08P.Qi'&<  '.QilP''`'%. %..Qi'&P@@<@T 08P.Qi'&<  '.QilP''`'%. %..Qi'&P@@<@TU .Qi`'%.yA.Qi.Qi.QiQ$f .Qi.Qi.QiRA.Qi.Qi.Qi^A.Qi.Qi.Qi_A.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.QimKB%.Qi.Qi.QiX`hpx$.Qi.Qi.Qi (08@HPXS$q.Qi.Qi.Qi`hpxP$.Qi.Qi.Qi[Q$(.Qi.Qi.Qi (08@\JA.Qi.Qi.QiC.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.Qim.Qi.Qi.QiHPX`hpx\$.Qi.Qi.Qi$.Qi.Qi.Qi$>.Qi.Qi.Qi$.Qi.Qi.Qi$s.Qi.Qi.Qi$.Qi.Qi.QiA.Qi.Qi.Qim .Qi.Qi.Qi$.Qi.Qi.Qi $.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.Qi$`a.Qi.Qi.Qi (08@HP$.Qi.Qi.Qi$.Qi.Qi.Qi$.Qi.Qi.Qi$.Qi.Qi.Qi$.Qi.Qi.Qi$.Qi.Qi.Qi$.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.QiA.Qi.Qi.QiDw&!!"Uo"rM@XG^nPSV< Hŷ <m4;sfΚN>l')7[QbCpvYvM<a_K"J ԁ4m.J7(+%. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4?%4 (p"p"zzm$22( TTT,,m$22Ptd(QtdNetBSDAPaXU SR ffffUSWVP[?.t$$ujPjjj茂j"0F $u & Q/tuXuk;(s(9rD$t P$P $;s9rHP#$06v@ PUSWV [È>.A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]7 USWV[û<.; s' ~*u.UE9r^_[] SWV[l<.;s9r^_[f$SW&<.5u1ƃ5 tЃ t$k_[SW;.4uYƃ4$t|$<$kt$?t<$ktЃ_[WVD$0tP>tKj/VKt@Ƹ!q"ܑ&PVt&uVhp"hp"hpv3&^_`SWVhp"hp"hpv3& 1۸!q"ܑ&PCPrFhpv3j F6whw%hpv3o& uhpv3j 6jD$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5~3  u$1^_[Vhs"Vhs"&3 5~3hs"jwVhs"j輨USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S&tutD$D$$D$% D$t$@N D$l$h ~3h"$xD$ @l$0tD$Phe$Sj iD$  |$\$4t$,s$L$)L >QPhu" D$  L$s()@L$L bQPhu"L$ D$  s D t 4T&hu"L$ D dtPh v"D$(@9XU\$D$T$T$9tt$N9BD$4T&5~3h*u"D 1h^_[]t$|ht"i*%WS$h>u"h[u"jUx5~3hyu"jt$|hs"5~3hnt"3$hu"jhc 5~3 u15~3h-v"jğSWVPD$Hw#t$>4&Wt ub8&$h"s"Wt N1AQhc5~3! u 1^_[5~3hBv"j/USWVP|$t$7{<h>s"WV̦ fu <~3u o3)u ~3uhAs"pIs"t ~3hjQm ~3u 5~3hRs"IhKu3$(&SUt uUh{s"j!h[s"jE$NPVS& P,V6pv3PhVv"V Vjjhv"&&hv"hpv3P uj5~3mWVοVt& tuVhs"jdx&^_VPΉj PQ謙 x $9u^Vht"j+WVοV&tuVht"jt&^_USWV\$$1~3 ~3h3 d3sV2j=Px<$hjjh<&U ~3H F H ~3VP3u~3t;#=t%{ ~3##=uthRw"<&~3tttzut!tcu~3X 3^_[] ~3zVhv"W Whw"4$hv"4$h"w"juhlw"hw"D$L$011PjPjt$h>z$<~3~3h3d31PjPjt$hw" 33hw"j1hjPPt$hx"؅33 tj 1PjPPt$hx"褅,2tZj ~3u$1PjPjt$h)x"lh3d3ËD$p3h:x"jG1hjPPt$hPx".|3x3h\x"j~3u$1PjPjt$hsx"~3~3ËD$~3hx"jϙ1hjPPt$hx"趄~3~31hjPPt$hx"莄~3~3fSWV3t/ `3\3 t5P3)փ>8F uP3~3T3 X3 ~3~3;~3 ~3r*jZ~3P3~3 ~3 X3T3^_[áX3 T3 t ~3~3hN&h"$j跘hN&h"$j覘hL&h"$j蕘hL&h"$j脘USWVt$|$66$r#SjSVWF u=o3PMp3u,p3$t33d&Ahx"j3d&1QQPf t3y 5p3L3 L3 =,2rl3uhNy"롡~3u#~3~3y"~3d&1~3H~3d& hQPe ~3yJ1~3H ~3 hP5~3Q ~3 ~3y 5~3~3~3~3utS1V d3339h3r_ L3t= 3 ~3E ~3t# L3) d3I ~3" L3ujl~3 P3~3x3 |3t ~3 ~3t ~3h`u;5~3 ~3=~3 ~35~3VP5~3W ~31Vh@36hjhj5~35~35~3~3ho -,2e=~33 3 t33 339ss$P3 d3tQj QjP 35d35P35t3P$ xd5h3-d31‰1 \3 `3T3 X333T3 X3~3 p3xPh"$+l3u63j5h35d35t3P  t5p3h"$觏~3 h3d3 `3\3T3 X33T3 X33C~3s `3\3T3 X33T3 X3 3u@s)t(3,3H P3PQQI \3P33~3 ~3j1X3T31`3\3hzy"j.Ph"$j!WV3=t=X=zu 7~3~3 ~3t;~39щ5~3s))Rj5~3 ~3 ~3~3 ~3 u\5~3=~3 tJ5~3j5~3= ~3 ~3~3 ~3~3ʉ~3)Ɖ=~35~3 t jY=~3u~3jPu 8u*~35~3Pt^_ho#jhy"USWV~3|$,t~3~3(p‰D$l$|$,u ~3 xT$ ~3~3 t!~3jQP5~3R !ƒ~t$VSh~3 $~ D$ `18D$ Z ~3~3 ʋ-<383t>5~35~3QP蠎0343331~3~3T$<$t$ 83-<3l$13L$ 33D$11 ~3t,~3u#~35~3h y"_T$~3L$ AD$)ʋ$tЃ|1@|p9@|5~3~3*~31 ~3T$1 uK33I$T$ ~3~3)ѣ~3 ~35~3-~3933$ t ~3)PQ5~3 ~31~3~3 ~3~3 t(335353QPVR tjh`%j[$^_[]5~3h/y"5~3hx"5~3hx"j蚎5~3h"$j踎USWVt$(|$,\$$Uh~3j[ C4WVs(P( 8jUj[ 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[hy"j V΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu+8u F ́Ĵ^v$h"$j肍VP虊9v V5VPQW t1$^ÐSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV~3 ~3t/jh2#jY ~3 ~3tjh2#jY 1t$PVPFȺMb׋ H3-։+@3D$H D3iى tL$ 1FD$|$ 535353535 3535353hy"jdW,WPWjX ,3(3 t?ƒ ʺ%tϥ#RQPhy"jd|$4WlWPWjW $3 3 t?ƒ ʺ%tϥ#RQPhy"jd|$4WWCPWjwW t$ 4303 t?ƒ ʺ%tϥ#RQPhz"jd|$4WWPWj#W <3D$=83jPt$ t$VÉiL$it$V)QP蟇RPVSt$Whz"jdt$@VB$ViPVjV e^_[]EVt$;VMjfUSWVl35x3=d311C3W5L35t3P$ Mtg~3u5p3h"$u3W5L35t3P$ ݅~l3t )u=d3N{T,2rOH,2d5x3 d3=3 |35h3jVP5t3W !ƒt^_[]hQz"jJ5p3h"$jhWV~3uD5~3 ~3=~3 ~35~3jVP5~3W !ƒuuJ~3 ~3ti11~35~35~35~3P$ ~J;5~3~3r,f ~3H ~3Phm5~3Q xw^_xof@ ~3Phm5~3Q tD;5~3~3s5~35~3h~3 3~33 ~3 t5~3h"$jfUSWVX $p $l 7Q$h$r#jj1hkz"WS艎 H-$&333@33333333u3i33S3G3;3333333=3-<E=3u =M=3ui $$P =3u j ]Vh#'t^_[]h#~"h~"hCh.~"h~"hDh}"hL}"juSWVt$=3<\$Wj h$r#RQPSn(SVhe@$^_[SWV|$13A3GO 31ʋ31 t$3 3jP5 3 39}3W3 39|_SQ33 3u 35 3WjP2x!9u=3353>XE0Ph#hpv3 h~"'0ŭPh#hpv3 h~"N^_[0萭Ph#hpv3 hJ&hN 3uá3u tjwGjFUSWVjՂƋ|$11K< @u=3t?jj5 3 5 3薶3335 3UjWy A)߉n3 3N F53q033-3F 30?Ph#hpv3l hJ&Mrh"]1H33T0Ph#hpv3* h"'+0ԫPh#hpv3 h~"LVđ1^_[]Vt$53q0F33^WVL$ 35$39})=379}>3829~vRO9G9~-823~Z3΋Nu#82)Ou9~82RN982 $3u 3uu82^_É1jDjDVT$3t=31363t@9uхt3uh%hK1^SWV1p33j?\h"譈3"tWt|8/uWh9"WhE"h(3c (3tLP t$hl"P蜾 31ۅu@W?5(3h"$ko"jkR"PJV蘂^_[V 3tAPxG 3(3t!P 5(3Z(31333;5(3f0PVhq&hpv3;h"I^Vt$ 3t3P(3t!P> 5(3Ɏ(3Vmjh3hu3} "x 3331,3@=ujuSVL$D$ T$t$,3,35,3,3~A2,3BI^[fV10343<383PCjP]]H3Fu^SWV5439503t$03VjjhH3ut=L3H3H3jjPPIMth"h"$[H@30P3@u83=<3VʃtVP G~*h"5O3r0h"h"$G1N1Nyh4"h"$G543~03H 03H31H^_[Ë 03u!T$74303143xD$Q03H31HSVփuU@30P3@uH3jjPPLth"h"$GH3 L3 <383aˍH3)Qh@3P虡 O3@30P3@uH3jjPPKth"h"$FVjjhH3T^[Vt$ 03u4303143x 1H^USWVh"lNƊtx<0uFD uh"h"$$EGuȿ|w WjP 1T L ш @uP3hjVf PK81Fth"h"$De^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$P& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVP3 t uhE"XC^_[]eC$t38u@353Nj-31;-3M1WtÃ=3tj jwSVVVSt$81Ʌ;L$uWwZ?E;-3|1MV315h35l35\35`35d3蒇5d3 3u 3uu ^j:jq;V5`395\3}d3I3P5d3螁tC5`3d3 3u 3urufL$\3r5\3 1^0ƠPh#hpv3 hJ&A 3u‹ 3u tj:j9USWV l$ D$fD$p 1P \3l319d3@u 9ul3Sk3 t$$PPh,  $ 3| t %u3ڃuh2#QUuhv"QŹjD$P 4Ë $X39}=T3]39|A‰T$R5T3NjD$X3=T3 3u32$@PSW褚 =3?5ƅt3VPP,+ 38uK=T3뜣l3Gh2#53覸t:jPDž_"x Q:? ^_[]Í|$s0Ph#hpv3I hJ&> 3u3utj8y"j&7WV \35l319}'d3FىDuw9@u1=l3^_USWVD$L$9tV\3r=d3~=h39 t9|1Ch3Mu9|1Ch3=d3 9u^_[]fUSWVl$}!uEh32#PUT1h32#PÅt*t$Sǀ}!u?S= 0賜PUhq&hpv3h"=eS貴x(=3uWh(v"hpv3 53+t$00GPUhq&hpv3sh"=^_[]USWV |$$Wơp3$3D$31-p3-39-3t\$=3t$ gDž~w1135t3Y6ts3PPjJ Å 3u3t$ Dž|$$\$9t$utt "<$u=p3t!΀"9u 3 uhpv3PP9¡3Ƌ p3Ӏu1A9|$t $ p3 33t )) 3u 3ut j4 ^_[]j3USWV1|$=3t WrGHOHt uG `-x39}t3V39rFU5t3Wz-x3t3 3u 30u 3F8W<1ۍF-x39~N3 t39wUQyt7-x3t3 3u3uhtkt30 FT0Ph#hpv3* hJ&9 33j2G @utLt30 Fp380聘Ph#hpv3 h"Y9-1t30=3=p3  )Ɖ^_[]js1USWV|$?!uGh"P t$WI,VPÅt2l$t$ US NjD$8!u?S=0褗PWhq&hpv3h"{8mS裯x-=3uWh(v"hpv3 t D$ )@ʼn3芿03Pt$hq&hpv3\h"8^_[]USWVPl$Uƃ=3t1ۅtf;l$ `1V$th~;-3u=3t =p3u8 GWPt$ F x4EEs @6;l$ |=3tt$$$^_[]USWV|$\$l$19t[=33t UPrUPFy^0Ph#hpv34 h("61^_[]USWVP\$53FEx @u}|~PVq6tj39~l3|39SPugƉ3|3 3u.3_tO53;^_[]Ë5|3W53V . ,1xщǃ|$uE3| /539$~Z39V5|3*ucÉ53|3 3u3t |3W53U  ,$+HPS5|3D( |$tM1BDžh_"4D0Ph#hpv3 hJ&41 33539} |3|$N3|39͋|$|MVPst053|3 3u 3umua(/ 腻0.Ph#hpv3[ hJ&4 3t13uj-j/,SWV11u3H u37hu35u8u3@%fu39uu3H u3ÍF=39~Y39wW53r=33 3u 3t 30u 3F 3C00ّPh:"hpv3 hE"2%u31t 3033^_[Թ0}Ph#hpv3 hJ&U2 3u3u tj_+j*USWV\$ D$1tt$hW"D$ l$1uHD5 v3J v3;0v3у  v3Qv3;=D2|hv3h%sF1GD5 | <\t< v3H v3;0v3hv3j\!v3H v3\\5tjj Sh\" tVG\")Ȋe" v3J v3;0v3Vу J v3Qv3\$ !0 v3H v3;0v3hv3Pjv3H v3D50 v3Q v3ɋ\$ ; 0v3hv3P v3Qv3D50 v3Q v3; 0v3hv3P v3Qv3Dhv3Q4 v3Q v3; 0v3~;ȃ t3 v3Qv3D$F9hv3Q]hv3P똡 v3H v3~v3H v3 hv3j 1^_[]fWVD$L$L$$$0蒦| $ |r13hn"t$t$ \ ot9EtzS3ǃxtostypf<3먡o3  $)D$|$ta$8-uW3D$|<o3b3S 3D35$L$jj}thj芲1FhJVyVjnhkj_h32ƅux'3|$t$8t$0|$t[hpv3hv"^B$8u h"_-j轐u$hpv3hu""Bhy"--y =3th3h#hpv3Q 3tPh"$hv3  xt` 3| 3x51g3QPP M=3=3hpv3hv"/Ah":,j蘏%u33h_",%u3΃t0hpv3hv"@j%5153hpv3hv"@h"+VQ=3th353h"hpv3jrjk*Ph&hpv3z j=3j|unh353h"hpv3;f$j0yj<t$8!$h0h3/^ uh3h#hpv3 jL$ ɸ!3Phht@j x#$r@2D$ rD2ËL$=3t1@ 3Ql"L$=3t1@ 3Q#WV1F=3t9|$ ?!t!hB#Wtj/W|th")1^_3333x>3 3 33 3;t,uQ39;u3빋 3| 33t9t31Ƀ USWVP`}33DJ@t t@3@DJ@t uHH 3~Ã=w$,&=3!h@"  !=3" 3A1Qptntl  Ӊ 3A˃=3FP”^ U 3@߈\$ ̀1ۈL$QuH 3H1KDB@,Aǡ3 3  Pj  53j$1  ˣ3@̃=3t=3y=36DB@jLǡ3@1Hptntl   ˣ3@̃=3DB@8!h,"=31Hptntl  ˣ3@̋ 31PptntlN  ӣ3@̡3HQPN"3@1Hptntl%  ˣ3@̍H 3 3 p1Pptntl   ӣ3@̡3PPv 3A1Qptntl  Љ 3Aˡ3PPH-33=3=3 9=3 -339 9w hq" 3PP 3A1Qptntl  Љ 3Aˡ3PPl@ 3A1Qptntl  Љ 3ADB@;h" 1ЍrЃ sOҨj h353jC 3w裨8"%3 3:o t!gc ptrP  A 3< b= 3Ho13PP9 3-3 =3=3 9=33-33@1Hptntl  ˣ3@̃=3F1Hptntl  ˣ3@̃=3h" 1@3 3AQP2 3<j h353A @2蹦8"h"N@2 3x w =33t30h5&趾 3x A =3u;.53O1@3 3AQP@ 3jPP>3x  1q1ۃ=3Ƀ=3 ˃h% 3x  =3u-5353 53g 3x ? =3uL-5353: 3@;3?73-3x =3u , 3IQ T3x =3u,3 39QPn3x QVP 3y F( 3y 1 3y P5353g 3A1Qptnt lu  Љ 3Aω 3y  33=@29|PRQ 1=3u 33 ǡ3@1Hptntl  ˣ3@̉3z !3SPhA3x  1@+33uF%3x <u<2=3t133x =3h3h#hpv3蒽 3x }*x1Hptntlu  ˣ3@У3x '3G1333@Hptnt lu  ˣ3У3x =33uB#|$Wt"5353QP';333x ==3uJ)=33u53Q5;3)3h\"h"h"3h%31< *5 3y qt3@P3@P3=3h%+3x )53j 6'(Y$i*tEEp $A8GMi 3913)@أ3=3t W6U31 3u 3u u^_[]jjSWV=3uj貽L$ɸ!33Pjh"h"Hy|hK#DtkP~=Yà P;tGWPߜ|3/tf/Vy~ed.hDhup53jh"Vj=3ujL$ɸ!3jh3KUSWVPl$53'Ƌ=33-39ʼn) u)E1u1$3E@3V}tzP蘹t_3PPj DžtO33H3u 3u[uE6M3@Pi1,$l& 3u 3ut j1^_[]jUSWV$3 3th"ckjP~3L$F$ ,39} (3V3(39|BVPD5,3(3 3u 3! 3 u1C1E҃!%=3h3P{Ɖ$ ,39V39V5(3C5,3(3 3" 37 09L$]939|WPSC=,3(3 3]9~[39V5(3B/5,3(3 3u 3yt v(3 3 (E 3Q39\u=Q3I ( (3G (E,$s 3L$A 3 3y 03)9~_39VPBI5,3(3 3u 3 03(3| 3A(EA3039r 3L$A 37 33/ 3Q3 ( 3݀ (5439}3R339|KVP)At]5433 3u 3S5(3P\ 303D$1!P莈07`Ph#hpv3d hJ& 3 3u!u#^_[]h"qhy"gj'jVjW5tL$Qq p PIH10_Ph#hpv3â hJ&n1^V3t.L$19 @3u@3H3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h3XWV 3 td< uhE"1 Q3I t;8t7P1ǡ3t?=3u6P,i3953h"R53j33tV353WP` 3t.h'h3QPt<53D33/.0]Ph#hpv3 hJ&^_USWV=3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-39}=3M339|KUP=tYlj-33 3u3uyS53WX 53=3tsj jSWme 0\Ph#hpv3 hJ&1 3u*3u(tjh$h"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u3 u3E#t3 uE1^_[]8uP3HЉʀπwR诃j h353G 1w聃8"uh"1gu@3ErUSWV3H 3H%u,8Xu'33h"t18u=39 3L1}539~[39V53:#533 3u 3\t Y3 3Q3 u (\t u^38uT3H 3 31< u0=3u't 3| t %u3ى38339|NWP9t8=33 3u 3uuuw5303M1I}0&YPh#hpv3S hJ&1 3u 3uu^_[]H3,j'jUSWVPL$33193}%3ȃ Eh"Kl$ 3PUVPt$$KǸ1$3PP331S̪á3tP芬EPPjM Ņtl9u 3l$ u3ue$33+39}yF3@3P%Ut$ Pt$$hDž+9 3u13uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=3tj jvS肮vލD$jPjSu!~t1t$ED$$D$1E $A9T$ 439Ɖ $T$~c3t$ 9V536\533 3t$ T$u3=3tjj RS藭T$=3RSWQ 4$D$D$ 3 $9~bt$ 3$9V536533 3t$ u3=3tjj t$(S=3t$SWP Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu*|&D$)D$39~V3 39SQ533 3u3|$~#D$$ D$ ud$th"$=3\$tjj SV賫3SVPO 3f |$%C<#|0SPh#hpv3 hJ& 3t e^_[]Ë 3u tjjUSWVPt$ =3T$-3E<\<&I,$D$h)39~Y39W533=33 3T$u3%$9C 31F9uEEπ;D$$,$L$l)39~Y39W532>=33 3T$u3ml9}C 31F9u,$y^=39}3_39|W53D2=33 3tT$ 3T$M 0E+3;3539}3J339|KVP1t)533 3u 3u^u`IKy0PPh#hpv3! hJ& 3u 3uu؃^_[]jjfWV 3 39|ld 3j Qh3e tJPhPPh#hpv3蕓 hJ&@53N6133k 3L$t$T$ =3@Q葤 3 3RDVu35 3@LF5 33^_SWV 3 3r9 3@<u|L19tWW59u 33H23L2^_[USWV=H2=L2= 3t 33$3D$j荣3 3 3ÍS4R4nr@44v\1L1 [ 3\1l1sRt6,lmL)1 3t)|?wt)LI1 3t~l)}L1 3,u44vL1Y 3l1}w4R4Ӆ HA9~R34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=3t׫H23$H2L23D$L21 3u) 3u&tj\h5"$^_[]jlUSWVL\$d32hE"e+J"tNjt$`hU"SVg fttu=<߃u o3r|$L$ D$1<&߃"D$PdƋO9rPSt$ e tu;_Յuͅu t$h~"-|$dD$ Du$$1Fl$?uSt$ hZ"jL$j QP $;Fl$|1ƋD$8u&1zPUjy!Uh"$jD$ th"jBNjC=m@!sHQPW_ xs{QPW> x4$Uh" =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@W y?60Ph"ӍL$fqQhmW 3Uh:7#D$ukD$Ph"hr" T$"h"T$"h" v3H v3~v3H v3 PhU"khv3j Րt$8t$8t$8t$8t$4h"脊t$Ht$Ht$Ht$Ht$8h"ct$hЄ"Rt$ h"AjgrpPh/"hpv3Œ jHSWV֋|$t #"?t)"VQP JB8 v3H v3;0v3hv3j<v3H v3v3H v3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hV"&thh"Pau3hl"%thh"Pau hv"1jhh"hl"H Puu h"j 03D$ u h"j t$,)݉\$D$$D$11D$$h"SUP c7~+Hr߃8tlH w&$Ĝ&<$뼃4t6맃dtket/1@D$=<umWt$_`Xh"5<KD$71@D$$+L$ o3 o3T$uAo3$T$uȋ$D$,jj@RW9l$L$ $tL$ $L$,1ۋD$P]CEu S)St$PʼnD$$ U]l$$T$DtIL$ىL$$U$E L$)QPRI 4$.]EuED$ush"h%T_u]h"bh"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh3t$ t$,QPRFt$ *yj{=3y h"|$$tQt$(jVjhSNy h"jVjh53Ny h'"h"^ǽt$(1CUVSwD$PNUVSw53qNt$,1L$XAAA @D$HPQS! =3u'l$hD$h(8jU&6j ul$uDžy hS2#1O~fVS53LM VSt$V=M |$h53l$0fE<u1ju@hWjA uj8j18tƉjjU$ tD$68ZtDj8tEVSt$ x )bj8#Th%|$l$8fE=3ul$0fE9EjD$LPj |$@f9fGfG3G$jVUX tQf|$<tٺtf|$4t?3L$0u+fD$<=3ufD$4 :i8t$>Nf|$Dt1BuNfD$Dh|$u%j t$h9"jt$jVxh#yWgh}"Ph>"hpv3袃j(xPD$L$jQ53 XUSWVA1K8uSt<։hhhU7 ~WUV ~)u1,h1ۃ8#ۉ؁^_[]ÐSWVP|$\$WSqZƅu]jjtqƉx jPS ǀ;t$8u 4$ 3A9tL 3^_SWV\t$lt8|$jYPW: GY\&Ӄ(Ӄ,P6B60 $4$8$WVd^_[USWV $8 $4 5 3VVPV1 0W5L&1WWPփ (JWWSփ _ƍ Wh PT& WjjWX& TV\&h <Ƹ jPPV(`& hVU8 V"E=a==hD$\jPSP& 1Nxr$ STǃW0t^SWP tg0$8 h"jm<0h "jV< 1N ^_[]þh"j0<۾Sh"j< ¾h4"V!=bt =buk $}u+Zt$WSVL$ / FYD$t8Shb"#ShV"WVPw/ 1QQt[0( Lt5$3tQP!0,tt|@P5Ɖ4P8tg04@tt| r>1A8Љ4DAtt;L5rSh"j6: 10hz"WV|$x$t,WDWHDWDW4Dx uW2>jtw\wXP=29}5PBt852WVh"#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP8̀ uCt1t RPL$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PU D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph",h"[%|$PQt$t$RhQ"j(C$t&8$\T$XT$H|$RQt$t$VhЋ"j($L$l$8h"h "hh"IUSWV u|$WH1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h"j'NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWP">l1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hSj,PSD$HPhT& |$0hSj,6StND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWh"j%^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh4" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ 03038383H35L3D$D$TH Qq T$T$ t$t$QSha"j( 11KL$0t.ESPh"jV53[S343t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1hljP88H H;1D$8<938D$D$ tD$tD$$3ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP"PD$tD$t$t$8WSP"PjtD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhX"D$8Ph3Vt$,V'~GD$D$8D$HD$L$PD$LPh3VD$HD$8L$ $\$(\$(u@,(L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L @3D3tt94 S.8$3T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Ph""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVhŽ"D$8Ph3St$,V~D$@s,D$¹tt;<FG;D$ L$?-Vh" Qh"j$ $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP;D$DT$@D$(4t$8t$t$t$0|$(WVh" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhv"je1gD$4$DŽ$߬$D$D$D$@$߬$ h&a111CƋD$|$8D$|$H|$LjD$LPh3VL$HL$8t/3ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPhێ"b11ҋt$  t<=H3L3$T$p$1߬$$$߬$03038383DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP31A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=3$t1J8D$<D$ۋL$؋3k,L$1T$9|L$$)щL$ Ɖ$D$HPWh "W $PhD$(T& yNt:L$ L$tL$L$8]:u*t$ tD$Phd"j@ ,uh("j, uhE"j M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$P D$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP3D$ t(Gdt;<r61@ht 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWnNJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP4$]0hVP ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhW"jT$$BRt RP9RPVWjt$$Vh("t$$k,PD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph"j D$,|$D$T|$XD$TPhT& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =3yh "je11t$ t$$k,t$PD(D$L(L$(}tTt  t1L$(VWt$Q](`&[$t$ D$L$9Éʋ|$S=3tQPjWhU"jJ]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh T& 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$Q?D$XD$TPh]T& |$t$t$kL$,9 $ ?t$!0PVh2"jD$,]|$t$t$t$L$$QstXt$|9|$11k,D(t PC;|$}L$֋L$]t$Qt$D$,TD$, m4$yD$,`14tPP2hS&j,u׋$e^_[]USWV3tWjjPk 39u 34t0jQƍx!=3h"jvt$U3xi8tPWhߑ"Q!V`tPSh"Wj/t8Vhő"j 1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 2I 213Iu顀2Pԅ3 2~ t1@ԅ3@9uUSWVD$921A9|G2SƉ<$~ SjV 2D$~Q1ɡԅ3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5ԅ35ԅ3$2^_[]V$3 3D$D$ l&T$ t$ 253t$T$L$D$\$ $n"6$^Vt$FtN H N tNHNfr v NVE 3^VD$`sH) 33 3HtP4BPQ@@1ҋ3v9tą3ԅ3rh"jWtp4F@3^USWVD$T$#25ԅ3tC=311-39| n-39t%9P4uH$3L$X(3\$ t Fu1^_[]h "h"hhƓ"USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>3 3 29|[5̅3tFNu Ѕ35ą3t5FNHNFy F4VPV3@31@j@P&U1@PF ~4D$F(^$F0^,n#2^8ԅ3 ԅ3t q4ԅ3^G FtH 7~ F^_[]É ȅ3=h"h"hh7"h"hhƓ";Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP ȅ3Hȅ3N^,H 333H@3P 3 Ѕ3HЅ3H4Iԅ3H89t;tprpԅ340ԅ3t4F ԅ3H^hX"hQ"h4hƓ"USWV}]uuu W@t 31@31HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$gd&s`&G4$O,52w0VPww D$0^_[]USWVPt$ffd&s`&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j*8p ؅3HtƒQ ؅3@ ؅3^_WVt$ ܅3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv v^_USWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=܅3| t Pt3؅31t 98t@^_[]Ã^_[]`V15܅353hVh3 5؅3^ft$ t$ j%SWVt$frLN4F,=2~0WPvv 1d&t\fv4V1AN4F,=2~0WPvv 1`&1;NuN^_[h",1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR1׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS_$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h" USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPY3T$3D$M u1^_[]USWV(t$Fd|$wt$LoHo9ދ\$Pl$<|$ttLXtP u1\$SjtQVRHPt$Ht$HUrtuN Rjt$ wd{Wrt$f1hPW jt$ ;|$D$@G(D$DG,o0uFhtȋ1FVt RPjOdQ AuFV FVt RP9OdQD$xd11 |$D$$D$ D$D$D$D$ $uD(tȉDpTtt RP蟜 tuGW l$ $BGWl$$tRPX݃1ۋ4$FÊM t19su)Gu7|$ \$'ŋl$F0FF F F$|$0tfhj`ljPLtLXt uB\I\$$|$ C$|$4NhӘ"zV<1ɺPt`tLtt l$,\$(|$0uej2ttP ttPA 芇t u_4u_4_HoL_HoLUS6jjW'hrW>q$ 1=2lj2l$1 UPQSWVhjgË}Pw S P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhj趭Njl$hu PO P E1PUtA|$4t h"TSvW^1^_[]u C4CHKL1}Mt|$4t7hi"St$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhʗ":$  $ V 19tQRh " 1@^USWV |$,\$$t$ tCPPt Ttt4RQhq"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth"hv30D$(u KHKpStURQPt$DljT$t h "lQu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh"b 3VRh"K T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPht" D$L$9tQP$$h"t$Ht$nL$tI9ȋt$ tPQ$$hĖ"襋1t$謰\^_[]h-"h"hh:"=h-"h"hPD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt衍|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$8"nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$R"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW~ƋD$0T$UW~ƋD$0 u$$$UW~ljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RP#~ERP~$GW #RP}ERP}$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPh"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPh"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWyNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP#yt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPxT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPw|$FV D$t RPw|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPPw t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPu|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP*u$ D$TBL$?ttXLT$BtJ J T$$T$ QPtL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP%tي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV rD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv v t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h~" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hK"h h"h"h h"hZ"h"h"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p 跂A L$H SjQ ^_[]USWVL$T$ B3ulF1G&Uh#,$ v3H v3~v3H v3 hv3j u q1^_[]Vopv3PPh"VVjjhʞ"+"@&PhB#hpv3&ujUSWV׉΋*h"UN&tCt[PU4jhh3s 533t233WVS53H^_[]Uh{s"jCy53h"$jayUSWV$:$D$VuP߆ 9$j uP† 1ɉ\$QSu Ƌ8X8"u11F9Ή$<$1ɉQSu :^ ËD$8Չ8"u !t$$Vhyd53 tbVh"^_[]jh"7jh".uh"$h0"hJ"$p hd"h|"jw$053h:7#jwUSWV}E phJ%VFh"Vhz%VSD$(P53Z#D$0= M$L$A1yyy D$Phwd53賺 D$tG\$ D$ L$|$j |ljL$ NjL$IuɉNjD$ D$|$uhjD$v1111O w+Ow?u$L$A1AAA D$Phwd53ɹ  \$tmt$ NL$,D$(3D$FD$FD$ FD$$~D$(PPWt$,t$t$t$hĚ"W KuD$1D$|$Ynhxd 53"R531111VQRP53h6"hxd 53ڸ 3LQhg"ww ww53h"w_G|$9w  jPQ53}!¡3tNSVPh"AWt$ 53yB $9tR"Q"hv3腧SVPh"soكT$;r ZƉ[|$?e^_[]jjs53h"lh?"h "h"hpv3& jQh"WV$u>$jvW. s'Wh{dЀ535 t^_jh"js653h:7#j-sVPPhtd@53 $t%t53h"$("u"53Q3$$m"m"s$r#QPhF"u 3$$ m"s$r#QPhr"P 3$$m"s$r#QPh"+ 3$$m"s$r#QPh" 3$$s$r#VPh"^53h"jqWV$u^Vhzd@53誵 tH$D$PWVh,"$PwwwwVh:"h^_%53h"jxqUSWV}D$Phd@53 tzD$Phd@53 u53hn"bl3$|$\$ t$jVSWiVRPSWt$h"e^_[]f53h]"jpSWVP|$uX|$_hq#Sƅthw"Su+1Qhwd535 t ^_[753h:7#j=pUSWV|$0t$,1@ <o3$1ۉ؉D$h"WVw qt\$te+$95o31|$7wWh|d53苳 D$ ;D$t-i9l$sUt$AƉD$l$묅h6hPV3L$ $r#tH#RQPh "|$ t\ư1P`VvvvvQPh" G;|$ ru53h"$t1^_[]W53h"jn53h"jhnjP|$u1Phd@53F 3tQhD"-XD$ 0Qh:7#j@nSWVP|$t$^h#SttDh32#Sbt@h"SPtut$($$ $uhfa$vu%$Phud53B t ^_[653h:7#jJmSWVP1 \$(Sh}d(@53 t{T$`1 tumS53hq& C|$dj wVz Vh~d(53蘰 3t+wSQh"{P^_[53ha" *Qhs"jlVPt$L$ 1tu9hTR#v迿u%1@Qhvd53 t ^653h:7#jlWVD$L$ 9։9|1H^_fUSWV\$t$p133333 3333D$31H\$1A $D$ D$D$,h"UWs R~H,$,& 3ЍHwf$&Sh<3Sh83hl"5<<L$< <3839|l<3bHЃo$&2@ 343jD$LP5<U L$H92(33222S3$335<j/VӖa$PVjFH$!=@/<2-22<D33<j/SYF33Sh43h03h,3hD"5<0<L$<=,3,3x3m5<|/2=UUUU)ʉѾ3333!!ʉсi <1B|@331;tٍT$d3LD$dD$j/VtC1ۀ>tT$da3 D$dD$ tTj/SהtF1;tٍT$d#3D$dD$,t>\$:t$1\$(X@&<&h"G u1\^_[]hv"hO"zo3=3uj= 33333 3Yh'"5<h"Ph"jf3=3u th"0"3 3t uhݟ"t=2uh")ǃ|u D2j= 3|$\G1PPL$lQPjW踜t2t$dtt"1PPD$lPVjW茜t52= 3u4$P52vBu#$=u 33  3 3 3=D3 ɡ2= 3t&jQP3 2u[52h##jhhT3QP|2y"8hT3h ",2T3= 3u'L$dQP٢52h;"hP3hrdAP蝨 52hx"`hP3hedA52i 52h"hT3h("_$$t(hQP52hE"J$$ƒ 3>s1@![Vs ) ȣ33x3|3? 3 333H33L35x352=|3=P3?w 33=3L[V3?3) 3>r$r$ 3 H3L3D3u 22]u1hQP<1 2u25D3h"$^5212j52|VOqH3u Vh!"8 11hL3t1A1A1ۉL$@1hL33 3h3=3u#,3 3033433 t$\F|$LSSWSjV]t$LpD3n 1QQWPjV+y5D3րD352j/V t@UUUU)ʹ3333!!сis<313t!tt 3J3cԋ3 3 313‰ $3(3031 ,31AhQh3E i-3=,3 / 3ً 3P+==w !r%1H$D$ ʀŸw1D$ $}ȹ3yt3t  u,31I $L$9 311O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj 31҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$ 3-3=3 3D$3t T$$T$3=3uu 2; ,37=3l3_hM""ED381uh"D3L8L$(L8L$$L8L$ L8L$48\$81=2Ɖڋ\$4PVQRaWPSt$@t$,t$4t$ Ƌl$dh#Uz|u u23Uh"hb"h"hu3jdU>31K1Kޅ`1PPPPPP =28h1"1 38LFu=3uRh"%tajhӼ"R1"WjWWWP+h"t҉J3u  3=3u3u 31g=3D3D$tD$|D$h"޻31N=t 蹵@ 1k"WhVVWP+9tigfff։f5޻3,3L$ȃjPmD$ u h"j3Uh"1HL$ Ajh"1۾3D$N3tB?t=kWUh" R3L$ DD 3$ D$tD$D$ uݻ3 ,313|(.tq<(tk{PWh"/ 333t (BD$,T(2D$ TL 3$3L$ щtT$ ,3T$D$,F9u߃|$~O1l$GVWh" T$ L D3$3L$ tT$FЉT$9uT$1۹˷"VWSSSP)T$ ‰ $DD$Rr3=ueݻ3$@D$ $#D$u D$ <&1$L$19;ta $Ȣܻ3=3u 3u3u 3=3t8L3~ h"3~lh͠"]h"D=3u1IX3 3t h"h"tL3o3e$jt1 ܻ33t 3t3$ D$ ܻ3 u=,353 331|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ ܻ3|$E9u KD 3D3D3DL /H3 L3WQD$lPڅ D3=UuBW,"5<3h"$KW1ۅu"؃|^_[5<3h޵"h"jOjV蚯P"$r#QPQPQPQPVhg"hpv3,jUUSWVӉϋt$ н"t"V$#tb=Uuj1=U=|$0h"fLJUh" J1N1N= 3u fSWUh"=X3uUh"X3\$&0tUhH"Wgj(WPR x:?r3t T$ 1I\$fǃ$^_[]WV΃=@3u9$1@3tI=331ȉ1f ¸t@3Ph@3hL3S f=3fJ3Utj@jh 3 ^_USWVӉΉȃ н"t"|$W!,$$j\WUځ D$EFI 3EPART3M u#E1M1 uu Wj8 ;Et 11=3t } tu$u SVRt$hH"UUh&"G ^_[]USWV|պ$u $D$$$L$ T$,D$t[9-,3~x 3 D$ D$ 353D$8$t}t ։t$(t 3D$D$($r#D$ L31ۉl$8QD$ 1MD$(D$8D$D$P$uat$(T$,$L$P=3t-t(WPh" L$ T$8St$,T$4$tD$XRQPX XL$ tC=u=D$8L$XRPQnX l$0$$L$ *D$ D$Xl$0|$$L$ tW$=3tduD$P $OD$hl$( >-<31ۉl$(-D$D$D3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$ 3 35,3<3D$t$u~t:t  Iu3 щ $ 3t&=uݻ3օ4$u ݻ3G3ti@3Ȩuh<"h͙%[@3tj3=uћ3Ѕ$tN<3=3u"Phq"Y0h<"JPh"t @3 =@3uQ9$$ty%ty%1@3tiћ3х $t4$P5<3h"=3u5<3hN"1t"13=u ћ3ݻ3^_[]VPD$ L$ $QP)uh$r#Wh*"腧 |$Z)uh$r#WhM"k D$|$3:33 3l$M?>33KL$ u}tGE)9H9^_[]USWV,։L$D$DD$Z"tD$u"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h"ԣ 33D$HL$LVSQPIzD$T$D$PVSUP-zD$|$ D$@VSPWzljӸ1=2ƉT$ L$@PVt$QRyPSW|$LWVUl$lt$,t$,t$(t$@h߷",hu3jdh3^ |h#h3$3\$ $t < uC{ - `}3DAu<-j D$$Ph3 D$$\$ h&S 5K|$(@D$Ph5"S8 $ϋT$ t։t=t$hC&Sy8 t't$h8"Sc8 ct$ |$@D$1=2ы583jVWRUxD$ՋD$D$D$D$D$$t$t$D$$  T$<3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th#S\< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhb"͠3Vxƀ3t$Vh<"蝠 583D$,$t$P։ω,^_[]h1"j[&USWV΃ twttu"^T$(|$$+<3уD$ ;3"L$ 3|.|$,T$0 (3|$9=$3|=3u|$4u 1^_[]Ë-,3~} ʉ$9tw3|(tk 3t( T( (t1+<39\$ \$$}2;T$}#=3u6|$4ttD(OG1nF "t(n9Չػ}n9l$\$QAuƉ3tt  $tt ^3 311 3t$ -,3t$|$$|$}3] ʀ|(tP 3t( ;L$T$|L( (9Ή} =3{|$(t ;3KC 330"1$t=t 3  3S"=3|$(50353B14303,3(3$3 33Ɔ3t$ |$(P3903u853FB14303,3(3$3 3331Ƀ|$(T$3\$1 5,3n 3|+D$Nu 3[\$j5<33)؋ 3P|$(t$ hhj:3VfǀU03L$ 3D$3ƋD$$ȉ5$3(3,311,3u3=3h""u"s"=31|$(9 03u853@14303,3(3$3 333Ju UPQ% ,31|$(tD$3D$ 35$3=(3^_[]h"j WV3t^ tڋt֋|҉tΡ34 ,3 QPV$ ,3ƀ^_USWV T$L$,3@hPh32  ,33~C 33$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR'$ 3;UjPB} fDŽ;UtZF , M ;M;MU;; 3 <3T$)ʉUL$  <31 EE=3 3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M,3 ^_[]h0"j0WV1=3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5`}3<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$a!1Kl$ 22uhUPzQ5H3P ;2u[jVW52`!1Kt?D$H5H3#$SUPlQ 52V52W ;2tÉ؃ ^_[]hͿ"j$USWV$0$,1@D$l$D$D$ $1h"WV# suM}j U5<軟 á<8=L$90F}8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-o3)1<$L$jhQP42h\3hedAP^ =389l$| 8@f3UjDž\$ t| v3H v3~v3H v3 hv3j 蟚jh\3hv3 v3H v3~v3H v3 hv3j W<$ D$tt$r#tS"Ph3"D$f3\3Waf3gdWPV] xnu)D$PhwdV] h"h"V1^_[]Ph"25<h"jL4 h"h"&Oj\gyPh`"hpv3跕 j=USWV\T$3< $S'D$9d$ՉjRPt$ V\11 Sl$UV 9 1U\$tL$j@PQ{M 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4D&h"T$l$ 31ɺ31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf 3ŅtMaQ4D&h"T$ t tuf f1113|$ 33T$33f3l$E<$g\$ttXaQ4D&h-"[ ;B Q4D&h["> <$\$t4D&h"<$l$!F1D4 Ą^_[]USWVt$|$\$Ph"SW Sjj9h"=ft1VUWSuE9r^_[]B&L$t9u@WVt$ |$7׬WVSWV$D$\$VPWS$,$,njS7Vhi%I#u$ptu!D$"t$"jo"jp0HPVt$ h"jUSWV\$ l$|$t$1E1@ <o3h'"WVZ ou%jShh&5< tEPr ǃuAo3)ރu4t$$V4Nut$(t;^_[]hd"j'-nPh"hpv3} jfWVt$|$ VWit$?/tWhY"Vhr"ڗ^_WhD"j fWVt$ |$7WVUSWV|$$t$\$WPVS$8$81EFuMjSt$ Whws%g!uPnD$""D$ jPu^hu$u3D$9Wh"h"SV3F j/P9|4$<Ƌ|$ \$SW_t\ NuZD$@u>=3L$o"m0iEPWt$h"j 3{<|$\$W4$?+Wh"h"Sr4$u h"j F j/P8t|4$4$*j|USWV\$ l$|$t$1E3t&33h"WV h~n3itVn3Ѓa~.btCd3봃otBs3띃NuS<331=33mjSh&5<tHPEuAo3)ރu4t$$V41ut$(t^_[]hd"jb hjPh"hpv3踆 j>{$"=3uD$ D$@"3t $P=3u %=3u "=3u $@P0h"h*&j WVPh32#Qwt1ƉPjPWÓ W*t jP VZP^_ÐWVt$|$ VWet$?/tWhY"@Vhr"2^_WhD"j fWVt$ |$7[WVUSWV $$l$WVSU$ $ hU3WhXq"uWVh*"jGD$@tF$j$ht&hVV$$$h3"juttPFx@HIt$81VRtRRP*t$ tPh"9QL$xtL$tD$8@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

z$WP1HPWh3Vh"h"&u=o3؃rKVh"hO"jsD$t t @@u|$$h"Ћ45@3j/VYumD3Vh"h"hSJ$DPS֮u"5@3h"hx%hhD3J@3D3 Ph"Ku =3hjS6 |$4tg$y\hh5@3  D$xD=<3~1hSPjD$ F;5<3|1QQQP_D$ u D$y05@320{ PVu h:7#E 1HD$j5@3耟Åy'5@3205 PVu h:7# $DPSy'5@3P20 PVu h:7# $L%=ta= uD83u D83L$t$QRPS5@3ul5@3hP&5@3h$"NDŽ$$lfsD$tjV$$ $ $L$ Z$ $ u4h^"L$ u.$$lfst!$$Phws%4hp"L$|$u$=2|$Tt<31<3ɉ\$Hu0<3tL;$$ s5$$ %DŽ$$lfs<3t$$ $$ 1Ҿ9É|$u|$ |$|$ t+|$ u$1Ҿ9s h" h"XL$8J#$L= j|$W$($(D$8T$ t$VN|$(O11VSh$Pt$X臡xHWD$(+D$L$,L$ ʃ|*5@3h"W1D$(+D$L$,L$QPVS7D$DT$XD$P*D$L$L$,D$(D$8L$  L$lD$h1l$h\$8$JD$\D$8L$\ t&|$D$ fD$Bl$B|$`l$D$`L$d QPhSt$Xyx>WFD$(+D$L$,L$ ʃ{1QPWVth5"j1F\$D1VPSh;"{FD$XWVPS %|$$u1Ʌ|$t1ɉAw1@|$Phi"%FD$tt$5,35 353t$\t$dt$<5(35$3Q535352PWt$L@ƃ|$4tV<USWVӉ $X-|$j W\$ SQ Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ {,8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$h"j:USWVpv31F/WVUhh"<WVjh"+WVj!h"WVjh"  WVSh"WVj+h"WVj;h$"WVj$h`"WVUh"WVjh"WVjh"h"WFWVj h"pWVSh""`Vg:fD$t1B9| 2I 21l3Iu顴2P 3 2~ t1@3@9uUSWVD$921A9|G2SƉ<$~ SjVV& 2D$~Q1ɡ3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u53s53$2^_[]V$T3 X3D$D$ l&T$ t$ 25\3t$T$L$D$\$ $n"A$^Vt$FtN H N tNHNfr v V P3^VD$`sH) `3d3 h3HtP4BPQ@@1ҋp3v9tt33rh"jtp4F@p3^USWVD$T$#253tC=P311-\39| n-\39t%9P4uH$3L$X(3\$ t Fu1^_[]h "h"hhƓ"g!USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>P3 h3 29|[5|3tFNu 35t3t5FNHNFy F4VPVP3@P31@j@PU1@PF ~4D$F(^$F0^,n#2^83 3t q43^G FtH 7~ F^_[]É x3=h"h"hh7"h"hhƓ"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP x3Hx3N^,H `3d3h3H@p3P p3 3H3H4I3H89t;tprp3403t4F 3H^hX"hQ"h4hƓ"2USWV}]uuu W@t T31@X31HCSuu WW KN0F,xNF4VPe^_[]vjv d  fUSWVP|$g&s&G4$O,52w0VPww D$0^_[]USWVPt$ff&s&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 3HtƒQ 3@ 3^_WVt$ 3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpd@F/hjv v^_USWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=3| t Pt331t 98t@^_[]Ã^_[]`V15353hVh3u 53^ft$ t$ {j0SWVt$frLN4F,=2~0WPvv 1&t\fv4V1AN4F,=2~0WPvv 1&1;NuN^_[h"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR譯׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSۮ$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h"USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPժ3T$3D$M u1^_[]USWV(t$F|F }F u}F F$|$0tfhjܻljPLtLXt uB\I\$$|$ C$|$4NhӘ"a<1ɺPt`tLtt l$,\$(|$0uej论ttP膺ttP\A 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=2lj2l$1 UPQSWVhjË}Pw S| P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhj2Njl$hu P P E1PUtA|$4t h"_SW1^_[]u C4CHKL1}Mt|$4t7hi"_t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhʗ":$  $ Vx19tQRh "W* 1@^USWV |$,\$$t$ tCPPt Ttt4RQhq"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth"9)hv3D$(u KHKpStURQPt$DljT$t h "\u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" 3VRh" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPht"D$L$9tQP$$h"t$Ht$L$tI9ȋt$ tPQ$$hĖ"V1t$(\^_[]h-"h"hh:"h-"h"hPD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$8"nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ^,LD4@hD$D$D$,$D$ /,@o M|$@ t"D$D$D$$D$$R"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWcƋD$0T$UWGƋD$0 u$$$UW ljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RP蟉ERP菉$GW #RPzERPj$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPh"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPh"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP蟄t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPa|$FV D$t RPD|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP̂ t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP/|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP覀$ D$TBL$?ttXLT$BtJ J T$$T$ QP7L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV}D$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h~" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hK"h h"h"h h"hZ"h"h"pUSWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p 3A L$H SjQY ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QPz1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jD{Ɖ t,UQFtf^81FFH1|$<΋t$ 3uN 3NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPt$z$K\$tSD$ hD$@p$Fx~"1ɋ@ L;H|PHsu"l$ \$ 3{3 3\$L,D(Pl$ tttt$T 1¹pt Ѝ t$@F01FHD$Pt$.KCLLtPQ4$菑Xtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(3y 33Py`P迬D$@3 3C9݋|$"$( x?$( Z1ىjPySh$PH uSUh"! j2PWU E2$( ;h||$jt\h"@PUW| $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"WaL$\\L$\\ $\]u^E x&Yt8u1҄tʋ$( t?r QVR V5qE8uUh"Ih"Ph"4USWVՉt$hR 1I t uFjh)#V u<^Ft t u^F t tWʗPWV还 tt$hUI u1I1ɉ^_[]WV׉RhQ  t6< ~< t<#t< t >t< u6AWhV űD$ 1GtPh"$^_V1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh/"+C< t< t< uh32#SƍD$$VhP L$T$\$PQRSD$0PD$Ph"D$@P詃 t$$$ىh"rC< t< t< uSߕ=$<rLjShD"Sh`"f?Sh"h"t$<L$D$D$L$ oPRtXljo 1tX L@uH~vCtTjhhn" VҔ$^_[]V蹔 )UjS D$ D$ CD$CD$C D$C$Cl$Uh&r#VV u D$CVF)1$<;obD$D$PSh" =USWV$0xjW[ƅ~F$0h$1jUZ~4$hP C9uЋ$4h32#SǍ$ىhR"$0S荓t| uƄ$ $0ph"QU%D$$0qh"QPىD$PUPUS u׋$0EED$1ɍ$D$ $PhSo D$PD$PD$PD$Ph %SD$L$ T$ ыD$E L$ T$ D $A9L$D$uPh"h";}Sh"h" Sh"h2"; $02t$t$h"$@t$Ph"a |$W褑}~14z_G;}|Vk_1^_[]USWVD$(}~;$ ~VE pSM $PjVWjSWD$11D$D$D$D$$D$ D$h<"u Vu+G H5$h&D$>j 5<PL Cr3밋<$PCrj hq#VH ىVvSb 1PuE$ ~S4VH $Ph jSPt$VSuVht" ,Wh)"j:ÍD$LPSxu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BVZ} 8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQf $Phn"Phr<rr h"jhr +rryt$$$PVWU>ލ$P|$xh4"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WPe $Ph"Phr"tM"PSh"ϯ .1$P;$h"Shrt$VW"9;$PVh"||$$Vh"ch"jhr t$j=3:$h"Whrt$ "?c.\$jh"WhrS$d|1$XAA$Pj2PQeb $PhV"Phr"~~;$1Fȋ a&w ع&QPhX"轭 G`;$X|΋$\>9rh"$`>ߋN8 a&wع&PVhX"Z `Ouet$$P\$ ZSh"+h"$P\$;$PPhU" V hE"Sh*rt$  09rh"h"$\>$Thmk%茬 V裫h "v$X~:$\1j hE$V# "tQ?C`;$X|j H~-h2"$`>V`Ouj $X1~$1:t @`9u9u$\Phs"蹫1@\D$,\$H|$PS$hjVi L$,9F Vh"VhrW h"IF0Ph"7F0Pv,v(v$h"j 0h&"$Th"Ph"h"FhU&%V9gD$0L$4$PND$8FhQ"Vh(r WO  FtsShp"聪$PtPhF%hh"[$Tt*Mbi)QRh"& j <$XqPSh" ]hJ"$X~n$1Wȃw,R"$@&L$7"!"" a& 8""PRhb" F`;$X|ۋt$~G$`>G8tu #P a&w &QWhb") `Kut$h"VhrP>U"tj"Pt$1 E$`$d $jj h3`$QPjVmyjh`$Vy< V$`t$Vh"$XMbi)QR$\VhD"F$|$|$|$|$|$|Vh" $\uMH#1wh"L$!r "$PPVɧt$h"!11҉4hӀB9u$r#tH#QPt$h"p=3~S$h1h #Q1PQh"4 C uߍ_ j A rt$h"Vh&r@t$S>#;$PtF""tM"RPt$h"æt$ USWV`p׉͋$tph"S%,$tSeÃr t1C1|L$PVQaa Ou vu hu Z$1hoVW owt1$0 j2t W9 F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh0"W9 Ƈ$L$h1"Qh+rU9uh"jhr U`p^_[]WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jhz%S: tVjh"S: tBjhTR#S: t.jh"S: jhq#Sm: u$D$D$h"PhrWh"PhrW=3t?|$"t"PVh)"衣 |$u$4ȹ&VhD"肣 ^_[$oWV襉ƿpv3Ph"W Vh"W VhW"Wԥ Vhx"Wť Vh"W趥 Vh"W觥 Vh"W蘥 Vh"W艥 Vh"Wz Vh."Wk VhO"W\ Vht"WM Vh"W> Vh"W/ Vh"W  Vh"W Vh"W Vh "W VhA"W VhX"Wդ Vho"WƤ Vh"W跤 Vh"W訤 j.VRhQ( t^Vh"$j'WVPΉ1WPhPPj PQ~ u^_Vh"Qjq'USWV։ωl$PU\$hjSb E9C Sh"ShrW VhH"Bssss ha")ss3h"{""t"t$(Ph" t$4t$4t$4h"Ԡ$t$Ht$Ht$Hh"贠D$8PhN"衠$t"Vha"脠$4ȹ&ht"f$h"RĘ^_[]t$ t$ t$ 6j tt$h"jM&USWVӉύD$(jPn71t$`FFF FFD$h$r#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVPD#D$HD$PD$P x&5l&|$D$ fD$ l$ \$Tl$+D$Ty1\&Ph"$j($P袝T$D$ +T$(+D$0хyL$XD$\D$\5|&D$XuT$hL$l+D$$D$ $߬$̝&ݜ$ܼ$D$pt$t$$߬$̝&ݜ$݄$T$xL$|l$x̝&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$P DŽ$ <\$D9r<"ShrQ3h["h"UhrVuh}"t5|$d} r"<$c!r"P^_[]USWV$`T$$<`$8`t$D$0hE"Ph*rQ 0͉L$9r\$~HT$ |$ $1hWt$ s u$8`01@$F`9uӃ<$T$ uU~\T$$$0$$<`hWt$ s u$8`D$1@$C`Mu΃<$t $`^_[]t$h"j USWV$,hE"+8J"tŋ$0h" 83"t 3~?-|$h"VS' M~%Hwv$& 33ǃDt*MhB#5<ќ3u5<M4 43nNRt 3j W5< 3L$9&-<23332j W5<5 2L$9]` 33}3nPo-tW:pPT-ujj~QPh7"j@D$كL$l$ umt$=l$ 1  ut$)K3h"5<h`"p5<h"` $L$L$GȍQw[sV?PRoPl,-G A6PqGu$t L$-AGL$AL$$j=3u"hh"h"h"h"h"h"h"hpv3zP$WdPh B$We bU*yŃ=3u#t3MIрK=3u }8$V+ƹV])uV+W !