jSWV[|$WWƃuOG @tD 8u:3t)`102oǀ3^_[ÐUSWV[[tt$339}3AP3腞t' 333343;33PQRP! 33t331^_[]ÐUSWV[Ëtt$339}3AP3赝t' 333343;33PQRPQ 33t331^_[]ÐSP[ý$tT$ 2Pjj $[ÐXo tT$QT1øUSWV[6TAx43fTFT$PXj R+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhto DHDHDHDH uǀD$ FF^_[]øH+Pjj+,(+PjjQX j^f+P jHffffS[n0[ÐUSWV[H|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQ؟uF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|诱t1fF9vʋGPt$wW"W1^_[]ÐSV[0t$t$V t VN^[ÐSV[Ít$ t$t$V t V^[ffSWV([I0Wt$<2WV0^_[ÐSWV([ t$8Wt$@2WVd0^_[ÐSWV([ 0t$11;3}:tt3PpT^_[]ÐS[NT$t$t$ [ÐUSWV[93|$0t$,T$ $u0\MDH@utl$4D$ U 鐐t$ D$PL$ QD$ Px)t$DtL$9D$)<9u AT$)RU[t( $4T$4R7D$0D71^_[]ÐS[t3t P[ø[ÐUSWV[Ø8D$ $4VjPjtSʼnt$UdƅtMD$ $t$UD$PVֈtT$t$$V Vu^_[]ÐUSWV[|$3t P 3~/11퐐440t0;3|4t3ǃwwLJ3j0jm4tW2Ht<@xX3~3<P<72@HX3@$4Ƈ31^_[]ÐUSWV[ût$3t P3~/11퐐448s0;3|4gs^_[]ÐUSWVX8t$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$W 1Ґ$t$V|$(WD$0Pt$$<ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V> $4D$)Džu |$ $tR1VT$ * 4$)tWj V T$L$ (^_[]ÐUSWV`[814t `΋43t42NzRЃPWVPVHhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<W PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DP0y;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$P躃D$T$3;4}D$PRjQD$PRjQhNj$D(PnD$$L$ ;47&ffffUSWV[;|$$D$hjjU, t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ U D^_[]USWV[Ë|$$2t$Ƌl$r:D$0>D$4uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$U 1^_[]ÐWVY-D$T$ t$w4  p@^_fffSWV[t$VO~~tyы9uv0jv,j9p9p 9pt P}PjVGj1^_[v46j9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PiffffVXnt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[|$ uT${[ø[ÐS[î|$uT$ L$O[ø[ÐS[~|$ uT$[ø[ÐS[N|$uT$ L$[ø[ÐSWV[|$u<t$D$9% ƉM1^_[øSWV[ü|$u8t$D$|$% Ɖ81^_[øVX^|$ u@1t0QX2#Q@Q@v~8tt$ Q@^ø^ÐV|$u9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZŽL$1~t$ ~9J$u9r ^ÐUSWV[KD$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77N1^_[]ÐUSWVP[ʤt$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux hQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p `912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [ht$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV41 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[ T$L$ Aq D$t$jVPt$ ^[ÐUSWVXȠ$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQCE;~} K(t$몉SV[T$L$ Aq D$t$jVPt$ ^[ÐUSWV[ël$1t>19)Rju uuu0tPU^_[]ÐUSWV$[Ht$D1Sl$HGL$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV Y|$4t}\$\$0$Pjt$,IT\$ D$L$ H HD$4;Hϋ@,L$4p0 F, fFV8 }![, < fN< 49D$4;H|%T$t$ t$ǃD$4;h}pD$(p|$OoL$AD$$jG, 9;t$u 9l$ ut'9L$D $jUt$t$V$T$BL$( ABAcOPL$Nfɺf|#udt$T$ ։D$8)jVD$ PRPfL$8#|$T$t$ WyL$΋D$ )jPWVW#t$D$@f|$$ut$It$t$8Qp0QjP-ɋ$Kd0PjQQ f~$~gD$@u]D$(t$Fh2u&@9u%$PD$80%;\$6>v t6>vuD$@tt$ t$tNF$jv=D$@$ $0jP Ktdt0$PjQP D$@|D$<@1fl$<΃9T$$u뎐|$ ;l$,0L$|$$t$HT$0;l$ G;|$8NjL$DT$0D$D$,|$@|$L$D$D$,@l$99l$ l$T$ЋL$D9щȉD$ D$AD9@ t$$@ @ $Pq|V\$UT BfBD$ALfBt@zAD$Rq|\$|$$uD$D$ KD$D$,T$D$,p;@ uD D$Pz1r)1@ $Ph WA\$ ƀw @ $PQR\$ D$@@ L$PD D$T$D$$)ЉD$L|$T$ )։t$,)3|$L D$P@D$t$+t$$D$@H0t$ T$pxpu@t*t!|$ ׋T$t$6;VaHTl$Ut$$Q}f 0UjPG jjjt$V(|$@UjppG jjt$jj@t$ Q fUjPAG |$D$,T$Lt$ )T$T$Ll$T$TI,T$DD$Dt$8t$0l$D|$,D$ ,D$H4;l$$;l$ ;l$D$@, D$L~9|;l$Tl$@D$P9AuqwD$ht2$VP\$t6uw@ $PV\$D$px1ŋG @ $h QP| \$ ƀ=r{,t$G@ $h WP+ F$h Wt$ P  \$ w@ $PQw D$PGD$H$Qjl$H&D$@, D$H$QjUP\$L$89͋T$HuD$@,T͋D$0;D$+L$8D$0D$H,t1L$|$ t-L$ :$jjQt$Rl$E@$t$ 4b $0$QjPD\$ D$t$ )jjPjt$0oEHVPbxpuDt.t%|$ ׋T$t$6;Vt$ Lt$l$$UQ b 0VjP7C jjjt$W|$@Vjpp C jjUjj@"D$ PQaVjPB |$EFD$0D$,0jjUt$R1D$@ɉl$8tT$|$9zt4؋$PQa0QjPJB |$jjt$(Vjt$HHL$ QP`ϋl$H $0VjPA |$ |$l$$l$|$$@VjA uL$j|$ |$$L$ T$$F0VjPRA |$0t.L$|$$@Vj$A uL$ $jjt$(t$R$0|$ l$E@$Vj@\$ uUjH@ |$ |$t$$t!t$@UjHz@ u@L$ IQjp0_ UjPJ@ jjjjt$|$$0$UjQ@\$ |$0t$t$$@$Uj?\$ uL$ ɋ|$l$y8VjL? D$ t!l$$@VjL? u@L$ IQjp0 ^ VjPT? jjjjt$0@@p10QjP$? T$$jt$RjQ\$HD$ $jjt$t$R_$0|$ l$E@$VjH>\$ uL$L$ T$9Q|$ 0$UjPQ>\$ |$0t$t$$@$UjL>\$ u,,+PQhrR4 $7 USWV [hD$41\$t$LL$H\$DT$@|$ PQJ t*NjD$9 t#W $~ 1ɋ$0PjW+ ^_[]Ë,D$0L$ `;> MIIlttt$ jQh+ j D$uǃ USWV$T$ [DV D$PBpL$ t$tIT$$` t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$Pjt$) ǃ ǃ 11ҋ`D$8 tlj)D$4>$,D$8 $<t$u; } t$Ћl$)$t$@@9 9<$PjQ0) @x H$L$T$ t$`ՉL$)4/L$T$ 9~L$T$ <$Pjt$( ǃ D$ ; ;T$ 9<$ to j Pdox) @ltQjP%( F t3 j Pox) j |j m  ǃ 1;  $l$*ǃ ;  @@ltWjPV' yA t`j t$Hlt htðuu냹tt u1ÐXL@ xÐUSWV [xLAP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21ChD$L$ /jt$[D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVP[êGL$9 ft$9|$ 9l2uCUw$-4$t$sk&w&|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVXhF2hT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVYD|$xv9{`|iT$t$p"fr"f1l2u@>_w-s y&f>2~w-s q&f ^_[]ÐUSWV[CL$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZ,CL$x?9J\~2D$t$|$ Irftf>vf1^_[S[Bǃǃ9t% DŽp"DŽt" t 1[ÐUSWV[KBT$L$l2uI~w-ss&w!&ff ffffǃ>t* f0p"f0r"DŽ0t" t 1^_[]ÐX_Ah2ÐUSWVP[:At$ t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[ ?l2tu6@t!|$0QjP (!G@f@d^_[ÐX>f@dffSWV[|>D$ yOQW~ ;O~ t Q WP/WF^_[ÐSWV[ >|$D$OQW~ ;O~ t Q WP.W^_[ÐSWV[ì=xWt$W^_[ÐSWV[l=|$Wt$dWh^_[fffffffUSWVX+=tLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j xL$d( $ș)l$T$ $L$$$D$wx)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$n7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$H&D$g1fT$t$j xŋd0L$ș)L$4$T$ l$lt$mD$$Յ $$v*x;l$tl$l)"Px‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K'Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K'Й~ ƃQWT$H ^_[]ÐSWV[Ì+|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[+  jt$t$t$P1[ÐSV[*  jVjt$PJ1^[fSWVP[Ë*|$t t9t QD$PL$QjPW]L$N|$kK)l$kK) 6;6i)P(PUPt;y t0q$t~fuUvu1 q T(^_[]ÐUSWV[ø(D$$L$t@1D$D$>D$PL$QjPW\L$kL|$kC)l$kC) 7;7i? )x)PU.t7q tAy$t+nuUwu A|)y^_[]USWV[Ø'D$(L$1҄t@1D$D$8>D$D$PL$QjPV}[l$-?L|$ ) i)ʼn) i)k^7{^7lj*SiŠ)Ǎ*PD$Pt1D$H*<tzp t:h$D$t}suPuD$uދ} مt3l$,t+Et$WPuVEЃ^_[]ÐS[&t$ t$t$ [ÐUSWVH[%t$\4lD$P@ND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$U:L$QjPUXL$ȿNt$kK)kK) 636i)P(PU$D$$T(ED$j=UtƉH$$D$<$|$W<L$QjPWWL$Ƚ-?Lt$) i)) i)K^7s^7Ɖ*SiŠ)ƍ*PWvD$5tcL$f <$|$WL$QjPW>WL$ȽkLt$kC)kC) 737i? )x)PWtD$E*E!D$|)Dqh $$D$vgPUmPUU_,PU=7PU%!sPU tT,PUtrX,PUte^,PUtXEPUu^O1<5.' D$UNj$tP 1L$;D$v==wL$L$Qt$GL$uD$ 9D$ tf, UQS,$t'UW@|$BU{4+1t$ 1 t]|$uf, FM $QP4$~  $LD=uVQVV $4D$ H^_[]1|$t4$ɯ1USWV[æhWT$L$ $L$\1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG0'M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$? 1Pʋ$H $$$H $<<$Rt$W  /$//$H $>$D$^_[]ÐUSWV]x2~:^^t@\|,$n*^ÍxЃs.ÉD$$\D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%\Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[1l$E<%uEpuEπ r?уstlu~;|$~,|$t릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[L$ T$D$$Pj [ÐUSWVX$1h ։ͅu4$ u'$h9 5 @0t$E4}0u"$hE, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,۟E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $=ȉىӉl$ |$uGD$1l$뀋$\DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $>$t"A$|t+H$D+$1$uՋ$1ڃV$d@!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,>RE,}0M4T$$V$0PRQ1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PQP=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$\t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$D1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$f1ۋu0M4A9s E,u,߃$Vu,^rE,u0M4tڍqu4 $1$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,:tRE,}0M4$V$0Pt$QE4E,M4},$1^_[]ÐSP[M T$ D$$1Pj= [ÐS[ t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[ T$ D$$1Pj [ffffX L$ÐUSWV[È |$(t$ l$uPѓƅ>l$$uj蛹hjlL$tfjVP NjD$uj(P/D$@ x |$(u-VqE\1F4,9Pk1D$tGuP|$(,x |$(tF|$(m,V|$( -Phht@U薾 t$t$tL$t RB(JtRtP)tjjPv IA(tPtjjPv IA1t^_[]Íi,Pjy.-VSVP[< T$L$D$tRQPVƋ$t P.^[fUSWV[t$|$t$jt0ʼnVU辘|$T$VŸD-Pt$t~Pt$tkI-Pt$it[O-Pt$RtKU-Pt$;t;\-Pt$$uA1 @VK^_[]ÐUSWV T$L$[Íǃ c-P܏Ņt'}/u{L$$ t$  m-P蠏/P,}PVuU|DžjWWW͖tpL$v u\D$ VP$tIT$ L$$ Pt$ zV`'ub-1V='u-P螎$|$ $~:s1퐐Nt:t됐tÍMwUPWi D, L$$ t$ [tu{PtG-T$ PQhR~)T$ L$$ t$ $-t$ $:uw1퐐Ot:t됐tÍMwUPVi D, L$$ t$ [tu$ $ȁ ^_[]Íl- USWV[Xl$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%\$L$ A ZAthhP0+jj!G(hhP|$ Gt\$h(jP|$ "\$jh芌|$ G9ouG)o\$UD$p膍|$ Go\$UVP蘨 W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP ~ gC C$ދ\$PF$ދ\$P~ F$D$\$jWF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|V=t.)9uUt$VJ t6u0,1(V貾9ſuUt$VkJ ^_[]fffUSWV [D$48H L$@ 1퐐/t <,tEPT{UWPa .,v3l$4uW請EED$\$cD$-D$|$j|WtD$4@ T$L$ t017t<,t\$RT$RD$P^ztDl$VWQf Ut$PT 1<$WNjt$D$Pl$8uՄEW|$WV WDD$D$D$ Džt$"\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0\$<u3D$u'\$Ux\$8C k$K($fC K(K(|$T$ t$4-Pd>p1\$91\$-4$裈K\$-PdD$PtD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ QN ^_[]USWV[(D$t uy0-|$ 1퐐/t <,tQL$E$PRvt2ƃ$UWP_ 4$t$PK 1^_[]ÐUSWV[k|$ t$FN,9vtU6趀uCu;Uut.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[|$ l$qhPWڹuLt}D$x@ȃǃtVot$ U蔹)Lstƃntfuă뿐1ɋT$z HfD$8l$|$ u)1|$-WuPt$D/WApr-WuPt$D1TL$4xT$$s$tntfuσ1} t WPVO l$ E|$f>t WPV- }t0EfEfF}WuV f},t&E(fE,fF}(Wu V迕 f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[Û|$ t$FN,9vtU6xu]uUUmtHnNT$l$f,Ninf|FFWRPǓ ~F 1^_[]ÐSWV[t$FNy9vtW6>xuCu;W;mt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[hl$D\EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1.bGj|U9D$tL$j|Uat L$U=rUPt$P 10^_[]ËD$tP®L$ =r."D$t+P螮L$=r8.QUPt$T^jjPKutt$ $@ 1D5t <,tFPSkD$4 VUPX D5$(L$tSD$HtJ11t <,tFPj Vt$P D5$h|$t+D$Ht"t$Ga $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0Hn$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p m$D$t$HjjjPjfWjQ.VWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[|$ $ ftGt @1@WG(f hwU#X =wb, Ƅ |)ƋtVPUW 9vD|ŃƋGtVPUW 9s D|ŃE$^_[]ÐSV[t$ tavivivhv hv$hv,hVh19 uǃ ^[ÐX @ÐY @u0USWV[U$(E$$4D$$0j:Wut*jQPp t0V$0W NjE;$^_[]Ã(u 1 tM0ut68ut@x$f$O:t @t@uS4$l$w$D$j@UPU <:t$EF<:uEl$4$D$D$OtuP](P]Cǃq,bD$O@$$,PQhWj t" ǃtMJj j,(,WPXWP/P]t/j/V蝊t|$uFA$jPRQV'FAT$ $jPRWUQV/VPjESV[ýt$ j:Vfrt*jQP tt$V,1^[ÐVYnT$փ1u t^1(^USWVH[(t$dl$`L$\D$Dȃ= u(<$y-/L$VPj@QT$tLT 9 $ƅtID$\WU(b ~*)NjD$\u $dVUQB ;L$Dt[a1Kt$\(A 2DŽ(DŽ T $;D$Du ЃH^_[]GUSWVT[|$pL$ll$hD$P= u( $t$ u3/L$WPj@Q蟻t$t$ T$Ijj 跡D$Wt$  $t$j 莡9<$u-;D$PuyL$T^_[]WQU ;L$PtNT( DŽ(DŽ ;D$Pu T^_[]EUSWVD[xL$`T$dt$X}|$@uM u (t9ƀ9/RQt$dPj@WY tRQt$dV讅 M;L$@uD^_[] ESWV[ü|$=uj u (tVw@}tL!(s dDŽ(DŽ WA^_[ÐUSWVP[D$hT$dML$LL$pL$t$lуuc u (tOz=m8@tW=m AT$ vPQj@Rڸx. VPR bV{<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l(  4()uT$ff׺r$σߺfDfu,$tу$$1cE;D$Lu^P^_[]Ët$d(  DŽ(DŽ ,$1,$AS[ÎD$u& u (t詟-[Pv[ÐS[>D$u& u (tY-[t$ P{[ÐSV[t$ j:Vjt*jQP tt$V -^[ÐSWV[||$t$j:V!jt*jQP踏 tWhVe  WhV ^_[SP[D$ L$ $L$ƒu& u (t--Qt$Pu  [ÐS[îD$u u (t1[Py[ÐSV[]t$ j:Vit*jQP蝎 tt$V b-^[ÐUSWV׉[RSjj UD$UWt$ l t$j ,19tG4$(  DŽ(DŽ 跜^_[]ÐUSWVL[FD$D$H1,<jU( u} t @u D<@u^(  DŽ(DŽ D$;D$HL^_[]Íl$ E< us{U詛8|$jW(1 u|$ u}Fu(+   DŽ(DŽ Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:p# D$t$DRL$Dp# A @`? e/19<$t# D$D@ @`ƒ?e/91s# D$D@ @`Ń?+e/9r# D$D@ D$@|$`D$?e/;|$  ՋL$q#  <$‹D$Dpu# D$L$ D1 <@4$T$<`Ń?|$_u+e/19QL$ T$D $L @`ʃ?|$_ue/19 l$ D$L(D$<_D$$D @`Ń?+e/19 ՋL$ T$D |$_$D @`ƒ?e/9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0tF/C/;D$(Q,^_[]É<$t$D$# VRPQT$T$L$ t$ ?3e/|$D/? e/D/ ?e/D/D$e//T$T$L$ t$ ?3e/D/? e/D/ ?e/D/D$e/D/D$L$ < e/L/ ?e/L/ e/D/D/ p# <$<$5USWV[u$D$$  ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# 8y3xy4t2tkƷ< sԃ1@tt# tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# 9y|$| t!qtAD>1tBD>׹@# 8yD,|t.tkŷ< s݃1@tt# tр‍ p 1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# 9y|$| t!qtAD>1tBD>׸@# 8yD|$t=2t$Fi%I<<fw1@tt# tlj瀍 ;p 1ttD~t# y  fABy w~4ABy w~4ABy w~4ABy w~4ABy w~4Ay wʼn41 @tt# tlj瀍 ;p 1ttD~t!z$Qy$A# y$B# $u1 @tt# tlj瀍 ;p 1ttD~t⍃y# 0pQPQPQu# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$ف`zр3ʉрUɀʈǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ΀# D$# D$x# D$t# D$p# D$l#  ʋD$h# ыD$d# D$`# D$\#  D$X# D$T# D$P# D$L#  D$H# D$D# D$@# ʋD$<# D$8# D$4#  D$0# D$,# D$(# ΋D$$# D$ # D$#  ω D$# ɋD$# ? ? ։? T$ځp $T$ 1# u# E# Qu# ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t e[ 4$l$T$ L$ Ń4p x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]s$USWV(](D$<X%UUUUʁUUUՍ4P᪪p t x   x p t x   x p t x   x p t UUUU $؃p t x   x p t x   x p t x   x p t T$H l$ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $yh $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3p 3p 3p 3p 3<$t$3~3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 1#t$t$D$|$811t$3=p $3=p $3=p $3=p $3=p t$$3=p $$1L$t$|$l$3l>l$|$l$ 3p 3p D$35p 35p 35p 35p 3p 3p 3p 3p D$t$D$D$$7֋T$ Bl$l$l$$xl$ p t $x   x p t $x   x p t $x   x =p =t $x   x p t ȃx   x p t x   x p! t! x ! ! x 5p" 5t" x " " D$@P1(^_[]ÐS[{D$1ɐȊt tT Tt t t4 uP1[ÐSV[D$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[MD$$D$DD$@D$9\$6D$L$T$@jjPQjROqD$HPj =ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jPֺ$jPĺD$0Pjl\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjlt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]USWVd[ť$|D$<$`# hjD$@P DŽ$@D$V$@8$u H$@D$0$@UV<ljD$Pgt;uHU/WPCi]/WP+iuD$L/WP iD$UVɘljD$L4jPW!h D$,u:|$$@PW#x$@L$,UVoD$l$0~t$\$UVOD$ D$D$ D$$$@&D$ \$UVtt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DW"D$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V11$xUc$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-/PQR3_h$DUt$@VF j jW hjU hj$P D$@hjP D$<;$`u`d^_[]D$RW_D$t.T$@PQhR}l$ $[fffffSV[ D$ h`rƉPG)Ɖ^[ÐUSWV[ȟl$0/jD$PUc thh`) $)D$j PU $l$1}$K1D=t<$t h`tt$,aō/& 4$t$L$QWPjbVD% L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃/t$ Wt$t$Pjbt$(Vև& % %  % jQPR ;& % %  % jQP ; & % %  % jQP ;& % %  % jQP ;& % %  % jQP ;& % &  & jQPS ;& & &  % jQP  Ƅ; & jjt$( ^_[]fffffUSWVD[|$\w 1o2t$`tD$@jPVd NjD$@9t8tnD^_[]n8"u tr'D$D$ D$D$D$<D$8wD$X$2a$/WQjPY0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ D$ fƍ$t4$$UD$  jVD$' |' $$ $ jQP |' |' $$ $ jQPk |' |' $$ $ jQP. |' |' $$ $ jQP |' |' $$ $ jQP |' |' $jQP |' H|' @jjV D$;$uD$^_[]fffffUSWV[E$ $$D$$AO$WiVUWQj W$$l$ UkD$\6666D$`6666D$d6666D$h6666D$l6666D$p6666D$t6666D$x6666D$|6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$|6666D$x6666D$t6666D$p6666D$l6666D$h6666D$d6666D$`6666D$\6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\t{E6L$\4\D$tdF$tB$ڹD 0D \0D D 0D ]0D  u$t D 0D \0D $V gD$\j@PVig $$VRg VWhVfD$j@PV/g jWV#g VWihD$;$u ^_[]fffUSWVP[Ê|$l$t.jPUu Ƌ$9t8t"R1^_[]R8"u t7ސUSWVPX L$ |$t$Q̓t2$1ې?e/9u)ދ$r`?e/?e/V ?e/V?e/V^_[]ÐUSWVPX:L$ |$t$Q̓t2$1ې?!09u)ދ$r`?!0?!0V ?!0V?!0V^_[]fVYn~T$ t$tt1ut b0^Åtr0^Åtj0^Í]/^ÍL/^ÍU/^ÐUSWV,[}t$@VcL$DV,~09rЍ,1V8T$$V(T$l$ D$D$|$F4D$L$ 9v|$VWuW$u WVf 1,^_[]ÐUSWVH[(}l$|BUƋD$h4$l$D$D$lD$ D$pD$D$tD$D$\D$D$D$ D$$D$(D$`D$,D$dD$0D$4$D$<D$@D$DD$8$PctUV |~D$xt UVP! $tL$tA$D$PW$5t!UV W$  UV 1V H^_[]ÐS[î{jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$8@4[ÐS[^{jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐS[{jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[þzjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$8R4[ÐS[nzjjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[zjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[yl$hU<ƉD$ D$P&ljD$VD$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$D$ tKWV(tD(1t$ t$ U T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[xt$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[.wjt$t$t$@[ÐS[vjt$t$t$[ÐS[vjt$t$t$[ÐS[Þvjt$ [ÐS[~vjt$ h[ÐS[^vjt$ H[ÐUSWV[8vt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Xut$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[xtt$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXsL$Q##wÍ84ÐUSWV [hs|$(l$$t$ D$45D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[rD$ hPt$@A [ÐS[Þrht$t$1 [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[ rD$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[(FD$pML$LjPt$lv D$h|$df$D$V0L$)L$D$PVWKD$ |$$v=D$wt$.D$lp8L$ QjjVj V|$)cƃPD$2PL$Q ? $ $$m=|$D$lp,t$ jjt$>V VU|$)Ƌ $PD$2PL$Qk  $ $,t=D$D$lp(t$ jjt$>V V|$)Ƌ $PD$2PL$Q rg $ $,p=D$D$lp0t$ jjt$>V$ V{|$)v#Ƌ $PD$2PL$Q sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7JL$R)уtuÐWVt$  r!̐cw^_fffffSWV[Ì?t$|$G@hjP  Dj@PW g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V|$l$E@r8hWtG\GXGTGPG@hjP  5ɼGg jG gG;ʄGrn+G4كG0kAG<[G8y!~1^_[]ÐUSWV[e=$$N$@r8hUtE\EXETEP$t$tAsE@hjPT  Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV  h$$VkLhVU< hV1;$u Ą^_[] USWV [ø;l$(16t$ %T$$NP NT  ()`N`L$$WRP ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP$ 1 ^_[]ÐUSWV_N:$hRP RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ WC hj$P  g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV4 D$hWD$$hPD$;$xu D$e^_[]lffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[x(|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[û&D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[%D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]x$$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$_54L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$:5$FQ? T$‰ً$|$D$G<uD$ $4 $+u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4踾L$ |$ )t$)t$$t$,)wD$ L$?? n4 T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4EBT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍4FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N {5FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$QC l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj 4&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B [4Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?ፅ6GPGX 6GTG\GG?$L$u aD?4FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  5FL$Q? 5FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$5$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v't5D$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$5~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=+ 5$FL$Q?P$r4$NL$Q?D$T$ ߋ t$ 5$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $sUSWV[6iE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRPv )t]D$)WPu8_ }43M(U,E4E09w)RVP. E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[,t$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[ûL$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU  F4n0)Pv8U 1tN0^_[]ÐUSWV[+t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[L$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RRT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$$L$@D$?? u)D$(5L$(5É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,At$t$jjjjt$$t$$ [ÐUSWV [D$8s81j|$<8_|$ NGG uG G(T$$$u O$L$,tՅx|'D$D$$D$$T$0zƒ|$( |$4~u"$ll$ tʉ$hjl$(u(Ѓ 9ljE(@*D$GG $O0G,HO4L$0OPWLWTL$0 iɫ OXjPu(U G8jw,u(U G@jwLu(U GDLJL$0jPu(U GW 8tG@tADt;t7ȉID$D$4G$U*!G@EU ^_[]ÐUSWV[[t$~ V$N91yoǃ8w~At Pv(҃NADt Pv(V$NA@t Pv(V$NA8t Pv(V$NQv(V$F1q@^_[]Át*t쐐SWV[l|$WWƅG,ODG$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+XT$D$tq01t ^_Átփ*tUSWV _L$ y y$q9NQǃ8|$<|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[l$$t} t}$t }t9/t ^_[]ËGHǃ8 D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPآ )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[è|$$ $w9>~NQǃ8wHl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw sw o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw u o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw r o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQar F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw r o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQqL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw p o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw o o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw n o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw `n o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq l $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq j $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$X$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv X n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv DX n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv W n on)n)ouGGD$8xt1$^_[]ÐUSWVXر$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu S } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu S } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu Q } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu Q } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]X_dÐUSWV^8L$4t;T$8\$0Ӄs3I͉у1&Ӊi913dƒT$4zR13dƒT$4zR13dƒl$4M1ʉ3dxT$  1ϋL$ 3dÃ1ؐ\=13d\=13d9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3d3d3.d3d $3Qd3d3d3d $3Ad3d3d3dD$ $3A d3d3d3d|$D$ $3Ad3d3dЉ3d|$|$ $L$l$11D$D$33d3d3d3d3W13d3d3d3d3G13d3d3dȋT$3d3W 1‰3d3d3d\$3d3_1ˋT$ )3d3d3dÉ3dϐÉ13dW13dW13dW13dW13dW13dW1Љ3dO13dRЃ^_[]ÐS[t$t$t$ [ÐUSWVX$D$$tz \$׃vND$t$d1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVXآ$D$$tz \$׃vND$t$d1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPX$T$tfǃvEt $d1ف 1υt1Mu밸^_[]ÐUSWVPXj$T$tfǃvEt $d1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[.t$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffXFÐUÐXOT$J r (ù)ы(ÐS[D$D$ P[ÐS[ޚt$ *[ffXL$ P $ d, | 0 x8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_+T$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P<L$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$dPP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YBL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +()9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +P)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[xt$舰ƅt|$7VC;G K ^_[ÐSV[íxt$ 9tt$P:F1J J^[ÐUSWV[Xxt$tLƋ|$$l$ $P:D$PWU, 1uRJ(V u 7J(^_[]ÐUSWV[w|$GtE/D(U8]wU*t#V轡=yarau D$0VcI1^_[]ÐUSWV[Kw|$GtE/D(U\wUt#V==tcidu D$0V;I1^_[]ÐUSWV[vL$A1t3)D(U6\NjD$pU$t D$8H0^_[]ÐUSWV[kvl$M1tMuD1V[uVt(WZ=yarauD$8eH W1^_[]ÐUSWV[ul$M1tMuD1Ve[uVWt(W=tciduD$8G W苝1^_[]ÐSWV[ÉuPt$ t$ * t6D$t7<$D8WZt$WtD$ 01{GrG^_[SWV[ uPt$ t$ ) tFD$tP<$D8W`Zt$WQt,V=yarauD$ 01"FV聜F^_[ÐSWV[itPt$ t$ ( tFD$tP<$D8WYt$Wt,VD=tciduD$ 01"KFV9F^_[ÐS[sL$T$ jt$t$ [ÐUSWV[ÖsQ%Ƌl$$P5D$PUW' tgVZD$tz<$D8WXt$WtH|$$t@V<9t7V6EE 43E8Vu 댅t D$ 01E^_[]ÐS[ÞrL$T$ htcidt$t$ [ffSV[mrt$t$u_Pz=tciduL$1=tcid^[ÐUSWV[rt$t$#_P(=loobul$VEloob^_[]ÐSVP[üqD$Pt&Pt$t$` D$VrD$1^[ÐSVP[lqt$t$Vt$t$` D$V.D$1^[ÐSV[qt$t$t$!^VP8^[ÐSV[pt$t$t$]VP9^[ÐSV[ýpt$t$t$]VPg9^[ÐSV[Ípt$t$t$]VP9^[ÐSV[]pt$t$t$a]VP':^[ÐSV[-pt$t$t$1]VP7:^[ÐSV[ot$t$t$]VP:^[ÐSV[ot$t$t$\VP:^[ÐSV[Ýot$t$t$\VPW;^[ÐSV[mot$t$t$q\VP;^[ÐSV[=ot$t$t$A\VP;^[ÐSV[ ot$t$t$\VP<^[ÐSV[nt$t$t$[VPw<^[ÐSV[ínt$t$t$[VP<^[ÐSV[}nt$t$t$[VP<^[ÐSV[Mnt$t$t$Q[VP<^[ÐSV[nt$t$t$![VP=^[ÐSV[mt$t$t$ZVPg=^[ÐSV[ýmt$t$t$ZVP=^[ÐSV[Ímt$t$t$ZVP=^[ÐSVP[\mD$QP0t&Pt$t$\ D$V D$1^[ÐSVP[lD$QPp0t&Pt$t$)\ D$V謔D$1^[ÐSVP[ÜlD$QP0t&Pt$t$[ D$VMD$1^[ÐSVP[DT$t 19 uL$ tB ;D$v1[ËBu0PQ$[ÐYCD$t 9t1Ê@$ÐUSWV[ëCl$1t99Eu.E P tNjEu0PW"$^_[]ÐVYNCT$1t 92t^ËBu0^ÐUSWV [C|$ 19t$$9Gt{o F D$D$P<t[$W0ȅtЋT$ՋVtэ~QPRt$t$V+Owo tQd1 ^_[]ÐUSWVP[:Bl$9EuwD$tyEti} Pq$P|tFUu0~t$RQt$ P+M}u tQ1^_[]ÍH7-7t6PQh;RH S[nAD$t9u L$ t9t1[QPzk[ÐS[.AL$t 9t1[ËD$ Iu0PQ%[ÐS[@L$t 9t1[ËD$ Iu0PQ[ÐSV[Í@D$ t9u L$t9tf^[Ëp0ЅtItRPkאS[.@L$t 9tf[ËD$ Iu0PQ"[ÐUSWV [?l$(|$$}(t' jPŃ' PQ1[ÐS[~>D$ @tL$It(QP[Íy7[7t6PQjfR 7[7t6PQjgR S[>D$ @tt$P[Í77t6PQjtR SWV[ü=D$0Fu9' W~tWق6' VPWFuFt PkVb1^_[ÐUSWV[;=D$t$x t4hjWV0m tUVjt WV4n1PVo^_[]ÐSV[<L$T$ 9t9r 1;q u4r0ЅtItRP1^[ffUS[e<EM L$$D$e[]ÐUSWV [&<lPQ8' WI' l$UVtPcW ^_[]Ét$Wj :thʼnPUc|$GEOM,$EVÀW|$Wt(PcV蝀4$Sp1l,$UW9uVMc8P8 8PQhMRUS[:EM L$$D$e[]ÐUS[õ:EM L$$D$^e[]ÐUS[u:EM L$$D$e[]ÐSV[=:t$ 1t9u Va^[ËD$@$ÐWVY9T$ 1t 9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZN9L$1t91t^1^ËAQ^ÐVZ9L$1t91t^1^ËAQ^ÐVZ8L$1t91t^1^ËAQ^ÐVZŽ8L$1t91t^1^ËAQ^ÐSVPYL8D$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY7D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY,7D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY6D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y6D$t9u@H@ty1ËT$ BÐSVPY5D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY<5D$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY4D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY4D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y3D$t9u@H@ty1ËT$ BÐSVPYL3D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY2D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY=2D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVY1D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX1T$t9uBJBuy1ËT$JÐSVY=1D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPY0D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY\0D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY/D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXo/T$t9uBJBuy1ËT$JÐS[./D$t9u L$ t9t1[QP:Y[ÐVY.D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY.D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYN.D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVY-D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [ã-u t1D$D$ D$~N~(DN+t 0tV-usD$WPv.