$VVY+DžD$u h%"Xul$Vh#hpv3n Vh|%h$ PSW(yl$`t$Xt$T1ҋ\$މT$̓=3ut3MIрs6=3uA}t']h`%SdthB#SduWH(Ņu{D$TƄ ML$XE|&hP$ Ph>"hpv3sD$+hP$ SW ىV1 D$@W'$WDbPhC$W5c $'hpv3jjh"Y>$WaPh"Wb j)$WaPh"Wb =3tVhpv3jjh"=3$WiaPh"WZb 6WKThpv3jjh"=33hpv3jjh$"a=3ꍬ$U$P`GV`)1;$v7$5<P{3$P`$$1Ehhpv3jjh"<l$WK(_D$h9jUPF3L$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=3 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h`%Sg\t jh|#S[ t ;/u f. Gf./WlZSaZ9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PSWtH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 52 t3H $s-t$$tHfHxt P2)1^USWV=3thv3jjh"E1jj9#tvƃ=3thv3jjh"1x31GNIIˋ^s t3 tVfV(x3ޅu3=31WS"ơx3Krk=3tV$Ph"hv3~ ~uV7dV'%V`v v"3F$53vu;33K^_[]USWVPl$t3M1t$"Džt.w w!ƅu h"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=3tW"Ph"hv3} W_1l$$ttF9u t G9t$&Qt$h3h"hpv3%}<$WbWE&F~X|$<th"V_VCbV&vfFt$ t$ t$ h"hpv3|EuFufFFV!|$WP`WV&N=31ۈ33|NIL3h3EQ3ǀ3|NAMǀ3EFNDt$h3h"hv3{1N1@=31ۈ33|NIL33WPǀ3FNDǀ3|INOWP3ǀ3|NAMǀ3EFNDVdPt$h3h""hv3A{C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=3#~VPt$h/"hpv3z1t$h3h"]a >W\Ut$$t$$|$$WX ƃ*Vhg"V%]1@KGufGfG1@=3$ WbPt$h3h""hv3yUt$$t$$|$$WƀH1@=3ىV_bPWh3hU" |$u V[v vY3F$53Ut$$t$$WDUt$$t$$W.PZN1@=3t-ى,VaPWh3h""hv3x؃^_[]S133|NIL3t!h3Mǀ3APEǀ3|ONTt!h3Mǀ3FNDǀ3|INOt(h3Mǀ3|NAMǀ3EFNDƀ3t(h3{Mǀ3|MODǀ3ECHGƀ3[SWV=3thv3jjh")3=31VWftmxtg t3W sJX tCf{u7=3tSPh5"hv3w S\S [빃;=33k53tc~ tWuLfthS"W Z=3tWRPh5"hv3 w Wy\W9 륋v$^_[SWV=3thv3jj hk"H(3tS31{ t$C$Su[SFuՅu53th"VKYv$^_[USWV=3R3utDhv3jj"h"',thv3jjh"'53t$G!jj#^ơ(3;3,33,׋-3WV]Ɖ׋ ,3(39sAWV2ÅuWVh"p\ SPh"hpv3u c렉1‰1 u`WVÅu h%"%\Cuh;"SXCt SZcSSPCcQPWVh"hpv3t:K39tPt$ ZU-3(3;3,33^_[]USWV=3thv3jjhS" &f 3jY9T jj\ʼnT$3 3PQ\D$5,35(3J\Ɖt$U9\ʼn$St$p\Él$9$\$,3 (39ˉs6f 3j8DTk D$;(3,3rM\$ -39sI,395(3s9-3tS 3E9u,3 (39\$ ,3 (39ΉsZWVÅu h"YSCPh"hpv3r cWV[Ɖס,3 (3911 uU9t$D$ rIWV<Åu h"|YSPKAc9-3u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5,35(3fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=3thv3jjhl"_#FtVPXfvu݃=3thv3jj h{"#3=31ҹ$RL$QtMƋhtDEt9VP|$ Wd1ۀ~UiCSPW+W em븋L$$; 33r^_[]SWV=3thv3jjh"U"3=3rc11CWS5t:FfN~u %fFfth"VYSvuȃ;33r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h"VRWh"hpv3o 1^_[]fUSWV`=3thv3jjh"!!535353h."hh2xk3 t= 4uFFF%)Fu9rV9=3tJhv3jjh"F 3t(t$hv3jjh"F 31V9vtRPh"hv3i 3thv3j y$ 9̓>t9߁^_[]á3tPjt$t$uù2WVIAfF=3|C 3)f(35 3jQh$3u53F1$3PVQ = 3F3^_ù2Qh/"M8u"h"hr"53hS"hpv3hj&]WVjh2x1t)h t 8@ W(^_V(3 ,3t7#$3=@u%o>(3 ,3t$3!=@t^USWV$$$ $jhWV/,$3tE1M1 tmjWVS$8jWVS$8t$Sh|%hVxcV<$ 3U Rh53DžtGh`%P%>tSh"hpv3g 53DžtGhB#P=tSh)"hpv3f 53[Nj531jPP68.+^^$DOGrhPD$PhR"hpv3rf:hPt$V] $(j7V@ 3u D53Nj53j1PP6-+^^X^_[]SWV׉1jPP1^-+FF9tX\$)yWh"hpv3e %؉jQP6-~tF hP6/ F^_[USWV|$_ OtGhS7 GO9}vDty)9|n4 ȉG.uFhW%P;;-33rv=3tUh"hpv3d \GP1=3t:Ph"hpv3d %1=3thpv3jjho"1^_[]USWVD$$PWD$x/@thW%Qj1ƀ81Mbi)$3H1ًP1 t 3P RV853At\G9uGSVP9 t53Džu*hW%D$P,jtƀ8MbE^_[]USWVt$!M1 tFjhRWX*,$3t(E1M1 tm`ƋU R^_[]ËD$0褵USWVX=3thv3jj&h"$3 ߉^_[]USWV|$u h">W -3u`Ɖˋ-3UDžuh"z>-3)ً39w؉9vlj<3|$3WSJ^_[]USWV։ϋ\$ t;=33rVWh#= -33QPVWB{s LK$\=3t%[$tC1K 1 uh#S9^_[]SWVt$f~thy"V9~u(~th"Vg9~ th"VS9FN tkQPDžuh"V)99tt79uNH4~^ SW FtPh"V8.>W+333F$53^_[ËAP 9ttЋR9uIHËIH h#Qt8Vt$V*33^SWV|$t$Åuh"V,8;^ty^C Fs j/W^GSP*3 3W W+*FV86P+1ɅF fN^_[USWVd=3thv3jjh"#=3td|$xh"WTƅu090+Ph5"hpv3XT Wh6";t$ f 331؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6lvuݡ3$3؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W[u3$53L$T$9΋$D 1$T$|3~L1\$3 tAD$t$ jjSG39|͋ 3 $53T$|L$<q$Q Ai33QA 33QA3A$t$ Vjj(QF @t3)70Phc"hpv3Q t$xho"8V&h^_[]USWV$=3thv3jjh"0e1PPU苣 Džy060FPh6"hpv3sQ Uh"88D$,PWy0[60Ph"hpv31Q Uh"7$jS!ƅu h #7SVW蠢 xD$j(PW茢 y050 Ph"hpv3P UhH#{7Wo3RrD$l$3=3,$1Չ1 9$hpv3jjhj#jj5353k3jP.3u h"6PjPh`%HĨ^_[]f 3D$L$ 33D$L$ 33=3u t$(6t$pPh#S6D$ L$$ 33L$T$ 3<)3؅~ڋhh7 #Ph #hpv3~I1Fhpv3Vjh#V=V2to=3uf=3ubf$HD$=3t PjE:?Phm52g y" .0Ph#hpv3H ^1Fhpv3Vj)h#DVK=USWV(΃=3|$()1\$@kD$(D$$D$,D$ D$0D$D$4D$D$8D$D$t=3tPWh= #hv31 = 4 43hQV 44^_[]t3 PUh= #k s-4hh4U蚹 0)Ph #hpv3V1 j%USWVEp3f 3D3 @3D$=te^_[]á4fD$ , 4L$ , 4}Ph(4讄QPh(45p3h #hpv3$jDSWV|$t$ 48; 4vhK #b  48 4WVP薬  4^_[5p3h #hpv3T$ jUSWV$$=3t$h#hv3$ Z$ $(މ4$9{CKQPh"hl$U=3t CU342h#hv3#tUCKQB+{))σ#WRL$ QP$(ѻCKQB3{))σ4$#WRL$ QP$,kBCKQB;k))΃#Vt$RL$ QP$,t%=3$(tqUh!#hv3" \{$(u0jh1#D$ Pl tFjhl#D$ PT tk=3thv3jjh#9(jtzwC@D#P$ 6C@D#P$C@_#Pj$$!C@O#Pj$$ u_{C@_#Pj$$E!C@O#Pj$$ =3J=3t&$r#;$ t#Ph#hv3  =3thv3j `0^_[]-SWV|$t$=3t4 4WVh8 4P =3uWV50 4p t^_[Ë5(3=,3p3=0PSWVhe #hpv3 jSWVt$=3t4 4Vt$h8 4P =3ujjV50 4H!ƒt^_[Ë5(3=,3p30\PSWVh #hpv3j V3t3tuf 3VVVC ^PD$L$ $QPhpv3# X??9:V= 4t114Bu11Bu=Iu1@'5p35,35(3Ph #hpv31^SWV\$j/StMƊ?SDžu#Sjj0SDPO/F^_[WV|$ th #WWNƃ=3uhVp~x=3t.u Ft#h#Wt9h?o%Wt'\$j SW菋 $ 9uy6h#U$~h#Wt@h?o%W~t.\$j SW: D$ 9uyvh#j蹎D$PhU54 u ^_[2h"#j诎SWV |$t$ >h#Wt9h?o%Wt'\$j SW藊 $ 9uy6h#U$~h#Wt@h?o%Wt.\$j SWB D$ 9uyvh#jD$PhU54 u ^_[:h.#j跍USWVhi$(1hWD$ P? |$ |$ D$~P1ۈD$$,,jUh" tjUh7# tG99ufD$u\$ tR$,4jVh% EjVh=#t 4jVhB#\ 5\$ D$7f@jh0uht$Vj P54D$^ރ9tD$j@hK#P3 ߉tD$PDaryDpriml$t?tD$PD andfD D$PDgrowfDnt$VxD defDectsDuVUjh#P V54545454h#JEt2tR}jh#V  H}j1h3#V V#}jIh#Vֿ t6Wh"Sh"$UփOut$ h#z8^_[]1h#jLUSWV}\$j S54O D$t"NuD$Hj@PjSPhy#j$j$Vjj54rF=tPh#D$D$ D$$fD$t$j VE 0w  9 1L$81qAQQ a A j QV54-D$t$ *jh#E p  D$ @L$jhtjPjQ54h#hv3ED$t$H1D$`D$L'Ƅ$0VhQ`54 $j D$tPSk |$'y9D$(ȋL$;$&|"@D$Ph=#(hv3蛻j GD$$<JD$ D$ L$jhtjPjQ54~e^_[]ÄtH<t<u'54h# 54h #hpv3= P54h#hpv3"hE#uh#j菇E 0h#`USWV $ ~($ 1j4hT# ?C9u1CCJt$LUPV CJjh'UVjS54~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P54545454hX#e vL$D$$jh'hVjS54Ffȁw$VhUK VhU: ƅtL$D$jh'h$PjS54]$f1Ɂw$PUhWh#s3Wh#evL$D$jh'h$PjS54$f1Ɂwh#3t$ t$ 1؃;D$ D$4ƜF>|$Ń &h^&hx% ~y)L${h#D$Phd#$VD$P H PpRQhj# tVhs#^h#(^VD$P H PpRQhj# tVhs#^h#y(^USWV$Gh4ܽ&V( Vh#: r[h#'O yj h#O,@tPh'#O, tPh7#GȅtPhY#GȅtPPhl# O W hVbVh#|GtPh#f$hVjWƅtVh#:j Pt)$1@9}$݀#Vڧ uC <=%:l2ShV>#$t$މ|$=4t2=/4D$(2L$, T$l$hPRh4QWV[MD$(t$=4|$t'`}3@DJ@ut1ɊTAu=4umT$,$uWjSt$8^|$=44`΀<$|$tZT$,$VWjSPiUtgHp St$0t$8$PVh4!4h4у *4T$,$VW1VSP544C$0&D$,$D$(D$=4t +1ۉ\$0\$&\$'芴D$4SPV5 ljӉT$tD$p!Ѓ]8"O0PVhq&1<==41$1Ct$|$81 t$4t$0D$(t$tt$pj,T$RA[A1OD$D$1D$ D$j=QD$ tOAL$ \$ h0#VQt=j,S~AL$D$"h0#V21۰D$t$h%Vh>#VؤNh^&V¤ghM/$V謤ht&V薤.hNM$V耤c |$$i \$ Ct$ɍQw1$X&>a΀-% plj\$ Cut$BT$ҋ $)|$41ɉQD$PS# D$ D$ 938*貱8\$ L$ D$D$W|$h#S:Dh&S$;hh&S7h[#S3h#?#S'h(?#S̢D$t$ |$@1ɉQD$PS D$D$ 9؋t$8苰8|$m1ɉQD$PS  L$ 99։D$:L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh44t2h&B#v 1<==4 ڍt$81 D$ \$phjSh4PVT$RT$1BD$L4JD4`L$p$QRSRPV4 4u1$P`$w x&Qh4hA# 41<=4 j=Vy9=4 j=VyT$81 D$ t$ hjVh4PRWS\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP輂$h4h B#D$49t 8VhMB#S1JD$ $$Qh@#,=4D$t$=4$D$D$,D$\$(V GC@D$p9Vh_B#Ӭ0|Pt$hA#|$oQhA#=4D$WSt$h?#VD$ 81ҸD$ |$\$ Cj"$PoYÍD$pWVPSt$ $P\$ E $4jt$tS7 $4jWV# -辫0gPh4hA# B4 4$Ph4hq&D$ $u1@t$2|$ Qh?#(11G|$1\$ tpupth|#Q9]D$ t$D$t1@L$ ɉ%t>#PQ^Q|$t 袪8t1j t$ Vh4$`St$hM?#FQt$h?#7.l2m2L$ L$ ف$K{8P|$WFD$ t@j QS=V D$ ;$|$8tQtUL$4 T$hjRh4QWt$O l2T$ gL$4D$ 41ɍAD$4tT8`T$ Q$QRQPWt~c4 4T$J`$wx&Pt$heA#t$L$ $d$ r $3 $tu¸[#t(?#PQh@#|$D$u |$u |$TF1@]%t>#Pt$h>#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qh/A#0Pt$hJA#|$L$lj% L$St$hk?#{D$$D&臧1ɉQD$PS' L$ 9t 9St$h?#,D$ D$ D$D$0L$0RPQt$,t$$P+|tBD$tUtsD$ |$4jVPM D$h|$tɦ811FD$&|$4VVP  D$'$D$8|$4jVP D$p4jVP UD$1=4D$44$Vt$h?# Ph>#=4he^_[]4$h@#ًt$D$t$$t$S@9s Vt$h6@# S@D$t$|脥1ɉQD$PS& T$tD$pD$ 9t8uW8 St$hx@#Qh@#/1ɉQD$PS ƋD$ 9t8t}St$h@#St$h/?#D$t$։D$ФL$8`OGL$0d$ rxL$D$nT$臤L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$hl># jj-={Ph4h># h>#hxA#hA#h4h6#SWVPD$t$|$L$ $QP679w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVSw1Ht$L$ltT$d;WuT$h;W(u QO ŃtD$ppPUu D$DGXHr P`oXd^_[]USWV$l2484t 4/4Sh4omtW4މ)ˉESQ|$ W>u DW4VVߑfǀ4/SUmu4Uh4Q,^_[]USWVhT$D$A7#&1Ch4}D$ CL$;rjt$V{ ufD$jD$Pjh4V.t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPVWt$h!7#|$$j@WVPVWt$h17#j>WVPt$=h2Ph"We 4t54Ph=#5h2BD$$PV5h2諿 4^_V΅tO Hw;s14  4te0wPh4h=#M Atʡ4  4t"ğ0mwPh4hq& u =4t^jUSWV=4ˋ}4 4 t u tthv3jVuk}ti=4|}t j 艶MO؃thD$VuP;r t$UtuRh"{5p2Rhx% bD$VuPq tMD$PVh=#踶 D$VuPq t+t$ t$ Vh=#膶]D$ s*P? D$L$ r!QPh`B$ rD$rIPh&r#QPh$xt$hoL$'}u h=#j +e^_[]Ph&M&USWVP=4u(ˋl$ D$$|$54 4 t u^_[]Åtthv3jt$Wi܅4| t j 蝴$^_[]uCuWt$h"P K4$~DN1ۅtPh#.t#=4uPh>#9t4C뿃u,h=#'t+ORh"״#L 딅t~=4|t j 1^_[]1ɉr $~1Ph#ԳC9ur4$h9>#躳j вtuQh"萳b5p2Qhx%w IWVD$0L$41|$VVRWQPpt)L$$<$ug4 4tT$jjvB1A8=4uQh"t$t$t$ t$t$h!;#ٲ^_Qh;#j8USWV4  4=4|$(|$44 4t{\$,1PPQPSW+ot`,$tYUPGtLƍD$(1QQPVSWnt&$;D$u4jPwVWaVWD$8tPh4h];# ;w1D$$&Ph;#Ph;#Ph;#Ph<#^_[]UWV EMT$ 1|$VVRWQP7nt@u|$ D$L$ L$D$4 4tT$jj Z1AP4t!u.=p2D$PnPWVh0&QPh$ t$QPh&<#ܰe^_]Vh;#j6UWVEMT$ 1VVRWQPWmt+M|$ 4 4tjjj1A`4u5p2Qhx%D 4$h t$t$շ t Pt$t$h3<# e^_]Qh;#j5USWVD|$huI=4t@D$$1ɍT$QQPRh;<##qD$pt$D$(1N\$$SmDŋD$d\$ 1ҹt(t$ RRVQWPkD$ \$1Ƀt,$t$XL$$9 1 $\$(K1ՃH11D$1D$D$1D$D$ \$|$,Euϋ $q|$,\$]\$\$ ]\$ \$]\$\$]UT$T$UT$}T$UT$T$(Iu$L$HL$ H L$HXPL$Hx L$H$t$X\$(t1E<$tEPhl2VhC<#j\$DSs4 4tىjj(A=4uSh"蝭w$w wwwww ww7hJ<#s,D$tM(9ʼnd4$1A1AURD^_[]Vh;#j"3USWV$$|$$u1D$1ɉQQPRh;<#L4$$t$VAtfŋ$L$ 11RRQUSPHitO$D$ ;D$*#L$$l$u1L$$jjUi 1A1AU=4tM<$1\$t$Whl2RhC<#jS蔪L$$jjV G;<$|u 4 4tщjPV=4uRh"螫<$~/1t hˉ#腫ttVh<#oF;4$|j t$PĄ^_[]Rh;#j81USWV$=4t  $D$\$蜒1ɉD$QQSP$Vgj0CWUUCt3j Ct$S$UB)8W$h<#{ =4vjw11ۍL$l$ PSQU$Vftct =49$$D$4 4tT1΋$PjU$h<#1Ʌ7_l$ 11΍L$AAQU D$L$PUh<#jdQ$WPUV to4 4t$jjPDH1L$AAQ\$SZ D$|$PSh<#jdW萧$jPW Ā^_[]USWVP\$(|$$1PPUPSWme$P=1PPUVSW6etu=4u5p2t$hx%U $ $ r/1۸$r#WwwPh<#$C ˉ#;$rj ,1A1AyVhM^_[]Ph<#j.UWV0EMT$1|$ VVRWQPgdt0M|$4 4tT$ jj1Ay=4uQh"U1D$ L$ T$$L$l$L$, $$D$T$l$L$(D$L$l$\$\$ \$$<#e^_]Qh;#j,USWV@$ @=4t Z$ V!2ƍ$ h jUp h%V  t}1ۍ|$1ESWVL L$99=z  h%j$ ƅu$ 11L$RUPQ$8@$8@btIt =4$,@$@4 4t.1T$Ph X1Ʌ1ۅÍL$MP}$@SPUB U$@JtW4 4t$ jh V0$ P|jPS SDJ@^_[]h8"tD$9t 8uVh&=#Vh=#j*h=#h"$j*USWV \$0|$,1PPUPSWa)4$D91PPUVSW`=4ut$ h">rt51t ttt ttth[=#ӣ 9uЋkT ;$tl  1L$D$Sjh"艣 {t+1:LtPh=#c G,;{r܃TD$@TL$9uj [VH1A ^_[]h4hq=#+USWV }=4t D$ toh=#W^|tcr1ɉt$QVW  T$$9t8uH8,Wuh=# =4j蚙11CL$ t$PSQVuu^tWt =41=4u?=4u6L$1J1ыT$1 u#MUPj h=#1ɅRaMUPjV tK=4u-=4u$1H3$3|$ uMUjj h=#MUjjP e^_[]ÉSWVt`}3q~FDx@uAFX@ut9v`}30Dr@tH^_[USWVPω11s6tUVh<=#SUh#S t9V6F4$Euuh$r# ,Ɖ$t^_[]hH=#hC=#j&hH=#hV=#USWV\։ύD$ jPj PD 1u0D$F|fD$Y|Uh=#j D$ Pž$L$D$ L$/Ph#j D$ P蚞[ $fL `}3/LA .sD$ L<u\$ SjPj S螃 E9[|$ t D$ PVh=#胟d^_[]WVth΋u\~8tU~4~`N4F8 I9rPD1F0F4F8FXHr PDFX^_fUSWV\$"4"4h(C#sP\su "4hq"PKxu "4jcb"4Jmx &蹶'?c.5"4芓hq"Pwu 4]4=4]43C#t]#l$PKrt Pu|Qߋ<-t<+u{uNh &ShwtGSM16kh8C#q"4t8u)h?C#q"4Pqt "4#hFC#}q"4Pqt "4OC#1="4tjh^C#~FP7֛j觛N="4u0j_`ujjB=#4t!=P]4u="4ujhuC# C1FVV7=\4uh$#503uu\~jhC#B jM5\4f:0BuK@"4"4!Ѓt4]4"4Bzu=X]4t0譚|X]4jS=]4u T"4=b4~jhC#u j j 6GWVt$ y5"45"4"4ut[<|=^4t=#4t|2'V1Wu=WSBV$WV|$ Wr@jP9tWP^_t$t$e9tjhC#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@9#4<#4U5k4^=H#4u #4H#4U=v====,=XAf2 #4iL#4P#4T#4F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff f<D$L#4D$L$d$ P#4 T#4D$D$fD$ D$5k4Pj5k4U #4,^_[]VPhht@ja t1hC#ktPZ$t$uչ%~X#4hC#rkt(P# X#4 X#42 X#4 X#4u.hD#!kt P#Tƅ~5\#4hC#jtP# \#4 \#4 \#4 \#4P^V[tPT=/4t1H V^PL$$`#41Qw$& D#M(uMf`#4 xD#4D#+D#"D#D#D#!D#=YÉ$D#/uf`#4'D#uf`#4`#4WV׉vu1=/4u WVC^_SWVPh*D#iPi1Ʌ 2h%uiO&t/4Qh#4t/4=D#t/4Vy )+#/4@D#/4CD#/4E?&/4#/4FD#|/4q"y/4/4/4/4/4/4/4/4~ $^4+4o%/4t<ӥ#$r#$r#t /4d#gtlj=/4ID#O #4LD#>XD#t /4iD#!sD#t /4=T]4t8="4u/湄D#/4T&/4=/4u /41/4$r#u /4$r#⹤$/4t8u#4/4$r#S&q/4=/4tt8u#4/4$r#r#:/4t8u#4/4$湇D# /4t 8t1@ /4$r#1/4$r#D#u%VWWh/4h/4q#y&V5/45/4h04h/4HR#N%V5/45/4h04h04C&N%V5/45/4h04h 04#;tlj=04#m04o2&U#$r#$r#tơ/48t,<$1QQPԀ PW蚇<$W>i@$hD#04⹸%=2$r#u$r#u$r#/48t2<$ X#4IQjPX PW<$Wh@$4#S> 04# tÉ$04#$r#tƹ"=/4u$r#t‰h$r#Ɖ5(04>u :4^_[É⹩$04z8{lV t<0 1=/4u V}{^USWV׋t$$\$l$;Et*+u(N%$r#t D$ L$M^_[]USWVր9tMτtC18042U5X#4Wy 8041804U5X#4Vy ;804|ut$#4^_[]Ë /4X#4USWVL $։ύl$ D$?hD#W)?SWUI D h! VUy $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$aAxt$4h! VWnx L^_[]Ë /4X#4V=X]4t ="4=]4uF /4X#4/48t!/48t=/4u 041B#4=]4u /4X#4b=]4t /4X#4H,04=D]4t!=X#4|1Fj 2F;5X#4|^Ë $041B^ 041B $041B=,04ug=X]4t ="4uN=]4t /4X#4=]4u /4X#4=]4u /4X#4,04Ã="4",04Ë 041BY (04X#4Ht$j5/4{ 1B)=<]4tË 049tX#4 =8]4jË /4X#4 /41BV=]4$04t 041B5004t-F=/4/4t/41BV^Ã=/4/4t/41B^_%004t /41B>004t 041B'004t 041B004t 041B004WVD$ #=$2 lj Ƌ /4j" 04j 04j=]4ttV$ /4j5004^_WV|$ 1Ʌ<+u OL$ GWb-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th%VatrL$PQV t4uRL$xD# $x2P D#T$x D#$x D#w^1JD#^aD$# $2  0049uVD$ T$5$2! щ щ! ‰ 19^Ã=2thD#Ë 041BSWV@΃=2tt404tVs`tx1Cj S*VGV^SP_GVh%P  404=404!VhD#j@W.WZ@^_[ËD$804WV92t#֍|$RQjW1B$52^_Ãw8&ÉfUSWVPt$ P!уtRPtt jhD#jhD#l$$\$|$Q t^tY9uE}㽭4u <Ճt(ˉ $19u tC ;$u~2KՃujh%E#t jhD#jh E#D ^_[]1ۅs IQRP踒fVt$t=2tjh9E#52^á2xy=<04uE @040@#4@u.<04jhNE#?t j4t2P 25"4)"4V1N=@04t9t/ @04,@wB$@(@1҉,@Ɖ^USWV=2@04@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh`E#1@$qQ52 9D$}@04럃^_[]USWV-@041|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5j4(@04@9@S @041JЅt8=D04u/@u1u0@4@ '[WV@041t[@t @4v @044@0@{!уt RPF1G)t j4t^_USWV@04t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtH@049t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë @04t$@(@ ,@1HUSWV5@041H(@$@9t#H1ًP1 u,@;Hs D|^4%D$z9tG1؋O1 D$ ~9 $tG#G=x]4t @t2x9 @}lh jjtH @1HGG7FGF8~FNOG Fx ~,@;GsN+x]4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@H!ƒ5@04@@2tOD2Q@u;G  )RQ@w u&@040@4@&OD1@l$1tʼn$yjhE#1="4u 2x~OUQP 5@04@@o<$t0@D$4@=D04tU=|^4u#L$ Qh"$ |^4j2=D04t=]4u q=j45@049>tOOHO@045@04wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhE# ;41H^_[]USWV@04ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H2á@04@u1I4@0@Ë9t1JQQ 9u@o @044@0@1@@(@$@,@PPP@sE!ƒtjhE#81PPjt$IE!1WV@040@4@!΃t@@9} 0@4@^_SV\$t$ 5"4({@04h8@j@04@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjVXD!ƒt@04 @04@P5"4vz@04@u@^[SV5@04@  ˀuH9tPQP P*dž @vv Hu5@04@uE u@5@04dž@tV1@04P5"4y^[á@04t@1fWV|$t$ t=H04ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnV+tD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV h$r#j4hJ#lLh14h14h14h14\$ -uF :tjhJ#]jNbt'.t514bt0:wtptcu+14F&jSh14 14jSQ ,uF14141414141414141414141414141414hoJ#J1tPh?J#J1F$2VhJJ#WhL04P(hSJ#dJVhaJ#WhP04P ^_[h{J#>JPJj3P21B thJ#Jƅu&hJ#IƅuhJ#Iƅt]hH#Vqu6hE#Vqu$hH#VquhH#Vqt1BE#w1 `}3TA ruƀT04ƀT04ƀT04@=u=H04D$T04SVt$ 14M1ۅuD14;1Cu12(u!=L]4u2 1ۅÉ^[D$T04ËL$=r!=H04tP5L04j hT14r'T04u T14U14uT14ESCT14Ãw@T04uQhkJ#VPt$ u t14ESCuw T04u;Vt V5P04B$t14xPV@,@T04uPhkJ#V5L04j ht14rt14^WVD$L$ =H04=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$x&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=H04t'~3P19wKS>~-19s2C,9r9v)CK$Ht Eu]2t2PSHt)E uu3jhJ#^jME1Ft^_[]USWVοT041ۉ$FA΍HЃ $jjjj QPUsu<$VЉt$މjjU݉t$RQPU&NtjhJ#jT14rjh K#rjG$H $1.tbt cu1벳뮁T14sT14)PQWQ ^_[]f941411494949494 21949494 2USWV\$SDD$;\$1$t$jD$P ;$sCPf=H04t1Wu1u"WUCuW594594;u^_[]SWVP14$PC=14t!141WjSs F$8u1^_[SWV\$u 94948|$$!L$ 94; \#4}( $ 94PD$94948uF948t<|$$|$ $ 94P948u949v 994w^_[SWV94;94~_|$94h14jh94T 94)ˉVWSn $H $~U94+D$94;94149494^_[SWV։ϋS/BPjW ?)߉ىjVW ^_[USWV1D$$59414!|$7l$h14jW L$)ΉSUV D$t$14wɋ 9494<99414t$ \#4)у|Z~V1\$ l$h14jS L$ )ΉjUV+ |$\#4+94t$ 9}14w14)Ɖ5945945VYt$D$ 94)594 94$H $~^_[]ËD$L$94 :4t@USWV\$;=]4t@D$0n t3>SU0BuF8AUV o ɋl$u9tSv At1|$jjSOF ~.EFE0uE^_[]V94t";T2t1FVh14P/ 94p^USWV\$,=H04tV94tgفuH :4J :4:419*Qh:4~-945:41E494J :4:41E94=94u 94 941҅; <2t҉օt1PS;H*$&=:4+":4Шu*%=tS 94194]^_[]Ét$:4594 2y9414)É 2n1|$ l9} SWh14> uԉn$r#t9414VW[=94=145* 948u!e0:4:4tP :4%MD$PE=-94E˨ -94E:4 :4? ǃ:4^_[]:4] v:4e:494=14v!x ux ;|94=14w%:494< t 948 t:4:4 :494B594a:4948r :494=14wx u 94=14\x tQ 94=14.uD$ L$PjQ课 $T$e^_]Ë :41; 94|14á94t @@@ 11[1PPUSWV="4׉΋$$L$ D$1AyōD$PU#D$=xh32#UaU3W$ShU o 0jhAK#U$ ShUn D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShUm S41PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV="4o=82u=h2u =W4P1TAP4@PjVPRW~4|8QZtQL8h"W_É4$pu1ND$PVw x#D$ =uhV蕴h4K#a0tP ƅdո(2Ex uָX2Fx uhAK#h#S^ T$Z ^VUhUK#S:SH34$VW{WVĀ^_[]SWVhxK#/P/tt;^_[&h$#V41ۅt+h#f%V4tV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u%qK#+iK#Qh#P[] tWhK#vF] Y=82t"hiK#h#v&] V(2=h2t%hqK#h#v\ VX2^_[^_[USWVPӋl$D$ $uSP1SS1tD$ t}t8^_[]StV믉h14jPN SPuSqWV948L$ Ƌ94 \#49}I9u94xtWD$94$94V948t,t$<$PD$948uڃ^_SWV 1494$ \#4+ 94|51ۉ|$8tZO\$\#4+94$9|Ӏ8t-t$|$D$|$D$$8u$14)ȣ94594^V^_[V59414tR94)Ɗ 0@u 2594A=9414":4=14 1@^À=14t89494 2594:41@á948t AUSWVPQK/$1;t.߉WjU $)ډfu $;uƉ^_[]USWVhK#O+hK#@+VhK#P@ Åt^_[]jhK#Wz@ t VhK#Pe@ UD uhK#*VhK#P:@ ÅuVhK#W%@ WV9G t'փtPhK#VY G?G uG^_Ð0:4i ËD$u5Ã<3PhK#USWVD- #4ÅE\$9uz$1ۀ|tisljDDs9u>rjjx 4:44:4$t,tV#hj:} =j4TeuYÃ=j4e4΃e0:4~o6/=H:4u #=p:4 t t =^=H:4;p:4Ct}.CЃ jS&ed~hX:4 D:4@:4=0:4t 0:45=0:4u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=0:4i0:4ih%jjS\Fc`$(&="4 %t#-l250:4=ES[jUY  xS0:4H݃t =]4-8:4>!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$& 50:4 hL#9L#49#49P#4=H:4SH:4C1Ƀ x:4l:4ῃ5H:45H:40:4/U]VsWWr!2@*="4%9:40:47^40:4h#jjl:4p:4n="4 5T20:4 }hK#0:4 _ghC%y1PPv^41; @:48:4 D:4HD:4@:4/="4 0:4%hL#1PP9L#49#49P#4؉ك u. u.S莍iq:45l20:4%aih%{jVyl:4p:4 PZw 8:4 *l:4уBЃ@*? !1҃ ƒ!D$Z=H:4,9L#4t 9#4h 9P#4W jhM#j#t$(VIOVrlp1BsRtM&="4=0:4738:4Щu8:4Mj5<2ùe=j4Iv_*-t%+q1҃¹) l:4p:4S\B D$t1< x:4D$ D$ PD$PD$ P萪 H:4tjD$D$-<{|Q<`ʃ=x:4tR D$HL$@븃@l:4|$ ^s 8eB0:4emhL#1PPL!ùe9L#4e9#4e9P#4e e 1?PS1FP@/l:4Ph$r#5x:45H:4虤 1;5@:4D:4|D:4@:4n蔰VVA 1;@:4D:4  D:4@:4|#4'M1PP5#4 =\]4 t:4 t|7ػT 1;@:4D:4|D:4@:4蛻=]4@:4u' D:4|5T:45P:4P@:41QQm1;@:4D:4 D:4@:4|#4|C=]4u5T:45P:4P1PP5#4A D:4@:41҉3P5]41;@:4 D:4|D:4@:4]4聺觮5D:45@:4DT5]4J0:4NVhL#h1PP5 ùe9L#4e9#4e9P#4e e /йSE*re|褹ʭ\>4\:41\>4 L]4 `:4L]4 ^4 d:4^4h^C#Cjjh+L#D:4݋5@:41ɸd9 jhOL#="4t>t5\:4\>4`:4L]4d:4^4j)eD$t Pj{@eJr蘬 L$Qh"$1;@:4D:4|D:4@:4)O=]4@:4u' D:4|5T:45P:4zM@:4jjP1;@:4D:4|D:4@:4跷ݫjj蟷ūD$<3D$PhK#="4jhK#VR D:4@:4]4 D:4@:4]4@:41ɉ D:4|D:4@:41@Pe(ejhL#e1;@:4D:4|Y@:4D:4 諶Ѫ=]4u5T:45P:4Ljj- D:4@:4ʃEݣ]4c D:4@:4]4h:4  h:41; @:48:4 D:4|D:4@:4q j5<2?@:415h:4"5h:41;@:4 8:4D:4|D:4@:4 j5<2RCi@:41D5h:4=]4t5T:45P:4J1=W D:4i@:4me5"4V?P/V$@:41ɉ D:4|D:4@:41@PuGjhsL#@:41ɉ D:4|D:4@:41@Pk 2V_e!ֹe5]4RPyJ1A诳է D:4@:41҉AQPcM\>4Nn\>40:4>X`hL#r1PP?ùe9L#4e9#4e9P#4e e S賁+̲1PP5]4n豲צ1PP5]4jP#'@:4D:4ؽy蟦=]4t5T:45P:4Gjj5@:4d:0ؔ@:4D:4艽*Pjj5@:49; eS贔D$D$Ph M#{豱ӡ@:41ɉ D:4|D:4@:41@P"etbt3tFu j11A; @:4D:48L#|$r#L$Qh@L#11%@:41ɉ D:4|D:4@:41@P'"e11A; @:4D:48L#|$r#L$Qh`L#je5"4<h$#P.5"41=tjhL#o5l20:4nvh%1SVUh蠻Ag5"4rSPx]]4 \#4݉@:4 D:4\>49‰}@:45D:4)‰\>4;4e]4 \#4@:4 D:4\>4;4i1D:4@:415]4QPHFjhL#H3D$PhL#d ։u=X:4t@:4 D:4X:4e,5X:45@:4tI~V8JjhK#bUSWVP趮ܢGVD$1Ƀɉlj щ d>4`>4D04=j4uH9ljD$u21xUUjn6 9-j4u;=`>4d>4D$tD04 j42t8teue^_[]USWVPӉơ8:4u8:41 r4$0utV4$#8:48:41ESWPO á8:4 8:4 h:4tu1Fx` sKu j]j%u0SW58:4 á8:4 8:4 h:4ujhM#t 4$4$^_[]WV=2u=X]4t ="4u袬׮t "4"4!ʃt]5"4QY;4u =2uP5D]4=D04D]4D04u _BLE5D]4=D041jPPB ^_SWVl:4߾hk&t$#0:4/ V+=p:4u V@t hM#t u%C%P1;4PP^_[V蛫ơ0:4"~S.#V$^%="4q:4VPujh?M#  tY>!t |:4t P\ V!|:4="4M|:4.h3M#qF<+t< t "4t Q V菛"4/7E="4V蜭h9M#Pt% ="4V^X@:4^(N5@:4jF5@:4jQP軯^5l:4V5x:45H:4H:4738:48:4PV"4h3M#h$r#r^SV 8:4t s70:4Zb8:4shEM#i8:4 shPM#Q8:4 sh\M#98:4thhM##8:4 shrM# 8:4fyh}M#8:41Ct$‰sShM#jV/3V8:4CuϹ"tW% sM#Q;4^[fD$=H04t@WV|$ Wjeƅ~WhV ^_USWVt$0l$(|$$t U ,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD H04H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t W WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f :4 :4 :4 :4USWVi $AD$)< u?FP貛^tP 9~qN#ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp2hhh2hM#htjPV jhM#hM#hŋtjhM#hM#hjhM#hM#hŋtjhN#hN#h^Vt$ t:j jr tL$HΉp :4:4jhN#荞^Vt$ t:j j- tL$HΉp :4:4jh4N#H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃVv 1H^_[]hYN# t8tMjQP[ ƅuhK#t98t4jhiN#P/ ǍEjPW W iUUUSWVP1F="4jt$ރP#19jV n1PPPS#!ƒJVWS= <$SO11 ?$:81xM'x+xG1O|E(|n|dȃ|$:4t:4Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW S 1N^_[]4$ |t|uVP11xtɉSWVh:4t$b<ƅui\$h:4e5:4PSh:4I5:4P|:4t:4h:45:4p^_[ËT$ :4t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=]4ÃB1ۃ=]4ÃCɍH9 X#4~Pj#|k;4SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=]4ÃB61ۃ=]4ÃC%|$mu9X#4~HPj#j;4؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PV0ʼnPD$X9vpG$11Ʌu2~>9sWt$VJ t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWV19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQ\t1=^4ƃtEuG%t|QhO#hh20&AVh"$6 Eu ?=u Qh"P#$ u 覣!ƒtVHQhP#^Ã=^4t$"4tPP&t5"4ËD$t5"4PF$1PUSWVu195"4O"4t_jP%="4tJtWg%W"="4u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =]4uID$xAP&t4D$8\$PhN#FًT$WVt$j 1@t="4jWd$5"4t$V$t$5"4g$5"4$h"45"4##4t$ t$ ۨ(^4=^4111j4D$4PD$,$jUuWPWе Uڃ,$C^_[]SVt$ h$#V1Ct'h^C#VthN#V1ۅÉ^[WV$ VtVWVtWt^_USWV 1=]4]="4Pj\h"L#1Ƌ|$ 11@L|uM@-u)Fh$#W)1%tuQ%t s@AAۃ\$WVW؃D$jPtWVt$PO W "S 1tXt^~u1O\$$D$jPWb uQD$P4D$(0$#^jhP#4|1 ^_[]ÉOVD;t;VD1|$rɅuŋD$(N#1O;PrSJ USWV="4t^_[]j荈hP#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jhP#U{PljD$UVWS\$,8jUHrS\$SVUP 4$b SY \WG V=C V|V$ro#N@ |^WV|$=]4taPW1o1=]4#D$=W*jP`qWP3hP2LPWnx#D$=@{WjPqWPh@2V'n WoƉ|^_V|$PVx D$XT$\1jPPV|^UWV蒊lj5"4# QPnt1GL$ T$3:43 :41@ u,L$3 :4$3:4 u!tL$\9|$X}e^_]ø'Q#Vt$V9vHx/uAΉ^fVn :41ы5:41 u^ã:4:4=8]4t^6~^P~SWV1ۃ=D04t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=;4t;4USWV-]4~ON}=]4~Q111SWuljӉ:}qF;5]4|؃=]4' =]41=]4|=X#4111;5]4| V|ljՉ!<$=]4FD$1;]4á\#4D$ /4D$\>4D$$\#41/4\>4PPSUt$ ljՋD$ \#4D$/4D$\>49pt$j pF1MX#4H91Z{1@^_[]Vh 2F;5]4uj{ t j2^USWV\$,=;4t;4&|$$t$ l$X#4t  $9~ l]4$x 9} H9$!tT=$^4t ]4tC(;41҃=D04TRQPWV脘WV Ɖ1ND$(D$<$=D]4t7X#4H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=D]4tzmz1@D$/1@D$=|2uu=2t hTQ#\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|2 "4t)!u =D]4u=\4u;4=\4t Xm;49l$"X#4HPj-|1Ot1E1=]4~1VV|{~ VVVD5 -D04t <$tw y|2j@ ^_[]USWV=;4t;441=:4u!h]4y=D]4t X#4'|$t$;D$||$$t D$9X#4~ =]4É!tF=$^4t ]4t0(;4,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=:4táh]4y=D]4t X#4ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]ÅtX#4HPjytm=D04tPay1u11FUvUVRPVjv!уu j4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V X#4~&111RP!уtF X#49| 1 X#419^fVt$tsVGF95"4u#1=2tu1Ɂ2tщ "4AF=2tH ;4v 9 v. ^% ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12tá ;4USWV\$S@Nj522tv W6Wo |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@ ;4VEES7ËnU)9Ë\$sU SKeFW謥 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t Pפ w0^_ËD$@0ÐUSWV$|$41ۉl$|$I|$tJ |Ɖj4uEx tu|$t${ʼnX]41FÃ=]4tt t uW{ʼnw t t uw uQ1{ʼnFR \>4IC)݃1l$|$#,$!tD{ʼn)݃11ۃ|$ t =]4t"{RPj F |$  jPV# \$St$V}y=]4t%$ЉWUt$ t$Pt$W=`]4t)|$ t"v t uj4t&1M$^_[]Ãt~$^_[][zUSWV։ $Q1۽t+L$ D$!ʽtjjQPVt$}ʼnt$|$0t$,HQtjjWVt$8t$8}Å u> <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=\>4jjPWV^_USWV,T$Dl$@ظBӃ=$^4t  ]4t0(;4 @1)ʉ|ЉjSUQP虊كQP4v=`]4tK uu|| t u+| t uj4ttj4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+tj4ǃ݃ tkwRPW v=]4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N \>4 CfN =\>4=]4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1X]4l$t$1E1!1M,^_[]Ã=]4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjhdQ#c^_[uƉסX#4HPLi11 u^_[8iWV!Ӌ X#4It*QRP4 X#4HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhR#bKy1V[hVjRPUo=]4jusj'hD$ jhD$T$l$ !Ѓtd9}\X#4H94$SW!уRPvlj9Љ $AX#4H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$X#41VVjt$t$PY95]4^_[]1K16-;4-;4X#4H $)QUjSWP(1K[6=D]4tf"g15;4SW=gX#4HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9;4QU#>$4,$tt=t|<9;4|wC^w \$D$ShU#jW$4,$*U#f9;4u+9;4}9;4t9;4hu_G t t1"~#ut|\tt t tL@?3~|$j=Wd9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuU#$r#6$4t$ t t_G칒U#$r#$40tUPtuU#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQV";4^_[]SWV׉Ή5;45;4h}U#hS=w )WVRQ;4S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl2 t^ ;4 ;4!;4JtGtO GO ;4!;4l2 t ;4u ;4^_[]ÍZ w6$'tEGЃTZ$'btPeu>f ;4랄tGOm>2#놃>4#w>^&h>o2&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w] ;4!;4d   > ;4 ;4 !;4";4&;4RhU#jh ;4U# ;4_t>$r#vVhU#,=4P+t ,=4Ւ"hV#蹻0=4Pt 0=4V#jVL4=4jVL8=45(;4h=4h=41=4PҎ $u=4^1|$á=4=4S<=41=4@=4 4=48=4 @=4@=4@@=4;<=4|1ۉ>4>4>4 >4>4>4>4>4 >4$>4(>4,>40>41H=4=4h=4#h=4=4P $u=4[USWV\$0l$,1=t]4uSUƉס]4 ]4SU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| 0>4=]4tU t0>4=4Z=4D=4\=4]4 =49}Q=4ƁD=4 \=4ك=t]4WV^! tt$j VRP)NV込1 ]4)~$=4r5=4ƂD=4 \=4Iu܅~+1ɊT 5=4~==4D=4\=4A9uס=4H =4ƀD=4 \=4=4>4^_[]Ë ]4t ]4=t]4t1]4@V5<=4@=49}9 8=4<u"4=40Ph=4 8=4@=4F9|Ӌ5<=45@=4=4>4^SWVt$\$u$D$0j?oPy/=H04t&v!Ss1҅ SVqt1҃Pn1҅t$St@=4~- 8=4Vt[u8=4 @=4LV3Zt @=4t> 8=4VtV[t'i=H04tVs1҅ƒK1JFVY# /4#/4#5/4#/4‰^_[QY# /4#/4ʉ# /4#/4á@=44>4>48>4á4>4@=48>4>4ËL$1wQ5,=41SVt$ 1ۃw)V5,=4uV50=4ϔ1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJ1V#9u!B1@uDA;1A+u%uVt1@^ÃwV5,=4u߸ع#L$1uj jE1ɉHH SWV= >4 u|$t$\$t-1 |15D>45@>4tm1@Z ug ^4t L]4uU=>4~+L>4 H>4\@P>4>4 >45@>4=D>41 >4=H04 >4%=uaP>4PP>4T>419RhT>4bmhT>4mT>45L>45H>4L>4 H>4H P>4>4u"P>4T>4x,1WV=H04t P>41At^_[ÉШu-%=tS0l>4=L>45H>4뢋L>4 H>4P>4>4USWVӋl$,|$(>4=]4h>4uBu>%j jzC1҉PPh>4(>4>4>4twQPl'UWS h>4xt,>4Ph=4蔅1h>4>4u+^4tL]4A\$l$͉=H041؋5@=44=4>4Rk5@=4UWS% 65h>4c h>4=4PV軄=4@=4VP诅V荄 =4AVUUUЍ@@=4 >4 \>49}oh=4藅ơ >4 \>4Y$gQVlu&4=4@=4PjVPm>4$#54=4=49|@=4l$ EVjUek L$ )v %uh=4蚃5h>4" h>4 @=4; <=4 54=4|tq=8=40jf j8=49u"_l$\$u4Шx$_l$\$u$54=4 _ ‰$ u*^4t =L]4uKuG ڃ^_[]H04m_uiud1UWj>4+=4 t2(;491J$;,;4} qɉы40;4)t _4=4\$ PjSi 1EL$4=4) @=4PjS`i ǡ8=4 @=4tW4V)>4~Z>4t\ [5x2)Й)֋$F UWh% N1>4E1->4$_PdtUW ]H04t6=]4t-QdtQd UWl $UWS t1@1^_[]SWV=P>4~4։1T>4Pd VW u C;P>4|1P>4)^_[Ã=>4~L>4 H>4>41WV=>4~L>4 H>4m>4|$t$ = >4uu 15D>45@>4itb=]4tY >4\#49>4|>4>4>4@=4A\#4 >4H9>4}]4 j ]4]4jf=]4>4tL0>4tBx >4 \#49}; j,>4P >4 \#49}0>4ы >4 \#49|L=/4tC/4„u0=]4t't4|$t- 1j1j 1j5@=495(;4 u4=408=4^_V=]4uajm5,=4rtMȺj9D#Fu=,>4u"Ⱥj>V#Fu^SWV։ˋ=@=4G@=49=(;4 u4=488=44D$ >4; >4~~ >4@=4>4 >4^_[SWV<=4 @=49}1T$58=4ׁtu Ӊ @=4@9|^_[ËD$L$ D=4\=4VD$ L$=>4u=]4ttNI1҉ tK1G=49~\=4D=4+5<=4)΋ 8=4 4=40 ~^>4 >4USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8j4u/(;4H9| Qu@4=48GO1H^_[]cS 4=49t 4=4Mtۉ>?SUSWV-(;4\-jSr jSr DžtVtRU54=4Vˎ 8=4UPW趎 Uy 54=4y 54=4=8=4(;41t Wx 1Gt Vx ^_[]USWVL$D$ʃQPO1H…t$=(;44=4D8OlV tnj4uc~4=4>-(;4u@4=4 (I=(;49rHŠIJ4=49s=(;4)\8OVà uQL$ t 4=4t=(;491H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= VMw 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15\>41K\>4|EtESSP t\>4@ԋ=@=49=(;4 4^_[]USWV=\#4\#4jD=X#4~AƉ!ӹt111CRVƋ >49;X#4} C!Љ̓uԉ=\#4)|^_[]SWVL$M1Nx@Nj\$S>@ w+;t1PPSE t2SP_1^_[V=]4t'ʁt1|21I9@uzu)u>uS1Hte1ɺ|2:tWAuN1|21I:t?@u21|21I:t%@u1|21I:t @u^ËL$H1Ʌx 2USWV։Q,@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=]4u1@$5>4+5 >4~1; \#4^USWV։L$|$0\$,Ѓt>4!t6tC؃T$RjQPWSQ=]4=(>41ۀ=$>4tw4$$>4 =4ىȺVUUUЍ@)I=4~4,I=41E 8Vt$0j* G;}|Cu4$SG 0>4tf d>4`>4!Ƴttt$,9} 5`>4=d>4$>41ۃtQ4=4 @=4T$ 1ۅ~&L$ PjQ\ @=4~8=4\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E >4;\>4uX=4#=4uD$,=4==4==4~01=4 8jG;==4|h=4t>4;>4~<$~>4 @=4 >4$>4~1 ;j_G9u >41;\>4uD$Ph=4t@=4 <=49~~51ɋ4=44*1 8=4444A; <=4|١@=4) $ >4@=4 >4; \>4~(]4 j >4H >4;\>4؉^_[]WV|$t$ =]4u1WVP PV WVt1@1^_Ðt>4H ȁ4W4r14W4tW4t>4xW4TW4|W4 W4 |W4W4W4W4W4W4W4USWVL$0D$,l$$|W4$|W4|W4t-9Br }$r1z3|$( H|W4u$$rtW4t :=tW4xW4xW4<$:rBJ jl$(jW|W4tC:|W4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?|W4t_ )ϋ,$]}|W4t|W4tV+BJ NF=xW4uW-|W4MEu$9ˉ|-xW4],$ϋ=|W4t sKӋ$JHJ^_[]USWV1=t]4tD|$(T$$!t3|0|W4|W4=|W4t'9PH }=|W4u11CŋE1ЋM 1 u ]u,W4W4W4EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}j4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[j4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVStW4 11؉^_[]Ã=W4xÃ=t]4u ;41t]4Ph>V#4VW4xNH W4d|@W4* W45W49|jhVV#z5W4^USWV|$ l$1Ƀ|W4|W4tKC9|W4W41 W41 5W4v vB1IʅI~nVv 4$9ʼn1I1PPt$R9j4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$Rj4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=X#4~%GW8É!Ѓu O;=X#4|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhQ#2p>41111ۉu WVSU1PPWV+j4u Ɖ!Ѓup>4^_[]WVT$D$ =]4t 5]41)|щƉ^_fUSWV t$ >-uF(s7h%+V+h2#+艣D$1S6]+S)S\^SSljy Wzh#À8t>tkV聪tmSʼnD$}$Uq $ȃ$jP'袷t$PShN%t$U t$g  Sa'Ņu>tVhq"F'U(Ug jWWz1FVJ]V'D$$t*P*hoV#y*/j ))3;4t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhV#.1N\$h"S4h%Q)SH)h2#;)3(1S|&S[jj O1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVS,jhV#1KtL tGf;t=ËFHN~ ;F~à tQu VSV1Vj d1GWZWg%e1=;4VZ^_[]fSWV1W41K4t 5u'#ar'G__ _Gt Pvd GF6u^_[ËL$ 1ɅV-$t:\4'W.t7^uM"4\41\4\4\4"4 ]4\41\4\4 \4\4t Pa \4Fu,~1S薺PW豺FvQa ^F~ ^v;"4t PNu VSWh ^_[ËL$t@;"4tjhV#x)1HËA QUSWVD$T$1ɾW4="49~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9\4u \4\4uUSWV\$SκƋ\4t@PPVOu\4\4 ` Dž\4W ` u^_[]USWV=]4|$,t$0h#W l$\4\4!ʃtWj UQP"\4u\4 h$#V蝓t\4VU\4PhV#W苼u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=X#49Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P^  $FQF^_[]V="4tjhV#&dt$D$tt/uKV"4;m?u7=2xCjh3W#뵃=2x%"4QhZW#l&^jhW#jhNW#{Vơ"4t P] VޣP"4V] 5"4蛙 ^3"4VD$$L$ t tC8.@L$$Vheh&Q 2>jhhW#2xxPhW#j VVF||P|0tB D$0PhW#;D$$Vheh&P >t.jh~W#1]4L$QhW#$^ã]42V2x$ X#41Vh@BVPRQ_]4^VD$$L$ t tC8.@L$$Vh#Q 2>jhW#2xxPhW#j VV ||P|0tB D$0Ph+X#;D$$Vh#P >t.jhW#1]4L$QhX##^ã]42V2x$ \#41Vh@BVPRQ&]4^V|$u%t$jVt0PhOX#N#^V|$u%t$jV؇t0PhlX##^SWVD$L$tP\4p="4tjhX#"VP>PR Zt V踘)X!ЃtV谕5]4SW? ^_[VD$L$tt\uoPe03_Pơ03t=(3t PY VӟP03VY 03QhX#!^V|$uJt$ =4]4tV"4-\4hW%_V_h@^^WVD$t t0t$b4l7=tDMtGhuXF 3PH]4b4Qh"$5!Emtwt su!FF3Fb4Fb4F$37vX V^_D$u5|]46Ã|$"7VD$Hs^\jhX#7<3V)h͵$&PhX#hX#V;3xu'hY#h=Y#haY#hY#hY#hZ#h7<wVȃ=]4utjhZ#$FVPMy0PhZ#^_ÉPhkZ#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;(;4~,;4A9s } uE9u9t},u E&| t2(;4+$;4x2 ^_[]WVD$Pt t*$TV9PVLD$ps D$ stopD$Tab =t2|i1Gt$rVfD,V4,;4h&r#P6 G;=t2|V赆D andD theDen t$V萆5x2hZ#P5 0Ph"$D^_à D$t t+uyL$tJQtQytWjhZ#Mà$2L$%2AAD$Ph[#!%1%2$2$2%2 $2%2 V D$t t]D$t$jhS_$QVP46h$#V>t5>t ]4 $]48]4tP9]4$#L$Qh[#O ^ËD$Hsjh5[#/Åu "4Ã|$u=]4D$u =]4~GT]4ÃD$ u)=]4| PhF[#]4ÃD$ u)=]4| Phs[#]4D$u"=]4t="4t*!ƒÃD$ t t%uCD$ 2^u2@t+$2"2P7Qh[#V D$,L$(t tC1ɉ ]4 ]48,uT@L$,t$Vh|$Ql >tejh[#Ot$5]45]4hG$jV0Ph[##t$D$,Vh|$P >tjh[#9 ^ã]4]4D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$'d~&s wR$'s wU$'gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G^41 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh&\#1QZS^4^[ÍD$Ph \#҃=]4=]4=]4Ë ]41 X#4+]4t$4Ph}]#h\400 \4USWVl$,H ]4t&AUjQD$}ol$,7F]$ '|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph}]#h\4 / \4FVEŅ8D$EH$l 'E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=4]4nAL$,9 ItIT$uWoD$,7\4j+o2Ph}]#\4V- T$jV%D$,|$?+"4t P L GP "4CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WK |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh]4P ]4I]4^_[]É|$|$ u D$Phc\# D$Ph\#͉-]4ōD$8Ph9\#uA0h|]#j*h]4ËI1Ph]#j*h]4ڣUSWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph]#=j UQ xt-u)%tt0Ph]#1H^_[]SWV9toӉQS|@jP ljtG\$=]4t <\u ~t F <$t)\tPSWWt GFFuD$Qh]#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$]4Ph\#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hp#3rtP~31@USWV\$(|$$1E=,^4uh0^47?,^4k49<$l$D$l$ =|^4t=p>4t=]4u3=d^4ubPjD$P D$tD 29PaHD$=D04t= ^4tft$,SWA ,^4=D04u"t1(^4@(^4| j=y!^8P8#1Hpt9=k4td^4[1,^4D$ D$D$$PD$Pj 9=k4t j4t, j4,^4^_[]øjh0^4藶UVVVe^]USWV\$芃03[ SsVs,jUVSh:7#UP9^_[]Vt$V[ uVh"p#he^4}" e^4^USWV D$0щL$l$ |$$t$4PWUƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWVՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$S2׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WPÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWbi)$l$D$ ׋ $D$ՋD$1PPU\$S ыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPDe^]fSWVPj4t ;4Z1^4WP(t>1C4$$^4u V WSCu ^_[S=b4tb4 \$3=b4r 3H 3b4[V53^4t(^43VP53 9t ;4^Vt$53^Ã=b4tb4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVmي,p#O u݃|$0xG-Wt$8 ^_[]USWV\$8T$0t$,11|$GUSRV@mي,p#O u݃|$0xG-Wt$8臌 ^_[]SWV|$(L$$\$ 1Ѝt$F,p#NuxF-VQ:^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$P]j ƃ^_[]WV t$RVQ t|$P3GuVj^_9Hw @sÃtP=USWVPt$|$b4V<$=]4uԇTh=/4 pV#Vt$ P]Eu /448JMp;5\#4| ;4^_[]VWj .^_[]ËL$T$$r#PPh=p# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFub4^_[]WVt$|$ zt!2Ph\p#PhVp#$r#PPh=p# ^_WV|$t$ t%WVra7ft=\#4 ;4 j Qu jF^_fUSWV\$l$=p]4u<؉%t1U`g1GWP?[PW1WPPUVd[1 jj1="41Ƀ=j4HPVWEQ Åt!W4 |$t8jhtp#'D$ tPXD$ 0Y4 D$ 89t VB4 ^_[]Vt$tPX64 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQt ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u ieD$E ʀ[} p]4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]øpa&fL$tt"u$ X#4X#4HI X#4Ib4ʋTUSWVD$T$ X#45b4|1Gll\G9uTD^_[]SWVD$L$5X#4b4|F|\\|N B^_[áX#4~Ph5b4yo USWV X#4; b4b4th!t 1G31K;)1G1I4:tl!GtˉP0  X#4jQJƣb4X#4b4~PhVn !t\l^_[]USWVPL$\$As X#411H$(uX#41@$1b4<#|tZb44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$b41H; t$z|#=X#4|O1;Ll |C9u^_[]USWV X#4~.b411F1l9޻r G9u1@^_[]USWVL$T$9~1@+5b4A1G1֋l9߻rB9u^_[]ËT$X#4!х1A9HhY '*b4=4]4 't 'P b4h 'b4h '3h ' 3hH '$3USWV \$4j4b4|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$D '=t]4EQ-s4C$ىË $Fw$ '#Fw}$ 'X!уj WRPBBtDt L=t]4!15"4h$#P`1sTu~-]$PuYQA tLу|=RP螽1 $1=j4b47f1=\>4u ÊCCs|,v, l,uȡ#4!ƒtظ:,u5"4资j W5\>4QTу X#45]4n9|$ V5"45"4蛅PtmƉV+ +1+5Q ic+Ɖ!уRPUVj4=b4H8 j4H=b4wA5"4kP豄 !уRPaٹ ]4 X#4VQRP[g "45"4,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/15"4Mj WP j W1P9@"@|b4$r#9 j4t b4$r# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5]4Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^53~V5H]41=4]4tȉt 3b40A#4^5$3'SWVQYNjj4عj49r Ѝj4WVSL5 ;j4;^_[VQ!уu$x X#4H9}FV!уtt^^Ð1j4j4j4j4WV|$ =;4t5j4tZ=/4ta=X#4|<1W!уtRP虆Ws@GX#4H9|vuj4覍5j4^_USWV 22D$L$!ȃ2D$2D$ 1H2222=/4=;4t4$=X#4|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$X#4H9|u $u^_[]Ã^_[]鍌^_[]Tj4K|$thj4m=j4t1=j4j4j jhp#"V΋At P$ FVC^hj4SWVt$>t_w P$ WG$ ߅u1F FF1Hj4j4j4j4^_[hj4SWVQ1u(\$|$j4St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-j4Vt;xH|p$x Hȅu^_SWV|$t$u;j4Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=]4uH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^j4U1tHt$ !t Q9y}1I(t(t$=$^4tT$$1=j4uȅt^_[]hj4j4=$^4tUWVjW7!t"j]jRPWV je^_]Ã=j4u p]4j4j4d j4Vj5<2t2j4jVx 1F=$^4u=j4u@11N^USWV(U ]1Nt$ t$tr:tm1j4PSi( $^41 ]4t)1V5j4hj4 $^4]4ttxq @3j4 $^4t =]4tj)$^4u=j4tj49j4J\$tP1ػ&!Ѓ1ojhp#D$Pj@t$>SD$$PL$Qt$Tt$V>j4$u:j4 j4!ƒt&9L$L$|D$;j4D$j4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$dj4T$X/ t$ t$  \$(T$_CtN4$jjD$xP$Pt$4t$5j45j42$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$ V T$1H#E t0E t L$PL$THD$$e^_[]Ã=$^4u?hj4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ \>4L$\>4L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$\>4}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8\>4;4t$ t$  }tEL$L$H1USWV8=j4j45j4j4D$$8u=j4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}j4 j4ȉT$!Ѓtsu!9t$ƄuYj45j4;t$T$$|@Ut$ 9D$ЉʋD$4$(;4@Ehj4hj4}!(;4 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># j4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=j4j4!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$j4 j4!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ j4D$j4D$$j4D$ j4e^_[]1JЋ4$|$9ωL$}@D$ (;4 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=j4 USWVt$hj4tH>tC\$1EjU1GGGUSxLj4G=j4-5j4t~'V uj4;4^_[]W USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5j4jjSt$DPV5j45j4s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@s4Phtk4fUSWV T$(\$$t$ 1`3PURS-")ˉ<à uVh"$cKt$|$u u)u%u!1ɃtsQl3Ph"s##Kt Dht# ^_[]SWV \$ hSh@r## uPeths#~ ^_[BxEhShq#o# 4$t t$j V>hs#뙿 hZm W2/53t$S jW/|$We[9uR1Vt$74$ljShs#}VAWV|$ 53j/Vt@jWh'Q#QVM^_1@s4Pjn.ÊD$ v3J v3;0v3~{у ts v3Qv3jPhs4hq#" ths4h32#P.Lt:j53P? f=3u5(q4Ahv3QOhs4hPr#HUSWVt$81GWh~z"5q4軛 1-s4ho Sp-D$hq4SD$UU WhLt45q4豜 tLtFPFuf=3(q4tjQPv Pkj豍t$4l$0jD$T$1D$EHM~EHMU ڃÃ=s4uf=|3u0Iڃ% tM 1f=|3@ ЈD$P D$ƒ t|f=|3Qq f=|3uf=3tT$j \$Ct,j Cu\$T$f=|3x댉\$ 넻 $f=3tD$ @D$ Ph%r#Fڃf=3s45l3jW5(q4踚 s4 s4 u61= s4#$ |39uj5$t hs#zjڀ tf=|3u j ttFPFujuÉUHt$j*f=3t'+\$|$f=|3)r#tbr#WSP jhLt45q4t hXq4jj3(^_[]USWVP\$D$jP5(q4 f=31=s45l3jD$P5(q4E Wl9=s4ttػ1FU Phr#DKtMVhHk45(q4- =s45l3VD$P5(q4ј W9=s4u^_[]WVjPhs4hyr#% t ^_hLk4hs4Hrhs#xы Lk4u Pk4Q[h32#PFtAf=3Pk4r#tr#PQhWXBWhr#V \WhPr#CLhu j_(s4USWV$ v3J v3;0v3у  v3Qv3t$hVh@r# 1GWh~z"5q4 WS'Wj'hq4Sj WhLt45q4 8x>jEƉ׉U^~*9u$hv3QHEhs#\v11f=3tj)RPhr# jhLt45q4, 1hXq4VW WV&Wj&^_[]j5(q4WX1Sj&SW&VVhr#AS8USWV$ v3J v3;0v3у  v3Qv3t$hVh@r# 1GWh~z"5q4 WS%Wj%hq4Sj WhLt45q4  Xx>jeƉ׉U&\~*9u$hv3QFEhs#|t11f=3tj)RPhr# jhLt45q4L 1hXq4VW WV$Wj$^_[]1W5(q4%j5(q4SgWj$WS$VVhr#?W6USWVPh t#s1GWje$WjZ$9tDƅtZWZ9uht#Ds1Vj$Vj $ ^_[]hpv3Wjh#2hr#Z1Sj#SV#-3j/U t@SQUC hpv3WVh#hr#WWVPjhJK$5q4裑 f=3t%53>t=q4V?PVWt 1FVh2#5q4] |$VW5q4艒 ?nu53hr#!> ^_VPjPVhs# t=q4u.5 3V7yVh s#=ht#qP^Vt$j5q4~VtVhs#=ht#qEj4WV5,3t)>t$=(q4V*PVW_ jj{VhVh+s# V3t$3jh3`$5q4 3u3$3%3t$3t$3f=3t53t$$53f=<3RV#t~"Pn3t$33t43t$3j3t$$3f=3RV#t~"P^WV,|$8V5(q4$h~"Wvt! $#Xq4 $ Xq4Xq41GVW5(q4 hXq4Wjv8^_WV,t$8W5(q4h~"V1Ʌ#G OWj5(q4#8^_V1Vh{t 5(q4) j迀Vhzt 5(q4  ^S\$1ujP踏[ESWV|$\$1FtCWPt1^_[fUSWVl$$1dt4Pt4p4%PhP3hmu#t$4U譼1I~1L$$D$=o48O>HЃ sX 4HЉ5p4jhP3hmu#t$4UC߃ufH1K$ '<dt4뷃EF<jh"S} jh"Se h#SD$QPuV<h%Sh}#Szh#S$_=o4<q41@D$<$XD$t4=Pt4<j/SPt4k<$$YxD$ P1PhPjPP5< p4L$ !P5<hu#QzS q4t4$q4=<W*Sh%hPt4k 1@1H1HD$1@$D$~1HD$$o3)t5|$L$(4hY%Vt5q4 q4t4$q4 VjVjVjVjo45p4hiv#j V5V4$jhv3N#wL 'P_ D$tu1=o4 1A111ɣ<3 333=t4t 3= q4t5p4 uW6uB= q4u5p4 u3^_[]xVh%v#Hh}v#Ahnv#:hv#jԻ5p4hv#!hu#hu#hDv# hu#hu#j蟻hpv3jj@hv#j,hpv3jhhv#j,fUSWV,|$@h+ j)W^1ۅo4= q4ho4Ou.j 1=$q4ȍPUt(q4jU(q4x3=o4u?jP (q4teQ(q4Uh"$ o4WŅ?1GVj?=o4t1O,^_[]ÉVQm=$q4uL$ @Vj5(q4 1Vh t 5(q4 Vj1@o4jho4NfWVP=o4t 5o4t$uhny#ƅhy#pt8/u33y# P腰 Vh3P %1 '9uQPt$A X 'uڃ=p4u%hp4h9$t$蛽 u p4%h|t4h%t$v u |t4=t4j:hy#t$訰 1ɅuǡPt4u'>/5Pt4jV8Pt4dt45xt4 q4t4=p4u p4%|t4Y1ɉ t4Pt4t=dt4udt4t =q4lj:h]$t$ 1Ʌ t4= q4u6dt4t=t4tP5Pt4V 1 q45xt4j:hS&t$| t 3j:hz&t$[ t 3j:hS>#t$: t 3j:hv#t$ t 3j:h%t$ t 3j:h~#t$׮ t 3j:h#t$趮 t 3j:hU#t$蕮 t 3j:h%t$t t <3j:hf%t$S t <3j:h^"t$2 t |3j:h]$t$ t 3j:h#t$ t$q4j:h #t$ҭ t 3=t4u t43=t4u t43t4tPh",t4tPh2"t4tPhy&t4tPh r%ht4h.z#t$˹ u t4ht4hr#t$覹 u t4ht4ha0#t$聹 u t4 5Pt45o4o4t%j,VtA1ɉ5Pt4 o4^_Vhy# Vhz#hsy#j荴ttu$Vhy#>hy#hy#>j%fSWV t$ |$6Q3o49p4p4)p4Kh4z#P p4VW8=$q41h,q4S Xq4,q4%dq4%Xq4%\q4fxq4 q4Xq4fvq4pq4hXq4jS> hq4hq4hq4hu jz#9 p4tz#Ph"$-萯q4 x |AEjj5(q4܁ xPj5(q4ā hz#jXu h:z#j腲1hNz#VWg vtHЃ rt+vhZz#<p4ō HЉp4봡o3)ǃG<1`}3DHu0W=r$hhmz#`hr#jSGhWhp4觿 ?t GG?uq4p45p4hz#j V3* WjcWjXWjMWjBVtuhnv#h}v#jhv3Mhz#3t q4 h#= q4t53u,u5= q453{53hz#j衰Phz# WVƿpv3Ph:{#W- Vh_{#W - j!=q4thq4htjI jSWV53t>u+t$s4t P V葵ƣs43h#Vts s4h}#VktahV#VWtShkH%VEteh%V3t1pv3Vh{#W+, W s4$11ɺ30 ߈s4Bu^_[ñ1WV,|$8V5(q4\WVWVX#NF=$q4t L$f=3t D$#$d$d$ wfD$ f=<3t $Vj5(q48^_hXq4jjl SVPf=3tjnt$R 30utztD$= p4„u30u1f=33몈D$< t< u>jV5(q4z f=3t|$ 4#t$r#P[`u 2 <3tu 3tt A8u1f=3t `}3DAt T}3DAD$jV5(q4 f=3D$Pk&/h,q4jj  USWVt$D$ $1=q4h j D$1CSj h,q4SW Vh"$&hq4AtWD$ hXq4jj t$jy Ujn =q4uD$ 1;$ȃ^_[]Ët$$4$u3H u3~u3H u3hu3eȋL$ < U;t$ KD$ V1FVj 5q4h4#YVhq4@SWVP3\$ x3t%p439u Gt+t' u9tpD$jP5(q4 Yـƀ_rs4^?t@آ s4 s4 s4 s4hs4h"$)%PW1^_[Pu3H u3~u3H u3$u3t1Ƀ= s4!YXD$_rs4^?<t@ s4 s4 s4 s4s4SWVT$L$D$= s4ut1<1s41F9uRQPQw y 8th%覥^_[h{#USL$ \$1B1t 9tA8u[VL$r4tSA z#8t6u(^@\VPts4)ƃuf^?݈@r4^VD$Phz#v#=x3x3p4Ft3_rs4^?<t@ s4 s4 s4 s4hs4hz##_rs4^?<t@ s4 s4 s4 s4F t*vPhs4h{#"p4~ v 7^ÐWV1FLt4VW5q4u VW5q4v ^_USWVt$jV5q4v  uD$41؍oD<jV5q4nv D$< t r֍,f=3ts4t Pw u3D$y1D$hB#P$s4tD$y3D$nD$jP5q4t^_[]1f=33USWV1GWj8Wj- VWVjq4fC(q4CfC 1l$jjSsu ~}D$tvjhLt45q43u ~]Lt4Bt8StGWuG1GWLt4U5q4s WUl$5q4t 1f=33D$hU5(q4t j)Ɖ,<= s4  A9rWD$Pj,s f=3s4tyf=3~g|$_r5,3Pt. s4YSQ;Y~ڃ tZG9r QR%l$!y-*8u!PWjl$UV'Eh@(jf=3ts4t PjKfSWV3t33^tPütF tFFu҉5 3h{#hW[h32#W!tRVhW/ t4=p4tWh{#}j WBtWV%%3^_[USWV|$h?o%Wj Wj=W0t@C@uShG%Wqu S6ÉXj?Wt0tO@t8JSsj?!tOYt@t QtWh{#R~5=3t,3Ft = @t t~vuك=t4~h4#Pt4^_[]SWV΋t4C!w\Ct4؋ v3Q v3; 0v3hv3j "t4 v3Qv3 Xt4#|>WAأt4NI$ 'Wh6#Dt4@t4N Q1f~ @t4 v3H v3t;0v3lhv3j!"lt4v Wh{# `Wh6#t4@t4N tEPPet4Vv3H v3!6h"$lt4#|t4h4#KO^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n{#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uhG%SuW 1@WgljR1^_[SWV31t8ϻ3WPt!CtWPt Cuމ^_[USWV׉A tS^؃H$ 'n tWU,tjPu U WF tQfB t Xth{#ZM*N 1?!9~ t~ N 9tF N^_[]h{#fSWV,1f=3t h|#|$Wh~#+t%th:#v|$ D,v4$ $ 4hW uW$ 4h:7#9ō$UhP蜮 tʼn-u4=u48v4hPU)c u4u%t#P5u4hp#h$u4Pru5u4h#u4uG=,v4tyu4lv4=lv4tVlv4hu4Qu4u7J$ u4z$u+hu4Pu,u405u4h#Z:u5u4h#E=u4hj$$ t"b u4u$ thT#hu4Puu$ ths##u4=$ Du4u45u4hۀ# u4tpp 0h#  u4uGu4T#ttD##u4[#@t$r#QPh)#  ,v4tPhh#~ u4uu+ u40Au*h# u4 # u4#U#hu4u Vh##,u4=u#5 u4`u5u4hԁ#5^5 u4=au5u4h# u4tPau5u4h #j u4Au$ th#=@u5u4`u4$ th#h<#h{"h00USWVt[ׅtf΋'t#'tVP|t%]uWVh# ju4^_[]hۃ#hЃ#hh#hЃ#hh#PPPh#hpv3 u4t@t hu4ЃjvD$t@0hE#o1h6#h+#hh#@D$t@0h~#91h6#hq#hh# D$t@0h#1h6#h#hh#USWVh#1^&,'Qhx%hpv3 't*tu6hpv3jjh#hpv3jjh#hpv3jjhă#0̃#tˉ#FKrhpv3j H^_[]USWV~v39u1Ht$Vhht@P V$PPftхu! $h#'tc D$^&'0tBV/ؽ ;$ݸ̃#D$VPhx%hpv3 D$ˉ#uhpv3h2#K}^_[]fL$t11f3QBuhօ#hDž#jTh#WVD$ tRt$tX|$t3fPh#fPh#f1@^_h6#h#j` hօ#h#jah#USWV @$ @F~  ߃| RQh#%19ս|*Ձ tRQh## 1 @^_[]û l$ WWSUP%`9tmv hQ#$ =Ut%tv h#RhjU2 1$ PPQ_É11 Զx$" 9/$ $ =JA|$ hD$ Z|$O< G|$$u)D$L$T$$RQPiT$ L$D$19عPh#`ch Pv tOPSQh^#56$!u$!$!j?PQlh t$hLJ#Q+PQh#$ "u!$ "$ "hPQh t|h#$ QRPhC#]h6#h#h8Bh#h#h91h#h#h: h#h#h;hц#h#h<h?#*$$j@P$!P Pt$$"PϾ$$ Ѷxl$$ $8v+)t)+8uHJRQPg t h#Í$  tL$(SUPV l$ 1rh$ US |4ōPUS < ߁WjP N1\$ PPh; tB=NýjPU  98t 8ux8u2N1 T$ PPS 9ǃu88u<\$Shmdv t*h#c#Wv hH#v h;#FN1 T$ UUPB ljl$Shmdv 91EUSWV$F~ 1jUWSPZ9u!D$=жxt9wwF̓uv hQ#聂 v hz#2ST$1uD1Gu<jUPSvZ9tu&v h;#h#1^_[]hPv h#h6#hl#h h#hl#hh#hl#hh?#hUSWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ P D$VUP s DD$st$s 8D$ s <D$tf4$l$4U't_uh"#ho%h!$hpv3 'h#hpv3 uhpv3j 'D$l$4$sf@8tD4$t$xV!@SPSVA" \$$Vt$S*K1D$0D$,D$(D$$d$sD$4j@HPe st$st$h#Wt$h#Ft$h#5t$ hÉ#$t$thΉ#L$9't uQhډ# 'h#|$4tD$4Ph#|$ gvVD$PUø 16D$8uT$Bg)QPR-a thI# 1@^_[]USWVӉ͋t$VO 1Htkt$t$VSUVtGURt$t$VWUV9uVSW` t'Ww  Wa 1H^_[]WP USWV$$$|G8-t o3$D$ 1FD$h#WSj it 1'39t9At&9IuJuiu3$tHPh$ AtPqh#U  늡<A뀃Dtou&t$ mt$d<$W$uQ 1t$hWV jSVa $FWPP藇 uhh)&VhiPz u h#j薁WPT$'3l$D$G_HrY7S_hjD$*P ft$fD$CL$fA37SGhjD$&P ft$fD$f\$ $T$0 T$T7hjRj SAZft$fD$fD$PSU\ $T$l$GD$x|$ hhjD$$P \$ $ sh܏#sh#s h #sh=#sh^#sh#s h#zs$h#js(h#ZsHh#Js,h##:s0hA#*s4ha#s8h{# sXf|$rL$I#fw 4'L$T$ t$"VRQPh#hď#h#j|D$f=313hjD$$P fD$|$<3fD$ $T$3h"$H$'L$f|$#t}#PQD$=ufD$L$IL$}1|$D$L$ t`}314/Drt#E9uT$ЃDPhv#~|$uj}jPP? jt$t$ VѨ VhiW u hZ#D$(|$ u,$PD$D$,$|$ 1hSW GG?t$>hSD$$P G$0hSWb jl$UW whݒ#Rhv3ŭWh:it$V2 uO j.>hv3葭j9Wh:iV u Cw8)|$##P'$rkLPD$$PQ袮 $<1|$Vh#ot$kL4t4$'h/#IhF#<48~1D=PAG9uh#'4 D$4!4"4#4$4%PSWRQt$h\#4(h#444,40k<SWPRQPh#4`h#kh&#^4\t h5#Et h:#3h#&&4d6|$1A t$t&u/7t$t nu Qh?#FL9Mt$ $t$qVGP$t$RVFh#Ph#hpv3  jUSWV։1hUS3 jWS sUPP$} t'Sh9iP tVpFĔ^_[]hh)&h#jwUSWV׉1hVU jSUh }VPP| tAUh:iP菺 uGPh^#q1FSEĐ^_[]hh)&jvVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Phv#^WVhY#f>r1D~Ph ^&GH9|j]^_WVhY#f>r91D>Ph#{ 9} j:G9|h#J^_WV$fGjRWӢ WhiV t Đ^_hg#j'ufUSWVu }6hh$r#j h#VW| Hw$L'v4v4ԃBu|1PP5<p v4불v4v4v4v4v4v4너v4v4sjhv3K_v4S3=o3=v4u.1L$A AAAQj jB =v4v4v4v4v4v4u31O=tv4$3tch$#Vt^=v4ukjjVA ƅD$ PV.D$(!=<\$yB  u3u1PPV[A Ɖx\$v4&v3=tv45v4PL$Q@ ƅ~E1v4VPSn? i)u5v45v4t$@ ƿy5v4h"$mv4u31O=\$t$9ȉQPAL$5v4u ύD$ PSͯ5v4r*V萀 v4Vh#v4v4v4v4v4V@3h"$lv43V@3h#Eˋ$B65v49Ph#hpv3f 1@v4$;u3t=h$#W+t1̜#=v4u32#PW;? \$u3\$=v4 1$ӋFHN~ HVƒ =v4u u u1G1=v4up=v4u< u7 =v4>h$r#h#hv3K $v3@t>$@$Ph#hv3!ڃ $v3@ t_  =v4 v3H v3;0v3hv3j$Q  =v4x v3H v3;0v3hv3j^:=v4, v3H v3;0v3hv3jMڃv3H v3$v3H v3^ v3H v3!;0v3hv3jIA v3H v3I v3H v3M v3H v3%;0v3hv3j-ڃu!v3H v3-`}3DPuW v3H v3;0v3~ƒ tv3H v3hv3Rmڃ v3H v3";0v3hv3j^2ڃuvv3H v3^?tЃ@Ӌ v3Q v3; 0v3~ ȃ t v3Qv3Vhv3P=F @t5v4h"$gv4f $v3@uiu3\$t Vѽ(u3%u3Wh"$gv41;`hv3落uv4e^_[]hy"jlh$fUSWV$$0E h$r#jޡ 11E1D$D$D$D$$׉jh 3h#$VgQ~Hw@$'ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$j<$ىY1ɉPXuG o3$T:-u"j9uzuI o3 u o3)t u <$u|$uM1ۋD$Ã<$D$ tD$ $4u9>W uTWh`#D$u5t뢍D$PWFu!Whz#Mh+#ji$1 |$ $jSV + u hD&Pp41uB8V1CHHf wy$'|$uhU.4Åu뼋ss 訢 PVh:7#y |$u.jSUa@ ss q PVh:7#B 1F $tCPpQ7|$t KP;AmPsT$Z|$Osh"$&d1F7hD&jhPPh#hpv3jfUSWV$$61h$r#Uu -z4-z4-z4-z41Ch#VWp e'H wu$('z4-z4-z4Ńo'filz4뙃prvz4oaz4z4z4%z4-z4-z47z4-z4-z4z4 z4z4z4z4z4z4z4u o3)ǃ=z4z4u-tX1Ƀ=z4=z4tL$H=z4=z4=z4=z4tʉT$4xz4jxz4Pxt$lVUhH3s 9rUh#\hH3謷H3 @3QT$/u>t$|9A@3A @3I3vy/th#h;#jet$ D3Dh jE=z4u$PhH3B$PhH3Bu@8uT\=z4u=z4t@z4 z4t3D$ P6A1#$=@txUhH3D$ P6 Bu6h"$jd#D$=@uz4 z41ۉ  t1ۀ|$/uhH3h#.t9U"r|/u (IHr IH9/touɉt$P;z4USWVT$juQ4% P.D$1t$CHfw?$T'ss PVt$ h:7# Psh#>|$(5D3C,H3)=|5TShH3hĖ#t t$V-1Ga{DuO|$u C(D$?Cj/D$ P轧t L$)@L$D$hB#QXT$CS(L$)ʀ</t ~/t/FD$щT$H3)rPhH3h#t$PVh^ L$@3@3=I3vx/u H@3=z4tD$PhH3p?D$PhH3>T$KP3Qt$31 u@T$(3Qt$$3q u.shH3h#  CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH3h-# 1Gt$#KPqt$1BD$ $x'=z4L$ QP T$ z4 z4sHtbffM 4Q4T$ z4t$/D$ !=@8fusha#jSt$ V7 1G)=z4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=z4t$tjQ\4H 4t=5u4PVH0u$#D$=u茴YjPV/uB#D$=@tM19t<1jA ŋ9uUVh"$jR該PPhΙ#hpv3j~USWV׉΀=5tj}$hVS_ =w6S_t)$ PQh%WS9耳?Ap!=5u!L$QVЃu#D$=@`=Vh"$L1C؍e^_[]Í\$SW.u#D$=@=5u"SW.u#D$=@=55>/uD$PV-\#X$hSW^ W7\t?$ VPh%hWGD$PWg-u#t VQLD$PW-Å5WV/PVt@\$L$/PWt@L$ Q\$S蓣u)D$ )=|\$=5u= 5hv3+Wh#hpv38 u3H u3~u3H u3hu3FÉ؃t9 t4u3H u3~u3H u3hu3ƒ߃Y=5u#D$=@uWcWu8=5u WV'5 PWQVQtW#1ۀ=5$5VPWhÙ#hpv3jj h#|9D$t$QVPZ Ƅ fDŽ$.$$PQ*\$4$9|$ t#t$WP$ D$Ƅ fDŽ$.$PQ*$3$$3$ $3$$3$  WVh# fD$L$TTPQנËD$L$TTPQ辠USWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP\^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP萟^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP*^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQPĞ^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP^^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQPȝ^_[]USWV |$87h$r#jG jŇt7D$Phht@j uD$tL 3(5,505[u 45t$41۽h#WVQ HσG$'051851(5\5`5,518505<5@5P5낃wp5t5^|5O5@T51 5"55@1(5\5`5H5L5d5T5X5 45=D5t D5<5p5t51Vh5Gl5p51C+<518505@5,5D585105<51@x5<518505@5,555(51M55r 5cL5H5J1(5\5`54@518505<5,5o3D$=,5u=@5u =85thD#F^tPI L 3=D5u D5h5 <5L$$ ȉD$5 P55  5L$D$ ыd5 T$ L$u1 T$ =5t ŋ$u|$u|$ t+uhl5j@,l5 l5=5 5tL$t*t,uw kL$t;t=u^Z R K( =L5u==H5\ t/ ( ! =L5u=H5 t 5)θ =05u/ =@5u!{ =<5u=85 t 5t1AT 3U4$5 ^_[]פPh#hpv3' j譵USWV΋\$=X5a t1PSR ~jP1ɉ=d5tW  L݉t$=T5D$WÉL$ CHHf$'ks $} PUh:7# $5{Dt{T.u =45tw=|5uL=5u%sh#o1TSh#L|$|sh#C5VWʼnى=T5ut jSWN W Å裤0W{ 蓤0茤8u ^_[]jhD&jBWVD$ qH1ftYT$zHftIf t$f tf9t=d5uyDt,RQ51f Duf u RQ^_fu1@fu1HUSWVL$dh5D$ <5u =5D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$Pz PSl$$h:7#t$X 1@F F$5Z|$dt~T.u-=45t"fu=d5uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=<5t-T$$L$(=x5t-sh&M&j $W$D$\l$t$0KjsfDžt=x5tsh&M&j $U轷js螓Ņtщ|$Wː‹L$@D$9ʉT$@l$ U誐ʼnD$<9L$<=5t/h$#sl D$TPrT$ 9щL$ 1|$PpM  à t$P~ Ct$ Ph=5t +Cl$TUPHU] ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=p5tD$|t$ |$ nl5ʃQPRW$RPh"jVڵVD$|=t5t$ |$ tHVUUUȉD$|$D$<$$SWh`B$VUvU蝎$t$h&M&VUSUz$=p5tDŽ$Mt$4t$  v3J v3;0v3~у t v3Qv3Guhv3Q艴=5tXD> v3J v3;0v3~!у t v3Qv3Gu7hv3Q(L$D$ ρÃ5T$95}`;L$}XD> v3J v3;0v3~!у t v3Qv3Guhv3Q蒳 v3H v3;0v3hv3j gv3H v3 1D> v3J v3;0v3~!у t v3Qv3Guhv3Q v3H v3;0v3hv3j ֲv3H v3 e^_[]SWV΃=5t vrhW%c1TVO^_[SWV΃=5t vhW%1TV^_[Ã=5tATPqh% ÃTQh"$ثÍ` f w5$' v3H v3;0v3hv3j@I/ v3H v3;0v3hv3j* v3H v3;0v3hv3j=k v3H v3;0v3hv3j%D v3H v3w;0v3ohv3j|! v3H v3g;0v3_hv3j/1@áv3H v3@v3H v3=֡v3H v3%áv3H v3|밡v3H v3/1áv3H v3*USWVl$(}=h5tE G=5t=p5t(DGP51 5Í4^69L 3} ^_[]{E ;\ 3~*P55I tM \ 3554FMt%$Q  Qt $ B$Iu$ L 3șƉșD$$t$D$ D$|$1ۋt$=p5t( 5 U tt$ ;4$}Z;D$}El$)š v3H v3;0v3hv3j ׮v3H v3 MuC;\$r v3H v3~v3H v3 hv3j 耮D$@D$;D$ ^_[]j)LUSWVt$~=h5tF G=5t=p5t(GP51 5Í,C L 3-9} ^_[][Gșljș|$$.1E  E;|$|6 v3H v3~v3H v3 hv3j s1V =p5t(41;$}D$)á v3H v3;0v3hv3j v3H v3 KuGm= v3H v3~v3H v3 hv3j ¬^_[]USWV|$=h5t_ C1ۃ=5t=p5t(C=P571F  F v3H v3;0v3hv3j,,v3H v3, +N, v3P v3; L 3} 0;0v3(hv3j ܫ;~&v3H v3 "v3H v3 hv3j 衫1W =p5t(4_ŋv v3H v3~v3H v3 hv3j ;^_[]fSWV|$`5W|t pSP9 t81PWV/ Vh"$蟤VJ ^_[hu#Wh#jy*USWV$U2|4(F$$1 |$1 9$)덄$PSUD$P\ tXǃt-tat$J^ ?tL$T$d$.?T$O$E1 $ ;z3r9vL$?T$$$^_[]SWV ΉRQS[ 1t4u t|uHthv3PjSYWt V^ lj ^_[fUSWV$$31h$r#W%_ WT;%$ D$D$ hbY%SV0 mu05<ItChP$WH 뼃pu D$ 뭃u o3,uk5<h`#j}(#D$=@u.$VtP3 9r*th#j%|WPʖ ty/t AƄ/@L$M$D$S5w|/uH9tx/@tj/Sjޅt@VvL$rSh#P1A $'@PVt$ ) ٍ$Ct1@$Mg4$PPhϜ#hpv3Vjܕȋ5USWV։π=5ujV葤t~VWCt98uR\$@SVt{SW9Wh"$1ۀ=5VWh" VWhǬ# w=5u=jWuWhћ#H#D$H=@V7=ċ5/jV豣D$@PV[jW舣uD$1Pt$LD$2x $r#t%D$1Pt$\\v1Pt$`wVPSt$D$BPhۛ#hpv3譟#D$H=u}1PPW{ t$HhV_ \$D$̋5Ћ5V~CVh#1C؍e^_[]ÉVh#hpv3 u3H u3~u3H u3hu3 uÃtH tC u3I u3~u3Pu3hu3t u3 tuÃ߉1ۃYM@Vh"$7'$̋5S0 Ћ5t$|$SPt$  Å11S5Ћ5t$h 9x߉=ȋ5t{\$(t$,l$( l&$$L$$D$ l$ |$T$ fT$l$\$l$T$ȋ5RQPVSt$(t$(h*#hpv3e$5̋55Ћ5t$  Å6|$W\$St$uVh%#SD$hL$l$JD$pBD$tB D$xBD$|BRWtVh#t$\t$\W: 誁8tVh #j#D$HD$Ht$\$ \$D$t$Ph"$2V艻tVh#t$S1V5̋5t$t$ЋD$HPWtVh4#$Wt΀8-t$VhA# WntV|$WǺt Wh#H1ۀ=5DVt$SWVP׉_5jWP t$t-h\#h{#輨h\#ho#1@^_[%tPh\#h#脨 4jWP t$thÜ#hÜ#%tPhÜ#1돸d#=5uj#\#jWVh &Phq"SSh"$9j~Ü#jVh &h˜#hq"WWUSWV8` 3t P` 31؋5܋5555@53it$L$,'hjV ` 3~Vh#0jG` 3hhVa ` 35hjV0 ` 3;~VhK#0jͳ5u 31` 35d 31t~5ttja` 35l 31@5` 35l 31@D}Vh0#0jE` 3t5tj` 3 76tQ` 3h5PYxC5%= ts=`=@55h}#j許 |55hk#0j膲5` 3` 351HPhm8@5` 3^ 1ɅA 5-P55L55ˋ 3uL76P76 3v$@'=L76=P76>1jSS5` 3^!ƒu|8f5-P55L5 a1H 33=\5Gt =}r t~=P76P76q˃u#=L76tPWUV萘 ~jWUVv tw߿(=P76u P76~~= 3| 318^_[]111RSWV։ωS/ 3D$t,t\$W3/4$5t$)ctjt$.'Q#1@jt$.#1PW.4$t$jSVVx^_[h֥# h#h#j`VP=` 3x=86 86t}=5ut=86tDp86HQP~'Q &@51܋55$Pj 586h#5p86L 5p86K=5uKh55` 3Uu4#5=u"P5 L5u5515=3w=86t 3~ jP5` 3 3~jQP 86 86t4=5u+5p86hM#865p86>J` 3=܋5u 5tP1܋55h86t 3 86 86t'=86tGp86HQP~Q @5Pj h86h86tZ586hޝ#iuC5p86 l76h76 u \76X76jhQPfRPh#Vk1V5p862I5@5^USWV=3v3tpv3D$W&O+5 5 u1@1ɉ$L$=h863\$5l765h76h#hS赍<$t$W5l765h76e$h#RPWh#hVw$VSh#hW[}WxfPW}tf=5t]t$5555h#hV$Vh5h#hWWfPWjJ 3u_5@5<$t$WjVd$h$RPWh#hS蕌$S]Vh̤#hPvh86D$= 3O@5D$ #D$5l765h76VSP1$5\765X76VSP\76 X76 h76l764$t$VPQc$h#RPVh#hSȋ$S]$QL$Qt$Wt$$hݤ#hP蔋$t$VdPVj "$PW586h:7#t$Pe^_[]V~=5u(=| 3~h~V5` 3 | 3~^Vp51=5uE1jVV5` 3aVxRP5` 3a ysh#0jd 1N^Ã=5uh#jI&1=؋5u5865P76hB#j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5| 3=5t$t$5` 3 ƃu*~3܋5;5P76tc5P76tU؋5L~ ܋5?5| 3x5 3h#j, 1{r5 3h#0j^_USWVP5| 3|$l$1ۡ` 3$WUt$ ƅ~)tދD$9up5܋5!| 35Hs-q8 uc1hž#Vh5| 3:~\%tS1jPP5` 3Sx})RP5` 36_ yPbhq8tD^q8t:Tq8t0Ty:Dq8t :q8u | 31$q8Eu | 3xt p51܋5=p5uh#j腥`tx>h86Ht)t hz#5 3h#jL 1%hD#jp5 3h!#0j^_[]USWV1N=t5=| 3 3uh#j٤܋5<u5-5sg܋5\51jWW5` 3cRxXͽuWURP)jWU5` 3#RyQu t#܋5@܋5=| 3:h۟#Ff@Phm5` 3Q x| 3h #j1^_[]USWV \$$|$ l$(1uu5| 351jVV5` 3IQx\D$ljT$Ӄ=5D$P5L59L$ujRP5` 3Px+D$T$EU,=5u#hnh?#0j | 31N ^_[]USWV~=| 3$(~$$~5t)ho#j蔢I1u)1ɍ|$h~W5` 3g 0|$fGWhm5` 3O fD$D$Whm5` 3O \$h~S5` 3 $h~S5` 3 GfD$D$Whm5` 3OO | 3t1<$uzfD$D$Whm5` 3O f $ P7611F$$~jQURы$ʉD$ ʋ$$~) h#b1F|?1jPP5` 3Nxg)y11= 3|!hˠ#11Fs1olh.#RjRP5` 3]N1yKkh#.kh#"kh#khV# kh#0jB 1N5| 3~^_[]fD$D$ D$Shm5` 3M yZkt$hA#Jkt$h#0j٠SWV Vh86j ykhf#0j袠 jVj yjh#0jv 1N=t5p5=|5=496u586h#趟=5hl 3W[\hd 3WE\o 5aXΡ#t# 3#t:#QWPA S8 3d#t2#P586h#h#hע#h#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5555hO#sWh0#T586h#Ah#4hע#'h#<=496th#j{5 3h#586ḥ#ҝh#ŝ|$h Wf|$.|$t+D$5..L$f tWtX= r@h@# h#h#Y586ḥ#Fh#9sWy\Why#t5| 3586h"#86 ^_[hm#Мx5t P[% WY x5t 51t5| 3h_#j|53mtt$11Hfhh5%dth5$W51fh)#0j臜 1Ht$&fhF#0jX 1HVt$VEufVhZ#0j*^\SWV|$$Wƃu[Wf1~tHNtt 9 tu/.fPWCt#D$=@t f1N|^_[USWV1Fh86PH{h86P kjƉ+<5Hw> h86SPh5Q@ (5$ ,5L$QPh5\h5Cjuh5[jh5^uH=5/u+-Bu"5PTPh55P hv3WVh5M<$v3@ub(505 ,5 45QP.t h86P(jh86j  xsZ1e^_[]Bdho#0jՙ USWV ( 3x&, 3kL 39|׋yM1II1D51PQÅy19}WDu=3hѨ#j.hhD5OÅy1ۉ9|( 3x(, 3kLShD5 3y݅u=3tehѨ#j迗D51E$sVhE5D5P )؍D51Eh#ji1IkFL 3h86ShD5#1ɉ^_[]USWV D$h86xGD$C5$1F1D5SQ291Ch86hD5h5P$ h86Qu*D$PUhD5Q8 D5tu=3h#j耖t$hE5hD5 $W1CttUtB:x9u=3tFhW#j,WhD5Q19uh#j1H ^_[]h4#th5Q<t @51h}#USWV1Ch86PHh86P yjƉ׃=76t/53 t`h#0j4 e=86t Rrx7t$t4h86P(jh86j lzbV1ۉ؍e^_[]Ít$\$D$<5Hw5 h86VPh5Q@ (5D$ ,5L$ h5kWeh5duy=86tSh5Dt^86 86tSh5%h5Ujh5Xt@h5Em(505 ,5 45QP=5/u+?<u"5POPh55P 86 86tSh5` 86tpp86|NPWt$h5)6Q=8686D$L;5D$P5Ph58865t@t=86u Pl=3t1<5Hr@tZ tUh5l'9D$X;5D$\5?uD$Ph5$Ã|$=86ut$h5Åh86VSh5P@ =86uSh5/!؃=86\$C=866D$p86HQPQ 86=86D$L;5D$P5(505 ,5 45QPDy h5j=86\$^=86Qp86HQPQ D$L;5D$P5D$X;5D$\5OPj |z86D$u(5D$ ,5L$ QPp5x535p86e-(505 ,5 45QPh5ji\$=D$L;5D$P5Pj y86USWVj/h5*>1Uh5;Ut>55h5UK /tOGh5WUh5h#jjO1N,K|/t1Nuh5h#jj^_[]SWV=h8601F h86t9t71h#jێmQHbh86P R=86t i<h86x t `m#86 86t#586h#5p86t 86ujh5^t((505 ,5 45QPu1=86th5hxuth5lyh86P(ljgSW, xa86 86t&=86t5p86hM#2861G*ƃuejh86j ^_[USWV $h86xu d?*1Fh86P,h86@0D$ jYD$T$=86jSh59]jh5Q$=86th5~gh5+th52d<5 w's1PP55f $jh5Pƀ=5/u+4u"5PbGPh55P> =86t4$h5Z' 86t:p86|Pt$t$h5s.Ph5086@5h5T$t8=86=86p86HQP~dQ ch86L$Qt$5SPD ƉPS?&=86tc=86tZp86HQP~3Q 2Pj t86Ph5%dPj ct86D$L$ʃ|QP  ,5(5ʃ|QPxnh5*1C@TPh5Z%VU55hf#0jh58ch5)t h86P4 jh86j =86tn)11Fe^_[]þ5PV$Vb뙉Ph5$뇃=86t cxIxh86PHx11@USWV $$h 586Sy = u$ /,4ŏ4/t EƄ4/FED$P586#D$=@`1Gxv%xmlxd=86t exRh5!(ttjh86jE Gm'1586hަ#j 1GĐ ^_[]ES586h#0j҈586h##뻸 )D$ )D$$h5 X86 86tV1=5/5t$PU ;D$vh5hE#jN _D$PS9E5WT&W^jh5Kt'h5K`h5&'VSh5NR xơ86 86tD$Ph5I=86t5p86h5+86@5=86tEh5C=8686D$D;5D$H5h5{<5Ht 1PP55 $jh5#Pt$h5 Wh5D$P;5D$T57wD$ Ph5;86tk=86tbD$D;5D$H5Nh5h5^^D$D;5D$H5D$P;5D$T5P55hf#0j蕅P5WWWh5!Ph5=86e=86Xp86HQP~ Q Pj m86 D$D;5D$H5UfH76H5L76u h86@L76=~| h~Ph!#thPhR#j蜃1HãP76 355y x1\76X76 H76L76ʉ`76 d76H76H5=3u=L76t4=~| h~Ph#thPh#j1H55 y xH76P76`76d761l76h76H76H5~ 3P76USWV=t86thߩ#j艂1I^_[]Ã=L76P76 3uL761IxՋ=`76+=d76|$\$5 3UVSWj)9|11UV$)݃H76|Jd76 3`76~H5P76Pd76d76;`76r֋ H76 3`76d761)ȉQPx[H76Ɖ5d76 3ȣ`76)=h76l76 P761\76X7631h#jWV1N= 3=3uhB#jy1l76h765 35H76Z1 3~9} G{u'Phw#j~ xI1=l76=h765 35H76~ H76 d76h76l76 `761^_ËD$L$d76)ʉd76QPR USWVu ]1D$ D$ D$`76 d76)ȉ9؉| d76)։ P76QPVS/u/1N=76MWh#js 76.|$tjh W V; $=7676_Shq#VPU$yƅE<$8$S x<Shq#P$eU$xyw[>0=86t5p86$h{#Vjs1576$ $ >QhZ#0js1N^_[Ép:USWV|$?/tGj/P. ƳUWCu/Fj/V ƅuhW=86t$$W jW[y3UWոu%D$ PW)jUPWV/Fj/Vm1ۅA4t*PWt1K#D$1=@ۉ؃|^_[]/WVD$t$ $PKyu~x<Wh#0j r$tDPvyJ<$h#0jq$ 1$76^_USWVD$Et$$^߅tP誩y;Wh#0jpq=86t<$8$W 1 86tt)$($u7=76uj076P"7676!UW3 3t%1PPL$H$X$T$W$tJSW#y!:SWh#0jpWu$ 1$76^_[]WVN1uA|$ t$t$W\ t(5p86Z :Wh0#0jp1N^_Vt$#D$ PV3t%5p86 9:VhN#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=3t =3D$PVet9Vh#0jKo_=3u&D$DL$HL$$Mbl$L‰T$=3u'D$PL$TL$D$ Mbl$X‰T$WVt6198Nu} u&WVu9Vh#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PV4t%#D$=@uVh׬#jm 1HjW |^_[USWV׉L$]D$PS˳t6St$躧th80wwS tՃ} tL1@_1=86uTG3D$ 3L$ uKG3D$O 3L$ u9t$h#jUl 1St$h7#Vj6m1He^_[]ø#D$=@u%h`%SL)tS0S|q} D27Sh&#0jl댋D$$u1@Ë $jPUWV}wPVu1@xN=86t1A$$3L$ $3$ u*0$3L$,$3T$ uVh#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $T'586h+#'uu=86tlD$PUwuZD$ !=uHhWU2 ƄD$PW3uD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUUt$ƣ 4$U{ 5L$ t uu$UFD$y)Q8=86us<$8$U xZL$ A$4t$Uh5#0j3j1H=86t2<$8$U Uh{#Wji1ɡ86tt1Ƀ$ !($t($t$$586hޝ#%jUh{#jJe*0t$8h#0t$8hk#0jf1O ^_[]SWV1|$tQ\$1OjWWSxjh76S蘛 y%##\$0SV0je^_[Vt$ xFP赝=86t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$( ~H111Ã1T |A9uV$P$(ݛ ǀ$1111틴$(3x$3|$ uUP$(W xLX$3D$8T$3L$4 uF1VVV$(7xE$($\h#.hk#.hͮ#j%c #v.$(h#0jc1N|(^_[]V=86t76=86t76=86t@76=76uh @ 76t01x&=86tDyhQ#jhb1N^WV76tP舕176761N76t 76tqA76uj1u3H u3~u3H u3hu3qtN;4 3u1tB 769G= |+76xx76 PW1t-768j576h76l 76&1^_SWV|$tR?tMj tSƋ\$WH~ </u>ۉ^F=76t%76p!h#j`1Hh#5765761^_[á76t@=86t76=86u0=86t'D$$u76tjP576e WV=86tB576t;11G~u)uh¯#jA`6h#hpv3xF vu^_USWV =76u%761N76u76}$ $ $L$P076t#HHf w=$p'phE##"ph#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$pՖ E* 76qhY#0 ph #p j_e=86t\@PL$QL$ Qpp p09Bx876jjt$t$t$t$ph)#p j[_ 761N1 $'LJ$Ƅ  LJ$LJ$=86twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G 76 VqP  76VqP 586hޝ#n1u76@e^_[]fUSWVT\$tl$h=86P($ޣT$L$X$1V8$V<$$r#$r#t4$tVjQjRD$Phs#SB $u2@$%  RPh#Uh#^|$x$h#SdBEPD$Ph&%SMB$Hs Uh#u# Uh"SB SX^_[]Sj QUSWV@L$E\$CD$PS{3j9#|#L$QPj@t$Vvue^_[]SWVT|$dT$t$X$hS($WVSh#t[d^_[SWVt$F=u1H|$P4t6t)G\$QjPS|VS舳Gu܃^_[Ã^_[lUSWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V86~1F1u86h#j9W^ÐSWVL$D$t$|$<76t76tt\^_[߼}\1KZ76teSPti:tdx:o39}j <@o3sPVW3 hV76:-u/76È76n7676`S6h#o3=S6h#hpv3<?^_[f1Ã=76u1áh860h#jV 76t"H 76p0h#hpv3%<586h+#u_sUSWVd|$|j/786t@l$x86h+#PF586+#1Cl86496D$ D$1D$$jh 3h´#WUHЃJw$ ';t$$@$'<5묡3t 3863r3t c3P=3#\$86! <kL76 L765]#5Y% 3865<R3t 33\$86t53el8686L53=86.86 Pt$ * NL$ < 76$LF5353535376<765n$86q5<[Z 3@K 38<8-u x5D$ =P86u 8686335z#863765<WO 86496s86d3U86P86?51@D$ )3 L$ ƒ ʺpv3tv3 o3p86ƒu 9u , l$D$kL 3h8676 86q"1$jh8 3h#WU裶/~HЃJS$d'4 3ƍHw$L'86뫅!<53496|5n$m86@X86ˀC8615z#"86 <@Ƀl~mtKotRpd86SatDeJ1A 86 86 3 3 3"386 3@{pe<5SH863 < |76x761ɉ5<"]8686<L$hy jLjh 3Q=*h86bl 5<Vh#[ V~ 3486 86@5< i@86|5865Y%865<9i <E L76N86486 $! < }86865< =86@86  3%=3p86v3 0akG1A11|$<$t86D$tGNutNj]]hG#S1t[hl#SuE7676j576S^ 1AL$y#$]176<$D$h$#SZl$\$th32#S1Džu u31 ðt5hl#S u376S I 1urL$tP؅uAJjho#S uP76D$t t P CP臹ىQs ؉D$1ES#jt$ S 1AL$"1ED$\$t t P h$#S!t W=T86<$l$S|$;76,31ɺ G1Fmفt#u41A 03<1A 03!531ɺ.1!# $ 4u h86 3=rnFr0s9-o3D86PMo39}j4NxPo3@o3 3o39 1VV4b xo3@o39| Qh7#j?H 1FPh޳#V(H V"5<h!#h<#jHj"5<h~#hh#5<hM#jG pv3Vhc#覠w%5 3WV- 5 3WV- Vh$s5<h!#0h#jjG!j6"mh#jCGt$h#jjP$t,(XN8@tUjP$yFD$8UhG#W1D$h.D$1$h$#Uth32#U@-Džu Ju3tkðtAhl#Stjho#S tj1ujSðuh$#U,t W=T86Uhs#l$}$l$hl#W]tjWB\$rt D$W 3|$ td^_[]á5t8uhE"5t8u5J"UhJ#j E USWV|$W%UWXUVANJ00ht$跩tAtZ/UVXUW488ht$vut$h#0jxE1H1^_[]á76t H 76hpv3hϸ#6jWVpv31FWVhh#WVhh7#WVhh#WVhh#VUSWVPˉjPQ փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Q$1>tj,VrÅtj=V^tmj $ tdAE0H@76=76t L86sL86uh(#j6B1O^_[]h<#he#h<#j B4$% ɋD$L$01&WV586h|#hpv3( t(ο#Ph$hpv3' !uءxv3H xv3~pv3H pv3 hpv3j I+^_SWVPωPQKt4Ƌ$| tC$Sݹ t'ǍCPVW DG T86 T861^_[USWV$t%t_݊M\tS8uEEhV#j@EjE UEƃjSVM t3l$hUVPWUh#j\@Sw $EE<\t:uCCUB $AStRC1fGt,PtStgtstp1B ы$J@u $A=X86tZ\86HVV?4$ Who#ji? 1H^_[]V Vk h# X86 \861V4$= Wh#USWV\$tK;tFj蓷 tLNjl$1pSSG woD$G95`86t%d86x!h #j>1Nh!#=`86=d86^_[]WV5`86t;11GFu)uhN#j^>6h#hpv3$ vu^_USWV`861 l$$=86Kt(=86t!9t)@tB9uKKt8<`86CS Dž$h#j=z$uEP豬t?NjCt /C;WC |/uHC C$#hx#j2=Ct/C1N^_[]USWV|$LJ$`86tOwCu kPUC |/uPV3@ t2[u1=86O=86=86 2$=86tW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=86tGtlD$@1G8D$@1D$\1GEt$ h#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh7#j59tNjE|$tDD$@t:$t$PVhp#hpv3!VhZ#hpv3  $t+Et$h PV% 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7:p86pv3WVVjNuD$L$ L$$VjVj%uD$L$ L$$VjVjuD$L$ L$$Vj辯VjӠuD$L$ L$$Vj蕯h#H861868686P 86t$,NFF FF} |$WVj y|$ujWj WVj y|$ujWj WVj y|$ujWjn WVjZ y|$ujWjB TWVj. y|$ujWj (D$,WVj   WVj 0=3t3i=)‹1@?9 tR=96t3<$/>3i=)‹1@9 tR 961QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=96ujh=< 96#t\u#uGW6 tjxGj jWK Ť />3i=)Ë 96,t 98t#@u $j t!8h $1(Wh#j9- h#hU#j!-^_[]USWVP|$1N=96ujh=? 96#t\u#uGW tjxGj jWN O />3i=)Ë 96,t 98t#@u $j t!8h $1(Wh#j<, h&#h˽#j$,^_[]USWVt$totij/Vx1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉhJ#j+1H^_[]1j ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjcS CS>tKt^?tYڃCKt6C;C C})VWh#j*S贳 h#C=96t$ 96X Vhb#jW* 4Vhо#96 961Wh#j** SE h+#}VQh#j*USWVPϊۉ$ts`}311JDhu.e[YAuۉ4$Åt>V",FN4A1RA113W1J 4$$'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSLV!1҃ډЃ^_[]fV1=96u*jh 觪 96uhb#j1(1N^USWV 961Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj Ël$EP莖 $$$KCs{ D$C $C1^_[]Ët$ h 3P蕞  1$$CHC1FwCE3 S S h#j&1NwUSWV96t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j& tx@ LHDh#jY 1^_[]USWV96CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj J1ɉHT$, $$$P HN HF F t$1 H;@u 96-$96 96 96-$96Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@ 96=$96l$T$s}ډD$0! umщjt[$96= 96 tIj t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Phl#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=(96u*jh= (96uh#j1N^WV(96t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(| t^t$tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W蝥 h#jj ^_[]USWV (961Kt$/>3i=)‹/uPV/Džj$ tWW茊tN$$QVQ4y8~V Q(y,~VIlNF ,96F5,963Wh^#!Wh^#j V VhG#j ^_WV5,96t~1F,96=86u~ t v6蚫3 3tWWvvvv 6踫=3t v6ά6膣 V} 5,96u^_jhÀ=096u1WVL$T$t$ 09611H<>u5Guu%P=496t09611@^_V|$ |et$>t\jh)#P t 3=3t#h#j|j 31H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh{#j^_[]SWVh1Njh#Su3h#Wu!3u9896Džu91FWSh#Voh#h#h#V WShK#jL1N^_[USWV\$hSb1N|$1h$UW O$LJ4$<rD Sh@96h<96   PhH96hD96  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQg 7 1D$ereRPQ8 ^_[USWV $ $Hw.$' e| Rh#{=896x1ۃd|Rh#Q1l$ hVU $ jdPU$,蘌 $$$Hrjtr$@ L$ D /f@ 0 whq#h#h#h#$F1 $F2 jdPV fF0 $j j0P 76 76t86T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U[ $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U| $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R t$ h7#$%$ $LJ$m9rD$ )yQj0U/ 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%hT#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh)#W t1H^_jhy#W u(=496uL96uL96h#jjUSWVl$hUh1N\$1h$WSi K$ǃ4$Yt"Yh PQ" Ǎ A/G<rH )Uh@96h<96o   PhH96hD96G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VP4yEtQQP  ƅ(8$VPyElQQP˳ 1D$@$$$$$ȃJ-σwY$'<2ǃ$)$Qgtxu,&-u~t6h32#VDžu'j0 PVhG#jHu31FUW\ t5Ë$rt$VhZ#j$_Ft1N1u3t Wл^_[]fVjh%#8xKh"P/X96t)h32#V\961u;5X96mVD9=86th%#h#j 1H1^WVPD$$|$t t86t$86 86t"=86thpv3j 86pv3586h"W 4$VWZ Wj  ^_PX96t$L$T$ $RQP, 5X96~XSWV|$1N|5\96t,\$OPWSD t;j S1t^_[SWVPD$ $|$t t86|$t$86 86t"=86thv3j 86pv3586h"S 4$WSY ~V茡 Phe$hpv3 hpv3j j ^_[fUSWV} u7th$r#j \$1h$WVo LtPt߃95o3D$h4#Wƀ8/h2#Vushz#Vtua$PVDtKD$Ph`%Ct4$3D$ $3L$ u$3D$$3L$ t1PPƅu j02Vhv3>$v3@ujhy"jfPh6#hpv3* jUSWV$$6h$r#j芜 11ChG#VU,n e~%q~3كrtރvt_xt96ŃV.PtrكRtwftAid96h96뒃Wt6duq`96zp96ld96h96Wx96Il96;uo39|=d96u 1Ĉ^_[] D$h j)$D$,$S I9v9/u؃@]9v8/@tj/Sȩt@À;.uCt<.u{t0\$u h#C\$96EHu]j$8u 96Pj<|96a$8tӋD$t$ VWA x96tRtD$W^4=d96u8ts8?ti8t_Wh"$q_HtjC PWh:7# +D$@uD`96u;Wh#96;;=p96uW|ڀ=d96utV/tD$%=@t/==l96u uWW w d96 h96х ˉ4=x96u Ő=t96t@jPt$$ u hQ#7Pu-uI8V,NjGHHf wO$H'=d96WOwP"{jWV{9 GG \=d96uWOwP:GHftIfgft9G =d96u P& PW}G  Gwud96;8=d96uG ?tow 觚 PUh:7#x c=l96uO1zuSwt)d96t 8t18?t'8ut/wh"$S\96V+Dž6=p96u =96t96ww0hD&j`ww ę PVh:7#jS`Ph#hpv3 jd96USWV΀=h96uLVha#hpv3 hpv3~u3H u3u3H u301C=|96l$$#E=jR@8D$Pu<=l96uvVho#1Zhu32Ɖt9 t4u3H u3~u3H u3hu3ƒ1ۃYÉ؃^_[]ÍD$x $r#t%1Pu1PuYVPWSD$Ph#hpv3NUSWVAӉ΅:#K1jhV, $ǍD$PW_.D$3CL$3 D$(3CL$$3K #D$ =D$W,1PPPW D$$h PQ譻 KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PW* D$L$D$)T$T$ 9D$t;$SV:96Vh"$X)̾96Vh"$XWk,1@e^_[])W+u1PPPW uh h$P袺 KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW{) D$L$D$)T$T$ 9D$t1)W,+1PPPWF h j$P KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW( D$L$D$)T$ T$9D$ta(W{*j1PPPW蕟 Th j$PF CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PWG) ;D$t$$P$!Pq8 L$)L$L$L$ |$D$ hs'W)|1PPPW觞 fCXK\D$L$ȃ|ojr \$9ËD$| S$PW0' 9D$)؋L$D$ظL$|&WZ)1USWV\$l$UEtMƊAuA)k')\:6j赸UGG SѸG96<96 \:6t^_[]Ã=`:6t^_[]USWV\$tKƊAuA)k')Ƌ,961Gt?uSgtmt&uSNu496jVJ1^_[]ËD$t @ъ@uA)k')96WVt$ >tVG t|$u G?\:6ww ww Ww  \:6u=`:6t^_WVt$ \:61<96t96VPs8uG'u \:6t^_Ã=`:6t^_:USWV|$tWBuA)k')961t(l$sWtu tC uމ^_[]jt$ }t@1ËD$L$ pq莪SWV\:6ƍ1P腶1 96tQ:t @ C'u9 \:6u=`:6t)h jVWg{~R1ۋph0#)p43HQPP@%3Q C9uW荶^_[h#WV11 96t)96Q:ujPuFȋ G'uƉ^_USWVjxB68H xB6(11C}t$Ej=P譂t)AQUkh:#537(TjUt_Uh0#p(w23HQPP$3Q xB6H xB6(S UhO#53' u1^_[]VhB#tauj4xB6t$1Pc ơxB6H xB6@u1^fWVP50:6`}3DBuF:''ut t- (:6]$p'NF밉jWVL <:68:6 :''j(:6@:61D>G:''uGPV8:6WVP謈 8:68^|~u$PPh#P~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ50:6^_ÊVF|uܹո ѹ Ǹ É)B$:@B:''uVPQhd# fUSWV|$,t$(S脲=(:6jLV~t:xIuxNt@jLPj V~1tE@j P~)=(:65,:650:6"1,=4:6uƉS;^_[]ù#V=4:6)u ^5,:6Qh#*WV$r#|$ |$wL3 P3 pB6>t'F pB6QpB6RN@>vuڋ7 pB6QpB6t& @뭅+L3@P15G6VrƉRPh$# 1 ^_USWV8׉ˋ 8:6<:6D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh"jV;jVt$ % USWV Ջ\$$St$$tƉ׃=4:6%up1҉  ډD$$=4:6&uU1ۉ D$8:6 <:6ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$'  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWV舞Ɖ׉^_[߹J#[#>#wSWVP=G6@:6G6Q5)Ɖ=G6=3ttxt>u{&1ۉSPV諑 Ɖ9u$8t*8u+$t@:'' t$@u^_[ùh#}%USWVPՋ\$St$gƉ׃=4:6uKh$8:6 <:6MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljա4:6HwSjP ljա4:6uND$8:6 <:6N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!TH8:6 <:6N"ىWP1Eكra$"ى=4:6#É4:6݅~h4:6 8:62É׃'1H8:6 <:6NLىWP1 18:6 <:6NىWPÉ4:6L8:6 <:6NىWPe$É׍Eكw4:6|$4t;~l-4:6b1A1Ǎt$WSh"jVjV58:60't1I1@1l$QPh"jUQjU6  ؉^_[]ù#T#J,#@USWV֋] $t$ơ8:6 <:6L$ D$T$uPV֋=4:6Ww,L+'8T+'}uPW ֋=4:6ȃ}tً$VPt$ ֍GwT+';E Qȉe^_[]fUSWVb3$D$ h#t=etuD$ jxB60hD:6GVSP?SU@P谧áD:6)QPS} D:6)١xB6pQV蛙PS/$$jhK##ƅ<.u 1~.D0t/ua$Ph`%wtGPVft6$3D$$3 $ u$$3L$3D$ 1e^]Sh$5t/h$"uxB68LtjxB68j*5D:6uj=D:653[3f`5D:633HQPP3Q 53 3@u1[h8#[0y Phm#AhL#7SWVWϟWPٞu2\$Vm谡8"u6W蝟WP觞tVLD:6V1^_[Åul0y Ph#jD:6tjPh4# hx#ÐUSWVD$ 3fa1Ƀ|$‰tpыLh$SŒ$thd7#S谒u 1t$.4NJ]taM\uNEU\rw$0'\0u!11ЃwxAunjt$>3HQPPe 3Q t$.PN    ȉš3HQPP 3Q<$t*3HQPP 3Q 53W 3Hu 1^_[]ÁfHh#jfT:6u辛L$ X:6jPV=\:6t `:6K15`:60ppp VPj  95p@6t =3ujVV^jpPT$=:6u :6D$ $1APV`:6\:6t1It$aVPL$T$ D$$PD$:6jWVP|$t$D$$4$ WWV׉ΡX3t L39ty u hL3 =p:6:6uIPh"h`3 =t:6t5t:6h"h`3 t*t$ Wh`3 x4h4w%h`3xVt Ph"$h`3] 3HQPPj 3Q h`3 ^_SWV|$t$\$SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$胜4$w^WVt$ |$cWY^_PT$D$ $1IP>XËT$1It$)Vf'T$ L$9upu'0fuQhH&j hd:6 d:6@^1x:6:6:6:6WV|$ |t|$wL3 P3 pB6>t'F pB6QpB6FN@>vuڋ7 pB6QpB6t  @:615+L3@Pơ:6PV :6^_USWV\$0t$,|$W̙5G6jVi j=83thƉ؃$1t7=3u.D$0t Nf $uQVi=x:6u"W这j螵=83u11EPiWcu :6D$0u^_[]jUSWVL$,|$(306̓VԘ$x'Uw1ۀ=3_=x:6Mjw1ۀ=31=x:6$=:6jwH1ۀ=3=x:6=:6uQ=D6tTjw1ۀ=3=x:6=:6t  u8V31tu :61l=D6tUW_j\$0SWh a=D6tWD$,E=D6tt$,WK_=D6tst$,WE\$,SW=D6t@UW=D6t)UWyPh&#e hL3k=D6twww. :6@jw1=:6:6 jwa=:6t :61V谖VuL$,=PE6t l=r3t :6tu u^_[]PNjUSWV@|$T5T:6D$$w=*3tttnE65G6P$Ph6#Gtj P53[ Kȅuhn#53Rl$jU{th5T:65X:6jm<$t&4$hhu#[53|$:6\$X\:6-T:6j wD$ \:6u=`:6tSw\:65T:6j \:6u=`:6t]<$t&4$h#538@^_[]j5T:6USWV\$;s3=*3{E65G6PP'h6#stj V53 vhJ#u hY#3HQPP3Q 53Vl$\:6ttQu {tF1ۃjU_|Sl$SP~ tuQV{:6Ju \:6u=`:6tjsUsV言:6 \:6u=`:6ttJ=*3tA{t;E65G6PHPh]#539^_[]SWV|$:6jw1=3t :65:6^_[Ë\$1x:6u/? :6ut΅tSw5:6x:6t"u8|:6H |:6Kx:6jw=3tru+|:6H |:6x:61 1@65:6+USWV1=3t5:6|$0D$Pm[thUS- =x:6tiD$:6,$\$4>GG6=*3 E6PQPh2"w 3HQPP3Q=u3HQPP3Q 53juw  Sw5:6=3uZx:6t"u*|:6H |:69x:6m"u|:6H |:6 x:6 :65:6D$P襏 ^_[]USWV|$0t$VR@O G6jPw+ _1=x:61{t'GG6$pW Wuuޡx:6[tZtT1=x:6uI=3u@l$41; u{CG6Us t=x:6u =3tʋ-:6-:6V譎 ^_[]USWV\$K1t@ \:6PSwƋk1OuD$}t 1{PuVy uR \:6u=`:6t~ jW|$x4$jt$jux Wq<$t$bmE{t V[v1 Vh{:6 \:6u=`:6tA^_[]Åx W C0e Ph#USWV$$D$1t$ E6D$$tE6D$DxE6D$Ht$05:6$P辌5:6EG6L$XIEtH1F\$XljtwuGG6hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjGG6w誸tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P$D$XtH$r4$ ȅu$1ɉL$@=3t=:6u|$ ~ $@D$@D$ )$=*3E65G6PDPl$41dz=u)3HQPP3Q9}j=WWƉt>u#3HQPP03QFPU 1Ո`1t$XtOË$t)3HQPP3Qv É΅u$u t(PV53 مt ȋN΅uء3HQPPS3Q 53|$ +t$4~jh 'W{ u|$$ƅuf|$# L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$-8 fD$D$# f=D6t*fsD$=` t= u ft$}u$D$@f%Lu D$\:6jU[qD$,ED$D$tD$L$` =z3u f|$t$Ut$4r t@:6|$D$D$`t$daD$,F L$\:6=`:6tYD$t;=:6u\:6=`:6t.t$`jt$hL$D$Hs*|$# toD$ t$,t:6.u D$ 1@t$,o\:6=`:6  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]F6D$(F6:6"<<NjD$ T:6? D$(F6=:6:6Y1PPW 1ɅȉD$PPVB6\$pfB6D$ HB6$B61B6\:6 F6L$( t:6L$LF6D$D$hP \:6u=`:6t$jVB0T:6D$ 5T:6|$t&D$1f|$tH tE6xE6$t:6h t$8:6H :6=t$L$QPy :6\:6t$D$(F6D$DtE6D$HxE6D$Lt:6hB6B6t$pD$ T:6|$Pt jK \:6u=`:6t=x:6u 1x:6|:6D$@z$jWT:6D$ =T:6h!t$85:6t$Ut$8nWt$Ut$8VpD$ffD$0fD$8D$L$D$u#x33t3|3@L$D$:6D$pySD$lT:6D$ 1D$T$PWt+X:6D$|$D$:6=T:6D$$ E69t;D$=* t=-8 u)F6D$(1F6D$TL$$PQt$u |$ uD$0ufD$D$4:61f|$ˆQP$:6$xB6B61@ <o3D$:63f`4$t$T$$L$t:6D$ T:63L33`3T|$TtD$(F6:6D$tD$p:6D$D$tFD$t D$f|$t$lQ\:6=`:6t|$# t jD$u3F t3)N3|$@tht$Dhhk&m $P薀^_[]h#5:6t$1=:6ȍPu =:6u"D$4thB pȅu5:6t$ t$,Pt$=X:6uS葕'h#hB6xB6t$p|$Pt jt$h)D$(F6D$DtE6D$HxE6D$Lt:6D$ T:6jPŲP0 \:6u=`:6tVW Ph#xX:6u:6j~:6t:61~WVt$tr|$w$'j Wv M $@Fvu;Ftj WP( $jpVg ыF @v 빃^_V t$t8>u3Ft,ptF E6QjRp ^SWVQ3t1OS jjP] t6>F1"jjP3 tv^^_[USWV|$41GGG =3l$0\$S]}\:6AjUfjUPCh uA\:6=`:6t 4$1CSt$SU\$t$$w \:6u=`:6tS|^_[]h#VP:6u1PPVPjh3R tF$P{:6t.1QQVPjh3sR t:6@=PATH5:6 ; :6 3 3^á:6SVh$r#ZxB68uj21^[1ۈ335:6thB v|65xB6 E6SSQPV:6áx:6ËD$ x:6|:6PËD$@|:6 x:61x:6|:6Vt$ |$|vXPh#1@ :69~1Ҁ8cBx:6 |:61^WV15:6VDxB690t\WzxB60PjPfH5:65:6:6@:6jw5:6JWz:6^_USWV$E6$j/WFt@D$PW{D$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UV'uD$ %=`uVyjWS ƅuWh%Wh# Wh#L$:6x :6V|$|D$ p膇:6:65:6uu~9} ~ x:6|:6^11@1USWV4h$r#c|$$WT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h#53(14^_[]UWV׉΋ :6uj' k< :611D$ T$l$ &D$ $,$<$\$ D$##D$&?6u0uFjh^$WJ% %W/i|80uHx.t x0@te^_]fUSWV|$7j/VPQ^ \:6u=`:6t h#D$Ph#/thv#h#GPh"$Q t*3HQPP3Q*3HQPP3Q ^_[]ÃPWh#SWV|$tWȊ Bu%iC)ʾ!)