$ T$ D$1ɿ9T8"yxu2D$j\D$WPv# T$ D$D$9T$rF8"u<WD$Pv T$ D$!Ѓu 8"ttjPVl tu L$e^_[]ÐS[+' jPq' PQϻ1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[*D$0' VPVǺ1^[ÐUSWV [Ø*t$4NswD$8t8@tlr@u߸ppQj WjUVUZ tWVgWt UVY[1 ^_[]Í8m8 8PQhRWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[Î)lPQq' Pn[ÐS[N)' Pn[fD$w sÐS[(D$ ;D$uPt$t$w [1[ÐUSWV[ø(D$ t$tP D$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋L$qD$ tL$9QWP~u 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋH vHN1 =tP w싔Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]Í7998PQhRUSWV ]%D$ \$$p1}<"$N<\u< $1ۃރST\$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍc9H98PQhRUSWV0[!$Du wj011<o<$ou}u $hD$(P Y|$,D$D$@@@@ @@<$GHws 琐HOP} w@$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUW%Xt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUyWu҉p9D$9D$Ews 搐<<}jt$W tfjt$W tS9jPW E $AEtLt@<-Eu<-u}>u$h\t u94$ҭ10^_[]Ët$t[$NjH<w sO9t1V\ED$"} D$,$t$UFD$m$hō9D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VuTD$0D$ jP^F,F0F4F8F<^[ÐUSWV[)t3PjVtjj@艖DžuUOj@n1t=lPWH>GjPZ]o,w0G4G8G<1^_[]ÐL$WUSWV[xt$1l9nU]N4 Džtbl$~4<$tC1퐐F,t,l<HW;~$9uG D$tl9uL$ t 9t1[Ãt$QP] [ÐUSWV[ t$$t l9tFD$ PRF8D$$P4D$$@,D$1׉T$4$)ωD$4$ƃPt$,st1Ʌ~믉t$9vwL$T$ )VQP^ D$$@4@<W24$2t$ Q^_[]Í6:<9PQhR{==9PQhvR\S[~ D$tl9uL$ t 9t[ÃQPS[ÐS[. D$tl9u L$ t9t1[QP:4[ÐY D$t 9t1ÃÐY D$t 9t1ÃÐS[Î D$t9u L$ t9t1[QP3[ÐS[N jt$ <[ÐUSWV[+ l$}t^_[]j@薈tƋ|$lPVn0jP~OF,F0F4F8F<}(t7h2tL$7PUrVp0bUSWV ։L$[b|$ *?u-wG"}MG]jjWU -9jPwwt,ut$$jPww,(Ox"OD$ $QPht$0Wv$D$=L$$?u%8"uh׃P8:uQ'jPWX t4jjWG t#ljt$(P6t$>t1t$$U. ^_[]Í==9PQhRiS[ÎPt$ [ÐS[^jt$t$d; [ÐS[.Pt$ [ÐUSWV[t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPj-D$(Ct(h:R:9PQhjRQRGPLW=1^_[]É.:R:9PQhhR~@R:9PQhyR:R:9PQhRS[îL$A4tPQ4I,Dt*Pq,[Í ;:9PQhR-::9PQhRUSWV,[(D$@xl$DuVJ}4tS|$(jWl$HU4 tjU3tlD$D9(t9$VJ$,VnJPt$D54^_[]jjŌtt$ l<At$DVL$*L$ql$$9.|$F=9PQh1RffUSWV[ûj7zƅt]l$PV"FF Ft0UytUt$P  ~n V8"1^_[]ÐUSWVP[*l$|$D$D$jyƅt61T$T$u͉ǍPVS!F~n ^_[]ÐUSWVP[êl$|$D$D$jyƅt61T$T$u͉ǍPV F~n ^_[]ÐUSWV[+D$1t&|$tWxt>WUP蠞 jrxDžt!PWN Gwo 1^_[]ÐUSWV[èl$19}EuBM1tDm $t: $Uwt^Ut$D$P U;1$D$jwt"WP$ED$E E^_[]ÐZL$1t 9tËA ÐZ¯L$1t 9tËAÐSV[}T$ t19 uL$t r ;t$v1^[ËR1ttVRQ ᐐUSWVP[D$1t 9t ^_[]ËHh t( $tDUhvt؉Ut$Pv ątg>X>>PQhRl>X>>PQhRMZoL$1t 9tËAÐS[>D$t9u L$ t9t1[QPJ [ÐSV[L$ t 9t1^[ËT$19Q ut$tRVqC ֐USWV [èt$(>t~(t  ^_[]ËFY_jQvPgt҃~$tD$jPv  ʼn$u ~8"tD$N N$9u8"t=>>>PQhR1jPj N,$U^t7ǍFPD$PU tcD$;$uZujPV tD|$u W莄1,$jsƅt-PVF~n WQt W?D$$0USWV$[y11T$G=w ⍋jAPQ踙 u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5>PQjtR SV[-L$t$ 9t8V 1;Q u.FtRqP6= 1uyu"^[Í?>>PQhR臺)?>>PQhRhffffSV[Í<PQ6|$ u( ( V^[ÐSV[=t$ 1t 9u V^[YD$t 9t1ÀxÐYD$t 9t1ÀxÐS[îD$t 9u L$ t9t1[QP[ÐSWV[lt$~uo~(tijPvv=t( !jPvvt1( |$<PQ&5V7^_[Í??Q?PQhR蓸SV[ý ( VPƃ ( ( VPƃ( 1^[Ð1ÐS[^D$L$ yt,jPB2F,F0F4F8F<^_[ÐUSWVP[ht3Pjttrj@jDžuU<{Wj@j1tE,$LUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[è|$1tvL9uloUP1O4ƅtIl$44$t*1G,jt$ [ÐUSWV[l$}t^_[]Ët$j@atdǍLVP^ 7t$jPh(G,G0G4G8G<>}(uL$UxUSWVP[j*։ $|$?uwG8]u<GcjjWb tCjPwwt,t1&jjPUt$t1U^_[]ÍBB @PQhRRpS[ÞlPt$ 賾[ÐS[njt$t$t [ÐS[>lPt$ [ÐUSWV[ t$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%@@ @PQjmROQoGP=&Wuo1^_[]É.@@ @PQjkR~@@ @PQj|RS[D$H4tH4[Í]ABA @PQhR衪USWV[D$,hUt$0~Wp%~4tR,$ljUt$4V tjV2tLD$090t9$W %$W%lPt$0\ ^_[]jjfgt%%AD$0t$PL$T$rL$9Al$ F9(u:G@j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ð􍃆8DDPQhRUSWV[|t$~ t 1j Vt ;~ r^_[ÐSWV[<|$t$t0t*PVtuj Vm^_[1SWV[t$F|$uLPVujVm1^_[Í8DDPQh$R蓚SWV[üt$F|$uEPVtiu]jV}1^_[Í8EDPQhER裙USWV[t$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Í8EDPQhdR3USWVP[ZD$1ɅQh Dt$7jK1Ƀ#hK$GGG wtHt$WՃj W=tjW$$D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[t$@|$[fffffS[t$t$jt$t$t$>[fS[λt$t$jt$t$t$>[fYXZQ̀QQr鰍S[Ît$t$t$t$[ffffS[^t$t$t$= [ffffffS[.1;D$[ÐS[1;D$I[S[޺88t jq1[ÐS[î88t jA1[ÐS[~88t j1[ÐS[N88t j1[ÐS[88t j豊1[ÐS[88t j聊1[ÐS[þ88t jQ1[ÐS[Î88t j!1[ÐS[^88t j1[ÐS[.88t j1[ÐUSWVX( ?) R4(( ѐ>t1 @u~1ɍ(( >t 9u#;T$t$9[ÐS[88t j豇-[ÐS[j謘S[ζ88t ja1[ÐL$1;L$Ð1ÐffffffSWVP[{|$t$t<$PhvtVj^_[ÍԶ GFPQj;R诂fffffSVP[t$t1Phwt@Vj $tЅy^[ÍԶTGGPQj;R;fffSWVP[ë|$t$t3tRtu$F$=轇<ԶG_GPQj:Rāu$PhtVi ^_[ffffffSV[ t$ tjh^t Vi ^[ÍԶGGPQj8RJffSWV[üt$|$t w(w$1^_[Ía.HGPQj7RffffSWV[lt$|$t w(1^_[Ía|H:HPQj7R谀fffffSWV[t$|$t w$1^_[ÍaHHPQj7R`fffffSV[ͳt$ t$&ff g#F F^[ÍaIHPQj;RffSV[mt$ tF(^[ÍaeI#IPQj7RfSV[-t$ tF$^[ÍaIrIPQj7RxfSL$D$ t9tEA󐐐€tuuuu˃t@Au<€tAt9AtAt9Au΋D$[fS[>$+ Pt$t$h [fffffSWV[ t$T$(с wdp.c*?&b"Au-ta lsw--trN-ywNс@txuSsF-- trN-twNсtxuSsF--trN-twNtxuTtF fF ^_[ÍI׍IPQj9R+}USWV [Øt$ ejV:$?1jt$V[; Ƌ4:|$l#D$,D$ltBL$4$t$$UTs u͋$|=uU99l$}q)t"uDur;MDMDMD MD9u>1 ^_[]ÍtDJJPQj>R{wffffUSWV[$áL$(3L$,9L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$|$d$$jjdPWU$$|<$u;L$duh^_[]Í.QPjS[ΣL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[Ät3T$8tOl$@toKVPt$DR芌KzK:KPQhRo멍KzKՍ:KPQhR}o뉍KzK:KPQhRWoT$Hk\ODH@utD$ j PW芙 $T$t8"u,t"t0WLFgPVQt$HT$ 9L$<lD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ)KWVPQt$H11҃^_[]Ë$T$|$(9ыl$,}K|$09Njl$4}KUWRPVQt$Tt$T褉 맋L$8fffYOi̟mNA90̟%ÐXL$̟ffffUSWV0X$t$DL$H|$PL$%1|$L$W9D$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$fC T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ *1$3l0^_[]Ë$|LpLLPQhR.f$LpLLPQhRfL$XUSWV0Xh$L$Ht$DL$1|$L$WD$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPU< T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$U#1$e0^_[]Ë$|LpLLPQhR_L$XffUSWV<[l$X|$Tb D$\}  |$T  D$u D$4tǃԟǃ؟T$PT$$9L$$0T$,LT$0\$|$ <$D$(\$؟ǃԟ|$ l$XL$1L$uПHD$4;L$$D$T4П>-u FD$,Пt$06E<+<-~؟L$ ԟXT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő؟<0Пԟ؟ȉ $:|$Tk $)t$$)ΉD$t𐐐љȅuD$$)\$؉D$D$ L$T$-T$T , L$T$D$ D$ 9~$L$ D$T,uߋT$L$tĉ;<$|D$렋T$ϋL$T,,t‰;<$|L$|$T,; $|ˋ|$ŋD$D$0'\$؟+ԟ|$ /V؟tԟuԟП<-u ~П4$<:tkE$<4$PV,L$ tEH<$W;:&L$A;D$PʋL$TTD$:uD8t}:t4$P $? t/ǃԟǃ؟ȃ<^_[]À:uL$:tVL$D$X:L$u^W0ПD8t}:tjWPeWx:L$T$,ПL$ $_D$p70П:t%j=R*@)D$Cԟȉ $؟|$T> $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$V7ND$\(pD$D$ 1T$ $ $.T$tf\$QURN uUM $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8:XRQP… \$؟+ԟL$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:tqRQP@ 1L$\|1uD1 <-t<+::BtD8tD$X8:tRP?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:tRP.1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$80ПD8t}:t4$P趃 $E<-t<+u:}:1<: :LLLPQh_RTwLLLPQh`RTD$l]LLLPQhaRT|$T;L MLPQhR{TL MLPQhRQTLMLPQhR*TnLMLPQhRTfffffUSWV[kT$t$(+ ǃ(+ ;D$}? 9-u7yI,+ t8--?0^_[]Í0j-Rx$tǃ,+ --LyM׍'MPQjRRR(MyM׍'MPQjSRR(+ ,+ ::tlQR#tXx:?u'1x:tH;L$|鉻0+ 0T$?u?ܟ::^VMUPQRrǃ0+ ?tqc0:D$8:E?ܟ3UMfffffSV[t$ tj jV ^[Í NMPQj/R.QffffSV[Ýt$ tjVRO^[ÍMNHNNPQj/RPfffffUSWV[Kt$l$tyjjn 1trjtkNjD$oGG E~}|PjQRjWtKjPj U1^_[]U8l$uEU8U(W}|$7oU(릐USWVP[:t$ l$ME 1҉s9r J9sAEOQ0j t`U)ƒQjRD$ `Q E $}E T$)9w΋MVRPT( E E MU9r‰^_[]ÐUSWV[kT$L$t$ D$t0tUyyNN[NPQhRMpxA)9}8ITTi t?NN[NPQhRMx3rH HPp 9r@ 1^_[]S䐐S[nt$k1[fS[NXt$ t$ Pr [ÐS[Xt$t$t$Pذ[fUSWV[l$|$t$t1UPWV1^_[]ÍNNPQj4RMŐSV[Ít$ tjjjV0^[ÍONPQjARLfffSWV[<|$t$t1hPWV_0^_[ÍMOOPQj6RlLfffSV[t$ tjjjjV輌t^[ÍOOTOPQj0RLfffffffS[~t$j t$t$[fffffUSWV[Kt$|$tBjW*~G0t ujW,^_[]ÍOOPQj/RVK띐USWV[~t$|$ttft7t9fh L$f@Hx$p,L$ H(L$$HDL$(H P1^_[]ÐUSWV[H~j1L$,l$(D$$t$ T$wGo Ouu u&t,t+$܂tzmXUTPQjwRK>VSV[ýqt$ t ~t/>U UTPQhR=~uр~|$^[ÐSV[Mqt$ t ~t/FU5UTPQhR=~uN .wu^[ÐSV[pt$ t41~t^[ÊV u.wL$~9|ԍUKUTPQhR<먐SV[mpt$ t~t0^[ÍU`UTPQhR<~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[o|$t$t@1u6T$L$9w"QjV"> FfFF^_[ÍTvUTPQh.R;뜐SWV[Lot$t>~u/L$Fy |y|9IL |F1^_[ÍTUTPQhMR\;랐USWV[nt$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍUUTPQhhR!:UUTPQhiR9SV[]mt$ t"~uDNu;V9r1-TUTPQhR9~t^[ÐSV[lt$ t31~u(NuV9rT$x 9v ^[ÍTUTPQhR9fSV[}lt$ 9y ^[Í3VVUPQjTR8אUSWV[+lt$|$t.l$tGMϸwG)o >1^_[]ÍTGVUPQjbRJ8뱍ZVGVUPQjcR)8또USWV Xk$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQg9D$0 28t p׾$VPUX 7+D$p)t5u+VQA$RjP8 7D$)smH1 ^_[]Ë$UhV֍UPQhR6D$4$}VhV֍UPQhR_6g$V΍hVUPQhR16D$a$xWL$dWՍUPQhR5L$USWV[Xil$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQI7 D$ }+$x)t6u,WQARjP6 l$}<$)s8O^_[]ÍUV֍UPQhR4V͍VUPQhRr4렍xWL$dWՍUPQhRF4L$;SWV[ìgt$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9UVUPQhRJ36VVUPQhR 3)뒐SWV[Ìft$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1UVUPQhWR2VVUPQhXR1VL$t"T$ tփuQ^ÐUSWVP[ e|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP2 D$$L$(l$0O}^_[]Í WV$UPQhR|0T$L$8D$4VU.WVՍUPQhR?0\SWV[ìc|$L$1uLwt?;t$w6)w*t$uQRjQ1 ^_[ÐSWV[,ct$|$D$Vt$P ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [b|$$D$(t9D$ L$,ň̍XWL$NWL$U $t4EtM9wEM )9w+8t;9rt$t$ht$ -d$<뭋D$4 ^_[]ÃD$0D$4(+T$ ܐSWV[ at$|$D$VPt$  ^_[ffffffS[`jjt$t$t$t$Z[ffS[Þ`jt$ t$ t$ t$ t$ t$ [ÐUSWV[U`D$$$$$ $$$f#}t$pPQj VID$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6 't&6P]&FgPVQZWPQFW ,ZSZ ,ZbZPQXft$-jt$xjjy,ZkZPQj,t$ujjx*jt$~xt$讛t$ 袛y,ZtZu^$puSP$0uP$$eu6$@$8j,$,ZZpQRj/V^tDžttbjPQy $t$u5Hygyj$$2$PQWV ^j$$1$PWVf8dLj/Vt3j$PQV,,ZZVPQ% j*USWVh[YE$dL$$|$$t$D$LD$PD$TD$HL$8D$HQPj[ l$$D$ @YD$$D$ D$l$%_YPmjuD$PQ Džx11D$ D$4D$1ҋ$D$;$ȁĜ^_[]Ë$1ɋ$ύYYWPQhR.RXYWPQhRnDXYWPQhRV蓷USWV[HCD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP;L$u^_[]USWV4Չ[BD$$0qƃ<- <- Ƅ$/jjjhWUVc1Ʌ |$$/jjjhPUV8t1D$(D$$D$ D$D$FD$D$D$ $L$ PQRl$Uj 4$|$.vt:D$.jjjhWvvuW$3Pu,$@$/u<- ZPRQj14$kD$;$0u4ȁ4^_[]ÍlXZWPQhR h>USWV0։[@$DE$,8aƄ$+$+jjjhPVW}1D$$D$ D$D$D$D$D$ D$GD$ D$$L$PQR$Puo<$1t[l$l$* t=D$*jjjhUwwuU$/Pu$l$1PE;$,ue0^_[]ÍlXZWPQhR $TZZWPQhR xbfUSWV[?|$,D$(/D$wl$GQjPk  G1t$ 4$1D$-t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿et$ w=݋t$|$<$$t$&$$1 $+L$ r#6[΍,[ZPQj`R D$,H$$t$,F $)ʃr#^[,[ZPQj}R F$)N)!r s.^_[]ÍmX,[ZPQjCRZ [,[׍ZPQhR1 몐USWV [Ø<t$ ~Nƃ|1 V҉$t`L$FшT$?r?鍋=1 $j@UPQL\$+=1 ~t0|$>L$:$u =1 uL$>͍ >T$1ҍ|1 -9si$:t[U;L$s>t 9sE.9r9s34$t[h9s맋 $|1 9s$=1 ^_[]fffffUSWV[;;t$|$pUl8PPWVWEUL^_[]fSWV[:t$ W!PPV W^_[ffffUSWV[Ø:t$tLD$F$V~nF:}1 PUWRt$t$QjV#$^_[]ÍW[[PQj3R듐USWV[:|$,L$T$ |$l$捃[UWRQL$QVPt$H 1uA$L$1 1 1 L$1 L$ 1 L$1 L$1 ^_[]Í[[PQjBR[USWVH[89l$`D$ D$D|$\SrE$MUu}m&\UWVRQt$PjD$JP"$$8\PQf&jjjjPVoƍ@,0 VjjjjWoƅQUVzL$\QL$ QL$ QL$ QL$ QL$ QL$ QPV${D$L$ D$D$D$?D$D$@D$D$AD$hh@V.p 1lj,$t$\hVWo Ņ~UVD$ P> 0Wp0,$xj$uj!ƅth$\L$QPJG1\F LFuF E;$lu5p^_[]1㍃\\{\PQjNRt'USWVl[/$D$h$UD=$$U= uj! ƅtXD$XUPKF1LXF LFuF ;D$hu2l^_[]1ꍃ\\{\PQjhR~J1S[.t$ t$ f[ÐS[.t$ t$ F[ÐSV[í.\1 jPV  D$ jVPjX^[fD$ȉty!fUSWV[8.t$0l$,D$tjuj)蘭ƅtRUP1 F LFuF(;D$u6^_[]1ꍃ\A]\PQjFRur辡USWV[e-$ $$P'h@VYl1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ y|=P$Pt$_k ƅ~.V$P$P |) u84$9lq8|$$uj)芫ƅ~$$QP1F LFuF(4$Wk|$;$u^_[]1踠裟S[^+jjjjt$t$[ÐUSWVt[(+$D$p$U$$U= uj)]ƅtXD$\UPk1L\F LFuF(;D$pu5t^_[]1ꍃ\J]\PQhRG~fffffffUSWV\[(*|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]Í]]T]PQhR]]T]PQhRx$(ffffUSWV[t$0l$,D$tjuj)8ƅtRUP1 F LFuF(;D$u6^_[]1ꍃ\M^ ^PQjFRur^USWV[$ $$Ph@VT1$|$$ $ u#D$P|$WBP|$`l$d$$ʃ|&jQPt$ |=P$Pt$S ƅ~.V$P$P` |) u#84$T8|$$uj)*ƅ~$$QP1F LFuF(4$W@T|$;$u^_[]1XCS[jjjjt$t$[ÐUSWVt[$D$p$U$$U uj)ƅtXD$\UP1L\F LFuF(;D$pu5t^_[]1ꍃ\X^ ^PQhRkGfffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[Êt$ L$A͉?@)ύ‰Ul$P19wct,B$ WUPط 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP| ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [Ø|$$D$OGD$ $?17l$ )ȃ8,PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jWB ;D$u ^_[]offfffL$$Yai qyD$A(tQS[hRjjc9 [1ÐT$D$ Zbj rz $z(t RPS[jRj9 [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[ÃRjj~8 [1ÐT$D$ Zbj rz $RPS[>jRj98 [Xt@ffffffSP[ D$ L$T$$RQPn[fffS[jjt$j7[fffffffS[îjt$t$jb|[ÐS[~ht$t$j/|[fffffUSWV [Ht$ D$D$$|$jjUVjWZ1D$D$ $jjUPjW#D$D$$jjUPjWD$D$$jjUWjP賟u8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjR)1u ^_[]ÃtOw OsҍHt^d^PQjw ^ffffSWV[it$(WjV xqN|$,t?r$d$D?r'm- d$!L$jWV* ^_[fffffffSWVP[ût$tB$5 PQhRx>L$ $´5 )QVWRs.5 PQhR5 = t@= ^_[fffUSWV[ t$D$D$I@t NQw lى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]Ín_e_+_PQjbRSUSWVX[øD$lD$ 8D$DD$@D$Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]Í_{_+_PQhtRSWV[Y|$t$t5$D$ WVjjjPw1Ƀىȃ^_[Ít__PQj:RqffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[t$(l$$.PT$(18D$8tP)rjt4)sD$(8rl$ ugPt$9ŋ$t$b趵0rD$8tP(WRs4$F#t$:#r01UPt$ҡŋD$G6#oD$ G = = D$8tP(G^_[]Í`_PQhR `_PQhRT$(#93ádLjUPQRV/j5USWV׉L$["2jeVj+Vt-1 |$WjPj%eyFu<$|$1jrV!t?b $UW`ft1jau%ų07|!wq!詳01^_[]ÐUSWV׉[7= tu(!mu?ru<6!FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[Øt$0l$$AT$0818D$8tP%gt/D$08rL$ ubPt$Ӟŋ$t$]P0D$8tP9%Wo4$t$01UPt$qŋD$G6oD$ G = = D$8tP$G^_[]Í&`_PQhR迫&`_PQhR蕫t$,|$(T$0VWU jUSWV[t$8$8tP#= t9ut>mt9uu+$8tP#贰h1VEu= $8tPy#|$jWu 5 ƃu V8tU ntt$^_[]Í6`.`_PQhRFfffffffUSWVH[èD$`|$\t$$UVPWVtUVt$aǃu.覯8uj?~;$} VPaǍD$9tLV0mA$jD$PVft&UPt$hWDV{D$$oH^_[]Éƍ``B`PQj>R1fffUSWV4[ØD$\l$HSt$XoL$`u0t4u^uBt덻PtǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ t0|L$ V2 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$虛Ń|$jt$ RU||$tUjt$ RPe|$t>jt$ RPNl$t%jt$ RP5tjt$ RP T$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQWщ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WPƉр|$ul$э`4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0z0蕚L$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$9zL$,T$$ Q`4$Qt$(V0WRUt$h$[4$|$2jjdQU豘ыT$,t$$r`4$Rt$(QPVt$dVt$dn 9wijt$ QRTщ9|$}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QR轗щ9}T$ 4$T$\ijt$ QR茗D$ ы4$T$\BK`PQj8R莢D$l``PQj9RfmfffffffUSWV[$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]Íaύ5a`PQhRM>USWV։[ñ$$F t%G HO =rĥ,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQx D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]ÍaSa`PQhR|[EaSa`PQhRR4Ea\a`PQhR+USWVT׉X$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRV LuD$t @ t$?D$ h |$t$(${PVt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVPL)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtPLYt$FP:YF^_[]ÍEa;a`PQhRuUSWVYT$tht$1BtBظkw+ltրztЃːt *u1^_[]ÐUSWV։[T]F,F tvjFUPwRl$~D$uNtQjPaD$ L$$t$ F1퐐f$t=tsAuE @u1$P-]$hPQ< E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu跏$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$PIŋ $fE$$UW$L$$Q$QP$D$,!=YEaa`PQhER蹆M lt$10dD$/ Njt$$E @D$uPPUu 8t E u;$6Ĥ^_[]ÉNjt$몍aa`PQhRaa`PQhRʅ|aa`PQhR装$caa`PQhRuOEaa`PQhRN7Eaa`PQhER'L$ Eaa`PQh/RL$,USWV[VT$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍t΍`PQhR蠂a΍`PQhRuT$8a΍`PQhRCT$8ffUSWV[å$$c$$tu資1D$$tŋD$3l$ 11h@PTD$(D$$D$ iL$L$\QPctYD$|$D$0t$\ d$<0fD$PPju@] D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tPxvPWu uhv3D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P (jD$PD$0: D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$jbjPv_ u|$1D$Wt$;Ƌ$6yd$t$\D$|Ay DAD$$uD$*\ՋD$DJtDHD$D$ $@uP \ DAթD$nbjPD$pINjPD$p+ D$ |$t$ztG$`L$tZjbjPq@jPD$p /1ҋ$tnbjPD$p1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8譀< 蒀Y1D$ D$l$t)pD$D$\PjuV |$N8|$ $%|$tcjPu~ |$t&D$u|$8|$ $tt$Dtu V,~t$jl$ U{ 1$u UZ=;$uEČ^_[]Ë|$|$[|[bPbbPQj_R~yy1!S[jhjt$t$t$[ÐSWV[ü= t-= jhjVPt$$t8= 0jF= = tP+= u^_[ffUSWV[;|$= jjjP = l$= tUQ= # = t]1i = 9= wHt Q; = W++= t$UWPȟ = u 1T$ Ɖ^_[]ÍbbpbPQjt$:.ƃ= [fffffffUSWV8[u }D$D$L$$jjPQjRQtYrL$0 $$t;L$$L$D$l$tL$(L$D$l$_u D$,D$D$ l$_e^_[]ÍccbPQjERu*"ccbPQjFRpuffffUSWV [ب-cP110t\ƀ8tUT$D$j PV tŋT$t|zt)7cVPE1ɿ0kP&wAE@ʹE&u0@9~ $McjP赢,$gcVP蕢T$t$$D$ t c= RUPjQL$ t>= ^_[]ffSV[]= u*ǃ> \1PVܔ= tt> )VP!1^[ÐSV[ǃ> = tP89\1PV[= u)VP1^[ÐUSWV [u$ǃ> ǃ> ǃ> ǃ > ǃ> ǃ> ǃ> > = hhU虠D$ 1Ʌ$t$L$ $t$ > L$l$<ǃ> = hhU0D$ > t$P)j\WVqO t8t剃> 8#tj\WVGO t8t뉃> j\WV'O t8t뉃> j\WVO 68t牃 > ǃ> ǃ> j\WVN tD8tP> j\WVN t8tP> h > |$$W" |$~j\PD$ PMN ǀ8tWfu͍jUW0hth/UWhtTdUWht@UWgt,ךUWgtUWgQ> E5xxMf l$<$j\WVgM 8t牃> 8#j\t$V4M t8t艃> j\t$VM tOǀ8t扻> PWg" > PWftb4t` > D$\1c> PQ[ > l$tэQPfu> <$j\WVGL t8<$tP> j\WVL X8<$tP^> t$t$1ɋ;$u ȁ ^_[]SWV[Üt$ǃ> = t P۞&\1PW= t*t+V> [eu䍃> )WP/ 1^_[ÍtccPQhRgmZSWV[̠t$ǃ> = t P &\1PW3= t*t+V> du䍃> )WP_ 1^_[ÍtccPQhRlZS[= tPbǃ= [ffS[ΟL$T$ j@t$[ÐUSWV8[Öt$PT$$t$,ZT$L\D$(D$D$$D$ |$\$ 9AEtL$|AyL$ DAML$Za*?$k[ffffS[.wlPt$t$t$ [ÐUSWV8[vuD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$y\DP@Ӻ\$%D$ D$$OL$ۀU|$ɋuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ P7Pt$t$- ZD$x$W7Pt$W @D$x$WW7Pt$W )D$x $W,7Pt$W D$x$W7Pt$W uD$x$W6Pt$WV zD$x$W6Pt$W+ `D$x$W6Pt$W <D$x $WU6Pt$W D$x$$W*6Pt$W D$x($W5Pt$W D$x,$W5Pt$WT 1D$D$$T$EHL$D$D$D$ Pp5Pt$t$ D$@D$ P?5Pt$t$  D$@D$ P5Pt$t$  D$@ D$ P4Pt$t$Z  D$@D$ P4Pt$t$) D$@D$ P{4Pt$t$ D$@D$PJ4Pt$t$ 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ |$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ eD$ e|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$e|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ Vb-D$Pt$V ID$ V3-D$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$lQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$LډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$DA(|$€´|ffWfPQjIRX!USWV[Tl$L$t*t$1Ґtuщ )4@tRjP" ^_[]fffffffUSWV[HTt$$|$(9jVPƿGLjVt$, t$(LD$l$,L$ t-|$,RUT$RT$t .l$(RRl$(T$tX$|$  tQPT$ <$EFt P F tT~tE1t(0F t((F t( ;~s F @ƋF PF,t PF4tPF8t PyVp^_[]ÍQggPQjKR?egggPQjMR?efffffffSWV[It$HW!L PVmW^_[ÐSV[íIHVL PmVΎ^[ÐSWV[lIHW襎L L PQmW脎^_[fffffUSWV[It$l$VvZVt$j[1u<$Vt$B[DžtpU7 t]wtуUP t u막t$~utQ ^_[]É1ԍtQhhPQj1(\DHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xshhhPQhRF 0hh֍hPQhR USWV [È>L$(l$ D$D$(N|$$L$ߐt$,D$PUD$PlutxD$ѐwztM׊D$L$uD$ `l$ s+D$tD$u:t)2 ihPQhR  ^_[]Ël$ u렍;΍ ihPQhR /΍ ihPQhRi S[<t$t$jt$ [ÐS[Þ<jt$jt$[ÐS[n<jt$t$t$[fffffUSWV[;<pL |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉtL uj(MƉDl$Utwn$Nj 0Q 1L utjh=ʼnpL 0ƃL LtMjуtL @1t*n$FwUQj PQ$|$z^_[]ËtL )USWV[:xL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉ|L uj(ݹƉDl$Utwn$Nj 0Q蜸 1L utjh@ʼnxL 0ƃL LtMjу|L @1t*n$FwUQj P"|$z^_[]Ë|L )USWVP[Z9l$UNjL $tOs;1҉vL ljh==L $uƃL D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$lt0tL tuR:t!jуtL tiE$StL uj(nŋ$,tIEj |$WPA WtE@E$L$1E^_[]t$t@ϐUSWVP[j7l$UNjL $tOs;1҉vL ljhML $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$|t0|L tuR:t!jу|L tiE$S|L uj(~ŋ$,tIEj |$WPQ WtE@E$L$1E^_[]t$t@ϐUSWV[{5t$|$ tЋpL t61=tDtP(ǃpL D$L$ƃL L t?1=tDtPǃL D$L$ƃL ǃtL D$ 1^_[]ÐUSWV[k4t$|$ tЋxL t61tDtPǃxL D$L$ƃL L t?1tDtPǃL D$L$ƃL ǃ|L D$ 1^_[]ffffffUSWV[U3$tA$1uh趲ƅtcD$E/$tt$$9ux/Ĕ^_[]J?$9u/(>?USWV[Û0t$tD$tdPV$xaa1ɐ΍,?UQκt&UP$y.w8"tV2 g1^_[]ffffUSWV[/t$VNL PZL ƃL \ tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t P'ǃL ǃL 1F ^_[]ÐUSWV[.|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]ÍKnnnPQhR]nnnnPQhRv6USWVP[-|$t$t#l$ t?tajUjW^_[]ÍKnnnPQhR빍nnnnPQhRutnnnPQhRxUSWVP[-$L$d$p$l 2L$|$$h\$T$8u{L tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lh觫$p $L$1xjjjU|$ `?oPQhl$XUjjjh@Uujh@6j D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ j ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$tnnnPQhR$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QPT$ )ʼnl$‰$L$\$(l$$|$ t t$Oit$,D$l$ tEF4$hD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$҃؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PU話5))\$ )D$Ɖ$T$<*)׉ڋ\$QVPN Wt$DU@ t$$t$ t$0ݶ/L$0\$|$8T$L$ D$ɋ,$tt$T$fT$Ћt$ 9v8)PU|$u(Uj|$ |$L$1|$k04$"Y0rL PKL PL L$ <$14$蹵$lyD$0P|$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$VD$xW薤t_WVPW UUx~1L$ ȉŋD$8L$D$8B\$WԴ |$ t$dUU |$;$LP^_[]0WHnL$nՍnnPQhRL$,83oL$nՍnnPQhRꋴ$tL$,nL$|$nՍnnPQh RE|$L$,tL$|$nՍnnPQh R $|$L$,Ń|$ \$t t$kc4$atnnnPQhR$|tEonnPQhR~$|Y\$U|$ t\$t$b\$t$0ϲX"L$ÐSWV[Ì"t$|$tatY8t1t0:t+|t&9vt:t |u^_[ÍKnnnPQhRu}tnnnPQhRKVSWV[ü!|$t$tGtiL tPǃL ǃL ƃL ƃL WV^_[ÍKnnnPQhRunnnnPQhRpS[!L tP#ǃL ǃL ƃL ƃL 1[ÐUSWV[õ $,E$$$(L uL ȋL u!Q0 L L t%1L L PQq1t $D$uz1L VwMVǃL L HL @MQP2 L u<\1DN@u:t#t L <|\L L L $ƃL l$L$L$ $Dt\uUL @0uًL t:tuT$ T$VP tfVǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$V]ǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5L tPǃL ǃL ƃL ƃL GVǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$^_[]À|\u ƃL ƃL TnnnPQhRM$<EnnnnPQhR$<ȐUSWV _xT$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd<XƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPW6ƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u (FPU认tL$(U$W* ^_[]ÍKn֍nn$PQhRc|$nn֍nn$PQhR.|$|$(Sn֍nn$PQhR|$&Kn֍nn$PQhR$nn֍nnPQhRUSWVYT$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd輗t]ƃdNJD$$ƹdEt#<:tu)FdPW^u`)nu N$UW-t1L$$8$nonnPQh`R$W胧^_[]ÍKo֋$nn$PQh"RL$Vno֋$nn$PQh#RL$|$$&o֋$nn$PQh$RFL$Kn֋$nn$PQhR$nn֍nnPQhRUSWV[Kl$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuPZ F(N8D} '~wF^ FPB^ uWv$1R tƒN ~?:V|@uH)ƒVԋ^ dLFF$BBQWP uvvQ K~?:uFV;~t^  ^ 8u^ F,;8u e^_[]Ë^ 茅S[>0t$t$ [ffUSWV [} F FEFUVzRu)ʃԉF:FJFx9u0RuMP N ;Nue^_[]裄fUSWV0[SD$(} PQVXL t$M L$ML$f|$ L$T$|$QRj WPBuOt$ rF|$j WP^ u0O L$FD$D$ PjL$Q蒵 79_t$} urP tgM9uWM % oQPR}Wuz19r"y";L$(L xjjP@ PFJD$t$L$ WJt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V uEPVuՌ ;EsD$t$WkHL$%D$"T$ ;UwRPuƳ 1ɋt$;D$(u ȍe^_[]6S[ ojPu;L ]h P{>P [SV[í L hVt$t$t$%t1^[fffSV0[j t$DD$@t2D$D$ D$HL$ $@D$1L$ ^_[]fSWV[Ìt$|$jW1j VWU) jW(^_[fffffffSWV[<t$|$t PpPQ ~^_[ÐSV[t$ tPFtP}FFFtP}FF^[ÐUSWV[x|$(?u pPQt$$oD$t U7}jjjj|$87#Gʼnt$Ptqt< t< tt$WHqt Ń1W/$FL$(A$AFD$1uD$(E< t< tt֋T$(BH9u<BjPD$ P-E D$ 聾L$ v8ukD$ $FD$,t$UpmŃzAA jj t$D 8 8tq0|$(tPϭ$tP{GGGtPz{GG製01^_[]Ë$fffffUSWVP[*l$t$D$ $ t t@u$Dq0qpPQj8RZ@QUVwЃt 0$^_[]ÐUSWVP[Úl$t$l$ t t@u$Dq0qpPQj8Rȶ@QUVwЃt x0$^_[]ÐUSWVP[ t$ l$T$D$$$ t t@$u0qxqՍpPQjpR2t$0@$QVURwЃt ٻ0$^_[]ÐUSWVP[jt$ l$T$l$ t t@$u0qxqՍpPQjpR萵t$0@$QVURwЃt 70$^_[]ÐUSWVP[t$ l$T$D$$$ t t@(u0qqՍpPQjyRt$0@(QVURwЃt 虺0$^_[]ÐUSWVP[*t$ l$T$l$ t t@(u0qqՍpPQjyRPt$0@(QVURwЃt 0$^_[]ÐUSWVP[Êt$ l$T$D$$$ t t@4u3'rrՍpPQhR诳t$0@4QVURwЃt V0$^_[]ÐUSWVP[t$ l$T$l$ t t@4u3'rrՍpPQhR t$0@4QVURwЃt 贸0$^_[]ÐUSWV[Ht$,|$0*T$>t .$ tEt@u%rrpPQjJRVE@NT$RQjjjuЃ>T$u-\sOs^rPQj[RT$,$ t|$ tEtHHu0sr׍pPQhR踱|$0EHHPVt$0t$0WRUуt Z0$^_[]Írr^rPQj}RaS[lPt$t$t$t$t$S[ÐUSWVP[Êl$t$D$ $ t t@8u'szspPQhR跰@8QUVwЃt g0$^_[]ÐUSWVP[l$t$l$ t t@8u'szspPQhR%@8QUVwЃt յ0$^_[]ffffUSWV[kt$l$3$PQWz t"t$ VW 1WjjPԁU'PQW: t$fffffffS[jt$t$t$ [fffffUSWV[èl$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]~VUSWV8[%$L$4L$u$X$PD$u$P| $$Pt$Pr :T$$EjPjD$tk|$jWjD$,D$ tND$1ɅujWjt3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVW'x9!xt19)u|$T$(l$);$Pw|$$XD$0P螢ƃjPiitQ$1 T$|$$T@uX$L$0PVQWt5W{D$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ "‹D$$t $uCr.蠯|$茯1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4VY DžL$~9t/;$WVQL$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j|$l$t$D$Pjt$ jU}jVtjl$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$jt$ jt$i넍PtssPQhR葥DtssPQhRrjtssPQhRStsՍsPQhR`tsՍsPQhR跥ꋌ$hR4tsՍsPQhR腥2}tssPQhR謤tssPQhR荤LUSWV[èD$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]{LUSWV[+l$ |$t$t Vz1L$1jUWPV^_[]ÐUSWV[l$$|$ t$t V*1L$T$jUWPVp^_[]ÐS[ÎL$1jt$t$t$t$6[ÐS[^L$T$ jt$ t$ t$ t$ [ÐS[L$T$ t$ t$ t$ t$ t$ [ÐUSWV[L$(T$ 7t$T$L$0D$L$11jUt$,jP`xD$Ƌ;D$u ^_[]JUSWV[XD$(L$,T$$>|$T$L$0l$L$T$ jWPjU1xL$ȋ;L$u^_[])JUSWV[|$t$t V.10L$1jUWPVp^_[]ÐUSWV[Ë|$ t$t Vޗ10L$T$jUWPV^_[]ÐUSWV[;|$t$t W舗101jUt$$PW^_[]ÐS[0L$1jPt$t$t$[ÐS[î0L$T$ jPt$ t$ t$ Q[ÐS[n0L$T$ t$Pt$ t$ t$ [ÐSWV[,|$t$WsxuGكs^_[!t_t$t%<FF ^_[ÐUSWV[ë|$ u ^_[]l$ t$Wxt t- t(WxtWP u뵃!}/=<DFDF ^_[]Ã=t̃~~ŐUSWV[|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv@<$|$Dփ 6D$4)D$4@u \҉L$x MV=vt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉu$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/\DPg%0W$\P$D$4@uWtu#\DxuGws>4$$^_[]ËD$4  !rfUS [õE$D$D$D$PQD$e[]fffffS[nt$ t$ [ÐUSWV[5$$%= uRl$l4$Nƅt1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGHlG D$ D$4L$ $Љj0)t9D$"D$ <u !G OJD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR`8l$ǃt$<)l$ D$8D$D$14$D$Lt$8DžN( u" .uGt<.utʐL$tXw P/<ōG UTD$t1 .YMPNQPT$ Rb u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRVF4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$踉1ėutPQh1R較D$u‹.x1F)EHftf },$FtpPFu|$t$u N)$xDuW@8/tOF(uI]jh@P tFFU$U<$u~yljF^_[]FUSWV[;t$tf8}t v$d>V }t!v$Bv$7v$EVEW^_[]ÍuuXuPQjBR&vfffffffS [ËlPQt$ t$ ,$ [ÐS [Kt$Pt$ t$ ,$ [ÐS[L$T$ lP[ÐUSWV ׉[T$40xtb=t= T$4t=uD T$41@L$8L$4L$0L$ D$l$ L$RPQUWV-=u蔆"كTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[γL$T$ t$[ffffff̀rS[Ôt[̀rS[tt[ ̀rS[Tt[SWV[<|$t$t-9t!t F9u1^_[ÍuuPQj*R\fffSWV[̲|$t$tt1WVv^_[ÍAf*vuPQjBRuύLf*vuPQjCR~뮐SWV[L|$t$tt1WVZv^_[ÍAf*vuPQjBR~uύLf*vuPQjCRd~fffffffS[αL$T$ lPt$ [ÐUSWV(T$ [ÒL$<\$%t$@|$t;D$<|$"v+覃1t$ \$VPo\$u<+t<-t D$1 1ҊD$L$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[4t[USWVTXD$|$tt$ht&L$ptCwm\$7x\$\w!wPQjxR7r뵋\$q\w!wPQjyRr$vl$l1 D$͉L$4A\$P$gD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$qY!wPQh&RpV\$iwY!wPQh'VowwPQhrVt$xo$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWPS  \$R&1T^_[]Ë\$qww!wPQhsR4c$\$qww!wPQhsRc$LUSWVTXhD$ L$pT$htwL\$ h ֋\$ \w!wPQjxRb$vl$l1 ШD$ʼnD$4֋\$ PW:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ iwY!wPQh'V`wwPQhrVt$x`$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVP \$ Qe1T^_[]fffUSWVP[:|$88tqw$hG$t,GO4$6tV1‹n1 uV ;WujfƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$jUTƅtF PVW) u$^*jU!t@ PVW) 1*V8t uVV $tD$ 81^_[]fff̀rS[Ôt[ḃ̀rS[tt[SWV [Yt$ |$t[D$D$4$zU0L$jjPWjQh*1uSU9 u BU01 ^_[ÍtxwPQj񐐐9t uD$))t8t)Pt u+D$ PB^_[]Í/x|xPQj@RLD$(S;x|xPQjARWLD$(7fffffSV[ýL$D$T$ y9xRVQP Q6Q4P 1^[ÐS[^D$y%9xP PQj@RP P j@4R P [fUSWV[~t$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JAf@yxPQj?RJ눍Lf@yxPQj@RJq1^_[]fffffffK̀rS[$~t[USWV [~t$ РD$P97$|S_ NL$ 9t6ʉi)iAi ˍ $4L$T$ o9s9s}$?9r|t$^uA$t209r9r։t$^_[]É݃t209r9r֋9s9r9r봐USWV]X||$0||$4РD$Pvt)1ҋP1T$,ރ s;DžDžDžL$0AQ1@t$ sAs(1ہ1)L$$D$0Hމˉ|l$Pt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉)D$L$0t$^_[]ÍyyMyPQhYRF[USWV[Èyt$D$.