!:63tFWPbtc6|$tT\:6W`PSnƉf@@ WP \:6u=`:6t u10;6^_[\:60;6Q3.  \:6u =`:66USWV$$$j/$;turfEE^E69tth#VWt $j$q1Ʌt@@t`tm$umtisD$ P$xfE$Kyo8ko8]o$ u=03x $u  \u =03y& u $MƋ$1Mtfyu03YL$$j$P 1OD$V`mG:6tAPh#m{t$t-'5:6h#>{t>/u19}-9j$$PM ƅvvD$ PV<x3D$(!D$ =u8=:6$Nu$m8tm8t mD$}o$E$\$|$$t$t'53jS\P$hq&VfEo$T$pƋ$$\:6|$ÍD$ uj$HfxT$ ufBuω7 \:6u=`:6t ׅt"G GfEG EG fEGE fEEĜ^_[]\:6T$ Éuj$fxE$ufBj \:6tbiV`\C+L3P%jV$ij$t3fxu*SVm$=`:6V$h#SWVP''1t8|$''L$8u%tWPw]L$ t us^_[SWVP('1t3|$('L$8uWP,]L$ t us^_[V('t%('jPf@NHu^V:6 03trft fuxB =0;6r^USWVP\$=E61N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#3wt1<:CG럡03y x5031Ʌx $y $Q503^_[]SWV\:6:6>t+fuwW' ߉?u׃0;6r \:6t^_[Ã=`:6t^_[WV|$D$ \:6jP+@ft*fu vfFGF GF GF \:6t^_Ã=`:6t^_WV t$D$L$ \:6fO 3fOPtGWVU \:6t ^_Ã=`:6t ^_jt$itfxupE%1USWV t$811G$1D$h#ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШPxB6:KBxB6*#$1\$ D$4$߅u U='t,]''8uUPYujUNƃ<$t0vh#4$xB6H xB6(t|hN#-j v2tuh\#vh#xB684$t3HQPPJ3Q l4$t%Uh#SPhl#+h9#,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$'D$j/U1jU脄~f0= Ph>#:uhh#Yuh#Bu h#7t.Uh#3+E6 t$|$tJHh#_t$xB6H xB6(ouh|$돡E6D$ FjUD$PK PcN<$u$r#|$ty#Phr#~Sh#pt$ct$1 ^_[]h#+#ct$r#RVh#Vh#1PPt$  5L3@PubUSWV|$D$\$=3t4;6H 8;6 L3 <;6 P3 pB61ɉ @;6 P;6H G6SppB6tH pB6~<;6<;6dH <;6<;6+L3PaX;6T;6u%Vjap X;6X;6sT;6UVWX;6-X;65T;6x=tET;60va5X;6΅u!c<;6pB62V'X;6T;6t OX;6G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ tE6t D$3 E6D$<;6+L3D$?~uЃtRWT$4$ D$1@D$ wy< pB6H pB6f<;6e$!PVVST$0/>u!y@u=D$ D$4;6$pB6H pB6R<;6Q=4;6un<;6+ L3;L$~[xuUH<;6QpB6H pB6<;6pB6H pB6<;6$ |$D$5ЉD$$ pB6H pB6<;6`T$,H <;6>~=u|$ D$ RV"T$4| uG6pB6H pB6~#<;6%J`T$,H <;6 X.`T$,H <;6$9Ut$ *T$4<;6+L3jPHPuT$8 _T$,H <;6>pB6H pB6~<;6 _T$,H <;68 G6w_T$,H <;6G6V_T$,H <;6$^4_T$,H <;6D$$ 4|$tu^_[]USWVt$,\$(=P;6tE6t$D$ 3&j[XNFE6D$ @;61oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=X;6\:6\;6u(QK9P7Y\;6NQP5\;6X \;6 \:6u=`:6tPX;69t31Ʌt AuQP!u=X;67vA X;66^_Vt$t"X;60v5X;6΅u^V5@;6t1\:66P 5@;6 \:6uۃ=`:6t莻1P;6@;6^USWVt$(PnY<;6+L3PmXL3Gtr}t  KvC#:t /tQ t7=3tAL$,u8 pB6QpB6ZO@랃tPY^_[]Ã=pB6u ZpB6L38t!P tx PXu$hK#ljPXGËD$,tÊ6%'$< t< s4< w*pB6H pB6~<;6ZH <;6pB6H pB6~<;6YH <;6Gw/u}/uE P USWV,D$DD$L$@9A|$$D$t1:''‰T$D$D%D$ j=L$Q#D$pD$$L$(<$ L$ u:|$L$D$ PQ 1ڋ\$L$  F6T$)11G<;6+L3D$D$<$u \$H l%t$l$UPRTT$LQT$L$ t,1t}y;@ڋL$ u4;6<;6+L3=3\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =B6t1C L$@11ۃ9|$t$ |$Wt$T$RV WUL$(/<$ }D$1|@uD$pB6H pB6~ <;6ՍQ<;6V<;6MP<;6EK1ۋl$$]|$ D$EÊ6%'$< u.pB6H pB6~<;6 tVT$H <;6pB6H pB6~<;6 FVT$H <;6]EuKl$ u% <;6L3)<;6 pB6\$\$L$ D$E< w.pB6H pB6~<;6 UT$H <;6pB6H pB6~<;6 UT$H <;6]Eu1L$ }D$n $Ip$'|$tpB6H pB6~T<;6R1G>L$u0L$ QV1>t5<;6U<;6ۋ\$uhT\$H <;6=<;6+=L3t$ t$(St$ WV-u<;6=L3<;6)=pB6Sg1G<;6+L3t$PS <$t[1@Ftuրut܋ 8;6 8;6̀tuŠQ1ۀ؉Hu,^_[]ÉRPh#dO)Ѓ5G6h#F׊t!#u(HL$IQWP5G6h9#D$ƃHQWP5G6h\#USWV5<;6+L3D$\:6@;6D$ D;6D$$H;6D$(L;6D$,=P;68;6l$0U+Q+L3P-PD$ P$jU3QD$,L;6D$(H;6D$ L$$ D;6@;6=P;68;6D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 \:6u=`:6tfhWt$ ygQ8t\:6HD$EEt< uD$C낉$L$}1A9pB6} RL$ƅ~N$ pB6 FK1:pB6H pB6Q FK1Ƀ=pB6 Q1ɉƋ$|$t6%'$< t$< s< w pB6F$ pB6F\:6D$ x P*D$t P" D$tP5=:6$u+L3jPt$$ 5<;6 \:6u=`:6t^_[]USWV D$4L$@-<;65L3l$)hP?D$pB6H pB6~<;6qPH <;6=L3UEWD$ P[N<;6+L3PZM5G6W蝛ljӍD$ P]NL3 <;6<;6) pB6 pB6 P<;6SWh"jP<;6xt$GF9Iu|$"tjVU0 <;6A <;6pB6)pB6D$ ^_[]SWVt$|$\$P;6t#9Xu 9p ux2jK P;6@;6P;6P;6Xxp ^_[WV=P;6t$ 95H;6~?=@;6\:6?P =@;6 \:6u׃=`:6tѮ@;6P;6t?9p|\:68P P;68 \:6u=`:6t芮 P;6u9q~)q$95D;6~ P;6P;6@;65H;6^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) t`pB6H pB6~<;6TBH <;6E63:65<;61<;6^_[ÃЃ w1Aj PV A8ű$<=tuw~;5B6B6bE6D$5B6ØD$D$‰؃AD$$Z|$ T$L$T$|$,6%'$< u*pB6H pB6~<;6AH <;6pB6H pB6~$H $ <;6Q<;6 @<;6 $Q$ P<;6$eØt2<;6 $Q$ P<;6$eØt2H <;6pB6H pB6~$H $ <;6Q<;6 .><;6 $Q$ P<;6$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-GpB6PpB6~=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9r\;69tH9u W%8/t F`%Q5D$;5\;6tF/}tEEGXـxs@<$uokt$tdǀx .u.uN jWt$G t8tG@u@/UPWVH5\;6=`:6tt$±tWE/Q \;6߀xruX@8tB@9tD$P5\;6詵x5\;6,Ą^_[]ËD$1Ʌt AuQPFWV|$ W)@P7WPHj7p X;6X;6^_USWV\$D$|nOʼnmIWP)|$SUÉps+x 7u߅u҉3D$^_[]SWVt$(\$$W7C 8;6L3<;6P3pB6P;6js2pB6H pB6~<;6h9H <;6<;6+L3Px6jVP W7^_[USWVt$FPh&r#ĩ3HQPPu3|$Q1ۃ|11E4 (E9uSh#j3HQPP3Q|=1C4膤3HQPPޤ3QC9u1^_[]Ðh#辘h#贘;6H ;6~;6H ;6#=~u;6H ;6USWVP83H ;6t+u y;6H ;6~xhL3蛤h`3莤 ;6183~PX;6hSp {e_68t_83xLF68#>WjW蔣 !Pjjs  h6#683p;683@1ҋ;6  ;6@@P t 1+;6;683{tXAˋ-;6M ;6~ @لt;6أ;6=3t$5;6D$p53D$;6H ;60~^_[]ø;6;61;6;6h#,USWV=83w \:6^t)kU$~D(< t< u 83Hc F;6F;6F ;6G $9t V4  \:6t^_[]Ã=`:6t^_[]-V ;61~^Ë83r t ~6u1@1z;6 ;6SWV\$t$|$\:6 83y tja1 83I  83A$A ;6H ;6H ;6H XtK =;65;6 \:6t^_[Ã=`:6t^_[RWV$\:6jW1ƍD$PVuT#D$ =uD1PPPV u2jPV襟 u <$ELF1PPPVU uZV9t:$Ph \:6u=`:6t菓Ā^_Wh#VQh#ؓV>Wh#ēV*Wh#谓Vt$\:6ho VjjV號 |$ t83H~Q83pxuh/ 83A1;6;643 \:6t^Ã=`:6t^馒83tL$T$9PuHuá;6 83A ;6A;6A43Aj8. 83@1ɉH H$H83WVt$|$ \:6|$t=;6WJ!;6;6543 \:6t^_Ã=`:6t^_V583\:6Fx PϊFtP ~ u83V~ 83H ;6H ;6H ;6@43 \:6t^Ã=`:6t^U83Vt$ 839t`;6tPu^h#莑=83`;6t-Ã|$t=83`;6uh;6~P83@fWV|$ 9=?6=p@6@3t P袉jh%#膜@3MPȈ@3hs P=5@3?6Bw9t jjJ1Vj莕Vj胕Vjx? l@69tQj1l@6P5@3 .0 h ?69tQjT?6P5@3ǥ5@3m@31Vj躔Vj诔Vj褔=?6@1VP tV@3FuhS#J3^_.0 hPh#:-0 h-0t hPh#@3;D$u D$@3h$r#DxB6SWV=?6jQEƋPh"$Ǟ|-1GPhqK$蠞G;|ۡ3HQPPB3Q O5@3tJ\:6V[V \:6u=`:6t{^_[h#ۍh#эx,0! hPh#貍Vt$ h$r#C^USWVh$r#vC=?6xB61FjPlj+?6i5rO@QPh#Q |,PhqK$+E;|ۡ3HQPP͘3Q ڛWxB68tH xB6@(1^_[]h#臌h#}USWV\$n;%u(sVd8V7H#KS?8#dS7 ?6M5?6At#~i9:0#I {?6#4$D$D$=?6C1tQ~H$8?uEt$P|>uUt$6t #tl#K\$ueZ*t%tS-tU+E#D3x+;?6}#5?6it /#\$1|$ t5^_[]áD3t ?6i#뚽#SU~USWV?6)i5rO=D39u=D3)?6~9ut Ku ]t]tu`ǁTtCiu3itit0 5D3^_[]SWVt$\:6~X1tttG9uމjQu'19}q~5@tu ƆH \:6t^_[Ã=`:6t^_[^+5?6i5rO@Ph#賈+5?6i5rO@PhG#蘈P Ph.#脈WV11Fhi#_>kt!Zu忀ރlt puԉпɁuxB6tg8tbPh"$bm=3u =3u@xB6tA53jPvW:xB6H xB6@ujabW53 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh5&Wߖ\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th #jD$P ] ?6)i5rOC-D3+9tti-;)t RPh#jl$ Ue\$D$P$t+,D$0h#jS0S\$ŋCt:tBuM ,%Ph #jQD,ingD,Runn}=tQ l$ ,j SP0 D$xxl$ ?S l$ ō,@)QPh#w0 h%jQR ݍ,PWD$P}݃FD$ ݋\$GHO W謐H EuݍCWP2$u/1M|t؁PhqK$W@ N1MM|FGHO WBH GHOl$  WH|1GHO WH ~T$KWiD$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =3$tCt>5@3螙D9t%5@35PV$=?6~y\$t$1=?6tEt*t t.<$u u/S0=?6u WE;-?6| $^_[]L!0 hjPh#膂USWVD$4\$,tl$0|$WUS ƃu 8=PE6t\:6?6?6D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o?6D$ ?6$iD$ 9T$tcu tQ=p@6t 1=3uL$,uP9tPtu 3P \:6u=`:6t^_[]Vt$\:69tP džƆ1z \:6t^Ã=`:6t^oWVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$hm#5t$ntpuB6D$D$D$t xB68D$t(1PPSȑ EjS==?6u|$1?6-xB6~6@ ?6D$u}t!AH Et{1jPƅt9u ED$u :u G EuxB6t Dt111D$uD$?6L$L$t$D$\$l$|$ ?6@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$?6C$jU9 L$tc|$tNuJD$1rȋi4h&r#jD$(P2l$D$D$L$D$u U D$\$l$t0~Ot)D$?6y\$l$D$tUD$tMjPSD ?jVDžtjuS# =3u V 4Ń퀉0^_[]hq#{Sh#{Sh#{{USWVP1$1C11h#J1it"gu$ڃjt puЉ̉( xB6t yjPƅt,1t?6)i5rO@Ph#H$t#tH~1i0 tPh5&轊11G^_[]Ã~1i4hv#腊3HQP~G ;| Z %PG ;| 3Z;|lh#yh#yV1=?6ujt$ St1+^V1=?6t. ?6~$A?61F:uI}^V=3tO=p@6tFD$t+ ?6i5rOA1ɋ3u0VQh=#R^USWV=?6u65?6~%=?6Ft WN?6l$?6~"5?6HI}\:6tfiPƋ-?6=?6iPUV ~ ;uKuU l$hnƋ=?65?6i 1҉AJw)׉=?6 \:6u=`:6tmw\:6fdž=31?61B|iP \:6u=`:6tv^_[]SWV\$|$հƅtt.VSt$W\$<$D$ #^_[0` PhG#vUSWV|$ p@6tWdW~*15p@6T:64@6V>V}5?6l$t$t%t =3ttttk0hWj~Wj~t uu`mul1V褂Vh#f%趁tOh#f%h#vVjQuV5@3΋tTWjzWjzt*=3t!WjzWjzWjzu?6^_[]=0 hPh#wuUSWVt$ l$|$1ۃ=p@6t/t*=3t!ttSV|u5<3tEL$ji4DDt QP ^_[]WVD$t$ N ?6=3u=32t=?6jP=?6~?6>f@..@.^_WVt$ (\:6NJujVj 瀾tW5@3<u%+?6i5rO9D3t mjVt=tu  ρπtt=ttu ju VK \:6u=`:6tr^_ 0 hPh#DsSVD$L$ =3t1ۅ SPj\ ^[Ët$1҅tހu1=?6u2?6u) ?6~?6:tzt IuhX#~?61@SWVt$$1@=?6|$(1@L$r #$H'Wh#bjvu h4V#h%tjjvjv 1~ hZ#21@^tjs%;th}#hε$jvh%1Wvhp#1Wvhu#Wvh#jvu h4V#xhZ#kjvm~ t+u h4V#Gh#:jv <u h4V#h##Rjvu h4V#h#7h2"v h;r#jvh#jvu h4V#h/h%;h#kFp]h;r#P~tF1SwJhO#.Sw 1> #t#P uh#h`$vh#v#'1D#1###1#N9tQh&r#jWWSxuF x%Ph&r#jVRVjv S h$#51^_[hz#hz#jvUSWV fD$ ?6 ?6l$ 1D$U$u1!" $']1x&~'t!=\t_"t $Q\$ \|$ B]ڃ # t#,$$׃߻O&!$}D$##} u#$%)4$<$zT$tvӃux<'t ur>u<'_pE~FЃ r# ,$t#\$҉Ӄ9uG8,$"2D$1&<':'$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I ?6?6 ^_[]WVt$ tG|$t jV~t'h%h%jVvu^_USWV$t ?6 =?6D$P E6t E6E6 $=?6z1jh'St `P>;Hx@u8/UD$PV;x D$pL$t 1D$tD$p1ɋ?69?6:6tH1 8t:tGt89=P3Z 9=P3~:65L3WPV >?2#<=pB6l V: fiDle cDhangD ged߉V~v3HQPPvv3Q D$pL$t ?6?6E;-?61-?6D$PĔ^_[]_fUSWV<1UjD$hhh UPj\t Ըݸf9u 9È(@6j Uu ,@6j蜘0@6h$r#U h@#L3,$Uh4@62:t$T|$PT:64@60l@6p@6@fD$PVWVW~=(@6 Àu {=3n$hP#X:6ttQu :6 :6<$B=35=p@6(ȃu6Ul@6p@6|B6$X:6u7=X:6u73HQPPt3Q h`3tD$P\:6=`:6tcg$$=(@6u>hK#J't1Ph]#QPP[V$=3u3 (@6t N=(@6uEt$(Vhg#t8t$PTPV$G6=3t =|B6tj4'kuD$P|B6u/jM=3tFh2#|rh`3s*1ɀ=3ˆQPj=3u=|B6t43G65:6+p$$#uSWVD$8t^\:6jPqƅx jVO \:6u=`:6tvex"1=3t=*3t*31G ^_[11=3t 31j蜉V3V芉=3tt*3u3^_[USWV|$(V11C=PE6tn1=3u4t0j53ujh`3q3P=83t.te=3u\1Ƀ=?6 ?6jPPi1;tW1R=3uIu=3t7=3t.hk#hpEVuu$u蔆V#^_[]Vt$\:6jVox1jP \:6u=`:6tcj^Vh#ct1Ã|$|D$pPmmft$赯 th#ct$t$肺 th#cWV|$ WR@Pn tWP^_h#ZcSWV|$P39~b9\:6؃P tr H3 L3P3H3 \:6u=`:6t wbP3\:65L3>L3)P3 \:6u=`:6t?b^_[h#bD$t L3) P3L3j h#jl D$ H3 L3H P3H pB6H tB6HtB6ËD$\:6H tB6P \:6u =`:6aVt$\:6H3;t H3PX FL3FP3F pB6 \:6t^Ã=`:6t^=aUSWVP3<k\:6-L35H3t@6t|F9uuH3PVD  H3H3+ P3 pB6L3=P3tB6tG90uC H3 L3H+HH x@WSUP 5L3=P3 \:6t^_[]Ã=`:6t^_[]S`h#`D$\:6L3)P3 \:6u =`:6`V5P3P3pB65L3^V5P3+5pB6P3)pB65L3^ËD$ L3) P3 P3L3+D$ȣpB6USWV(L$@D$D$@t-΍i11PwDGÉ,$Eu1ۋD$b USWV1\$@<uPƋtPEu1ۉ]hB6B6=B65B6B6^_[]SWVP\$t$t2uhe%V1C$"h#^Z4w%(,3u*23v#03RQPh#^ˉ#uȡ3HQPPtZ3Q (,3t"23RV#t~"QPh#h^ u.$(,3tPVtuv#VPh#M<$u#13t(813uƁ23u숟23h#1 [3t$Y3t(813uƆ23u Z3@uă^_[V(D$ T$039tuv#RPh#Lt#13t(813uƆ23u숁23^WVt$ ~t)~tP uvި ^_USWV jA xB6t_y 8-uUD$$xB61B6P  xB6y8-@P1F PơB6)\:6B6=B6~-B6Ft7 B61NࡌB61ɋuB6 \:6=`:6J1F5B6P)ƅB699S\:6 B6B6lj4$މt$\$)1*C/5B69rL$ 9v!\$ۋ4$ P; B6w4$ 9vQ9wB6 \:6u=`:6tIW1 ^_[]h #2Jh#(Jh#Jh#JSWVT$ B6tstm8u'1z:trrD8uAÀ~:u"9u xB6QxB6 tf B61ɉ B6D5xB6>1t6?-u1t+O^xB6-uta5xB61^_[Ph}#:IPh#/I|$u1PjPPge\:6jwxB68t PI \:6u=`:6tjH1ËD$Ѓ w#j jP uB6B6ËL$~ND$tH  B6=B6u B6B6B6hB6hB6Qpph!#CHUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh$r#hD#Y J|$:uUD$8@?jPhD#Y ^jUhD#Y 1|$D$0)@<PhK#h`3V jhD#f1?\$D$01@11T$4*l$Ph&r#j UVhUhv#Y D$EEjUt$0X u0^_[]À|$:uD$8@:Ph_#K1L$0L$4@UjEfVD$ 831qqA1Ʌ ?60PQ83p ]t u 1%8383@j* 83 u^qqhl#EPD$?6/$aQXUSWV'ơ83@tu'tƃ 83 x,$@D$t.$xk$18uWPtG'uD$tKjD$p4*t6NjpVWPVl E$ht83@^_[]USWV83@|$u 83A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq83@@|$Fu6|$uD83@ 83Ap8 u|$u83@^_[]jjX 83ASWVƻt u j pxʡ83@^_[USWV83kE1͋ 83x t*?6,PqN83@ C1Ƀ8Qs s j@83HOH O oKy K9t?U1CSpt ^Sh4$'P= 83HO@ G 蝯83!^_[]WV@t$P 83A uyW wWhn#4T'h#j"Q Wh#j"PQWEuL$Lx4T'h#Vh#jPQWUSWV83@1u 1=3tMtݡ83@xuUj @jtÉGpj`aC+t83@tj,(pƉ^_[]h#83t$p0h#O@USWV83@$ u83@$EŃCߡ83@$'$ 83APUj já831Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt83xJjG B u083x,u%@:''t@/@:''uh#jÀ=3tjjj 83H0+H8O U 83p0j^@ 83QPI H pGu583~ h%vm|$F83xujD$ 83Hu 83H L$ qx0j@83HKH K {@;u.83x }83x|$ T@0GjG 83@t(HS u 83@83x\$\$j 83HK @0Cku83x ux,uh%pHjP@<31ɉH H 83Q0PCAHrAAtejC9t jW\G @:83@ u83@$EŃ!ߡ83@E<$t!t;tj pXÉ{؃^_[]/ uS\$|$83X0j2x@ 83QPI H X t\$|$D$C 83APsVL 83jj 5jj,jj#jj jjh%jjjjWV83x$G Hs83jpW$ uq83p(x,u~ 83At8 u @A8 @tHA~րxru\tuՀh#83p0+p8j@ 83QPI H pG .Pt83@F 83t1^_jjVt$&9u^jVVL$1:''tA1B1t A:''u^uVt$j@ 83QPI H p^USWV |$$tD$ D$$D$l$E1$83xc 83x0$t $j\ƃF 83QVI N ~ut. 83I:''tAt=t A:''u1c83H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc43 83A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j(83 $+H8N~L$NL$$N @0FEPrj/vYuG43 83+A8FF83@4 ^_[]jjjjh#L$1:''tAt=t A:''u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;0@6}X;,@6~P,@6I;-u{tBuG83x0+x8j@ 83QPI H xF^_[F h#lUSWV|$43D$=u ?vl$$5L3P3pB6G$|$ t u Ǜ t19uD訛 $ tC9u?,$ u4383HH }yMt9t u>u:<$ t=u葞$)jWP萞 |$l$$uS\uNpB6H pB63\F u%pB6H pB6  F43#ápB6H pB6ƈF t詚=v43菚=t h' u4383HH pB6H pB6r=L3)FV,83x43+D$^_[]USWV$$1҉T$ T$$D$(54383r0=4$'t1$|$ fw|$1/fFn D$j8fNL3 P3 pB6=8&'u ƒ=pB6‹nD>  $\'=2#'u f|>z pB643Bס83=2#'Xf|>LCD>fT$ T!uhЃoĘ0N,諘05,/L>=6%'fu pB6Bn׍MN|$=@01fD T.fTT.fTT.fTD6%'fD1AL$!(ljƒ(M pB6FD pB6BvNO|$s@81ɃfD T7fTD8&'DfDfD> 0 = pB6\G_T$ t$>Hff pB6T$ Bf|>D>u6t$ˋ nMn pB6}f|>  pB6BFfL D$$D$f|>tD>t pB6Bf|>u D>v pB6BW pB6B*Ã{t :'' pB6}E+=L3 pB6E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $z nMnD.=2#'u pB6 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD4$'fD pB6T$ B1AL$ I) NjFfL pB6B) 4383@8xt ?6 ?6$8W Nf|F\=`4" $"}f|  pB6T$ BFu6$ Ft$HFuЖD$$D$ Poſ1۹$'D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD4$'fDu6t $譇 FHF pB6B赕= t]H\t 'u 4 t =u 43831Ƀxɉ ?6$6 pB6T$ 'uF|2#' pB6F$ 6%'$< u pB6T$ BT$ pB6 cʔ,t$@  4383xD?6?:''L$ `}3DAD$D$E|$}~6%'f|t pB6 pB6B\6%' u pB6BNf|t pB6B1@D$ pB6 pB6B݉ý {"XŃ', D$0$R nt$T$ Mn pB6B1@D$t$C?6$4#U ̏` Ń< ?\u袏\ 0 \$1CHЃ w&Hw ÃHÃéOu M pB6vNO|$@81BfD T7fTT7fTT7fTD6%'fDőL$ uk%=I =pB6 D$ wF pB6P?ˀ pB6@ww pB6 x?ɀtw pB6@ pB6W?ˀul pB6GXT$ W pB6x ?ʀtw pB6E pB6O?ʀ pB6Gw7 pB6x?ʀtw pB6E pB6O ?ʀtw pB6G pB6A?ʀtw pB6A pB6H?ˀa*B6B6D$D$$B6B1z:''t.pB6H pB6LjGq :''u\KЃ w4pB6H pB6LjG; ÃЃ D$ u t pB6׃Z pB6H pB6]=Gt/ up}tkpB6J pB6/#@ǽh#tE%t@Ń:bD$D$$''Õ¸U1#,W9uڍ1|$Nf|uf|t Ms@ L39T$ vNK؃|$ @11fT T3fTT3|3|t3ft1BfTft|2#'fq fq ƋT$ ;6H ;6~;6H ;6 ډËFD\$D$$''fQ1'')G pB6x?ʀtw pB6E pB6O?ʀtw pB6G pB6A ?ʀtw pB6A pB6H?ʀtw pB6@ pB6A?ˀa2 pB6AD$ ??pB6H pB6~2G:pB6H pB6~$_1c:B ˆB1=2#'nD=8&'G=2#'tf|cf|.3pB6H pB6莿5L3Gf|uNT$ ؃t 4$t$nŀ>ts4$flPT$ )B83L$H,L$H $վ83pM tΉ${ Nu83xĨ^_[]1HE;0@6} ;,@6~,@6>uxkjy1$&tu>tyu6EBE9E0E"EEEA }83h$ Ή$z Nu=tuS$##$:#43 83A0$b#u$G#b$#V$u#J$F#>$]#2V 83xt@@ ^Ãx t#?6$@)83@ @8 43H0;6H ;6~;6H ;60諄ƃ~0:=F $ '> t=u럃F~t\u^ 43@43 83A0yt?6 K?6$S(*;|u0d|83@=t*ʆ4$D$D$2#'Kuۡ83@1v u4383HH @1@Q&83@-83@83@&tQ;ub83@ 83@؅83@83@ 觅83@u:\u?0 u64383@81Ƀxɉ ?6P&Bjjhc"A ځVȋ 83y8~0 pB6QpB6@ 83Q8rq8^USWV\ӉΡ83@D$ 1,$T:6D$^+L3D$$UP\:6$~S"ʼn$S5L3P l$|$tD$$T:6 \:6u=`:6t?w43D$-L3P3pB683x t*?6PL%83@ 蠀ǃ[~!\u9菀ǃ[C tJ$Q u"4383HH s`un=ub\tX`tS43 83QQ NDt""u$pB6H pB6~E\E \@ŋ pB6ApB6@pB6H pB6ٷEL3@|$t~Pt$jP荅 D$pŋȅut$ j轴E83xtH@1D$43D$jNǡ43D$Kt5 83At$ D$AExK83@t$ Ex P39ًl$踵 P39~=L3pB6t1SUWN )pB6\:6Us $ \:6t\$=`:6\$t 83T$ QT:6Nf|u%Du pB6QpB66@Vt$+t$ pB6QpB6@~.FpB6BpB6ȅAJ։ȃՃ\^_[]á83L$H0h#W~<$t 4$r /83@D$T:6jP!jj#jjVtQYr N^V 83$r#ytA5?6t7t u(E68F6543P5?6#^USWVt$,|$0l$U5P31BW;L3u(VGB69w&B6WVS( Uڲ^_[]Áw: t9v$P5B6k tãB6$B6랾#뤾#USWVT$L$ -T:6҂Ɗ*3p:6D$1|$083D$|$ljW0tJD$83*3V艂-T:6D$p:6X:6$r#jU/\$t$l$=T:61F5p:6D$083$V\$S7 !{Vh4$'P 83A |$t|$t=3u #@݅u:T$1rIJ$JB *3VVRM -L3=83D$*3t$臁D$T:6D$p:6؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV B61t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu B6tu(Mxju PQ.Ex PUn uF^_[]USWVl$ t$\$|$t|h@VS(e VSB6 jjV ;D3~=D39t V ^_Vj 迣tL$ T$5B60B6PH^áB6tT$B69Pt uPc USWV$|$<\$81D$ $D$1F5 <5o3h#WSK !1tbh$Wh$#Wuo1<C6tE\:64C6[ C6t jV \:6u=`:6tF@uD6>h$Whthv}"WVt D$1p@|MD$K}h &Wt8D$D$h# j531CKD$D$u}h:# v11 t=t8<C6u.u h#v VaPhw%  GF@uh2#A F@uu=D6tk1uu莩ND$E11P@É|$t<C6tW4C6h#Ah1#<C6t4C6 h$#{SfPh# Eluh#53 Cu|$tE1F-\:6D$t P1<C6D$t4C6X D$C6t jS< \:6u=`:6tEt h2#11<C6t:C68u.u h&#aVLPhw%   GF@uh2#/F@ut h2#1<C6t?C68t3h1#4C6VPh#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=D6t61B=p@6tbu^1Ƀ~7t@tuH1=34 C6t1Ҁ9ƒ (u1=3B1ɉσu1B D61t)9t`tbփub1^։PjSٗ $u=3d1@ָ PS豕t^u D6u jS1D$ D$D$$K?r ? 1@ jPj ^_[À=3u=|B6u =3=31@V\:6C6>t8t6U D6rD6 \:6t^Ã=`:6t^eSWVt$u D61ۃÿC6t6C68t+\:6SP \:6u=`:6t C6=D6ru^_[,^_[V1=D6u#C61A:t2>u D6r^WV|$ Ö0D6u"t$=\:6tg=LD6u^`:6WuS =C6tӃ<C6t>C68t2t-PD6PE6=3tu=\:6u"90^_WV|$t$ D6uWVj D6<rjV2uƆ D6^_áXC6=D6t1Åt8uUSWVLD61GPE6Qu953u V^_53t$WVt$ NfudE6FNtF t0fu^~\:6 ?NQPF N)N\:6vՏF FF \:6u=`:6t V N^_Vt$F t-)t'VfxQPR yNFN F^53t$USWVP|$t$j'V%]t~th#V<<k>t!h 'V 1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=3uUWMGHO W]H"WVGHO W3H"^_[]WVh 'Qdj'V'[t)19<>^_hL3oh`3bUSWVD$~@|$l$1SWU t H8tF r)~1H^_[]ËD$)D$\:6X3tPL 1X3P3 \:6u =`:6PD$L$ T$$RQP XVPt$t$VN tt$ P4$YL ^h#PD$L$ $QP53 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+G6+tE6Pqq hd#jhF6轤F6SWVP|E6` 'C PVw u,$$w\1CGσCGCuh7t9^ uSUv t61^_[]ËD$t8SV jƋ4F6`u8F6$9J 4F6#t#$#t"&08F6㟉4F6t$D$$^# ^[WV<5T:61$|$PW!t $D$PL$LT$H=T:6PQR 5T:6$<^_USWVL$T$tHtA|$9t91:''Írjt/9t+1:''tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U?{V藈Ƌ $A$~ C@ $Q$f=t @UPEWVp ^_[]SVh#WV<5T:6p:6$|$jW赼u"D$LL$H=T:6p:6PQ5T:6$p:6<^_USWVD$ èu|$=Z3uÍD$PQW Ƌ@\:6Nt$݁ uF @SPуF`u vG F~tuF1Ɏ! s%t É^~E6tE6uE6t j~ \:6uk=`:6tb[r2j賆XxL$H @ $  $#`uWF `u WF fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=B6u0@=|B6tc@=:6tf@=3ti@=3tl@=(@6tp@=3ts@jPh#,WVt$|$ \:6twхVP? \:6t^_Ã=`:6t^_WVt$ t|$Wv 6u^_USWVP\$\:6j2ƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFRSP}j=S~RS迄UPu< ؉G@543S543hT3PZ ~ F1gjt$F6uQG L$<=u5xE6HtE62UjS $81F FFtE6F6~F65F6 \:6u=`:6t^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ :6t8Q12<08uF=u =ut j=RPF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVDF61tr:1҃ЉuF6r׍P辂ƻDF6Nj+t7Mȃu%EttUЃuEmŃF6r^_[]SWVDF6>tLGu% uwB Gu#WA @tw݁Gg;uF6r^_[2SWV|$tfh#W.Ws9uWh"$V't*tUj'W#Ot8)WPh# h# Gh.#Wh%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPh`Y$tUh`Y$>=uD3HQP~ j( P 3j)n~=uGutha\#EU3HQPP3Q ^_[]USWVPF6uF6 hF6T$ t$\$DF61<$?tIOt !T$ ttуt݋ F69|QPT$(F6%F6)uF Gt/1Ix t#t0u51>j1ɀ>g1AbPVI1>?f u%PVC1u%#L$1PV1t1Ʌȃ|^_1@Ow$!'1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$S t$M19{USWVӉϋuG6fx@$\!'$PW#1ۅD$PV r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PWT1ۅD$PV<$L$$t$<|$@11$;D$D9t$ aZ$PW1ۅBD$PV,$3D$ $3L$ $$3L$3D$1 dVW9i1ۅTVW)i1ۅfVWiVWi1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]rQ9-u1tQyt8ytBÄth#Q h"'t1h* jjh"'Qh* jjh!'h+ jj hH"'RwËD$L$  )VL$D$ 2)u AJ)^USWVPuj PVB lju8t"|uځ8"u 11E9s:$9t( `}3@DQ@uuN9t ڃ^_[]Vh#yVh#nUSWV׉t 9Fup  ^^EI9uM1PPcI~ōP@rPUt)j=W;thW>utPh&r#j@V$jVh~# Vh3ht" 12$VWhv# Ѓ#t"&VQh^# j,h#h#q VWh#bL^_=X:6t 1;6;6T?83B61B6B6B69B6tj=B6u3L33`33tP, 3Vjz15:6 ><35?695T3t\3@8@u jR\:6jDLD6uƀLD6@u \:6u=`:6tx^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$,*'$L)'Vw vVw d_ t"Vst Vw?w]N@F1Vw q#w ]N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u,*'E$)'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t") Ã|$) USWVPu } G6G63f`|j%v6m O1@ 0G6D$,G6|$@t$(q%v>%L$ h#VQ<*u C hu#S01N .u{*u{ 1HD$Chu#S1HD$  t$CD$'C`L$&~QF0 $*'. D$׋L$ jj D$tfL$tjWt$QPh0G6TFu$d*'G6l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Ph0G6liG6L$ Q0u|$G6H G6T$ l$=G6uM|$L$ jL D$tbL$l$tf|$ L$D$$0G6bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$0G6L$\$L$$X8GG60G6E ƋL$ cjl |$D$VPt$wG6G6G6G61  G6 G6Wt$*|$$0G6 \$$pG6,G6t P% VjWP ,G6҉D$xF\$wZ$*'a=&t1"u@"*\\t#'u0'btnv fre\qFuZ`}3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~VpG6G6T$t P# T$G6 G6t P# T$15 G65$G6Љ\$H\tF5$G6X])P0tXM\$u/^t-u#F5$G6벸^tic\$>T$ j5$G6F5$G6{ `}31:DYt 7GuF5$G6\$DF5$G6ȋ\$+1L$ jlD$t1L$t5WQgpG6L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ h0G6 PRQt$QP  G6FPv  G6 VjxPU` 7s G6T$t t$L$ t PVRQhG6MT$L$ t1PRQhG6ӯ.VWh0G61PQ*t$P PQhG6裯 tG6(G6T$z \trB<]*<0tu$(+' ?$*'."'#Eu uShA# G6 4$`}3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h# G6\),ҋ4$u|$ uWh# G6 ^_[]WVPG60tpG6^1ɉQPV Nj `}3#DQt$c#r& G6+ G6VQP4  G61^_SVˡ(G6H (G6 u:3Prp~r0 P{3Q 밅u(G6)3HQPPD3Q^[SWVPG60t"G6<'t<"u1B^_[11f]1ɉQPV;@ lj+t:<-t6 `}3DAu)G6+G6VPhn#  G6 $ڃ^_[SWVӉQPMǃArVh_# G6GPVh0G6 D$-G6.G6Ƈ/G6^_[USWVP׉1PPPF ,>UL@PUQ* x$tG9tCG6+G6VPh#.G6+G6VPhw#п  G6$^_[]WV9t"΀:t9G6+G69t\VPh#ZG6+G6Ph#賿D[8"uD=G6+=G6j"3 PVWh_#~RPh<#m  G6^_USWV\$$8l$}hbF j jh+'Ulƅu!hbF j jhx,'UkƅH h]#LD$uE#-w؃uL#D$uT#[#u=tG6tj (dtG6xG6c#w %u j# 0' q#u D$u y#Uw %@u#4fD$u# D$u #D$u#D$u#D$u#tG6tj btG6xG6#+'tX+'|$FTPSh#jdW b,^ u΃=tG6tj gbtG6xG6tj @btG6xG6+'1+' tN$L :Ntl P#PSQda#uFj PVc UA8u$8u؃^_[Vh"$jWVhq#jtUSWVe fm6G6 |m6ƒ |m6G6 |m6€ш |m6G6L m6G6G6h~#t h#t8ƿ5'#PVI2tG uVh#j $$1ɉh #SUf P6$$1'G6kj j5<@b ƃu?8"5G6G6v <fG6Wj j5<a ƃ _%G6j j5<a ƃuD?8"G5G6G6G6G61A5<5<hS>#V0tch8#V0KG6G6BG6G6/G6#b>8"tD5G6  9uG6rCjh#5<hm##Vh*#5<hT# 5<h;#jbu h# G6t 1ҁ‰G6|m6փ95G6u<9G6u2m69G6u#m69 3t 3G6G6=G6u\1ɅQLh# o3=G6t)ͅt=G6ut 1jhhG6P4 $yhG6h"$j"=G6u1D$(Pt$u#D$0=u G6G61N1$2' $$h"X3"t$h#Qh%hVRVTvth"P_($Ph"$G6dM6 $=dM6=G6pK6B=h32#tVt1@$$Phmdt$ hh#h|tWWh"# $=\L6u \L6 =`L6u `L6 4$hK6 TG6 $$1 uWhPhK6  1K6K6K6K6tjVhK6* hK6\ $RhS蘪K6hG6VW0 5G6VWF5 W)l$t$D$ 1ɉHHD$UD$ Pj] uDžy#98#BjjRx߉DžV.mx9ujUj  1|$nh32#$PT<hjhK6D5 ^ W(t $h#!Qhv3 u3H u3~u3H u38hu3)ljt9 t4u3H u3~u3H u3hu3)ƒ߃NyjUj hS2#1K6v3hG6VW4. 5G6VWj3 hK6dtd($Ph"$$Pq1@P-GjUjc PuPh?C##tǍ$PWh&%VhD$uh"Z$Pfqg%jPh'Q#QQƃu WJ VFWVθE#2'PV(t uVh,#jG G6裘G6GG6GG6O1lm6t^_^_WV΃=lm6 pm6t>G6t49t08#8#9tS>#9tS>#QPh#^ 5G6lm6pm6^_SWV#47'7'VSh#hpv3P;#ujYEVPjj"Pe th#D^1Q1L2'$ =uh~ jj"t$ 1$4ÁF"u4$+ 1@^WVκ u1H3 r1P^_V΀=G6u6=G6t񺣂 t41t)PhK60hK6hedAV xk^Ã=G6u񺣂 Jt=G6t7G6t.hK6hedAVp thK6hrdAVY t=dM6ujCh.#jh?#jUSWVPύAPjh#hv3OGw4(7'h $Ph'#hv3N v3w(h3#VN w,h:#VN w0hA#VN w8hH#VN w4hO#VN W4O<W8#9tQh#hV#hv3gN$r#OHtQPh_#hv3BN$r#OJtQPhi#hv3 N$r#OLtQPhs#hv3M$r#ONtQPh}#hv3M$r#OPtQPh#hv3M$r#OTtQPh#hv3M<$f$1۽av3Pjjh#wVh#v3P@MwVh#v3P)MGtmÈJ9|6{u;[tVPWh#~XD$(ffL$(D$ 1ۉa)D$u!)tPt$ha#!XL$4 <)ǘ΋I<9vt$h#W$N<.”T$9vt$h#W$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h#oW D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( \L6`L6t$(L$QhV/W  D$ 1h#VtG<$h#Vv4(1>tYj:WD$AL$\$h#Sv,1tD$h^&WtkhNM$WhN#W\D$Php#W  D$q;G6efZL6ujhO&l$!Uw l$(7'1tUP QF7'r܉1hD$ Pj <$Wh#wUD$ D$t$ <$}trÉD$h"Ub t:h'"UP t/h,"U> t$UWh8#T F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhX#TD$ D$,L6FʼnD$uf5K6l$u D$l$l$h/$Wh%Wnh#WXh#WBh#W, h#Whӽ"WTh#Wh#Wh#WUhO"Wkh #Wh#W|h"#Wfh-#WP<w ~W|$WhA#R T1<$(L6jD$<$rt$Wh#R D$fK6@<$Wh#RG6fZL6jUhK6jUhK6 <$t$ht$0VoR J21jD$ Pj< D$K6뜉1jD$ Pj D$K6q1jD$ Pj uuD$L6J1jD$ Pj uND$L6#1jD$ Pj u'D$ L61jD$ Pj^ tt$W|$Wh#$QD$L61hD$ Pj uD$fL61hD$ Pj uD$fL6a1hD$ Pj ^D$fL611hD$ Pj .D$fL61jD$ Pjc D$ L61jD$ Pj8 D$$L6; G6sr"jW|$Wh|#W|$Wh\#΍L$$ t$dL6|$xm6L$$ L$hL6t$xm6rh#Vol$}}L2'1ۋ>t.WLt t uPUW臢 Á2'r D$`}3MDHu D$"91hD$ Pj t4$h#ND$ \$"r)Ut$h#N h#ND$1ۋD$pL6ND$pL6W4(t$|t%h#V`n L$1Ҁ<tʉT$D$< w'<$$ 2'L$ L$lL6<$tL$$L$ L$lL6|$xm6cL$$t D$|$xm6L$lL616FL$<$C fF|$xm6L$! L$lL6|$xm6t8L$$ D$|$xm6tL$lL611A<$D$ hK61D$ ȁ(^_[]4$h#LD$ WVPθWEVK6TL6fXL6hK6 fXL6=G6u=G6u#$}hK6hgdV 1hK6hfdV y#8t #8uv$=G6u(PhmdVn xX53h}~ 71=G6u$hK6hgdV2 y #1G^_ù#h#] 뙃=3tt$ t$ t$ N "1HVD$ t$=K6thPhK6+ ^D$L$01V"t,uVh#-t"uVhl#Vh"$=Vh%#Vh#J^htm6hmd53& USWV8 $RPh hhM6Qhm6 G6v|Pt$h#yJ lj D$T$1D$ XƉ 11 ‹l$N6 hm6hM69hM6hWD$P $;D$$r#=dM6t =}t=}uЉD$$#=G6tȋ G6=WEVuT$tf9G6rD$Pftt=G6%4$t$Uh#GI D$t=VEW=G6$t=VEW4$t$UVh#H=G6|4$t$UVh#H=dM6$D$PSt$Ut$VhI#]8=G6u $hG6Sv3V 5G6SVI SGSt$VhVW dM6D$ L$D$11t4$h]#D8^_[]USWV T$ $11F1Ń=G6|Uh#G QPWD$Pt$9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=G6tUPh!#G Ɖ ^_[]Ã=G6tUh#=G6tUh#FċL$T$tPhK611@Phi#t"j QP:@ u8"t1HG61Yhy#j>Ph#t"j QP? u8"t1HG61Yh#jSWV։ϋ\$+G6tItEuG61tGtBhM6N6hm69w1hM6 1tthK6QA1@^_[VhA#j*L$1=G6T$ PG1ɅɉWVhm6~( WRPhhM6Q: hm69u ^_hr#uQVh#jPQVh#j衺USWVPӉ΋l$|$uj WV> Eu"9"t:M";L$ w,O>t" t9t`}3DJ@t1^_[]WV1t>΀9t7h#V<t#ƍFh#P;d1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh#Wh#C1۹xm6؃^_[]ËL$9/upL6D$\$A/jPU u$D$ K6D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh#Bxm6!Wh#Bxm61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh#fD$$Th#Sut]"<8'W PWS  '> uۀ$U-$T14 9'D$XPO tpC"uD$TPh)#0$T$끹 # 9'j" $eFMu SQЃ {Sh#t0h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h*#/$PQhC#R~$ $u ~ˍ|$@WV9t"b&J~PH k$7'1OJH w@$8' &B(D$ D$$l$ CtGtngtbcB8D$D$l$c&ɋB(D$(D$,l$(B&ɋB(D$8D$<l$8&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=m6uHr8jVSW5D$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph#9"h&#,"~USWV|$t$t$h"V$ Gw49'h:"Ph"V$ GPSh"Vk$GPSh"VX$VjjhS&GXtVjj h"GXtVjjh&"GXtVjjh+"{Vj 3w(h4"V# w,hF"V# w0hY"V# w8hn"V# w4h"V# w# wPh"V-# wTh"V# Vjj h("1ۃ|lu Ku1C1t\h^&V" E9uVjjh$H^_[]USWV$$0$h8x,1ʼn1$14"@D$Rt$UWQP9$71w8$Ћo,1lj1l$DRWt$4"P@PUaUD$PSh="$S!$#a0QShK"$S!<.Ǡ!w48:'hY"Pha"Sx!  w$9'5h"_<t$uM55h$r#RPQhh""555WRPQh{"S!7h$r#h"S  "55RPQh"S M8tDƔF1Ph"S  F;Eu 1<1A71Au01<  $jj@PD$PWD$ Ph"$&C9u<$u4 v3H v3~v3H v3 hv3j 1^_[]h#jfUSWV $ $ D$-@1m6m6m6m6m6m6$m6m6m6t$ h#USO c~!P$:' m6˃PtdT]=<?1AJ5<dm6뒹 .<m6h$r#n m6b m6D$m6T$:@=m6l<D$ Tnt uBxou D$ 1Ɉ m6h%V tm6h$r#`ء<$j:WGC-m6tWutm繘m6S c$ \Wm6tm6t m6o39$ 1ɉL$tVh$P蓜 tj/U0u Uh"hx%h$ UVÊDžuVDž7h$P# ƋohX#Wut(h^"Wcth#WQpV 1QQ$ 4PU7L$9C9$ $ 9tU%lj?,$u1QhD$PQV軲 hm6hzd@P tq$ PhedAW Waj|$ WD8$9",;'uWjhn6,$h h 5m6P Ġ ^_[]h#jZ$Ph"$jvVh#j9h{"hz"ʍD$ Ph# D$ Ph#j>D$ Ph#롍D$ Ph#땍L$ Q40;'h$USWV։ϋl$j Ve UZ CCCOK G^_[]hH<'PhK$hpv3 j USWVP׉΋tAS1W&4$4(VS Whk$Vt$ P W É^_[]USWV|$1_hX#St$h^"Smth#S[u\m6toU3?t[u=m6t .=m6t%m6toU3t [u^_[]USWV$D$|$m6$r#tW3t CÅush(D$t$ uD$?r%D$ m6t L$ mt L$ ^$D$ D$h۞ $$ t$hUn%hV:$0|$D$4$L$h%Q1G@΍K9|,SP Ŋt><-u(GD$tj=V>t>FD$ GD#th%D$PHu|$1F1B,$֋$$$,$Dm6tP$r#tw"P$h$#| xF1Ë$4hw%`C9uj ot2ƅ|$t t$衵 4$薵 tA710h4#膑|$t t$l 4$a ^_[]ÍD$jPVHB x!L$ȃtuuhs#묁tlP PUh:7# 끉 m6utD$P$vuW$P$u2#tˉ#Pv vvh $hpv36x$SWV։ϋY Wss ss҃ 4s6t~j HWss ssԅuA 4s6^_[ÐWV1t$|$ ɉ @4uzȉXȉX\ȉ\ȉqzQz1z PQ40y40<8y<8D@yD@LHyLHTP}yTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40x40<8x<8D@xD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7)xVw wxV FwwxVFwwwVF^_USWV\$l$EffEffCEffCEffCu uwS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuvSCuuvSCu$u vS$C EDȉCDu,u(vS,C(E@ȉC@u4u0qvS4C0EHȉCHudh$VŋFNxt6tbSQP xt6x (u6~,=u6tffOfGG@ Չn,~$N()ǃ~$N(=(u69<$D$hP-(u6>N,ș)N,)n$F(teh$V$FNxt6tbSQP xt6HT$<L=u6tAf=u6t4f.<$ ^_[]s6(u6F,)F$N($fOt@ s6븋D$L$t$ QPQPUSWV$$$ $$$(h`Y$SV\1j D$SVWUhPD؃r_$u695 u6rPSV Pt7=u6tf%"=@t4n#WQh'|%d Whm$T^_[]USWVP|$\$s s@=u6tf9uRt6t=s6t=t6tj:D$1PPPs sQs s6Ot~1F=u6tf)9F=u6\$tAf)=u6t4f=u6t'fL$=u6fVT$Rt)f~T$JR>>fD>=t6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=s6=t6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=s6t Vt$t$Ut$h$1Ƀȃ^_[]1A=s6t1=t6<$\$ HfUSWV $8$4}tE1ɉM4M019 t6‹DT 9 u6tRPaOM$U(E$f M$E$U( u ^_[]%=uLIt6(9‰|ǃ=s6t<|u=t6tFNFh1 tt6tD$hVPΑ |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =u6t RPcN t6I0VQRP*Z։D$D$ ЉT$t t6=t6Q8k=t6L$$tL$D$ =u6t QPM t6#8t@DQL!!IT u‹$8U t#DT tE=u6t!RP~MD t(=u6t1҉EU}@U=}@|$s6EM QPQPh$3WWhO$聇hs$'uQ{u u t6y0ƃ=t6u6t:tMPWL?UUlCD$T$NQt PWsL~V ~V hG$Zt6|t6@ 뛋5t6F8E -t6T$$tT$D$ =u6t RPKv0 I)؉$ʉT$t*DT tZ=u6t RPK$8D t6=u6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|Ws6E$8I QPQPh$3UUhO$薅hs$<$<t7t6Ht)$|$-t6Cq qƃ=t6t0FV=u6|$$tJRPJ)RP{J4FV =u6|$$t&RPYJ)RPKJ)FV )FV hG$6t6|t6@ USWV|$ \$t$u69 u6aDs6 @s6 ‹-t6t9ˉrux9ˉ\$؉jL$QWPnUց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$ס|t6t`v0WUL |t6t6pxjV|$(WS謚)Љ @s6Ds6=t6jVPS脚 |t6A^_[]WSh$|t6@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$t6p0vv_ $G t6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPfS19rÃ=u6$t$ \$ti=t6t,ۉ~A1_t45GT\$F9uۉ~1O ɋW @9uG W5t6萲t$ D$x#- t6;Xt|$#=t6t JًL B tmt$v vh&$hW;WVt=t6t$$B1ɉL s6t$ $$Bt$ B Ct6;Xt`R5t6踱T$\$1ۃ=t6t%JًT tN=u6t#RPEBt/=u6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tbs6L$AI QPQPh$7W]WhO$hs$|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=t6t+FV=u6tGRPD+D$RPD1FV =u6t*RPD+D$RPD+D$ډFV +D$ډFV hG$rt6|t6@ 1@$5USWV\$41F~3|$0l$,|!u6 u69|)S9у} ȃ^_[]Éދt6K89}=s6tOI.A!1‰9)=s6l$,|$0t!t$4PWUh$t6PVWU-Nj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=s6!$l$|$ T|$0tN# $ND$T$RPWUh$ t6<$\Ttq!qIVPt$ Sh$5$@l$19=s6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh$t6t$Sh$1Al$,|$0USWVD$,\$( Ts6Ps6փσ5Ps6=Ts611 J \s69Xs66 ds6`s6Hs69hs6@D$ hs6=t6\$jD$ PL$QT$RLց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =ls6ps6txs68ts6T$t|s6‹D$ȉ`s6ds6s6WUS5s65t6贬=t6l$$-`s6+l$(=t6|$`5s61VV=u6tf%=tjvdv`l?VdF`vlvhX?VlFht4>?TCut4?TCuG9a=s6t< t6(1s6SS=u6tf%=u1=t6u(x$CS =u6t RP>9Ƹs& ɉ @u ɉ @uG9wt$t$t$5s65t6襬s61Ƀ=t6 Hs6^_[]PSh?$awUSWVl$|$t6jVUW跏 1ƒ Xs6\s6Ds6@s6=Ps6-Ts6=`s6-ds6hs69s68#{H1ۃ=t6(=xs6-|s61ls6ts6ډps6t@ls6 -ts6=ps6Wh腆 s6t^_[]UWhb$Tvh$Jvs6t PPj s6USWV l$ =t61ɅDT =u6t RP< t6Y0މD$ʃQSRV wÉD$4t,P,t6<$R01L$41́@T$t61+J0#L$,#l$091۸ T$9и|0<$L$(DpTt|$RP+l$ l$9}16L$11ۋL$F)߉ӉŃw9}߃F<$T$tYL$(|$uSRP!+GD(|$u1҉ 1 t6q0RPa $D$(DT|$u1҉  t6q0RP) $Fjt$SU_Ӄ=t6D$|$ t6 $iSPWt$7T|=u6t6WRd*׉& $iSPWt$T=u6t1L$ tYSl$ Ut$QT$+D$$`t6p0Wt$c $N1D$4 $t6p01^_[]t$ t$h$(cUSWV@Mt61TD =u6tPR)D$,T$(D$(T$,5t6F0D$EtH@t)PQ;)D$T$@htȉD$5t6D$L$|$D$|$D$NP\$,D$(É1 t1ҹ 9|kލL$0át6@0 T$D$=t6D$0T$T$4=u6t RP{(MDpTt\$9Ѓ}11@D$|$ ]D$1\$|$G)T$L$֋T$|$w9É}Ӊ\$|$D$ G|$|$u=t6T$t'L$=u6t!RP'D$DT=u6t1 t>=t6RMT$=u6HRPc'9L$0ơt6@0 T$D$=t6D$0T$T$4=u6t$$t RP'Mt$t$$=u6tȋMD(t6@0T$,‹t$(΃=t6u6t+tMVR&uVFt$t$ &7KVRm&MQ AD$:MQqD$T$AQ!EL$DT=u6t1ҋ t6q0RP耐 ƋL$ jWSQ跄Ӄ=t6D$ t7~SPt$t$$蓄NjT=u6t RP%|$)~SPt$t$$\=u6tȋ|$1҉\$$ t/f t6q0RPݏ xËD$L$ L$0|át6@0 T$ʋL$ȃ=t6L$0T$D$t!D$4=u6t)PQ$D$ T$8=u6t@ɉL$ D$ #Wh8#Wqs6Ns6?s6b%j 5<fs6Ph$s6=<h$W葃h$W{c$j Ws6s6Ph$s6s6~m_f#j5<3=mPh$TAs6s6/s6$v6<D$ s6s6s6s6s6s6s6D$ L$uD$t/=s6t=s6D$th$蹸D$1o3)hD$=s6t s6jjth2n j =s6thIn jhά j |$D$ D$4CD$=s6u PZPF3Džu6h:$%Z|$ tND$Pjt$6譧xND$t$eZL$9|ȉD$t$ (L$9|ȉD$6hJ$(WL K;D$=x{6D$te^_[] Ph$j, Phe $hpv3p jUSWVP׉΋\$t$US ) M9t 9u^_[]WVhd$j,USWV Ӊ5s6QW=s6t=s6t h{$X1SW[u=s6h$Xt6=s6u<t6Ph${XCWt h$eXh$XXV=t6t>=s6t h$X=t6t h $Xh0 $X/=s6u hT $WX=s6u hr $W3=s6u h $W6=s6u h $W<=t6t=s6u h $WT t6|$Y8֋T$  SP54u650u65D$Xt1NPSWUkʼnFظ|߃\$ <$w4Ft6<$t LX FuWFsT$ 8u6 Uh. $>jSSWUt$@hR $h' $m=j[sUSWV |$ ow@u Xw VUp D$t|VUh$w wv6 v6ʃǃv6=v6|$ |:w wh $= =s6h $qjG $D$|$tjVU¾ u6<)1CVUh$D$,p p*v6 v6ʃǃv6=v6 j w hp t6tHt6 t69tDy1Y1 t 9u,0u64u6$|$ ,t6t6Q1I1 ы|$ tt6$G0W4L$Aڃ]D$ p ph $J< =s6t)h$覽1C+s6h $;h $h1Ct ؃ ^_[]s6jpj~fUSWVP$T$1B@B51 t6v6t6x,11=Du6t>Q:t6x,$kd1PWSQh$hpv3rDu6t61ۃVU聶tzljl$ t$t6pt=u6tʡt6 u61ɉT$HtttȉD$LVUz8tD$PWbu(Ct6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$v6ŅtTM1ًU1 u3VSh$w wv6HPUMpXv6 t69tmu1 t6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $8='h$F9h;$eh$ejj聴=t6u6f@=u6fh$8h=$eeU1hPVPVҜ1Bh$8h;$'et21VWhVWVW莜1 tah$+7s6h $du<tf@=u6tf @f=t6tjjxfhh; j5t65t60T$1B@B{; -t6t6  $Du6$Wt>E6+5t6=t6kdPWVQhM$hpv3aDu6uF$hp$vv 躑 (u6A1ڍF$h$cvv 6ǃ=t6F$ u6&jP1 (u6I F NQPQPhSt=t6F$ (u6t%QjPSh$$h$>6#s6QjPSh$$h$36=s6th$菷=s61F$(u6 I1)щN$uh$b-vv *ǃ=t6F$ u6$Wt jP1҉GW1҉GW }hjD$\Pf =t6u6D$tt7fD$T@jv$-fD$T@jv$fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=t6$tD$\=u6tL$Lu$D$PD$PD$XPyDu6;,$/s6$W=u6vu65t6;4$]|$T{$AhjWd -t6=u6tt0fD$T@js$&tPfD$T@js$xFfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=t6$|$TtD$\=u6tD$L$|$TtD$\D$PD$PW٧;4$=t6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h$ss QPTh$(^t~s sqf@fNCKK CQPhB#ss oOCK =s6th$ss QPCKhB#QPss fN s6;<$=t6t64~^1ۋ/uu q]]8u9rۋ=t6/CK tS  StQP HKX9rjj轄`^_[]s6j&ejtPh1$/L$D$@, +A,USWV $0 n8$=t6ui=t6t`E=u6tȅtNE=u6t$; u6$u6s&E=u6tjPo@E$F0N4 utEh`%PV)$0 F=u6tȍL$A=t6AAhh`%Q t6 u6tD$D$L$L$D$h$v v薉 E=u6tfM9v%}EPh($.O$h$4[4/E=u6f)=u6f=u6fEtf=u6t΋$0 AI 1 h$QP辈 h$Z$0 F=u6tȉE$$PpZEL$fAWQU $)fEPUV =u6tfD$fXWPU $0 G0W4w wmfH$Xs6$0 =t6t>}t8h$v v贇 h$Yu EBs6F0N411G9 v vGD$@=u6tȍL$A=t6AAhhB#Q  u6 t6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=u6t2f)=u6t%ffD$=u6ffu6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=u6tfPjU\ D$fEutEhB#PiRl$L$Aq $0 JR ωtljhx$RQUW݅l$EMك9v%}EPh$*$h$qWD$$0 T$ 3F0V4=s6h$ڃD$=u6t΋D$p@ =t6X}$0 ~h`$v vڄ Eh$VJs6B$$0 1GPVtXD$T$ F0V4=s6h$4ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV D$fXSPUp E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQU  $EtMw\}.uVV4~0|Juh$ } .u8h$v v% Eh$ U4$F0V4=u6tȋ $u69 u6s5h$juv v݂h$T4$=t6E=u6tȃu}uE=u6tȃtb}u\FN U=u6tʋ4$h$jRQPX=u6t}Eh$T1 u6EtjPgC$0 A4y0$$0 t=s6$=t6JR u=u6tPjVRQ菁h$cSƋE=u6tjP1Ƀ=u6t fu61ہ@€@t f u6fGs64$Crv $0 A4y0AI U=u6tʋ4$h$jRQP褀h$xRs6zE=u6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=u6l$\$tȋM=u6t1퍜$UQUPhScSh?$$"Ph5$ %9-s6th$jl$\$ h$zQƃl$\$$0 A4y0| AI KC=t6taEO9tU$0 AI U=u6thg$jRQP%GEh$Pu $ s6fO4$E  ^_[]ËM PShv$"ȃ=u6tUSWVT t6t6,=Du6t>)"=t6kdPWVQh$hpv3sDu6}ww cO W $T$ WGO ƀÄ:1=s6t4=t6t+=t6t"uGO 1F9ƺw1 tbQPc8uS=@u6xJ1v6KNj@ $GD$wOG tQPb8u E;-@u6|E;-@u6=4$h$b"h$ORv6话11|$D$HNL$D$D$D$$D$D$ p D$TD$Dt6pt =u6t ɡt6-u6L$Ltt tȉ݉D$PD$PRmu h$!D$TPv6t$t$~tyD$ K v6ΜL$QPt4t$t$af@jw wt$t$~t t6t6tDŽ$@t$`$L$$8t$ٍ؉$<P5t6t6t6h$h$ udt6ǀh P5t6 5t65t6,=u6tt6PP>5t6t6t6@ t6HHщ8<=s6th $n=s6uh$u_h 5t65t6  5t65t6&=u6tt6PP75t6't6,t6t6D@RL҉111C QPh<$[ t6HLщ@D=s6th $m=s6uh$h 5t65t6& 5t65t6.%=u6tt6PP665t6@t6,t6*HHPLщ8<҉@D1ۉt6 t6s6t61Ƀ,=s6ha$1L$ t6L9| 9Ph\$t6=s6th $8l=s6uh$Ih 5t65t6 5t65t6#=u6tt6PP45t6t6,t6@h$L$>t6t6ǀ,04ǀ(<HHPLщ8<҉@Dh P5t6 5t65t6"=u6tt6PP45t6t6,t6 t6s6G?t6L-=s6th$:h$7t6t6ǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5t6 5t65t6!=u6tt6PP25t6t6,t6=,t6t}=s6uth 5t65t6* 5t65t62!=u6tt6PP:2t6ph5t65(t6 h t65t6=t6VhmLVjP G011D$)9|ËLG8 $HLOd t1SRPV5t66t0|$u)h$h $s1AL$=t6tLSVV36 t6A8$HLId t1SRPV5t6U=u6t SVV5 =t6G0ŋ $A9u6 u6ʃƃVhu6VjPK jw,t6y9 $u6 u6t69؃st6Ét6t6C t6UPƣt6USt6 Vht6Ft6 $t6=s6 t61Ƹ1ҽhWV5pt65t6|5\t6=`t6dt65pt6=LBALtl=s6HhA$Xh$11IPPQQPV7pt6f@5pt6+6 pt6fAtt6FȃtvFjPh`$ =s6th$]e=s6uh/$nt1Fpt6f@5pt65 pt6fAtt6Ff=rmh$=s6th $d=s6uh$t0fFpt6f@5pt6,5 pt6fAtt6Fffuzh$=s6th $cd=s6uh$tt=11IPPQQPV6pt6f@5pt64 pt6fAtt61Ff9D> <:PVQv D>/|)Ot$L$6}62}6$!D$h8J}6$ D$tB?JL$h)PRQSWVD$t$ $u695 u6r==t6 t6jSPV)޹394v t^_[PVh!$CWV|$ wu$='1XD$@uPw w Ph"$*=s6th"$@h!$t ^_Ph!$趽Du6USWV$\TM@$ 5uh`h`VP衖 =s6t h"$?=t61ۃL뀃=u6t\,L$UPQ DPPz$\, u6L$L$UPQh |$u $PP@1LDffLD@9u=u6t8PP\u6L$UQP t"PP\L$UQP  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h"$(USWV\$t$=t6!ߋ,t9Xt6@u|$t&j肞t1ɉH HHXh1^_[]h="$VD$ L$5t6#p9tыR9u @^USWVt$|$VW/t6!t7^Fu+11 33 1u{ t6tqt$0|$,\$(l$$T$}6t9PtjRQ }6(Xxp L$ }6t9HtjQ5t6 }6(Xxp ^_[]WV t61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$x@'$1Aȋ$sY9UT>'<0>'Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$='4  <Qh(#$h #$脹D$P`wZL$ D$$>'1B(ɀ!1Rh4#$h #$SD$H`wPD$T$ $>'1C%   [QhD#$h #$衸SD$H`wND$T$ $ >'1C%  [QhQ#$h #$6USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tW赉ƅuWhu"j$$<$4D$Phd@Uԣ tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h <%t$ 1 Sh"U9 CPh8"Uש C Ph"Uũ CPh"U賩 CPh"U衩 CK,C,Qh/"U艩 C0PhD"Uw $@D$t P? 1-Uhzd@$<W t1 VhedAW hjU[ D$ P$4'dD$, 9L$ L$9u0$S11:8tx$0h"lb$11҉ $ƅ*ŰP贐 j PUh ^_[]$0h"j蕆USWV81ۍD$4ShPSu 1NtAljSPSWuWU uMU D$t$$$Q1e^_[]fUSWV]D$D$ PSc$1NHD$ D$(%=@= j/SKxr)ك$0PSQh^#$hRD$jPVhǻ\$$0PS: Ou\$ |E tÉ\$D$D$ D$|$$D$ PSa1@$D$hh S(S ƅ%D$ PVD$3D$ 3|$$  D$uH$0PS$8$P$TRPV VS D$4@D$1$Vht#$jS~VjSbR ƅxc1GD$ PhFV  V8u;V S Wht#$jS*jjS R Gy D$t PѢ<$t t$&1Ox VR e^_[]D$(%= tn=@u$0Shf#$hPSƉ\$1@$D$:\$ D$ PS_B$D$jS#Q }tStN$PhF|@Vb x4D$t PơU$$JhF V$USWVP1hUU= ƉRP)9-u6t1@fCM+PUUSF t6;A0u $ytWVC^_[]Ë\$-t65u6SUqRPX$@ `t6ؔؐh P5t6 5t65t6 =u6tt6PP5t6t6[USWVt$(~Oholu6tUQrՉ 1=t6L$$t| tWVrƉt$$H$át6@05u6QPWVsUC cMhml=u6tUQ,rՋt$( }t6@0ˉ9Éʉ\$4$rQPUt$LPDTGlOh|$ wL$,=u6tȋ|$t61ɉSh$$=s6th)$T*h$lt$" t6QP#T$1RQQD$P1Aát6;X0t$~~1Ƀ=t6T$DT =u6|$t RPmL$ pL$QSRPjyǍPn}6$|$1D$D$t1)ÉعF@jPܓD`r9w<$r$l$T1C @<$9uG<$;|$}t6X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡt6@0)ȃ`T$1ۡ}6ـ#h$$b=s6th $'h$ ع`֋,$L$t1ɉȉD$ օt$ tH t6i0T$,RQUt$> t6;A0l$,} $L$l$l$,t6@0D$Mt$ |1TT1PD$T$ ʃ=u6t RPjL$(ωQM D$H 9tet$C9\$t$$h$$ s64$F4$;t$SD$`1s60^_[]ËL$ ʋ t6f9u Sh$$褤D$`,t$$h$$lj t6Ph.$$CUSWVT$L$D$0(D$ X=u6tSUiʼnӉ OD$$t6@09ʼn} t$t$5D$PSUt$< t6;A0 t$~QPSU-~t$4SUWt$T$LtL$A L$ Q5u6t9RPt$ƉT$ ht$1ӋT$1 t<$G RQhD11 u5\$$9t ;D$t`GPD$ GPWTt RPjh$<$G L$;L$t9ta щʼn$;D$t`1h%$辢^_[]USWV t6$t6x0UWt$0t$0sƉt$ыt$$)‹\$(19r11 $p|$ )Qj`PRys }6T$4$1B srl$,$ ȈU1wX=u6t t6!9GX=u6tȋL$,1Ph%$蚡 }6L$ $  h%$y=s6th $"h$t$D$OPWTP1GTGP^_[]s61USWV|$,u$tz$t61@$t6sll$t6tt6 L$  ƍD$1PQQVK9 t6;A0-T$zu D$`1]l$z$Ń1EGpD$hn D$ Pt$ u&xMt(T$hn D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh%$џ=s6th&$-!h;%$Et3s ss3st$Vn[E;,$us6'%t#Ph$$0jUSWV0\$T|$HOX=u6t1D$,D$(D$$D$ D$D$PL$Qs tPst$OGu6҉L$D$td$PQ dÉ׋n11 D$Hp{ډø4$uRWPS Dž1F $ LBAWNjG ;C wjTj蠄M HMH MHX,O(HW,щT$PW@ODL$HT$0POLL$4H$OHL$H O $H(_q1Ƌy 1 t $B8HB8tQPQQbC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h($_'h'$h%($h h&$qPh($6O4$V0Vh'$h'$h h'$hn'$hWVt$ F,t@}6th($F,P;1~,>d9~8uv0^_h'$h'$h h&$D$x,u@Pt P߄h'$h&$h h&$}WV΋I01t*N8~2IN8tPQP P蔄N0G;~4vɃ~8u^_h'$h'$h, h&$h'$h'$h2 USWVEH1Bx,T$1hsM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vS譃e^_[]h'$h'$hF h&$>USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hJ($h($hK h&$.USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h'$h0'$h` hF'$h0'$ha h&$蕽USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h'$h\'$hq hF'$h\'$hs h&$軼USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hJ($h7($h~ h&$fUSWV\$$|$ l$t$}6t5t6SWUh($USWV5t6 1^_[]USWV\$$|$ l$t$}6t5t6SWUh)$dUSWV5t61^_[]V=s6th5)$Œ2j5}6Htahj)$腌h $+tS}6xL~61 }6 s"@Pt4h)$ }6}6F;pL|^5}6vj}6t'x,tP}6P}6á}6t x,tt$t$t$t$P1WVt$|$ VW=t6dtX=u6ts,t6`uau33 u1@1^_WV s6t1 }6 t61!`u/aʀs2hlpx1Ph)$ԊPh)$h $gJh)$蹊t6 ǀdƀah P5t6b 5t65t6=u6tt6PP5t6Ѱt6t6!1111QWRPjh}6hh *$h $艶lh)$ۉt6 ǀdh P5t6a 5t65t6=u6tt6PP5t6t6 t6dPs+aʀu Ph)$PhC*$h $蟵h+*$t6ǀdƀah P5t6` 5t65t6=u6tt6PP 5t6t6^_jUSWV1L$ AL$HAL$@AL$<L$ `P'L$A \P'AXP'ATP']u }h*$SVdc ka~(bt@it YltAsttuJD$PW,5uVPD$DPD$DPD$,PW(D$HPWC# D$ PW$uh@'jƉe^_[]Ãu95o3ujhTP'D$Pi8 u1PPD$Pje95o3t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQVRPt$8t$@t$8t$@W1u2h+$R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]S^kt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ S t$\D$Ph&r#hV^D$@w ww7VPh~+$S 1h+$+hY+$WfUSWV1L$(AL$$t$@L$ D$ }] h+$WS6_ aLuKVbtit'cD$ Pu D$(Pu3 D$$Pu udt AuZD$ 9o3u~]#D1غ$Phzd@虚 tN|$$tOh@'j[t$ ut$@u1Oe^_[]h@'j'11J$THPT$,L$(HL$x1VVVVV]PeT$4 @T$ƋD$(D$8D$,D$4D$$D$$\$S]SjPjt$ t$jjW: X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPNDE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q n H @AQ@A$Q @QHALh1$SXh1$h1$USWVP\$|$tus$" $"$jPtQ1@PVSjPt$8t$8W E1u>4$h,4$W V|WSh3$W4$h 4$W 1H^_[]UWV} uOʃ<|RQPh2$VJPRDx& $T$W1ٹ|$5<h#2$ 5<h"VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhTP'V 1OujV5<>uW?,VQ>~Ih32$Q1$VQ7 t1PhE2$Qx 1O^_SWVP|$1N?u;j S5<U 8u1u5<h"t$ ^_[WV|$1N?t5<;1t^_h3$t$USWV 1O1;B։ˍD$ j P5< уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5<Ax(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,膇jhTP't${$ tjVt$a$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0wh^2$VIz1t^_[]1;BB  FjhTP'P 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hn2$W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Phx2$Q 1HUSWVt$|$ t)l$\$$jWUSͰ tWUSh2$1h2$V*l$(\$$jWUS蚰 tWUSh2$V1H^_[]Ã|jWUS@/11USWV\$1s3h%5<V t^1WdE'誄tuWh"3$t$ 1NlE'hE' Ch%j Džu^_[]WV|$ pE'dE'Wh>3$訪u^_USWV t$@\$ hE'lE'!Љ! tK$\$L$49$r#tˉ#\$8SPQ> SdE't$<> Ջ\$!$!u Ћ|$4t?t$RShL3$jV荨?$r#tˉ#\$8SPWo> SVWd> ^_[]USWV \$ |$$tl$4|$0L$,D$( uhS3$S1N ^_[]S 1Nt@PL$$9sPQhb3$S_ɍQD$@ XT$ډL$Y jhTP'S  ׋C0!K4!T$, ыT$( ЉC0K4t$t$ D$(P K H $YTL$ Q #|0#l4 l$, |$(|0l4|$ QPW t$$h3$W 1t$$h3$t$(d WV|$jhTP'W  1Nu.W5<6t5<h3$t$ 1^_USWVl$$\$ |$t$jj h$r#USjV yD$USWh3$货|$tVhe$蟧j 赦 ^_[]ÐWVo3;$$,(h5$^ $h5$Bj$,(}RPh 6$ h6$ jV p FQPh6$ܦ v,v(h;6$ v4v0hO6$ F8Ph&r#hWU3Whb6$菦vPht6$1$hdE'jIĈh6$Z1HĀ^_fUSWVD$ $t|$$L$|$t$,t$4RQҎL$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh=$P%1D$Bh=$ D$_$ӃD$DL$H(X,EP!t$@E X,L$H(u4$t$w7t$Hh>$u1fUSWVPM(,|$8O] D$1h>>$uSo sujsWVVuutqD$9o31t$$u_h,M'jwOt$$S4T$,D$$\$(ju)t Hth>$u_1Ne^_[]ÉD$H@ D$ juVjVH A D$ $Y$jV jV tuh>$uD$3D$3L$ u41D$Bh>$u-hN0$h>$V\$D|$ ]HL$H L$p $HTHP1ۿ $9s611jhTP'V tN(F,9ˉ|ىˉǃ;4$rΉD$+D$T$щߋ\$9ljD$ +D$L$,9t$L$;L$|$D$11CT$09Ӌ\$49щ;L$$|$( $$T$u11҃]|r tht^1B$D$the?$SG 0+T$x|$yRt$h?$udh8?$D$t$th?$S11A $1A;L$0D$4D$,L$ |L$Vt$VjS @L$)΋T$׋jp jRQWVS 6 $p q F?  yq @N F$FV0~4j\V軻FSȾ H @AQ@Q A$Pƃ׃q0y4QLAHS?D$ ulD$ \$$ $L$(|T$ |D$ fft$Hu1h?$h?$Sh?$SfUSWV0u1L$ L$AL$AD$] }D$h7@$VS a~bt1iugD$ PW*u5D$PW$D$PWut3NT$T${lh^&_1D$|$|HWt;L$L$(L$L$$xupt3L$(P3T$$ t @ut$ t 9o3uD$L$ t!T$ T$th@M'jve^_[]t$t$ QPt$WߐUSWV}u 1L$ \$CD$hY@$WV* t4H w]$TM'SuF D$ Puuut%xL$룃L$뜃L$땃L$뎃L$뇃95o3j}Wqu hiB$蜴\$D$|$|=W`t0L$T$xuXt01΋x1 }@u؋\$ mWt9^\vuShB$W 1HhM'je^_[]þc@$hAq% V hM/$ V hB$贳WD$p@$D$i@$v6 \$Ssv v S^ v3H v3;0v3hv3j ev3H v3 \$' v3H v3;0v3hv3j %v3H v3 FtHPhw@$~N1v6v C v3H v3~av3H v3 ]h #~N1v6v  v3H v3 v3H v3 hv3j f^ Sh"$P|$3W \$Sh&r#P$ S SWWuhhO&W Wh}@$}~u(h~6h&r#hSe Sh@$})Sh@$}D$Ph&r#hS, }Sh@$c}hA$V}$f~ jj h$r#RPj|$7W xWh"$}"$f~ RPh~"| v3H v3~v3H v3 hv3j |$G8jm$Sj$P蟴Sh(A$|hTA$|G0O4 tQPh$PPhB$S}qhv3j oFHsF 8-uJF $1҉QQ$$Ph&r#hSSh@${vG1c@$hAq% V{ hM/$ V{ hB$葯WpD$p@$D$tD$i@$1ot$w7] VJ{w w V5{ v3H v3;0v3hv3j <v3H v3 \$ v3H v3;0v3hv3j v3H v3 GtPheB$z h #z v3H v3;0v3hv3j 蜀v3H v3 v3H v3;0v3hv3j `v3H v3 Ow7w  v3H v3~v3H v3 hv3j hF D$Sh0B$y$1۹GB$v6SJ $|$5$v vS, \$'Wh"$PS$Wh&r#PVVSRuhhO&S  VShMB$y GPh&r#hVVh@$xG8$jmVj$PҰVhIA$xhuA$xG0O4 t#$QPhRP\$ RhB$}USWVӋ$$$$M'hA$" Ft hA$)xhA$xF ~1ɋӉ13$ 6@uhA$hA$hA$wl8|$Vh&r#hWaWuQh B$wĘ> t hA$}whZ-$pw 1A AAt$Qh&r#hVVhA$hA$hA$wĔhA$v|$uhusuqVhB$ohn-$vuuulhA$A$t$r#PRh}p%vĜ;8jmWj$VzVh&r#hWWhA$XvĐ^_[]USWV΋\$$|$ ʉl$͍L$jj h$r#UPjQ̮ yD$SWVh\B$u|$tUhe$uj t ^_[]USWVDt$`l$\\$XT$1 `P'A \P'AXP'ATP'B0B$` h C$VUa k)Hw]r$uStJPSu7HsutPD$PS uhM'jD^_[]1Hu߅tjhTP'D$P t9-o3uPhsDD$PS벃luh^&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uhHC$SWA a~bt)iuRt7D$PV"uUt$D$PVtD$PV8uhM'jռe^_[]Ãluh^&1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=o3d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H 8~6H 4~6@0~6 ,~6h,~618~6F4~6F0~6F,~6F^Vt$|$uD$ h<~60H~6FDD~6F@@~6F<<~6F8^fUSWV$$$$#h'"WV ou-<95o3Ji 1O$QhF$D$P! $2ƋFHt$ $xP'h ^ hSh&PD$ xþ1${h Wh)C$P Ph="V' CPhG$V  CPh(G$V uCPh5G$V ZCPh^&V ?CPhDG$V $CPhMG$V  CPhXG$Vj CPheG$VO C PhsG$V4 C PhG$V CPhG$V <$u $lVt$s WGU $ɿt$ D$tQhF$P D$PhZ-$t$ rp~ f whG$PU fG8Ph&r#h\$SjShG$V3 4GPZPh*$V VhG$ $f D$$$Fo~ 1Ce OƉSh)C$V )Wh&r#hD$PD$Ph^&V` Wh&r#hD$PeD$PhG$V* wwhAq%V^ wwh$VB w$w h@ #V& l(jm$Pj$W$$t$Ph$V ,Vt$ї C$$L$ AA H94$hG$t$ t$hG$t$ t$ v8t$|r t$覣 h$#U?h"UBiPV^v3tkS=`hP'jٮV; hG$$1ORt$ 1O4$ 6hv3VV 1*Uh,$$y V t$Ģ ^_[]ÅtV誢 hF$hrH$h hG$hG$hhG$hG$hhF$JFfUSWV]} $#D$D$ hH$SW iu5<tFumD$ D$9=o3uUj]$,(>;ǃD$T$ЃD$,jS9t%D$t6hH$hP'j.jS D$ tjStD$t h;$w@h$#V=+H$tQs "hF$PSf )j$P*J hG$V$f hG$D$ P f jhPJ D$0Ph*$t$ D$0$L$ 11t$ L$ D$PhG$t$L bD$\Pt$ tpt$hH$S 1O1PHV 0h6H$hWH$S辥V hyH$S袥t$џ ֋D$+D$ L$,D$D$@L$$L$\$uoh8M$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSPY 0t,hTM$ MHtU4uL9rRQP+ t$|$t%u@uhV tI/81tSul|$tDEM9rQWP u@u`V u@yu@u`V teEptUt$8ЃtEu8uXV{ t, ^_[]hL$hK$AhL$h-J$5hL$h M$)u\u\hjM$udShM$j& wlh"$jG fUSWVt$F 1tvt$#H t[ST tCPER Vt$VJ tPUWwK uW SQ 1SD WkF ^_[]USWVu]PhM$S. t$f1j?1Nt}ǍD$ Phk$Se td\$ t\hjD$P) jS\$S ShiW t$E L$Uf jQhM$P je^_[]PPhk$t$ u1$YVPt$ t$t$V tPhk$V u1$^USWVt$t$G t Nj\$ Pb 9v,? ,1N*Ƌl$Wb VPU )SjU( ^_[]USWVt$t$GG t?Nj\$ P4b 9s9Ƌl$WQb VPU )SjUv( ,, ,?1N^_[]UPh(&u6 t$+1H]USWV@uPhqM$V ] hM$VrF tPa |$ P\$$ShiV\@ |$ jS_ PhM$u XH V݀ ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP_ t!PhM$SG V肀 1He^_[]h r%hM$hhzM$6$WV|$$hM$WrE t;Pc` u1V` jPV VhiWQ? t^_hM$hM$jVhzM$#hN$j Vd~6h3V V l~6hvV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh6N$hV9>tVhlN$AVFߋD$t$j7QPh6N$hV>tVhN$AVXF߁^UVuPhU$VJ t3$L$ AQhiV= u hU$1e^]h r%hU$hhP$7"UVuPhU$V t3$L$ AQhiVe= u hU$:1e^]h r%hU$hhP$!UWV}W#ƉPhǝ$W_ tZt4$P<tW@PVl\ tGPhXU$u D t>V1e^_]h r%hU$hhP$%!hAU$hU$hU$ hU$hV$j htU$t$CB tPhXU$t$mD HhCE&hSU$hhP$ WVPt$|$D$PVW tKD$tUhL$WA tPhL$VD H^_hCE&h`U$hhP$R h`U$h M$jA hM$j SWV$h]Q$SjA t]P]\ GAsdWt^WPh]Q$StNpxPhiS3; u?V11&1HĐ^_[hIV$h^V$hwV$jT hQ$jx USWV 1CCj7Shxi P uhT$?,$PuhT$#Ɖl$D$Shxi W u hU$j $L$9~D$~*1t j <Sh"$=G;|$|j <Vj4USWVH]'D$@]'D$<]'D$856u#D$1D$11D$=6D$(Pj)u h5T$|$T$(L$,T$։L$ ȉƒ\$06eĉL$T$|$|$ɚ; t$D$\$=6u11D$\$W|$|$ |$|$|$ |$ ʚ;||$t$ L$ӋD$D$t$\$\$Ë|$t$ D$$Pyu h\$jB t$ D$D$t$$1|$\$F =3@O9t uGtMF L$u@T$(\$,T$ 3T$3L$ u L$9L$0 L$9L$ \$ \$} VЃuGt^VЃtTjD$

H^_hCE&hoU$hhP$hoU$h M$j蠿 SWV\$,hS$S; t`PV GW8t\WPhS$STtL@xpPhiS5 t5Vt1 1H^_[hV$h0V$j̾ hQ$j USWV8}D$PhQO$W u \$Sc1OtjL$D$ x L$, D$0!1҉ƒt$u !L$,T$ !D$0j SkT t$PhR$V< D$Siu |$Oe^_[]h r%hT$hfhP$USWVuPhWO$V tg|$ WhiVO4 t$L$x f D$1H01҉ʉ$T$Hf!D$WhiV4 1؍e^_[]h r%h~U$h0hP$vUVuPh^O$V t,jt$V 4 1u"h)U$h"$} 1He^]WVPt$V't&ǍD$Pt$V> u WhQ$jڼ P-D$L$AËD$L$AËD$L$AËD$L$AËD$ 331ËD$ 331ËD$ 331ËD$ 331ËD$H@3 31SV\$ Sh3uCЃ r"CrCr W01H^[h3e H?r 5 ؈31ыL$t 61ÍAЃ r)Aw AwÉ1HUSWV1t$ D$hVP 3x6t8u^6ǁ666ă6ȃ6̃6Ѓ6ԃ6؃6܃6666@wh3R&uhCT$0h39&uhfT$ht3 &u h~T$jT $53tvh3%616663tt3$h3$U ƃV B~>CN6F v/FwD$lT'6Au"hO$C$Wu4D$P1VhVVj V5< 69t$:*ƀ6l `C Lvms33u$366r66D$P1VhVVj V5< 69t$taY6>6O6CatTl5$3+wtz39t3 3$ÿ3؉$3o3 6$u =6uB=ʃ6=6=6u|t =6u =Ã6uftu^6uS$ttH)ŋ$L$ T$ RQL$QWPU%u. u&h{"hO$,5<h%jζ t$PD$P & u hO$D$t,DtVPyDžuh{"hO$JW WtS)uh{"hK$Wuh{"h-J$3t H9t@h{"hO$$@ t%VWЃ$Wj&heP$h{"h*hP$USWVd- uhV$hO$j迵 Ƹ3jmP$r#$r#t=6uLhj$V VhiWn( t!$uۋt$$4u=6t ~ j *hv3sŠWt& 3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhR$h$V-VUhR$* jl$U$V跶 Vhit$ t$,$t!PhR$*VhR$,$jt$Vb Vh~it$P t$tPhR$2*j H)ꍄ$P$$ j:QPhR$h$P%$t'$UhMS$)U}E}uj:$$hR$h$Pʹ$t'$Uh_S$[)U"E}u-34$tVWUmuj|$W$V $$ DŽ$@Vhit$V u$ hlS$(1@Pl$U%jWl$0U说 1@D$81D$ƉPV560 ǣ6VY1u 6$h#Z1H^_h˶%hZ$hhY$WVPt$T$hX$V tbP%9 V8 PWPtIƉPV56舜 ǣ 6V1u! 6$h#1H^_USWVt$T$1hZ$Vi thƋ-6P8 VI8 PW该t6ƉPWt>V ݉-611H^_[]h˶%hZ$h2hY$h_f#fSWV|$ t1H>t$|$\$j@ PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V5 tE$$PwCt/$F ~G F1  1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QPO Ɖ׃с11E9r 8"t$8t{1H^_[];sC| C 9s} Q"WV t/t$ L$Ps(,tD$$F ^C F1 USWVuD$ tV} ]CtP7 tEC tP7 u/D$ Ph(&7޽ u$D$1$1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$Vt|$,$h%W D${&tD$1{tj/t$tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$oDD$4D$4D$ PD$8Pt$ t$ [ÅuD$ x1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr\1X \$TfD$t7|$0j WPߗ t9t1ۉD$=r"11HD$$P辺|$1OL$L$D$L$T$PQRh[$VJ 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$PZNjD$fVSPS sD$ t P4$WR0 W萹<4$uM S]s {te|$t^t$Vt$t_@PW/ W tNVsE0R ߉VuP ۉt3EF ^C F1Vt$hD[$h%[$hD[$hU$ hD[$hV$je WVt$tVr1H^_V t3t$L$|$ Pwt΋D$F ~G F1w USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'G<$t@1@>1.1-t PN 1GG GG1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7% t+{0t>-uUst>Vs t)u 1H^_[]Ís s(CtP7 uCtP7 t1@뿋C$1$_'4v6 !6 P6  v6d tMtk $t$ 4$UQ$t^hmb$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh`$j X1Hx^_[]hQb$h>b$j WV0t$<|$jWh]$V萴t8W t7HfJBRhiV t!10^_ha$ha$Wha$j h]$j3 SWVL6h3VST6h3W@VgW^\6hV3d6hWl6hSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW Whi$ U $!hb$$HQPۍ\$4|$fGWhiU t$b$f|$*ub$=6t PJfD$(WhiU t$b$f|$*ub$=6t P |$fG WhiU t2D$*=) Phb$=6t hc$fD$(IWhiU> t2D$*=) Phc$=6t hc$n1Shi8U |$Dhc$31tPDL@uShi8U t$HuM1|TuD@uD$L|C`}3L$P9Dzty:t|$jQh\b$ uVh c$11t j,DLxPtT h\b$jv<u h"$Lj b$PhiU tDh$c$$t$h0c$ hRV#j PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJRI PhJc${$=tPhTc$^j t$=tPh@c$5^_[]Phb$jz hpv3jhh]c$#ÃD$1ɉJJ JJ fBRhiPm t1h]$jy 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h`$jy USWV,$@$PhiV tr$A jjj"" xgljj2 xi$-hSWAG xB$/uE$0uf$Ciu.h^$?t1H hS^$*thm^$tWH 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h^$h٘%h^$h^$h`$h]$h_$QL$4Qh^$(D$f($-D$](E!L$:!PS E PD $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q t6t t6Eu6tIAtcAtCAtPA tSA@tBAyAAT$ht6UWt$PVt$D$VPRRh^$W,l$ }"E!Ê<)\<$`a'=6`Cs|$[VPWl$Ph_$hN_$#<*<0<2=6<$ _$<t_$sQh"$D#1L;$r#y3`$QRPhC<#bG%9u<]K%C=Ph:_$h"$=6S<$CPhr_$KPhw_$K s k t?L$D$F~_$PWhx% NC%܋L$D$(Mu} L$D$D$F_$PtPtPu_$_$ _$"QPhx% NC%D$ŋL$D$(ȉ</=6%<C<$a'W`$=6CPh_$=6CKSRQPh&_$hW_$qC~@sFNuQPhk_$9 IRQPha_$!Muj>1l$ L=6?CPh/_$(shI_$h"$=6<$CPhr_$KPhw_$Ck tAt$D$x~_$\PVhx%b OC%܋D$t$)E}twt$D$p_$ttu_$_$ _$"QPhx% NC%D$<t$)ƃl$ rPh_$j><$€5`$$a'>`$rQ=PuJC<u;h?_$h"$B=6yCKQPh_$ ]=6PȹD_$6<"<`$G`$ L`$b`$l`$t`$|`$`$`$`$`$`$`$h?_$h"$Y=6<$CPh_$71D3 $r#t(`$T3 ׃l3 URWPQDe'h_$uj>l$ <`$`$CPCHÃ)gj EŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]h)^$h^$jn WVD$(1www ww7fWfGfGwWhiQ6 uh|^$ j1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQ| ;l$D$tD...P^_[]WhO$Q{ 1<$tɍGrD$X1.Ph#Sn E;,$sGwUSWV։ϋ\$Qh"$Wp)Ǎ 9~)j<t+~'K1.Ph#a9t OE܄u j-aj>W^_[]ø wf'ø"øSwf'ø"VPt$ D$Ph7a$V tD$P^h r%h4a$hh`$VPt$ D$Phb$V҉ tD$P^h r%h@a$hh`$WVt$(|$WhiV tgD$Phaa$Vj t7D$D$WhiV 1uhka$xg1H^_h r%h\a$hh`$hLa$jk fUSWV8~ y h d$*ghz%P y h$d$ gjhTd$t\hL$jQP D$tPh=f$fjhTd$5 D31 VPh  VPUSWQRPh;`$1EVRQUhgBVWhr. 1H\$(C CCVWPPUPP P P PPPPS8VSj7 |$www wwVWj VWj V^9 SU9 WG9 D$ @ )T$VVQRWPp1I9u U8tމ56 D3tщ1@8^_[]hTf$dj jj hf$ u8"f$jVOt,f$jh$h9f$Vhq"hg%g j mj fUSWV`~ZD$=6tIt@ƍD$H@ L$1jQRRjPrut$Vhe$< 1t$HFFF FF1G>\$SVj% l$ UVW dƅZD31OjUj t:9uB$=h>e$jV6  8uh D39tttn1VSjw VD$$Pjg D3vhd$@jjj 1VSj3 VU6h e$1=D3u$=|$ u'1VSj VWj `^_[]Ét҃t̓ u1Ht$8F FFVV4 PhXe$u1Gd$WVtTd$D$8x xx8WPV$4 q"{jhad$h#襡 g%SWd Whd$j&VSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[á6H 6t$Vt$VVPh6d$ijb%VD3VPD$$Ht5t$ I?r>$ !P$Ѕuσ^PD$L$ $QPj ߞXWV1N=6tED$@ L$1҉RRQWjPět4$ he$^_VQ5 jh4f'~3 jVS3 tPe\t^Vhe$>jVhe$)jPD$L$ $QPj, XPD$L$ $QPj  ޝj#XÐUSWV$$D$D$D$,1H$11D$hjf$WSk f~/P w`1A$@f'5<a D$u[FtR=5<D$,D$낃g<8#u(@j L$ QP_ $D$8L<Pj@$)<8#u)@j L$ QPe_ D$D$8<L$QP߸ j D$ P5< _ D$D$8c1Fj D$ P5<^ $D$85<hf$8o3<=6u-6~q561ۋtVP諵uJVh"$ FtPhDh$FtPhXh$j -6C 9|?,u)É\$(k <D$js D$Ps Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0z1ɉQD$ P4 D4D$8u S8tz`Xt$76u 6-6CPVt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP j r |$tt$ VUWs  UW0 8C|$$8D$@PW<tD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWt!t$ VUW\s #|$$tS9u$UW/ RW1 $D$utSPWs1 uWhg$Z1ļ^_[]Ë `}3DQu tq$ mhu$D$ ^"1ۀ=6u =6hi$Pj t$Whi$%0i'jj@VD$|$ tjhi$U< t?$ٺ"st$(Uhi$ $(Uh$hP$DŽ$0ffsDŽ$,t_puDŽ$(moun$D$$(D$D$$(h%P11G@F9NjD$|,6VPTV ɉD$t3o-uj=S{t6CD$#h%$,PÅu 1G 1GD$D$D$L$ D$L$(LD$D=6$u 6tQhi$|&1G1D$4hw%F9uj 1ۀ=6$tD$Pd u hV#HI|$(t_ƅ$t Plt$l$u |$ $H$tt4$2hS2#{H$t Pdlt$Xl$(t$: jj 螫WSt$ ~)D$ u|$ jWt$ 탼$u$(hv3P;|$($(jPV t"$(؃tTu*tGhs#G1C؁^_[]ÁttPqPWh:7#& 1ۃ$u1ۃ=6u 6t$, Pt$,V t$, Vhj$=6ujޫ$t7t$ 1FV Vt$a u hi$F%g'$($(SPh%hWt$WFI 讬8tD$(PWhu#iF u般8u$(QD$,PQhi$;FjUSWV ˁD$Pj VL$ Qhj$|#+t$1g'Gt6t =6t#͵$tˉ#FwPhx%. G!Ņt G h'rt4͵$tˉ#U$r#tH#FUQPh&j$1tK͵$tˉ#FPh;j$RWt 0h"$ h&r#=6͵$tˉ#FstspPhIj$Z=6͵$tˉ#Ph"$1sds`sTsPh[j$slshs\sXhwj$=6|Ut$ 1|$$hVPPh"Pt$u(|$ t!j VutVWhj$ h%2#t $Ph"$s^_[]WVt$t-t|$ PWڛtu頀64 16^_WVD$ 18nuxou 6PtMt_1,tu@APVtCƉ8j,Wt1Gt@Gj,Pt'h8p&Ch"BWf1^_fWVt$ |$7 WVUSWV$$l$WVSU$$hhU3Whq"J[ uWVh*"jG D$@t.D$t$QPh k'hV ^VjطUSWV$$$1hWSk 8D$$81G= <=o3D$ C|D$D$1D$hl$UVN T~H wV$4i' $׃Gt!M5<L$ 뱀L$5<-$Ax|$뎃UL$5<($At|$_ $V $M5<L$|$0P$hli'5<C&PfC $o3)ƃ|$|$t L$T$ ttL$ T$|$u 1AL$t$St$V$r$$Ap\$t t|$uSD$PV>!t\uD$0$AtuD$4$Ax|$u#D$ L$ L$Ĕ^_[]hd"j:D Vh$=Phl$hpv3 jfWVPt$jWV.@ 9u9t x^_Vt$h"jC Vt$VKKt@^h#V^Vt$VGPt@^h'%V|^WVPt$jWV? 9t9u x^_Vh"j C WVt$|$ VW t$?/tWhY"8Vhr"*^_WhD"jC fWVt$ |$7S WVSWV$D$\$VPWS$,$,njS7Vh?r%V u$tu!D$"t$"jro"0{PVt$ h"jB USWV\$ l$|$t$1E1@ <o3h'"WVI ou%jShPk'5<;@tEP?ǃuAo3)ރu4t$$V4Nut$(t;^_[]hd"jA 詡Ph"hpv3 jfWVt$|$ VW; t$?/tWhY"dVhr"V^_WhD"j3A fWVt$ |$7 WVUSWV $$l$WVSU$ $ hU3Whi%T uWVh*"j@ D$@tY$$QPhn'hVWV$$$$$h.m$'jMUSWVMu1} ]hD$ PVڝ D$ FxD$D$D$D$D$hm$WSG L~)Hw;$0m'5<Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5<L$1@D$kjuhlm'5<|=P+==N|45<1@D$5<Fp1@D$5<L$ 1@D$o3H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ tuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ WW9Wr@$N|dže^_[]hd"j= t$h$蛝Phjm$hpv3 jqWVPt$jWV9 9u9t x^_Vt$h"j= Vt$VDt@^h#V^Vt$VIt@^h'%V|^WVPt$jWV9 9t9u x^_Vh"j< WVt$|$ VWo t$?/tWhY"Vhr"^_WhD"jg< fWVt$ |$7 WV1^_USWVp|$o$o\$WVUS$$jHSuWh$P uIn8KD$  =6%D$ Vt$S jHSt$D$@D$ $p QPhr'hVRD$tS\$O$oj j ShWt$ PrtPePhn$Gt$ SWhn$t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@hn$贴81p^_[]WVh*"j: j迫SWV\$D$@u+t$?t;SP t7VY1 6C6C^_[h8p&jZ: jSUSWVPL$$T$ l$\$1$13֍zhm$USA @~7M$o'OӃ23= 66먀'룋 <DF@N@늋 <IF(NnOe <R3KF ? 30O' <aF8N 6O <g\PjD$ p4t$ N @OPt$(ho'5<6Ƌ$t 6t'tOt@tO t= 66 s=6 6g@tOy  3sg st1A T$ J sh#V46$fyhn%V4L$ A$I$shm$Vy4L$ A I$shm$VW4L$ A$I$shn$V54L$ A#WXoh8#WBo<$t=<Wi(@,<1Uz$PPhPPV6Yjj5< D$,9<1z$PPhPjȆ6 =6=<jh̆6h$3WSP <1{z$PPhPj6<1>z$PPhPho6r<І6a1@D$(S<1 1%PPhPj%6(<1Z{$PPjcPPh3=<h'%Wmh#Wim ܆66=66=6=<yW0!@<17{$PPhPj?6B<10t$PPhPjp31Ghpv3Wj>hs$!G=6<$=<hr1%Wmlu6G=<1$#PPjPPd31@D$$<1"PPjPPj6m<1y$PPhPh<6P9<1Mt$PPhPj6 =<=Ԇ6j:WEAj/WE.?y؆6<Fv$l$0UU݋\$UW|$Pv  66s`}3DH,W9D$h$WjhZ&WjĆ6W ܆6N1z$PPhPj l3,6 `}3DHWD$<$Ć6ht$o3=d3_=܆6tVhu$z5<ht$j5<h t$Zht$Phd"jn Wht$9Wh|$.D$ =6u1=6@6$1󫍄$B̆6Al$$+D$ -6t1$ 1D$$$MljL$$ PW9Q?t$h|u$6l$Ul$RQPc $׉ȉ 6= 61| h2v$$t/$$T$9‰sQt$t$WPhWv$tFtA 6WPUa u5 656t$hv$|$(F=$PU脖 uRt$hv$  A#$=`h6hu$1=6 $Vh0Mu Vhv$al$VjD$Po 6-6- 6݃=6~VUWt$hv$S|>9|Pt$t$ 7 )̓ }4$y0\$l$ 66ɋ|$  6=؆6 656σ|,@σ|1ҿ9  69|щ 6|$ D=6Ejjh6 .h6hu$6=؆6t6؆6t&hQh:w$  ؆66t=|hPh{w$ =Ȇ6u1=61@Ȇ6=6u 66=h3,=Ć6t#jhw$hw$hw$聙Ć6=6u=d366t$t$ t$4Ut$$Vt$t 9t VU t UG =69$PtE> tƃhss$Dj vPhx$jd$ PY! j j j hW%$ 6$66ApQt̆6@jxQP$Phss$Q" go0Vhx$jd$ Pt$\ $|$8jU$Pב $PSau/jZ$P$dP@` u$<mfsjWVϹ 9uD$8%PFP$Phx$h,w$|$D$D$4jP $u/h6hu$$Phj$jX hs#j /dev36 6/ D$ 6tD$ 6<$~~l$4 $jWh"3_ u ƃrl$Wl$$U_MGWU_:l$ ʼn\$4Ë$H$|$І6\$L$ u DІ6$dT$dž,<tx(=؆6dž dž,dž(Ɔ l3p3u(jh }$4=6-56u"jh3}$=6,56 6N06F4Qt$Qhf}$=6w,56F4Ht$Ph}$=6S,56F4 69}"QPh}$u =6+,56F0=)hPh}$E =6+56F0=|)hPh~$ =6+56F0N49}QPh?~$~ =6+66;6|QUUUU)ʹ3333!!сis{09\~\{0\\5Ȇ6sXș9}%CX=6~Qhz~$5~6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$h~$J}=6**6{4$=611F9tA uPh$j $Kd= 656 u։<8=d3[ WVh~$| =6)6<$C4$8=6`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPQNjs8ƒPVRW:)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh$Yz=6'6tm 6yxH1҉$q1ҋ8$$)$<$$1C$I8$ 6=6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$WO1C1 t׉Ë$$QPV$$V9s($$$VsOÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPƒ$$$$$$׋$$$RPVQP$9wȃr$9‹$֋$r‰$$$$$B1WRQPLË$Ë$ʃQPRSz)ÍC4$$W$$P$Qo@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQFKj$P$$^@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh2$s =6 6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d3$_|HL!ʉG41SSjhjPS,6N 6I4QSPU 6H 06 ,6 46P44Q586щ <6`@#HL 9| Hh h3H< Ȇ6HX 6H\ Ć6PTXH fǀ$̖%=6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d35O _(HLJ$܆6$$$t!LJ^F=6$$߬$$ڌ$p&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$P$Un 6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$$m=6O0 9| IУ@6D6=6u\Tu))УD61VVjhjPVH6u@69D6D65D6jPIQ =6G 6 61ظ|(RQh$"m =6 6 65H656~ ș)dہ|4hw'GuȹC=؆6tL1$PP$$5Ԇ6V1=6VhZN 61u;1$VhjVu  =H656h`VW& =6tWV56x\H6hhPO 1@$=6h$膟=6|o56N,I\Tt~!NȃN׊Nd1 t1WPh`B$RRi$&v39u1H$Whht@P4 PPftu!ѡ6t $ Q$=6u$|&6H,$$DŽ$%$ 6I,$1$ DŽ$1hv3#6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hi$=6Y 6j5 6L 5 6FU $F +$^6$~J`^p=d3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=؆6uFh$ NlK`ڍOȃ$ډFd;v&hK$/=665 6F $11ہ~U uv`щSA6$~!ـ1@ 6Il 65 6F=d3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5 6N uҋ6B8H!tk)D46B8)Nj5 6$9sE)ȉـ1B~U uv`5 6F$CHu͋6B8$؋N9ȉ$J`~U uv`щS6$~!ـ1@ 6Il 65 6F=d3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45 6;Vs2р1@~U uv`5 6F$Bɋ6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$46H 46V$P V PV~x; 86up=6t<6s4PP 606@06Kd15<6s4<646 6q4jPXE 65 6{0 9 H6PVQB =6tH656P5 6g 6y0H6$ryxtG$\؆%TuCl$AP$ 6Ou$ց\TtQ!QЃyId t15H65@63 56\TG~8^xN`1?9'D6+$~0lj$Ɖ$)ى$=H6$Ņ%GlH6D69wߋ$9w$6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=6} $H$$$~A=62$=|j.]扄$$r#t% 6ׁ\TtQ!QЃYId t1RP$Vh$]$$;$$|W=696H,t =6 $$ DŽ$j \DŽ$C6;X,/$~ j q\=6 $hjPA d3 6+ɋMt@U@f$$hM$lCɋuM@EfDŽ$ATX$h$ld3fDŽ$!3tt3$_ lj$DŽ$6H4$ $ H56D@VL!! $`Nd8WfAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t3@ lj$DŽ$ 6H4$ $l$h  56D@~L!! $߉$Nd t1$Sv4$j26@0p9w Au1H$$DŽ$1$$tUXǡ܆66@056V$SQP$h$l 6ɉ$$$t RP$CPKT$l$hߍ$󥃼$$tA$ȃ=6CX$tFDŽ$PQL18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$$pthj$P< 6\T$$i$$ $$$$DŽ$H0$$_$ 6@$D$@L!! $`_S$h$l$  6Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h 6@$D$ @L!! $$?R$$$h$l6Hd t1$S6j$$V 6$ȔȐG$11F$t =6$$=640=d30w4w+_1H6$`SWPz $PjSA9 =6t$W\=6tH6ǀ\8 6=H6x\hhP8 6QPz+WV=6t,6 6q4PP׸ 56HLNd t15,6v4t5<69546vG=6t6p4VVx 5<606@06=6Od1Vw45D65H66@4P5,6ݶe^_[]ÿWjV7 1=6VW\hB#SBh$蚇j&Jj%Jj(J6j JjJj'JjJh$Lh$BjqJjjJjcJj\JjUJjNJjGJj@Jj9Jj2Jj +JUSWV=6ua΋\$=6t66St$P 4׋ 6UPSt$$5(6 9u^_[]3:0PWVh$lRj$IUSWV"=6΅ L6u6H4H @6 L6 =6;6 66;}FWh xw'1I!;HtG#P;Pt;H uV9R_1ڍ_5H6P=6Wh De^_[]USWV΋L$l$=6t=6teUjQ4p׋ 6SPUt$$5$6l 9t?80)PWVh$Pj"G66UPQY ^_[]SI`wD$$4w'1C:Qh$hpv3R .  [SWV1ۃ=؆6։ SjQ3 =d3@fF F)f ^_[USWV Ӊϋ56F Nd t15 6G=6t 656PP跳 6yU +y/\$|$y1U =61=U L$D$uq`|$ G`Ӊ $u щw*l$$Dw'р4l$skPh4$hpv3;Q =6 6D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah$ h$h$11҉ ^_[]ÉՁ|$U u L$I` L$w$Tw'ʉـ1@BPhQ$hpv3AP 8ʍ 6ʍ   1$56$~3%)1@ 6Il 56 6K=,6Od$sC=d3CNdЋT$ t1҉t$VQPRP#{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRQL$|$ щT$ՉD$ȋL$D$VW|$RPPыt$ʋL$Vt$QRPJ"$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D456;F8|$}X1Bσ) 6yU uI`1@56;F8|$|=6t 6VPP 56F Nd t15 6USWV$΋=6G Od t15 6=6t 656PP胮 6xU t)h$ ~=6( 6xU ‹l$(H $t@\$=6t 656PP =6G Od t15 6w6,6HC, $9r%UQho$1I =6V6 $\D$jT$RPQD$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5H6W6\TudH6jpxt$0t$ $<=6WV1L(ɉL(@ u1LXɉLX@ul$H6jpxt$0t$ |$,;=6trUV胪1tttp`TtDpC u1:Cu) 5m% $D l$hVU m% $D9Pl$6T$5H6p0^_[]j=j =WV։σ=d3ȃ@PQR =6t'ȉGffF=d3u GffF^_fUSWV$8tW ƅuWhu"j3 $$<$4D$Phd@U tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h <%t$ H 1 Sh"U] CPh8"U C Ph"U CPh"U CPh"U CK,C,Qh/"U C0PhD"U $@D$t P3 1-Uhzd@$<W t1 VhedAW hjU( D$ P$4KD$, 9L$3L$9u0$S11:+8tx$0h"b$11҉ $ƅ*ŰPj PU ^_[]$0h"j USWV81ۍD$4ShPSu1NtAljSPSWuW讘 uMU D$t$$$Q1e^_[]fWVt$|$ VW$ t$?/tWhY"$SVhr"S^_WhD"j fUSWV|$$\$(SWt$(t$( )jj`SWq~XNjL$t$AhQl11 mTTDPD$T$ |$,t RP7E`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jV% 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^z$VVhVhT6S<V|<"VVjVV[\6s<vE<X680<Mt$VVhVjl6p<7{$VVhVjh6G<Z{$VVjcVV#3"<$#VVjVV#31@D$`6=\6\61@D$<y$VVhVh!d6Pم<1H$Fv$t$VV11KSU$Pt6p6 $+Ph<$5o3)=\6u \6$1|$(hjW  ttt=d6u d61;p6 t69`6u  hPV ueVhiu${ohk$ 5<h t$j5 1Phhx6PVxō$PUu1hx6hu$ō$PUu?Vh|u$j =`6jjhx6F hx6hu$ljt$1=`6 |$u =t6p6)j5d65t65p6ףp6t61҉|`$$P$T u$$j5d6QP $׉ȉ p6=t61| h2v$$t.$$$9‰sQt$t$ WPhWv$qt$Vjn$u Vhv$ d6t6%p6ʼn߃=\6~VWUt$hv$o8|>9|Pt$t$S )σ}4$ T6-P6uU-T6uY5t6=p6d6@19lj| 19ǃ| T6u P6͋5t6=p6d6ˉjURP'=l6l$ h6uA@19lj$ $t$u hx6hv$jPVW v|$wext23$2fs3$ Wh="hx6h.x'Vhx6hu$} 19ǃ} h,w$ l6t$VUt$  U t 9t V؋ j-USWVӉ $|$j W\$ SB Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ 8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$h"jߺ WVpv3Ph$Vg7 1GVWjh"VhXx'W+USWVu} D$8jP=x65|65T6%UUUU)3333!!щ%iP6Bd699#3#3T$u tv|$΍Q6656 6VT$ 66ډ6P…Ƅ!) 61f1ҁ‰t$$r=t6p6\$9D$ 6T$61t$$ËT$ u׍؉)9H1D$ 1l6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣl6566#3t$ƺQ=6D$6D$ 66D$661 656D$8666S66ď6N5ȏ6̏6܏66[6r,fЏ6 fҏ6ԏ6 #3f؏6\$H$SW8 93rWh6r 5X6|$t"VKYjVh6B 166L6H6̏6D$܏6 6+ 6 1҃r1I156~σRVPWγ56H19w+56|$OL$)9r΅u ܏6f5N65T656V6YVjPd GD$AD$ 11L$\$66tn6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 6@܏6t N6 6@ 61H6L2 6D1\$;|$t6)á6f\0 6D1 6u\$fT1 6T1fD1L$ G;|$tD$ ̏6|$11t$66=\6~i T6 i{5P6Q5t65p6PRuh$- 6 T656PQWh$-6@661QQjhjPQƷ6I 56jPF =`6ukt6 p61! V5d6 1N1Ƀ *&Fu  1@D$$=\6|>h$`=\6|(L$ 6 61PQh`B$PP8+D$$&v39u1H|$LWhht@Pn PPftu!ыt$\6tL$QT$=`6uL$L$D$ 1D$L$ 11T$hv3j=̏6t$tX6tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5ڏ6616 56D$ hh6PX 566P56Vt$6 =6=6 615d6ǡ6)؉1t$ P =6Wjh6 6H9|$u_656 6)ʍZ9s1Gр6B9r)6VhP\ t$ 1Ƀr!11ƃ6Cω 9rωp 9ǿs"ˀ6CI 9rޡ6L$  61Ҹ6Pt$ 56Vj6P  6 6L$)QhP  u16@ u桰6L$ D 61Ҿ6Vt$# 56jV+  =6tb1=6t 1#3#O 6F;56r⡰6L$ D 61h656 G;=6r=\6t$|\tX=̏6te6t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=`6|$T$T$|ʉj.='t$몸$r#|$|$t% 6 6jQt$,Ph$'T$;D$_=\6* 6t=`6u&D$ D$D$j &1hB#k'~ j {&=`6d=̏61܏6$hjV  fF쀁"fFD$8FFF fF56 ׉؉t$ ֍$fBt 6$,F܉VDF81 L$ F4D$4z 61CL$ =6WGD$(\W2D$S56tPjt$0  N6 9`L$97|$0N6L$,ʋL$(T$61GL$ T$D$ 6D$6D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP L$ D$1t$V 61CL$ \$N6 6=6t$,9sD$()QjPh t$L$ D$41ҋt$(VW'V$Yj=̏6t6t &3'3&3@1=6à r t$hhjV fFAVfF6ÉFD$8FFF 6fFfFV 6AFmlj\$r*D$p1ۋ 61zC9uߊ 61h65656f5(3|$D$1ۉt$ (3x1ɉt$)r򍀽6RQP Wh(36V (36D$ f6 61Vt$ \9\$t56(3D$ CiL$T 1VhVD$pP1 95̏6t6t#3$3%3fD$TAfD$V#3ƉD$XD$8D$\D$`D$d fD$lfD$n 61@D$pAD$| 61h656iL$Tj fڏ61ۃ=6 56<hh6W[ 566P56V= 56 615d6ơ6)؉1WP5656ڃe^_[]h $h$ _$hX$P h$Ph $h$Vh$Rh݂$PRh$hVh5$hVh_$RVh$Whă$VPh$h$vjVWt$h$gh.$`h^$Yh$RhF$KRQh$B/$1$'h $h$"h $h=$h $hm$ h $h$j轥 USWV6=̏6tr6tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(6Ѓ܏6t N6 6Ѓ^_[]SWV=`6u0׉΋ d6\$QPSt$ 5|6Tx 9u^_[WVhއ$h$j USWV=`6΁ 7u=61 6 7d611;p6-t6ǡT669v@1Shz'8!;HtH#P;Pt1A xVWh 7h$@ h$qhpv3d81B X8ė8@88З88ԗ88ؗ88 8 uCء8h88d8 8 `88 88 ؉+88D$HT$Ll$H8+8D$8D$85&v?|$ D$ fD$l$\$4l$ D$4Ӊ 88&whؕ7 88 8888ʚ; 886eĉ811ۋ88D$T$ ؋88D$8D$8D$58L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05&&t$v 8858=8|$(t$(|$D$ fD$ l$ \$,l$|$,=8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă58 8=8ȕ7t 1Aȕ7y747 079}(8i-@=B'7@9u8e^_[]hb$h$jx USWVh8jM 7&\$Du{'-88D$hD$h5&\$Dݜ$݄$h8j u{(-88D$dD$d5&݄$\$D8;̕7D$D8 8 t]+ 88$$߬$8+8D$\D$\5&&s=ė8uZȕ7tQ8 8 t5+ 88L$xD$|l$x8+8D$XD$X5&wD$DD$Dȗ8ؕ7 &w١8 8 t>+ З8ԗ8$$߬$8+ؗ8D$`D$`5&D$Dw\$87$fDŽ$jht8j(S D$8 &|$&D$& fD$Bl$B\$Tl$&t$Tj$PS SD$lD$lPD$,Pj5875<757CS <h8j: <7D$8<BC97)؉D$D$8 T${'\$A9@8I؉L$A 8Iff9uė88088,88(888 <8u8@88<8888ܗ8ȕ7 1D$18 8l1A h}$Hhpv3Aȕ7<1A t$,I PVh$ ΍T$(jt$>Ph$TD$ ȕ7t$؉T$΍T$(jt$F$P|'h$΍T$(jt$JhϏ$΍T$(jt$bF$@|'hݏ$΍T$(jt$$Fft$NfQPho$" ΍T$(jt$؉t$h$΍T$(jt$^؉t$h$v΍T$(jt$z0FT_h$G΍T$(jt$9FPh $΍T$(jt$ ؉t$h/$΍T$(jt$؉t$h9$΍T$(jt$d؉t$hI$΍T$(jt$9؉t$h%T΍T$(jt$X؉t$h]$)΍T$(jt$-؉t$hr$Chѐ$/Ph$L$lL$AQ D$iPhC$h$ h$h!$Nhl8hZ$t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظŒ$L$dT$C;8u#Ph8QD$X\L$$ D$L8PQh8 T$ҸŒ$u1GÌ$T$PL$r |$ rI v3H v3~v3H v3 hv3j (  }T$A{^N2D$ˀ) hȌ$uPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh͌$h$s9 |$ sS v3H v3~v3H v3 hv3j M  }KF߉Ήs(T$h$L$T$؅t% v3H v3~v3H v3 1I hv3j hv3ءܗ8;̕7*؅tءȕ7!^L$AQ T$Q=,8 (8 t+)|$L$p|$tl$p08)ЉD$PD$P5&H8H8P8P8)3v)3ȗ8vȗ8\$CfK%X8f!tX8 ܗ8T$ .KfKfX8D$ p8@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$Jp8@)t2(uK \8ȕ7t1 \8hƋ$ \8 ȕ7 PVh$P Ph$h8$hU$hv$AfPh$h$h̎$h$h$h$h-$hD$hT$he$wh~$mh$c \8h$1BD$D$pf)3@)f~\ȕ7tSωL$!ȹT$V!RPt$ hA$ T$ D$,ȕ7t1RT$D$fxf5)3ȕ7ruTt$,} L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B07C9D$=ȕ7 ؉T$547|$77)RQPU GD$9L$~D$8:7uG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E547)7t$>RQPhv$47;07}0u h$sPhp$aCы\$1B\$D$\$D$T$jh$jLw 1Ah9"WV88~b88 v3Q v3; 0v3hv3j.8 v3Qv3.H 8by`)88 v3Q v3; 0v3hv3j8 v3Qv3H 8|tN=8t4 v3H v3~v3H v3 hv3j %88hv3Whpv3J888888T8^_jjv1A1=ܗ8PUSWV׉E\$1AMȕ7]E uWVh$4t h$#Sh$ȕ7t5@D$ &\$D$$$ȕ7fyuhpv3je^_[]UVh1AtD$ 7$$8D$$9$pܗ8D$$R$[X8tD$$h$B8t9+ ܗ8} $y$!L$LD$L l&D$Ht$H\$$$$  ܗ8ȕ7 X8L$DD$D=H8@|-P8& )3 ȗ8\$,D$(\$ D$\$D$\$D$$$?ȕ7,8 (8 t5+ 88<8L$XD$\l$X08+@8D$@D$@5&ԗ8 З8 t7+ `8d8L$PD$Tl$Pؗ8+h8D$L> QPh$lȕ7tkD>L> QPhˑ$F|>uGD>ȕ7ufPh$"L> ffPQh$ ^_[WVɕ7u8jjV  t'86J PWh$hhl8!"6% Ph"$hhl8^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h*$$t$t$ t$SPh$ UPh5$ t$t$t$ hA$t$F PhS$t$ , Ph_Y$nr0G9s'GPh#H| KG9r߃$^_[]fUSWV`ƀ8-uFh3#Vu 8h3#V1u 8T$,11CD$D$hh$Rt$0u Hw؉$|'\$̃duE뻁뱀=8t\랉\$떁댁낃u1 o31;L$(uj|1L$ 1ɉT$Љ $P輾L$Au $AP{D$t2ڋL$ PWI Wof uމ$DuY|$ujP DžuE~ Py`$t8=8uIj Vh3#辥 Whq$T1FVrPh"$Vl SU< h3#=8Mj Vh3#h Wh~$Va \$$r#"$VWS jjVWS\$uT8 1GWWZWjOWjDWj9WV*Wj VW: u h$jQk jj9 u$8j* u7 j* j j9 t)qtOQ\* j j9 uQה$8t1Aj jh3# ukWh$jh$t$UL; $Qe0WW 9 $t$r#V腣PShx%Wj SWh$j解AVz&=8u$r#&VPh4$hpv3ujfD$tPh$h~'Ph $hpv38jUSWVPu } h~'WVWq cR~5StET ġ8͍Hw4$|'8벃L88둃ftTdL 8t8eȡ8V8G̡888) o3xnС8=ȡ8tjjh#f%6 ԡ8ND$ jjj"Mn ԡ8jL$$Qh@hP辬 u h1%cԡ8i )ލ<S H $|'=8t1Aj D$<1CPSeD$D$ PSND$D$$PS7D$D$(PS D$ D$,PS D$D$0PSD$D$4PSD$8|$ |$z |$o |$ d |$Y |$N F 8D$8gtj5ԡ8%7 rD$ D$$r#D$D$$r#_;-ء8S<-t.H$1ۃ=8uWh$hn$hϘ%l >h{&S謹g =8uhY$hA$hϘ%/ 1C8FLCSS H3 VT$W$}' \$@1ɍP$}'81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 128#8L$L$# 1AD$ PD$@PD$ D$<+ܡ8R D$ Pj$8+38+38+3 88׋t$#D$ Pj8d$zT$ ED$ L$TL$@JL$C8"+3-L$#d$d$d$L$׋t$8:(8@.08"8 8 88\$ H888 t 8t 81SSP L$Y\=8j$)/jD$D$ D$$r#D$$r#ء8L$9a|$u qܡ8 8ta|$  ‰4 D$=8T$tD$1@D$ D1ۉD$04hxShP8b atgcuL$S8 X8R88@8d8ء8\8x88 H8 p8tJt$(~A|t1ء8t|$ ObTء8Ȣ8tPt$ tH@WVhȢ8De Ȣ8=̡8t=8uu$ء8tMD$tH@Vt$ Wd =̡8t=8uL$$ء8tDD$(tIAVPWd =̡8t=8uL$(${ء8tDD$,tIAVPWTd =̡8t=8uL$,$.ء8tDD$4tIAVPWd =̡8t=8uL$4$ء8 tDD$0tIAVPWc =̡8t=8uL$0$P8)f=P8=̡8tP=8uG=ء8t4 v3H v3~v3H v3 hv3j P81=8IWhP85ԡ8\+ u+87tt)7|$t+u-$/9|$Ph>$!$|$*$ PMPh $臿83u=8t"o1ۃ8=81ۀ?D$# t$ x{t$$l{t$(`{t$,T{t$0H{t$4<{t$80{e^_[]jhh)&j[ ShC#h$ hǛ$h$jp[ WV)3t#|$ )3WPtFu)3F^_USWV,׉1l$u58V5ԡ8+ D$ VPUh8WSS|$G"ww Gw\$VVSVjW胑D$t2Pi1PPSVjWJl$=̡8t'h$j=8tt$ h $P1|$94D$=̡8tCхL$% D$@8t Ky9=8Cx$CD$CPS5ԡ8& u^87t 9D$=8u{=̡8t i58jt$ Pg$PZ$tH@$58P|Pg$P!h0h%9VwxE褺t7tu$$*$ P(Ph $1G,^_[]Ph>$hӘ$ h"h$jX USWV0=̡8AuF8,r!4~'h"Phq$:aPh$'Ph$F<5$$~'vvvhϚ$F|$(QPh'RWov3PWFh$F(R'QPSPWnv3PWFh$pF QPSPWnv3PWFV xdvvh$* V!