̉)ōР$P蓾t)1ҋPtt14$ D$^_[]ÍyyMyPQhR EUSWVP[zxРW賽tI010$9r$9r$i0mNA900W>^_[]ÐS[wt$t$t$b [ÐS[îwt$[ffSWV[Ìw|$t5jWt ctVW(1^_[ÍtzyPQjARC몐USWV[wl$t{jUt=ǾtUWUt1l$UPt$ L "19s#IH8^_[]Ít zyPQjVRBaffffSWV[\v|$1t,mPWzt |$t=t=tƉ^_[ÐSWV[ vt$t-VW tPW V^_[ÍZzMzzPQhR-B믐SWV[Üu|$GPtƉx @VP1^_[ÐSV[Mut$ t%VPMt L$9H 1^[ÍZzizzPQhRvA뷐USWV[tD$01t:>t41 |t$t$ t$ W8 uD$ <=u.|$$ Q 9ttD$0Q M9u;Q s|9v9tfP/ǃQ ǃQ $jWP ;F04F8uyPD$0t$s )$jWP E0E8u4)  $PjQ B $Q L$Q ^_[]ÐUSWV[HsQ tQ 1t0DtPVtQ Hى|$jjD$P tE t5jVt$ F:Q tVt$VŋD$Q 9tPǃQ ǃQ Q UjP@ ^_[]ÐUSWV[+r81tR/tL,t4t$t$UX5 uD$|=uօt D$1^_[]ÐUSWVP[êq|$1|mPWtfƀ<=t^tR)tI1 $ $lt+Vt$U4 u|5=uمxD$8.1^_[]ÐSV[pP趷ƅt(C0^[ÐSV[ýpPvƅtB0^[ÐSV[}pP6ƅtB0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[oD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[xoD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[nD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[xnL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[økT$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t1^_[WVMtGPVܓtۍGPV+tʍG PVtWV 묍*{||{PQhRmU||{PQhRFUSWV[;Mt$|$Gt/uTot^REwn1o  u-GFGFFnFn GFG    U|{PQh$R||{PQh%Rt||{PQh RMGFGF^_[]Í||{PQhR S\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[Jt[v̀rS[äJt[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[I|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1f||PQj:R]|||PQj;RVAUSWV4[I$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOF#}l$0PQjU!1UH $\9ȋ$QU$`- FfNĕQPR$`U$`01Ʌ9$Fx$P$T) }PURQw0*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LĕQPR$`$`/l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$0}}PQ|$W$`Uu.t;$Tg$P$T)D$D #P|$Wt$L$QR".L$)D$D Pt$t$t$R-L$)D$D Pt$t$t$R-L$)D$D Pt$t$t$Rw-L$r)D$hD Pt$t$t$R>-L$9)D$/DPt$t$t$R-L$)D$DPt$t$t$W,19D$F$PED$1$10D$ #D$}}D$׋D$ tD$ $ 1QPt$t$UI,H)D$>Ń19t$un 1f$PL$$T)fv fD$ }VQURt$+L$ ;$T$ŵT$0L$RQPWt(8W$\9vpD$0Pe;fǍ#}$0PQhWC+Wj$\9v QW$`O %1QW$`5 D$0P8eFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KFD$$ Z|$$$ hUVjphtl$(U\H9$L$RU$,UA G$,@uXOtuKO t> O u)L$ QPMtPDž $y+aG#}T$ PQhRx&= $w89;$(w))΍L$ WQP D5%D$D1D$;$ ^_[]Íd}&}PQhR2 mXd}&}PQhR $$bWd}&}PQhR;苰fffffUSWV[5<$8$E UP7`E 1Ҩk4$$4$0$,uRUZ]-VU]t9~uۋ$0tPv u*ft#Q$4ƃ1ҁD$D$ƉffD$D$hVQPKt$D$L$ T$PQVRu@m9t$D$ ff9|$$0$4t*G9D$D$u_GRQP uEt$WVU`24$1E u U[;$uЁ^_[]1ҋ4$E t菮fffffff̀rS[4:t[USWVP[:PaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pf 8^_[]ffffffSWV[|9|$t.jW!G=tjW^_[Í}}PQj@RfffffX9L$rÐSWV[8t$u8~}PQhrR*VtF~tP^_[ÐUSWV[e8$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$WtGotPr܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$bW}PQhcR?F HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$0JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$1D$,}D$(,D$D$URt$h$sU =r e$$|*(d=1t2t u#D$!L$8 !сuD$1ɋ$|B ‹/tEу9T$62t$0t$0h t$4T$D$D$;t$4t$_Hr dt0T$|.u%$cqpRPQhVt$$L$$|Z~N|$ ,$$||$ t$$u uuDžt4|$\l$Ƌ@ut$ taWc0t$@l$D$ *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RYNjD$$fxxt$ T$@>PL]fD$>P8]fD$>P$] f|$fD$f|$"D$<$$!|$hVWt$8RXgD$D$$fxxVT$@HVNjD$91%L$L$PVt$V 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8W"hj$P DŽ$DŽ$DŽ$DŽ$pVWP$Pj%6΍Gfwhj$P DŽ$DŽ$DŽ$DŽ$jaND$$%MD$WMPt$t$t$DQ$Pj%腮T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWZfD$FP ZfD$FPYfD$h$!Pt$ Vt$8WUfNjD$$fx$!xV^VAV=*hL$L$t$L$L$|$hRQD$赀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~V<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$ht@\L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u yn T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ VL$tL$8$tYt$`~l$(u2D$4t$%Ut QtFUt$`)L$8uBffU01l$(E;$%b%^_[]QYpUǍd΍Z׍}PQhRs΍Z׍}PQhRc$%]΍Z׍}PQhR+.4Y΍Z׍}PQhR$% ύ}PQhR$%~ύ}PQhR$%MT4qWVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[f|$F$ jPzŅtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$Pr ^_[]Í}PQhR@€}PQhR|$mX}PQhRUSWVT[&1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4D$ D$$L$j L$QKtL$t$ t$~e t tt,…tt$ P~u$ND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$PD$Pjt$G|$$"RoT$GtItu܍}PQhRT$u뿐D$L$Eŋ@uaL$$Ut D$PT^_[]1ύ}PUhh RAύ}PUhi R~USWV T$[rL$8D$ l$4"t$@jV1]F1t 1Ƀt @u\1<$L$D$ Pl$ U,1PU|F<$T$t ;D$ P ljT$4t$@jtoL$ Qt$ PQ 1upF<$T$t ;udD$ PtljT$4t$@j*t n)tl$<UlGt!D$881<$;D$ ^_[]ýW蛆t‹GwtP肆܍͍}PQhR4Y͍}PQhRI}PQhRt}PQhRMifffUSWV([å$H$<$$E UPM 1U4$Um$DUtڋ$D0W+t4$DptPW tu뗐$@tP$Hp ոj$DWH1$@T$t.$@öT$D$1L$D$=wu4$T$$L$%D$&hRWP։L$a4&t$$DP藙 D$L$T$ t$$QRPVu%t?14$E t 4$1E u U;$$#(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$uAT$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$@T$L$ ut$t$$LUtPQhRffSV[]t$ t,FF#EgFFܺF vT2^[Í]BPQhR밐USWV[t$|$$|$ n? NV@)19vt$ fvt$Ut$$VPL$ ! L$T$$19s+D$ (L$@9rt$ 1)ƋD$ȃWVPÖ^_[]Í]KPQhRlVKPQhREUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWζ ;D$uY ^_[]Í]aPQhR茴]aPQhRb\ffSP[Pt$1Ƀ $ȃ[ÐUSWV$Yt$8D$D$ L$\1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RUWjP蠤 |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W-{ Pt$l$ U{ t l$ /D$D$<F\$hPWz |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WURyT$ \$WjR薢T$ |$L$F t[l$Et Nj,$U \$Wt$T$ Rhy E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$yT$ L$E E$\$l$TU?c/4$U,c$L$$9sD$DQ c1ɉȃ0^_[]D$D捃"قPQj]RAW\$萡SV[ít$ t Vb^[Í.قPQh/RfffffUSWV|[Xj$o1tGljPWڀt)l$XD$\|+WQ W1|^_[]jjWjjUjFWt҃L1D$ l$<$D$ƅuUW뚐USWV [x|$$(rl$ NBCD3EB 3M t虣1 ^_[]Ë|$,jF0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPj[=F4~F:F:t1F;pS[ît$t$&[ÐD$@ ÐSWV[|T$|$9W v#wG,ʃt$<u0 Ћ0茠L  )r;GvQD$Ot$1^_[ÐUSWV[t$,~$ED$\$Pv(t$Q 9quJi$qD$zD$4$9t$2D$<$8L$HL$D$ l$D$$$$`$ttl$$;%`t %)l$ $D$D$et$L D$0Fvt"l$ ȃ$D$D$dt$L D$0vt"l$ ̃$D$D$dt$L D$0ut"l$ Ѓ$D$D$@dt$L D$0ut"l$ ԃ$D$D$dt$L D$0Fut"l$ ؃$D$D$ct$L D$0ut"l$ ܃$D$D$ct$L D$0tt"l$ $D$D$@ct$L D$0t$t"l$ $D$D$b`t謆|$4tvL$DL$ D$D$,$t0dƁ Ot yI u2D$4$D$E5L$@L$ D$l$$$记Ɓ Ot yI u2D$4$D$4L$L6r.|&Sa^_[ÐSWV[|$xuƁYjVWu y#}WPVr$ ^_[ÐUSWV4[è$D$0D$IuD$HL$j.QPjT$PQj.jR_y$tEL$PQVP D.0;D$0u 4^_[]S&USWV([t$L$-uAD$QD$ +tD$ +u AD$Q\x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$\8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$q_֍ PQhRvpːUSWV[ӣ}PfD$|$D$ D$PKlHHPP0ppp RQWjV譌$r D$ƀe^_[]USWVP[Jl$PU^EBPUFPU.PUPUPUPU΃jPU# 1uR\MDHt?tj PU t8u$8 L$A.&L$0t9^_[]ÐUSWVP[úl$sPU蹂txF u6jPUg" 1u[\MDHtHsj PUҕ xs8u $8 6D$t8^_[]fffffffSWV[ܠ|$t$jWLGHO~;G~ t H WRYjWLN^_[ÐSWV[lT$L$Bpr~ ;B~ t 2~: RQ^_[ÐSWV[|$(D$$u$PcbD$D$D$D$ jWKG0u ǀD$PW>?jWqM^_[ffSWV[ÌaHt Jt @t A ?t/t5GtU\$ L$ 1)D$ E0|$}4},1tqtk<.t t<2t[|$T$ `T$ D.BE0}4B9DD$ @ PU0}4D$|.|$T$ uT$ |$rx)D$7D$E0 E4u!\$jt$jhVD$(\$1M0QU0E4A}4sKjD$E4D$ Cf U0}4D$u0}4WVu`Z C)ljD$ s2\$L$7jQjhRD$(D$ Ɖu0}4\$uuE"$+PWQjdjV8^9E4BPVu0< E49s)\$7jQjhRE4M09U0)E49L$ u4U0D$T$t$\$w)D$7D$ E0 E4u"\$jt$jhVD$\$E4M0QU0E4A~~}4snhD$E4D$E0A\$Af E4w-7\$jQjhR\$E4M0QU0E4AE= U M E4u0} PVu,WA!A9AD$1))lj\$}$&#u E PQjdj$+W\9E4@PWu0: E49s%7jQjhRE4M01U0)E41E4u0} MU }$"u D$ E HM HL$HM xQƃE t$ H V|$Wt$PQjdj$$+W2[ 9E4?PWu09 E49s%7jQjhRE4M01U0)E41u;D$ !u <E PlPL$ Qjdj$+WZ9E4B?PWu09 E49s%7jQjhRE4M01U0)E41u E P1Pt$ jdj$+WZ9E4>PWu08 E49s%7jQjhRE4M01U0)E41u E PQjdj$+WY9E47>PWu0 8 E49s)\$7jQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$7jQjhRE4M0QU0E4AD$`/}$D\$u M QU Qqu It$\$QRPVjdj$ +PX\$ 9E4<P$ +Pu06 E49s%7jQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-7\$jQjhR\$E4M0QU0E4AD$#M }4E0T$WP=;E }4;E0 E4u)\$7jQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E PL$ Qjdj$+W/V9E4:PWu04 E49s%7jQjhRE4M01U0)E41E HM @Pt$ jdj$+WU9E4f:PWu0;4 E49s%7jQjhRE4M01U0)E41E E PE Pt$ jdj$+W+U9E49PWu03 E49s)\$7jQjhRE4M01U0)E41M AE  L$<%\$OL$ L$7L$L$*M01U0)E41E E |$\$7%Pt$jdj$+WET9E48ƃD$PWu02 E49s\$jt$jht$,D$(E4pE ;D$8}0L$T$7T$ L$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-7\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru E PQjdj$+W`R9E47PWu00 E49s)\$7jQjhRE4M01U0)E41\$ E HM L$HM pQJE T$(|$$VPjdj$+WQ9E4H6PWu00 E49s)\$7jQjhRE4M01U0)E41|$\$E OL$ L$7L$L$*M01U0)E41E E D$\$O\$Pt$jdj$+WP\$9E4d5PWu09/ E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E PQjdj$+WO9E44PWu0q. E49s)\$7jQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0' E49s)\$7jQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-7\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$7jQjhRE4M0QU0E4AE L$) \$PXE M4+U0B  ru0M4B\$wPQjdj$+PF9E4:+Ƌ\$P$ +Pu0% E49s)\$7jQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$7L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$PD$Q|$XWu u$u? E4u0} PVu,WI**E L$))|$1ҋ\$اL$L$ 7L$L$$+р਀tsRPt$ jdjVD9E4g)PQu0:# E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$Ս|$X\$PVQj2jWC\$9E4(PWu0l" E49s%7jQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$7jQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$7jQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$7jQjhRE4M0QU0E4AE MU \$VWu,P}$E PL$ Qjdj$+WA9E4&PWu0U  E49s%7jQjhRE4M01U0)E41E HM @Pt$ jdj$+WQA9E4&PWu0 E49s)\$7jQjhRE4M01U0)E41E E ;D$%L$OT$T$ 7T$L$%M01U0)E41E E ;D$@%\$Pt$ jdj$+Wq@9E4$%PWu0 E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-7\$jQjhR\$E4M0QU0E4Au 'E PlPL$ Qjdj$+Wz?9E4-$PWu0 E49s%7jQjhRE4M01U0)E41u E PPt$ jdj$+W>9E4#PWu0{ E49s%7jQjhRE4M01U0)E41u E E PE E PE ҍPWVQjdj$ +PC>}$u E E PE E PoE ҍT$XPWVQj2jR=9E4"PWu0c E49s%7jQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W89E4!PWu0 E49s)\$7jQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0k E49d\$7jQjhRE46?D$E4D$W\$|L$D$L$7L$L$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$W/\$9E4Pt$u0x E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0 E491\$jt$ jht$(D$(E4  |L$D$L$7L$L$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$.\$9E4mPt$u0? E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E49-\$jt$ jht$(D$(E4\$9=}4E0)E4u)\$7jQjhRE4M0QU0E4AC}$n }$bPL$ Qjdj$+W[19E4PWu0 E49s%7jQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0g E49s%7jQjhRE4M01U0)E41E HM @Pt$ jdj$+Wc09E4PWu0 E49s)\$7jQjhRE4M01U0)E41M AE I T$}4\$E0.E4u)\$7jQjhRE4M0QU0E4A |g}4+E0-E4u)\$7jQjhRE4M0QU0E4A}3}4E0 E4u)\$7jQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7:$+t$:$ +f@======2|$7:$+2z4|$7:$ +r|$7:$ +rz t$>:$ +rz4w|$7:$ +r|$7:$ +rz4|$7:$+Rt$:$+2|$7:$+2z4|$7:$ +r|$7:$ +Rt$:$ +DŽ$ +====2|$7:$+2z4|$7:$ +r|$7:$ +rz t$>:$ +Rt$V:$ +Ƅ$+=fDŽ$ +==2|$7:$+2z4|$7:$ +r|$7:$ +rz t$>:$ +rz4w|$7:$ +r|$7:$ +Rt$:$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$|L$D$L$7L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$%\$9E4(Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$\$jPjdj$+PF)\$9E4 P$ +P|$ \$ D$|D$D$D$L$7L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$#9E4M Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0 E495\$jt$ jht$(D$(E4|$ D$f E4w)\$7jQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u ηE M4 U0B  ru0M4B\$QVP"  ƋM49s)\$7jQjhRE4M0L$M0)D$E4z|$)D$L$7L$ \$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P蒨اPQjdj$+W%9E49 PWu0 E49s)\$7jQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj?}0W3 ƋE49s,\$7jQjhRE4}0}0)E4E \$u4u0Pjև}0WƋE49s,\$7jQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$7jQjhRE4M0QU0E4AD$w|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$|D$D$D$L$7L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0j E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$7jQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u %E M4MU0B  ru0M4B\$QVP  (ƋM49s)\$7jQjhRE4M0L$M0)D$E4|$t)D$L$7L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$7jQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u xE M4U0B  ru0M4B\$QVP\ {ƋM49s)\$7jQjhRE4M0L$M0)D$E4|$)D$L$7L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$7jQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u ǭE M4U0B  ru0M4B\$QVP ƋE49s)\$7jQjhRE4M0M0)E4sf )E4w)\$7jQjhRE4M0QU0E4AE4D$E0D$|$)D$L$7L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$7jQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$|&D$,;$p+u ȍe^_[]Ë\$?USWV [St$,|$(D$ .ʋ7l$Ut$Vt$40RQĦ‹L$$7>tVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>s7%D$D$Q@(D$ 9s$7jQjhR)))x ^_[]1))lj$PQhR뽐USWV Չ $[#RT$8D$4 D$L$D$"u$7jQjhR|$4QA$93<$779$xD$D$7D$ D$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$7jQjhRMQUA+<$-i"^"D$4L$D$ ^_[]ffffYOT$4D$#lpÐUSWV[ëO|$ l$t$~Jt$~2UVx(ƃ|$tލF9wȉ9v!(+t$^_[]ÐUSWVP[O|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ } (^_[]E ffGftC,$RWסxǃ9w,$)xD$ hHGftf,$RW腡f 8 9Xσ95,$)5|$ oGwtc,$RW 8 9σ9,$)|$ oGwtc,$RW衠 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [ØL|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.Q ^_[]Ð~34$UOx(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0Quus]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[J|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.^_[]Ð~34$U远x(ŃtߍE;$wMȉ;,$v [(+l$xD$$h,h,L$ H(ŋT$0PhRQuu苪U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0M(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV XhG\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jō;FPQhR|$ FPQhRFPQhZRgfffffffUSWV[AD$$L$1w|$ u 010~PUWVt$(t$(QR. 7XOAL$u,ÐXAL$w1USWVX@D$|$4t$01>0N xtNi|$|$8Z~D$D$\D$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$MNRPQj>R ;\$bRPQj?Rl USWVP[>t$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]ÍbqPQjgRr 1fffffX= s ÐS[þ= s ht$ PN [ffffÐ1ÐXo=t ffffffUSWVX[H=l$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMnL$"jWRPj2jQŃ9D$"PD$tPUD$pD$)D$iǓ$))ŅtUT$ T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ |$"jHQPj2jWH9W|$WD$iD$lj|$)ƋT$ D$kD$p\ txҋ9|Wy>TWPڋD$+D$pyxffffUSWV[+:l$Uƃ;D$vS (`|$UW1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[Å9$$$hWP! x3l$hU$( xUWL1Ʌ;$u ȁ^_[]5ffSVP[8L$t$D$T$ $xRQVP!x9rRQP ^[USWV[Û8|$t$l$tt$$PW+&t ^_[]VWh!t W LJWVU ͐USWV[8|$t$l$tt$$PW%t/ ^_[]VW t W LJWVUF ͐SWV[Ü7t$|$jW1Ƀ PVW ^_[ÐUSWV[[7|$tt$O#PW$tw 0l$VW/ t WRLJWVUM ^_[]ÐSWV[6t$t5|$r#u#jV#tjV$F1^_[S[~6D$tL$ ttu H1[[ÐSWV[,6t$t_|$G?wS|>1RjV"t3jVU# tۃtjV"t jV/#^_[ÐSWV[Ü5t$tAjVq"t2|$jV"wsf~ 1^_[ffS[.5L$T$ lP[ÐUSWVT$0L$@[4uD$\VVD$ P-ǃx\$D$t6d=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$$|$x$t$D$D$D$\$$|$,Vt$8PQRWǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$t$,PV1D D$,\$hPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[.|$  g >L$s*D$@--tr0twPu@-'[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[LD$Hr} %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[Ýt$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[D$ L$t9u[ÍّPQjpRiS[ÎD$ #L$t9u[ÍّPQjpRD$t&L$tu1u 1tÐS[L$ D$Qss)ǀ[Ãuu ǀ[ÍّPQjpReS[ÎD$tL$ t 1[[ffUSWV[Kj ǐ1tQ@@jjPj V(O8tE(W5(^_[]ÐSWVP[|$tcOGQ9u0$jQPi 08t  G $GT$pw1^_[ÍJBPQjZRySWV[,t$tRtC|$t3~t-0~r4;~rPV۟^_[ÐUSWVP[út$t@F$t*.1tt$Vt 9<$u1^_[]ÍJUPQhR뜐USWVP[:T$J $Ћ*1|t$W2t94$u|$ l$tWE$F;$} $)Qtu<|uprP $كU|l$VRQPWhUh0zPōt$hWj jVPQ‰$0u uuuVj P WHt$}w$0+i@ ;A7T$ B@$0p t$ V莟 $0xD$@ $0;h:t$|$$WD$)L$L)ʃQRt$ PW~/9s)u̍^L$hPQfx =l$0@ W$0@ $ ;$^_[]WֈU$0@ V$0@ t$t눋GD$fFFfGD$GD$ @@ t$;$0@ &"-PQhRo"lUSWV@[t$\ED$<|$T>vx ux Pxt&D$j.PWV!tl$tw$x D$P賹L$QRPD$PWUu $t!Q,l$|$TG )|$TWT4$l$tNjM;L$ǃD$H=;$D|$ uNfff -t$t$PL$t$(cQt$@Ff$w-j5D$0$Do4Vd4PW|$t$8t$HQj%}T$T$@t$$P6Stt$6Pj%@$D$@9F f|$0u D$(8gt$|$u$L0V1ƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WPT$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PR9s l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0V說=~ $!D$1$D$$1D$\$|$$Rw1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$<Ĩ=(ƋD$L$,)9Qt$@Pd D$$LD$ꋄ$H@ tՍT$$Lt$, D$D$l$)Ճt$,)9sC$LAURPX 4$ul$l$$T$8)ƒ)19s@Qu蹷1$X;$(,^_[]Ë$LnRPUՊ 1‰(dZ֍PQhRvsZT$$PQhRIT$4z?|$4X聳USWVT[Ó$h>Wt1T$ T$G j(c¸hl$D$D$ D$$D$$1|$ D$ l$Pt$ Vnhǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< t PWgt1ɀ8 L$L$D$D$L$ t WPStT$$9s=ȉ81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]Í;` PQhR]/` PQhRBKUSWV։[T_~\LZu 1^_[]É4$t$0t$u'_ t E<)׋$΋$x`<$1L$D$ D$$}T$uUt$T$ E ulD$;tM gE=t܉t$L$4QP{t$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QPH{L$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tR[D$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQZD$e ߋD$)D$Uyu E;D$U_otjU xİ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t QZE0EEEe jUw1뙋t$uyb)EۍՕPQjGR/ՕPQhRD$D$ D$N/ՕPQhRѕEtfffUSWV [8t$@|$4ue>FD$FD$\$jt$8t1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$uϗPQhRaUSWVP[Ê|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]Í*{ܗPQhR~uܗPQhRXaUSWVP[ʼt$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]Í*{PQhR豈{hPQhR臈T*{͍1PQhR^4USWVP[ʻt$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]Í*{PQhR豇{hPQhR臇T*{͍EPQhR^4USWVP[ʺ|$l$tcEtDt u91?$EQUPEQUt 1<$1^_[]Í*{PQhR豆{TPQhR臆TUSWVP[|$l$tStuEt8tu-$EQUPEQUt$1^_[]Í*{PQhRuIPQh R軅dUSWV[+|$T$tL$t )ŋt1tXuQBWQRP t?t=Gظ UQWP%BWQRP ttGhUQWP 1^_[]Í*{'֍PQh*RFh'ՍPQh0R资L$(,USWV [t$$l$ P|$(k6Et,t@EL$QUD$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$U ǀ|$tB}u3PQh_RsJ3PQh`R轂L*{EPQhR薂4PEPQhRl SWV[ܵ|$t$tt=hWWV^_[Í*{XPQhR uÍږXPQhRUSWVP[Zl$t$D$ |$$=_t"t4uuFQVte$EE$FQVPtFOt+E9t, t W9GuL$(t t$ Vу1^_[]Í*{dPQhRǍodPQhR踀}dPQhR菀dPQhRe*{PQhR;IPQh RzUSWV[xt$ |$m7$t1u$Pu1tLt-l$T$BL$QRPt)T$BL$QRtll$1;l$$D$0tN1 $uPj;D$ tuȾ)1Z $UL$Ql$$U+ ǃu=}u7u34$PBD$ 14$7BD$ ^_[]Í~zPQ1܍*{PQhRQ~q>PQhR'~JSWV[Ì|$t$tt9h(#WV ^_[Í*{PQh?R}uǍ>PQh@R}룐USWV[l$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Í*{PQhWR|LҘPQhXR|%USWV[l$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Í*{˜PQh{R{Lј˜PQh|R{%SWV[|$t$tt4WV^_[Í*{ޘPQhR${u̍ҘޘPQhRz먐SWV[l|$t$tt4WVJ^_[Í*{PQhRzu̍јPQhR~z먐SWV[|$t$tt4WV^_[Í*{PQhR$zu̍ҘPQhRy먐SWV[l|$t$tt4WVJ^_[Í*{PQhRyu̍јPQhR~yffffSV[t$t$Vt$t$t$~>.u^[ÐS[ît$t$t$t$t$J[ÐSV[}t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[^t$ t$ [ÐS[>D$t$ P[ÐS[t$[ÐS[t$Z[ffYϨ ÐXL$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX($L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$JPQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$lw;t$b\Gn߃^rxo;l$1\,, $*XwkdT$Ɖ*t$i $*Xwi (Ћ4$XWm;|$Yȃ|$ U(!Ћ$JPQV xuD$ ƋL$$QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$;w(^_[]Ë$wᐐS[þjt$t$t$[ÐUSWV([È|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ l0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[L$T$ lPt$ [ÐUSWVT$[’ɉ$t$4|$ |$0t=D$0|$ "v-d1T$VPP\$u+t-t$0u#D$ D$t$0t@D$u20u- 3 E})Elj4$|$t$(VbQ~6Wt$(V73 t)T $΋T$rsxoD$D$ ;0srnEt%  ȉ  ȉ ŃU2ItL$L$ ) $^(D$(H @^_[]F @4$utD$t0ٍxPQj@RXD$,cUSWV[Kt$l$|$ jW7WUVt$ jW9^_[]fffSWV[8 8tft8PQ Džu:j= t.P JGGG ^_[ÐS[n PQP[fffffSWV[<t$|$t]WV0 ^_[ffUSWV[ l$|$[$PQVx t"t$UV| 1VjjPt)W4'PQVw ^_[]fUSWV<[Å$T$PE$8FNt,$ @QP0,$NolȃFFD$$xD$$Vj Pl1Ʌ,$t$ D$D$D$ D$PD$XǍŚt$8jWPhVr=hVl\D$t}ƍҚPVr\tGL$T$RQWЃ D$ t2L$t*tB́RjQPv-,$V D$;t P[D$ u QPtj t$|$|$|$ |$|$l$l| |$||$|4 ,$t t$ jQP1Ct$9D$t*L$tt$t$уD$;t P&[E;$8u^ȁ<^_[]ÍǙPQh~R6T_;ǙPQhR T8S[nD$ L$01h[ÐUSWV[8t$,INtT0(RQPWq~1ا(D$:D$ D$mD$\D$L$ t$7q;~F4UqFDtt$qFDtu&u8tMt$ pFDt4$pFDtt$pFDXt$pGj o^_[]ÍǙPQhR9RUSWV[ë|$ 11 t5D$0ft$ 9rԋ <.D5tDot-1t P$9tGGP GT$JRWO~ǙPQhR9Q !1ɋ I `QP t8 Il$u}ml|4 t  1^_[]ÐUSWV\[8L$||$x$+|$x8D$8tvƉD$XW tgi9t uD$tL$HD$  D$ W9$u8; H u(!D$D$  D$ WtD$PD$xD$Bu 76._^_[fff̀rS[}t[USWV[}|$ P$D$l$$lt$L$T$(PVUWt$<9tO $+t$ O"1^_[]ÐUSWVP[:}t$vO8$l$ L$T$$t$,PUVt$8=9t5^_[]Ã19tiF9udFqF9ulFyF9utFF9u|F뫐SV[]bV1dPmV^[ÐS[b1dPw[?SV[aV覨1 V薨^[USWV [öaP ɉ$tG$W$\$1=L$T ~5X $WP%\$uD$T u $hR\$ƉP tPj3t0jdždN-00|$~X hWPO P t ܪǃ @V҉t$>iFs0hFށdN$ܪt$>-00t!t$t0J$1ɋ\$+dF$ >-00uȅVaFs0`FށdN$ܪt,>-00t!t$t=J11ɋ\$+\F$ >-00u D$T ^_[]ÐSWV[,_hRƅt(T$j!tV:181^_[USWVP[^D$tBՀ:Pt=ǀ}:ju1ɉPDžF $1퐐9}h.dNP Ń=~߿TFFF fFdžhFdždFdždNUTC><$~81퍻" 9,$t".dNjEPW uƄ.dN_1^_[]ÐS[Î]t$[ÐS[n]t$jt$t$[ÐUSWV8[3]M 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtfL9| }Z^FD$ 9߉D$ T$|$\$#)L$ #11uj+DH(4\$tg;~N|X1Ƀ|I|$T$ 9}'4}t$;tt$t}։9|كu>L$dFL$(uV*T$iFH hFdNP(}jܪ[1+dF GыV+D L\$jhY`QPӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U|Rut]9D ΋u}\$-1kD$ \$uuPVftML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐSWV[D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽%8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU(|$u|T$jD$P$L$L(|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ dUSWV4[RL$HD$AD$ AD$A D$AD$AD$A$D$,D$ D$(V荘X uƃX Vt#D$|$ L$jWjj'|$uL$jWjj~'|$t1ՉNjt$#0|$ xt$ |$H4^_[]Ã|$(xۿ뿐SWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[êP$P`T u1dPl$|$P tABR lP~;yQq|1)͋$P^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[+NUT u1dPl2|$t$P tWVP ƉU蛔^_[]ÐUSWV[ãMD$D$fBt π?:t \?:u$,?/4$\$u(\$jW=\$ W?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrD$\\$hWP; j.WtU\$j.Pet59tx/ux.uHt/uэ|$H4$$," 4$\$h@ W腋ǍD$HhPW( +&y \$n0\$W"D$(WgdND$4lPD$0T$LD$D$T$#D$ D$`T$a |$b L$cy ρ D$\T$] t$^ L$_y ΁ Ήt$D$dT$e l$f T$gy Ձ D$hƒt$i L$j T$ky с D$lƒt$m \$n T$o|$y Ӂ D$pƒ|$q t$r T$sy ց ֋D$|$1T$1=y\$$ZL$ʼnL$,ȉ\$@ÉӍ/L$‰Ë\$$[B,9D$(/D$ D$tXD$t‰T$4$\$T$HЋ|$)L$(hL$,QWR8|$#D$ {|$t9D$t9$T$,HXp 1D$uT$1l$t= $Ƅ9>l$ $\DT$ՃD$ 9|$D$ Mȃl$uAT$j ŋD$X l$EÁy] ËD$h ݋D$X T$j ݋T$R l$] y M  É $Ƅ9>t*l L9݉9@1l$l$~iD$9T$$4$1><t >nm^9};|$ |$ 91L$tL$T$14$|$\$$L$ L$T$|$F1\$ ʃ{ s {y $dFJ|$,ӄiFRN 9hF9q\$T$N 1ۅQ΃1rY̓1$\$;8dNT;8eNT;8fNT;8gN9u\$1ۅt"|$41D$(/9uD$4$T$|$1ƄfNfDŽdND$81L$0L$<1ۋl$39l$l$@L$:.>unM߃$iN$\D$1. $tDA)>ii;T$tyl$lp $ Y I|$0,~;uM}|1ۉȋl$p{<$L9t }`$@\$ ۋ4$.S؃1Ƀ1ɋVr<$w̼  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF4$91tA ́ 1ҋ4$v~$x<ыl$hF$dF4$9ũ~ 1\$躳USWV։[a?tK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR' $Ec\$jt$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0V >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$iQL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$<1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ01i4Q9uB ^_[]ÐUSWV0T$ $X1D$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$D$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$)ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ e麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$7)jhUt$ !T$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP)Nj\$jhUt$ћL$D$|$s؉D$͉)пjjUt$FD$(|$\$jhUt$$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ t$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPI)jhUt$3U\$T1ڽT$\$jjdUR)jhUt$ޙt$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$0|$ 9|ځ41ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$4X)D$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jPn~ e1^_[]fUSWV[l$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]ÍɛPQjFRqɛPQjGR|$$bLɛPQjHR>ffffUSWV[l$t$|$tU6^_[]Ír6PQhROʐUSWVP$[õt$d U`t,jtPx $Hp  17"  xuxt)txu8u밾Ur`^_[]Ã듍6PQhRqKUSWV[d D$ P `   $ L$ L$ǐ|$$tD$$9G t GtO  tGwЃ GЋ 9t DžuZ u';|$r$;|$s<$$<$C<$1 t$ ^ u#t7W虩u^_[]ÐSWV[lt$d W^"  xuxt&t xu8uj蔘u $p@@  1W^^_[Í6PQhR&IfffffffUSWV[Å$$$$$tD$$DŽ$DŽ$ $$jP']$@jP]DŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^PQjPR pPQjQRqT $ ;$u ^_[]8S[lt$t$Pt$t$7[ÐSWVP[ûD$L$T$t$ 4$lVRWQP^_[ÐSWVP[{D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[;t$}XjWE`HM`~;Ep~ t EXHMX WRjW^_[]ÐSWV[üL$B`pr`~ ;Bp~ t rX~zX XRQA^_[fffffSP[]D$ L$ $XQPR[ÐSVP[,D$L$T$$XRQPVD^[fffffUSWV[T$(t$$|$ t&t"qTN @14$t8t$jR/L$0A uy$‰Ņ1@<$1qyQ0uE)ljuދt$$$)1t$ ƉACAAAjQ֍PQj=RCK׍PQjQRՋ)v1WPV/ L$(9l$QhuC}T$RPV |$(Gy<)ЉAjQt$$jU$+D$1t$ Ɖ^_[]ÍIPQhR[L$8AffffffSP[ýD$ L$T$$RQP[[ÐSVP[ÌD$L$T$t$4$VRQPEB^[fffffffUSWVP[Jt$|$PVG1sht$t$ 'Q x=|PQ+fF FfFfn vF$F,F(F $tjjjV^_[]ÍiPQj>R)ffffSWV[L|$t%jWw jW^_[ÍPQj;RxfSWV[|$WG;D$w+t$9w 9w9w 9wPWVY ^_[fffffSV[ÍD$;D$wt$ Pt$VɅ ^[謅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[Dt[USWV[+t$F0u ǀFFF tVu"Vut) aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]Í1PQjL$aD$?