݀'tP'~ 'tF\$(RPQhSPSVh$hv32~^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV&+D$  PCY1PPWSjV|$dt$ \$h$ D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9+3tE+3P{y$L$t ha$h$QQh%PPhK$L C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP$#PPh$ v3H v3~v3H v3 hv3j T$h9t$g h$? L^_[]hӘ$ jh3$jMH D$t'T$tt ha$h$QQh%PPhK$ ËD$t%u$%tup$Ph$g$z$Ph#USWV|$<\$8D$4t$0~u/jUb u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhW~"Ph"$PWh# ^_[]USWV|$4t$0=8uM8hh86Mt 8'j.h8st@hPh82T t"^tCt0Wv`rhhe%h8S ^_[]1w)ȉPjQѣ SVUz fEu jU.a WUu&Vh8Sh$hh8,8^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh8Shѝ$hh8輽8[SWV$L$4D$1G't$"tZ@:t9rD$Ph$Ͼ,^_[SWV|$t^D$uFD$jjP t1Nj0j.Vqt@h8Pu7ut$ e%hVh8+R 8^_[VD$L$ 1Ҁ0QRRhh8VP` thh%h8q 8^Au yuyt$Qtu ȃP Qw APh$hh8:8SWVD$8Q4۝$R84۝$R8ƄR8.r|I1AFL$ tWWVWh' u;D$ D$ PWEWWVD$Ph' tt$UĨ ^_[]h%t$ @ tԉ1|$l$Vh$PVSxMHt$t$Wh|dD$Py \$tN1D$;D$ 2i9t$sVt$Ot!ʼnD$t$Wh|dt$y ul$$WhedAPgy f$a$>ukSt$h"h%h$W軭Ƅ$t85$ ğ$t#$QPWԮ $Kà9Éu|$$P 1h%j Å~A1ۉh"PujVh"hx%h$WƄ$|$t8\$ ğ$tJ$QPW C;\$ mUZS|$l$|$$PUSWV  ujפD$$D$<$sh$V thj%V3hUs3 Ƅ$hj%sÆut s hj%V.tt s h$Vt PN= 8D$ h$VtHá8th$P8(j,S_tZ S8,PD$PU;xD$!=`ÉUh"$- S7Dž?tG<$tSWUh $hN%h$V蕪V\ tEUh$Zh$?Uh-$h&%h$PC158tVD$Pj B Ë} 9tVSh$譹 tNt$ t.u[D$.}"D$$<$ch$6 D$8}"D$$C$:D$@B}"D$$J$t$ }2D$5$D$$$r#}D$D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h$h$S\$ = 8uD$$D$ P$Pp 8\$t$Ph$  8PU) uUh"$ 1@$~#Qh$!1@$\$$$Ĕ ^_[]$Ph"$j$ ߄Phƣ$hpv3/ j赕USWV L$$8$T$t-(8*jh$8v (8š$8$T$1i E$48t!u6$t$PwT$ uF$t$PjwT$ tEM<ǃ hu$21 ^_[]ËD$ t 0$8$4$݋D$ t 0$8$$ؾ,8Phh,8~# uh,8h"$jv# fVD$t.})zhja9h$5\8輟 DY9T讴%&%'PQhx%5\8臟}#u5\8hOL$DY9^ËD$ H^WVθ&%'PV(vt)uVh$5\8 DY9SGt8tPwh%$x wh0$fuj whja90 Ga9a9^_WVD$ t;5a9D$=8 l8u 8';pt8@uVh $j! @u=b9thb9Ph%$À Ph0$賀u5a9=8^_Ã|$t 8$DY9Ã|$t &%DY9Ã|$t ?$rDY9Ã|$uha9hE$5\8蓝 菲DY9Ã|$uha9hf$5\8b ^DY9Ã|$uha9h$5\81 -DY9SWV$$DŽ$HH$pƋ$ ƒtS!=0Y9Ф$tˤ$Ƥ$atσ=ǰDY9^_[USWVx֋$$t{tp11@=`}3D_t1z\t r9΅t<΄t45`}3AҀ|Vy5X}3TVP5`}3@u΋$ $t`1HhZY9trʄt<$1ۊHY9t8tCu 9sYY9B+$=FFu4$D$|$ 1 jY9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ j]9<$؉D$j]9$to\[$uvz$\$-`}3BDEJ<0HB,t ]tVрy$t[`}3BDC$G)=~"B $tG)=BJB5A`}3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$5\8h$ <$?uhVWq( x^_[]USWV0$Du%$H$Dhդ$PQ y1E-Xj9h(jUh08 t$H4$=8I1VV$P8 Í|$0;=8=Xj9$H5@Y95T#t58RPhǦ$Q軆8#5\8jj6h$881DY9^_h$h8t$t$ DY9h$h8t$t$DY9WVD$ tZ}UuZt$~h~"W?tOhRV#W?tBWpy7vh$5\8 1H_1=l81@1l8 h81ҾRV#t~" щ h8PVh)$5\8舅1=l8DY9^_ËD$uD$L$hC$PQK tvD$ph$gu<=DY9u0=8t5\8hT$ D$ph~$tgu+$b9Pf9Pj9ǙDY9VD$ L$DY9t u]H 8HQtsP& t8=Pb9\8t5hPb9h$PK DY9(^<Vh$ Pjj$h$5V&^ËD$tIDuD$L$h$PQ t$D$phէ$Ufu$b9蹘DY9SWVD$-uD$L$h5$PQ  1G=Xj9h(j\Wh08耚 t D$1VVt$ ǀ?tx=Xj9tyD$thWhէ$eu $b9=Xj9uB=X8t9=88D$btXj9=8 Xj9VVt$A DžaSjwXj9mDY9^_[ËD$uD$L$hݧ$PQ< tmD$_D$L$h$PQ tI|$BD$ph${du8D$ph$bdu$b9ÃtDY9USWVt$ |$.E1ۈ$5\8jj,h$1% u v1.=DY9^_[]DY9USWV D$ #D$$L$ h5$PQ L$ ȃ#D$$L$ h$PQ D$ L$$|<$Dh$#t$Vt3$8|t+4$$H$B$ 3D$$hX$07VD$1E-Xj9h(j'Uh08K t D$$\t$=Xj91D$ H9=8"tB#7$9t$t$$T$$VVP4t$QXj9u?=X8t688D$$" Xj9tA Xj98E_t$jFXj9$9t4$!*DY9 ^_[]SWV$tKjjtK~S軖 9uWjȯ1uho$贒1HDY9^_[þVa Fujj{h# g%tj/VE t@hQW =l8t85\8V \8HQP~ Q Pj 葀|j5Y9h'Q#WV~  jWV~ Vh\$DY9jEqSWVPD$D$t&D$t$h$PV蓽 rDY9^_[ËD$ph$^u|$h$< tD$x|$Wh$^W7QPjWK] uP|$h$ t D$x |$WhĨ$I^WPPjW\ 1ۃuM|$ Àu*D$p VhĨ$^VPPjV\ 8{5\8h̨$ D$DY9(=Pj9t =Pf9u=Pf9t#hPf9h$5\8z DY95\8jj%hۨ$K,ËD$DY9=Pb9u4=Pb9t#hPb9h$5\8z DY95\8jj$h$+ËD$uD$L$h,$PQ8 teD$phf$\u<=DY9u0=8t5\8h;$ D$phe$a\u$b9ŎDY9ËD$uD$L$h,$PQ莺 teD$ph$[u<=DY9u0=8t5\8hm$ D$ph$[u$b9DY9ËD$t8uD$L$h$PQ tD$L$QPh$r# ˍDY9USWVh$V $|F$$h1Gh4Vm 9}hh%VV G9$uVh"$Zu jLT$b9^_[]ËD$t8uD$L$h$PQ tD$L$QPhΩ$ ֌DY9ËD$thuD$L$h_f#PQ謸 tHD$:D$L$h$PQ舸 t$|$D$pphԩ$Y ÃtVDY9VD$t$588u h$Y%DY9D$ ph$Y58^VD$HrߋDY9>588uh$8YD$ ph$"Y58^VD$t$588u h$X%aDY9D$ ph$X58^Ã|$u|$t&DY9Ã=8t 1PP)j=8t 1PP jjj|$u|$t͊DY9Ã=8th"$3X'V1VVcVjVPD$ D$t}uD$p*lDY9fh$h8Y9t$t$DY9h$h8t$t$DY9WVt$ t3}.u:hc$W t+hY%W t hj$Wu: 1Cv}tu&6hr$5\8e z1HDY9^_[t8u88P58h$5\8e1VD$ L$DY9ʃuCuD,23tK423V$r#tQPj h$5\8Qeu^Czjpp DY9^WV|$ W߉tQƋ|$@tPFWTF=8t3|$t,P6hح$5\8dWh­$5\8d ^_WV|$D$ DY9uIwOtAƋ@tPHF6h$5\8Sd DY9^_Cywh­$5\8*d ^_V|$t.=,b9t6588h-$F58(xDY95\8jj,h$I^VD$HrxDY9`=4b9t$588u(h_$F-5\8jj,h2$D$ phd$E58^VD$u5=,b9t=T$ 588Ju:Qh$E;xDY905\8jj,hl$[rQh$RE 58^ÐUSWV@$(@u$,@tw~!$,@$(@h$PQ tӋ=8~+$,@X1\j9j US|8 t F9u19u2$,@ph($5\8b DY9@^_[]ÍD$h@h8P/ hj9D$@1ɽ $L$99` `}3OGGDA@u8ȃ$t \u_GGY `}3WDQuViuAG;$(@}/$,@9)Q4V $,@4s61@$F?tG|1ۍҍBWGDQu苄$(@9|ˋ$,@9)QtV% $,@t68L80xtƃu5\8h0$'5\8hE$~ t;=8u25\8hq$ DY9D$@9G=8t<5\8h8 \8HQP~ Q Pj cj 6\$S9 L8L8059V =9t'~t!\8HQP;H~EQh@D$Ph8 9$(@L8$,@Pjb븃<$JE1A;$(@t4fUSWV1$D$jh8Tv t%=8t 1PP1<$~KD$@$Ahjhj ِ<$t(=8t$t 1PP$^_[]Ë|$ \$1D$9}ƋD$j:4 t8=d8u d8D$ Y$-8t+h$#U25t}|tU8<$~D$@$D$<$d-SWV։jhP$Q jhX$W tlh\$WCWtjh`$Wm uYt F t8t4h$Նt8tjh`$W3 t ^_[(11VPP ^_[)WShg$j USWV$\$@t$<|$j hh$W] |$D$ 1D$D$SiƉ$P"2D0h$P(t$Dh$$t$ī $t|$@t$t$@ЃD$;8t|$tt$D$L$d).$`.$Y.$tM.|$Htt$HED$H|$Ptt$P*D$P$t$ DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=8t;P-D$HL$H+8tD$Ej/t$L t@Pt$Dh$t$HD$t$ѡ8L$D|$D$81Y9Y9Y9Y9$$98t1$Pt$5u$\$` Y9Y9|$py$Y9$h32#t$L趸D$|$t$e$QPu5$8$<$$$\$` Y9Y9Y9 Y9t+t$j5Y95Y9PY=8tPt$Hh=$5\8V Y9Y9 tQPhH$5\8U5\8h2#l 1O$=8K8 1O$*|$pu D$TQhܱ$ c8ht$hW =Db9|$Lu:|$LD$puuh$t$Hh,$*uh$S~D$L$Y9^$|$LD$L8|$dD$t$h $~8P$$W)$<h%V?[1A$<$ǀ?tvj:W t=@j $QP[ ~޻t?$9u3;$u*W:)9$<r$)PWR t/h%VZDžm1Ft$Hh"$1$t P}$$u |$p$$Y9 Y9t$Lt Vhh$t$d脯t|$dj%Wt Wh$1$GGG fG$P$xPW# $u2$t'8t"$tJ?t1hW%W)tVh&$C`$(2WbDŽ$t$Dۜ$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB H8JBB D$(PRW$8", t ]60vRtD$(Z$$PN-j j WhSvv t%h"PS j "PW =8t+D$(xt!~X$tl$WSP5\8Qv jv_ Åx`=8u~PvvSfx)$P$P$Ph$r#蓈ykSn 1KW$Ph~$c Nȉޅɍ$P* PW$4h?$]h1N=8tJ$t$uP~$$t$uPY$8~R\j9Wh$&tNu1h@h$h8 uL8059ދ$tPQDŽ$$t4W$PjW0 $tPDŽ$$t4WJ$PjW^0 $tPDŽ$D$(t P( |$D$$hj谀$t8<tQ_h$$记D$$\t$ fj*t8tV=8tWh$5\8,N t$$tI=8D$tPt$hh̵$hе$5\8M1@t$ht$hh$f |$dwh$V #h$Vѭh$Ví`8tph {#V觭 ȅuY9 Y95\8h̵$ 5Y95Y9h"$Va5Y95Y9h7$5\8M1F&1t$lhܵ$V' $`#=p8t"D$$q$t^$QP|$h$ tPh$WȬ h$h$h$W讬D$$0$|$Pt1$t̵$tˉ#tD=8$tPh$5\8,L FWh$$8W= $$0t-=8tPhҶ$5\8K FSh$W t=8t5\8h $T h#t$ ˫t$d1VP}\$D$Lt$P5|23ږƉ$$ىD$'jD$,P58 \$(;8W '8"NF؊ u@;ut tH@D$(h#P-$$u 1É.1ˉ$$8$4=$8t/j$P1$8։щ ы8u81ى߉$$|$`t<$;$$|$$$$$$5ʋ$$4$8;$$Ɖ$|$$t$Pj583$L$T$P88$)$$8T$@R1Ot1$VSWl $u*$#tu'VSWB t߉$ȉ)u$$P9=(Y9=8$T$L8$9=8}#Ή5\8,$Pq\8HQP;H~-Q# 8Ρ89=8}Pj#BЋ$$L$T $|$`t)։>ډ׋$$|$8‹$4$8$ $8ˉƉ$D$@1S$P$+$$$$+$ى|g@By)Qj$P$+$$$$+$ΉЃ||$`t$@$Dt$=$|$`tCt$5858w h#58M|$`=$@$Dt$h;#ʻ|h$#t$D$8|jj n$D$@h"PLk D$@|$@DŽ$HY9 Y9 m!ڃt9}M#$H5Y9Y9$$!;$$=8t5\8jj hƲ$jD$T}D$@v3=(Y9=88 8ƒ 89}%\8HQP ;HQ#\8HQP<Q 8tB$ڋ$!t Y95Y91ϋ$H1 D$hB#P h"t$Z;D$@|$@tDŽ$ t$D$@Ph\$hN$Vhp$O"8)PSh$gh$%Pt$HhԲ$j2lh$hܳ$Gbh*$GL$D$ D$8t$4D$ D$0D$D$,T$1@މPj =t$Ûth$͸jct$@$= $#$1V$Wf$$$$$$t$@Ѓt$@Wt$ u.5\8$PPBPh $V9 8=8| jZkY9x& Y9 8Y98; Y9u188D1\$  Y9 Y9PL$T$ T$8t$4\$0r\$ 81tt$hu$5\8L8 L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Wh$|ED$L$ L$8t$4\$0ËD$D$,T$1@t$~Pj#3;7tt$h$5\87 T$d|$pD$TD$L$ L$8t$4\$0ËD$D$,T$1@h$DD$L$ L$8t$4\$0h$DD$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$h&$$C$D$8$D$4$D$0t$,$$1@މjh$CD$L$ L$8\$4$$ًT$ t$\$|$|ljL$xL$D$$"$$ω$$$h>$h4$hh$USWVD1D$ D$D$D$fD$D$0D$8D$4jh`$Q t}D$VtƉD$j@Pzt%L$L$4d8@P@ƉD$j:VF@PD$ t$D$0|$"$jPW4 D$4t 8D$t{8tvD$ t8tj;Pp th$Ph$Wh$WVWhK$A Vh?$yA1C)1C>l$,|$ $tc?tTj/W L$9uut$@jhW%V @L$ǃuC=8taD$t$uI$t>thk$V71Ʌ $t}thk$U1ɉL$<=d8=8t 1PPӼ=d8?|$DhPW |$L$D$L$D$ tD$ D$$=88L$QPq=88t=ut$8t$8t$ s t D$,t>D$Pj3D$T$"tQPhr$o? "D$Pj詓<$l$,|$u'j/VtG1|$t>tFhhS&l$LU l$t$1l$ -$b9D$Pj«9-$b9*x1l$,1Kd}Z<$t3$DSVW% ShW%W SUW <$hh%t$LV t$l$D$ D$<4uT588=8V$tB$hP|$LW |$D$Pj588uj/UY t@ʼnD$ D$$=8tAD$Pj?>uP=DY9uDhpv3jhh$S)1D$PjV8DY91ۃcÍL$%L$0d؁D^_[]1Eh$ =Ph$h$j谲 USWV օ\$ |$$jhP$Q l$t=jh`$U t;jhX$U t9T$(.C fCPC fC C 1}Gt$j/U$t9lj)CSyS\$$UP蚿 { uG<$WxC Uxj@V|$$tZ{ u d8w@PmxƋ_j:Stt@PLxG_Ot[uUnj]U5$tYÊ@t<:uL)SUV贵 V蹉,$}:1j:VtEt$t$Vh$1ۋ\$ t3tHj PU4 }t $9ut=s fCt$t$Uhɴ$:CC tWt_uk8KUVht$c: t$t$Vh$K:\$ n1HJ38(u$r#UvC{u{ X%tW%PvC1 ^_[]hM$j蓯 WV։2vvvGvtvGF G FfG^_USWVȀ%t u7Qt*5`}3|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj]=X8t<Ph$jdV'~ \8Iu1IPVQ_{ jh8`B Vd8j\=X8t|jj ;MD$~h32#WI D$|$n8D$ D$u38u Njhh82 t$jLD$=8 8xPim  8|$tt$lD$jDY98=8jLh32#VD$|$t~D$ D$fxtD$xD$(PWjux.#D$0=u$$ Y9Y9u h$5\8 Wh\$Vh,$wDY9D$tt$jrKD$tt$j [K 8xPl  8|$ t|$t D$ t$Ѓ|$t t$D$$81Y9Y988e^_[]Ë=Y9 Y9" t^L$ hФ$VthƤ$V"u3a9HD$fxL$ D$@щυtSVh&% Vh"$$b9WD$|$Y8;`8v+ d8tQغ8`8P]cd8jAD$ujj ID$=(Y9tD 8=8t Y9!ȉ'D$ !jWPt$_[1a9HspL$1HfytL$IT$fztD$PV5,85`85d8IE aPhQ#ݕNED$HQPD$~ Q Pà tWti8 8;L$D$|T\8HQP;H~0Q#5\8H 8L$D$L$Pj#͋D$@ @D$HQP;H~bQ 88D$HQP;H~(˃ tًz888PSOPj B1HjWQP Ѕx,5Y95Y9h$ $u h"$>tc8 8;L$D$}%\8HQP ;HQ#\8HQP~ Q Pj D$@ @tu hQ#踓D$@ @t$8 t h$藓1H88jq>|$ tD$ t$ЃD$t$h1t$V8=8 Pj#%h$hۻ$h+h$SWV |$$D$h0$Wt D$0$=4Y9Ф$tˤ$D$a9ƅu=Hb9=Lb9 4F95a9t jVth+$jw$=895a9t jVth`8h@$t$ jh$8b* jhh8K* hjE 8h0$W 8|t1@v5\8h$[ M5\8h($C j#DY9!hWjwD$ Y9Y9 tQPh$ \$$SWh&% j)U j#D$ Y9Y9 tQPh$ Vt$h&%j  81WW"W4$jCj"= 8SVhH$5\84$joCj`" ^_[Åu1t PF"=8t j  |$1=8P"=8t j  |$1=8P!=8tV 91j $,y h^$葏=8t DY9jYVV=8t jf!j\!=8t DY94$jABVt$h&% t)Vt$h&% u=8 j =8{j\lWVd81VA5Xj958$Y9rt suY$$dWPVȠ Wh$Vy \8Iu1IPVQ_ jhh8& Ph$j蝒 USWVD$=8p888jjP\ 8h8tL$jQjhP 8<<=48w=<8j=8=l8u 8h$Ɖ=8~&t =8u!h{9h#5\8H =8tCDY9=$ 5\8h$讀 h׼$܌1A =88=@8=8=l8u 8h$>Ɖ=8~&t =8u%h{9h#5\8  =8yDY9=tT$ wJ5\8h$ ?$tg<8h+$=8 +$3$t2@8h0$~=80$PASV3Q LPSV3Q QEPSV3I1  $DY9=t$$ <$$T$$$VRQPWhv$h`8 $$:$:$:$88D$ff8k=85 8^  88=8188u f8 8t PB^ 8jjP辔 8=8u(QT$ RQhP  8 8Qh8P: h8tjD$ Pjh5 8 D$18888888D$Ph85 8(8 OD$8j5 8iy h$E=8" 8$t#/=48=<8=88=@81)L$ ׾8󥀼$u DŽ$$j j $Qh$QPRX =8=l8u 8$P$Pt$h&$Ɖ=8~&t =8u.h{9h#5\84  =8+<8 8tPV8 8858=88SWVRQPh6$H8$8$8D$|8D$x8D$t8D$p8D$l8D$h8D$d8D$`8D$\-88=8588 88PQjRVWSUt$|$$$$$$$$$$jjhM$/X=8[=8N81ۉh׼$;1A#h$hؾ$u 81ɀ=8D$jD$ Pjj5 8 1Ƀ5\8h5$}y 1E=8DY9=$ w5\8hy$h$t5 8VY  81AJ8;DY9=t+$ w!5\8h$W5\8Qx 뗠8<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,PhA$h`8y , |$ |$|$1-8-8-8-8-8-8-8f8D$L$  ȋL$$ D$( ȣ8D$ $ fD$ L$$T$(t$\$VWRQPShJ$h`8 1-8-8-8-8-8-8-8f8D$L$  ȋL$$ D$( ȣ8D$ $ f8f 8;88jPh85 8`1ɀ=8uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph$h`8A \|$ |$|$18888888f8L8@uD$ $ ff 8jh8h8 d 5\8hֽ$5\8hL$5\8h$5\8h\$5\8hֽ$=8USWVX=8 8tuPjjPT ƃPj5 8T t$ 8D$fD$D$jPt8<D$T$ |$ Mbt$1PWT$L$+T$ +L$(x@Biy1PjV.a u8t8#th$uh$8t$4\$8VS5 8DT ǃu+U8t K8#uoVS5 8T t׉5 8S = 8t$jWoS ut:|$9uD$0jPjjW V5 8Ehտ$5 8S  81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$ Y9Y9 )$fz$R|$0|$Y9 Y91PPPt$ :KY9=Y9|{11FljË$D$$@D$(PD$$PL$,$|$(~ Q P t u\$,ى;=Y9Y9|1jPPt$ R:\$0D$HQPD$~ Q P| " t ]Pj ti8 8;L$D$|T\8HQP;H~0Q#5\8覬 8L$D$L$Pj#3̓88D$HQPD$~ Q9 Pǃ u|$<tN$@ @$HQP ;HQ t3 D$ $Prp;P~&у tr0 88gPQSۋ] 8 8;L$D$}%\8HQP ;HzQ#\8HQPQ 1JjQPRǻx~L$1HfytL$I$fzt$PW5$85858e8 t h9$r1H88vu h"$rE @Ph\$4Pj &D$@ @t$8 t h9$Ur1H88$@ @tu h;#/rj|$ tD$ 4$Ѓ$t$1t$V-9t$t*t$hN$5\8 5\8h$e 8 8|$| j%=8yD$ = jjSvBT$DD$@!уJ։1\$HPS0s{ 1CSu 5\8} D$@P說P5DPWh$VPj#h>$h-$h3h$pUSWV\$j/S t"W%9tjP!/W%t`%jPDžxx8hSh8賂 ƀ8.ue8G1dMt[G09tÉ؉jh8x.0uO.u1GOtSh $o1^_[]5\8h$c SWVd|$t1F58j"jdh$S \8Iu1IPSQ A W9Vhh8 SWV9 f$D$@=u1H$jjSPyt h$ohh$59 59 9j Dž,y h$n=8t DY9j9t+t&1ONthSPJA ju=DY9(u jj'h$ =8t DY9j8^_[V>08j 80^USWVP8hj |$ 8te$Ĵ8L81@K$L8Ĵ8188E8 Db9CthQP EDb9 <88<88󥡜9<<99@@9a9DDa9a9HHa98LL80Y9PP0Y94Y9TT4Y98Y9XX8Y9$hpv31@(^_[]Ãl$t$ 11GVWV5\8 o3)$<$@5858=88t:D$(ppppp  H8Hx8h8PVSǽ 5858hK#~ t8tP-8J tPasƅuox P!tƅt=8O6e-8=I88uetahPhI8t =wVh$hI8t 9r&58j?_PVh$0 I88uhW%,8 V-Vh$Ps Vh|i$W@t h$c} tlj1WQh$| $V:} $r#$r#tWQV| $V} مtWQV| $V| مtWQV| $V| مtWQVk| h$| q"tWQh<$D| h$| $tWQhrb#| h$a| مtWQh${ h$=| tWSh${ UȃW6NVjVjVjVjh\j9$<|$|$ $@j:0t$@0<jh8v hj+hj $@0j@V茐txGp5<h[$<?u D$PPPh>$hv31PhG$F 8P*81\$(ht$Sp t$~$@@FF =8t 1d88$<@VP=8 8tȃujUS 8ȉx8t=u98Ph$5\8 5x8! =8dx8|$|$ t&WWWv$@$@Hjh8 hj^hj O5<h$Y5<h$L5<h$?Phq$75<j?͚PVh:7#5<h1$j?譚PWh'$j5\8h8O K=8th8h`Y$5\8& 5\8jh@h8hu3'tEt W=9kL80t&ƅu'E$Y$5\8PAO /0$~ tq$=8t9j 6Wm L88L8059V =9t'~t!\8HQP;H~Q~ & Pjhj hj ^_Ã=X8t\8HQP~Q fPj <fV58u<,23t!023hrb#PLtFuh$j^ 58$tPhh83 8^SWV|$1t*,23t!,23WPt Cuމ^_[V58u<,23t!023h$P衔tFuh7$j^ 58$r#tPhh8P3 8^V98X991Y9 L8A95P5L8O:t9^USWV1|$-+3t}D$+3111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,hV$D$Pjt uu ^_[]d;9ơ\8=8m#t$Qhy$P* +3t7+3 8ttPl#PV8 8uV-jVf D$E3Vxtǃu&Vt$h$ Vt$h$5\8E|$tw7j h$5\8c"j 7t$Vi t$D$PjW Mr^_[]USWVP 9X9$t!uLY9t.u=Y9A99!2323Y9 Y9A t tu Y9Y9tu$Y91BY9 Y9$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5X9 9;$X9 91tu Y9Y9Y9^_[]WVt$ t8,23t423VPdtuVh $jY G^_h$f=23u + 23\8@=u1HP2 1;23USWV}uCjh9j999999Y9 Y9 99|$(jWjY98 Y9 8w+959G1;9)ʉT$t$999s?D$09D$(L$, 999=9D$t8D$"t8ʃ|;D$L$y =8`E\$ |$tY1${ {{;{{WSWk ;{{{ {{|$$PS\$j誸U$1ۉ___ __$PWjz 1@G ____SW|$ S\$3k =8fDŽ$ Y9t$Ph"$hQ1FY9 Y9ƒ\$x|$|l$x̝&ݜ$݄$ l&L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)Wh2$QPOY99|ӡ Y9tPL$ PL$ )΅~DQ4))h$r#Sh'Rh9$QPƋ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4l'QPhC$SWWL$(+ 9T$,9\$0+9x@BD$ډL$hT$ll$h|$@8 81G؃D$@5|&vqL$`\$dl$`̝&ݜ$ܼ$&1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4l'RSt$DhP$QP Y9Y9ȃ88D$u݄$|9s0;T$ D$r$|$\$|?؍<)hr$؍<)he$QPC N+Y9 Y9T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh8 VD$ B J1rrJVRVd $^Ã0D$4L$8T$ 1ɉJJJ JJQRP x$1H0Vϲ0j農0^USWVh=8u=8u }t$XjVCb+9~=9N+ 9y@BD$HT$Ll$HL$$D$$5|&8 8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и$r#tH#|$d5$Y9PRQh$hW|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ$r#rH#+|$QRh$Pt$$ų i)s<$*<$Hrr޸t1@D$))kd΍ 9HQP~ Q PʍHr̃t"19HQP~ Q P蝘\t"u59HQP~ QP^9Gdu91G 9HQP~ Q P[~#\uE9HQP~%Q'H wr? t:,u3PƗt%9Gdzh$$ 1N9=9ie%'h9Ptu :v2USWVՉh9QztDj.Vjq1ۅt6UPzu&)Wh9VT u1ۀ91C^_[]SWVD$=8t5Db9h=$5\8v nD$t$h$PV` uA 88t8t$~Vt. T89PQ DY9^_[Pvt=8t"=8t5T8h$5\8轿 1G=8 Sh&%hja9P =a9=a9Sh$ha9P =a9Sht&ha9P =a9Sh@"ha9P =a9Sh<&hb9rP  b9=81PPv hh$jXB WVPh8ơ\8?snt$h$Pʾ Ɔ8 8?)PRQhu35 x?t$|$ 91; L8 ^_Ph$1 ^h$t$hk$5\8? =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=d8tDt W`h$.$t V`h$PD$D$ L$PQRSm:4$uu|$l$ 8\8tQShP$POSh_$P> D$WjPUhu3tU58sƉ$t=8t`VS<WFWt$PN Wh|i$VN WSVN $t Pt_4$Vh$uD$uqh$n" t66hs2#t$hk$5\8CDY9kt$VD$VJPjV^ D$Ph$膞Ƌ|$WPjW1 u{D$ u?h$! tt$VD$ VՐPjV D$ 8PhĨ$Ƌ|$ W蟐PjW賜 1ۃD$  ˀuPhĨ$ĝu_4$Tj91F=8uR8,=8\j9Sh$ّOuh|$i 1$tP]$|$t.WϏPjW D$tP[]D$|$ t&W虏PjW譛 D$ t P%]d^_[]h@h$h8kK L8059UWhhPb9 uPb9Pf9Pj9V58=l8u 8hM$At>h$h{9I r1ɀ{9.)h{9Ph$5\8ljh$h{9M tfjhh$h{9M tN=8Hb9tLb9j h$h{9 uh5\8h$+ S=8Hb9tLb9a9j h8$hja9I thja9h$5\8蛸 1H@b9t h$j8 h$j8 USWVt$ \$l$|$WSU tUp| u;HDO 1 tL$ t>$fO gK9uX u3I u3~u3Pu3hu3 u3 tuÅt^$g t^_[]Vt$VFt^Vh$j7 hhPb9 tPb9USWV=Xj98t`=8tW$tw49Phh49 j h49od49tJ491P讈4989tNjwt8989t$h5P8VD |0/thhW%VKE hh$V8E V5$$P  8L$8(Y9$-81(Y98$ t1=8PGt*"1SSQPVh7$B#u8DY9d$$r t{9$ t1=8POD$8$(Y9-8h32#V裲49Ve49t2$754949Vh$0 h$u 1^_[]USWV,=8t8l$@11 SjhU tUh$ ",^_[]<$tދD$0S ,^_[]WVP58=l8u 8|$=h{9hn$5\8H f{920h{9h$5\8' {9t$1 U:Vh$UJ D$(Vyo!у $ 85\8jj(h9$`u=DY9u=0b9u 0b9tj=l8ua5\8h{9 \8HQP~ Q 0Pj 轱# l8tUh$5\8 4$|$58=DY91Hƒ4^_[]t$h$j2h<9Zt<9h$j1 USWV\$l$jW=ghm#W-gUh*$SI Džu&UhD$SI DžuUh^$SH Vjf^_[]SWVPj958=l8u 8=DY9h4#虏Pf9u_j h{9v]tL8tGx"uAHt.1Ҁ"ux"u"@Pf9ZHt@r1ӍPf958=DY9^_[SWV$h$V= V5; h`%PE1Fta\$SW蠋 t?|$/uH$VUPVSH 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh{&P} ƅu 4$]} 1$^USWVHuI\$ $Cj j ShWuu l t "hVW[4 j VSO4 8]t/M I9Nt vuvvS a jjS7 ƃPjS \$fD$=t8~%|$@jWQ7t8O$Cuu S VjP 1D$ PWhpq" D$ PWhfa$h$ 81\$@jPPhSvvk thh"S3 چ8Shu$ -D$ PWh$谆8$\$=t8~N1PD$PH6T$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,*8t 8#tj}ud 8AuZku<FD$ t:D$L$ PQhhuh t\$ ۋEu Y 譅D$ PWh$k 1He^_[]H t$aY WV|$h12$WFwt.h{&W4wt!t$?tt$ h$1F1^_耡 th5$j# Vt$ Vt$ t^Vh^$ji# USWVHE ML$8t$QPVf DUt$F|$$G(EK9u61Cl$WSSUt|$ ut$G( t^_[]USWV|hr"Pot+hr"Vothr"Vout9p9u }h$VW# Hσ s У23߃c u1t9σdt ltntFp9뵈x9p9맃t Vu% o39u=p9D4$9-u yt$$PQ1ۅtz<$uap9tX|8uNWlƃP*MVWPP 3.gz$PS߉ޅu4$h$^$%=t0=@Vh$=p9G59=p9jV DžND$PWVX$$P Vh$D$Vh$!t$$t Se9NvB11BW%jVQ $=t9$uXh$Vhx%PW&9r DŽ$.gz=t9uhh W ) $D$D$P D$ T$4$ =t9u@D$ #D$Vh`"$Vh`" t$: u h*$RV菴D$ !=t D$D$pD$59hVWT& W;j|<ǍWh$ktI=t9uCx9u:Vh$H$Wh$hu3ijD$P|$W; t $Vh$b1PPPW[=t9$uL=x9uLhh W ƒu 1@P D$ 1@P T$=x9u:4$T$WjVVh$F$P t$ $T$ V1PPPGD$T$4$\ t h$uD$ tP9 t h*$RL$#L$t9tGujjW% tV$PQL$TtNWh{$4$:u W2Vh@$aWh`"jWhV$ $l$pT$ 3T$ϋD$1 u Vܱ4$a $Qt$Pt$h$4$3 $Wh" $1B1P 5|9蹆h>'h#hpv3 j蛆Vpv3h>'h#V uPh$V jgUWVD$Pj-Sx2=x9t0#D$1=uT$l1h!$jKh?"<|$VWj tt)u1)tu4h)$6e^_]ÍD$t$1B1h!$PjVh:$PD$L$ $QPs=|9u |9XUSWV׉ˀ=9u h*$ t$9jjjS#X!ƒt7jPS> tuhZ$ql$hZ$11PUVWht$讍؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph$jV蹋L0L0D0.Vh$hv3虏 Wh#^_[]PD$L$ $QPО =|9u |9XUSWVpT$hL$lh!}h~!D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0RT$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$؅'1@ɽ9jD$0P{Ń|$<T$1D$ D$,8@D$,O|$01PPD$(PT$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0 |$_ $T'Cىt KDP@uD$ `}3|$1 ,,C t ^DH@ujGt-Ê `}3DA@CCu 1OD$" 8`}3L$C CDP@uʃ;K}/ K>C<\W O Cj$jGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E9ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$9$$ D$ PhWZ  h)G1$C<\  Cٍ$ j  H$$ j  Êt`}3DH@tKCu$ D$VVD$PV5z Ǎ$$ D$ VVD$PV5T 94$ =z31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$9L$ QhP 911 |$ 1 $Rg4t1BuڋD$8L$ Qj P94 Ǎ$Pj t$4 ^ŃuuD$ L$ }D$HPQ4xWt$ P<6 $(4$hUt$P6 L$l$ ȉD$<9 ɽ|$X`}3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't `}3DQ@tVFu$$  Qσ s[aj $( PS a8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A `}3CDP@t Cu;|kw`}3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ V E =9 hh V EKCDH@uٺ$yG=9 GKoCDH@uٺ$KfCDH@uٺ$ GQC t _DH@u%ƋD$pWtO@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVSƍ$ jhU0 uG1,9t!9}uEpVO*mj 9xt$p@ 9>GWVt$F1Ejhh9f Å1|$څ,5959hz$|$t5959h]$9 911<9t6 uGp5959h $e W߅uFu$9t@Py(9L9P`P9(^_[]R5959h$j 5959h$5959h$VQR5959h$$P5959hP$$P5959h$jjUj 5959h$lV5959h$UP5959h$>5959he$(5959h$Q5959h$5959h.$5959h$jj 5959h$5959h]$5959h$5959h$n5959hQ$X5959h$B5959h$,$P5959h$Sh"$95959h$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u$9_NSFJ1<9tJ9ouwvSKt?G $pSH|$698^_[]Ë$@S5959h$j SWV׉HЃ s%j SVd{ G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S0 uC9L9sL9؃^_[]Ë59=9SP PWVh$j USWVP׉΋$1m~ w]$' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x 2323>u)jH1҉P523 235ojnH@238 23>u j59hv35Au 9P`hy"j OPPh$hpv3lj`USWV\$|$t$ 91EtB59WVy ܖ9ܖ959@1ܖ99Ht8h32#pk9 ܖ9I 9KphU#jh9;grfؖ9"Ԗ9 ...99ܖ9@9 9 =9u98#uxnu 9  9W1 t,E-9@J}9ܖ9R)ʉ1ɉܖ99‹\$k91m1 9Q9u>#u~nu 9t91B C1ɾ8f 9@91ɋ\$u9\$t1A ^_[]ÉNKQh"$j1 USWV|9uN 919u:=9u9u3u39$9v39y"91NHQPPY?9=u3P==9tC9SS59y th959 o9=9tM9t=v3tPq=V959h9茼 99=9t99 9@99=9QPrf|$󡘖98t0W599V W59V =<W59$V W59$U V@ Un PWVh$Wh9Cc9h9n9޻t=v3t P;h"h9lg9rH9tt$t$Pb 9H9tȋL$!QP\ 99=9u999v39y"h32#Pf959h"$! 99$@1Q59P2 59h9h9* ƅttb9|0 uNt$@ $@ $QV59P91@|^_[]59h"$j 59h#h$h$59h$j h$h$ =9uh$ h9IjYh$벡9@ u:HQP~ QP;t59P 1=9t 9t SWV9X1t^h32#3dt&Nj@HOW:uW:9[뾋HWPa W91F^_[Vt$Vgt^Vh$j Vt$ D$tVP)uVh$jc V^WV|$t$ WVt^_WVh$j/ SWVP\$|$9t P]D$jPSW PL9VPSW 9^_[USWV9jh991FD$99,9JBtOz T$R uW|$+;A 9 9T9ыR L$y th|$ 9)щ;HT$7D$t{T$A 9 9+T9. 9;H@ 9 9|$toT9u1ۉ91;A91;AT$t1~T$ T9=P91ۉ__ WjWSQPZE|$t4JT$B8 9;H`,9T$T95P91~>~ VjVWQPD1FT$1T9=P91ۉ__ WjWSQPDT$t tCsBtt$u 9;Hr,9xt$t91BtȉÅQJA7$<'=95 9$=9FPj W] @) 9QPW 9Ҿ5=H9 H9R҉Y = 59h(v"59(_ u 1Pjh2#9S1P549509)1Pjh2#09S1P5 959S%1Pjh2#9S1PS =9 T$9= 9GPj S ƅ 9D$4)أ 99 5 9$99a(9j549509h9j5 959h09 4 59rm  T$9 9D$<=9v3=2311 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;523r59jjh%59j$l 59j l 1-RL$ tKQD$ ;23r59jjh%)159WjSt$ tsQ5tejPh' tQF;23r59jjh% 1')$Ph$59\ Z;23r59jjh%s 1t$ D$13Ph$59[ F9ut$ t$L$)423F9r59jjh% 59j$6k 59j &k 9@ @9  ֡9 9u5595 9j59 =9t59j j n jh9Y 95 =9( 595 9j596 =9t59j ]j 볋5 9$99(9+9T$JQT9T$ut Q;P 9T$IT9D=9yBu%hh r F 5 959PQ ; 9 jh2#r1  _ T$=09ujjh$r#h09 9D$0 9D$,9D$(9999099L$(t$, 09549L$0 89<9D9@9=9_ 9QZ=z399 @ 9 99r (9֍$9@PQ(95 9 F@+6vFt Pʠ uF6^_ËFp vh"$j^ USWV ՉL$\9X9щT$Љ$ `}3P9E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B l99r7 l9P5h9h9X9\9$P90D$SPt$V  it}ŋ4$L$]\4$L$t&uE\l99r+l9P5h9ƣh9X95\9F1C4$\9\9\$D$ l99ȋ$r+ l9Q5h9;h9X9\9 ^_[]USWV`}$111D$h$u W: uu5<>ut0Gtg<;u<$8u o3ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1h%SQ t+8ttDGh$jZ 1E L$3 th`% u3h"$jJ tD$PW uh.$ۃ|$ tt$| uh8$뼅tt$ uha$렋Cu/h# g%tjh?$VV VeSPK QVhB$ -Phg$hpv3I j>UVQt@t $e^]VhT$j WVP։.1ɉQPW胪 V?t$8t.1H^_u.8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pVo Cf{~a11C403t?L$qPt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPF tvPv [F vv>F^USWVP1k<Z@3~4Z@3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<Z@3Z@3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)op phpv3jjCh$j:V1=9P/W t*a jjj& VHV菂5H<Q95H<^9j5H<@9jP9t#1ɺH@3A<.u91 1@^USWV D$0f 99Z 9,I fEE!f ufE(Mt!U1f~ t @9ufE,$vZtE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? `}3DAhpv3jP W@$d'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$t'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuLTj=m$ 5D<迠5D<Ϡ1QQPS1t$V5D</5H<c1U)19}1ۋ$p$)ŊEt9}1< ˊEE5H<"h!$1VV5H<{UVj5H<iVj5H< 5H<J5H<\2= X}3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&hpv3jM bxu+=9 9σqt$VaVVu5H<Ihpv3j8M ,$,$fUuE 9|)BfUhpv3jL ,$T$4xut EfEuGza|1x(| E9}ED ufMhpv3j}L !}Eu)uE t uP蠹uf;}]D; jtQD; tt$4UЃF4; ~ttt$4WZufE tuPu sE uFusE9,Et)uE t uP裸uEtPQEEf~3M1tR'MEGЃ9|׋E4t t$4UЃu sEE tPrE ^_[]KPt$59t$t$h$hpv3:Z P$@ t$St$t$ t$UPh$'O $A It$U59t$SQPh*$hpv3n:$j.USWVT$qЉD$ qGud$ T$T$ $P$ǽ)j Pt)1Ƀ QWl$ U|$ WD$p,tS;tNt$Cj S/)؃ QSVWD$p~t G}uo $ $l$Atl$|$q讚KL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufth$VSw}|$Gu1PPwm|$ GL$G)VQw  wq ^_[]D$L$9 fAËL$1x9 9~9USWVl$0.99}=9DP59wǍ PjQe =9ۉ9t @tFj : 1@^Vt$ hh$h> : 1@^Vt$ hh$h> :˵ 1@^Vt$ hh$h> :褵 1@^ËD$1@ËD$g%1@ËD$$1@ËD$$1@ËD$]$1@ËD$c$1@ËD$"1@1199)ʍ9hQQPPj jh  1ø91hPPQQj jh  1ø91hPPQQj jh4 1ø91jPPQQj jh 91Á=9ftpthh9h$r#hI91hPPQQj jjd1 1WV91hVVPPj jh  =9t#1GWVh$7 WVh$( h$Ʉ h$輄 1^_ËD$1hPPQQj jhr$ 1ğ9j2BY1Ë 9AR@91ËD$@1@119 :)ʍ:hQQPPj jh  1ø91hPPQQj jhP 1ø:1jPPQQj jh :1Á=:ftpthh:h$r#h:1hPPQQj jjd 1WV:1hVVPPj jh] =:t#1GWVh$ WVh$z h$ h$ 1^_ø91hPPQQj jh 1h:1Ë  :AR@ :1ËD$1@:g%1@:$1@:$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$@1@ËD$@1@ËD$@1@t$[1@VPt$跻ƉPjV] tjjVq 4$5N1@^jt$ 1@WV|$jWtWNjVP- 1@^_WV|$jWtWVP蹳1@^_á :ƀxjjPͱ 1@5 :Ⱦujj5 :襱 1@jt$ c1@jt$ Q1@Vt$  :ƀx6虼j65 :P 1@^V :)thkj賛1H/t$ ƀxj6P jj65 :1@^WV :)thkj^1N?|$ƀx1FV7P蹰 jj75 :jV75 :褺 ^_V :)thkj1H8t$ ƀxj6PT jj65 :Vg1@^ËD$05 :証1@Vt$  :ƀxj6P  :)t P1QQ6P虺1@^ËD$1@ËD$1@ËD$1@ËD$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$#1@ËD$N-%1@ËD$9$1@ËD$G$1@ËD$?r%1@ËD$$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ø:1hPPQQj jh t 1ø91hPPQQj jh P 1øh :1hPPQQj jh, 1ËD$1@VD$ 119‰)hVVQQj jh  1^øh :1hPPQQj jh 1VD$ 01jPPQQj jh Ɔ1^VD$ 0hU%P7thVh$r#hF1hVVPPj jjd3 1^WVD$81hVVPPj jh t#1GWVh$1 WVh$" h${ h${ 1^_ËD$@1@øX91jPPQQj jje 1ø:1jPPQQj jjqr 1øh :1hPPQQj jhN 1ËD$1@ËD$L$A f@1@ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1@ËD$@%1@ËD$@K1@ËD$@1@ËD$@1@ËD$@1@ËD$@1@1@ËD$1@USWVPt$11Mf$0jWWSSUUh W"b x;}ԉ1@^_[]ËD$1@USWVP1A~9~^Պ\; 1ۋT$~N,$9uhL$PRQ9]vnph%PRQ]|$ Ft$uMh}%v;FVx$9tكaw~ ـb(Qh$P褹 t^WPS\$F[F8tt$SVЃ F9u vp^_[]fUSWV|$59ti=9WwWwG-99v1W褨uá9t P 9=999^_[]SWVt$U3t59PAvU31SSVg 1NtjSSP;91ASSWQQPSTU3Wfh =U3t@hX%Wmt59WuU3W_ 91^_[WVt$ w?=U3t-t)959r!PQ_ t;9slj4LK3^_59E9959m599nVt$5999VLPh"$^PT$D$ $1APYXWVPt$|$5999D$$WVP1A4$^_USWVt$R5959>-9E`}3\Jك@to@uwt uDZ@t< ty< =9u =9tI59pttj 59 =9uj 599999?=9u"59ttj 59j 59199999 9f)91ۈD$u9C59st$L$4 59s9Ƌt$|259sVUUU9}j 59|$uCj 59KVW59Z E߃ @ Ȣ99=9uW59rt7j 59Z%5959V9999597 ^_[]t$Ph"$VPt$D$ L$ $PVP1A4$^h$r#t$t$t$t$USWVP|$ \$$l$(t$59099D$,$VpUPp1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW蚢j59R1ɉV,$E|$@t[D$@8tRD$u:h+Y%59tTt$@59bTh#59OTWt$Dt$ h4w%59)T4$59npD$ 59|p59p‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US59T59hpthC%US59_T/)PS59 59<59NÃ~0L$ZD$  # L$X1)<(x1 `}3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP蓕 QtRD$(υ~] $9I\$)RPQ> KOuLuH|$@tAt$t$D|$W/ Whpv3j D$z19Dzf tN;L$$} `}3DXuhpv3jG  $9A)RPQ荔 $8GED$t+)j Pt$59L$99D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P* 4$踮0^_[]h$r#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(59 m59l$tKۋ|$,;Sw|$0L$Dȃ19AD$LD$Ut$HP1t$PQQŹt3;|$,t.D$DE9}SŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j P׺tC@j PuL$$)݃} 9WUQS59菅ƅ|$ ْV}ƅtV5D<܆4$59PW59JPWF1PPW* WQD$E|$ GWUPS59Pŋ=9VPW=9V JPW2F59t99#WUt$ ShX%59誫1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV4$tWV萅Vg@WވUPL@WC@^_[]h$r#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]h$r#t$t$t$t$USWVP|$ \$$l$(t$5999D$,$VAUPA14$SWt$(^_[]h$r#t$VPt$D$ L$ $PVP1ɉ4$ ^V59g59h^fUSWV $$$ P915:5:9i%5:W9WVP x'Ft(=9tvvP賗 vh9&B>vuɸ :9:::h%T D$|$ h[Y%SUQ e~o~1pKrtCGD9붃fg5<h32#VPhW` \$h#W&3 D jPh# t \$Sh|$W u4 {Z%x'WRPWVf t }u몋}tE$th#S2 <=u͍4@h#Pz2 Fh~]%V蹔 04$VW HT9h:h:hfY%5< bSY$$$ Fm<D$/J1Wh]%Ndu#D$=uD$h|$d}:h]%h t61W辑 t@ < uFrWB` 1W5` jh12$h$ AR5H<dǃ5H<d1FVVPWOz9$t~5:5:W59hŻb VjBVj7hj(5H<&肂hh93cD$D$@VljD$ VD$1Åj2PKL$t|$ o u*t$ `%n ut$ [%n j|rjUtc1L$ <:B @9u1PPPPPjPPj jUVPb4t(jt$W-WA11Vl|$ t$~14S4HC9uW:V1j tPjպjVhJ#蝿 ![P9j:j"9$u誸t`=T9t jǡ jjGȜ/91 ^_[]Ét$ hT1GQWP Ph#hpv3q VAW =hpv3jj,h.Y%DZj Źhpv3VjhlY%覱V V1Fhpv3VhEh[%脱V UWVV~ hK# P肙 6|[=9t>V萙Ph>]%W 59n59p9=9t>VHPhP]%WT 59&59(9=9uhpv3jjhg]%菰e^_]Ã=9tá:tt$P jm jf hK# tPo t hW%^ Zjh.w hjUSWVB L$Q|b  P Ń j h[%U_ ~ uF t$|$ Wv WfD/UW] Wjŋ>7Ptn,$n ;nu:FUWњt^FPv蹚tFljFn ~D$P94$+UV S ŅSY ^_[]ËD$L$I41@fUSWV1t$T9j%Vt$t$ t$t$4$jjVP;=T9P~t$Vj >hj]jYj߄{jVf4ʁVIVjj^4?15T9{ :VPX~Bjhy :jPWyjhx=9V/Vbu% :ǀ$jhxupkz :Ph"$jX jtO :)tTPCu2PKu#PuajhxP辚^_[]Ë$l$ D$jP輖tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uVYfVKfSWV1t$t$t$ t$t$4$5T9jV#jr4PVf8  :$*tKuKt!Pуt :$P :L$$Q3 tXD$t$VSVx)VOu]%u]%t*VB^_[À)ujhbsu Vt5D<w1WW5H< 5H<Q5H<wSj X9;xhj_jZjC]jVkJ]%]%!}E'USWVο$WQS蚈 Wh]%SK WSU~ Wh%U/ S1tGUt0VVVVVVVVVVVh"h41PP/t US^_[]SWV$SQV Sh]%V蝈 SVWЇ Sh%W聈 Wit VW^_[WV1t$t$t$ t$t$4$5T9jxVtkjo4PV[5xG :*tD$$tL$PQ^t$VfLtV誕^_ÉWj $?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QFD$l$1@$4V9D$pPt$V Z$DaD$|$ $%t um`}3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5`}3t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u`}3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV2 \$ 9tOL(tu(D, $ $ rt04؃ Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW5q 59t@WPh>]%V 59ը599shB#h]%9 9t*W蚋Ph]%V 59x.590AtPhQW#hx%j[1e^_]Ph ^%hpv3L j UWVV?p =9t>V1PhP]%V݄ 59ާ5959wh"h^%F 9t81h^%W莄V虊Ph^%Wv 59w$0FPh^%hx%j[1e^_]V1hhPhPjjPj jjhU3hи4xjP訪V輹^hpv3jjh]%腡9tPjjh]%jjp SWVD$x1|$9t9Ps1; P]PVh:7#WO^_[USWV$$$L$$QPhV! $h32#V $D$Wj1K4$J 1G9r6|$  WUŋ$(\5F4$ ÃugD$ PVNuH|$dh32#V $t:|$G=9tVhI^%h2^%P= 1KS1D5$$t 4$! 4$u9tVhI^%hQ^%P 1ۉ؁Ĉ^_[]U袐$$$1KqQ USWVu ED$l|$(PVW,  ED$8D$1ۉΊ<'t  j Fj'V违u Vbljt$ t$PSW D$ t$ )VPh"L$Q h^%VZ t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/W讴 tWP É@/ WP É|$PD$lSz ND$+D$D$ .t Vt$W3 tSy Džu]D$T$L$;ȉD$Pt$ SD$L$Wt$t$ h^%P 뒋D$L$T$;t RPSG |$\$$h%S G|$\$1\$L$<t$0Vhht@W聲 fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=H<jP|$ W 5H<lj:5H<j5H<[5H<^jH<D$D$(D$$1WSիD$ L$VWSPQ31N|$p$ 9h9hptt$$R =U3\$hU3hbtt$(+ us=U3ujjhn2&j: hU3hf@t$$ =U3t0U3hU3hbtt$(ΰ  _%\$U39t P"9t P i£:1t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@59L$@EL$D$D$9}=D$hP(>\Fgd|$u9Mx{;5H<tVEjP|$ۋ|$t h2#F(hP0(cu3H u3~u3#hu3d9Nj|$tcj' ;5H<t V|$ t E%u15H<95H<j5H<;Ucct$(胆twPquW_D$td$8u-e^_[]D$t$ h^%jf Vhd^%P 1S 6 1FV5 Sjh#f% 5 VS| kt$5 $ D$pL$|PSt$( t$ ]9t*t$h*_%P 59蓷99t*t$h#P~ 59`9hS&D$ 0Cu.h9_%D$ p+ut$vm t$e s h9REtt8tjP7 u%t$V6[ 6hN_%` j3L$1Ph<_%` USWV։5H<1@P5H<S5H<dah 1PSU`& :hP%}:hPS1CS%& 9Wh"$J:h$$FPU肄`5H<A@)VUPRQ5H<C\tcjPRJt05H<PV5H<S!PVy1PPVl V#`^_[]hpv3Sj+h^%跑S fUSWV-1@=ğ9$hd%Pjq h:rD$1D$ $ $?$V9;%VWo PWt$  VWo G|$e%̍'`}3D$W菴PWt$  uD$L$DAu >uD$ |$O 4$ ))ht$P4p FD$ |$$ ))Ƅt$茁$}8 }? jSz ƃ $NfF8Ju1ҹhuRRRRQRRQjSD$DPjuǦ4D$D$D$ D$ jtSD$ Pt$yD$ p ğ9 )) hPhȟ9n 14'jVhȟ9̳ t1GuD$(Vhe%j@$Sf 1PPD$0PD$XPSA t|$Lub4'hȟ9hx%h-jSj"D$L1QD$PPQQS@ Shf%s1=ȟ9su=ɟ9lu`}3 ʟ9DH$D$$PhW%, u5$nfsu( $D$1@D$ |$$tD$$D$$i jvjh1Wt$TVZ j!W|$0WJ iW&]hhf%QCh 9PPji= 9 h 9PPhhB#hug% Phf%j+o hf%Wohrf%Wohf%Wohf%Wnh 9hf%Wn = 9t!h 9hg%Wn $9hg%Wnh g%Wnh.g%WnW袯hib%jtnhȟ9h1g%h DŽ$h#9VVj~j ha%VS; #9defa1ȋ '9ult1 j hg%h#9; #9manu1ȋ &9ual1 #91 #9none1 '9 tlf=#9 tb=#9t`h#9hȟ9hg%jtChȟ9hg%Sj~$$'|#9Ƞ9hhg%HOh"Ifhȟ9hg%hg%hL [ 8 Ƞ9h_%D$ Pj3 ~ht$ h̠9i t$n{j h̠9th`%D$ Pj ~ht$ h> :i t${j h> :趈t=> :t Ƞ9h`%D$ Pj ~ht$ hˡ91i t$z=ˡ9u:h a%D$ Pj@ ~ht$ hˡ9h t${zj hˡ9t=ˡ9t Ƞ9hhʢ9zau=ʢ9t Ƞ9D$1@$" h9S$Whh Vʢ9PPjxVˡ9PPjw SWt%Ƞ9|$$|$ t |$ujɣ9PPjye|$t j9PPjz^hɣ9 =9u=a%=r!ƒa%t๥a%=ujQh9g j9PPj{h̠9PPj}Ƞ9u4D$D$Pj|$uh> :PPj|=> :]$]$t> :=#9a%t#9=ɣ9tɣ9|$ti=9]$]$t9=9]$t9=̠9t̠9SVWQRhȟ9Phʢ9hˡ9h"h,$L=9]$]$t9=̠9t̠9WVQRhȟ9Phʢ9hˡ9h"h(jjj8^ xP' "9a%Ph"$hb ha}<hȟ9hFg%hSz S"jrjQ$H1WWV$Ph8e%7 t( ;$P$TshJe%jPbt^DŽ$ 1WWV$Phie%7 ? ;$0$4&h}e%jPh`uq5: 1H t$t$6v1t$t$vha%j<$t$jğ91@$F=> :h"ha%V ha%jft$(VQ VlPh2b%hb%Wtf=ˡ9thˡ9hOb%WXf => :th> :hZb%Wt<:`1ɀ=9/9QPh%hh9j 1^ËL$1Bh:WVt$=ğ9u jG7Wj 螄u1@l:$5:o1ɀ=9/9%QPVWh: =1ɀ=9/9QPVWh9 1^_Vt$V dЉhx9$^WV D$Ph9 u:$nfsu-Vh9h:zZ Vh9h9gZ tWj 蔃1F?t[h9h:hjc%jPu>:c%h9VWh: h9VWh9 1 ^_SWV=ğ9hUȠ9u(h<%Q\u9h9hc%U=> :t ha%˵= 9t hug%赵|$hȟ9hc%hW h"WƅVWPhc%j[h$V[=#9th#9hc%Vy[ hib%jj[Ƞ9uGWPhc%jK[=#9tDh#9h9hɣ9hc%V%[=Ƞ9tChBd%Thȟ9hNd%h9hɣ9hc%VZhib%jZhB#hc%XPhd%jZ f%SWZhrf%WZSWZ=ˡ9thˡ9hf%WcZ hɣ9hf%WPZ =ˡ9tPh9h`Y$W/Z hʢ9h#WZ W2hib%jZh"d%Zuh̠9h/d%nS= 9thed%XShȟ9hyd%FSt V˚j|^_[USWV։ϸjPPO tCËl$hjW ojhȟ9WV WVSՌ S: 1H^_[]USWV$΋$PhU%$u tW$r#V ^l$PSU 9<$u:PVUWh[f%hC1Ʌȁ^_[]ÿWf%fT$L$t$q"u/Átuss$Ãt6u8h6h/u uh%!wP'hhV D$L$FFh\V~ ȃ ^SWVP1ۉSSWSjh' ~t{4$6V1ۅtjSSWPjh'}tEh%V2$ t&|$\$PS׃th%j $ uVXf VKf1ۉ؃^_[USWV6h%'\$|$jSP56 ƅt Eu$wS7eT whB#7U G^_[]WV܎'|$u't%|$ jWQ5 t u1^_ËL$U34USWV1td։σS—PSW赘 t u6P1PhPPj D$PUw. D$t΀8uɃ<$uð1^_[]ËL$U3w4USWVl$\$1}$hmW6StOD$SWPHDWWRt.ljFt(V$'EBh%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQԡ $V1VP 95T9D$40$X@h"P@tt$45H<"?hu3W 5H<!9r T9ɉt$ =1MD$Ni8D$$11t=i8,4:tǍXUS茖N݉|$|$l$$9 :ƀyH1ۉLPTXVUQP  :" .hQPfP VUhX9WP , :L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP :$()1HD,048Ƃ(1 T9<596W:|$c[ 9P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً T9ɋD$L$ӾV W$r#QSPSl$GU  :$H@ VW$r#RPQSD$BP 9t%  :QUHDRhh%P蝼 = :$0@ơ :$p&L$*QUPVWjj:WD$ D$D$ PjvD$ t.-T9L$QP5 : u<5 :h_R$Pdž$l$ :()8 9 :VM9VjP趜 L$ D$@D$9 T9yuƇy$u4P4 44S*$똋D$ :$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$8D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ48El$L$),$|4xfDŽ4DŽ48T4E,$DB8t$ 9zt$D$tj$DxZfDŽDŽ8D4B=ND$?P1D$ +D$D$$|$y+DxXfDŽDŽ8D4B1hPPPPjPPjjR$Pjz4$1K|$$8h"$jW D$Wt$%sD$tvl4u^u3h1PPPPQPPQjt$,$Pj4ÃtCD$WSrD$lxSŁ1H$^_[]1M4$见$<t4u/h誢hPh"V3I  :V31@멃=T9yuT9T9s19dL$w BsÁt1USWVD$$ :*t1G.$ )$Phh%hV ?r%jt(hfMVhh%h% j$ iW%W踢 :$Ph%hV脲 WVhi%蜥 ]hW%Vjj\Q1PP3Aho jl1qt^$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S6t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$ 'hi%D$P7 i%D$i%X3|$0tPhh%hWͰ Whi%D$P ?r%D$i%zh}i%D$P i%D$i%i3|$0tPh#i%hWL D3t#Ph*i%j\$S/ S\$W D3t#Ph1i%j\$S S\$W L3q"t12$r1%tWRh8i%D$ P D3@i%tQi%D$?r%D3|$0tL3tQh^i%hWw Whdi%D$P ws%D$wi%Q|3i%ti%PD$PT i%D$i%!hi%D$P1 i%D$i%D3 $t!t$PQh&%h7t)$j4$UtQtUd3U$ :=T9t$ $QD3$t<|$t4øSZS$PW^$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRhOn%U EtjP* t4$T؁ ^_[]Ê$ h?r%Wy$D$jV_ ù D$jQQPS= S  9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uhin%SSVUh}n%SC$ Pu1Vt$h]n%P4$S$ l$Sh&r#U4 h:UWVjPK1PSG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQ^_[9rwًz89y8rw19HUSWV  :1G*ZƄ$hj%进h"hP$菞Phj%jVC 59t  :QPhj%V] 5hVj%SC :)\$J$WPZx$L$@PQ耢 $d$ PVh D$@Phj%SB D$0PV`Y"D$0L$8L$D$h"P脅w\$D$H$194$h"WQFuށǐW$W迡 SQ;t$$ *h^9tPjjh:j%x_1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#t$r#$j%\$t7ȉL$7 T$wXi%D$ ?r%D$$('$r#$uht$$P&> j%Pt$hj%t=uD7L7qQPh k%u`$$#d%D#t $D$ ws% $T$hW%R^T$ D$L$ 1@D$hEk%RT$i%D$L$ hW%RuD7#t$$D7$r#@ttk%$r#yyk%$r#tk%T$($r#tk%T$ |$$$r#tk%L$,$r#tk%$r#tk% $r#tk%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4hLk%t$D?@غRPhj%t$>ClE;F{Pp\$CPW脞 SMt$0|$4hh褕L$0QjP7. P8WMtVhj%t$y> SvM=9u#D$@9@@h\Pihk%\$ S0>hk%S">hk%S>=9th9hl%S= $ 1|$@VVPWhBn% ;w$r#r#t#Qh"l%S= hOl%ٕhUl%̕h[l%迕=9t hdl%評hkl%蜕1hib%WL=Sb~WI`e^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ 'htl%U- Ueuhi%htl%Ub- U>FjVD1Ktljt$"hl%1G$G?r%G w"Ghl%b1G ${$?r%C(s4C8'hl%81C<{@?r%CDsP$sT'Shtl%U, UstlShl%U{, "U0F$F^ FShl%UG, F'U0F $F$^(F48ihi%htl%U, Utli%Whl%U+ "UB0F$F~ ^Whl%U+ F'U 0F $F$~(^48+4$iƷm۶|$9U91Khj%賙tzhP$臙tiD$hP$Pj記 XWl$UVt$t$]I6NIOu4$=I :Ph"$h 1PP}# :)t5Ph%hU 鋔$ 1$ 91APuDFl9Ɖr: :Ph"$h6 1PP"969ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhbh9m%h-m%hhl%腃L$T$jt$oËL$T$jt$XWV׉κ?r%jujWZh$r#Vh22#蘔 ^_V 91ɾ 9r^^VD$ 9tU@8xtlIuAH1FVVjjhh 90QRx tjh 9j: t 9^À= 9tjh 9j9  9USWV 1WWj9 &iP 6SPj 9 t$ xá`}3D$1/dev4$D$iƋ1N/ u1FSt$$P9/dev uDL$DAt|tER|$$t.jVj8 t `}3L$Nj4$D$/devG4$D$M[1O4$1O1VyE ^_[]USWVPD$tPpP11OFtFhW%PUyt.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T_m%wlm%PhR"h%V ^_[]Vt$D$QPbLt(D$t%t!h2hPQID$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$5:.@ujP =D$1҅D$t 9tL$BuT$ЋT$P]1hPPhO!h#!jjAPjQQhU3w i4WPZw 8CM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h"PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPk;D$1҅ӅtwU(vt\P,40U5t5L${|$P=$tL$ST$Dځ8Nut/$E t$AЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W9ŅjW9{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ .D$$@$;E tL$ A;L$tI1۸hSSh/ShjU>~`^_[]USWVϋ@PD$ P-hFPt$V x1|$T$RtPQL =P91PWt$$t$$7oD$T$1PWt$,t$,o t$t$RPqhn%|$dWa D$,tjPpW, t$ Wt$ , |$F;pRw =D$G e^_[]WV|$ tt$F fG ^_Q^_SWV|$D$XhƋ1ɀxQPVh:7#S<^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6<^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVhym%h:1^_[USWVu 6h%'jVP uh8j}wy jVw) U3OU3Ot 5D$PQ0CG1*QP菂D$,W D$($D$$(D$ ,D$L$40$VRB$$(QVPhm%hSn Zq|8^c|8PG@$QP"B'$HffsWBD$Bjhm%1ۃt$D$hm%hm%WC Vhm%SC Shm%W轘 SD$Ph}Dt$VW6W}V2ۻ$Phm%$8 1ۄ$hm%$hn%PוL$LQh^&P|B t$,04t$jj h$r#RPjV |$LWj`}3r \DZ@uWQVt$hn%ht$ Z 1C}$.1ۿ 9PSWvv t$L^^^F~ FFVhQt$ ? t |$dJSjVv $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj h$r#RPjVJ VSh$ht$ }G8@É؍e^_[] 9=}t'fy"V9 W9NuEt FuXt1€1ɾY9( Ӏu A'w'X9 ' Àu A&r  uȃsƄ\$,04t$jj h$r#RPjV, $PVSh'n%ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj h$r#RPjS W$mPSVh3n%ht$ D -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ hzk%qŊ Y|$hW%u hDžtoh'6htkDŽ$v/rDŽ$/dev,$$VuP" D$/devf@/VuP" Q踃낋E\tu xt@@AED$5:$ttt$PуuN :덬$WPU" t$/devfF/ :WPV! [Se\asla9aO$CQPU! {PWV :$t(tt$Pуt Nj5 :,$1D$0$h@h"P5tt$G :PU ftTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVS $WD$pVC l$ Uh%VV ǰD$h^"Wdh#WdtyhX#Wdtgh$WdtUhj%WqdtCh"W_dt1%D$tn%tD$VPSE VWS: Uh%jU DžED$4$v PS} t"vh"$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=P9SWt$t$H`$1PWt$t$/`|$. e^_[]fL$19bUSWVP\$1ɸR'to'tj'tэ  9R'Ɔ$9Bu14$9B9uT9juX9ju\9ju`9j~ud9jou$h95\9V_Ë-X9U_9w߉5`9V_9w-d9U_9w߉4$Vq_9w1Vh$r#h&o%PP$ l9^_[]}V|V$-#V@1 ȃ|^V|V$#V3$1 ȃ|^V|V$#V1 ȃ|^Ut9p9 u;D$L$A 1RRPhp9jQNCt9p9]SWVh$whw1WW k ƻf$StSuh/o%W#Vk" V+^_[WVt$D$D$PVW@ t$L$QQPhdo%jӚ4$B+ ^_VhCo%j SWVPVjB>u1@G:3s9%VPWSh: wsVPWSh9 1^_[USWV |$ faa@D$L$1C$r#=:thq%j:VrPWhx%h:vD$PUAD$h&959h?t%j訙x:rW!9u:QWh9Vt$D$PWh]t%SR$'D$D$ =mdt2Vh9h: Vh9h9 1$hVSf t$t$t$D$ x9jVV= ~;Ƹ PV;!D$i jQP e9]D$|$h\Ww'o ~#u4hx9h9Cx 21jio9ލ$9Hf@8tJu1SSSSSjSSjjUVjlL4jmoPV>VMktx9Ph9w u`~*=:t!hq%jU1:Pjn)D$WjS>\$tt21ۅ1C؁ļ^_[]ht%ht%h'hs%bUSWV|1ۀ=9t}h9ht%jŕ ue:Wt%%:h9VWSU3 h9VWSh9 VUB#N@1 É؃|^_[]ËD$L$I1@Ã=:thq%j(:Vt$ D$t PmVj=m59Z^USWVPWj<1F?tihX9h:ho%j讔uL:9Wt%o%h9VWSUh:~ h9VWSUh9~ 1^_[]SWVPVj`<>u1@;9o%h9VWSh:} h9VWSh9} 1^_[ù1@t E9It1ùtA/9t 1ùD$/9Au$9ËD$$9SWVhflhy1$hWVFb 㹄W3WSChWWh;Wj65l9WjWPVWXI4SP5;VIJİ^_[USWV|$1i/t\1tW$9tI1r rr2|_0u&1q1ur1ۃ0݃_r @뜃|$tB Z`BB`^_[]USWV|$D$L$BJ 0uQ=h91۾O&-`9B0t#1urF$9tuh99u'Cϸ`99t0$9\9tX90 5d9|$Q-jVPh&o%W"^_[]WV|$t$ Nt tuho%Cko%o%2tW%jjPWV^_USWV|$=:t h9j;WWG9u:l$}QWVhjf%hUz 1PP` ơ:t3Ѓ<PUuu#D$=ueߋ$$$tL :P{jۉt{uho%jz$t]PUho%h[Z$tP :hhSjP2 jP W V jUhp%h VE Ve tP$tT :Uh"$hi jj7ah591@|^_[]Ã=:t=:tUh2p%ju C$91$tX :Vt$hD*%VStV:t 99^t$-9u:USWVt$,VQD$j$t$V,to1\$l$t$GSVhVVj UPo L$Vtu(;D$0s"L$44]QL$|$)L$OGj$W,DžuD$@PPDžj$t$0b,|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$V3 1D$44Un D$44P$D$D$ j$S+Ņm<$t$ >tV\$Sn VGP$|$);\$u ^_[]ht%ht%h hs%kYSV5W31/t.T$ W39u9t $9t q/u^[V1ɍt$QQPVh8p%K y1t1^USWV|$(1$PPWVh8p% $D$(1PPWVh8p% Z$LF1d$Pj%J4$>$'h}d$Ueh~.hht%ehhUdW593D$hjU59FO 'PPqhVjU59&V7Nt PVW WD$ PSt$59N 59*59Sjhu% j D$ PU USh`%c D$(SSWVh8p%# $j- h`%fMuQ1AtCjVr{ u4Vhu%"1ɉtjVN{ uVhu%j) D$(SSWVh8p% u$~hLp%jTȁĐ^_[]1USWVhhWt%9tPjjhgp%(1\ :X :T :P :L :H :W3/u D$8W3ڃ9t$9u@H :Q/uD$/u.X :H :19haj覹 W31@|$>Z$9M L :L$ T :L$j5D<5H<85H< =:thq%j聈:\ :X :6P5H :h{p%jaa:Wj b0D$ttRN1ҋ0t1t /u oBrg$9uƃ$9\ :1$9uAuVD$u,D$ L :D$T :1@$9\ :^/ T :FH :X :QR5L :5\ :5P :Php%h` jj\/_59]139tvhp%hu>h,_t$FVj.~thp%j軆hp%j謆h+q%j蝆1G0909thGq%jfhW%_L$QPu{h`q%_$QPuYD$3$L$3$ t?heq%hq%Mft!hq%jޅhq%hq%a迪1=:thq%j訅:]$1L$VVPQh8p% }t|$ thLp%jTGjS"e^_[]1F]VD$FVj/-F^SWVPD$$hB#hr%{at@Ƌ|$]1Phr%S9 4$WV VBGhib%S^_[USWV-Y3ta1FY3t&U7Jd1tUh"$h] 111Fo u1tjh1@1^_[]Vh_r%]t$hPV hh9V x(9ƀ9hrr%Qj j/P!@nr%d :^SWVh{r%&]9hPVe VLF9K5d : 99PVhx%hWl jWh%4#E/ h~LVRj< 1hhr%WWhLjHj j j jVWW$94ƣ\Z3WP*\Z3V9W6 jjRt$59hr%WV,l h_r% \$WPSM SDSVj jj%R1@^_[UWVj WW0( W |$ hPW j W tZd : 9tV("RWQPhY%hhe^_]1PPj< USWV=9uj5_3 ǣ959u_3P>ƣ9^V=9~GtO99W WC;9t19h-Y 9A Pe9$9$V y))L$H 9Jx .@ SPt$4 D$Ph9=9-_39|uP59 9QjPN P59 9 QjPN -_3D$%=@t=ut-9D d19D8 zet$hW%t$ =9-999P  9D G=9V V+ $$9B 9fJhejQPĄ^_[]VPt$D$ L$ $tt$VPp 9t 4$VPp ^PD$L$ T$$RQP XUSWV$01D$$hr%WL$Ph"$Q hr%WL$Ph"$QӜ hs%WPh"$Q譜 4$ڊP9h$t$ k D$ t$蠊h"P<D$\$t$ hSx tt1h#S蝘 4$0P@P$4V@ u <.=tSh"$t$t t$ hS_x ut$ m?t$a?4$t$ 芾t3h0Ut$FVj$~t$t$Ct$t$&1Ʌ2jQ#D$t P D$t P Wh"$h3CU jj$T59U1N^_[]t$ Y>t$ N>V%11N4$脈t$xt$ t$ 4$ VD$FVjw#F^SWVPD$$hB#hs%Wt@Ƌ|$4T1Ph+s%S 4$WV6 V=hib%S]^_[hKs%hr%Srs%)1ۅtHq"t]q" 1ۅÉ[USWVh#U P D$1Ʌ$l$h#Un ti\$WPS 9s?hhW%S =w%hVS =wjS k t@h#UHn u4$R 1jVj 1Ʌȁ^_[]4$$ 1AVt$Vh<1|TsrLc1f ^Vt$hD*%V=tV9t 99^WVt$ D$wǃr9t\],tSPQj1 V5H<0V590V5H<xV59i5H<;59-5H<59^_WVt$ V! u.>vK0"PVWh{s%hpv3e s%^_WVt$ 0PprPGt$>FFVj F^_SWV=W3/t/t$W3GtPVQ<t /u?É^_[USWVj$t$ 1ۅtKƉ|$\$FUShSSj WV) $Vtu;D$ rj$Vlƅu1؃^_[]VPT$ D$t$4$ VP ^USWVӉϋl$jUtMƅtPt$V S3OVUP tP׃S.V%^_[]VPT$ D$t$4$aVPv ^À=9ua9gq"@ :+t%l:5t%D :D$h:G$` :&q"p:SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP $LL $UT4L$ L8L$T$T@Lƽ$$hVWU4 uD5<w |5L Ku1PPD$P臰 )ƍD$Phd@V% |$D$|PhedAV% Vf$1 GaD$P$,ht%t$VD 1PPV路 $C]su PUhhȺ9t$t.ɺ9CD001 ͺ91 u=Ⱥ9tZF9|4$!ja$,hQ~%$0u EPPP jOh9D$4P  D${O1ɳ$$uƒrL+1Ht$,D04$良t$$,hQ~%u EVPh$P EtE @E w-G$9@  V(؁^_[]1D$L$I@P$9wʀu/9Au$9 $91USWV$$1$hWV= E jShWWh;Wh5l9Wj jPVW$$4SPV%1Ĭ^_[]ËD$1ɋ0t1ur$9A1ËD$1ɋ0t1ur$9A1USWV ։D$ $E1$ " D$$ ,$D$&u%' $E@u%u\u%D$$5u%Ou%uu%F\$$h :M \$\$$&HD$\$$)|$=X9=:=h :$ <$D$D$u%@<$q|$4$D$ h :D$% |$D$ X9D$:D$u%=ğ9u$ByD$1Ƀ |_3\$`Z3C|$D$$$$D\$$({|$!<$D$h :D$`Z3{=|_3$r#|$l$ D$D$u%$kljl$4$1L K=ğ9u $fxD$|$D$$.$$C\$$'|$u1=:=9=h :$ <$D$D$u%r<$t|$4$D$ h :D$%J |$D$ 9D$:D$u%$juLl$ t$<$D$Qx%i$ \$<$D$x%i$ l$4$J > ^_[]Á=]]3ftp]Wf%={]3PFSWV|$ty9GO4VS-tRV t{S599Vh959h^%hSR jSh%4# fG\Z3~"PptVrzVI1^_[ËD$ 9Ɓ9 9fH 9fH1SWVt$99V~)S4:QY F9F9F1^_[ËD$L$01,fSWV1ۉShPS$ tD$$P t Vc:8VO:81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6fu61^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW3V}y 981ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=P91SWt$ t$L$ T$4'D$T$SWt$ t$'D$ ׋9t$ t$(2v%L$\PSWt$t$,t$RPPQN $P91WSt$t$&D$T$WSVt$&É֋=9t$Ht$H迍$PWVSt$t$v%PPPQYN $VD$`Pjhq1@USWV u C(D$|$8hjW]3 wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@Ǿ'|$D$u$'B 'B܏'B؏'QP׾'B@ tu Ǿ('pЋ$+L$L$8L$9ǾX'HQQQQRPRPjD$ tj`}31҉tDH@tӉOGڄu܅tEۋl$0t/t)h$#SD$ L$ tEH/uj#EH@EH`L1^_[]/EHjSP EHHLSWV t$ vDh&M&WSnE 1WSSPPjjh= SFDNHA`1 ^_[ËL$Ahh1USWVL$Ayw%sFH@HthGw%sqFH@HthNw%sWFH@HthZw%s=FH@H thbw%s#FH@H@thjw%s FH@Hhow%s\;T p8Vp,s #oh$r#Uh w%sd{91F( {9FH@LP`,PSUhw%W{9j5P9vv{9j5P9v$v d59RPSUhw%WpT{9FH1@LQwFHpX59PQE|FHp\59Uh'w%FH@`L$Ph&M&jQ< hw+VjP P5959hw%sNV^bRq+~V|$jPWRUvPQd@( m4*WP59hw%sT1hh*P5959hw%sh^_[]Ës=9h*PWUhw%VҋFHP59UUSWVP $1jlv D$~ 1ɋT$RL$QVPL t|$@trL$T$t$(t$t$4t$4$vP|$,|$^1ˋ~1 u5~3|$u&^3\$u|$t|$;>t&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vD$F@ F5:me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|r94$ukGllPwYGX FPv3t~C $i)ىQRP 1D7D77qfD7 D7 r4$~Efn'  V)RQP fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A iOu\$ 9fA |$tAqfAAr 1AA tAfAA A AufAAW) 91jEVVh=hchrjJVjVQPh094C(OL$<@C,SPm{,BD$$4D$+{tR[L11HD$Cu5{t/t*ChW%PuF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0%ƋEp%PVjWOUBƃu4UtU%ƃuEtDjUуƃu:C(C,SPJ{,1s$C$10s$mC$s(!C(1ۅÉ؃^_[]hiv%hTv%hlhv%USWVt$ kFllPvuNj\$FFi )tkllklPRQ ,$kl11CPsNj$ /L$s)RQt$  1/D/D/D/ i{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh- WP1^_USWV :t$ 1$V[/} Vٞ$T$GD$ pjVD$D$ 1ɺ<t$^"t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$L$wA;L$D$4|$HD$0G9GjRWjPy D$1Ex tjSWjPO Ã|$tjTWjP0 jUWjP ۉt$t2t.$L$ PRVSƋ|$Whv%QW t$$|t%L$ PSƋ|$ Whv%Q~W t$St-$L$ PRVƋ|$Whv%QMW t$ "L$ PƋ|$Whv%Q)W t$PSVWP9D$D$] ٹ}$L$ |D$ L$L$<1jPWSRPh`B$j$Pu! t">tt$ Vhv%D$DPuV D$8D$ D$8t$XjVt$(1IQjFj QPS D$89D$ t PV$P |$YtZV.o MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV% )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơP9}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋P91щT$1)΋EM M1WRQPKljT$1Pt$uu0)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$h`B$jVy C `L$rL$DPhv%uL$DPhv%jQ< D$D---D$D$s9CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVhv%PP SVhv%PP VjWaSXP9D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`h`B$j$P t"?tt$ Whv%D$LPO D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t Pg$PWm{{ t|$uuxD$t HL>@D> >jhEV> wE%rhD J$uR1jPPPh5hPj jjj%VjMF4x!t$PW0Va1@^_[]hv%hv%hhv%WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ 'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; ؐ'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh#jSS t$]EfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=,9t@u.1}hGju tEx y%rty%ty%M u@=Uu,>t'D$ L$ :;\M`|ˀuK(Ѓt tu tPjbjWTƍD$(PVm$1 $$QPVxS $VT9$ul$`=u]tP$PS $5fǃU'VTWh"$hy% uQe^_[]SWV0\$@1҉1 F FFF =(9tjP4D$VjRRS0<^_[USWV :(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$hy%jkt1e^]USWV8=(9EM 0~klP1 ËE E8؃lklQSPÇ ߾d' :$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$USWV D$ =l9u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS| F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h~%h~%hehV~%USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]hb\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$|:u @p|:D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$'d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth{A1Ot1L$D1 L$8ɋT$]t"9tjQPx T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(|:u ^n|:D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$ 't$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh{11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQv |$ƄE C ^_[]WVt$ hjPW ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut %1^_[]Ãt ux(tth~ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPVs >uD$ D$iousD$fictO4uQG4 t51ҋ5`}3D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuDk l$(Ph %U#f h"U [Ɖ$Uh%jYu D$Ph.%VFu wXw\w`hR%V/uPwdhi%VuwThz%Vu f1ۍ{aE4('WuWuWh%Vt E< t<uEMPWQWh%Vt$<I%9|2#PVwtC9z1hib%WTtVj D$PD$Pt$\$4Sh€%h%WS 1(^_[]h%hn%hBh%hn%h1h%hn%h h%hn%hh%hn%hhV~%eUSWVhj{{1O1ۍD$ShPS$4iz9+ōF,PhedAUͦ l$$4$0$($<$8у|1҉$$g F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$謱t98t4 .jPL$Quo D 9D$ u D$4$8,$F n$9Љ} 1F$F )ЃF n$,$G9t$0$$hҀ%jP r=t31>t9>u 9>t0uk9uV.V&OVU 01@19$,|;ЃVt$/؁^_[]USWVHD$1PuهRhjx;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^dD'ud FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h%h%jg6h%h%jh(h%h%jih%h%jj h%h%jkhV~%:D$T$ L$DrRQPk ËD$Djt$ P耋 USWVl$j/U芢 1NtbNj\$)CDWPUm uHD/t(t+t!u GF "u^_[USWVPӉ΃=l9ui"sv|$4L$0Rt$`VQW ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=|:u [|:~V19|(1@@89|~@w1A^_[USWVP=:|$(L$111=D'"\$uӀt0t u@tӋ;'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1hD't$(t$(t$(PPt$0' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVDnhhD'h9Š 9k911KjdƃwD'DtGCuޅtH=:PGd:t)1ɀ<t 'AuVt^_[1V :t(:1t ҡ: :F9r:PPt^fUSWVPt$ 1h4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$hx%jQQWRjjh%(,1^_[]USWVhu}WWPHD$T$ :L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv :@u ǀ@>1t$(F F>D$,Vt$<|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP2|$4r!1FD$0P2F;t$4rD$0=0訷D$p藷D$6艷D$vzD$  $r#1ۺL$#PWVSh0RQ t$kPW$r#PShPV  :VL$'Qt$t$t$ t$PPh`g$h$Ǻ :$0Ͷ$ :$p謶Ft$uD$D$\$(1t1D$pT$xPRVу t\$8CfCC<ffC C JCfCCX=:rC fC*C,fG1ۍD$(huSSSSSSSjjWPh貓48P胓@,prt$VWrW膔FuQ1K59mt Pmt$A59mm1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$O ,$T$  D *D$^_[]h%h%hyh%讠USWV$(E]0輬ƋEp謬ljl$E@ t P蓬$r#PWVSjh\1U5P9|$ ww訕w%t$R59RPSQV U5P9w$w rl$459RPSPUN G\$skhSjPD P迹Vc9j!hI%Vmy V$h裫%L$59PRUQż hv$59P%PUS蚼 hKPSD$Phj%hh9o 1҃9Q9A \߉$4PWhd@$j$W* hWh9R Nw@EƆ9 Ft3N$t.1@Ƅ9-H9s Nr,ń9$EBL$ ;QU9Vh|%WQ Vh9WQ h$&İ^_[]USWVX] E81h$r#PPPPh%PPI 9_ vSL$QSWPL t@D$ tWD$8uN 9uhƩ 9D$9H*h$r#Vhe@$Epa+D$8u RPt QPVW҃P91VSt$t$螒D$$VSt$t$腒L$8QRPt$ t$h%EpaD$V9p1h$YQVu WPTtY$UtOwGD$VP>)vVQj PG W@ )Q$YQPO H LCF;puD$VPh"$Epf` e^_[]USWVLt$`T$d\$1*kvs0C41GPjhda3  9u vEL$QVUPL 1hPPhhhj6Pjjt$(SP衅4ōt$ VPqwU腆S_~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 59c_|$.9L$`ʉAfAD$ 1Ƀx fJ1O S _1L^_[]USWVpU t$01^F4jjX1AǾ'D$ǃ@l'SPHD$ $ :L1OًP|T$|$`1 |$0jP4D$DD$ P9|$ 9ϋ$|$1HPPVt$t$WRQjD$ D$PW,1u!hp%VPWhd%j跿1EWhz%jA hW hY%W赘$hPSS> D$PS u"h%WPShd%jA1Eh%还hPW> Whx%j 0l$Sh%h%jt D$K%PV$SPW= h%Vٗd%1PWQU虾hЃ%V踗SPWa= h%V蟗PWd%PUaK%PVPhƒ%UC ahj%VZPhƒ%j ;hσ%薗hPW< hЃ%VPWhd%jڽhJ%ShPW< hK%VՖ1BP$h%V趖Phƒ%jy h߃%hPW6< h%Vtƻ$a3Wh%hU 1tVUhd%juŃ|$tjh+'$Ą ^_[]USWV ։Q 1Ht L$ L$$W 8 $f} r= jh%U0 u&USh%D$P uh{#( W7 Ņu>L$4t&t u$Ut$ t$ h%jt$_LW $ ^_[]USWVՉfD$/D$jh`%:D$5謔t&裔8t虔SPh%hU VSU?: 991j/Uq t5ÍD$9tK9vH8/t@PjB CߍD$ PWQ D$%= h$PW FƄ$/u&踓$QPhx%hU) /h$PUN9 hh`%U69 e=@uWA x*|$VW$P9 9r>ƌ?軌0|$W Wf螌01Ĉ^_[]hU蒉 t}/u }$$tcD$Ui|W^|Ɓ`|$tVhW%U9 9=VWU8 9%|$W6 x(W7̋>1F1S貋0jh*#j SWVύD$ PQ1xVD$)tOjWGx@ljj PW W u $=rɁ uƉĜ^_[USWV h讐ljPhW@jD$48T$y:D$ػ˺e{$L$~D$<P t3$r#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$$r#t$DRQPhv%jV D$ T$Bj5P9QPu$r#tC%t$DQRPhv%jVĝ D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o59t$hx%jt$hVD$XP1WWjjj0賕,P9|$4D$0 :L$QW<W,D$DPV[~ljӍD$DPVx|$߉څu D$$H؋Pٸ"D$<ho%t$w|$,] {t+[1hW%Swt Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#ΊPt$hx%jt$hVD$XP1PPjjj0?,j D$DPV  D$׋D$@t`}3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSWi )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5P9PQ|$ RPh`B$jW蛙 ;9CVDSjP jPPh9. V8@(^_[WVt$ 5H<Q5H< ~$uFjP59F$1O~(1h9QQh!h_ hRjFj WjPv$h9{e4F(x;F,VPOWv(afv$?F(F$~,v$n?F$1^_USWV4ˋA@Pjq$} C{$t%K0 u G lfG lJu,'fG G5G0-G G,.G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPc+{$4^_[]V$j)藆Nv811Fu >tlIut5t.j+ȅj,輅L$PVhϘ%jPQ 'u tEj,j+荅L$jPPQ+ h2#7j*fL$QjPT6 h$j-?t$R59Ph$jFVf j.h,'PVh}%hh9> İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5P9RQmL$RPh$jQŕ G<(\(|(Pu#]j#]L$>PSWhw%j&Q%j5P9SWmL$t$>QRPhv%j&Va $F|(,u)|$hgPh%j(W. <$1e<(Ou*?D(Ltۍt$h趃PWh%t$t(Tt(PPWh$j(Vɔ 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPh%v6;t 4$@;|$|$upd^_[]1؍L$>PWh%j&Q0  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&h脂t$PWh%j(V谓 4$h^VjP lj|$D(dph-PVh%j(W] *USWV :$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá :H1WjHDWWQZơ :$1$  :@u <@TX uDHXT=T9tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W W$r#WRPPQ1ҍD$*W Q$r#QRhQPeD$$W Q$r#Q1Qh0QP=&)ߋ :0D$pL$$QL$.QL$QPt$SPW/  :0uNjpfL$$QL$.QL$QPWSSj'B0 h$0+|$pG$DŽ$$T$0<$tT$@BfBB1ffJ B '1BfJB51B fJ*B,C1=:r~(uB0fB:B D$,fXC]~1K؃^_[]1USWVH :L$1$QD$`x_jS(Ņ~ ^"IuD=T$ ׋D$`B01huVVh!VjjAVjjSUhT4G(WPFw(UU.9w0$CPPs$J)NjT$\C$BCHfJkllPs)ʼnCD$DklL$s)Ɖ)$ى@RQP T$*lklQt$P 1DDD $1D50 D58j D5dtIL$ HL$T$PD=hD$PJSL$`D=4(D$P6D=hD$PL$`1|$DT$\fBA.1NH^_[]ËD$@1ËD$@1ËD$@1ËD$@1ËD$@1USWVxˋuyD$1 |$$B9T$Ju UD$})Ɖߋ] ˉt$w\$_ }}} ދ\$CKT$,9‰|$}+D$,L$D$L$CK CjlP%CtH{hhh'PB =rID$$t?x,u xPtlIu&5:t1IHH Pt$$VW5 :, >|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!8 L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,OhW%D$ P _t5ho%t$ ^u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0H9)ދL9\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$ L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$( L$)։t$ t$A5: 1FhC%h2%h]h%[L$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4S tt<1^_[USWVGD$5:l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1:9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX8AL$D$~@ 1ø11OT$LhuQQQQjj PWWSRh649tBƍ|$WPZ(Vn7x#9}P9k<4LE1UЍe^_[]USWV1:T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=D :t*=:11M<t9\@u 9DDMHEr=@ :tO:D$PP1ipt$1t9 :ut$P9t:,@uލEpr=h:|:J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@:D WVu)y8u.q$t"y8uqxu Hu^h4#h%hm h(%BD$x8u@h4#h%hm h(%BV 9;  :tD:t99t‹9u€:2t :^WV΋$tRtt@ =T9=@ :t$hpj:u@ :=l:t"h8j:u l:=D :t!jHj}:uD :=h:t$hjK|:uh: l|:5:<^::p1ɉ :5:5:=::5:<^::8 :5:5:=::5:<^::H :5:5:=:::5: :::: :88::t5::: : : X9T911E1|$<|$э$$0@hVhlhfhefjRjKVUUPWh%4P9SWW%P9uR :$t?:t6xuh`_GjBt VVb P9 P91H^_[]USWVD$ T$t C@P95:tA$txuPdž$ytƆyjh%觚=h:\$1ɡ|:L$iɐ $|1 $kt 8e 8 8M$Ѓ 8QPh%h$PV =:tAt*GL$xQP1tuƇy1u9y1LPTX) |: $ف89ǀ,ǀ<j\$|SPJ 9"hSP3 9=:t 9 9ǀ:W9WjP: Ft |:rL$AE\$ :t>yu):9tЋ9u:0u1H|$5:,1C1҉T TTCD ?k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D ?$k%h^\$t$uq軾 :t)PhS%h^uK:t(hh%hq^ u,:t(h{%hR^ u :D(Fp=D :11:Pt4:t( L$ 5|:7 878h%ht$)V A hVU |:t$PUh%h;WD$|:ts $|$|$ u^ 0D0<4t|88uL$81ɋT<|Dtsu|$ $D$@¸Ѓ=l:@D$1HD$$D$1i8:$P5:\$ "$x 1ۋWSPQL $($0}U$W7 W|8/tWfDŽ/: $< RtP$PWb t $L|$$t0|$t)$P0t$"9Ǎ$vl$t$؉\$C$;X |$O|$\$@|$5D$tL$4=:,$V PVh%hD$)PQ> 5:.$r#t22#PS5 >tiD$Pt>Sh-%hfT$\$ :$DL$4L$0:0|]t$V}Phƒ%WS :( ( PQVhɋ%WSt$\$ CCa5:.> >,>(>$> D$)Pt>Sh %hTS$$(t$,t$(r 9t P P91`9tWWhV%CUWh%hpv3}@ 9t8Wh%Pe@ 91Ntjhl%PI@ ^_[]1N =p:tt$h%jPuR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$  :V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$a$ytPmptYWtDžtFE tWPV" u WVkjVS E t VPV1HPPS| ƃxP90^_[]h4#h%hm h(%USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4L'jP8 D$$tIWV<VH /11 11$? t1$@$J1$A( 1tiu`$B,\$ D$4h&r#US* 1USSVVjjt$" Sx xL$1^_[]WV|$ 1uOG Pt/1; }ON"h:x 71^_WVt$ F1hWP; dž dž dž$dž(dž,P40^_USWV$h^2t$hPV衾 $$$'D$@{tUh%V USV 8Ouڋ$xhLuhMSPhƈ%V}C(~Ph&r#hV( }hNHC,~Ph&r#hV( }hO#C0~PhЈ%hVu( }hP#VPhƈ%W^_[]USWV$ b3u*11IhuPPPPjj PQQjha3P4 b3Nw'$R($'WP\1N1jWWVVjjhQ lS, T0D$4h&r#QP~' 1PD$PPVVjjU D$Pu x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP  Qkd)QhԈ%Vͮ ^_USWV$h^|$hPWi $$$'{hV VPhƈ%{hWvvPhۈ%W[hXp1~,t[hYS1~0W[hZ6ǃ4V uh^V0FT~Ph^#hW6% sh[[h^1~`{h\vXPh%WF\~PhЈ%hW$ sh]mFd~Ph&r#hW$ sh_HFh~Ph&r#hW$ sh`#Fl~Ph^#hWc$ shaWPhƈ%V/[hb1~pPPWhƈ%S^_[]USWV$@1N R$fT$' 1jWWVVjjhc|Gl=Ol :,1۹dWS<S1,G,10G041jWWVVjjhe] 1`G`gX"h\id jhD$4h&r#QP" 1PD$PPVVjjU D$Pp x1pGp1^_[]1wwVt$F~|F P t1@1FF^SWVT$1ۉZBr 1Bl@Zp舘Qkd)Qh%Vd ^_[Vu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_h%h%hhC% SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$t9uht9s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IP sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW_ 6Pw$$$X'@21^_[Ã!t*Wp1@<QKWPVª rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Ph%Q芐 D$D$uPh %j[t1ۉ؁^_[]E@USWVt$ $=` :$Wh%jP 1t t^_[]Ë p9! ÍD$XWh%Pj1~jDjjtD$$2#Vt$\kVjkD$(KD$T\$`C D$\D$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h#W) ƀ8tt1tCuVL$ D$ j jVp É$qj jVwp t#D$Zj jV`p D$T$C\$ \$D$|$u\$uthh%Sƛ hVS跛 \$E61ۉSt$,j SVo É$ tbD$ ʉ $tQD$ D$tGjhA$t$}VXj tOjhA$VDj tdjhA$V0j te|$ush2#jiD$(kzT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j h'l$}Ui hj蠤$tJ@j`PQT$裙 T$ $B0Z,D$B8D$B4D$Du0|$`t)Ѓt$\P T$uD$DЋL$Ht D$ D$,D$ T$HD$TD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPv<fWW߅uvF^_[;hя%hȏ%hhC% D$phߏ%j iSWV=d95l9t^s3ߥt$#$t$j(PV 4$蝣_u9hsj|$0VPh$jxW WVV &t Ĩ^_h1&h%hhC% USWVσ=d9u h 1t0?t+d9t!-l9E WP tt/|$thh%SՌ !hvS u4$$$$$St$h%j ^_[]SWVD$Qt$Rh %Pj h2#t$Z$jhМ'Pd uWh2#jZ$tAt$h#W 8tjt$2h2#j]Z$ut$補1ۉ؃^_[USWVӉ΋|$|$tBh.%S h5%Sv h;%S` hA%SJ hI%S4 hO%S hV%S \$hˉ#S ǀ?t(+$'WP uE F@j`WV豉 -j(W tj)PӨ t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3h&r#WU WUUjU = H>wѻPD$x0h&r#SU SUUjiU< H=wˉ :DD$H1Ƀ|1M1҉$PVRUk 1Q\$ SRPY 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]áx9tq.x9Vt$ x9u W. x919vFt=Nl:wu1w,:J:^ËD$Hs-s D'.h4#h%hh% Vt$ =x9u-(t;u2L$ rȃsd'$tu?:1 J:\:^WVP|$t$=x9uI-j PV =v1t-h;t 0:t4,:^_Ë $9u։^_-=(6:t$6:ù^-D$1ËL$T$t$ h5.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCShv-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF VhI@-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F Vh[,^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Phf,D$Ph@H,1\$}UM;t;Gs} Sh%q} ~Sh,%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPWo L$D$ T$VQPRt$Vh%h$P $L1QhPjV蚇x`WhydP D$Vh?|$t;jWS} \$;MU}h%h%h h% 1e^_[]RSQ} Shh%RQ/ ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSn )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H,:)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SU֦ @$\Cǃ1:k0hWV D$4WhPW$XZmD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$((tÉ|$UFd#D$0jPUQt$((1 Ⱦu#\$,hPt$  Wnt|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,PX P轢D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjjtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14pFuUpt$D$l$x P tn{ C K$;}sL$4QjSPL t_D$HtW,:)1ɉAw Puu2S"j@jP謮 fdžUS#p1ۉ؁4^_[]hu%ht%hh%诫 USWV4D$L D$PhjiƋl$X\$T|$H,'WU F|11Kn^؃N$F Fdž?džjh>US荠 @džPWtwt%D$ D$D$D$F114^_[]hu%h%hh%蜪 USWVhED$$11@D$|$ t&1ɀ8>@,19QYvPWN D$vP6N 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h%h%hxh%v USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D7154a:50a:58a:D$D$ D$1D$hӓ%WU? pu <8a:e~ft$lt*zD$ƒbtCeubD$벡<D$ ChjVV5<hޓ%!4a:0a:zVhVV5<hq$!D$Vu=o39}4D$$D$l$ t%1PPU D$yUh"$IL$ tHt$(Uh%V h32#6RuRh%fD$0Pt$s #D$8=$$ 4a:0a:jÍt$0ShV u UPVy UjD$0y 4a:0a:Sy h%t$(T1|$PKy h7%1 y hA%vuWjt$"K1St$K4$Ht$<Y%Sh#PP'3t1hO%t$t$J4$t$5Da:5@a:Ha:v3|$tpv3La:&v3t~v3=l$u1HL$(Qhht@P&x PtL$* Pa:t$Buh^%lʼnP}Jyh%Tj0 D$ yht%@$uBL$$4jPI4$t$V6赱6h%j3PhW j O j|$WUt$ x>tq1.SPt$ H yܔ 19u2@a:Da:)u蹔 8t1FVh%1FVSh%V 3t$@D$D$L$D$ L$ D$|$tvD$ PƋT$ уƉǃtωÁtt؉D$ u  8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj UQL$ɋD$tP* V4 P較 h$r#PVhɔ%hpv3s j V jV蛐 jR7 VPr^Ð=b3u ^b3La:@=u1HP 1;b3USWV}uCjhha:B ha:xa:la:|a:pa:a:Xa: \a: da:`a:|$(jWkB 5Xa:5@a:\a:Da:?X+=xa:|a:@1;a:)ω|$$\$ da:95`a:T$s;D$0a:D$(L$, |a:xa:`a:D$da:D$$D$ =Ha:EtQ1$w ww7wwVWVC 7www ww$PWj讐 M$51~~~ ~~$PVj~ 1@F ~~~~WVW?C =Ha:B5fDŽ$ 8a:t$Ph"$hQ 1F4a: 0a:ƒ\$\$xT$T$|l$x̝&ݜ$݄$ l&L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Wh2$QPU Pa:9|ӡ8a:tPL$V L$)΅~DQ4))h$r#Sh'Rh9$QPئ Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4'QPhC$SW_ L$(+ ha:T$,la:NjD$0+pa:x@B‰L$hT$ll$h\$@Da: @a:1F؃D$@5|&|$vqL$`\$dl$`̝&ݜ$ܼ$&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4'RSt$DhP$QP  4a:0a:ȃ||=Da:@a:݄$|=s4;T$D$r(|$$\$ ؍4)hr$؍4)he$QPM ƃ}u 4)h2#QP' ơLa:@=u1H$VQPp e^_[]+Xa: \a:T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$ ùų i)Ǎiɉk<)Ϲ)VRh$QP֢ 0D$4L$8T$ 1ɉJJJ JJQRP變 x$1H0V蕋 0j}脋 0^VD$ B J1rrJVRV6=$^ÐUSWVl$tD$ t|$ 9vE( 71C~7|$1ۋl$tE:ED$4FFPh%jUݡ C9rED$^_[]USWVP|$D$\$1l$ȃ t :t-u GGuZD$OL$`}3DBt1DJt*u?t!tjjU % C1Fu C 1^_[]USWVjt$1Kt.Ƌl$Ut$P V9u 7߉^_[]WVt$ht$ t"t$t$P Vi1H^_Ã|P$ t$L$4T$8P11H|USWV\$ tol$}Wj Q\ t A)WjV\ t:)1ɉ}  t uFt t #t;uu111"~ #t\uAu $ u t QA^_[]Á PhW%t $  USWV}t]M t Cu(1N41CC{uSj{ 1VQSI )re^_[]ÐWVt$ Fv 1Iv NtHN V~tbOtHON t wqEWhENjOtHON  t w?EW6E~u^_%EUSWV$$$$1ɍt$t1G$)ljƉ>umFOKu$t$1VQ$Ppr"u%h8%T҆ 8tȆ 8#u$SjVAZ tGtV $1E48FB$)Ex t$7@[h8%h[%,N h8%h&%7 7h8%hI%eS^_[]$Vj$A3t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhjPEuh%hg%{RÉhPKt4VhjPMEuh%hg%-R1H^_[USWVp $$$!19L$PVW1Hl$Ut ƃUɾ VD$PW] tb$UtM$dt< $dPUl t$jWX tu)$-j4'WUA 1Hp^_[]Ë$j-UP"0 D$L$PjD$L$PjSVt$ t P닆t>PD5džW1ۃ1ۋt9PlDdž- t^[V V" 1u 19^SWVlT$|$$VPC1Nt/ǍD$Pr PSW) t W7l^_[USWVӉjh0jQ ǃt{jjjV~ L$ F[I#t$r#V=1H^_[SWV$uShԕ%h{%EM $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6 8 x 89h%h%LNF G8~ ~u3FVh jv S?uh%hg%3Lt6hWv  t%uh%LPWVu  s V^_[WVp׉$ftPh%h{%K jL$PQWT jjP PjW tnjjW t\PjW~ tHD$|PWV t2Ph jp >u6h%hg%J"h%JW{ h%Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Sbڃs tAt1t% t&%S@ su^_[]USWVt$48`ځ% t0ty@ !ȉف tV @t !ف tVat ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jW_0jWT05^_WVPt$4%@5@u^t8tW%V$%8Vh&j?#45@u`V,2<jP,E u hL%G,dž,sh5%|Gj?3 t1t3u5$0$ $1Ph$%F $ $1PWh %F^_WVt$ h#pG8r4@84^_8t8t uh>%W譬jJ>^_USWVD\$\t$XFtt+NQT$PQhj@Ruh]%FD$n D$SPU69Vt)ǍFxۉ,$t1j@SP% SUh%F SUhr%E 1KNދl$Xue^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uVr'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j$(ǃ,f@K(1ɉHHH HrF>rD&>C5F $Pg w_ǍCWt$P?J ;)QjPr hF%Cu^_[]ËFUSWV |$8t$4l$Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQhĝ%d> SWVt$~ t^_[ËD$|$F @PWDr( ~ t͉^_[gV6uYh%Q肣~PtVAt(t NLt }#t%PV9^WVt$ >~Lxw16tЄuOF$uItV@u h%4=jjAV? u h%=^_vF$ljjVz? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph%;G$C$G>C>>-ك**PWQhB WtHAt[ƃx t Ph\%p;s%KFNtTHNUh|%;n 1On 1OOWt#QWtJV<1V\$ GtIO9tA t1Uh%:@1ۉSSD% 1G|$ ~UVt$$H? { t S^\$ HPtQPV P-<uV[+US?^_[]USWV׉΋A Ph%6:11BU>%tPVVUU1n 6ujn1^_[]USWV $ D$PQhhO t$h̗%h%9$1Ph%91F\$ MbihS$( EuVh"%?9u'l 87t l 8 uF띃tVh"%9D$$ \XPW>&Ƌt8t* SV>uSj$( ҋ>$ 1GOtHONG Pt=56uFGGtIO9tA t3@UUD" g6WQjj.>jV(t0<t$VtSB< t<=VS= h̗%7 ^_[]Vt$N Qt<tv$vLP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/j 7 Vh7%h:7#!7T$1|$`F(f9t(~ tωӍV QPRhK%6ڋL$tf~(^>8u(F*4$QPω ~ tcF D$F*|$ <UWSPωT$ P\$Sh{%6 <PUt$WPSh%5T$ V>t*4$QVf< H^_[]WVt$4rDD$ tN8tCt;D$ jP,  u!h%h%5 j-^_Ã~+ajjj= ̓kh%h%hƘ%5 1m9h %h%hƘ%4 <6Rh.%5@hݘ%h%hƘ%4 111dh%h%hƘ%w4 @+X1BWDPU hݘ%h֘%hƘ%14 11G1=a:a:6u P9W+a:zh%h%hƘ%3 t0S vPh6%44WVP1PPPVCD@PjVlN48@t @ sfyt ‰48WV{K^_USWVP$t8D$ \$9}$w ŋD$4VW tE9u݋D$ 9t9 u~<$h'%Wm1PPt$$ sUVW s W@W;9t>G 1PPt$$ UWD$$ W42D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1G@8u^_[]USWV \$@l$8;hk%W>V .h|%W(V !h%WV D$$D$h%WU |$t$<t$S ǃt1Fl$<4S GF9uW$t$<l$US WUD$P E t=1FߋD$@D$PoS Wt$Uo EE F9t$@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[]_ |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tWMQ tFt$9t$V_Ѓ с u VXV{^USWV$1t$t$($|/xh%W)O hk%WO \$,hVSXY jǃ0ҙ%b31O$$0@4jV9u11@PP$u1Ajj uD$l$(D$ D$D$$d%t%Uhp'P$V?u$duiM)4tQ6uD$ 럍Hv H w?$ģ'<$\w$'D$ %D$[D$ PxGD$%D$2 $d 1@D$D$D$$h5< $hD$%D$D$%1@D$x ˀD$D$FD$9o3t$bS{($h($$p$lo3)$艄$\$,Su1VVVS6$U$PjSA\$h[%2 D$9o3$4$|$0W ?o31VV4Wo6&$$Pjl$|$t\U HrBPt$h~%# t$\$ SgV 8$U $`$d$`$do3T$ QR$4 $$`h{"hY%l$,<$茄D$ t<t,<ulh%d D@Ug uDhn%> LHUL h{% TPUCs D$1DU Vh""4$h{"hh%"D$1Cl$,$bu Uuh{"h%d"D$PU'$tCt)QqtrqpQ#$PDŽ$WU':$t PD $ }$nUqq$VU# U+A$;b3t P%$dP@1uh% !$dt3$Xt'L$jQPs uh{"h%#!$j"$hhv3% $$d ؁^_[]Ë$r,u'o3Qj$4 $u*$`1PQQw $$c@u h%$VUI hؚ%$`5 $d$`$dUh@[jj$=t'Uhd[j$($}h{"h%h{"h%D$L$Ph%U$"h#( R 8th{"h%3$`Q L$aQ 8 S$`$d$dl$,hh,% u!Q 8th,%h{"h;% hhI% u!PQ 8thI%h{"h;%^ U~tUh{"hY%Uh%1k$`r;$d@ щ$`$dUtePh{"h%KD$ Pjh0j,q hS2#yUPhn% U$`$d҃ ց uK$`$dr>1ro3$L$ QPUM W$`$d %r o3$$r#$r#t% t%VQRh0&菋U{\$,1D$WhPiu h4%ShWj$$nuh{"hg%N$u($`r$d$d$`L$$PQS!$"$1l$,~O$4P t x uh%P%$4PF$$9|t$t׃z Ru$dh%P_S[$bh%JhZ*&yD$ L$$$XP蛻UhVj$d$ uh{"hg%p $dh%X$dD$ L$$$XQUhVj$d$W uh{"hg%7S$D$xh{"h%`_h%h{"h!%9h{"h%*h{"h@%h{"h% $O Ph%$`m$8l$,t01 t$VV$ uً$t$VPS VSmD$$b@t S$$1t*1G{ tS!u΋[uً$`<$$r>$1Ʌt z uRl$,<$$l$,<$$u@u0$d@hԜ%PJD$,PB't#%@tD$,Ph&Qj$dWD$0P"0$01~ tVhg0jj$$vSBI WVjh#f%bt*VPuVhB%MWh#f%h#0^_Vt$V0t$pApdr$PhJ%NjjtVhVjdj ^WVPt$D$uPh%h{% jP,E tuIh%h8uM, ,"dž,>wt=D$|$ffN(ffOfujP ȉG_1_F*N>QPS F>)^_[USWV$lt pvh%PWj t=wM$lDA 8th%h"$h$u)h%h%hh% $$l~>1ɀhL QSP ƍl$hUPt$ ͵U41 =wfD @PUhh%W=udh%h6%htI{>tA,$fEC(ffEEK*S>RQP C>4() PR1pČ^_[]ÍF Ph%n tt {>u[[ht h %? ~>t$fF(ffCCN*V>RQPe F>4)mC Ph% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#^? 1HXju V >8t~L$ T$pFhf@H X@fPFM1^_[]h%hk%hGh%hk%hHhL%L8 D$tFL$tt 9Jt >  > 1HBH@M1@h%h%hhL%7 USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;v= 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$h%h%h h(%h%hh9%h%hhL%5 L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]h%hҤ%h|hL%5 D$t L$HH@Lh%h%hhL%4 D$t@Lh%h%hhL%4 11WVD$ t!L$T$t$|$x0p4P8H<1^_h%h%hhL%f4 USWV(l$<\$߾@'1|$ |$|$<$E4t.1FM0 I?r: E4  G9rՉt$@Pj- 1Nt91D$ D$D$D$9E4t$1E0jS4;9 t G;}4r1(^_[]h%hl%hYhL%3 a:tD$ a:Qa:a:WVjPj1tMƃPj0- t/1vN F NN F N$(F(N,FH VL^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t PͦNSv@1F@FDFMF t@PtQPV P؋PtQPV$ PjF uPtQPV, PBF(uFN^_[jt$USWVu-~L =a:t'a:H a:a:N8tv|x| @t,'\$$pv3SVUS Uj ^ f3 s SVW  ^_[]PL$T$ D$$PXUSWV։3 $VhUoJ SV PUh:7#W3 ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXáf3ËD$f3r SWVhS$   1OtFƃ ||t M2 +D$HP f3Ph"$Q]  f3^_[áf3ËD$f3@P f3 SVt$ % hjhb3hpv3f3 s1fà 10 jSP  t1 V1H1@^[_ fVt$tNVV{VcV.jVPVO6v^^SVt$ V1Kt=jhjF t!jhj* 1ۃۉ^[ Vt$t'PSdžtP5dž^靄D$t$t$t$ SWV$hjWd, C jPWE WhiO 1NtF$$T$ !fD$f9t hWhi t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv [/ 7 N/ V1H11Ʌtm $BD<IG9uލ|$$ ^ F>L$jPWVt uF>*PWV! 1T^_[]VD$0tVUjV v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8`VGw}uM ufE O $PJt $jSVPUQt$4Vjt$8]$?=^_[]ËL$1t$VËD$t 0芈 VD$0tVBVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV$) Fjŋ$@V $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP tًv\$~;1$D$0Pt tF9u19D$$"$8ЃD$P1~11TjT$4R4z t GP9|PX~11\jT$4R4? t FX9|XD$ 9D$H$~11LjT$4R4 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$WuVhx%t$ 0|$w$H;D$t$\hjSKlj$w jD$4PVX CG$C D$ jt$ VU3 C yQPD$|PF D$lD$ @D$pUhi$ l$D$m@t$ FGF<<y<$l$D$0P$0 R`~/1djT$4R4 F;`|ӰD$|$0WQe~t$\yWh%e$_w ɺ@r <t5<(<$L$ 1@ut$h%$1@fG(FG>O*VTPRQ $t$6@u<$tW{tmWqG@WfGDGȉGHW~t GPGH$G sW}GLGMO9EVh%W%$7t)|$ jVW w_ jVS r& 1N^_[]j:S t/@1UQhQQj QP> G8mt\& (G8GjSPp O t `}3DPu:pKCu1l$PVhVVj US G0Et=it.u1@1QVhVVj VP <$ O4G4SWV$WjS! F jPS WSh~i tD$Đ^_[USWVP!D a: a: a:a:hר%Fa: a: $<  O+VQP 9v1 LJ\$ I;<j,jU@t ǃD h%Vj,j&Ht ǃL h%'j,jPt ǃT h%t$$Wh'V D$9rh%h%[H$|$ 7D$PWD$t$h#D$P B ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW螖D$u?\$S  J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0WAqD$t|#t3=w&AL$0h%h:7# HD$1D$S0Wq 1ɍD$D$$D$ 01D$ύD$PD$$PD$h#D$P@ ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h$U h%U h_#U $D1)h3%Ua 1Ʌ<$t$V{ H9t- t u!H\Ht$9u1@$D$$<jPSѪ 1Ʌ $1@D$S$@tXtT$@S $1B*$Dt,t($DSo $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$跿 `Dd<t A`Nh%<$Dt&u"t$ $< 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U@' tu;uHUh%D'D$uuUh#t$$t$$PL't$$^_[]USWVt$ t-tQN  8uP5|$t-tQ uPtt*t$1PPU t xTuXTj卆jPW5 $@DtW,Du싾@WXHLtW,Lu싾HW&PTtW,Tu싾PWX\tWg,\u싾XW(V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(o3|$$t)`#L$# $ 1CƋl$ \$18%s%Shp'Pt$ujt$\L$,1VSWPUAjt$\t$ VSWUkU#jt$\t$$VSWUMUjt$\t$(VSWU|$Xj=|$\W Ê@tC< t< u CCu1j h%WY j h%WA jh%W) jhت%W jhѪ%W jhǪ%W jhĪ%W jh%W jh%W Pjh %W 8j h!%Wi ?L$P1T$XPfL$T$t$XVY(1Kj/Vk uD$|$PjP L$r L$rL$T$t$XV'1Kj/V uD$|$P jPP XL$ r  L$ r  |$XDD$Pi4$PTt$X'TCD$P@3|$X D$P$;b3t PB11j|$\W6!ƉD$V茼yjW t>th#f%V V$ǀl@F |$X L$P T$Xj #' D$X |$PjP^ <7h+%h8%OD$Xt$P jP h%|$Xx D$P$<t$Xȱ  $<PU D$PX|$X hΆ#|$\W t$1VWjWWWWP覔 L$P9>t$Xhb% |$X t$1VWhWWWWt$t L$PA 9>t$Xh% |$Xt $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV"$6?mjt$\D$ 0USWVcO jt$\t$$USWVEOjt$\t$(D$Pt$P1t$X#džD$X= 84 j/P 1|$Pt@j/Pw tƍt$X.#t/PF1V #6 |$X t$1VWjWWWWt$t裒 L$P9>t$Xh% L$P ЉT$jt$\# h>%~|$Xq j,|$\W * ƀx 9l$Ps%ƅ |$1WShSjSSt$ty ,9h%T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFuu냃|$X0t$1VWjWWWWt$tؐ L$P9>:t$Xh+% |$XD$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1Vl @jP   L$j ZP< t< lGG|$Xt$P$ft$Xa $h+%|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P&$Ɛjt$\V3u7D$0J| 8Ut$Xhd%011IT$P  =D$P-D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hP fFPfFSfFVfF^fdžƆ D$P f$6l$Ptu|$Xt h%@D$X  y@Uh%D$P |$X D$P D$P D$P |$Xn$6t$Pvih%fl$P@Dil$PPTT*BE$ E|$X.E$$(i1|$Xl$PX$\@D$P` D$P D$P D$P" D$P  D$P D$P u |$X4t$XVڪ@@ $dD |$X|$XG\$PH  @D$P D$P D$P@ D$P |$X$; l$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV|Fu8jt$\t$ USWVbFujt$\t$,USWVHF t$Xh%l$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tV 9]VhM%'D$PG D$P7 D$P ' D$P D$Pƀ D$P@|$Xt$1VWjWWWWt$t^ L$P9>t$Xh%|$Xtut$1VWjWWWWt$t L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$t߈ L$P9>At$Xh%Qh7% %P C t$Xh:%W à \$S螮ƅ|$PPhG%SV(  jvVj/t$\{ AL$1|$P# KD$ɋl$t t OGuh^% N|$XoE1j:W l$t2At$1VUhUUUUQN 9.Mhm% j=W  ED$(@1 t H@Whݩ%+D$Pƀ 1K1t$P # $D$P1t$P D$X.U$ D$L$t$X3d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu `XNul$P(BjRQ Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/U SGJVh%>nT$P   xUh%=D$(h+%J hM%Ɔ <h}% D$Pǀh% 1K$dVh%D1DDD DD.u hE% 1D$(1h$WjhQ%W1xh%Wh)C$Wphh"WZPh%WDJh %W.h[#Wzh:%Wh=#Wh%W hӴ%W> t$ hڴ%W h%V h%Vs h%V] h%VGY h="V1Z h-%VT h&%VE h%V6 h%V' h2%V h̴%V h%V h?%V hH%Vk h#VU Vh%  t KC  t KCWh%Ɔ  xt$P1$ƀhuh%XttC< t< Cuh%0ǃh+%D$,Kǃ%1CƆ 1CL$PTGt$P jW l 륉h%W t-h%W th[%W t hܭ%W t@Ch.&V th%V D$P@ tsFH t t@@1 t H@ttC< t< Cuh%Ƈhh%wsF< < F1$SUjJ tUhO%1C CC"$f8l$1USjxSjSSW~ $D9]$ƃWh.%ttC< t< Cuh֬%Ɔ L$P1S=flF D$PV<  7Ƈh'D$Pǀ 1'S #؄  H@เsƇhD$PǀFt< t< u GGu1L$l$S$ L$1W F 4$VÍD$PSN#CUPA#؃8L$QP.#D$PVSP SL$PT$Xj 6t$PjPja 1Ӄ  (jVtZl$P  h;# 1F؄t  H@h%1K؃<^_[]ù@D$PǀǍ0PVj G whǭ%F -{]< < Ch%G11|Kh@ ыD$* * h+% C{K< t< tC C{< < Cht$1VWjWjDWWSz L$P9>sSh%8l$1S 1K;4$(ƍ|$WPQ FWPD 8UP5 D$P4$VP L$PT$XjCut$PjPFCt+j/Sc tIGC1L$P4 1D$PVSjND u7tb\$1SVhVVVVW{x L$P93tQUh.%tGShO%1F FF@dD$PƀMG=6 @/@(!  