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$PՓ\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $XD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $xT$ L$D$n6 D$0 L$ I $T$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $PtD$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$D$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0Q螠,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwPڟƒD$ƒ;T$,v$D$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$P<\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$9$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$9$PQhRUD$뀉׋$G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$9$PQhR=EL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$B|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$9$PQhR2U|$뉐|$UD$xT$ Ӌ$Clj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P\DE|$8E|$8|1 uT t$ 9wS$w닔hwl$Pmt t$T l$PU\ / U| 룋$L$19u $PT<^_[]þUSWVP[D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$肑USWV [ÖD$ 069rljT$D$uj$jWPH 螔(藔9$T$JHJHJHJHJ H JH RPE$jWP 8(18t!'0t$Q0*)4$PjV5 $L$D$ 81 ^_[]ffffUSWVP[sEET$@t$DT$$dpU }ǞjОjD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjP  )jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]裍USWV׉[÷l$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[ãm|$hE t$p |$<$ MM$UǞjОjl$l$܋|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPD )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]ffffUSWV[Ex\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$ǞjuL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$Оj؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(w@D$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$D|$<ػh|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃hL$T$vثhv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQU51$t?$L$U6$1xL$^_[]þTx0ffffSWV[\t$|$ty8L$tu1 1 ^_[Í*ԞPQj5RhrfVL$T$ tu1 ^Á1 ^fffffUSWV[ÀM1ЃωT$(ЃM$U XE81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1FǞj<Оj)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋܃$ۄ$܋҉t$$~@CM ~O$VRM$U jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmlD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك|$tT$L$؃ݜ$$$$$݄$D|$@ػhD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكD$!؃|$8=؋كT$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃hD$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثhv#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[ìD$1r 1 9vW<t8Ɖ^_[ÐSWV[LD$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[ýD$ PHpR=^[USWV XT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[þiSVH[ÕD$0hjP Z D$(D$,DŽ$@DŽ$DD$ D$D$$jPj5 .L$(VPQj5D$$D$ D$D$D$D$D$jPj\ js[j[S[îS[ÎfffffffUSWV[kt$|$tK1tjjt$t$t$t$J[ffUS[Mt6C$D$i@B)iD$jP1e[]ffSWV [é|$ t$t=D$D$ <$L$jjPVjQ/1Ƀىȃ ^_[Ítzt (h1^_[]ÐUSWV[à}uu)\$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋt$(PV'T$4D$(hPV'uD$(D$D$٩L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQJ D$p '3 |$4t$N  D$0P QVR  t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}E("P"L$D$ffffUSWVt$F98[ýU |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[Tu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[St$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXSǀ ǀ fǀ ǀ9 fǀ= ǀ fǀ USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[QD$H~( 1u 9r1$PƉ^[fUSWV[{QL$8?tP裖 wܽ t{ܽ ?u1>PƅD$t/Fn?tPCFF ^_[]1?tP d )ʉʁ oΉ oUSWV[{Pt$tbF!r VkO8}t3W荕}Fܽ ܽ tWkܽ ܽ ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[hOl$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&U=E!r\U'18}$P=}T$,Bܽ ܽ ti4$\8}th$P1}Fܽ ܽ t14$͒$ܽ T$, ܽ D$TG^_[]Ëܽ ܽ 1␐T$1Ɂsrr@r"y(6s@sރx @tS[þLj,tL$H@[ÐUSWV$[ÈLD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU<8?t:V͌?Eܽ Mܽ $t#V訌D$ܽ Mܽ $^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[FD$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [DE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[5A$t|1a1Զ PQjERh P$1D$jjWk ʼn$tƒ9tt#D$PW&to#D$=uTtVƋD$fF $tu fF f~vF$F,F(F UOĄ^_[]fS[?t$t$jt$0[fffffSWV[ü?|$t@jWaGHO~ H0 WjWB^_[ÍPʠPQj=R 럐SV[=?t$ t%FHN~ H V^[ÍʠPQjIRi ffUSWV[>t$atrt!w 11ҊNtgtGɍyw@ؐ+u˽뿁뷁 ՋL$) `1^_[]ÍTKPQj>Rg fffffffSWV[=|$f jWbG0ǀǀ 1G t WzƋO twуy y w`G0tW@9t QGG00G0ǀǀjWG GG:aPQj8RG f  ^_[f̀rS[Ô<t[SV[}<t$ t;F0u ǀVNuFH^[ÍܡPQj;RfffffffSWV[;|$A8uGG Ⱦ uuL  O @G0taW@9t QG0GG81t&WXG GGfG u WG t'DV|PVȁGOQPwW$ GO fO 1!t Gf@f  fG ^_[ÍPQjJRSV[}:t$ tF Ш u V[1^[Í)PQj;RSWV[,:t$t` 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWPƈ6@VRQWPL^_[ÐX9L$AA A AAAÐfffffUSWV[E9$ut hjX1$džt.%u%D$PQ?1t+ 8$u! 8u $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hVu VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaF0j P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNCot(1VQ(1^_[]14dž$j$螳tJpHHH H HHH 88oUSWVՉ[Ô3jqʼlj1&NL$jP蔼$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u18"8^_[]ÐUSWV[24jQ@# t D81t>0rPt_t u8~)1 9}8tQy݋t P\qVTt81^_[]ÐSWV[1|$tOW ^_[ÐSV[0D$ p|$s t.jt$ 1dž,dž,^[S[n0L$tAt[[ÐSV[-0D$ p|$t_dž,1t$t$^[ÐSV[/D$L$ qt dž,&t 1҃ƒt$t$^[dž,빐USWV[X/l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uNTw׍L$=N=L$>NL$a D$`$^_[]Ët$ |$L$$Jl$Dijt$@URV2uD$`뒀gt$l$UV݇ ut$f\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBr-#PQjbRvrUSWV[D$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]Í-#PQjbRrPfffffUSWV[|$oEtjPu7 EjWu,EtP脥E EtPcDžDžtP<DžDžUWVU^_[]ÐUSWV[|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[D$;D$wt$ Pt$V9 ^[ffffffL$1s!t11҃9rfWV_]D$tL$ P11^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[ØL$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T$-#PQjbRvT$(L$?-#PQjbRJT$D$-L$ #PQjbRD$L$_yffUSWV([xD$D$른O-#PQjbR$u 1(^_[]Í-#PQjbR-#PQjbRUSWV[T$0t$,l$$E( oM;dM9X$E(  D$($I҉t*t$BfD$D$Pt$UmT$< Pvƃ9Љv*t$BfD$D$Pt$UlT$< vƃ9ЉuXAtQjPup ƉD$fD$D$Pt$UYl jVu# T$0L$fT$|$(u 0t$fT$EL$jjjPPQUjT$LM(|$fT$MD$jjjQL$QPUJjT$LGM(FjPu臕 ƉD$hfl$D$Pt$l$,UVk t#jVu$ T$0M(E(jVu T$0D$ED$fEDV<DtG PU7ntkGt PUntNO, F)WPPbo ,$fnT$0|Vnft9uf&BMf9s $fMnfuvv9f$+t$0ftpt$ 1fuf9tL]4$f9r1ߐftMf9s $fMMf9s $fM)ȋ$t$ fs:t$,fFT$$J( 1uJ;uJ;L$0vfJ^_[]1ftMf9tTMf9r1ftMTMf9r1ftMTMf9r1ftMTMf9r1뢍-#PQjbRT$@-#PQjbRT$@-#PQjbRvT$@-#PQjbRNUSWVT$[òA,D$L$;t$cFjv7 $FD$Du (Dt&A PWl$kl$}sBu`}U|$W UWfz;-L$ #PQjbR&L$땍} ‰D$E)QPPk D$fEDuf$ftNL$uKȋT$fafE|$fEE jU7蛒 Af.Af; $T$sfL$fD$ufL$ 0D$ftpL$ 1ff9tOOD$f; $r1ސff; $sfOf; $sfO)T$L$ fslfE|$jU7蠑 D$8ujP7芑 $,PW$ut$Wox1Ʌ $$^_[]1ɋt$$fDOf9L$hTOf;$r1fOTOf;$r1fDOTOf;$r1fDOTOf;$r1뙉D$-#PQjbRD$QUSWV[ l$|$Et$jP7w tBMHjP7P E1t+jP7J tMHjP7# ^_[]f1̀ffff ̀rS[tt[SVP[\t$t$jjjPV:1Ƀ $ȃ^[ÍOPQj5R艿ffUSWV[$$$$ t$tl$xa$%GuS1<7vuN| ?-)щ $,19rj/PtI1ɋD$;$iȁĜ^_[]j>i E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$D$$t%ht$Wp0 $t*+$hW>P1Ƀ89t$1퐐$(j?Pt$轖 taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$ZO-ՍPQjCRWꋌ$1Ƀ8cfffffffSV[ÝD$;D$w.L$t$ 9w9w9w9wPQV ^[dffUSWVx[HD$tD$pD$lD$hD$dL$$T$dPjD$@FD$l9tC;D$$uL(^_[]Ít7PQh<R j$jU0 볍LP'VUSWV[e$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍ\T T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$LPw#[ÐS[LPW#[ÐUSWV[l$j@ƃ#jv@1jb@j$jU+ WU6+^_[]ÐUSWVhL$$D$|L$4Hpx |$8x|$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø荗USWV4XD$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$pLB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$͢]PQhRے\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$͢]PQh|R趐\$T$\$-#PQjbR腐\$T$\$͢]PQhRQ\$T$\$͢]PQhR\$lffffffUSWV[x|$8D$,hEtjPu_ E wJrr G&E(uI1GT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZc-#PQjbR蹍I-#PQjbR艍w8-#PQjbR^;E,jjuK[ Ǎ-D$wsZtvG GtfAjWu\ jVuZ DžuE#t$PjbQ螌ujWu\ rF(E('Erf9r$fD$E,D$;t$FjRu[ jvuY tW‹~ps f9t-#T$ PQjbR膋T$Hb<$wft$><$fD$2E(uEf $fD$$E($EfD$1$8t$EtP{NE EE($}fu E(jQt$xsB tt$t$jbPwэ-#PQjbRTD$-#T$ PQjbR(D$T$Ǎ-#֍PQjbRUSWV[[|$l$t$FtPHKF FF($nf~ F(^_[]USWV[t$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7-#PQjbR;몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU Ҹˍ-#PQjbRB!fffffUSWV0[ãu~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍-#PQjbRƒD$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$$-#RQjbPT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ -D$#D$$D$(uD$T$ LH|jP6P jW6N \|$T$ ps-ut$1ufyu:8u 9u1)^_[fY_D$0P,P(P$P P PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^hL$<A$iA D$AQT$QT$IL$1t$$4l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPIz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐYD$PPLPHPDP@P Pow(o)PQjPAFQjojPm FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[ݞt$ tAj@PVkD FPhjP8m F@FDFHFL^[ÐS[~t$t$t$ [ÐS[Nt$ t$ [ÐSWV[,t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVl ^_[fffffffT$D$fUSWV[PMD$$&ydTḰ ~? gL$* \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <h 1D$D$ D$D$L$8T$jjPQjR@tD$8h D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$L$L$FL$ƥL$ޥL$L$=hjjjPQRCD$L$8T$jjPQt$RI?L$81 u*jPy _UiK1D:0D$D$D$ D$L$8T$jjPQjR>t$8|$<7QPWVD$D$D$ D$L$8T$jjPQjRS>D$XL$ L$hjjjPQRuMD$D$ D$L$8T$jjPQt$R=tD$8he^_[]fffffS[N [ÐUSWV,[(l$@D$D$ D$$D$(L$ D$QPjH W)1|$D1҃|$H1‰|$l 2t |        t t} t{ ty tw tu ts d1`YRKD=6/( !    s#4Áp uH< |$9T$vQ׋ jjjhjPj! l t+f@ fɉ9sfэ4fxtnF|$DtL$DHH|$HtT$HQ|$ tԫuثԫ|$Dt1|$Htt$jWj ,^_[]þ |$ $ <jjPQjR_:<$ ȅUSWV[˒WԫtV6uN#dP7ƅt36#ܫtUmuW0#tUmujW>^_[]ffS [  uoD$D$$ T$jjPQjR9t1 u,JPQjAR^  [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[ېl$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQPOV QRP ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRPt,NQW QRP FEE1^_[]ÐSWV[YD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [T$0|$,D$(L$$)q092sVPS$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[L$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[Dt[̀rS[$t[S[t$ t$ jt$$t$$t$$t$$t$$  [fffffS[Ίt[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[$D$D$huET1}8XM4tI$PD E8*$$E4E0|$ 1D$L$j`QPu8VR0ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$<8@|$ WR$Ƅ$D$TPWt.$Ƅ$8u$L$ThPQ  $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U !UjD$$PU 8 ʼn`UD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PWx h$PWb U|$|$Tt$h$PW/ |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$PCE$$t8ISltC$($,2D$XP$06 $0$$tRt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TPyB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QP t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QPg t$|$ t$$tP2A$$t P"$($,uWP t$l$$t$|$t$P@E$$8$j`t@8@P$i$t$|$t$PA@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP t$$t$$tP?$$tL$$s.SWV[|tM΋uA~8t:~4~"`N4F8 I9rP F8^_[ffffffS[n|D$L$ AQ jQ0 [ÐSWV[||$t$t+jP6 tH  W6,^_[ff̀rS[ô{t[̀rS[Ô{t[USWV^u{$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLXzD$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gqo91pjPQw1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[Üft$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øPjj%Q4SWV[eD$L$Pt prxxp| pPxtz xyV1^_[ÐUSWV[he|$ l$9v`wDt9xtNȅuT$81$Xq3H7<871*׋PtIQPEjPQD$ pD$,L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~yk6ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p&2 D$ L$Q$ЈA1ÐSV[]ct$ V PFtHP tQ P V%1^[ÐSWV[bt$>gthGt tww$Ѓ gpNjPQw蕦;u<tww$Ѓ 4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[ìaD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[8at$0|$,ttqP3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P| Pt$8=t +l$1jt$8_1^_[]fffffffUSWV[h`|$(T$$<Gx:B tzu?Rt*d2 O2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj WV t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$xT$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QP/T$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]Í_#PQjGR(T$4j_#PQjHRm(T$4USWV[[|$tpjWG 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;DWP=Wx- jW^_[]ÀO @1USWV[Zt$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]ÍvPQjVR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[lYt$8uN uRt8F0t~@9tR!F0N FFfN ~u VkN u1uVVF11+NN^_[ÍPQjKt$t$t$jt$l [fffS[KL$T$ lPt$ [ÐUSWV,T$ XJD$D$@t$Dl$\$t7D$@l$"v'1ɻT$ EVPu+t-|$@u$D$ D$|$@UtED$u70u2E CT$B=sD$ DP[Í[ÐS[BT$B=s\DP%[Í[ÐS[ÞBT$B=sD$ DP%[Í.[ÐS[NBT$B=s\DP [Í[ÐS[BT$B=sD$ DP [Í"[ÐS[þAT$B=s\DP@[Í,X[ÐS[~AT$B=sD$ DP@[Í4[ÐS[.AT$B=s\DP%[Í>[ÐS[@T$B=sD$ DP%[ÍFn[ÐS[Î@T$B=s\DP%[ÍP&[ÐS[>@T$B=sD$ DP%[ÍY[ÐS[?T$B=sDP[Íd[ÐS[î?T$B=sD$ DP[ÍlC[ÐS[^?T$B=sDP[Ív[ÐS[?T$B=sD$ DP[Í~[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[ä=t[D$t8t9@€tuuuuH+D$ÐffSWV[<=0t1WjWQw t u1^_[ffffffS[<Pt$t[ËD$1[ÐfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[5l$$t$|$t9t5D$,tL$ z91Ʌ1^_[]ÍɴmPQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[-5t$t8D$ t|$tT$t121Ҁ9 11^[ÍmPQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[%4$0ЉׅtAϋ$tLRWPQ$$$4UhVH$yPVjcq S[Þ3t$jt$t$PUSWV[u3$$$$0ЉՅtA$ tL$RUPW$,$<QhVt$t;nl$VPQhUJPUjep tWD$ hjP' D$D$DŽ$DŽ$ .L$VPQj$;$^_[]ǃP膺҃¿+w狔 у̃ǃƒS[Þ1t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[1D$ D$D$$jVjn uƃ tjljj0jVjn jIjfffffffSV0[z0t$̀rS[.t[S[î.|jPt$t$t$[ffSVP[|.D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[-t[PS[-[fffffffS[î-88t3[Ë[ffff̀rS[t-t[S[^-j1[ffSV[=- u# V>u@1 ^[Ðfffffff1ÐÐ1Ð1ÐX, Ð1ÐÐUSWV,[X,l$D|$@ |ƃN =sdf Fw%  =uɋ 뿐 QUhWL$L$뀋 |$@l$Dt1 t& 9s8u+p /ƃ D$D$(D$$D$ D$D$D$ D$ D$  fD$ D$D$Uj(P׃8^_[]ÍNPQhR]fffffffUSWVXe*$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$ *MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$[8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$t[D$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$t[D$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WP}T$dPQRt$48uVJ*߉D$D$4yD$80D$t$WTdPQRt$40뒋Ճb8[0D$t$WdPQRt$4'0D$4ߋ]D$4 D$Mt$,V0 uV@)D$D$4qD$t+XPQR uV((D$4+f|$8]KT$HT$H9W؉P(|$D$4uA|$tJ8<D$@؉Pq(<t0j=Xf|$ ~80D$t0\$ WLdPQRWq|$ s0u'HuUSWV,$[E$( 0GD$|$'j j PhW$\$\获tbhPW՞ Ƅ$'D$?D$D$ D$D$D$D$D$D$#$@!vPD$PWt$ QRCK0E;$(u ,^_[]tffffff̀rS[t[D$L$ T$HffffffVD$L$T$ t$pH^VL$L$ t$t$D$T$ pT$Pʚ;|p6eĉP^SWVD$L$(T$+T$ |$|$$t$19}ʚ;)ڃx)Ήp^_[L$D$+L$D$ t1Ʌ ËL$19L$ yÈÐUSV[ÄuD$ Pj*t*jPix/$iL$T$VN*D$FD$ L$NFFe^[]D$L$T$ PiL$HUSV[uD$ Pjzt*jPx/$iL$T$VN*D$FD$ L$NFFe^[]L$D$T$ QMbl$‰QffUSWV [$0D$$$ $fEt$e$,$,$,PShD$ Pjjj$@$@$@jU(ƅu]E $@tR$4hD$PVU ƅE t'4jjjPhD$PVUy ƅ~s$4WVD$PU<ƅyvE @t73$t'PZEP"xEtLGP9$OfWfw fVRQt$ Pr߾WUNRD$;$u# ^_[]ÉGffuXoUSWV(]ŵD$$$$@$<jVQ1t81ۀ.Qu닼$@9vy.Åt1eD$ 1ۅu\$D$#hPWVJt/$P$P$P$PPV1\$d9ٸu^T$L$\$$P$P$P$PjWVN\$ ƅF$<L$T$t$D$~D$D$ *D$sF D$D$ i^DFT$L$D$~HD$\$D$D$ ɋ$<t .u xuD$$P$P$P$PP$TRF8=z$<1t<tu-D$ +$L!5u D$$<X1‹t у9#|$L$  \$$@D$u]D$D$D$ uA|$u:$P$P$P$PjW$T.Ɖ1t P$@|$ $<t.jPzND$;$$uL(^_[]þ|$t؉j$@:NÉ뿉j됋$@D$L$/kUSWV [õ$ M$1@ u tE;$4 ^_[]Í׸P~tЍQPtƄ$T$\ $D$1PhhRL$$t$ T$DH@u u{F$$R)T$D$u$DH@utD$(tDP@u Vu$,FPQW觓 D7t$vyiUSWV[%$$$ $$@t-tѸ$,$,PUQftRL$,WUPhQ=s>$4$4$4$4U$0R&U׶=r,j$ K;$u;^_[]Åt|.u|$qpUPQhWKft$|=PVt$|UQ2$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$ExnNj$L$|PQ J$L$xPL$QI$ǃ$fB$) $W 9$A A L$|PQlI$L$xPQQI$Pj\I$PQ%I$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPbDƅxՍ7Pj H7Pt$H7PjH7PjdH$ 1۸$IUSWV[Ël$ |$t$D$@tɹP) l$$FPj)GF|PQGfFD$@ u1ftPVPyGVjkGG fffG )^_[]ÐUSWVP[Úl$0t$$T$ |$D$@t׹PT$$։)͉ $9L$(B99t$4D$,WPFGPl$UFGUVP誔L$4 )΁r&{:PQh=RCL$8QPOF+l$ ^_[]fffffffS[Îjt$ [ÐUSWV[e$ $D$0$jUEEt U uEEEjmU U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžhltkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU+DD$ djVU P!uƅD$$}`hVW ƅ_EH}DM\D$ 19s( w 1҅tމ8D$ Ϲրwr tt$$D$ P tPǍ$WhhPhE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$PA$<#t<;t΋$doma1$in $sear1$ch #j P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P5 $< t< 0$< w T A< vhQt$H ƅ_ Pt$^nD$ kc$< t< H$< w& A< vhQt$V赇 ƅ_j VtuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< t PVe< D$<@@@@ @@D$@D$8#}j5Pj j$P-D$PD$;t$ s E$EtJP|EDt%uHPWYu퍃PA Pkt#V[ML$0 ;$u ^_[]VUSWV[;t$xP&"džft91 9s)tQ!DŽͅtMtt|5X9ut!xt P!WqdžtPmqdžf^_[]ÐUSV[4Eu jPc$D$F$FWfF e^[]ÐUSWVx[EL$ L$pu D$jPbD$3D$fGt$V jWV VWJGL$ ;L$pue^_[]TUSWV[;t$xP, dž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[D$At,t$0UP EO $L$(T$ L$NL$UL$ F< t< tjt$V bjPVܡ zj PV¡ (jPV訡 &j PV莡 j PVt 3zjPVZ  ºjPV@ ɺjPV& ̺j PV jPV jPVؠ غjPV辠 jPV褠 j PV芠  4jPVm VjPVS $`FPC5d$/FP#|Gt^kGddGtAPt$'F P|GGtPQ7< < {$H׋$ut$0UP $%Py뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]PVX?r?D$PVt$y D$L$Ƅ|$PVnX?r?D$PVt$by D$L$Ƅ($H^_[]ÐUSWVx[$$l3 h3 p; t|P9h@tP|x$D$D$%D$ D$D$D$ PjjjQt_ett. T$r^_[]Í-PQhR_fffUSWV[| ƃ|   p  t  t u' hp  p @ p  ${:tnq6w TK{9u 뷐Kf;{tK;|3xҋ D$ 4$t$CT |$)򉓠   t_LtU tK 1ǃt2<2 u,(#)փ  D$ L$ ,},T$t &M p E,E, E9c9 }(RL$ |$щ)ʃ|$  $sQ߉ʐ JHJHJHJHJHJHJHut1 : 89uD$|$,$},uǃ ET$)E uY$}u}M QWNEg)Ɖ D$L$,E <$t r }ts1l$ p t% t I9uʉ  @  @l$ p WjPTƉ p ձUe8yWp  @p WjP tp d ,u1u?|$ tE,1(p  ,$|$D$ ;E v:VuLl$ A Aq NjE 8L$@DP $1t$ L$ D$ 19S<2 u(|2 uჃ(؅B @   ։L$9Tt$t$ 2  T$k9tt Ty6w Kt$k9t$u 말Kf;ktK;|;xҍQ6w KS9u t$.t$KKf;SuS:t D$ :${;L$tT p6w C{9u,럐Cf;{uC;|3xΉЋT$T$$Љ  4$k9tTy6w Kt$k9t$u$뗐Kf;kuK;|;x΃ 4$-t j \ƃ p Ip t =Xt )  v3tvƊt_\L$9 $|Gy $ DAD.D$8Vl9s .1%00Pjg^_[]E+SV[m tz N9  QPF t{NDDDDD DD .je; tǃ ǃ ^[ÍYUSWV[Ûj0;ƋD$F P:FF蠍(Ff~FF, t 1ҋL$9u< F( th 9tF F$F藋( r R p  ^_[]19u뫐S['QPR j萚SWV[üt$8 t3 9t^t, z t7 9u ~t vGVG^[19uΐS[Þt$G[ÐWVX}L$ tsAQQBQQAA, tD 49u4 4~ v p  ^_19uSWV[ܶt$trT t/<t) z A)VPPT$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍ξPQhRyoL$4T$0^-L$#7PQjbRIoL$T$0zL$ξPQhRoL$ffffffUSWV[{t$nEtjPu> EjVtE 1t u1@u )d1Ƀ Vt^_[]ÐUSWV([øt$@l$<}GtjP7> G ujU蚌0 81qujWjjjU 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P0 L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP` u !1(^_[]fffffUSWV[˟|$ t$tGw#jP*džL$G|$$1D$@DA,Du!@Mu:O}GQWPUVu^/|$$KQ;v RPb)t2MQUQRP$ EG/1^_[]ffUSWV[Ø|$$G,D$$jj78 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$-#׍7PQjbRi\$8=$roD$L$,td;l$tX14Eju7k7 t%MLH4jP7>9 ;l$unL$1 Gw)f_ ^_[]ffffffUSWV [x|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$RE $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]Íǿ}PQhRgT$믐USWVhXD$|$|G =tŋ\$jj$W?{$jj$W\$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$go ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$WgO t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$T$ }PQhSR!bT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$ֿ}PQhR|a끐USWV[D$lAB9w}) >P2Q D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p "L$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$j1Pj^ _1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V 1Ʌt‰ D$0L$ЃVhPL[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$08;1\$$}PQhRzX\$T$ D$4@USWV[؋T$B =tL$|$ t1|$,t*l$$|$(tVz<t~UwT$ D@jf!P=tfOtfO1 NjJDHjWPVFi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P= L$,1TMGDHjWPVh t&dž(@f8u$dž  ^_[]ÐUSWV[VzzA =tl$$G)B fT$L$D$ uf͋t P ,$UjA|$(todž(dž $FDGjRPVftiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PVmf t׋@f8u$dž wSWV[x|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[ÆxT$$wA =tF)G D$ *$Ffu^L$t P?4$jlL$t$,t$,jWQPt$DFjWPQ,etjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[8wt$0l$$D$jPj |$o1 uOƃ1 ,t%9HuHP 1 u@[fffffffffffUSWVYnT$r 1t\z:_K _K _o ݃K 9stǃuƁK ^_[]ÐSV[:nV׳jV蜳d VP,^[fffSP[m u;$ jjPQjR&t<$ t ǃ [ffffU\1}NNNNNNNNNNNNNNNNdINNNNNNNNNNNNNNNNmtps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-11-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/netbsd-11-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/netbsd-11-llvm/i386/20260130105441Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/netbsd-11-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/netbsd-11-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20260130105441Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-11-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/netbsd-11-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20251206%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/netbsd-11-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/netbsd-11-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.0_BETAxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/netbsd-11-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist.B.-F.J.--------------------L.------------L.,N0N4N^N4N8N4NiacuteicirciexcligraveiquestiumllaquoltVVX4_0990999099c1090 1909999999999999999399653939999199U599989l599t4999999993954333141919665829|8 2t499t492l;l;l;l;l;l;l;l;;;l;l;l;l;l;l;;;l;l;l;l;;;l;l;0123456789abcdef0123456789ABCDEF>>!??v?BBBBRCbEnEzEEE@ÿ?zIzIIIII\ZZh[{[M^M^^^^^QDD !#&(*-/14}7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGcciccccdd)d6dHdZdld~dddddddee2eGe\enehceeeeee ff4fFf[fffffgg-grcrciBgPgagrggggg|chcgbbiibib%h;h|ccc4ciiiiiiiiiiiiEhOh4cVhbb4c4cb`hiiiiiiiiiiiiiiiiiiiiiiiiijhhCiiiiiWiiiiiiiiaiiiiiiiiiiiiiiiiCiiiiiWiiiiiiiiaCc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( AAAAAABBBBBB BBBBB@(((((((((((((((          (((((((((((((((((6;@EJ " \-BKqh|?ObqCzzooooooooZoooooooooooooooooooooZ/&111332-2<233O20l2{2202    ]:[=          d>8884CQB[BBeBoBBByBASCC          ;<;53210/-,+*)('&%$#"!  ::::::::::::::::::::::::DEAE216+-.99+&%/ /E!()*!!# E:::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::S'SsS'S'SOS7S'SESQQQQQ`iv`"%%%%%%%%% % % % % %% %%%%U$"%,%3%%8%A%G%bM%L% |#S%](&\% # `% d% t%h% <% xl%  Z$ p%M$ %% ,%,% h%ht% x%|% %% %% X%XH& X% Xf% % % % % %% %% %% % LY% .% % %# %  & \%  %  % % %  %  %  % M$ % %%% %  %%% % 0% 0#%09$ 0(%a#1% 6% =% B%H%NR%`'9%q#<q#v&5# X& W%`%`j%!4#p% u%&& G1$ \H% % 5# % 5# % 5# % 5# x" 5# "% 5# (% 5#  .%  5#  %  5#  z%  5#  %  %B# <z# x$ 'r# e7# ,$ h-" o& I$  % X$ Ւ" t& $ pz& L3$ 32# H# m~# \M&  3# " qL$ l4& 03# 3$"%'#% %%0r%zi%hs%%%q""k$%k$i%Xq"'%M"!%$PD$l$i%l$ l$k"&%"E$/%VD$$r#j7%E%#Dm#S%Z%+%l#C%Z%H%d#L%d#R%Z%#X%8%(tm#c(9=%(C%Q(I%(P%"(U&&&&&&t&a&I&&&&&&&q&>&&&&&&&r&[&H&4&&&&&&&&&o&Κ%Q%I%@%PP P    &&$r#&m$'&2&F&S&$r#؍(В(X(D((gnts0 p[#@&@&rbmnP`0#"Z%4#E$@ &#@[#tcid@ `yekdP &##p%X&@&@&0 atadE$loob((((yara "%#p% &,"&8"&R"&]"&x"&"&"&"&"&""&"&"&#&#&)#& B#&M#& a#&k#& #&#& #&vJ& #&#&#&#&$&$&1$&<$&^$&i$&$r#$&O&""!"")"."4":"@"G"M"N"R"cJ%v#Q"k"PD$X"D#^"R#3$"""""""""O&""'""/""4"="H"cJ%M"Q"M"PD$U"Y"a"e"k"o"z""""%5&5&5&h(5&5&#5&'5&h( 9&%ʘ%"$%9&9&9&9& 9&$9&)9&-9&29&69&%ژ%;9&3#?9&D9&I9&N9&S9&y"X9&]9&b9&i9&n9&"% %t9&x9&|9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&9&:& 9& :&:&:&:&3:&B:&M:&V:&o:&v:&:&:&:&:&5#:&:&:&:&:&;&;&-;&:;&R;&k;&;&;&;&;&;&;&<&<&&<&9<&L<&_<&r<&<&<&<&<&<&<&<&=&"=&6=&J=&^=&r=&=&=&=&=&=&=&=&>&&>&:>&N>&(__{|@||||}} }P}}@||||}} }~P%N&>N&cN&~N&N&N&N&N&.O&UO&oO&O&O&O&O& %" %" %"$@|%PO&$@|%((((&9#S&"S&S&_$j]&S&T&T&Z&T&(T&T&/T&3T&IT&LT&[T&_T&{T&T&6#T&T&T&T&T&T&T&"$T&T&U&B#% D#%%U&%/U&KU&QU&`U&dU&}$wU&U&U& U&U& &f% U&U& qW&U& U&U&Z%U&V& V&V&$%V&/V&5V&GV&KV&WV&\V&E"%iV&nV&{V&U&Z&Z&W&X&V&V&V&V&V&%=%$#V&V&V&V& W&W&!9W&=W&"NW&SW&#oW&uW&$q%{W&%W&T&&B#W&'W&W&)W&#*W&W&+c$W&,W&W&-W&X&. X&X&/X&X&0 X&'X&1/X&5X&2[X&aX&3gX&rX&7X&X&cX&X&X&"X&X&X&X&X&Y&X&Y&Y&"Y&DY&JY&#oW&bY&$q%wY&%W&T&&Y&Y&'W&%(Y&Y&)W&Y&S&Y&Y&Y&Y&Y&Y&^&Z& Z&Z&"Z&6Z&&=Z&)&EZ&NZ&aZ&iZ&vZ&~Z& Z&Z& Z&Z& $r#$r#Z&Z&Z&Z&Z&Z&_&_&_&_&$`!@|%O&$@|%$p!@|%O&`$i&i&$$O&O&(((Q%$r#$r#$r#$r#$r#$r#$r#$r#$r#ey&`}3$r#$r#$r#$r#$r#$r#$r#Q%$r#$r#wy&{y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&z& z&z&y&z&z&#z&*z&4z&&X&p&&&&&&&?&`&y&&&ǀ&& &&1&S&f&s&&&&&΁&&&&*&>&T&n&&&&т&&&&<&R&`&s&&&&&Ճ&&&&!&5&`&(2Ĺ<T<n3<<0."@ D=p-")"~3 w3=@=z3`<{3x<2L<p<v3<o3`b" 'p3|< p !%"̌=!!0$"z3["= tp3=(Ȉ=== nd=p<x<=P!5،(t<#d}32n3D<h<0 <<o3X<!(<Xp3l< <P>={3p<H=}<=p ƹ<v30A!|<z3p}3l<t<\<\|3 @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ(2b ( ( ) ) @2 _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|2z  * . ` d f o 04?4sz p2""(2(2(2(2@2@2@2@2X2X2X2X2 e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [< is a directory is not a regular file (use -f to see it)223R#$@R#JR#ZR#m#fR#rR#"~R#>&$R#R#$R#;R# Kb#7R# R# R# R##R#2R#8S# S#S# +S#(n#=S#IS#!US#^S#9pS#zS#A[#S#&%fS#)S#S#5S#eS#:S#.W#%S#S#6o#S#4R#S# S#+T#,T#-%T#.8T#*ET#NT#?%^T#E#eT#/qT#/T#'T#F[&T# T#o#T# $$ [|#T#T# D&%fT#"s"T#T#T#ۖ% T# T# T#T# (WmkRkRkYcWbkCkc kG ky wb YMYrWca2P]4]# ^#(^#b2@]47 P^#p^#B2]4^#^#c2T]4^# _# _#d2l]41_#L_#2A`]4b_#~_#D2(J _#e2d]4_#_#_#f2]4_#`#F2h]4"`#L`#g 24^4p`#`#`#h(2x]4`#a#i02]4P (a#Ha#`a#j82/ a#a#J@2!]4a#a#kH2H P2H KX2]4a#a#L`2]4b#:b#mh2X]4Rb#_b#mb#np2"]4yb#b#b#ox24 b#O2  b#p2H5 P2 #q2H]4b#b#+c#r2"]4?c#`c#c#s2!p]4c#c#S2!]4 d#d#t2  +d#T2 1d#u2\]4=d#gd#d#V2\ w2"]4d#d#d#x2( #e#/e#X2A]4;e#`e#y2|]4~e#e#z2]4e#e#"2 e#~2!]4e#f#?2 #2h 5f#Hf# 2A]4Tf#df#(2]4zf#f#02]4f#f#82]4f#.g#@2() fg#H2]4zg#g#P2]4 g#g#g#X2]4 h#5h#`2]4Vh#wh#h2$]49 h#h#p2$]4s h#h#x2]4h#i#2!]4-i#=i#2!]4 Gi#ci#2!^4yi#i#2(6 i#2! ^4i#i#2^4j#3j#2^4Xj#zj#2 j#2^4j#j#2L]4j#k#2 ^4"k#Hk#2 lk#2!]4k#k#2$^4k#k#2(^4 l#;t#o tTt#l pot#t |t#n $t#u Ct#w +t#w ct# { .t#{ t#{ t#~ u#~ s,u#{ ?9u# #Ju#} A[#o4:#E|#F"PUu#c#a"l&s[u#hfu#o4 !"$'(+-.03569:#{#d${#$p4{#${#<|#a |#lt4|#a|#pt4|#adt4:#"~!|#a,C$t4TR#2",|#d |#t4[[%aU#t46|#a,q4rb#y& =|#S&C|#q%G%aM|#t4 "at4Q|#%X|#p#"b|##Q3K#g|#y&q|#a7z#|t4||#%|#d|#t4|#d|#t4|#da0#t4|#%[u#|#|#8#"a$#t4|# #4#б   9#б    "#8#sJ#W#Ar##B##͋#ߋ#C##&#5#mF#R#Dj#E##d#Ԍ#r##g#F4#O#%`#M}#-#R#΍#a# # # *# ;#*O#A####H3z4P.P 3~ +#( P 5 < P Ͽ , R \ Z  )#(  t <  c , R \ Z S  /#8# D#n$Y#]#g#br#jz#jQ$c@"f#h#k#l#m#oɱ#oձ#p#ps#p#qj&&r{%uvJ%t"vBz#w#w~"x%xJ%zr"z#B#Cn$J##O-#P<#SC#T)(%Vhe%VN#X]#Z[#Zf#m#|#D#8# /## # %r"]#/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8PATH=/usr/bin:/bin:/usr/sbin:/sbinp;6@6@6#a##EV#eS2#F#IBz#i#Ls2#l#m#Ck%n#f##p#b #u#x"#'#q$s4#@#h"v#VVI#xB6@=dL3`3 #I$ ... ...u$z$\*$*$+$+-$-$$r#6$6$s:$$r#B#5=$=$=$?$@$$E@$B$B$$C$/C$$B#0F$F$H$0`'I$3I$P'30`'I$ Q'3'J$wasebfpf`' J$3 J$`'&%3&%b%ilmm0`'tM$3qM$S'3(`'.O$3x3`'wU$3 U$`'xU$3 U$`'xǝ$3 ǝ$`'U$3 U$`'OyXU$3tU$`'yN$3L$`'z]Q$3]Q$`'zN$#`'{N$#`'c~N$#0`'EO$$3'&~6`3`'~N$3%XU$%`',N$3tU$%tU$`'yN$3L$tU$L$`'S$3S$0`'ځǕ$^O$Y'3(`'O$033330`'O$3'&~6x3T330`'&3'&~63(`'O$33330`'3M$3WO$4X'30`'`R$3QO$|T'D30`'gO$dZ'p33 3 3L3h333$33$3<3(`'AO$33 `';O$3k$<33T3(`'lO$83D3(`'vO$`33 `'O$$3k$ `'<$k$33333AabCdhlNsuvW:w:z0`'X$ ^'03`'Z$3 Z$`'%3%`'לY$3Y$`'Y$3X$`'Z$3Z$`'Lh[$3h[$`'o[$3o[$0`'|[$8`'@3`'X]$3 ]$ `'%]$3%]$0`'3]$`'30`']$a'30`']$3De' 3`'ܻ]$3 ]$`'= %3* %`'c$3* c$`' %3 %`'qb$3 b$`']$3]$`']$3]$0`'^$3vJ%d'<3Khh$|oh$|th$zh$h$hO$|h$|ڧ"q%-h$#|h$h$|h$|h$h$|  '""X#^"mk%j$wZ%#k%"]h& "" ""i%@{%"@"@@......... lost+found ...dA%&_$ݕ$H$Ǖ$&T#~$4% " %% $ % [[%e$$$O%$b%'J$|&ҫ%n$##U$$XU$w$ǝ$ $!$"$#%$$%$&](&'$(@@$)$*y$+$,$-$/ŕ$1ϕ$1ە$2$3$4]$5$6%P'=&P'Y $P'3Fj&&P'%P':c#P'18$P'$P'Em#P'HS&P'O6$P'!Nq"P'Co#P'E%P'p#P'H&P'z5T#P'7Y%P':q|#P'E7/%P'2$P'K$P'TK%$P'K%P'E+$P'W4$P'G0̺%P'BU%P'p$P'4%P'[-*1&P':5DT&P'\2A[#P'z9$P'D4w$P'>$P' 7b#P'FT&P'NSB$P'@ B$P':G$P'ON$P'8$P';V$P'-q"P'bAX$P';$P':[$P'W_f#P'`$P'&Rq"P'FTh$P'$B$P'-m$P'$s$P'S1$P':y$P']I~$P'HVs"P'p&P'FT$P'eJ$P':$P':$P':s#P'Z5"P'3rb#P'3$P'F &P'C$P'@o#P'E$P'B;%P' NJ%P'SU%P'[-C$P'*$P'|XU&P'g99&P';&P'N$P'3E$P' B$P'R$P'EL$P'°$P'3F&%P'V˰$P'CM/$P'Qc$P'SU#P'%1(?#P'sа$P'%L%P'cO?$P'ذ$P' NJ#P'<2^&P'c#P'{D #P'WV$P'z'%P' ?"P'p3j$P'SU"P'z$$$$ $<$rb#$$@!$99%Ύi%zk%k%k%&k%<k%Rkk%hǏϏ%&'%(4)CRapʐ u%6Lbxʑؑ-IȒ 5'>ǔ0GUcq zi%0r%ŕ*Hljk͖ -Quŗ(F$6l$]$$!ҘX%$!$*$ 9$[$&4kۙ&՚T=aԛBf{SX%$!$ǜ<՜=>?x y+l:mJnopӝqrs!I[tmnop[queП)7E$S$a$o$}$$$$$à$Ѡ$ߠ$#?-% Z-$-$%0r%3$AyO{]zk|yu+9tɢ%uǣu 0H`x+$$$Ǥ!$֤'$.$^K23(33 33% 33$r#843 $r#X43$$r# x43<(43G}43 43 53$r#F 53χ$r#F63ƈ 73 873h73$r#F73;F$r#F73$r#F883$$r#F83  83# H93$ x93$r#F 93L$r#F H:3Nԋ$ :3; ;3H;3Ì$r#2$x;3$Ȍ$r#2$;3$$r#2$<3$$r# <3$r# <3$r# =3$r# (=3$r# =3x=3w(>3u$r#Fh>3͌$r#F>3$r#F?3ǍՍ H?3 (?3u$r#@3$r# 8@3W$x$$""4[%$B$#Κ%$$$$$%$$${$$$$$$6$$F$V$"4"h$8"X&}$$$$$$'$n$$$5$}"$$$$$ $/$L$f$$$7$$$$$"s"C$d$GB$H.&$$$r"Z%f${{"t${$$$$$)$:$$$$$$=$$$\$$$$H$q$$!$m$$"$$6$$T%h%%%%T%%k$r%%9%e%z%%%%%%% %-%Y%e%w%,%%%!%M%%%%%$%%%% %p % %F % % % %k % %%%%%)%Q%|%D%%%d%i%%%%%%%%(%<%J%Y%h%v%%%%%%%%%%%"%.%:%H%_%v%%%%%w%%%%b%%%%%<%%P%%N%%%% %%%)%1%:%I%a%%%%%%%%'%$9%T%`%m%%%%%%%%%&%B%]%%%K$%6$%%%%%%%%%%0%B%[%p%%>$%%%%%%%%% %%%%'%?%I%V%_%n%%k$%%%%%%%% % % %/ % % "%;#%#%$%%%%%%%%% &%&%%H$=&%h"#J&%O&%Y&%e&%n&%&%&%&%&%'%<'%['%'%'%'%'%'%(%1(%(%)%)%(%)%*%<*%X*%)#*%*%#+%3+%$P+%W+%mk%[+%+%+%+%+%,%x,%,%",%;-%?-%I-%a-%-%-.%.%.%.%.%#.%/%/%'/%4/%z$0%0%0%0%0%0%1%""1%31%>1%CE$_1%g1%w%k1%|1%1%1%P2%z2% 5%'5%C5%W5%GB$5$5%5%5%5%5%5%A6%6%6%H#^$m#77%%A7%M7%-$h7%+$n7%.%w7%3`$7%7%7%7%7%8%18%A8%W8%b8%8%8%8%2#2#,9%$r#:9%^9%:%b:%:%:%:%:%:%:%:%;%;%0;%R;%;%<%;%<%<%3<%a<%<%<%S>%a>%T?%J@%qA%B%B%B%B%C%C%C%(C%C%C%D%2E%E%E%7%"e% F%#F%S&LF%gF%F%F%F%9G%hG%G%`H%Z-$yH%H%H%H%H% I%BI%hI%I%I%J% J%=J%SJ%hJ%{J%J%J%@Z&J%J%J%J%J%J% K%K%8K%~"[L%iL%uL%{L%L%L%"'"L%L%L%L%L%L%L%M%M%"M%3M%BM%TM%[M%eM%5$vM%M%M%M%M%%M%M%M%M%N%N%'N%9N%EN%PN%YN%fN%uN%N%N%N%N%N%N%N%N%N%N%O%"O%N%5$vM%1O%S%[S%cS%S%T%qU%U%U%U%U%V%8V%BV%SV%iV%V%BW%ZW%W%W%sX%X%vD$/h% &u/n%Q%;& i%n%n%n%WT&n%gO$n%n%$0n%n%n% n%n%10n%&m#'n%(o%) o%*&+o%.1/q%@i%P$q%X%q%r% r%@f$ Td$r%%r%4r%@r% $ftp h%\6>|#?7@JQhAz%Bz%Cz%D f$E z%F k"G D$H '%Iq$r#v $r#$r#1eu%%%%%˂%ق%%%%%%,%];\]\ %e%dA.O Q%$r#$r#$r#$r#$r#$r#$r#$r#$r#C  -dd-ddTdd:dd:dd%mk%%%%%%%% % %@%@ͭ%`%%%%mk%g%##%#%#%#%#%$%$%$%$%$%%"%%*%%%%6%%<%&D%&N%&T%'_%'i%'o%(z%(%(%)%)%)%*%*%*%+%+%+%,%,%,%,%-%-%-%-%.%.)%.0%/<%/G%/N%6Z%;h%;t%0%0%0%1%1%<%<%=%=%>%>%?5%2%2%2%3%3%3%9%7%8.%:B%4L%4W%4^%5j%5u% |%! 8%" %# %$ %% %& %' %( %) %* %. %+ %,  %- %/ %0 ,%1 7%2 B%3 O%4 Z%5 e%6 o%7 {%8 %9 %: %; %< %= %> %? % @%!@%"@%#@%$@ %%@%&@!%'@+%)@6%*@A%+@M%&`X%'`e%,@r%-@%.@%/@%0@%(`%1@%2@%3@%)`%4@%5@%6@ %7@%8@'%9@4%:@A%*`N%;@[%<@h%=@u%>@%?@% `%!`%+`%,`%"`%#`%-`%$`%.`%/`%%` %C.%C8%D=%DH%EN%EX%F]%Fh%cn%cz%d~%d%e%e%#%#%&%&%0%%%%%%%%%%%%%%%#%*%1%<%G%R%_%l%k%o%{% % |#@%@|#%%%ˊ$%# X$ % %@%@1$@%@%@%@%`%`% %%#%% "%@&%@ O&33333333$r#$r# & !&!&1!&F!&33334&UTC3333l2l2N0N%IH\M9H NH33=33q3q3|q3 q39㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sžt2 33UU33UU33UUu3!P!P! !q3(v3!P!P! !s3 v3!P!P! !pt3d8=v3u3 j]&i]&p]&x]&]&(T&<&<&<&E"<&<&<& =&]&]&x   @   33333333333333333333333333333333333333 z333 (( 0000000000000000 X=3333 3333!33{3{3{333 (root)`2C((((((('82d2p2 242((((}3!!!Д!!@!!!!!!!!!@!`!!!!Й!!!p!!@!!!Service unavailablea%c%4ܦIx-@)-U 0  p[^Ml&"b8bQgh_߬2UDQnio7hʺzE6?Ѵ,L.snlntgd]yX)Ι{_ʨ$cRWILJQ(/LIMQ2$g$1d0&1%213ge3RK2'.shstrtab.note.netbsd.ident.note.netbsd.pax.init.text.fini.rodata.tbss.init_array.ctors.dtors.jcr.data.rel.ro.got.got.plt.data.bss.SUNW_ctf TTll/ 5A;`b"` Ap"zI2m$O2m$ [2n$b2n$i2n$n2n${2$42$ 2$  ~3 >%  >%#C?%MSGTXTS656 5264 5289 5306 5328 5331 5336 5344 5351 5359 5367 5370 5373 5376 5380 5392 5401 5414 5443 5458 6003 6037 6720 7008 7716 7772 7846 7942 8117 8140 8163 8169 8178 8200 8204 8208 8211 8214 8319 8522 8761 9202 9640 9675 9690 9702 9708 9720 9769 9789 9829 9846 9863 9878 9925 9963 10011 10093 10217 10353 10394 10432 10469 10504 10514 10563 10713 10719 10724 10728 10748 10858 10878 10884 10898 10910 10921 10958 10992 11016 11118 11155 11177 11276 11331 11389 11400 11416 11468 11636 11843 12014 12078 12130 12403 12954 13484 13917 14255 14588 14701 14716 14725 14885 15056 15206 15370 15393 15417 15432 15507 15647 15824 15979 15991 16071 16172 16218 16244 16314 16325 16334 16347 16373 16388 16404 16417 16472 16483 16498 16702 16935 16964 16979 17048 17122 17195 17225 17263 17317 17736 17762 17791 17895 18001 18186 18298 18413 18517 19204 19463 19603 19639 19809 19850 19986 20009 20046 20091 20342 20438 20492 20591 20602 20639 20676 20703 20712 20746 20753 20778 20805 20840 20854 20868 20897 20911 20928 20937 20959 20977 20994 21005 21024 21050 21068 21091 21108 21123 21138 21156 21183 21210 21232 21271 21289 21321 21549 21623 21666 21712 21859 22015 22059 22338 22365 22724 22908 23060 23241 23388 23546 23567 23615 23625 23633 23644 23655 23665 23672 23687 23699 23738 23768 23807 23860 23918 23939 23946 23965 23986 23993 24017 24039 24059 24081 24112 24149 24171 24185 24231 24260 24294 24334 24369 24397 24445 24454 24463 24468 24477 24486 24503 24507 24512 24518 24522 24560 24569 24596 24616 24639 24658 24685 24707 24739 24755 24760 24770 24793 24815 24832 24849 24862 24871 24880 24886 24913 24920 24944 24965 24989 25002 25021 25046 25069 25085 25091 25103 25133 25141 25181 25192 25203 25214 25231 25248 25262 25279 25495 25799 26247 26463 26727 26999 27051 27087 27123 27174 27191 27229 27243 27250 27267 27270 27275 27284 27296 27307 27316 27337 27379 27417 27433 27464 27489 27524 27580 27620 27641 27661 27702 27731 27779 28012 28047 28254 28273 28310 28371 28409 28448 28604 28619 28665 28713 28736 28772 28782 28792 28803 28808 28871 28919 28963 29024 29057 29158 29176 29315 29337 29460 29474 29484 29507 29612 29668 29784 29815 29820 29846 29885 29895 29938 29948 29964 29979 29997 30020 30050 30071 30097 30294 30337 30341 30347 30353 30358 30369 30383 30412 30444 30456 30503 30553 30593 30620 30636 30645 30688 30694 30702 30706 30726 30743 30755 30786 31042 31091 31667 31694 31726 31754 31806 31812 31818 31823 31844 31860 31882 31911 32052 32186 32199 32335 32337 32339 32341 32358 32371 32389 32416 32420 32426 32431 32439 32445 32485 32487 32497 32512 32529 32563 32595 32633 32662 32691 32713 32756 32782 32826 32962 32964 32966 32981 32984 33033 33307 33320 33358 33370 33393 33406 33431 33456 33481 33506 33541 33572 33611 33666 33773 33802 33833 33863 33900 33956 34071 34107 34531 34554 34824 35130 35440 35656 35767 35866 35883 35906 35910 35917 35926 36048 36117 36405 36543 36684 36765 36812 36818 36827 36840 36863 36909 36912 36957 37000 37065 37127 37197 37265 37358 37577 37602 37606 37642 37660 37688 37730 37774 37838 37888 37964 37986 38038 38082 38121 38155 38185 38216 38241 38250 38262 38270 38281 38293 38312 38336 38385 38402 38426 38469 38791 38794 38808 38821 38833 38840 38851 38858 38865 38874 38884 38901 38917 38967 38975 38983 38993 39004 39022 39039 39060 39082 39091 39101 39128 39134 39144 39163 39179 39197 39217 39226 39237 39244 39261 39280 39301 39311 39328 39334 39350 39365 39380 39401 39423 39442 39452 39457 39462 39480 39499 39518 39524 39543 39563 39583 39601 39606 39612 39629 39645 39666 39679 39687 39707 39731 39748 39756 39767 39788 39794 39806 39828 39842 39851 39872 39890 39899 39933 39956 39983 40015 40038 40058 40069 40101 40117 40128 40141 40164 40186 40694 40724 40755 40783 40797 40998 41220 41387 41474 41491 41509 41526 41555 41602 41613 41632 41654 41733 41925 41953 42071 42093 42234 42253 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_BETA. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_BETA ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_BETA ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_BETA InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_BETA ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? TastaturschemadeInstalliere die Tabelle der defekten Blcke ... Mchten Sie normale oder serielle Bootblcke installieren? Normale Bootblcke benutzen die BIOS Konsolenschnittstelle als Konsole (meistens der Monitor und die Tastatur). Serielle Bootblcke benutzen den gewhlten seriellen Anschluss als Konsole. Selektierter Bootblock: BIOS KonsoleSerielle Konsole an com%d mit %d baudUnverndertAuswahl der BootblckeBIOS KonsoleSerielle Konsole an com0Serielle Konsole an com1Serielle Konsole an com2Serielle Konsole an com3Serielle Geschwindigkeit whlen...Vorhandene Bootblcke benutzenInstalliere die Bootblcke auf %s ... Diese Festplatte entspricht der folgenden BIOS Disk: BIOS # Zylinder Kpfe Sektoren Anzahl Sektoren GB ------ -------- ----- -------- --------------- ---- %#6x %8d %5d %8d %13u %3u Das ist die korrekte Geometriedie Geometrie von Hand setzenBenutzen Sie eine dieser FestplattenDiese Festplatte entspricht den folgenden BIOS Disks: BIOS # Zylinder Kpfe Sektoren Anzahl Sektoren GB ------ -------- ----- -------- ---------------- ---- %-1d: %#6x %8d %5d %8d %13u %3u Achtung: sysinst hat festgestellt, dass die von Ihnen ausgewhlte Festplatte einer anderen - dem BIOS bekannten - entspricht; damit sind obige Werte mit hchster Wahrscheinlichkeit korrekt, sollten also nicht verndert werden (die Werte fr Zylinder, Kpfe und Sektoren sind wahrscheinlich 1023, 255 und 63 - dies ist korrekt). Sie sollten nur die Geometrie abndern falls Sie wissen, dass das BIOS falsche Werte liefert. Festplatte auswhlen: Der NetBSD Teil der Festplatte liegt auerhalb der vom BIOS dieser Maschine adressierbaren Bereich. Eventuell knnen Sie von dieser Partition nicht booten. Sind Sie sicher, dass Sie fortfahren mchten? (Antworten Sie mit 'nein' um die Partitionen erneut zu editieren.)Sie haben mehr als ein Betriebssystem auf dieser Festplatte; allerdings ist kein 'bootmenu' (Eintrag fr den NetBSD Bootloader) fr die aktive Partition und/oder der Partition vorhanden, auf die NetBSD installiert werden soll. Wollen Sie die Partition zum Hinzufgen eines 'bootmenu' Eintrages editieren?Sie haben eine erweiterte Partition in das 'bootmenu' eingetragen. Doch scheint Ihr BIOS System den 'read' (Lese-) Befehl fr diese Version des 'bootmenu' Codes nicht zu untersttzen. Sind Sie sicher, dass Sie dennoch fortfahren mchten? (Antworten Sie 'nein' um zum Partitionierungsmen zurck zu gelangen.)Ihre Konfiguration bentigt den NetBSD Bootselect (Bootauswahl) Code, um das zu startende Betriebssystem beim Start des Computers zu whlen. Dieser ist gegenwrtig noch nicht installiert; wollen Sie dies jetzt tun?Der Bootcode im Master Boot Record scheint nicht gltig zu sein. Wollen Sie den NetBSD Bootcode installieren?Wollen Sie den Bootcode im Master Boot Record auf die letzte Version des NetBSD Bootcodes updaten?Kernel (GENERIC)Kernel (GENERIC_KASLR)TypOrdnerBootmenSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivBootmenStandardbootPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition, (S)tandardauswahl$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.ll crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. cat chgrp chio chmod cp dd df ed ln ls mkdir mt mv pax pwd rcmd rm sh stty sync . ..MAKEDEVMSGTXTS656 5264 5302 5319 5334 5337 5340 5345 5353 5361 5369 5372 5375 5384 5396 5408 5417 5426 5452 5463 6000 6027 6593 6893 7534 7581 7694 7787 7821 7840 7858 7866 7875 7900 7904 7908 7911 7914 8036 8221 8449 8969 9320 9349 9362 9375 9380 9400 9419 9440 9499 9516 9530 9552 9597 9623 9664 9742 9860 9974 10028 10057 10089 10128 10134 10167 10290 10297 10301 10309 10333 10415 10421 10428 10440 10454 10463 10496 10515 10527 10637 10699 10718 10837 10888 10940 10952 10971 11023 11227 11435 11626 11686 11735 12003 12463 13130 13554 13876 14301 14433 14465 14477 14655 14852 15013 15147 15167 15200 15214 15283 15396 15568 15703 15723 15835 15927 15950 15973 16032 16047 16068 16083 16104 16124 16149 16163 16187 16199 16217 16427 16677 16698 16714 16767 16835 16908 16945 16971 17047 17504 17530 17552 17659 17766 17967 18040 18124 18224 18719 18957 19108 19142 19277 19321 19460 19501 19546 19593 19837 19970 20032 20126 20131 20165 20199 20214 20242 20275 20282 20307 20325 20351 20358 20373 20388 20408 20448 20465 20485 20506 20528 20543 20563 20585 20600 20613 20627 20639 20651 20665 20688 20711 20729 20772 20823 20860 21045 21108 21144 21193 21284 21414 21467 21727 21774 22135 22285 22454 22594 22714 22846 22886 22933 22943 22951 22961 22969 22980 22991 23005 23030 23073 23106 23139 23174 23228 23253 23272 23294 23299 23305 23336 23353 23380 23398 23419 23441 23460 23470 23500 23526 23553 23602 23630 23657 23710 23720 23730 23736 23746 23755 23775 23779 23784 23790 23794 23829 23838 23869 23886 23913 23934 23954 23973 23999 24012 24020 24036 24067 24098 24119 24145 24158 24166 24177 24183 24207 24217 24229 24247 24258 24278 24294 24320 24342 24358 24370 24390 24416 24422 24452 24466 24480 24503 24522 24541 24559 24577 24800 25106 25524 25725 25965 26149 26227 26282 26349 26389 26412 26446 26457 26465 26488 26491 26494 26500 26511 26523 26536 26566 26610 26623 26636 26673 26687 26698 26709 26720 26737 26748 26795 26818 26867 27108 27141 27396 27417 27450 27503 27529 27556 27712 27718 27761 27781 27800 27829 27836 27843 27850 27855 27904 27942 27976 28033 28061 28106 28123 28224 28229 28306 28320 28330 28354 28477 28558 28668 28696 28701 28717 28746 28754 28795 28802 28816 28829 28837 28856 28889 28909 28929 29145 29176 29181 29188 29195 29199 29213 29225 29240 29273 29286 29341 29399 29435 29453 29471 29489 29526 29532 29540 29544 29565 29582 29593 29615 29793 29837 30539 30563 30597 30616 30661 30668 30675 30679 30703 30714 30719 30782 30903 31026 31039 31173 31175 31177 31179 31189 31198 31211 31238 31242 31248 31253 31262 31267 31294 31296 31309 31321 31336 31364 31408 31455 31471 31493 31504 31537 31557 31606 31706 31708 31710 31726 31729 31771 32040 32053 32086 32098 32122 32140 32163 32186 32209 32232 32253 32279 32321 32375 32478 32505 32535 32560 32585 32642 32751 32784 33157 33172 33412 33663 33976 34130 34248 34368 34385 34408 34413 34419 34428 34537 34596 34847 34988 35115 35183 35220 35227 35236 35244 35271 35317 35320 35367 35412 35463 35522 35591 35638 35743 35886 35911 35915 35949 35966 35990 36042 36093 36165 36231 36329 36346 36377 36413 36447 36471 36495 36528 36548 36558 36566 36574 36584 36595 36609 36635 36683 36706 36726 36767 37066 37069 37083 37095 37102 37121 37135 37142 37149 37158 37168 37185 37201 37249 37257 37265 37275 37286 37304 37321 37340 37360 37367 37384 37401 37408 37421 37456 37473 37492 37512 37522 37538 37551 37569 37589 37610 37620 37640 37660 37673 37692 37705 37729 37752 37765 37776 37781 37788 37806 37825 37844 37852 37871 37891 37916 37934 37941 37948 37961 37970 37991 38004 38012 38032 38060 38077 38083 38094 38125 38133 38146 38168 38190 38199 38220 38238 38245 38268 38287 38314 38332 38352 38365 38380 38401 38415 38422 38436 38451 38470 39015 39048 39076 39105 39113 39150 39462 39639 39716 39733 39751 39766 39788 39838 39848 39865 39887 39946 40104 40128 40258 40283 40409 40427 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_BETA. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_BETA ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_BETA ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_BETA completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_BETA. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_BETASalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_BETAEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Tipo de tecladoesInstalando la tabla de bloques malos ... Le gustaria instalar el set normal de bootblocks o bootblocks por serie? Bootblocks normal usa el dispositivo de consola de BIOS como consola (normalmente el monitor y teclado). Bootblocks por serie usa el primer puerto serie como consola. Bootblock seleccionado: Consola BIOSPuerto serie en com%D en %d baudSin cambiosSeleccion de bootblocksUsar consola BIOSUsar puerto serie com0Usar puerto serie com1Usar puerto serie com2Usar puerto serie com3Baudios puerto serieUsar bootblocks existenteInstalando bloques de arranque en %s.... Este disco coincide con el siguiente disco de BIOS: BIOS # cilindros cabez sectors sect. totales GB ------ --------- ----- ------- ------------- ---- %#6x %9d %5d %7d %13u %3u Esta es la geometra correctaAjustar geometra a manoUsar uno de estos discosEste disco coincide con los siguientes discos de BIOS: BIOS # cilindros cabez sectors sect totales GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Nota: como sysinst es capaz de concordar unicamente el disco que escoja con un disco conocido por BIOS, los valores anteriores son probablemente correctos, y no deberan ser cambiados (los valores para cilindros, cabezales y sectores son probablemente 1023, 255 y 63 - esto es correcto). Solo debera cambiar la geometra si sabe que su BIOS reporta valores incorrectos. Escoja disco: La parte NetBSD del disco est fuera del rango que la BIOS de su maquina puede acceder. Puede que no sea posible iniciar desde ahi. Est seguro de que quiere hacer eso? (Seleccionando 'no' le devolver al men de edicion de particiones.)Tiene mas de un sistema operativo en el disco, pero no ha especificado un 'menu de arranque' para la particin activa o la particin de NetBSD en la que lo va a instalar. Quiere re-editar la particin para aadir una entrada en el menu de arranque?Ha pedido que una particin extendida sea incluida en el men de arranque. Sin embargo la BIOS de su sistema no parece soportar el comando de lectura usado por esa versin del cdigo del menu de arranque. Est seguro de que quiere hacer eso? (Seleccionando 'no' le devolver al men de edicin de particiones.)Su configuracin requiere el cdigo de bootselect de NetBSD para seleccionar que sistema usar. Actualmente no est instalado, lo quiere instalar ahora?El cdigo de arranque del Master Boot Record no parece ser vlido. Quiere instalar el cdigo de arranque de NetBSD?Quiere actualizar el cdigo de arranque en el Master Boot Record a la ultima versin del cdigo de arranque de NetBSD?Ncleo (GENERIC)Kernel (GENERIC_KASLR)TipoMountBootmenuNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activabootmenupredef.Tipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctiva, bootselect (p)redefinidoConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS656 5264 5300 5317 5332 5336 5340 5345 5356 5362 5368 5371 5374 5377 5381 5393 5405 5415 5445 5457 5888 5915 6491 6851 7536 7597 7675 7770 7810 7832 7850 7856 7865 7891 7895 7899 7902 7905 8027 8212 8440 8969 9387 9416 9429 9442 9449 9469 9488 9511 9554 9574 9593 9616 9660 9689 9730 9796 9908 10022 10076 10105 10137 10176 10182 10215 10293 10299 10303 10308 10349 10486 10496 10504 10523 10537 10546 10578 10619 10632 10757 10815 10834 10953 11009 11061 11072 11088 11127 11377 11549 11721 11776 11811 12062 12467 12767 13036 13397 13577 13896 13916 13929 14118 14262 14458 14592 14612 14645 14664 14765 14920 15108 15295 15315 15394 15492 15530 15553 15643 15664 15687 15706 15730 15760 15804 15837 15860 15872 15890 16158 16477 16508 16543 16607 16682 16752 16783 16813 16905 17396 17426 17443 17583 17724 17921 18040 18187 18354 18912 19208 19389 19434 19597 19651 19786 19822 19882 19932 20223 20332 20389 20486 20491 20526 20561 20576 20600 20633 20638 20663 20679 20702 20709 20726 20741 20760 20792 20796 20816 20834 20846 20859 20877 20901 20919 20938 20965 20992 21004 21025 21055 21085 21110 21143 21178 21216 21469 21538 21593 21654 21772 21931 21985 22246 22297 22673 22828 22972 23112 23220 23405 23435 23478 23488 23496 23506 23518 23539 23548 23554 23586 23628 23664 23702 23739 23787 23811 23823 23837 23845 23853 23882 23899 23928 23949 23972 23981 24000 24012 24056 24094 24121 24165 24193 24220 24273 24284 24295 24302 24312 24321 24355 24359 24364 24370 24374 24409 24419 24449 24472 24501 24523 24545 24567 24594 24606 24618 24637 24671 24704 24725 24749 24762 24774 24787 24793 24819 24829 24840 24864 24874 24894 24914 24931 24957 24981 24994 25014 25048 25055 25084 25107 25130 25146 25161 25176 25191 25205 25393 25698 26129 26320 26555 26743 26785 26835 26889 26937 26959 27000 27011 27019 27043 27047 27051 27060 27071 27082 27097 27128 27174 27187 27200 27230 27244 27256 27268 27280 27298 27321 27366 27389 27449 27701 27728 27990 28008 28035 28084 28114 28145 28277 28284 28333 28356 28380 28409 28417 28427 28435 28440 28493 28542 28582 28648 28681 28725 28748 28849 28854 28931 28945 28955 28979 29102 29183 29293 29321 29326 29342 29371 29379 29420 29428 29442 29455 29463 29482 29515 29535 29555 29771 29802 29822 29828 29835 29839 29854 29873 29899 29908 29920 29974 30032 30067 30086 30103 30115 30150 30156 30164 30168 30189 30206 30217 30242 30420 30474 31165 31184 31219 31249 31295 31301 31308 31312 31336 31352 31358 31433 31583 31702 31715 31783 31785 31787 31789 31799 31812 31829 31856 31860 31866 31871 31880 31885 31912 31914 31927 31939 31954 31982 32026 32073 32089 32111 32122 32155 32175 32224 32324 32326 32328 32344 32347 32398 32720 32736 32767 32787 32823 32840 32856 32872 32888 32904 32926 32971 33019 33070 33189 33216 33241 33261 33290 33344 33469 33502 33728 33752 34034 34317 34591 34778 34902 35027 35044 35067 35072 35078 35083 35186 35238 35484 35645 35800 35871 35924 35931 35949 35956 35983 36033 36036 36079 36125 36180 36239 36308 36355 36460 36603 36628 36632 36666 36683 36721 36774 36814 36890 36955 37049 37070 37108 37148 37184 37208 37231 37270 37300 37307 37316 37324 37332 37346 37362 37390 37442 37459 37480 37524 37866 37870 37885 37896 37904 37923 37935 37942 37949 37958 37968 37985 38001 38055 38063 38071 38081 38092 38110 38127 38143 38161 38168 38186 38203 38210 38220 38251 38270 38289 38309 38319 38338 38351 38371 38391 38412 38422 38441 38460 38470 38487 38501 38524 38548 38561 38571 38576 38580 38598 38617 38636 38641 38660 38680 38705 38720 38724 38731 38741 38750 38771 38785 38793 38813 38839 38856 38864 38875 38906 38911 38924 38946 38961 38970 38991 39009 39018 39062 39086 39113 39128 39145 39159 39190 39214 39245 39252 39266 39281 39300 39845 39878 39906 39935 39943 39980 40292 40469 40546 40563 40581 40596 40618 40668 40678 40695 40717 40776 40934 40958 41088 41113 41239 41257 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_BETA. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_BETA est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_BETA est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_BETA Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_BETAExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Type de clavierfrInstallation de la table des blocs dfectueux ... Voulez-vous installer le programme de dmarrage standard ou sur port srie ? Le programme de dmarrage standard utilise les priphriques dfinis par le BIOS (en gnral le moniteur et le clavier). Le programme de dmarrage sur port srie utilise quant lui le premier port srie. Programme de dmarrage slectionn : Console du BIOSPort srie com%d, baud rate %dPas de modificationSlection du programme de dmarrageConsole du BIOS port srie com0port srie com1port srie com2port srie com3Vitesse du port srieConserver le programme de dmarrage existantInstallation programme de dmarrage sur %s ... Ce disque correspond au disque du BIOS suivant : BIOS # cylindres ttes secteurs nb total de secteurs GB ------ --------- ----- -------- -------------------- ---- %#6x %9d %5d %8d %20u %3u C'est la bonne gomtrieEntrer la gomtrieUtiliser l'un de ces disquesCe disque correspond aux disques du BIOS suivants : BIOS # cylindres ttes secteurs nb total de secteurs GB ------ --------- ----- -------- -------------------- ---- %-1d: %#6x %9d %5d %8d %20u %3u Note: puisque sysinst a pu trouver une correspondance unique entre le disque choisi et un disque connu du BIOS, les valeurs ci-dessus sont probablement correctes. Modifiez-les uniquement si elles sont manifestement fausses. Choisissez un disque : La partition de votre disque rserve NetBSD se trouve en-dehors de l'espace que le BIOS de votre machine peut adresser. L'amorage depuis cette partition ne sera peut-tre pas possible. Voulez-vous rellement faire ceci ? ('Non' vous ramnera au menu d'dition des partitions.)Vous avez plus d'un systme d'exploitation sur ce disque, mais vous n'avez pas spcifi d'entre dans le menu de boot pour la partition active ou la partition NetBSD sur laquelle vous allez installer. Voulez-vous rediter la partition pour ajouter une entre dans le menu de boot ?Vous avez ajout une partition tendue au menu de boot, mais il semble que le BIOS de votre systme ne supporte pas la commande de lecture utilise par cette version du menu de boot. Voulez-vous vraiment faire ceci ? ('non' vous ramnera au menu d'dition des partitions.)Votre configuration ncessite le selecteur de boot de NetBSD pour choisir le systme d'exploitation dmarrer. Il n'est pour l'instant pas install, voulez-vous l'installer maintenant ?Le code d'amorage dans le secteur de boot ne semble pas tre valide. Voulez-vous installer le code d'amorage de NetBSD ?Voulez-vous mettre jour le code d'amorage dans le secteur de boot avec la dernire version du code d'amorage de NetBSD ?Kernel (GENERIC)Kernel (GENERIC_KASLR)TypeMountMenuVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activemenu de dmarragedfautType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (Ac)tive partition, bootselect (d)efaultConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOnMSGTXTS656 5264 5305 5321 5339 5343 5347 5357 5366 5372 5378 5381 5384 5393 5403 5416 5424 5435 5460 5472 5982 6014 6506 6795 7340 7386 7490 7576 7612 7627 7645 7653 7661 7688 7692 7696 7699 7702 7813 7998 8226 8702 9036 9065 9080 9095 9103 9117 9135 9156 9207 9223 9233 9253 9299 9329 9382 9439 9550 9671 9715 9748 9787 9821 9828 9861 9938 9944 9951 9958 9987 10099 10105 10116 10133 10150 10159 10188 10200 10210 10311 10373 10393 10513 10550 10606 10620 10641 10678 10888 11063 11212 11247 11299 11517 11832 12357 12720 13010 13403 13538 13551 13562 13708 13887 14018 14152 14172 14205 14224 14307 14422 14563 14688 14702 14810 14903 14932 14952 15028 15045 15063 15079 15098 15118 15135 15147 15173 15185 15203 15404 15643 15670 15687 15743 15805 15865 15896 15920 15979 16325 16355 16372 16480 16590 16730 16804 16880 16958 17450 17670 17781 17812 17939 17975 18103 18130 18170 18216 18432 18556 18624 18724 18729 18765 18801 18815 18838 18871 18875 18900 18919 18945 18950 18965 18980 18999 19024 19036 19058 19075 19088 19100 19118 19142 19157 19174 19187 19198 19209 19229 19258 19287 19311 19346 19381 19408 19595 19644 19676 19724 19821 19954 20000 20192 20222 20544 20673 20813 20953 21070 21205 21249 21292 21300 21310 21322 21334 21342 21353 21380 21414 21451 21482 21517 21553 21600 21620 21637 21655 21660 21667 21694 21710 21731 21748 21765 21783 21800 21813 21844 21869 21900 21931 21966 21993 22046 22056 22066 22072 22081 22089 22104 22108 22113 22119 22123 22158 22168 22197 22213 22239 22256 22275 22296 22312 22325 22330 22338 22353 22379 22398 22426 22444 22455 22461 22467 22488 22498 22509 22527 22549 22566 22579 22600 22620 22640 22651 22664 22686 22693 22718 22733 22753 22765 22782 22799 22819 22838 23015 23299 23609 23789 24000 24188 24254 24301 24356 24400 24420 24449 24461 24467 24483 24487 24491 24499 24509 24521 24536 24555 24591 24602 24613 24652 24664 24674 24684 24694 24710 24728 24777 24798 24843 25087 25113 25367 25382 25408 25465 25499 25534 25676 25693 25742 25763 25779 25808 25813 25818 25824 25829 25868 25903 25933 25988 26021 26067 26081 26160 26165 26219 26233 26243 26267 26353 26401 26507 26541 26548 26563 26590 26599 26638 26645 26667 26686 26702 26720 26752 26771 26788 26945 26976 26983 26992 27000 27007 27021 27039 27058 27068 27080 27121 27166 27195 27216 27239 27258 27296 27302 27310 27314 27335 27352 27361 27380 27526 27568 28078 28086 28110 28128 28172 28177 28182 28186 28217 28230 28239 28285 28411 28502 28514 28578 28580 28582 28584 28594 28608 28623 28650 28654 28660 28665 28674 28679 28706 28708 28723 28734 28749 28777 28821 28868 28884 28906 28917 28950 28970 29019 29119 29121 29123 29137 29140 29179 29279 29292 29323 29333 29350 29368 29396 29424 29452 29480 29493 29522 29557 29603 29708 29735 29764 29788 29815 29859 29970 30002 30270 30285 30518 30731 30991 31157 31247 31333 31350 31373 31380 31386 31396 31495 31551 31827 31951 32062 32124 32162 32170 32187 32196 32218 32267 32270 32313 32358 32413 32472 32541 32588 32693 32836 32861 32865 32899 32915 32940 32988 33024 33085 33139 33220 33242 33281 33318 33350 33374 33401 33427 33441 33449 33459 33467 33481 33494 33506 33530 33571 33597 33614 33643 33967 33970 33984 33996 34002 34018 34030 34037 34044 34053 34063 34080 34096 34139 34147 34155 34165 34176 34194 34211 34224 34250 34257 34265 34282 34290 34307 34331 34350 34369 34388 34398 34409 34423 34441 34461 34481 34490 34513 34533 34544 34559 34571 34590 34609 34620 34630 34635 34641 34659 34678 34697 34704 34723 34743 34768 34785 34791 34799 34809 34821 34842 34858 34866 34886 34906 34928 34936 34947 34970 34977 34991 35013 35030 35039 35060 35078 35087 35118 35134 35161 35180 35200 35218 35239 35253 35273 35280 35299 35314 35333 35878 35911 35939 35968 35976 36013 36325 36502 36579 36596 36614 36629 36651 36701 36711 36728 36750 36809 36967 36991 37121 37146 37272 37290 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_BETA. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_BETA zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_BETA zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_BETA zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_BETA zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_BETAWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_BETAUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Keyboard typeplInstalowanie tablicy zlych blokow ... Czy chcesz zainstalowac normalne bootbloki, czy te do uzycia z zewn. konsola? Selected bootblock: Konsola BIOSPort szeregowy com%d, %d bodowBez zmianWybor bootblokowUzyj konsoli BIOSUzyj portu szeregowego com0Uzyj portu szeregowego com1Uzyj portu szeregowego com2Uzyj portu szeregowego com3Liczba bodowUzyj istniejacych bootblokowInstalowanie bootblokow na %s.... Ten dysk odpowiada ponizszemu dyskowi BIOS: BIOS # cylindry glowice sektory razem sektory GB ------ -------- ------- ------- ------------- ---- %#6x %8d %7d %7d %13u %3u To jest prawidlowa geometriaUstaw geometrie recznieUzyj jednego z tych dyskowTen dysk odpowiada ponizszym dyskom BIOS: BIOS # cylindry glowice sektory razem sektory GB ------ -------- ------- ------- ------------- ---- %-1d: %6x %8d %7d %7d %13u %3u Notatka: od kiedy sysinst jest w stanie unikalnie rozpoznac dysk, ktory wybrales i powiazac go z dyskiem BIOS, wartosci wyswietlane powyzej sa bardzo prawdopodobnie prawidlowe i nie powinny byc zmieniane. Zmieniaj je tylko wtedy jesli sa naprawde _obrzydliwie_ zle. Wybierz dysk: Czesc NetBSD dysku lezy poza obszarem, ktory BIOS w twojej maszynie moze zaadresowac. Nie mozliwe bedzie bootowanie z tego dysku. Jestes pewien, ze chcesz to zrobic? (Odpowiedz 'nie' zabierze cie spowrotem do menu edycji partycji.)Masz wiecej niz jeden system operacyjny na tym dysku, ale nie zostalo wskazane menu ani dla aktywnej partycji ani dla partycji NetBSD, ktora bedzie zainstalowana. Chcesz zmienic partycje, aby dodac wpis do menu?Wskazane zostalo, ze w menu zostanie zawarta partycja rozszerzona. Nie wyglada na to, ze system BIOS wspiera polecenie odczytu uzywane przez te wersje kodu menu. Czy na pewno chcesz tak zrobic? (Odpowiedz 'nie' przeniesie z powrotem do menu zmiany partycji.)Twoje konfiguracja wymaga kodu rozruchowego NetBSD, aby wybierac, ktorego systemu operacyjnego uzywac. Nie jest on obecnie zainstalowany. Czy zainstalowac go teraz?Kod rozruchowy w MBR nie wyglada na poprawny. Chcesz zainstalowac kod rozruchowy NetBSD?Chcesz uaktualnic kod rozruchowy w MBR do najnowszej wersji kodu rozruchowego NetBSD?Kernel (GENERIC)Kernel (GENERIC_KASLR)RodzajMountWpis menuNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaw menu startowymdomyslnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partition, bootselect (d)efaultKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, a#!/bin/sh - # # Generated from: # NetBSD: MAKEDEV.awk,v 1.29 2020/06/13 19:46:23 thorpej Exp # NetBSD: MAKEDEV.tmpl,v 1.237 2025/03/28 18:41:25 riastradh Exp # NetBSD: etc.i386/MAKEDEV.conf,v 1.37 2025/03/28 18:41:26 riastradh Exp # # Copyright (c) 2003,2007,2008 The NetBSD Foundation, Inc. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # ########################################################################### # # # Device "make" file. Valid special arguments: # all makes all known devices, including local devices. # Tries to make the 'standard' number of each type. # init A set of devices that is used for MFS /dev by init. # May be equal to "all". # floppy devices to be put on install floppies # ramdisk devices to be put into INSTALL kernel ramdisks. # std standard devices # local configuration specific devices # lua Lua device # wscons make wscons devices # usbs make USB devices # virtio virtio(4)-related devices # # # NOTE: # # * MAKEDEV is used both as a standalone script (via "sh ./MAKEDEV # all" or similar), and as a function library for MAKEDEV.local (via # "MAKEDEV_AS_LIBRARY=1 . MAKEDEV"). Because of this, the script # should consist almost entirely of function definitions, apart from a # few lines right at the end. # # * MAKEDEV may be executed in an environment that is missing some # common commands. For example, it may be executed from a minimal # system used during installation, or it may be executed early in the # boot sequence before most file systems have been mounted. It may # also be executed in a cross-build environment on a non-NetBSD host. # usage() { cat 1>&2 << _USAGE_ Usage: ${0##*/} [-fMsu] [-m mknod] [-p pax] [-t mtree] special [...] Create listed special devices. Options: -f Force permissions to be updated on existing devices. -M Create memory file system. -m mknod Name of mknod(8) program. [\$TOOL_MKNOD or mknod] -p pax Name of pax(1) program. [\$TOOL_PAX or pax] -s Generate mtree(8) specfile instead of creating devices. -t mtree Name of mtree(8) program. [\$TOOL_MTREE or mtree] -u Don't re-create devices that already exist. _USAGE_ exit 1 } # zeropad width number # display number with a zero (`0') padding of width digits. # zeropad() { case $(($1 - ${#2})) in 5) echo 00000$2;; 4) echo 0000$2;; 3) echo 000$2;; 2) echo 00$2;; 1) echo 0$2;; 0) echo $2;; *) die "bad padding" ;; esac } # hexprint number # display (base10) number as hexadecimal # hexprint() { val="$(($1 + 0))" hex= set -- 0 1 2 3 4 5 6 7 8 9 a b c d e f while [ "$val" -gt 0 ]; do eval hex=\${$(($val % 16 + 1))}\$hex val="$(($val / 16))" done echo "${hex:-0}" } # linecount multiline_string # count the number of lines in the string # linecount() { local IFS=' ' # just a newline, no other white space between the quotes set -- $1 echo $# } # nooutput -12 cmd [args...] # run a command with stdout and/or stderr ignored. # "nooutput -1 cmd" is like "cmd >/dev/null"; # "nooutput -2 cmd" is like "{ cmd ; } 2>/dev/null"; # "nooutput -12 cmd" is like "{ cmd ; } >/dev/null 2>&1"; # except they should work even if /dev/null doesn't [yet] exist. # # The "{...}" wrapper used in cases where stderr is redirected # serves to capture shell error messages such as "cmd: not found". # nooutput() { local flags="$1" ; shift local junk case "$flags" in "-1") junk="$( "$@" )" ;; "-2") ( exec 4>&1 ; junk="$( { "$@" ; } 2>&1 1>&4 )" ) ;; "-12") junk="$( { "$@" ; } 2>&1 )" ;; *) warn "Incorrect use of nooutput" ;; esac } # check_pax path_to_pax # Check whether pax exists and supports the command line options # and input format that we will want to use. # check_pax() { local pax="$1" echo ". type=dir optional" | nooutput -12 "${pax}" -r -w -M -pe . } # check_mtree path_to_mtree # Check whether mtree exists and supports the command line options # and input format that we will want to use. # check_mtree() { local mtree="$1" echo ". type=dir optional" | nooutput -12 "${mtree}" -e -U } # setup args... # Parse command line arguments, exit on error. # Callers should shift $((OPTIND - 1)) afterwards. # setup() { PATH=/sbin:/usr/sbin:/bin:/usr/bin:/rescue : ${HOST_SH:=sh} : ${TOOL_MKNOD:=mknod} : ${TOOL_MTREE:=mtree} : ${TOOL_PAX:=pax} status=0 do_create_mfs=false do_force=false do_mknod=false do_pax=false do_mtree=false do_redirect=false do_specfile=false do_update=false opts= while getopts Mfm:p:st:u ch; do # Note that $opts is only for options passed through to # MAKEDEV.local, not for all options. case ${ch} in M) # "-M" sets do_create_mfs; # "-M -M" is for use from init(8), and sets do_redirect do_redirect=$do_create_mfs do_create_mfs=true ;; f) do_force=true opts="${opts} -f" ;; m) TOOL_MKNOD=${OPTARG} do_mknod=true opts="${opts} -m ${OPTARG}" ;; p) TOOL_PAX="${OPTARG}" if check_pax "${TOOL_PAX}"; then do_pax=true # do not add this to $opts; we will later # add "-s" instead. else warn "Ignored -p option:" \ "${TOOL_PAX} is missing or broken" do_mknod=true fi ;; s) do_specfile=true opts="${opts} -s" ;; t) TOOL_MTREE="${OPTARG}" if check_mtree "${TOOL_MTREE}"; then do_mtree=true # do not add this to $opts; we will later # add "-s" instead. else warn "Ignored -t option:" \ "${TOOL_MTREE} is missing or broken" do_mknod=true fi ;; u) do_update=true opts="${opts} -u" ;; *) usage ;; esac done shift $((${OPTIND} - 1)) [ $# -gt 0 ] || usage u_root="0" u_uucp="66" g_gpio="29" g_kmem="2" g_ntpd="15" g_nvmm="34" g_operator="5" g_wheel="0" dialin=0 dialout=524288 callunit=262144 # only allow read&write for owner by default umask 077 # Set fdesc_mounted=true if the fdesc file system is mounted # on the current directory (typically "/dev"). # Later, this will be used to suppress creation of device nodes # that are supplied by the fdesc file system. # fdesc_mounted=false if [ -d fd ]; then # Parse the output from "mount -u -o nosuchoption .". # We don't parse the output from df(1) because that's # less likely to be available on install media. # # If the current directory is a mount point for the # fdesc file system, then the expected output (whether # or not the current user is root) is: # mount_fdesc: -o suchoption: option not supported. # # If the current directory is not a mount point, then # the expected output is: # mount: .: unknown special file or file system. # # If we are not running on NetBSD, or mount(8) is not # found, then we should get some other error message. # case "$({ LC_ALL=C mount -u -o nosuchoption . ; } 2>&1)" in *mount_fdesc*) fdesc_mounted=true ;; esac fi # do_force requires mknod if $do_force; then if $do_mtree || $do_pax || $do_specfile; then die "-f option works only with mknod" fi do_mknod=true fi # do_force and do_update do not work together if $do_force && $do_update; then die "-f and -u options do not work together" fi # If no explicit method was specified on the command line or # forced above, then use one of mtree, pax, or mknod, in that # order of preference. # # mtree is preferred because it's fast and designed for the # purpose. However, it's unlikely to be available early in the # boot sequence, when init(8) may invoke MAKEDEV(8). # # pax is usually acceptable, and it's likely to be available # early in the boot sequence. However, it's much slower than mtree. # # mknod is just very slow, because the shell has to fork for # each device node. # case ",${do_mtree},,${do_pax},,${do_mknod},,${do_specfile}," in ( ,false,,false,,false,,false, ) if check_mtree "${TOOL_MTREE}"; then do_mtree=true elif check_pax "${TOOL_PAX}"; then do_pax=true else do_mknod=true fi ;; ( *,true,*,true,* ) die "-m, -p, -s, and -t options are mutually exclusive" ;; esac # If we are using mknod, then decide what options to pass it. MKNOD="${TOOL_MKNOD:-mknod} -F netbsd" if $do_mknod; then if $do_force; then MKNOD="${MKNOD} -R" else MKNOD="${MKNOD} -r" fi fi # do_mtree or do_pax internally implies do_specfile. # This happens after checking for mutually-exclusive options. if $do_mtree || $do_pax && ! $do_specfile; then do_specfile=true opts="${opts} -s" fi } # specfile_before # This is called before the bulk of the makedev processing, # if do_specfile is set. # # It simply prints ". type=dir optional", which must be the # first line of the specfile. # specfile_before() { echo ". type=dir optional" } # mtree_after # Output in specfile format is piped into this function. # # It uses mtree to create the devices defined in the specfile. # mtree_after() { nooutput -1 "${TOOL_MTREE}" -e -U } # pax_after # Output in specfile format is piped into this function. # # It uses pax to create the devices defined in the specfile. # pax_after() { # Run pax in an empty directory, so it pays # attention only to the specfile, without being # confused by the existing contents of the target # directory. Without this, pax would complain "file # would overwrite itself" for already-existing # device nodes. tmpdir=./tmp.$$ mkdir "${tmpdir}" || die "can't create temporary directory" cd "${tmpdir}" || die "can't cd to temporary directory" "${TOOL_PAX}" -r -w -M -pe .. pax_status=$? cd .. # back to where we started rmdir "${tmpdir}" return $pax_status } # makedev_main makedev_name args... # Perform most of the work of the main program. makedev_name # is typically "makedev", but may be the name of some other # makedev-like function (if we are invoked from MAKEDEV.local or # some other script). The other args to this function are the # command line args with which the MAKEDEV (or MAKEDEV.local) # script was invoked. # makedev_main() { local makedev="$1" ; shift # Parse command line args setup ${1+"$@"} shift $((${OPTIND}-1)) if $do_create_mfs; then # Count inodes and create mfs file system. # The makedev call merely updates $count_nodes. count_nodes=0 $makedev ${1+"$@"} create_mfs_dev $count_nodes unset count_nodes fi # Set before, middle, and after variables, so we can do # something like "( $before && $middle ) | $after", # except it will have to be more complex so we can capture # the exit status from both sides of the pipe. # if $do_specfile; then before=specfile_before else before=: fi middle='$makedev ${1+"$@"} && (exit $status)' if $do_mtree; then after=mtree_after elif $do_pax ; then after=pax_after else after=cat fi # Actually perform the "{ $before && $middle } | $after" commands. # # We go to some trouble to ensure that, if any of # $before, $middle, or $after fails, then we also # exit with a non-zero status. # # In the block below, fd 3 is a copy of the original stdout, # and fd 4 goes to a subshell that analyses the exit status # status from the other commands. # { exec 3>&1; { { eval "$before" && eval "$middle"; echo $? >&4; } \ | { eval "$after"; echo $? >&4; } \ } 4>&1 1>&3 \ | ( read status1; read status2; case "$status1,$status2" in 0,0) exit 0;; 0,*) exit $status2;; *,*) exit $status1;; esac ) } } # # functions available to create nodes: # # mkdev name [b|c] major minor [mode{=600} [gid{=0} [uid{=0}]]] # create device node `name' with the appropriate permissions # # lndev src target # create a symlink from src to target # # makedir dir mode # create directory with appropriate mode # mkdev() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $1; then return fi if $do_specfile; then case $2 in b) type=block ;; c) type=char ;; esac echo "./$1 type=${type} device=netbsd,$3,$4 mode=${5:-600} gid=${6:-$g_wheel} uid=${7:-$u_root}" else ${MKNOD} -m ${5:-600} -g \#${6:-$g_wheel} -u \#${7:-$u_root} $1 $2 $3 $4 fi } lndev() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $2; then return fi if $do_specfile; then echo "./$2 type=link link=$1 mode=0700 gid=$g_wheel uid=$u_root" else ln -f -s $1 $2 fi } makedir() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $1; then return fi if $do_specfile; then echo "./$1 type=dir mode=$2 gid=$g_wheel uid=$u_root" else nooutput -2 mkdir $1 chmod $2 $1 fi } warn() { echo 1>&2 "$0: $*" status=1 } die() { echo 1>&2 "$0: $*" exit 1 } # makedev special [...] # the main loop # makedev() { for i do case $i in # As of 2005-03-15, the "init" case must not create more than 1024 entries. all_md) makedev std wscons wt0 fd0 fd1 makedev wd0 wd1 wd2 wd3 wd4 wd5 wd6 wd7 makedev sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 makedev flash0 flash1 flash2 flash3 flash4 flash5 flash6 flash7 makedev tty0 tty1 tty2 tty3 makedev st0 st1 ch0 cd0 cd1 mcd0 vnd0 makedev bpf makedev ccd0 md0 random makedev cgd0 cgd1 makedev amr0 iop0 mfi0 mlx0 mly0 dpti0 dpt0 twe0 icp0 makedev ed0 ed1 makedev nvme0 nvme0ns1 nvme0ns2 nvme0ns3 nvme0ns4 makedev nvme1 nvme1ns1 nvme1ns2 nvme1ns3 nvme1ns4 makedev nvme2 nvme2ns1 nvme2ns2 nvme2ns3 nvme2ns4 makedev nvme3 nvme3ns1 nvme3ns2 nvme3ns3 nvme3ns4 makedev raid0 raid1 raid2 raid3 makedev ld0 ld1 ld2 ld3 ld4 ld5 ld6 ld7 makedev xbd0 xbd1 xbd2 xbd3 xen makedev usbs makedev ipty makedev local makedev cfs makedev lpa0 lpa1 lpa2 makedev lpt0 lpt1 lpt2 makedev ss0 uk0 uk1 makedev speaker joy0 joy1 makedev apm makedev cmos makedev audio makedev radio makedev music rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 makedev scsibus0 scsibus1 scsibus2 scsibus3 makedev ses0 ses1 ses2 ses3 makedev sysmon makedev bktr makedev tprof makedev ttyCZ0 ttyCY0 makedev agp0 makedev pci0 pci1 pci2 pci3 pci4 pci5 pci6 pci7 makedev pci8 pci9 pci10 pci11 pci12 pci13 pci14 makedev pci15 pci16 pci17 pci18 pci19 makedev altq makedev cir0 cir1 irframe0 irframe1 makedev dmoverio makedev kttcp makedev io makedev bio makedev acpi smbios efi makedev virtio ;; xen) makedev xenevt xencons xsd_kva ;; floppy) makedev std bpf wt0 fd0 fd1 wd0 wd1 wd2 wd3 sd0 sd1 sd2 sd3 sd4 st0 st1 makedev tty0 tty1 tty2 cd0 cd1 mcd0 ttyv0 opty ld0 ld1 ld2 ld3 ed0 ed1 ;; ramdisk) makedev floppy md0 ;; all) makedev all_md makedev std fd ptm makedev dk0 dk1 dk2 dk3 dk4 dk5 dk6 dk7 makedev dk8 dk9 dk10 dk11 dk12 dk13 dk14 dk15 makedev dk16 dk17 dk18 dk19 dk20 dk21 dk22 dk23 makedev dk24 dk25 dk26 dk27 dk28 dk29 dk30 dk31 makedev ccd0 ccd1 ccd2 ccd3 makedev cgd0 cgd1 cgd2 cgd3 cgd4 cgd5 cgd6 cgd7 makedev fss0 fss1 fss2 fss3 makedev md0 md1 makedev raid0 raid1 raid2 raid3 raid4 raid5 raid6 raid7 makedev vnd0 vnd1 vnd2 vnd3 makedev iscsi0 makedev bpf npf makedev tun0 tun1 tun2 tun3 makedev ipl pf crypto random makedev lockstat clockctl cpuctl makedev atabus0 atabus1 atabus2 atabus3 atabus4 atabus5 atabus6 atabus7 makedev srt0 srt1 srt2 srt3 makedev tap tap0 tap1 tap2 tap3 makedev gpio gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 makedev gpioirq0 gpiopps0 makedev pad pad0 pad1 pad2 pad3 makedev bthub makedev putter makedev drvctl makedev video makedev dtv makedev drm0 drm1 drm2 drm3 makedev altmem makedev zfs makedev lua makedev hdmicec0 makedev dtrace makedev veriexec makedev autofs makedev fw0 fw1 fw2 fw3 makedev ipmi0 makedev qemufwcfg makedev sht3xtemp0 makedev scmd0 makedev local # do this last ;; init) # unless overridden by MD entry, this is equal to 'all' makedev all opty ;; audio) makedev audio0 audio1 audio2 audio3 makedev hdaudio0 hdaudio1 hdaudio2 hdaudio3 lndev sound0 sound lndev audio0 audio lndev mixer0 mixer lndev audioctl0 audioctl ;; emcfan[0-9]*) unit=${i#emcfan} mkdev emcfan$unit c 367 $unit 660 ;; gpio) makedev gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 lndev gpio0 gpio ;; gpioirq) makedev gpioirq0 ;; gpiopps) makedev gpiopps0 lndev gpiopps0 gpiopps ;; lua) makedev lua0 lndev lua0 lua ;; pad) makedev pad0 pad1 pad2 pad3 lndev pad0 pad ;; qemufwcfg) makedev qemufwcfg0 lndev qemufwcfg0 qemufwcfg ;; radio) makedev radio0 radio1 lndev radio0 radio ;; video) makedev video0 video1 video2 video3 ;; dtv) makedev dtv0 dtv1 dtv2 dtv3 ;; iic) makedev iic0 iic1 iic2 iic3 ;; altmem) makedev altmem0 altmem1 ;; ramdisk) makedev floppy md0 ;; sht3xtemp) makedev sht3xtemp0 ;; scmd) makedev scmd0 ;; usbs) makedev usb usb0 usb1 usb2 usb3 usb4 usb5 usb6 usb7 makedev usb8 usb9 usb10 usb11 usb12 usb13 usb14 usb15 makedev uhid0 uhid1 uhid2 uhid3 uhid4 uhid5 makedev uhid6 uhid7 uhid8 uhid9 uhid10 uhid11 makedev uhid12 uhid13 uhid14 uhid15 makedev ulpt0 ulpt1 makedev ttyU0 ttyU1 ttyU2 ttyU3 ttyU4 ttyU5 ttyU6 ttyU7 makedev ttyY0 ttyY1 makedev ttyHS0 makedev utoppy0 utoppy1 makedev ugen0 ugen1 ugen2 ugen3 ;; virtio) makedev ttyVI makedev vio9p0 vio9p1 vio9p2 vio9p3 makedev vio9p4 vio9p5 vio9p6 vio9p7 ;; std) mkdev console c 0 0 600 mkdev constty c 0 1 600 mkdev drum c 4 0 640 $g_kmem mkdev kmem c 2 1 640 $g_kmem mkdev mem c 2 0 640 $g_kmem mkdev null c 2 2 666 mkdev full c 2 11 666 mkdev zero c 2 12 666 mkdev klog c 7 0 600 mkdev ksyms c 101 0 440 $g_kmem mkdev random c 46 0 444 mkdev urandom c 46 1 644 if ! $fdesc_mounted; then mkdev tty c 1 0 666 mkdev stdin c 22 0 666 mkdev stdout c 22 1 666 mkdev stderr c 22 2 666 fi ;; usb) mkdev usb c 55 255 444 ;; usb[0-9]*) unit=${i#usb} usb=usb$unit mkdev usb$unit c 55 $unit ;; uhid[0-9]*) unit=${i#uhid} mkdev uhid$unit c 56 $unit 666 ;; ulpt[0-9]*) unit=${i#ulpt} mkdev ulpt$unit c 57 $unit mkdev ulpn$unit c 57 $(($unit + 64)) ;; utoppy[0-9]*) unit=${i#utoppy} mkdev utoppy$unit c 174 $unit ;; ttyHS[0-9]*) unit=${i#ttyHS} for j in 00 01 02 03 04 05 06 07 08 09 10 do base=$(($unit * 16 + ${j#0})) mkdev ttyHS$unit.$j c 196 $(($base + $dialin )) "" "" $u_uucp mkdev dtyHS$unit.$j c 196 $(($base + $dialout )) "" "" $u_uucp mkdev ctyHS$unit.$j c 196 $(($base + $callunit)) "" "" $u_uucp done ;; ttyY[0-9]*) unit=${i#ttyY} mkdev ttyY$unit c 172 $(($unit + $dialin )) "" "" $u_uucp mkdev dtyY$unit c 172 $(($unit + $dialout )) "" "" $u_uucp mkdev ctyY$unit c 172 $(($unit + $callunit)) "" "" $u_uucp ;; ucom[0-9]*) makedev ttyU${i#ucom} ;; ttyU[0-9]*) unit=${i#ttyU} mkdev ttyU$unit c 66 $(($unit + $dialin )) "" "" $u_uucp mkdev dtyU$unit c 66 $(($unit + $dialout )) "" "" $u_uucp mkdev ctyU$unit c 66 $(($unit + $callunit)) "" "" $u_uucp ;; ugen[0-9]*) unit=${i#ugen} for j in 00 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 do mkdev ugen$unit.$j c 64 $(($unit * 16 + ${j#0})) done ;; umcpmio[0-9]*) unit=${i#umcpmio} mkdev umcpmio${unit}ctl c 366 $unit 660 for j in 0 1 2 do mkdev umcpmio${unit}GP$(($j + 1)) c 366 $(($unit * 3 + 128 + ${j#})) 666 done ;; wscons) makedev ttyE0 ttyE1 ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 makedev ttyF0 ttyF1 ttyF2 ttyF3 ttyF4 ttyF5 ttyF6 ttyF7 makedev ttyG0 ttyG1 ttyG2 ttyG3 ttyG4 ttyG5 ttyG6 ttyG7 makedev ttyH0 ttyH1 ttyH2 ttyH3 ttyH4 ttyH5 ttyH6 ttyH7 makedev wsmouse0 wsmouse1 wsmouse2 wsmouse3 makedev wskbd0 wskbd1 wskbd2 wskbd3 makedev wsmux0 wsmux1 wsmux2 wsmux3 makedev wsmouse wskbd makedev ttyEcfg ttyEstat makedev ttyFcfg ttyFstat makedev ttyGcfg ttyGstat makedev ttyHcfg ttyHstat makedev wsfont ;; wsmouse) mkdev wsmouse c 65 0 ;; wskbd) mkdev wskbd c 65 1 ;; wsmux[0-9]*) unit=${i#wsmux} mkdev wsmux$unit c 65 $unit mkdev wsmuxctl$unit c 65 $(($unit + 128)) 200 ;; xenevt) mkdev xenevt c 141 0 ;; xsd_kva) mkdev xsd_kva c 141 1 ;; xencons) mkdev xencons c 143 0 ;; ttyEstat) mkdev ttyEstat c 47 254 ;; ttyEcfg) mkdev ttyEcfg c 47 255 ;; ttyE[0-9]*) unit=${i#ttyE} mkdev ttyE$unit c 47 $unit ;; ttyFstat) mkdev ttyFstat c 47 510 ;; ttyFcfg) mkdev ttyFcfg c 47 511 ;; ttyF[0-9]*) unit=${i#ttyF} mkdev ttyF$unit c 47 $(($unit + 256)) ;; ttyGstat) mkdev ttyGstat c 47 766 ;; ttyGcfg) mkdev ttyGcfg c 47 767 ;; ttyG[0-9]*) unit=${i#ttyG} mkdev ttyG$unit c 47 $(($unit + 512)) ;; ttyHstat) mkdev ttyHstat c 47 1022 ;; ttyHcfg) mkdev ttyHcfg c 47 1023 ;; ttyH[0-9]*) unit=${i#ttyH} mkdev ttyH$unit c 47 $(($unit + 768)) ;; wsmouse[0-9]*) unit=${i#wsmouse} mkdev wsmouse$unit c 49 $unit ;; wskbd[0-9]*) unit=${i#wskbd} mkdev wskbd$unit c 48 $unit ;; fd) if ! $fdesc_mounted; then # Create the "fd" subdirectory, and devices "fd/0" to "fd/63" makedir fd 755 n=0 while [ $n -lt 64 ] do mkdev fd/$n c 22 $n 666 n=$(($n + 1)) done fi ;; wt[0-9]*) name=wt; unit=${i#wt}; chr=10; blk=3 for sub in $unit $(($unit+8)) $(($unit+16)) do mkdev $name$sub b $blk $(($sub + 0)) 660 $g_operator mkdev n$name$sub b $blk $(($sub + 4)) 660 $g_operator mkdev r$name$sub c $chr $(($sub + 0)) 660 $g_operator mkdev nr$name$sub c $chr $(($sub + 4)) 660 $g_operator done ;; md[0-9]*) makedisk_minimal md ${i#md} 17 24 ;; fss[0-9]*) name=fss; unit=${i#fss}; blk=163; chr=163 mkdev $name$unit b $blk $unit 660 $g_operator mkdev r$name$unit c $chr $unit 660 $g_operator ;; ss[0-9]*) name=ss; unit=${i#ss}; chr=19 mkdev $name$unit c $chr $(($unit * 16 + 0)) 640 $g_operator mkdev n$name$unit c $chr $(($unit * 16 + 1)) 640 $g_operator mkdev en$name$unit c $chr $(($unit * 16 + 3)) 640 $g_operator ;; ccd[0-9]*|cgd[0-9]*|raid[0-9]*|vnd[0-9]*) case $i in ccd*) name=ccd; unit=${i#ccd}; blk=16; chr=18;; cgd*) name=cgd; unit=${i#cgd}; blk=21; chr=93;; raid*) name=raid; unit=${i#raid}; blk=18; chr=62;; vnd*) name=vnd; unit=${i#vnd}; blk=14; chr=41;; esac makedisk_p16high $name $unit $blk $chr ;; sd[0-9]*) name=sd; unit=${i#sd}; blk=4; chr=13 makedisk_p16high $name $unit $blk $chr ;; wd[0-9]*) name=wd; unit=${i#wd}; blk=0; chr=3 makedisk_p16high $name $unit $blk $chr ;; fd[0-9]*) name=fd; unit=${i#fd}; blk=2; chr=9 makedisk_p16high $name $unit $blk $chr ;; ld[0-9]*) name=ld; unit=${i#ld}; blk=19; chr=69 makedisk_p16high $name $unit $blk $chr ;; flash[0-9]*) unit=${i#flash} flash=flash$unit mkdev flash$unit b 199 $unit mkdev rflash$unit c 199 $unit ;; spiflash[0-9]*) unit=${i#spiflash} spiflash=spiflash$unit mkdev spiflash$unit b 208 $unit mkdev rspiflash$unit c 208 $unit ;; altmem[0-9]*) name=altmem; unit=${i#altmem}; blk=182; chr=182 makedisk_p16high $name $unit $blk $chr ;; bio) mkdev bio c 181 0 ;; ed[0-9]*) name=ed; unit=${i#ed}; blk=20; chr=79 makedisk_p16high $name $unit $blk $chr ;; xbd[0-9]*) name=xbd; unit=${i#xbd}; blk=142; chr=142 makedisk_p16high $name $unit $blk $chr ;; dk[0-9]*) name=dk; unit=${i#dk}; blk=168; chr=168 mkdev r$name$unit c $chr $unit 0640 $g_operator mkdev $name$unit b $blk $unit 0640 $g_operator ;; tprof) mkdev tprof c 191 0 ;; ttyCY[0-9]*) # Each unit number creates 32 pairs of {tty,dty} device nodes: # ttyCY0 => device nodes [td]tyCY000 to [td]tyCY031; # ttyCY1 => device nodes [td]tyCY032 to [td]tyCY063; name=tyCY; chr=38; off=32 unit=${i#t${name}} minor=$(($unit * $off)) eminor=$(($minor + $off)) while [ $minor -lt $eminor ] do nminor=000$minor nminor=${nminor#${nminor%???}} mkdev t$name$nminor c $chr $(($minor + $dialin )) "" "" $u_uucp mkdev d$name$nminor c $chr $(($minor + $dialout)) "" "" $u_uucp minor=$(($minor + 1)) done ;; ttyCZ[0-9]*) # Each unit number creates 64 pairs of {tty,dty} device nodes: # ttyCZ0 => device nodes [td]tyCZ0000 to [td]tyCZ0063; # ttyCZ1 => device nodes [td]tyCZ0064 to [td]tyCZ0127; name=tyCZ; chr=73; off=64 unit=${i#t${name}} minor=$(($unit * $off)) eminor=$(($minor + $off)) while [ $minor -lt $eminor ] do nminor=0000$minor nminor=${nminor#${nminor%????}} mkdev t$name$nminor c $chr $(($minor + $dialin )) "" "" $u_uucp mkdev d$name$nminor c $chr $(($minor + $dialout)) "" "" $u_uucp minor=$(($minor + 1)) done ;; tty[0-9]*) unit=${i#tty} ounit=00$unit ounit=${ounit#${ounit%??}} mkdev tty$ounit c 8 $(($unit + $dialin )) "" "" $u_uucp mkdev dty$ounit c 8 $(($unit + $dialout)) "" "" $u_uucp ;; ttyC[0-9]*) # some archs call com_chr ttyC traditionally unit=${i#ttyC}; name=ttyC; dname=dtyC; chr=8 mkdev $name$unit c $chr $(($unit + $dialin )) "" "" $u_uucp mkdev $dname$unit c $chr $(($unit + $dialout)) "" "" $u_uucp ;; opty) # Create 16 device nodes, [pt]typ0 to [pt]typf, # same as "MAKEDEV pty0". for j in 0 1 2 3 4 5 6 7 8 9 a b c d e f do case $j in [0-9]) jn=$j ;; a) jn=10 ;; b) jn=11 ;; c) jn=12 ;; d) jn=13 ;; e) jn=14 ;; f) jn=15 ;; esac mkdev ttyp$j c 5 $jn 666 mkdev ptyp$j c 6 $jn 666 done ;; pty[0-9]*) # Each unit number creates up to 16 pairs of {tty,pty} device nodes: # pty0 => 16 pairs, [tp]typ0 to [tp]typf # pty1 => 16 pairs, [tp]tyq0 to [tp]tyqf # pty16 => 16 pairs, [tp]typg to [tp]typv # pty17 => 16 pairs, [tp]typw to [tp]typL # pty18 => 14 pairs, [tp]typM to [tp]typZ warn "$i: creating BSD style tty nodes with ptyfs is a security issue" class=${i#pty} d1="p q r s t u v w x y z P Q R S T" if [ "$class" -ge 64 ] then warn "$i: pty unit must be between 0 and 63" continue elif [ "$class" -lt 16 ] then # pty[p-zP-T][0-9a-f] offset=0 mult=0 d2="0 1 2 3 4 5 6 7 8 9 a b c d e f" else # pty[p-zP-T][g-zA-Z] class=$(($class - 16)) offset=256 mult=2 d2="g h i j k l m n o p q r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X Y Z" fi start=$(($class * 16)) set -- $d2 nt=$# s1=$(($start / $nt)) set -- $d1 shift $s1 t1=$1 if [ "$t1" = v ]; then warn "$i: pty unit conflicts with console ttyv0 device" continue fi s2=$(($start % ($nt - $s1 * $mult))) set -- $d2 shift $s2 t2=$1 unit=$(($start + $offset - $s1 * $mult)) end=$(($unit + 16)) while [ "$unit" -lt "$end" ] do mkdev tty$t1$t2 c 5 $unit 666 mkdev pty$t1$t2 c 6 $unit 666 shift t2=$1 if [ -z "$t2" ] then break fi unit=$(($unit + 1)) done ;; st[0-9]*) name=st; unit=${i#st}; chr=14; blk=5 mkdev $name$unit b $blk $(($unit * 16 + 0)) 660 $g_operator mkdev n$name$unit b $blk $(($unit * 16 + 1)) 660 $g_operator mkdev e$name$unit b $blk $(($unit * 16 + 2)) 660 $g_operator mkdev en$name$unit b $blk $(($unit * 16 + 3)) 660 $g_operator mkdev r$name$unit c $chr $(($unit * 16 + 0)) 660 $g_operator mkdev nr$name$unit c $chr $(($unit * 16 + 1)) 660 $g_operator mkdev er$name$unit c $chr $(($unit * 16 + 2)) 660 $g_operator mkdev enr$name$unit c $chr $(($unit * 16 + 3)) 660 $g_operator ;; ses[0-9]*|ch[0-9]*|uk[0-9]*) case $i in ch*) name=ch; unit=${i#ch}; chr=17;; uk*) name=uk; unit=${i#uk}; chr=20;; ses*) name=ses; unit=${i#ses}; chr=74;; esac mkdev $name$unit c $chr $unit 640 $g_operator ;; cd[0-9]*) makedisk_minimal cd ${i#cd} 6 15 ;; mcd[0-9]*) makedisk_minimal mcd ${i#mcd} 7 39 ;; lpt[0-9]*|lpa[0-9]*) case $i in lpt*) name=lpt; unit=${i#lpt}; chr=16; flags=0;; lpa*) name=lpa; unit=${i#lpa}; chr=16; flags=128;; esac mkdev $name$unit c $chr $(($unit + $flags)) mkdev lpt${unit}ctl c $chr $(($unit + 256)) ;; bpf) mkdev bpf c 23 0 lndev bpf bpf0 ;; npf) mkdev npf c 198 0 ;; bthub) mkdev bthub c 175 0 ;; tun[0-9]*) unit=${i#tun} mkdev tun$unit c 40 $unit ;; joy[0-9]*) unit=${i#joy} mkdev joy$unit c 26 $unit ;; ipl) mkdev ipl c 44 0 mkdev ipnat c 44 1 mkdev ipstate c 44 2 mkdev ipauth c 44 3 mkdev ipsync c 44 4 mkdev ipscan c 44 5 mkdev iplookup c 44 6 ;; pf) mkdev pf c 161 0 ;; crypto) mkdev crypto c 160 0 666 ;; cmos) mkdev cmos c 88 0 644 ;; speaker) mkdev speaker c 240 0 ;; lockstat) mkdev lockstat c 177 0 ;; cpuctl) mkdev cpuctl c 188 0 666 ;; audio|audio[0-9]*) unit=${i#audio} audio=audio$unit sound=sound$unit mixer=mixer$unit audioctl=audioctl$unit : ${unit:-0} mkdev $sound c 42 $(($unit + 0)) 666 mkdev $audio c 42 $(($unit + 128)) 666 mkdev $mixer c 42 $(($unit + 16)) 666 mkdev $audioctl c 42 $(($unit + 192)) 666 ;; hdaudio[0-9]*) unit=${i#hdaudio} mkdev hdaudio$unit c 195 $unit 644 ;; hdmicec[0-9]*) uint=${i#hdmicec} mkdev hdmicec$unit c 340 $unit 644 ;; gpio[0-9]*) unit=${i#gpio} mkdev gpio$unit c 173 $unit 664 $g_gpio ;; gpioirq[0-9]*) unit=${i#gpioirq} mkdev gpioirq$unit c 365 $unit 444 $g_gpio ;; gpiopps[0-9]*) unit=${i#gpiopps} mkdev gpiopps$unit c 344 $unit 664 $g_gpio ;; lua[0-9]*) unit=${i#lua} mkdev lua$unit c 209 $unit 664 ;; rmidi[0-9]*) unit=${i#rmidi} mkdev rmidi$unit c 58 $unit 666 ;; music|music[0-9]*) unit=${i#music} : ${unit:-0} mkdev music$unit c 59 $(($unit + 0)) 666 mkdev sequencer$unit c 59 $(($unit + 128)) 666 ;; radio|radio[0-9]*) unit=${i#radio} : ${unit:-0} mkdev radio$unit c 87 $unit 666 ;; video|video[0-9]*) unit=${i#video} : ${unit:-0} mkdev video$unit c 193 $unit 666 ;; dtv[0-9]*) unit=${i#dtv} makedir dvb 755 makedir dvb/adapter$unit 755 mkdev dvb/adapter$unit/frontend0 c 200 $(($unit + 0)) 666 mkdev dvb/adapter$unit/demux0 c 200 $(($unit + 16)) 666 mkdev dvb/adapter$unit/dvr0 c 200 $(($unit + 32)) 666 ;; iic[0-9]*) unit=${i#iic} : ${unit:-0} mkdev iic$unit c 201 $unit 600 ;; spi[0-9]*) unit=${i#spi} : ${unit:-0} mkdev spi$unit c 347 $unit 600 ;; amr[0-9]*) unit=${i#amr} mkdev amr$unit c 176 $unit ;; apm) mkdev apm c 21 0 644 mkdev apmctl c 21 8 644 ;; random) mkdev random c 46 0 444 mkdev urandom c 46 1 644 ;; cfs) makedev cfs0 ;; cfs[0-9]*) unit=${i#cfs} mkdev cfs$unit c 60 $unit ;; sysmon) mkdev sysmon c 67 0 644 mkdev watchdog c 67 1 644 mkdev power c 67 2 640 ;; scsibus[0-9]*) unit=${i#scsibus} mkdev scsibus$unit c 61 $unit 644 ;; bktr) makedev bktr0 bktr1 lndev bktr0 bktr lndev tuner0 tuner lndev vbi0 vbi ;; bktr[0-9]*) unit=${i#bktr} mkdev bktr$unit c 71 $(($unit + 0)) 444 mkdev tuner$unit c 71 $(($unit + 16)) 444 mkdev vbi$unit c 71 $(($unit + 32)) 444 ;; io) mkdev io c 2 14 600 ;; iop[0-9]*) unit=${i#iop} mkdev iop$unit c 76 $unit ;; mfi[0-9]*) unit=${i#mfi} mkdev mfi$unit c 205 $unit ;; mlx[0-9]*) unit=${i#mlx} mkdev mlx$unit c 78 $unit ;; mly[0-9]*) unit=${i#mly} mkdev mly$unit c 80 $unit ;; twa[0-9]*) unit=${i#twa} mkdev twa$unit c 187 $unit ;; twe[0-9]*) unit=${i#twe} mkdev twe$unit c 97 $unit ;; icp[0-9]*) unit=${i#icp} mkdev icp$unit c 102 $unit ;; agp[0-9]*) unit=${i#agp} mkdev agp$unit c 82 $unit 644 if [ "$unit" = "0" ]; then lndev agp$unit agpgart fi ;; pci[0-9]*) unit=${i#pci} mkdev pci$unit c 83 $unit 640 ;; dpti[0-9]*) unit=${i#dpti} mkdev dpti$unit c 84 $unit ;; dpt[0-9]*) unit=${i#dpt} mkdev dpt$unit c 96 $unit ;; altq) makedir altq 755 unit=0 for dev in altq cbq wfq afm fifoq red rio localq hfsc cdnr blue priq jobs do mkdev altq/$dev c 77 $unit 644 unit=$(($unit + 1)) done ;; wsfont) mkdev wsfont c 81 0 644 ;; cir[0-9]*) unit=${i#cir} mkdev cir$unit c 86 $unit 666 ;; irframe[0-9]*) unit=${i#irframe} mkdev irframe$unit c 85 $unit ;; pad[0-9]*) unit=${i#pad} mkdev pad$unit c 189 $unit 444 ;; qemufwcfg[0-9]*) unit=${i#qemufwcfg} mkdev qemufwcfg$unit c 342 $unit 660 ;; vio9p[0-9]*) unit=${i#vio9p} mkdev vio9p$unit c 356 $unit 660 ;; fault) mkdev fault c 357 0 ;; clockctl) mkdev clockctl c 89 0 660 $g_ntpd ;; kttcp) mkdev kttcp c 91 0 ;; dmoverio) mkdev dmoverio c 92 0 644 ;; veriexec) mkdev veriexec c 170 0 600 ;; vhci[0-7]*) unit=${i#vhci} mkdev vhci$unit c 355 $unit ;; ttyv[0-9]*) unit=${i#ttyv} mkdev ttyv$unit c 12 $unit ;; # arm, acorn32 mouse-pms[0-9]*|mouse-qms[0-9]*) case $i in mouse-pms*) name=pms ;; mouse-qms*) name=qms ;; esac unit=${i#mouse-${name}} lndev $name$unit mouse ;; ipty) mkdev ttyp0 c 5 0 666 mkdev ttyp1 c 5 1 666 mkdev ptyp0 c 6 0 666 mkdev ptyp1 c 6 1 666 ;; ptm) makedir pts 755 mkdev ptmx c 165 0 666 mkdev ptm c 165 1 666 ;; atabus[0-9]*) unit=${i#atabus} mkdev atabus$unit c 166 $unit 644 ;; drm[0-9]*) unit=${i#drm} unit2=$((unit + 128)) makedir dri 755 mkdev dri/card$unit c 180 $unit 660 mkdev dri/renderD${unit2} c 180 ${unit2} 660 ;; drvctl) mkdev drvctl c 167 0 644 ;; isv) mkdev isv c 192 0 644 ;; tap|tap[0-9]*) unit=${i#tap} case "$unit" in [0-9]*) mkdev tap${unit} c 169 ${unit} 600 ;; "") mkdev tap c 169 0xfffff 600 ;; esac ;; srt[0-9]*) unit=${i#srt} mkdev srt$unit c 179 $unit 600 ;; tpm) mkdev tpm c 204 0 600 ;; dtrace) makedir dtrace 755 mkdev dtrace/dtrace c 207 0 600 ;; fw[0-9]*) unit=${i#fw} for j in 0 1 2 3 do mkdev fw${unit}.${j} c 171 $((${unit} * 256 + ${j})) 660 ${g_operator} mkdev fwmem${unit}.${j} c 171 $((65536 + ${unit} * 256 + ${j})) 660 ${g_operator} done ;; # create putter device and symlinks for all subsystems using it putter) mkdev putter c 178 0 600 mkdev pud c 178 1 600 lndev putter puffs ;; zfs) mkdev zfs c 190 0 600 makedir zpool 755 ;; iscsi[0-9]*) unit=${i#iscsi} mkdev iscsi${unit} c 203 $unit 600 ;; nvme[0-9]*ns[0-9]*) unit=${i#nvme} unit=${unit%ns*} subunit=${i#nvme${unit}ns} if [ 0$subunit -le 0 ] || [ 0$subunit -ge 65536 ]; then warn "bad nsid for $i: $subunit" break fi mkdev nvme${unit}ns$subunit c 341 $(($unit * 65536 + $subunit)) ;; nvme[0-9]*) unit=${i#nvme} mkdev nvme$unit c 341 $(($unit * 65536)) ;; nvmm) mkdev nvmm c 345 0 660 $g_nvmm ;; autofs) mkdev autofs c 343 0 600 ;; kcov) mkdev kcov c 346 0 ;; ipmi[0-9]*) unit=${i#ipmi} mkdev ipmi${unit} c 354 $unit 600 ;; xmm[0-9]) unit=${i#xmm} makedir xmm${unit} 755 mkdev xmm${unit}/rpc c 358 $(($unit * 65536 + 1)) mkdev ttyXMM${unit}0 c 358 $(($unit * 65536 + 2)) mkdev ttyXMM${unit}1 c 358 $(($unit * 65536 + 4)) ;; acpi) mkdev acpi c 359 0 ;; smbios) mkdev smbios c 360 0 ;; efi) mkdev efi c 361 0 660 ;; sht3xtemp[0-9]*) unit=${i#sht3xtemp} mkdev sht3xtemp$unit c 362 $unit 664 ;; scmd[0-9]*) unit=${i#scmd} mkdev scmd$unit c 363 $unit 666 ;; ttyVI[0-9][0-9]) port=${i#ttyVI?} devunit=${i%$port} unit=${devunit#ttyVI} mkdev ttyVI$unit$port c 364 $((16*$unit + $port)) ;; ttyVI) makedev ttyVI00 ttyVI10 ttyVI20 ttyVI30 ;; local) if [ -f "$0.local" ]; then umask 0 if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + \ $(linecount "$("$HOST_SH" "$0.local" $opts -s all)") )) else "$HOST_SH" "$0.local" $opts all fi umask 077 fi ;; *) warn "$i: unknown device" ;; esac done } # three variants of disk partitions - max 8, max 16, max 16 with highpartoffset # hack; only the one used by port is retained in final MAKEDEV script # routine is called as: # makedisk name unit blk chr makedisk_p8() { name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator } makedisk_p12high() { ho=524280 # offset for partition 9 to 11 (same as ...p16high) name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 8 + $ho + 11)) 640 $g_operator } makedisk_p16() { name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 16 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 16 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 16 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 16 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 16 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 16 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 16 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 16 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 16 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 16 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 16 + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 16 + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 16 + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 16 + 11)) 640 $g_operator mkdev ${name}${unit}m b $blk $(($unit * 16 + 12)) 640 $g_operator mkdev ${name}${unit}n b $blk $(($unit * 16 + 13)) 640 $g_operator mkdev ${name}${unit}o b $blk $(($unit * 16 + 14)) 640 $g_operator mkdev ${name}${unit}p b $blk $(($unit * 16 + 15)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 16 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 16 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 16 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 16 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 16 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 16 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 16 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 16 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 16 + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 16 + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 16 + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 16 + 11)) 640 $g_operator mkdev r${name}${unit}m c $chr $(($unit * 16 + 12)) 640 $g_operator mkdev r${name}${unit}n c $chr $(($unit * 16 + 13)) 640 $g_operator mkdev r${name}${unit}o c $chr $(($unit * 16 + 14)) 640 $g_operator mkdev r${name}${unit}p c $chr $(($unit * 16 + 15)) 640 $g_operator } makedisk_p16high() { ho=524280 # offset for partition 9 to 16 name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev ${name}${unit}m b $blk $(($unit * 8 + $ho + 12)) 640 $g_operator mkdev ${name}${unit}n b $blk $(($unit * 8 + $ho + 13)) 640 $g_operator mkdev ${name}${unit}o b $blk $(($unit * 8 + $ho + 14)) 640 $g_operator mkdev ${name}${unit}p b $blk $(($unit * 8 + $ho + 15)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev r${name}${unit}m c $chr $(($unit * 8 + $ho + 12)) 640 $g_operator mkdev r${name}${unit}n c $chr $(($unit * 8 + $ho + 13)) 640 $g_operator mkdev r${name}${unit}o c $chr $(($unit * 8 + $ho + 14)) 640 $g_operator mkdev r${name}${unit}p c $chr $(($unit * 8 + $ho + 15)) 640 $g_operator } # make only the very few basic disk device nodes - 'a' partition # and raw partition makedisk_minimal() { name=$1; unit=$2; blk=$3; chr=$4 doff=8 ro=3 rn=d mkdev ${name}${unit} b $blk $(($unit * $doff + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * $doff + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * $doff + 0)) 640 $g_operator mkdev ${name}${unit}$rn b $blk $(($unit * $doff + $ro)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * $doff + 0)) 640 $g_operator mkdev r${name}${unit}$rn c $chr $(($unit * $doff + $ro)) 640 $g_operator } # create_mfs_dev nodes # Create a memory file system for a given number of device nodes, # and mount it. Attempts to use mount_tmpfs, or falls back to # mount_mfs. # # If do_redirect, then also redirect output to the console. # create_mfs_dev() { ndevnodes=${1-1200} dev_mountpoint=${PWD:-/dev} # Number of inodes is the specified number of device nodes, plus # a margin to allow for extra device nodes created later. ninode=$((ndevnodes * 11 / 10)) # Add 2 reserved inodes (needed for both mfs and tmpfs), and round # up to a multiple of 32 (needed for mfs, not needed for tmpfs). ninode=$(( (ninode + 2 + 31) / 32 * 32 )) # Try tmpfs; if that fails try mfs. # # For tmpfs, allocate 16KB and 512 byte per node. # Actual requirements are much lower, but the size limit # is only intended to avoid accidental writing to /dev. fs_bytes=$((16384 + ninode * 512)) if mount_tmpfs -s $fs_bytes -n $ninode -m 0755 \ -o union tmpfs "$dev_mountpoint" then fstype=tmpfs else # This file system size calculation is exact for mount_mfs(8) # with 512-byte sectors. 40960 bytes (80 blocks) is the # minimum size allowed by mount_mfs. fs_bytes=$((8192 + 2 * 8192 + 4096 + ninode*512 + 8192)) [ "$fs_bytes" -lt 40960 ] && fs_bytes=40960 fs_blocks=$((fs_bytes/512)) if mount_mfs -b 4096 -f 512 -s $fs_blocks -n $ninode -p 0755 \ -o union swap "$dev_mountpoint" then fstype=mfs else die "Failed to create memory file system" fi fi # Our current directory was in the lower file system; change it to # the newly mounted upper file system. cd "$dev_mountpoint" if $do_redirect; then # Redirect stdout and stderr to console ${MKNOD} -m 600 -g 0 -u 0 temp_console c 0 0 exec >temp_console 2>&1 rm temp_console fi echo "Created $fstype $dev_mountpoint" \ "($fs_bytes byte, $ninode inodes)" } # # MAIN: If MAKEDEV_AS_LIBRARY is set, then we are being used as a # function library, so just return. Otherwise, do all the real work. # [ -n "${MAKEDEV_AS_LIBRARY}" ] && return makedev_main makedev ${1+"$@"}  . .. dhcpcd.confgroup master.passwd netconfig protocolsservices# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  ... . .. dhcpcd-hooksdhcpcd-run-hooks  lfs_cleanerd fi done  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl dmesg fdisk fsck fsck_ffs gpt halt ifconfig init mbrlabel mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_lfs  mount_mfs  mount_msdos  mount_nfs  mount_ntfs  mount_tmpfs newfs  newfs_ext2fs  newfs_lfs ping ping6 raidctl reboot restore route rrestore scsictl shutdown slattach swapctl sysctl umount ... ... . .. bin!mdec"sbin#share . .. ftp gunzip gzcat gzip less more progress sed tar `tip! . ..$boot% bootxx_ffsv1& bootxx_ffsv2' bootxx_lfsv2( gptmbr.bin) mbr* mbr_bootsel+\mbr_extreal can't return to X1fD$fUSWV4ՉD$z 1hVP } Z ÉGD$0PSh Vjju'Ņ|$0 \Tu~,(CHKLЉ8<щ@DC0=>=`r7Kt1҃t 1BuŅt]4^_[]ËL$m4T$$D$1D$ $t=L$I1҃(‰)I;L$uFt$Pt$ t9F;t$(rL$AT$A;QAt$ N $t$ 4G %=ucot$,$ (9|$.,$L,0@Pt$ Qt 9(~Ut$(D$8PZ OL$o򋷔B@4Kdl$ UVs0QPjrFut4$VD$8P  t$ |$0/tL$ $Pu0D$L$0$T$1o/-+fXNŋt$ CUSWVT$B$hL$1щӋE!UD$ T$ut$1uxM`1 t1|$|$ \$ӊMd t1$D$PVu0SWjD$,pÅuCD$;E0u5$x 1ۋD$1uxֹ 1H $؃^_[]USWV֋i  |4(;u? L$ D$ED$D$1B9։$| <[ $9)1B9}14$D`l$T$Jd|$Wt$r0QPjD$$pu|+$l$D$;h0u{D$t$9wVt$ S^ GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWVT$L$iuENPUT$D$  u׋8 D$,EU_9؉ËD$}!@#^L$N0 $11 ʋT$u2!Ћ<$)T$T$0:u)΋ML$ 19s!2D$L$Pt^_[]ËD$t4NdRt$QPjD$ p%u4$Vj MED$ T$D$0WV֋xj|jR G FG|FFGON\FX1^_WVPT$t$D$@+7W++71Ƀ ȃ^_fWV+1L$D$ >tG u Att+1O^_ÐT$D$@+k+1ÐSWV+t3+11N9rtG9r׉މNj@ut(+wT+ H ^_[Ë ++fVW|$ t$L$1_^wHËL$1H@<uÐW|$D$ L$WX_ÐVW|$ t$L$Wt 9rNOX_^ZIчHIчH-чH-чH NetBSD/x86 ffsv1 Primary Bootstrap set_geometry Can't open /boot /boot load failed Invalid /boot file format bootEFI PART+1؎м|WRRAU10rUu s fXBZ?Q@RPf1f@|SNVFZPQ AfFNfVRS1_YXff Uf Uf U t E0t!u!u.Missing OS Multiple active partitions Wf1fffD fT$@fD(fT,f+D fT$9*ff^fD4fT8[*UuZ_f!GPTf!tfffff`fRfPSjjfvŒvAVdfarDisk error on boot ^>b< u~Ҷxx%Ȏff|Ѷxuf xvxfXkfм6$f~$Xk`a)1 u1USR  w$P,h^(hBoot2 failed: V$hLRVD$5aa#OPG5a^h%Oh@B))h1OVL$PQ$b D$t^8tYt$Ph]RhV$eD$@j/P1uIt$hCOhV$0&6$6$u߁^ËD$bP2bWV t$>tBj:VQ1t$D$T$PhahaQRVBt3hL{)aҡa atHQPRhMOO4$aj(VW" =ahKV"9u aa aaRQPhfO[^_SWVt$j,V0tC1۸P6PV0tGuhvO Et?tSxۣ7W=jtVh6h 7`^_[jt$hd! =dtdhdhOÃ=iINhOnVt$hOV6/tEh[V$/t3hOV/t*hOV/thOaa^Vt$V^PVxhP^V5 bPVhP ^USWVP|$,l$(\$$L$ t$D$Kat$PhKj(h`aً\$4`aaaaEaj:Vn.ʼn)'hKVp 9tm<1`aL@ʀŸrƀ`a$9}{ ʀпe w_$1ҍɍTQЊL@̀Ѐ rGCSVh`a 1JыD$ `aD$$D$(E|$,>t71^_[]19} ΀fw@Ɵ4$9؋ $tWVL$T$t$ |$PQRVWt$4MLuYt$ hKVG9t&D$a4$Pt$Vh LjPha4$VhLjPhaa^_SWV\$|$t$Dk5S*#R at#]B5aa=ahahahahaSWVa%P uhLJ iit P| =jtRh6h 7MDk=i~hJh(L1ۿ$45V]Ph_Lhiy1jPU< wr, th_t:hyLO1F 55[nhL1^_[O=jQWV׉sVWPhP 1=ahPWjV&xhPu(VQ5 brPVhPK ^_WV։rWhPhW^_MUSWVT$L$t$,|$$\$؃l$ x EP*V9~ EP ESL$T$Vt$,RQSd,^_[]SWV\$(|$$D$L$t$ SPQRVWt$ F`=bu"jP3h,b= jXjh$bXM hKt$ $9t^hPQ$9tS|$hPS(tPhPS(tAhSS(u6=a F`PF`WV`0t$WV1. ^_[fWVt$ tb1bbb^_ËL$1USWVPӉΊ< t< uF=bt8_uV7 (tw V'G,$t7t3WVP{) $2B Zbt@ uQ h`Q b^_[]ËL$1BAL$3L$%USWV \$4tu|$8u>tF:^_USWV@׉΋1 (t/ t tE\$@hPSQ w D,@j:SUt"ŀx/u:Sh]RhhbEO;/u+SWhvRhhb%/EىUUSShaWhfRhhbjhbtbuF$Tt $@pSUL$ 1ffO&7%fPfRf1ȣ$f1Ҍ҉$f)ff$f $$$$$$f$f$fZfXfP.$ "U% ؎%$XPQjYYf0؎%( f"..$Ȏ؎$f+&$UFu]fXfþ%iCfF>Cprot_to_real can't return to X1f$D$f`TÈfÉD$a`t$,fL$(D$0T$$\$8D$4Sf[f%D$a`R[s Àu1Of ȉD$a`fUAfofU ȉD$a`ֈzff؎؃BÈf/ÉD$a`ֈFff؎شHfÉD$af`1ɺO11fa`fa1`f\$a1`1۴f\$a1`1۴fh\$aUSQRVWf1f tȉӝf5}1fȫfЫf_^ZY[]USQRVWEPAMS} (Wf_f fE1_^ZY[]USQRVWf$f_^ZY[]`ffЉD$afUSQRVW}Wf_OfZ%_^ZY[]USQRVWM} eWf_Of%_^ZY[]USQRVW]@'Of%_^ZY[]USQRVW]Of%_^ZY[]USQRVW]U }Wf_ Of%_^ZY[]USQRVW1ǸOfXOu_^ZY[]USQRVWU} NWf_Of%_^ZY[]USQRVWPf11r&G$u&o&Of UaX_^ZY[]f1`r&&G$ufffЎشfwL$afUSVWffO_^[]fUSVWfT$fL$]Ĉf$1_^[]Ð`>f \$a`*ffD$a`ffD$afUSWV |$$\$,l$(t$0|$ ڃOu ʼno _$19$w"jt$8PSUW~4t 1xO11tiT$ $ËL$ A0jD$PjSUQ54tD$8tDL$ q4$&C$L$4t$t$Q D$8t0 ^_[]ÿjhl9t$ Q jt$ t$ 9 USWVD$|$1 h 1UP jUW wWS1tʼnFu/hTACtt?uhTPhTPhTPhUCt`h`UD$0L$,d$(ʉ9ǿ UrUrRUW |$hg[p{11PPP ݁P11,$xalE EtEuG${uuGL$L$4T$PS<L$ u hQWٿEt8tPhU迿WPh$U詿 Etph]R蒿,$'E!,$4|9h]RPhr\fhTYGz|$|$hg[&1D$D$ :1L t $0$u ^_SWV˸ 腷t,1h VP VW(t 1^_[USWV D$0T$,L$ tt 1ۉ1SSSF t:1K؃ ^_[]11NXt$4$|$ tk 3L$$ 3|$(t t4$|$t t$u $w($st4$T$ $E$u 4$ $l$0uu 1ɋD$tD$,|$ɋP8cj$PV uUSWVL$HƋT$t$$t$$t$$ u~襵tkNjl$(0hPW X t#$lj$ P $uΉ}D$,1 e^_[]USWV L$4É1O{u}D$PVw&ukD$=r PuFn@1T$8‰$L$<10jSPQt$Vv'uhSt$H 11O ^_[]USWV $ $HÅ$H $84d=8d1M-dDd-\d-Xd11PPP> 9cƅf<@04K$k 8<S,s(0|$h jW UE@L$u uP t C @S$z$L11ҋqy tAtAu-t uuB$u΍D<@ՍD48K C$@K C${,s(k K$S,s(-Hd Ld5PdTd$ ^1 ^_[]Ã=dt"j(jhd| ju)VbV*V趹VٸV蘹^_USWV=i~i;Lit8u =i~xhg[=jiu)~Y1FA4iPhW˛ F;5i|4~01 QWrh[4iFVPhX蔛;5i|ҍt$PD$P=ih3Xa1=j¹tXtX=iD8PQ0j5id D$PD$Qiǃubin1=jËiXt$XDPQÚjPV4i=ihX4Liatd dr1D^hX=SWV|$WC ơH5tP5PWUtuhX_jVS^_[VP$hX4jPV襉 u@tPpfUSWV=dudl$t$tC9ʼnrS5dt$ x&PV5d )9s1D$)1H^_[]fSWV\Qƍ|$Wu%D$=<<9u D$9|ƉWSu0|$u#|$uL$  9|ƃ<$uD$uD$<9uL$"9|Ɖ\^_[fWV=Uau"Wx PWjdZu j`.jd$uhjd_jduhj`Bjd u j` jd uV ^_f=dSWVt$dNr'Fs>Fdld5d lR dpx0\$FѣdltdjSW D$d4 5d5d( d5dj: t,5dj- t5dj( F3]6|$jWP+ d+o5d5d d5dj:? td5dj-+ tP5dj( uF:6t$jVP ɉ dtdPQ d d =dPtXjPhd^_[Vt$ u-dHs5dj ku bdHs5dV? u^8^VdHs5d.et#Ph,Pt @tƉ^ádHs5d|$t u USWV D$44|$8ÿgfffi= <uVRhXj U较~7w2Uh]RO<$tD$@8@uUh]R+j*ur:Pijtjuu1ۃ|$8t hXȏ؃ ^_[]WVƹ׉ 9}9}^_iL$@BUSWV$c?_!BW !%DGӉW7EjUhu E9}G?x&o1GG_GoGG1A$oGGt*G$tf5t1N<1}u4$u/1PjjVV7!tGGO^_[]VPjVhu ^USWV8|$XaD$T$t$PD$`L$\L$T$L1K|$ t$uD=edu8;du.d9Ƌ $ d|-d9 $ d} )|$`|$ujǸ$1ҋL$LyT$LD$Ɖt$ $L$ |$|$BtvuB9D$D$ }]ZJ ˋl$֙D$$Й)Ӌl$9t$URQt$46ttlT$LkBt_fD$(D$fD$*D$fD$,t$'fD$.$D$4D$D$0T$(t  l$*y G|$`tL$ |$t$td $ dt$5dd ded|$ 9)B ePQ|$WsT$X t$L$ Blj|$$)D$`1ۉ؃8^_[]fW|$ L$f1_VWt$|$L$f1_^VWt$|$L$f1_^ËD$t2@Ƀ t t @uH@t t uH@SWVL$YA11B~ v~σv%~$=e$(=W$= D=6/(!@ @ Y t uY t uAA-u6!thY!j軜1 1L$1@^_[VhXWV|$L$D$ 1҉1FtD-tPwt.-uWPuhY蟉j91^_fUSWVd;du9t$~nWEtV8U-u!e1ɃHd de^_[]USWV|$=euWx=euWt-WY dQdd| d_7\$? $ hQP D$ D$081^_[]Vp@tLN0t|tNw|F4j|^|1^USWV ͉ƋD$ 1ɅtfӋ~G4$;O}IT$D$P[u>t$9wVt$ S GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV T$L$ AxD$p$ uՋ#$1鋐1 ʋu&|$4)T$P+$9wʉ1&D$\$4$L$D$L$ Pt ^_[]Ë\$tLDzD$ HL$ $t$Rt$QSjpD$0Pu\$Sjt$ _ D$ $L$\$WVt$ xtt1HtG1)ΉwOOЉΉ^_SWV֋x1j|SR G FGFG$FG^\FX1^_[USWV T$PB$1D$BT$9BD$T$ L$PD$;$<$~Yl$ $D$Efut-]sfM}D$T$4`=VWk E;l$rT$B  $ B;JL$D$T$ OD$k hWYiyD$l ^_[]ÐUSWVL׉Ÿ<xljFu  bu-wC$D1QWhRRjsPÅt ؁L^_[]ËVgVL$ptt1Hɉt#I)ЉIIIЉ^USWVΉՉË|$$=fD$4$l$CIى\$ ;IŋIt$uq));$r$I+I9r|$VW\$S9 II\$)4$L$ l$|$$$1Ƌ|$$t$D$e^_[]USWV֋hj|jRn Md1Y< w |CBuWD$Ml1Y< w |CBuW$Mt1Y< w |CBuWL$N $NFIFXF\1^_[]øY XVƸtNtȺ0IdF1^USWV L$ )ЉD$(D$1T$L$ q $D$I|$4D$,IHuBPjt$ |$D$$ |$dž,IHTct$ \$ KT$Rt$WPUjsQthY?dNu,L$9tWQhY!d D$$t$)uD$@T$1ۉ؃ ^_[]USWVt$1~09 u Av z011,0|9~ D(C9u^_[]USWV,։ſbSbFL$QShjj@jvPD$l$ t$(\$C\$1۾|$(|$uojhDZt$ 舧 uND$HP1ʉT$$É\$ $ދT$Hf9t F9r\$ 4$FT$ۉ4$%ω|$D$$T$ 11F1|$\$t$uo,$l$$t$ ^_D$(HL$ t$ l$$l$UShVRjpD$(P<|$ًt$,$u%9t9buq $AT$u` $I ɉtN< |$AL$ <$O"!|߅tDWw$9׋T$u|$ OCA|$ ͋|$?tQŋ $9M$;t.u.$|;uӃD$ L$ ~IL$ G;tЀ r믋|$\$ $|$\$D$9j^1jPVM D$(p1ɉNEFN 1ɋE FD$N؉\^jJZH@Ⱥ7^1USWV͉$D$ pɋN.(~V9l$ n^ tr|$]L$ AT$RWhSUjqP|$D$9tI$N‰ЃNl$~9||$<$sj%l$ (9r~))9wω|$DWP|$W D$lj<$N)N1틔$$+FN҉Ǹt޾|1*1^_[]øWVt$ xtt1HtGw)ΉwOOЉΉ^_Ë@B$1ɉJJH@B\JX1øJZ_OfUSWV8ӉD$[1hWP辢 s j[t$D$$F&[CsH $l$4}Uhd\$SP UҹtӅuٸ 1L$Q\$(S Q1QPjVT$Ņt$ |$ u}{uw;buo$ȈC=|$w:Cp1Ƀt 1AuCtZŅt8^_[]ËL$T$4T$(11ۉ $d\$ <$WD$T$L$P>9\$/T$jnH^Ltt  T$t1<$UT$BL$QWvSUjrPL$;Ndt\$9\9u t9$9$Ht/q9u|z 1H170jZtt  t1 ^_[]USWV ։L$i  L4n;u?OD$ED$ D$1B9։$| <[ $9)1B9}1ɉ14$|`+$l$tTMttT$l$U$mT$  t1L$ T$Rt$qPWjUϋD$PD$;Gu9L$t$9wVt$ S訚 GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV$T$yGD$$tL$ OL$tt$ T$ ut$4 D$t$wZX D$Ht19|$D$t$s!!$tT$ ! $ɋT$L $1鋗1 ʉu2!Ƌ$)D$0T$8w)΋OL$19ރs!2D$ L$ PIt$^_[]Ët$ t}HQL$ttL$T$ JL$JL$ T$L$  t1Qt$PVjt$$D$$Pu4$Vj7 GD$D$t$WVt$ xtt1HtGw)ΉwOOЉΉ^_WV֋xj|jR賗 G FG|FFGON\FX1^_USWV T$ƋP1$BJT$zD$T$ t$P'D$=D$~]l$ D$D$}t=Eww*rm4=]S9ljT$VuWZB E;l$rL$AT$A;QAt$D$T$ J$B hWYBP$B ^_[]fUSWV8ӉD$O1hWPF s Nt$D$ FNCsH $l$4}Uhd\$SP UҹtӅuٸ 1L$ Q\$$S Q1QPjVT$Ņ|$|$ {u};buu$ȈX=t$w=Cp1Ƀt 1AuXMŅt8^_[]ËL$VT$4T$(11ۉ $7<$?L$ hQP胏 D$ D$0(1^_[]Vp@t1tNXt$9wVt$ S̎ GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV T$yWtL$|$t \$<$ u݋42t$ |$wR_\$ Ot1ۋ|$9߉|$s#\$ t4! $t1苏1 L$u2T$ !)L$L$41W)‹<$19s!D$L$Pt ^_[]ËD$tED$ED$H $D$RVQPjD$ pD$PuVj賌 O $L$(WVt$ xtt1HtGw)ΉwOOЉΉ^_WV֋xj|jR4 G FG|FFGON\FX1^_USWV T$ƋP1$BJT$zD$T$ t$PD$=D$~]l$ D$D$}t=Eww*rm44>]S躉ljT$VuW6 E;l$rL$AT$A;QAt$D$T$ J$=7 hWYD$[7 ^_[]USWV4։D$(CljD$ h(jPNJ 4$~ pC|$$D$G,C $AiPT$1҉T$0T$0RhdQP L$0¸uȋ>>1QPSVąL$Qt$h RPjUT$ E|$ 4L$33 u\=8 t=Tt@A0==`It1҃t1Bσ ut$ HB$ŅL$pD$$|11t:L$ I1҃(‰)I;L$uFt$PWz t3F9rL$ AT$A;QA YH>$X2L$ A %=uTqt$< 0|$|$L40@Pt$ Q: 9(~Vt$(pL$t$D$ D$$@h|@Od u1$J|$W\$S|$w0UPjrQu\VSD$8Pv |$0/D$(tlj$Ou-t$FL$01D$ h(-j ŋ$B4^_[]ýUSWVT$ B$pL$1ӋF݉1vxN`1 t1ՊNd $t1>T$ BL$Q\$Sv0UWjrPDžuRD$;F0uD$K 1D$1vxD$hPQ, 1H$ ^_[]USWV(\$t$9wVt$ SC GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV8T$ ϋQBrD$HPT$$T$ |$t$t؉1ҿ 9ڋT$8t$$D$|$ |HV$ƒ߃ N t1ҋ$9ЉD$|$ }!L$@#QL$ L$I0 $ 1$1 ʋT$u1!׋$)T$ :U~)ϋN L$19߃s#:1|$(GL$WSte^_[]Ë|$(L$, tVL$9L$AD$QL$IdD$ t1Qt$PWjRD$ Pu<$Wj D$ $FD$T$|$ WVt$ xtt1HtGw )ΉwOOЉΉ^_WV֋xj|jR菀 G FGFGFGO N\FX1^_USWV T$ƋP1$BJ T$zD$T$ t$PkD$=D$~]l$ D$D$}t=Eww*rm4p>]S~ljT$VuW9+ E;l$rL$AT$A;QA t$D$T$ J$+ hWY!9$+ ^_[]fUSWV8ӉD$71hWP& s 7t$D$ F7CsH $l$4}Uhd\$SP UҹtӅuٸ 1L$ Q\$$S Q1QPjVT$Ņ|$|$ \T,(CHKLЉ8<щ@DC0=t$>=`r7Kt1҃t 1Bu6Ņt 8^_[]ËL$TT$4T$(11ۉ $7\$? $ hQP@y D$ D$081^_[]Vp@t.t NQ01F 111^USWV ͉ƋD$ 1ɅtfӋ~G4$;OG}IT$D$P[u>t$9wVt$ Sx GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV T$L$ iuENPUT$$ u׋8 D$-EU_9؉ËD$}!@#^L\$N0L$11 ʋT$u2!Ћ|$)T$T$4:u)΋M $19s!2D$L$ Pt ^_[]ËD$tKD$/D$ H $NdT$щRt$ QVjpD$Put$Vjv ME$T$D$WVt$ xtt1HtGw)ΉwOOЉΉ^_WV֋xj|jR0v G FG|FFGON\FX1^_USWV T$ƋP1$BJT$zD$T$ t$PD$=D$~]l$ D$D$}t=Eww*rm4>]SsljT$VuW E;l$rL$AT$A;QAt$D$T$ J$9! hWY.$W! ^_[]WV|$ jW#x*t$t$Pj t^VX`hpxP%= bHYZtPhXRW. btP]!PhP7. hg[(.1N^_USWV@t$T1PPPV'!ƒDj@UV% @t;uxhcZ- bP PhP-\$\|$XjhRUq uY|$uRiD$iSWUV{khvZ_- bPa PhP;-wjhRUq uc|$u\iD$iSWUVuB1tAG+PhZ!S,hg[,hg[, bO5 b@^_[]ÐUSWV$1hWhir i =jWV!9Nj$$D$PWu\$`t$d1D$`}9t$d}W"@+Ƌl$`1ۍ9͉rQPW" ~)W"$D$<#t t< u FFF]}CG<=tCGC؊t t@jhKU n jhZUm jhZUm jhZUm jhKUm jhKUm jhV]Uym jhZUam SU$W$KiGt?<:tNGD$ )i@D$Ѓ rYi$iG$9eL$1҉T)T) b1D$T$$D$,T$d$(|$t$ t$l$ 1D$(1D$,T$D$t% @uljƋT$lD$tl$ L$,t$ D$j<V(L$hUD$Pv, XD$,l$4D$T$ F>|$G $TT$lt D$tD$$t'L$hT$Vt$$t$ Ut$ l$@ƋL$hT$l$0UPt$  D$)D$t$T$ T$ L$lI>$T0T$l$l$l0t$D$0ƃT$ l$D$@%|$$WP\$S ؉D$pL$,Hh$1@D$tD$$11D$0t$B<l$t$4$Dt$81F1t$l$ 9 $LI$4?|$$D$j h[P}`T$x |$$tX|$[t[,$t Ph[C L$hT$t Wt$ ttT$l|$+D$ $DD$ DD L$lj|$D$\$p1-rHL$89u 9q$E@Hu$||\$pFB<9J>D$t@tދ $;D D$\r{;뼋L$hjD$@Pso @|$<u:|$@u3|$Du,jhP?D$PP` ujD$TPhib {;\$pT$lL1@D$t$l$|$$|$4t1D$,%L$WQt$h |$u hW!B$\t T$0MT$l|$D$t l$u -1B$B B,@J(B6QWRT$x D$(!#BCC {s1T^_[]Ë$T$4t$$T$4T$0WVjt$RQ!ƒt0|$Wt$V t19tP bh[ht[ btP PhP hg[1H^_SWV׉jt$t$Q!!ƒt8D$\$ %SPVM t19tP bh[h[* btP0 PhP  hg[1H^_[ÐUSWVHl$dL$`d$hEEfyD$y,VL$\|$WD$PT$`fz,\$1@D$1HD$ 11${[Qt L$hu upL$htg EuC!D$E|$[th[sPh[8? L$\T$sssV 0D$t L$huuGL$ht; Esu%D$EL$ 9wȋk $9rʉ$D$ kC)v>L$ht5Rh[>CKST$)QR腌kC)v?L$hl$dT$`t4$9Ɖr $GJ, 9ωVl$dT$`fyD$mA0<ËV L$\|$WD$PD$)1t$`~4V ~*RL$$QV̋ D$l$3F0fL$L$ YC‹34$9ν wKD$Dމt$!ƃt uX%D$4$P) L$\T$4$Vs, +D$CM,$#l$D$`@0l$Gȃ(9R|$fT$ $1ۍ,t$ TwJt$\?L$\T$VWD$t tiD$ D+L$D$`@0C9r$zu9t(IuL$`I29tL$ D bD$ T$D$T$1HD$ $D$T$ $D$h% t $4$t$D$hT$`PL$(ED$B04'ËW L$\VPD$(D$G2LL$|D$hD$ t"L$\T$Wt$ t$ ; L$\T$WD$P|$$\t$t$+$L$`I2DT$`GƉt$t$ϋD$4ȉ%t$|$WP\$S萈 ؉D$dL$ HhG؉n1@D$hD$ 1D$D$$B0t$s,t$,1Ft$9jIt~5 bPh[m b X5 bPh[:jP$h Pj  b- h[OVĀ^_[]USWVˉƅtRSyl$D$ tPNjD$Go D$PSUuT D$D 1ۅt: PURx%uUSt$t$$h\ ˉ>^_[]Vt!ƍF vPvh\w 6u h~Ub ^Vt01 u^Ph,\< SWV|$1H w1Rjt-uT$jQ1 b^_[ÐL$u\ct?t 9JRuQh^\j$h k  kfVPD$ L$T$t$4$VRQP^ÐUSWV|$t$&{~ tatqt c %uM9vgKjzj z>u/j mz9v8EPZzE9u" u0 t+CQ3z)9ZC^_[]j zUSWV|$\$C1FCtCɉttGu b4A1ɉNN NNT$ RPVl Åt b1O^_[]Ëu~tOD$t@8t;=a~D$1C0`UttN$;a}D$C݃1뇋$rFH dVуYn `USWVt$w4<@>jt!L$T$l$ u(>jUV b 1JщЉ^_[]Ãtu.>j>j>j>j>j>j biUSWVl$ waD@jtM1ҨujɾtQ1҉Ƌ1ujt WP u҉t5 b1H^_[]1f=Dktá@k]Poojeo@kÐSWVHkt3Hk11N9rtO9r׉މNj@ut0\awQt5\as H ^_[QPh] HkHkfVPt$ =Lku Lk%D$$PVShg[.fWV1j?t VFu^_ÐPD$L$ $QPXUSWV D$8$|$4GG<%t Pn1GrwUø$4@1yluψ@ Ƌ $ $$0SR|$t$$1rj0ymjxom|$u\$($1[$0$FP5mFu|$W$0$1S$(HP$1һωމ@\B9ˍ^ʼnrD4PlNH$0h$|$y޿j-l1jj UV,? ي@L<G 9KƉrDP,lK$pP$1һljމ˃@\B9͹ٍ^rD4PkNj$0h$1jj UVf> ي@L<G 9KƉrDPfkK|$$ ^_[]USWV$L$8D$< PkDTkɽtD$D$\$@CC<%tPՃ\$1ËL$AD$rwb$@1yluL$@ 뼋 $ $PՃrl$$(ҋ\$PRgl$l $ $1hj0ՃjxՃl$u] $ $1\$0$\$FPՃFul$X$0$1T $yQ$1ҽŃ@L B9Ÿnȉr΋l$D4 PՃNK$(x$yݾj-T$ 1jj WU; ي @L4 F 9Kʼnrċl$D PՃK $yQ$1ҽŃ@L B9Ÿnȉr΋l$D4 PՃNh$0x$1۹jj WV0; ي@L C 9MƉrċt$D, PփM\$ L$8ɡPkt)ȃ$^_[]PkáPk;TksL$PPkfVt$mu`N1A FFFQ tV0A4?AA1JQAA$AL$t*vx),V@< w!1H#D$F<~@11Fs|$FX$@=??u @?@?~N L$0n$J?11ҋ$x1PPP\$*ڋ\$ L$,$A0D$??|$dW$xt%l$ р\$T$T$N?wBMFӉ‰؃ $AA?$A$$@PA@X @TI@\@G?'1рFÍBr wpFÃRrl$ ى׉ڃ,$EdCEh l$ h`L$|$@l@E?1ɋ\$l$ $x`Hl|$ 9skʉكw#YM>Ft$t$,$t$,$ˋt$JMlAf|Utt$;L$ ʋt$r\$\$w" A$fDBt$Au@lD$\<$GpGPGXt$Pt$\t$Hjt$djD$l$ $@^Rt$ދ$hl$HL\$9T$Љt$'>Fˉ|$9re$HLыT$0|$$ $ADBT$0O|$$AH?$x t$L$AL$Ӎpr$@  ˉ91ۃ$$HD@B?3D$C?T$$@D\$tP9wŋt$$9t$$wVR\$8S6 )|$ )t$$\$0$)pDl$ H ىӉŋxD3t$@l@F?1D$T$T$HdPhL$8ʉT$49ՋL$@XPHX1HЉ|$(|$\$D$ !TD$9sC\$(|$xL$AL$у#L$ T$T9r͉ߋ\$|$|$(\fw#)ЍM$Jlf\jt͉D$L$@$ftVfJL$ 9s(L$9AL$߃;D$ r؉)ЃJL$ 9s(gL$9AL$߃;D$ r؉)Ѕ $TirIJL$ 9s(L$9AL$߃;D$ r؉ )Ѓ1҉D$);D$4\$@$WfThtEIuhl;l$4|$ |$(|$\$D$ 4|$ <$ftt$D$\GpGPGX l$PUt$\Qt$Dt$dj4$L$@_T$@? 1 \$T$l$ $@] $@^ \$l$ $Am^T$Q?D$ Љ\$1O!ߋ,$}D}D)ىÉEJ?Չډˉt$$xTH\1N։!|$ D9s7T$l$ |$jG!D$ D9r|$t$ 4t$ t$ tL$ tft$ $t$(1N։\$t$4!\$(t$ LL$89D$ T$l$8FD$D$L$كL$#\$4L$ \$(L$ lL$ D$9D$wl$8ŋt$ D$ D?$@Z^Q?L$l$ \$T$ ֋T$<+T$$$Q $Q L$0)ы$x@^RQPY$@^D$Q?T$LfL$l$ L$ T$)‰Ƌ$D$8\$)Ɖ$L$ @uTD$4$FHNLFK?L$ 9sUT$Љt$j >F;D$ r/\$T$$@T_T$Q?l$ Љ1OL$ !ߋ,$}H)Չ‹D$L?L$$ l$ T$D$<)ȋ,$}H)‰\$v!;U0v-t$$@j_$ t$D$0)UD-t$L$$E4)v E,)E8)E8֋UD9։w9ωw)ʋ<$WDʋ|$0@GJu|$0)͉l$$$xDtT$ D$H?‹t$ T$ $I$tA0T$\$t i{=Bi $@]I GpGTG\GdDGtUt$dSwhPj,D$$$@"_T$Q?K@$t  L$s+$@ t"D$DfjPt$46L$ 6?11ۃ- FÃRr$@$tX$@L$t'@ t!D$DjPt$46L$ 7?11ۃ FÃRr$@$tˉHH $@t'@ t!D$DfjPt$46 $@8?@1 r$@$tg@^5 FӃQr $YDI$tY1 s)$@ t D$DfjPt$461Ƀ 1ҋD$9?ˋ $A rt$ID9wͅT$\$$Z$ۉ|$ t3St,{[)ω)v9wQt$ R, $@ $s@ tUt$ \$43 |$ )l$HD)HD\$$ɋt$T$@D@:?$@u@$t@$T$l$ \$17H$tAt$RD;Q s J,$MDFۋ$t9t$ w@t@ tVWl$4u E$0 l$ )\$T$@D@;?$@u@$t@$D$T$l$ \$17H$tA$t$RD;Q(s J,$MDFۋ$t9t$ w@t@ tVWl$4ue Ezl$ )D$\$T$L$HD$ 1ft$4l$ ,$\$l$ YL$HD$ 1ft$4<$C|$D$ LfL$4L$ \$)ʋ4$׈D$(ЉT$Ht$D$L)‰T$D$4$CD$|$(t&L$H u1@uKHL@I?T$l$ D$M?T$?\$l$ ǀ@??T$ \$l$ $@8_T$Q?W؃t$Q4$v(u4$V(փ94$F1FPPD$P F$A01 =?FD$t$;$@]H|$ $@^D$Q?HD$$A^T$Q?D$\|$ $A^L$Q?D$ʉt$1~o~D$D$1\$WD$ T$‹t$:T$D$(lj1D$D$%1D$D$뺋T$t$1D$D$$|$0y ؉׋T$$Q1l$ i͋ $A?u܍C$C$>?u$1PPP% UWP ;KuUt$R?|C1nVt$uNA tD$ A$@01^USWV t$ t ^_[]ËFnu }@r}S?tVES?EuFǀ^Vt$u"F|$ H t t 1ɉH 1^Vt$u1VrL?t1C?uBD +BD^Vt$t1HNAp)^fUSWV$$fDlut$:fD|LNu$2f|TLuDJu$H@P1A$D$D$Č^_[]9։T$w1Cf|\Lu Cu9ډ$r$1B1O|$|4l)xu~ t|$ufD$n1ftjfut21ҋ$4Vt|tlݍ_f\tl담$f~B9u1t2 $uS wyD$ D$$JD$ fJD$hD$$D$ D$$D$ $?1҃D$D$$"KD$ Ju D$ v1@D$D$ T$D1@D$D$HD$@$1HD$1D$41@D$8T$0BD$HD$+D$D$<$t$(4q΍Q|$D9\$,s19v`1)ыT$$JT$ 4J1MD$\$1@9uL$ D$)v\$1@9u+L$|T$jڋ4$rAGAGwtuG AGT$ ‹L$ 볹??8_ 4$t T_4$L$XAQ?D$H)ƋD$X0L$$)x HL$ )H1H!L$A[։!ϋ],\$$!׍\!Ћ]0\$ !"k!L$XY4\$‰!q Ӊ!؋I8L$Ɖ!荴0Cy։ЋL$8L$@!ōL$XICʋ|$ 1ȍN֋\$$ 1э9~S 15: \$4 1ƍ>*ʉ 1΍ӆD$H|$TD$DGT$LWL$PO j@jD$`PsĤ^_[]USWVD$ |$1ұՃ<,ΉՃ ,uNjt$ N?17)ȃ8PhbKV jPV LLLLLLLL@ujXjV^_[]ÐVWST$L$1t8uЄtZB͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐVT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fSWVL$t#T$t$1>:8u1tG9u1)É^_[fUSWVD$,t$$$tD$,"'CH tr<+t<-t D$ 1ɉL$CD$,t$u;<0u7 xu-KʀЀ rʀŸr ʀ¿w $1<0ƒ|$,u эL  $1H14$D$ 1K1н rrw';,$} 1;t$ wu94$KC1G1ND$(tt\$L$~ـ|$uȃ^_[]t$,h_h_:8u G9u1)^_[ËD$t8t9@€tuuuuH+D$ÐVS\$ t$tCFtD8t>u(CV9u!€tފCFt8t)[^VSD$ L$t 8tft`@͉ ыލ1΁ €t8u.t(8u!t8ut 8uHu1[^fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ÐV|$t$ L$uD$^ÃrfftFGK K ^.KTK}K7KYK'KK&RK KKNK K TY K %P-P$P,P7PBPQP`PPP_PqPPPPPPPPPPPP^e[ !###!#######{"5.12 (Fri Jan 30 10:54:41 UTC 2026)NetBSD/x86 BIOS Boot11.0_BETAIчHZIчHIчH2IчH-чH-чH(s*K>;AM3iǁ|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+\ M}-3Dh&ǪX~B4ϳ`1bOh3qJi=rGy=iG};Mt?mWC 3KOOyD<#*=(SFH0eCSFU0eCHah!IdontNeedEFI,7S<7SL7S\7Sl7S|7S7S7S7S7T7 T7T7'T73T 8FT8[T,8rT<8TL8T\8Tl8T|8T8T8TUUUUUUUUUV VVVKVT#V,V7VSS n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @ inflate 1.3.1 Copyright 1995-2024 Mark Adler  #+3;CScsM !1Aa  0@`@@help?quitpkbootconsdevrootmenuloadmultibootvesasplashrndseeduserconfufsNAME=%sNAME=%s:%s%s%d%c:%s(invalid)boot.cfgPress return to boot now, any other key for boot menu booting %s - starting in type "?" or "help" for help. Wrong password. commands are: boot [dev:][filename] [-12acdqsvxz] dev syntax is (hd|fd|cd|raid)[N[x]] or NAME=gpt_label (ex. "hd0a:netbsd.old -s") pkboot [dev:][filename] [-12acdqsvxz] ls [dev:][path] dev [dev:] consdev {pc|{com[0123]|com[0123]kbd|auto}[,{speed}]} root {spec} spec can be disk, e.g. wd0, sd0 or string like wedge:name vesa {modenum|on|off|enabled|disabled|list} menu (reenters boot menu, if defined in boot.cfg) modules {on|off|enabled|disabled} load {path_to_module} multiboot [dev:][filename] [] splash {path_to_image_file} userconf {command} rndseed {path_to_rndseed_file} help|? quit /Exiting... Could not reboot!%s/kerneldefault NAME=%s on %s%d default %s%d%c invalid console device. truncated to %s No menu defined in boot.cfg enableddisabledoffinvalid flag, must be 'enabled' or 'disabled'. multiboot: %s: %s boot returned onetbsdonetbsd.gznetbsd.oldnetbsd.old.gzonetbsd/kernelonetbsd/kernel.gznetbsd.old/kernelnetbsd.old/kernel.gzbooting %s (howto 0x%x) %s.gzpccom0com1com2com3com0kbdcom1kbdcom2kbdcom3kbdautodiskhdfdraidmodule name too long couldn't allocate command exec returned%s is not a multiboot kernel couldn't allocate module /prekernWARNING: couldn't stat %s WARNING: couldn't allocate module list Loading %s FAILED WARNING: %d module%s failed to load i386amd64generic/stand/%s/%d.%d.%d/modules/stand/%s/%d.%d/modulesWARNING: couldn't open %s (%s)%s%s/%s/%s.kmod%s%sWARNING: couldn't allocate userconf commands list Unexpected ELF class%s %sELFlseek failedread failedUnsupported multiboot address header Unsupported multiboot relocatable header multiboot2 info size mismatchStart @ 0x%lx [%ld=0x%lx-0x%lx]... %s, Revision %s (from NetBSD %s)_SM__SM3_NetBSD RAIDNetBSD FFSNetBSD LFSNetBSD SwapNetBSD ccdNetBSD cgdEFI SystemMBRFreeBSDFreeBSD SwapFreeBSD UFSFreeBSD VinumFreeBSD ZFSMicrosoft ReservedMicrosoft Basic dataMicrosoft LDM metadataMicrosoft LDM dataLinux dataLinux RAIDLinux SwapLinux LVMApple HFSApple UFSBIOS Boot (GRUB)Out of memory disk cd0 cd0a fd%d fd%da hd%d%llu GB%llu MB NAME=%s( hd%d%c(raidframe raid%d serial %d in NAME=%s size hd%d%c size raid%d%c(, bootme%s not found EFI PARTUnexpected raidframe label version unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660ADOSFILECORELinux Ext2NTFSjfsvinumUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedVBE2VESAmode 0x%x invalid mode 0x%x not supported mode 0x%x could not be set WARNING: failed to set VBE mode 0x%x DDC [DDC1] [DDC2]: no EDID information : EDID %dx%d Modes: [?] none foundlist0xmode %s not supported by firmware invalid flag, must be 'on', 'off', 'list', a display mode, or a VBE mode number VBE not available 0x%x=%dx%dx%d %c. %s %s%d. %s Option: [%c]: Option: [%d]: Choose an option; RETURN for default; SPACE to stop countdown. Option %c will be chosen in Option %d will be chosen in promptbootinfo too bigunknown command > com%d seconds. 0 seconds. -%c: unknown flag invalid arguments diskbufp %x diskbuf crosses 64k boundaryufs/ext2fsbad dir entry REGDIRCHRBLKFIFOSOCKLNKmsdosdosfsustar%8oustarfs@Warning, unexpected short transfer %d/%d ustarfs read512block Please remove disk %d, insert disk %d, and press return...Disk is not from the volume set?! CD001cd9660lfsWHTread header failedread header short=0x%lx Could not allocate memory for boot configuration bannertimeoutdefaultvalue:%c clear \\-__,------,___. \\ __,---` %s \\ `---,_. Revision %s \\-,_____,.---` \\ \\ Password: lseek section headersread section headerslseek sectionread section%s%lu++%lu.SUNW_ctf%s%ld [ls: %s stat: %s no ls support for this file system %d: %.*s (%s) %d: %s (%s) The ls command is not currently supported for %s Unknown error: code %dbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentNot a directoryinvalid file offsetPermission denied1.3.1|/-\heap full (%p+%zu)incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check%s: invalid base %dstrtoul    Pl+9ABԊяcȋ)$چ4p&7=̩.oس޳ XP39{ؑə 74iLqqsss t(u5|؀ހY/Ѷx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f W++)1_WVRVRf+ ufZf[fYfgNP 00<0u ^Boot failed (errno xx): & vUSWV|$$MU+ ++h+jh+'+t |^_[]jhy+ǃ$+@+jhy+ǃ=+5+D$8D$4PARTD$0EFI 1AD$|QPL$0QWVh+1Ʌ$z1=Us1ɀ$>^1C؉S$RSQPh+11Ʌ*D$0j$QP 1Ʌ1Ɂ$1Ɂ$$D$1 L$,9ѺT$wD$$D$rt$(|$qރ1D$D$D$ D$$1AQ$PQWVh+**t$(|$1ɉ|$$t$ L$D$,\|1D$HD$DD$@D$Ѷx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f Wt- -)1_WVRVRfl- ufZf[fYfgNP 00<0u ^Boot failed (errno xx): & kUSWV|$$MU- --h,jh-,t |^_[]jh, ǃ$-@-jh,ǃ=-5-D$8D$4PARTD$0EFI 1AD$|QPL$0QWVh-1Ʌ$z1=Us1ɀ$>^1C؉S$RSQPh-11Ʌ*D$0j$QP  1Ʌ1Ɂ$1Ɂ$$D$1 L$,9ѺT$wD$$D$rt$(|$qރ1D$D$D$ D$$1AQ$PQWVh-**t$(|$1ɉ|$$t$ L$D$,\|1D$HD$DD$@D$t$9wVt$ S GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV8T$ ϋQBrD$HPT$$T$ |$t$t؉1ҿ 9ڋT$8t$$D$|$ |KVT$ƒ߃ N t1ҋD$9ЉD$|$ }!L$@#QLT$ L$I0L$ 1$1 ʋT$u2!׋\$)T$ :U~)ϋN L$19߃s#:1|$(GL$WSte^_[]Ë|$D$(T$, t<L$Id t1Qt$ RPjWu|$Wj D$ $FD$T$|$ WV֋xj|jR G FGFGFGO N\FX1^_fWVPT$t$D$@<-7Wl-+71Ƀ ȃ^_fWV<-1L$D$ >tG u ACttl-1O^_ÐT$D$@<-l-1ÐSWVp-t3p-11N9rtG9r׉މNj@ut(-wT- H ^_[Ë p-p-fVW|$ t$L$1_^wHËL$1H@<uÐW|$D$ L$WX_ÐVW|$ t$L$Wt 9rNOX_^ZIчHIчH-чH-чH  NetBSD/x86 ffsv2 Primary Bootstrap set_geometry Can't open /boot /boot load failed Invalid /boot file format bootEFI PARTt-1м|ؿ|PWˀ~RRJ*Ft ~u. uƋu-P^ Z1fluCZRDPBTЃ?Z?H9tGUAZRerUutf. BZRAr|t}=UQufZ ZtL||Error NetBSD MBR bootNo active partitionDisk read errorNo operating systemInvalid CHS read`uaUѶx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f W- -)1_WVRVRf|- ufZf[fYfgNP 00<0u ^Boot failed (errno xx): & u5USWV|$$MU$- -(-h,jh(-,t |^_[]jh -Gǃ$ -@$-jh -ǃ=$-5 -D$8D$4PARTD$0EFI 1AD$|QPL$0QWVh(-1Ʌ$z1=Us1ɀ$>^1C؉S$RSQPh(-11Ʌ*D$0j$QPI 1Ʌ1Ɂ$1Ɂ$$D$1 L$,9ѺT$wD$$D$rt$(|$qރ1D$D$D$ D$$1AQ$PQWVh(-**t$(|$1ɉ|$$t$ L$D$,\|1D$HD$DD$@D$t$9wVt$ S GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV$T$y_D$tL$<$OL$t T$ u43t$ D$\$ wU$p Ht19ًD$\$ s##t$D$<$t !L$ɋ\<$1鋗1 ʉu3T$!)D$T$8w)΋OL$19ރs!2D$ L$PXt$^_[]ËD$ tnL$L$ tt $L$IL$L$ $ T$ t1QSRPjt$uSj GD$D$WV֋xj|jR G FG|FFGON\FX1^_ÐWVPT$t$D$@L-7W`|-+71Ƀ ȃ^_fWVL-1L$D$ >tG u Att|-1O^_ÐT$D$@L-|-1ÐSWV-t3-11N9rtG9r׉މNj@ut(-wT- H ^_[Ë --fVW|$ t$L$1_^wHËL$1H@<uÐW|$D$ L$WX_ÐVW|$ t$L$Wt 9rNOX_^ZIчHIчH-чH-чH NetBSD/x86 lfsv2 Primary Bootstrap set_geometry Can't open /boot /boot load failed Invalid /boot file format bootEFI PARTlfs-1м|ؿ|PWˀ~RRdF*Ft%~u.?tn'4X u0״t 00);v堐,;:us ZPJƋu?`ZZ1ZRRfluBZRDPBTЃ?Z?H9tDUAZRLrUutf.RJBZR2r|t}=U3{fZZtL||Error Fn: diskn0: a`uaU1м|ؿ|PWˀ~RRL.f1f1ҍ*Ff~<t<t:t'~uf>?tV4fX uftfufff:2BZR}s0״t 00);v堐,;:us ZPf1$ffu?HBbZ1ZRRf.:2BZR2r۠|t}=U3ufZ|Error Fn: diskn0: I`uaU" . .. chroot  installboot wiconfig# . ..,misc, .#.. . ..- db. log/ run0spool- .... .../ ...0 . ..1lock1 .0..