t$ %|$(t u$Wh%t$蜽t$1D$( s$t %@uh%j?suh5%ItF1tC< t< CuhE$Wt)Wϓ Åu"=1rWhP%31ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP' t(t$Qk,1҉T(T$T T!h+%S螬IVD$0D$ FD$(F^ t8U ljD$FWUP >)QjP 1FFL$TT$`r|$\s72USWV׉ˋt$$V; >"u y"uIFA $Vj"ct*Ń!9 VSb ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=`}3DWtCT41Fu|$ D$ |$jjD$PD T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v 71M^_[]USWVՉϋRk j=P ,$|$D$ V 1ۉ\$t?t9D$ 1j=S贶 )9uWVSS D$\EuVި4$ڎ t5ƍEjPt$  4DL$hV%UhV%hb% |$$t#4$h tzSRD$h% D$tHTMPR覢hհ%h`%hh% Vt$t#1PPV t@Tt$ V0 ^Vt$t$Ƙ^h~%h%hdh%s SWV1SSQ货 t&WVĤW蔠SSV萧 Džu^_[WV|$ t^ǘ1PPWi tPWyhƅthjV ^_h(%y1h~%h(%huh% D$t L$tHThհ%h0%hh%h0%hh%t Vt$t61tpT^h%h9%hh%? WVt$D$ L$zVPŠ9tV 1^_ËD$HTt1Pt$ hM%h@%hh% USWV\$tF+1PPU t.jVU 9^TuVUV_u^_[]SWV D$4toHTty9|$0uPLjPW腞t<Ƌ\$8PW葢Sh%j W~ VNV ^_[hհ%hh%h hM%hh%hhr%hh%hh% USWVa$c$L$<D$ VPU }W D$]8D$HVPS SVËET%t Etu%P8|$HWt$ |$WPRVh%Q Ą^_[]ÍD$HPt$Vhr%t$ah%h %hhհ%h %hh% USWVu 8Vt h%跨ňjjUM jWU7 Gt ;D$TG9t ;D$TWU'WVurGTL$tIѺ!! tD%WWj03u! 8t 8t h'%ާW߅11SSVg tLWVwWU譙9t!q h%舧WSSV Džu1VD$PVD$ PD^_[]t$ t$ hËT$11;T$ tэ HUSWVӉ΋BTx tt /4u$SGtCP7t1Wl$SVdDžGT;CTuQGt ;CtuFSWnu8GttCtuGKQPNuG8K8QP:&t%SGtr7tCtt-SjJ1 8t h%Wj1u2 8t(h%ե&t%ScSj0uy 8th%菥1ɅtWVFW^_[]ËCT@$u Cx;Gx%Wh԰%hͰ%h;h%| D$t%@<t <u ø /1h%hv%j;h1%9 D$t%@<t <u ø /1h%h%jQh1% D$tBHttu#xðÃxux uxux5 /1h%h%j}h1% D$t>Ht4t uxjh'PR  /1h%h%hh1%7 D$tEHt;tu&xÃxu x uxuxs /1h%h%hh1% USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^ Wo1=u!GB9r1ɍ|$0+ /1NjB1ɉÀthAu_1ۀ=a:uD1FFFF FFGFa:SVrVW_uPa:މ^_[]Åt 1u19[:Rt1h%hɱ%hh1% hձ%hɱ%h'USWVP|$G<t<$ $ l$W)Ã|WhV ۋ|$t(ٸF\$$)؃|PjV 1=a:u+a:W9u!a:+ /1N^_[]h%h%hnh1% SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQO ^_[h/%h(%hh;%h(%hh1% USWV|$t$)Ã|UhVo t(ٸFx)PjV@ ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQaGSKWVPQ* ^_[CPh$WVo 1t߉h&h%h{h %h%h|h1% D$tL$tf Hh%hG%hhp(&hG%hh1% VD$t&L$ t/fqPp QPI H^h%hR%hhp(&hR%hh1%' fV$'Ph^% u^USWVD$t$V81Ij0VQ1|$/ooo WV5't-1C 'I?r    DE9u֋-'t/11C 'I?r   DF9uWt$V 1ɉt$\T$\RVQ2PǀVt 81I $ȃD^_[]WVP|$D$L$ $QPW tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjPѪ tbL$1tHhӲ%h%hM8| /IG?uWG9rD$^_[]h%h%hhf% USWVl$t$|$t1ۅu>t7NL%t a& }#tÉS1ۃ1Ct:tV>tXtSh%t؉8txt@HtPt؉CjV.t.Vt!th%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPV|L 1H^_SWVD$1t^|${t 1NA~0jh%W苾 uW Wr G9rhv3 ^_[USWV |$ 7u ;l$$Ujh%U \$C UPWh%NS$t^DžtnjSW[ z 8th%ho#荙9h%~1HzSlt$h%h:7#R tG11CGt0WJ ؃uh%h,% ?Ņu1 ^_[]Ë$t|$u%tPWh%h% =mQ[PWh%h%辘KUSWVӊB D$ L$$t Wl *QPtNjD$$7@uMh#(k%tQhc%W o Ph%We |$ t$h%W@ {D$ D$h%$UT t$h%U: Ui |(6h%U 1>h%Q h }#$Uٻ 5h%Uû hv%U譻  h a&U藻 hs%U聻 h>%Uk 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Ph%W I4Э'h%W +7$@D$o|$L$ uMD$@tBL$qPShƓ%W"AƓ%D$ E|$tShƓ%W <$tBt88t/SQt"D$pHpDShƓ%WAM|$ tSW3D$ t7t1Ph"$W D$ 0uWݘ Wdǀ|$ WD$(P D$ 4#ti%Ph%W; vKL%t$O&tRhɳ%W AsHhֳ%W 'CPPh%W  s$h%W SmPh%W {Pt;CQt$(stPhhV tVh%WT {xtCxPh%W3 tr7@OǀD$(h`'Pt0ts~ t!V^t&PD$,P9uvhn%Ohn%B1OĨ^_[]D$D$D$h%W t1PPt$0V蚉 tc1PPV臉 9th%h"$W oET Ph"$Wr QjUt$0V9 Ņu1UVWU h>%$V h%V h%V h }#V͵ h a&V践 h%$蛵 tzhv%$胵 i%tn|$"D$<u D$xuT|$t Su@|$"$<u D$xDu'|$ tjSui%4#(4#4#D$ 4#4#ti%Uh*%W Vh3%Wv S,E%tPh>%WP 3E%t= t1tVD%u vuPhN%W ?Q@th\%W|$"D$<uMD$@tBL$q PSh%W0;%D$ S|$"$<D$@LL$qPPSh%Wtl{USWVl$t2E1Ft/׉˃PWh%S tEu11N^_[]USWV\$l$|$ttUPW]m 1tk<.tghT#W tUh$W tCj h%W t/tj.WE tUWe 1t^_[]D=|Vt$ 'Bء v3H v3;0v3hv3j v3H v3 Fut$ v3H v3;0v3hv3j v3H v3 Fsh˴%W Fsh%A Fsh(C$+ F sh" FҴ%ٴ%ߴ%%% %@uwxn%rh<"r]%rR% rG%r<%%r1,%r&fZ#r9%r%QH F sh>%2 F shG% Fth$ Fs hP%  v3H v3~v3H v3 hv3j hv31 ^ù1%TVT$ L$\tX9t(,Nu2l1th9t,Ju^USWV$$VEtg$$QPVhu%h4%ha%US 1N@t+9w');@MQP'At9w :)߉hu%h4%h[%USP ^_[]USWVD$<P a t$ $hˉ#V ]NjD$@HD$?1jh|%W ujhx%W u|$D$4Njt$0tNF tA.t;\$SP莮 D$P1U1HPUUUUSC 9l$u9t[,OuD$,Njt$(\$Sv 9 t-D$P1U1HPUUUUSLC 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ hˉ#Vz Dž4$~y14$oy螻 1H^_[]4$Ny} USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQA t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$Y V L "1H|$0t1rЃ^_[]!  7 USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy`}3DHes`}3DH@O\tx`}3DHX \\$ $2f\\ $$۝$T$$۝$O$sZ/t uP tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1. T$$t4<$t s%|$$u1F 71N^_[]USWV Ί `}3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMEl 1 ^_[]ÿ 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3Va 18c 1H(D$ p%t%L$QSPWV# Ą^_[]USWVt$HD$DD$L$UjSo C@G jPSIW fC $4CCD V$4PP~ UShip& C O*W>RQP~ UShip 蕪 1N^_[]WVPRQiw ~u~uF $%h(%hht%? USWV$l$EE"1ۉ]E E]1SSD$PSjUxt;$tEPW[t&SSD$PVjUUxu-< 8 tW`1HW`1$ÉGx9wt9wkG uZ$T$WuBt$ptehD$ PUv U$a9t U9r 聢 V>`19؁Ĭ^_[]h%{oUSWV(ˋl$uG*SVP tu 1^_[]fD$fx(t1ËL$ D$fx(uD$q V1ËL$ D$fx(u D$C V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS |$jjI`Ƌ$(@h@h%zljFuJ1ۍl$Sh%j Ui h@UKFuCZ 8tǍ\$($PhqB@Wt f<$f|$ jUS6> ShlBWGt txD$PhpBW)t tZ$$VЃuBD$PhfB@vs t(D$FP>F u+ h%^Ft P)V)O1ĸ^_[]USWVt$fFtV)vv v AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ d FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBPr ^USWV L$@T$*@h t$ Vh%U $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@莦ËD$D$ PSCL$QP ؃8L$QPSt$@车9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PUNEL$QP=8L$QP*Ut$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $PkPVhǷ%S1I/ދ$0$4Wj$@U t|$r $,84$GPP$0Vhط%WwSYGPVh%WR$0$4|$WjU $,t|$w1Ћ $ QqPVh%$4$4#]S?PVh%$4轴T$ }ltE$u?ClhPhhWWVh)%$4i{,t=u8C,j@Ph@hWWVh8%$4$$0t1WPC,;r鋆Dt%@1W"C,;Drlth1WC,;lrF $'1|$TPÀsE,$0;rT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$Ph!Vt$$@$@$L0 >}k|$`$0PDL$L$QWh!Pt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$Ph!St$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ VS t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$   V1(^_[]ËL$DtD$L$tPVQ>S D$ƅu SWVD$ L$tT$$w .11t$|$X+9sq "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p @v\F\^VF`t# P?v`mF`^SWVjh0jM 1NǍ\$PSPhW?atrjSjjW*at]jSh@hWatBD$$1ɉ $L$ L$L$D$fD$DtD$jPWW t W^_[USWVt$+VjUAChu,$t#tVhF$Pj@^  r%s%PShv%6|PShJ%I 1Bhd$ ^_[]WV΋tF>rD&@ GTt tB9tt9BTtI䋆tÀ~>r QVh%I ^_ËD$$POL$1Bhd$` SWVt$tgw]Vh{$j @^ w${PSh4%H GLhQ ^_[USWVhuD$D$G$D$GH t-wa9GGGG G _G_1ɉO OG_T$SPwD$@tGH%_0wF SPh%H _0G89+\$8D$<l$8 &|$ D$ fD$l$|$Xl$ D$XG8N PQh#%G w$yw(<PSVh%KGG0GH% w$WyPVh%G G0GHٸ%c1HG8G4 w$yPVh%F 8\$0D$4l$0 &|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( h&|$D$ fD$l$|$Hl$D$HG4N PQhb%xF ?G0D$ D$$l$ h&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu Pxw0PVh%E w$ww0PVh%Et$6u$HujGtGht:?ǹ%tPι%I%GHPuXj<c@O;Au<t ɽ%?u%GH0ts]Sh{$w4Q;Sh+w8P;Sh$,w0Py;C w8w4PhԹ%yD 1HG8G4]@uPD$u>C wiVPh%8D wwhV3uVh%DOhD$L$u2wHS3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;th5%CjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]hW%hM%hh%n SWVt$^ She%'BG0+G8PSh%A VhQj81G?6u]%EHPV Vhf%|? ^_[]WV։h,j")t/L$ PǀcSc tfǀ 1 ,^_ËL$h.VD$tF9tAtIdtI;u D$ th;%P^USWVPt$t1t+l$$# uVjj4^_[] GiP6mVKAtAt;<t5^ w$oPSh%= j1VUjt4/w L.o ow;.GOGO oo_H,$uGdGhSV VU=w-1GG G$^_[]USWVxT$΋}D$t$(HL @r@t‹D$PLih覵 D$ɀT$wȈBBV*QRP@ T$(  D$tz tA<t]<tYD$PPj`D$ 1SPD$XP. 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Ph %9t$*]tVSt$Dj/e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ K ً\$T$ |$D$0 tQL$\$)9C=|$ BRQPC> Ã\$T$L$\$- AW |$ L$\$)9!D$ C<AQWP= Ã\$L$\$T$|$ ‰ʹ ыT$ L$\$)9t$(D$ C+AQVP0= L$t$(Ã\$T$\$ D$0hL$|$0ʋ6D$@@ZD$L$)ȃfPL$ы\$tD$0t,ˋD$L$)ȃf2AL$كt,ˋD$L$)ȃnf3ȉAL$D$L$)ȃDf7t$(1D$ ˋ\$$X\$,\$8u1L$,1C\$4t$\$8\ˉt$(r\$$[L$,1C\$4L$\$8LPL$4\$$u4|$u L$,:t!L$\$ 9L$uC\$ \$,B,;A*ыT$ D$x\$ShP# t|$ tsjPhL$\$|$ PHW PL$|$)9 OGPSQ]: ߃<øHT$|$)9QGD$ $ GfGGPS0ǃT$L$D$ L$DD$8D$D$D@1T$ D$,D$ЉT$ | T$D8 B9rKruڋT$$T$4u+L$$1BT$@t$T$4Tʋt$(r6L$$1BT$@L$T$4LPL$@u|$u$L$$:uT$ D$,@,;D$8F)9D$T$ 2BL$$D$DD$8NjT$ L$AЈAL$AWu"D$)Ѓf9ffz׋\$  T$tQAY uK˃L$)9 GM AQSPJ8 L$D$T$\$ |$fG G|$L$\$T$|$ |$0t>D$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSPl7 ǃL$D$؋L$؋T$B)Á+),PjR` ,L$1OAhT|$ 1|$CD$PjsǃSt$ P6 G D$G D$ GGDCff_f_1ۉT$SfGEh) fGG@D$ffGSf f_ t$WhD$ p\W F Ph%/b ΃]w'6uhZ&V VjjA&1gydA$jD$PVo$ D$D$uD$HwK*PQt$ u)C Pt$h%* ىt$ t$ [u^_[]WVt$ Vt>wwvw k ]WT6ttt9uq@苆t'P{džtPdž1^_UWV}tuPG><r 'u#r G(ftf u  s% u`h ƍG 4$D$,$5&D$\$$}%u(Wh!EVjde^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0jw* u&h4j@`GH%GP_iVjhStSE0, pLJ  twAQ \ BjWhajP[h%hg%7'sY EX>@P, UB( A J*R>RQP -  ]rts4 t*Mq @T$hRQPPV]h%2C>t2Mq M*T$hRPQPV]h%% PjL1wLw w wL$u]rruG XixiF SPh,%F% D$h$PS6ΪNRh%%@u3EpCP t: @ NH M plYh%(%u Vh%%h%v$u3=u1HL$h$QPW t=w:F hZ%PhB%$ wW 1Ƀ8tmF SPh:7#$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQP* hZ%C$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6hL$ <G cSc{ ni;`CLsu%1C &cMScq s$SPVh%! M1C1G G\$"O0)G4)G8uL$YME Ph% A}w s$ RPVhe% WuWVt$ Vh!Ejtht j66t^_USWVt$ ~3E(L$tW9ud G N Qt$(Ph%>W0Edh;%WWNttxV1ɄutZE tS@;FuK_ PPPSh% uWt W+8#4 uE$;FuUhudEh>t ^_[]Ër^tuMEEVF $PE}t\$G$u=EH%j7~ruHWЃ댋Et {WZtstـT$sO$tPЃ8u)ʃAr P N@H@USWV׉΋D$$E t @9u ;M$^ POPSh%L EiP6r$u!}@uHhjjWV Džt jWVjj|$$tD;%EHPVK#8#4 u2j1Vh"jj؃^_[]ËL$hQWVP֋T$D$WPt$ 1Ht<$u 1t ɉ^_ËL$hQSWV1{\t^_[Éjh&Q蟻 C\t4WhRjpuh%hg%QN 8u"5$f3h% Wh%h:7#> 1NcD$T$ PUSWV$$($$$$_\ftPh%h{% ch$USY t'sPUV`t3_\t,Ct$?tF Ph%h:7# V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%h{%  t `jW0 tD$ WV h%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r P:JPVhh%$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@s޾%n1ɋl$ T$Et*u4%& Vh%"!%L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$ J%t$\$SWVStǍF WPhO% WQ} /6uhF%VEiP6ΛVh"uPj EP'uD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S蜈 t$@4$teSPh["Vt$Wh7%t$( ["ۋD$t$0% P;@4$L$ t/PUVt$Wh'%QSPh["t$Wh'%t$$7 $PUt$ WhJ%Q  h%V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EPtUWP +މ^_[]SWV(΋6ulVjj3K AuA jQV_ t=Ht*ub 4$?PVhw% OVD|$ss D$L$ q qQPWV8  >(^_[VD$ PhW% v B1F FFL^L$hkaWËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Ph+% ]%GHPVq^_[WVt$ F Ph%g OhGL^_D$ȅtȰ (1SWV\$C rO> 1H4t${GPhVe: ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0h`'D$(PEdx t]SXƀH|EdH #HL$|$WVrhEd@ D$WPYhF9VD$(PY1VVPB VVP' ƍF8Pbuz3WMhVPz SWWG| WD$(PXjVP ƅuSD$(P臮C$t{tlSWD$|$WP@gFWP3gF8MdQP gXMdQP gVD$(PWS蔭1PPD$,P toVD$(P~xF| uF|FXMdQPfVt$|9tV;UVqT1PPD$,P ƅuC$t$xh`'D$PC1PPVV ƍC D$~dV`Sn8U`?1PP$ 9tC9t?UWd T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$} # PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u&D0 G40 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ uo.L$( Ʌt ѹ )QPh%jW7F ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]h% VD$t:t0t!PtQPV PuVj^WV|$ 1u7jt @1H1N^_USWV $ yr6. t$ $ q>YtiDD$ \$fl$Ӌl$ h%WU_ - 8th%h%t$@s"j@{Dž@7k D>1ɨ1QSV PQFRC F CFKN\$l$ sg ! Fig ! F D$(t8tjVW uʋu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF b( oUSWVD$1tW8tQ\$l$G@tjUP u8u@$Vu4jjt @H h%1^USWV0hjdƅT$PL$LD$H|$D~Ӄ^dNdžu`P VLPVH@FDV@PQ5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUtNj.PUj$s t:NhVRPh%j.Q1 @jPW t&@`F`Nd#h%Vy1F`F`uNd 0^_[]WVt$ 1WWV# t1@WWVL9 1^_USWVD$$t8tb\$(勇tK0tEFPU#t.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]USWVD$t81t7\$t(tEPjSP萕 tmu^_[]SWV|$\$L$Ƌ@t9Xu9x t)jtXx N HF 1h%K1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP_ t&hPt$ h%t$-H1Ƀ H1ËD$1t' t!1Qd(u Q` uSWV|$uuu jPW t$H:u @`PUjPVWTtaQPAHd1IH H$ǀjPj781Fuh%W0J1N^_[11SVt$ ^d؃ FdF`u uhF Ph% F NhQPh% u2 tQd s((th%PI^[USWV |$41G$ujjWT t ^_[]ËsWt׋trNf(@_>t .o*Sh'U" Shĸ'U TD$ 1L$A AAPj@QWj1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU$ U V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS襐 t=m<$hj.PSjl 1T$ JO9zPWE`t.tRD$@D$,$KU5E hUPh;%3 4$ f4$ 1SWVt$\$Gt!PtQPW Pt1jPWtt2jP4%W51VPj4^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPUҎ tKd(1tD$ @`C`|$u%CdtC KhQt$(Ph%C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JSN0t4$ 1H1^_[]SWV\${C KhQPWkƋD$džuC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUy?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPt t u"GPt$,h% GdD$ D$1xG O4SQPt t $tsOdtYG %t%OhQRPh%hWj[u!E 81t; 8t h%Sw$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPwYs t $t8$C O0QPh% OtHO\$u4$FTjPS NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$ D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRhDQj螽D$ t;t$(h% j6Qh%V,e^_[]SWVt$Vjj艽tj11G9quƁjmمuިt?5j6  sh%V+^_[USWV] D$@Cxt$rj.VL$0QjQ |$,wVh%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh%h%e^_[]T$rRQPh*%ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQ t8D$ L$rQPh%h RQh% \Rh%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVP=s L$  uhj/ËD$CNC KFCF CCj.L$vQP! Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph'%T$$RGTD$0Pj $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$hP%<<tj<uŃt$h%|$$HL$Xpx jP$P D$<t$h%|$rst$h%$p΁Vt$ he%t$$C$x|$D$ƀt$h%B1|$t +D$(t$( 4XPjQ Vt$D$`P \$Zt$h%t$ 訾 $A D$PAD$LIL$HD$D% |$uFD$8$u>D$xdt4D$t!t$ut$hp%赺|$$t$L$U@AH|$u D$&D$6D$t0t$ t$<t$0V)j6t$ \$1ɿSQWҰV1QW轰h%t$D$u%D$6j D$@`L@O|$ut$h%몋sLߋD$,9CPut$,t$V.h VGPD$$t$,XGLtbt$,Vt$PY wPD$(À|$$.&D$$h%ø|$$3WQ%t$4q t$h%Etk,΋D$9t ,JutVt$4q t$h%U|$u/j |$u$jt$ut$h%$t$et$4t$t$h%|$$tL$11BL$jSD$(D$$UWV}u WYh|0 ƍG 4$D$,$5&D$\$$~%ԶWh Vjíe^_]WVt$ Vh2WۭVh WĭVh޷W譭^_SWV|$G Ph%聶ujj蛠Ɖ6GF_>tC FPjTt.t+@JAH *RWP tF F^_[h% ^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh%袴L$jQS u h4%$BHJAWh޷jj*G Ph%+Wh޷W iShG%|Yjt7UhjPs@h4%hg%O)h4%=d^_[]USWV׉΋A1PUSͪFVUS跪t!NtHNVJFxUUt$Pt$PtQP P9vL,V#^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUh%! t#@uUh%' S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h"%j봋4$VUho%. WjDu!C 81t9 8t h%QL$o@G WQSRPU踶tDD$GdՃGdD$ j.PUj< t'OQPh%j.V h %ر)h*  WhPj)8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW` uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPw{ Odt Od tY?uŋFuh%Pch%PMt-u~`?w#F0gF PhI%^_[]jt$趾USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPhe%h{% jSWN tD$ SVk he%詯p^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uhw%n PUn!D$C,9r|$t"w 7hw%8 PW8!,Nu^_[]WVt$ tqwgVhj胥1GGG G XGft^_# Vh%h:7#w ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUWh u?u^_[]USWVD$t81t9\$l$tp|tSUV u6u1^_[]1USWV$.FX|$ j.WUjy8 \$wWh%腭$$tXjVWr ÅFD$Pjt$ L$QƋ ulp|$NjSW: tL$9uPWV[ t0 D$ PSh%+ ^_[]h%蟬jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PSh%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh%$ WSh%藫 F PShS%ت t){4t#D$} t*tu VhD% Vh%蔪jjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]E%fع'9t Qf9Au<< <\$H $ܸ'|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh%%oD D$ PD$p Vhp%% D$ PD$p Vh% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPh%wD$`$T$B"pF L$ QPh%P 1Br&$F  $QL$$QPhz%<$tD$x%$l$ |$$ PD$$PVh%蓥D$w 1L$ T$t$QPR SWVPjh0j 1NtKljjSj hPct $jSjj)WGt WF^_[WV jh0jt ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW达D$jPV t?jWj$j)V苺t"$jWh@hViu%hw%螤V.E hw%艤1N ^_SWV\$|$1tD$'1ۃ ʾrft1ۋhDj͍H(H,| t1ۉfǀ<fǀ?WjhP jjW t W G Ph%ߢWhW購 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ Wh%P E]1@EEE,E ]$z t(Vhjj jWh%h:7#t^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$L'D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPShjPh%hg%Ġ$1ۋ6<$tD$D$$t;F SPh,%Ο D$$hPS6V%Ch%6Jh%蘟u3=u1HL$$hQPy? Ã37@$:VL$QRP% \$\$TSjjsl D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Ph%~T$E|$wD藏S GDtL$$SQP _Hbh)%Ğߋ$t|1QhQP芰T$R6#\$sD$1CDCH%-ۅt}u27 8tn- 8tdD$ Ph%h:7#6 FD$ u9H|t;A`t"ftftAdu y  Љe^_[]1ɉH1BPP@ H~ Whc%\ot/Vhj jۓ1Wh%h:7#b vF Ph9%h*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjPwcE <$L$ V諟txEtptk8] 1ɉHH@H HH$7E%$P67!11Ӌ$PR*uLjEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 t%tPV"ELPu4 u<Udž6ttFtu7@t'P;dž ^_[]à Vh%h:7#ٚL$1jSWV|$WhjdtxWhS>WhS'WhSWhSws^_[SWVt${Du ?~ Wh%P 1@1ɉKCCS(C|S KtHd sHdit xt^_[Wh%h:7#k ^_[ønL$xtBL$4SWV|$t$_u~G`ux{ ur 6ugtXuG@Psmt3O Wh{jP迋uh%hg%蟘t|t$WPV6^_[D$T$J P&)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1WoC,$;lrD$Vh%Pq D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P. D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ h+Wt$$t$$t$PD$\0 t0L$ D$ PQh+Vt$$t$$t$PD$\0 D$ L$)1H t$|1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s Y 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP贅G4 w$('   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP  D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUPP D$Ãx3 t 11A9r1Ë71$1 $`'D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ Ph%虐1l$S3qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N (H (H (H (|$ t*G>r!D& D$H<D$@ VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh% D$P4 uOt$ pffBfBpɋ<$tXQlR ڃ p7t$ffBfB<$tD$WVPR螕 ڃ L$t3D$fffBt$tVWRωe ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQP |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHP dtKWUP D=l$_D$ fǀ<萶 1fw ,')h%葃R|$Qh%j W@ D$l$ f9<t1}~ QWh%PEt$sf< fu.Wh%z(Ex(Et(Ep (El6tj!zD$0^_[]USWV΃|$$w Vh%躂1H׋_ 1ۉt$$S1ItU: $]h]d]`\$,Džu\$Sj~ƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh%&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph-%蒀k(UPhG%& ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vha%4},WVh{%Ȁ ^_[]V΋QhjFw1ɉHH@@ @ @$2t h^D Vh%h:7#* ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth3%VtP6jVjj`v-wx9Dth%Vu Vh%<^_É1jVUSWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPhY%Q|1%8WjjVuD$$PjӤ<$w$'8uJq%=ǃ8%8u+%8u%8u x%8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h%} ؋?ut$u {`<$uhs`t$ h%{} 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h%u:fD$D$D$PjUVD$0T$4)̓w!^ t$hd%ufjPD$DP{ D$LȉD$LD$PȋL$LD$P9v) t$Pt$Pt$h%ul$4D$h|tjD$@PUF upmjhD$DPt$<ǀfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h<%]sH t$h%ws|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPh%r wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Ph%rt}u^_[]8V6)^_[]SWV΋y Wh%q 1CCCC CC$t$^_[Wh%h:7#q ^_[Vt$F Ph%q1B^L$$Vt$?N Qh%Po 1B^jL$hWVt'׉΃|jt$RPKt j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV1t:ǀL/艈L/f$HC;,T^_[]SWVt$Vhjg1CC C XCC~ ;u Wh%p Wh&%ot#^_[WhG%h:7#o ^_[ËL$#Vt$Vh#jifF PhJ%o1B^hVt$?N Qh%Prm 1B^2L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh%h{%n tjS0  tD$ WSV h%vn`^_[]ËL$aVt$?N Qh%P?l Vhjd1^L$L$@h2%P1|$L$8jQj*j)5@b<qvu h%a<rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5@b<uy hO%Qa<t+DŽ$j$Pj&j)5@b<guuK1ۃ|$$(f3D$,tD$t3S?Xb<uh%hh%ƣa:a:|$$tF1FFFFF  F)F.N,a:a:9rF t$ƃ|$t.t$L$Aut$h%+(f3D$,|$,tF)F/(f3F a<@;DŽ$jjj5 y h%a<,b<a<0b<a<4b<b<8b<b<fa<'u%j.$Wt$|juj.h"W( WhJ%ܔ j.Wt$,juj.h"W( WhZ%"hj%蟔 hˉ#蒔 Nf%fw ,'Pl a<GNju j.$Pt$ j]h%<h% hˉ# Nf%fw ,'PГ a<F h%Ffff=fh%fPh%FffQPh%D sFPh%, L$$T$ /Ftc|$ umhG%h/% Fz$'hC%t$Ɖt$ t$QRPh%踒 hѐ$Ph%`4 'h#肒 a<F<<%h~%F a<tF%s%P K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( `}3D$0LA $sv%PQz F9uEPh%b hU% hi%h~%E |$ FPh%. 6Ph% |$ "h%h]% h8$hv$L$$ 'j.$Pt$ jF$Q4'h%Th%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"Pf $@D$@|$ Ph$r#hx% t$ 9|$oh%h%؎ D$$$T$ $@WjWhf$8&P菎 Ft h%|  v3H v3~v3H v3 hv3j u )L$|$$t1 q΃j.PL$Qjuj.h"$P! $Phw%迍 |$u"tVh%襍  h%薍  v3H v3~v3H v3 hv3j 蒓 t$GNjL$+{h1%:ih`$+ a<t$Nh͵$ Ntu%8&P 1L$1΄u j, D$H@%xO%-%sVQ蛌 D$9D$t$uKj,裋 hV%v D$4L$:D$tHj,z D$4WPhg%D $D$4D$ uj,K h_%  v3H v3;0v3hv3j)% nv3H v3)h%h`$̋ a<؋ v3Q v3~ v3Qv3 hv3j 赑 a<z|$h ot$dc~)/F1#ty1h%n2td3h% ^ F N t$~WRQPh% \$S2ƅx*Vh%ъ 'h%Š N h%訊 D$@Ph%蒊 ~`1St$2t:j.$WPj6uj.h"W2 WSh%C Sh%3 C9u\$,t$ |$d|$h19wƉ΅hv3oC (Mb<T$p1Ʌu9Q V&jVn  VPhj辀 5 b<h%{ 5tb<h3%h 5b<hM%U b<tPhd%> tb<tI b<9~hy$ 0D$D$L$d$ l& \$$$ v3H v3~v3H v3 hv3j b<Db<tzb<$$b<|-b<0f3b<$\$\$\$ \$$v%5 $hv3A hv3A USWV $$919gՉ $t$ $;8t$hh`%$,f =&GШu+$ ؃?9?)9K9si `}3LA $sv%PQhV =hV$, =GC~ 9r9$$ul&hh`%$,V =wDG$8:$ t-؍L$VSthV$,5 1 ^_[]USWVP։1|$4$u9|.HPh%X %wS$'W )1@1sC9uÅu.Ph%M& t$߉E1 `^_[]USWV4)ȃ'h %诅 :։ϋ ˉ h%膹ˉ $Wf_oUSRQt$Ph%G Gl$j.UPjuj.h"U Uh% Gj.UPjuj.h"U _U߸()|c؉<+<'ueh %0<9#<,uth%褄 '<+ugh % <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5<t$PV;hD$$HL$L$ 1x1PPPWK jh@P^ 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$Ć<D$PVPt L$@D$D$ 1 G|$<$D$=Hf3$TD$j=hS&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hS&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSP SVU |$|$t$ "+Hj=hS&P Ņt$,]d 04$Q"d 0D$$@'߈FHGNm&Þw$T':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N42^ "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H M] dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=؆<u t11jNt܆<1<؆<t Pu1@h32#h%w ؆<1USWV1=<MT$ l$(L$DžD$5؆<hh<规  |$t$#j h<1' D$<h#VS}܆<tUPpM uTWV2}<WV#}t7j L$QP} x#L$9u<;D$ D$uL$us ؆<8 ؆<APQ~ PQ8L  ؆< tuQhh<襃  |$u<1^_[]<<<1Ҋ+~,u"1t$L$t' t" t΅tAL$=<u< t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=<u#<؆<tPI ؆<t ܆<1^<؆<tPoI ؆<VtJT$1Aj<ƃ=<u#<؆<tP%I ؆<t ܆<1^t <t D$<1@1USWV D$,L$(l$$~ )$1H$`t <1A\$9|ωL$ tgp9tX tt$ PdJ t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$<؆<tPH ؆<D$,L$$ ^_[]f11f11Ã=<u /t(<11hhH<PjNt<1L<<t P轂1@h32#h%r <1USWVT$1=L<+\$0L$ D$D$|$(D$5<t$8S l$,D$ D$D$t$j Sv" \$1 h#VxE|$tt$(PH u~#WVgxEWVZxt^j L$QPx xJL$9uAE;D$ D$<u/h#Vxtj L$QPx x L$9t[ <8 <APQ~ PQHG  < tuQt$8S~ E h#VwEth#Vwwwh#Vawah#VKwEHh#V2wE /h#VwE$j:t$ 1@|$ uL<1^_[]WV=<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhhH<h<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=H<u+L<<tPL$9D L$<D$$tˉ01C؃^_[L<<tPC <PPhhH<h<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=H<u+L<<tPL$eC L$<D$$tˉ01C؃^_[t H<t D$H<1@1fUSWV\$l$t$V2C PVWb UC PUWN SC PSW: t$ VB PVW" ^_[]WV t$uRt>DžtA=R<t ^_Épxj Ph" ؀=P<u1F1=Q<tHR 1맋5Lf3P $r#QQh%PփN USWV1ۀ=`<t ؁^_[]Q D$ |$GSSPhT<jW&u T<O d< h<r1Hl<$r#1ۃt2u3hWh% D5\<~ȍQ2w$h'q<PAu p<?$D$-Lf3O h?#L$Qh%PՃr<Pf3@s<Tf3 l<I9@Xf3 l<I9@R<P<Q<t<p<yq<pr<gPf3 l<A9~WHPf3Os<FTf3|t%ƍC!t2)É$)t*ܒ<L$ ܒ<$)PD$p xPh<=r<=t<WjD$hpj Ph"起 5Lf3G $r#QQh,%5Lf3G $r#QQhe%PփE 111{PZDWhVEE ESWV 1L$ |$ ru\95<s(>tGǀ=r<u.;=<rN;=Ȓ<rDX< DžtVjWD =Q<t^UH 1ހ=R<t& ^_[À=P<u1Ffu]pxj Ph"A 뺋5Lf3F $r#QQh%PփjD NUSWV|$4t$0Ë <9s&<9 8Ս1ʅ/<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95<95Ȓ<H_ŋ <!9r؅ x<9s9s_h< 8!9t.M9wI9rE<8! Tf3!9u!=r<=t<X<Rf ʼn9rPVUV  8!!ōD$p <PVL$D$PVt$8<Pt$jUV薳thŋ$L$Ai Qh<=r<=t<u=Q<AE 1=R<tM^_[]t$h<HO=P<1GDu3t몍D$0xhj Ph"  5Lf3>C $r#QQh%Pփ'A 9U7)SjZP)MPjS@ :9/ $)QjZP)PjS|@ tƉ111USWVˡ<!9ta)‹ l<h t u9=,$)<l u=r<OE$)ÍFu\wl׽'xD$X <PWYPWm=r<N Vܒ<5ܒ<w(X' w׽'1É;GsG1B TGHO;Mu9}tAtDEWP5u%E9tt9sMxt MPQ}-E $ut=r<tGV^_[]ÃWU VjZS> vjZv > VjZS|> V t$=R<tt ^É01ɉHHj Ph"= ҋL$SWVȋ<!9t+)֋ l<| u 9t%)D @A Qh<q@D^_[USWV=s<t^_[]þ$r#VVVhK%Lf3Vh2#h"hl%Lf3B#=p<uB#j%=r<ueh&8#=q<u~&RQPhx%Lf3i9&=R<u%"=P<u3#]%=Q<uqL$%=t<u$VRQPLf3Lf3$ T<|$gfff̉ҍ4މ劄1u#GO wһ$r#2#SUWh%T$t$|$f4SUWh%Lf3Lf3$ <Ggfff̉ҍ<߉劄9u#FN wh$r#h2#Vh%T$Lf3$ x<|$gfff̉ҍ4މ劄1u#GO wh$r#h2#Wh%T$Lf3$ <|$gfff̉ҍ4މ劄1u#GO wҸ$r#PPWh%T$Lf3$ Pf3|$gfff̉ҍ4މ劄1u#GO wҾ$r#Vh $Wh%T$VVVh%Lf3USWV΃=Ē<tPt <3!1P`ǡ< <!)ȉ9r1U\`Ē<9tEuótP-h<!1PPjhjUP t(<t<=<=<-<1ۉ^_[]V΃?< ; <v$1u<Ɖ <^USWVP<<< 0trƃhD'PF,=d<=<4$t|n011FEEhT'PـEEC<(9r:5Lf3o; $r#QQh%Pփ=p<X<11<9s[ $,0EEhT'P5s+<C<]ǡ<<(9r<9$sj,Ѓ0EEhT'Px< <s <)ÉE;ǡ<<<(9r$^_[]U8 L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡd<D$<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9|<s$5h<!։Ņ9<v6J Љ  ȉ  F1r{@p9x<sBJ Љ  ȉ  F<< Xf3u%1I#5<!֡< Tf3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU tPU$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=r<t=t<uVj1^_[]VhU3 USWV5<1!-ܒ<t Eܒ<1-<E@;<v@uW-<E@<tE3t,ÉE uUh<'=r<t"=t<t!ܒ<E-ܒ<^_[]VhVjS2 USWVΊ l<T$ T$FD$t$V$D$9Btr$u$…<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S~VS SD$x,t @,KZ <tjNjD$G G< <)ʉWOT1Nt TtWt$-<T$ l<^_[]1USWVȋ5<!) l<L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ<94$1PPh̒< Åk jS̒<Wf SWzܒ<ܒ<;-<r ;-Ȓ<1WWjhj\$SU t\tV9tRSPw uE*4 j@\$S0  -Lf32 h2#Sh%PՃ=p<1lj1<4$9v(< 1QQjPjVQP @wg1=Ē<jUŋ5<!Ɖ)tPUĒ<9tut݉<$/Ȓ<u1]4$D$x Ph̒<YtA<$̒<C 9r09$v+jSV SVܒ<ܒ<uɉD^_[]b/ VT< X<r!1F<u. X<T<F9r^USWVP $1N=<1!׉) l<D$)ot +t=q<;<v|u+HL)͉ll+;<s| ullD +lD;G,$vuWVDGWV;_s_u.G WP=q<u.M,t <-},^_[]jPR 5<^_[]USWV@׉9 <95Ȓ<jS;Ȓ<u >9uPfS;Ȓ<FjWV *1ۡܒ<t  ܒ<8<H@; <v@j<H@ < 3H <HPh̒<<9rWVӫ u=0 j@S0j -Lf3. h2#Sh%PՃ=p<9=<u]ܒ<t  ܒ<6<H@; <v@u,<H@ <t=<p xPh̒<@^_[]9Ē<u)Ē<Ȓ<V, f\f3ø\f3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[áz3wD$t$PXWVL$T$ ‹q~y ;q~ t 1~9 QPnL ^_D$ `}3DAD$ `}3DAD$ `}3DA%D$ `}3DAD$ `}3DAD$ `}3DAD$ `}3DAD$ `}3DA%D$ `}3DA D$ `}3DA@D$ `}3DA%D$ `}3DA%D$ `}3DA@WV1F|$ 4X'W tF u1^_ËD$t w$\'1ËL$1t9t1ҍB|uËL$1t# t|$t`}3LH1H rËD$t `}3DA$H1ËL$tT$At9ut1VD$t$tPt$VI ^D$ X}3DAD$ T}3DAWVD$ $r#$r#tƀ>t4w%+ 0DPWVh<&hpv3oF ^_Ð1|$w L$t9tøf3f|$3H#t$r#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[] 1۾$$T$$IwL$I`q|$ \$߉t`rL'j`PS `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ P% t F;P'tmP'D$t'D$'1FthPt$$V V Ft$N tVD$PS |$ut$`e|$ \$|$u,1F|$uu1;p't$`=u-( 01H^_[]Ël' r ,$'t u‰,$''<$t9rPQt$ 1t/<$t9v]( |fL$%9 (vP}3fL$%9 (vhp3føÃD$L$L$ L$D$Vt$ t$Vhpv3LG hԒ"V><t"' 0kPhe$hpv3B pv3Vj HRV_ ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t% 0 % 1$^ÐWV|$ W4x' tFu1 ^_D$ftL$Q'1USWV$п$$ u Vx  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#; ׇ4$Y(}111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$<L$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$' j F H @(N]_?[\;^r~uFF<<C><% ^q{t|~F~F ;^r~uF<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF<F^9րրw t$rI{i9s <$=`}3]D_\,<$t~uF F<<Au~uF <F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A`}3IDJt"m9~~uF <NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF <F"{u@9s `}3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup `}3DAu f'tf`uW~F=@9t8}@u~uF ~uF <FЉL<$USWV t$ ^h.\u/;nr~uFF<<EMŁ'$~]$'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uF<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF<FωωD$$xt~uF <.n~EFx `}3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s2`}3 DJt"r 9~~uF <N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF <FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! ljX}3TXL$21@u"T}3TXL$1t$1ɅtT$T$1=z3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8u<F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 `}3LAtx T}3uX}3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQA F^_[USWV1y19sC11-`}3D]t#=k)CB9u1Bt=|yuA <Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$L')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' F<FUSWV\$1=z39v1@(ϋF,@jPv(6 t|F(N,QV,fH~<t}X}3Dh z31҃9v1B z3T}3Dh1҃9v)1BuG <G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF<<<^_Ã~uF<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF<F1^_[]É؉D$%'t$t$U u U t/uՃt~uFG롋$USWV 1=z39v413A8 $A,tI X}3L$ T}3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQg o^_[]SWV1G9Qs7ӉjRq tF^~uF <F1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=z3|$ r3GtD$WT$ou]t$S| |$Qo ]GtD$wt$wt$wS9 |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4= L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ Mk ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf `}3>|$u l$`\$\z `}3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" `}3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA `}3D$¿!DQf_֋D$ !DAf|$$_8tV|$u`}3L$ DHuf|$$_u3|$u`}3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ *F ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf `}3>|$u l$`\$\z `}3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" `}3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA `}3D$¿!DQf_֋D$ !DAf|$$_8tV|$u`}3L$ DHuf|$$_u3|$u`}3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$ ,$Ept$8V( MT$\t$Vt$(W|$t$p \$(D$$ŠL$d|$T$ DQ f|$$_"4$l$`|$dtF1L$<)tD$0@D^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$'$M|$$T$ \$l$$1P\$St$ W71Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$@l$$jVPSrK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Us9uËL$@!Ѝ4NG$jVWS9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWSR9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$t V= @wj/V} 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPhh%jPh<`<ø#%Vt$1Ʌ1t э^fVY^T$ܖwsܖ^ÐUSWV[(l$,D$(u1T$|$;D$ T$$75@PW. EPW @PW PW tPWҝ |$D$ tH@PW虝 PW聝 @PWi iPWQ tPW= |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [E$ @$ $ ,1 9r 胼$ t+$ $$ FhPWT $D$ D$jD$$ xfD$4D$dzV /$$ AfAfIӕQPRhW2t$ VPj $D$ $PѾ1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ V艘hPWS j:Wr D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVPgt Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃK, D$ $t1L$ L9s ዄ$ @<C\L$|It$tjhQPR*D$4 2qPh$P$$9s|$$$9s$$[1 $L9s D$HL$H P RQt$ Ph$P$$9sD$42qPh$P蝺${$_9sD$hI$/9s狄$ @2PQh$P$$9s獃%t$Ph$P躹$$ o9sD$ tW2QPh$PR$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ %$$$9sD$dL$HL$PL$pRt$t$t$$h$PD$L$HL$HL$HL$,HL$(HL$$H @ T$0PQt$,t$4t$X < 9u8jj5 t\ P 1 4N 0ǃX ǃƃ\ t 01^_[ÐUSWV[$01\ uut!j/V8c uS\ tƅu: ƍ|$VPQhWz=ry ?h@VCǍD$ jPW 9 D$$WtLD, L$Pjhjjj QD$(Ps Ƌ<$t'Vu D$8 tߖ 8 і L$^_[]ÐSWV[\ u;Pƪ6ƃ\ $tj/Va uA Ɖ獃VPQhW$=r# ?t"\ VP tEFu7hh%@V \ hVPA 9 X jj\ t=jjjw !ƒt"X P!J 1uR 0F 0^_[. 8#uVt׉ ƐS[>[ÐS[t$[ÐUSWV[u }蚔 D$<$茔 t$u$$D$Pj.ut=k<T$JL$|D$x$L$x$PQh$$$Pt$glH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$\1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$ D$@j PW, ۑ 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $ \$ 8u$$>$0։證 D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ<]|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPRNѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6W8G4jjdv6g jjdRPەWPGLjh'v6eg W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$< ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJt9u1^_[ÐUSWV[[L$tEׁܝu$C t+t9u11ՉL$!։1^_[]ÐUSWV[ۖ|$GtB#l$%t$PB<t!G t7t9uӾ^_[]ÐUSWV[ktC#l$ t$P;t!G t7t9uӾ^_[]ÐUSWV[tC#l$ t$Pb;t!G t7t9uӾ^_[]ÐUSWV[Èt$0t$, ǍVP‰t$D$(%D$1퍃ܝD$ <$l$tg|$ !RP:tG t@/t;L$uЃt'D$ t$j…<$uNt$0t><$9tRU PUW >&t1<$W #^_[]fUSWV[Kt$D$hEt'1PV9t%D=u1` u VPjD$@ 8^_[]ÐUSWV[ȓ|$ D$hEt$1PW59t%D5u` ^_[]ËD$@ 40tM7d D$jPt$V ŋD$18t|d r"u##` ug(B"tt$` a{(4$WPjуH WPjSV[Ýt$ v/!v $!V!^[ÐUSWV[XD$,8tD$,1퐐8@ujDHƋ|$(W F$"jUF D$ D$,F>D$Pt$1}nu1ɀ}ouL$D$j=U- tǃ|$D$,t1PU6tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jGŅ8` t 4$Vw1^_[]Í UPjUSWV[å$4$,ga 0(jPU uj:U, (jPU tKt$}/3t$UhV( jVPUP P t$UD$PQ|$ jjWjjV5mt$ jjWPjVl5t$/D$PVǍ*$0VPW  FD$ GL$ !jjQPjRT4tqVUW%  R(_ 0$0X_ 0(k_ 8uj/UBŃt$ $0UW  ^ 0(QPW  111^ 0$0P$4  11,$j$4V$4WjU0PFPWrt$t8HPQl&^ 0($0P$40  1,$D$PU] 0^_[]Í(,$UPVWt1] ('WP$8$8~tVCfffffffS[ËD$D$ $L$T$jjPQjR=2yD$[fffffS[+D$D$ >$L$T$jjPQjR1yD$[ÐS[ˋD$D$ ?$L$T$jjPQjR}1yD$[ÐS[k$L$(jjPQRyD$[fffffYT$Ԟu uԞÐS[t$:kSWV[̊|$Wt$t$ 9r[ ?)WVPjԞ^_[ÐSWV[||$Wt$t$/ 9r1[ ?5)WVPjԞ^_[ÐSV[-t$ ƅul)PjԞ^[ÐSV[t$t$ƅul)PjԞ^[ÐSWV[ì|$Wƅtu)WPjԞ ^_[ÐUSWV[kl$|$UW4ƅttu)UWPjԞ^_[]ÐSWV[|$Wt$ƅtu)WPjԞ ^_[ÐUSWV[ˈl$|$UWt$- tY 0)UWPjԞ^_[]ÐSWV[||$t$Wtƅu*WPjԞ ^_[ÐSVP[<D$L$T$$RQP蚤 ƃu*PjԞ^[ÐSV[t$t$t$Q ƃu*PjԞ^[USWVP[êPt$0t$0t$0t$0t$0jt$4-5 Ɖ׋,$t1JX (&*t$,t$,t$,t$,t$,t$,PjԞ ^_[]ÐUSWVP[*Pt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1W (v*t$,t$,t$,t$,t$,t$,PjԞ ^_[]fXL$"wÍ0ffffffUSWVDXxD$4T$dt$XL$l|$`1ۈ$<uЋT$\l$ht$T$l$D$L$D$D$ D$$D$(D$,D$0|$ L$` tt  %ju %#jo%#jxD$X|$L$t \$4UVWRP \$4UVWjjkm~D$$<$|$ D$81$|$ <,PL$4 !GD$ =u <$fa :u <$FR 8I O3L$8 =u!L$$;L$sD$=D$ L$$L$$HL$ D$$*D$$y|$ ;D$sߋL$L$ D$$ΐO? G<@ fu  $t$T$։t$81 tl$81 u<@* <$&  |$ $O?1ҸGD$ $ t1#T$#t$ b|$0D$$<D$,;D$s L$,D$$D$$;ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$,w|$$T$()9eD$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP;L$s D$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)yD$\$4VRT$$RQPr;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9l$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$Pjje $~D$$|$ $1\$4WRD$$PjjMe $ˋ\$4VRD$$Pjj$e1Ʌl$<릋\$4WRD$$Pjjd~D$$$D$ x@ut$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$PjjbD$$u|$0L$$tB;L$s5T$ >#\$4K L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS[~yjt$t$t$t$t$[fS[NyL$T$ Pt$t$t$[ÐUSWV[y|$$t$|$0t$(aD$ j/U  ,$t|.UPt$ WVt$8IuUlI 8uF]t$ t$Pt$t$@t$E 8*$t8ru)$tVPUt$\1`^_[]D 㐐USWV|[s$l$|hUW3 thD||$|/t`j/W'tQ)ύG=7=w{l$|<|VUPc WVU tNPUT 1tU#D$= u:$$0PU=1tC 1 C O|^_[]ffffS[rD$D$ $L$T$jjPQjRyD$[fffffD$tH8T$ ʉP81øffffffSP[MrD$ L$ $QP2[ÐUSWV[rl$tPm QPtEt$t$Pb Džt,t)M uWUy ^_[]ÉSP[mqD$ tL$T$$RQP' [øSP[-qt$t$u2uD$L$ $QP2 [ÐSVP[pt$t$t$V2 uD$L$ $QPV~ ^[ffUSWV([Èpt$@8Ut$@œVUW 4^_[]ÐUSWV([Hpt$<|$DUt$D艓WUV4^_[]ÐUSWV([p0t$@t$@V1 t |$HUt$H/WUVt (^_[]ÐUSWV([èot$UW^jWV1^_[]ÐUSWV[{E|$t1l$}t'uUWjWWV1^_[]ÐSWVZEttL$pH9@?t;:u1PDQAP|1t$:^Y|Rtqv^_[øSWVZ|DD$txL$pH9@?t;:u1PDQAP|1t(:^Y|Rtqv^_[øfffffXCƀd ÐSWV[üC|$0 2, 2 2x 2 N ` N$ NTd NX N\ N`` Nl4 Nm Nn822,22xG G$`GTGXdG\G`Gl`Gm4GnWG1Ƀ2QP莟G GhWW ^_[ÐUSWV[Al$uPŅh4j1ƋD$L$dž3Ndž2dž2d 3ƃd fFddž2dž3 hw3,V 5VU2@xpu xhdž2jjjjjjV&FjjjjjjVFVbZVPjjjjjjV F tdjPVGVNV% VlGHt 3t VdVK@Z2t Pte2tuc29ʼnu3sVj1^_[]ÐSWV[ì?t$2t Pd2t75c29lju2V"Z3390uV^_[fffUSWV[ ? t$@+@+@+@+@+@+@++ uǃ >ǃ <ǃ ^ǃ vǃ( #ǃ :ǃ 'ǃ #ǃ #ǃ #ǃ, -ǃ$ -ǃ4 _ǃH |ǃ` oǃ( -ǃ0 -ǃL <ǃP >ǃT *ǃX !ǃ\ f2Ot^t8tjtfxh ؋tvQjPW+ 1t QTpQTtQTxT|=u^_[]ÐVY.=1t T$tpqttqtxqt|1=u^ÐUSWVP[<p l$j+IGG(ujjyQPE u0Pjj3xQPej>( j<P j^x jv j# j: j't` j#d j#T j#D j-4 j-$ j_h j|0 jo jp jr@ jyX jz j{ j| j} ǃ( !ǃ +ǃP !ǃ ,ǃx !ǃ -ǃ !ǃ .ǃ %ǃ( 0ǃp %ǃ `ǃ %ǃ aǃ` ǃ fǃ ǃ gǃ %ǃ hǃ &ǃ iǃ %ǃ jǃ( %ǃ kǃP %ǃ lǃx %ǃ mǃ <%ǃ nǃ %ǃ, qǃ #ǃ$ oǃh #ǃ4 sǃ %ǃ8 tǃ $%ǃ< uǃ 4%ǃ@ vǃ ,%ǃD wǃ0 %ǃH xǃ ǃ` ~ǃ #ǃ( pǃ@ #ǃ0 rǃX d"ǃL yǃ e"ǃP zǃ ǃT {ǃ `"ǃX |ǃ ǃ\ }2NthtBt'zxp j ϋtuQjPVph l 꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVX7h l$+4+ع x( PPu^_[]fffffffX/7L$fǀh ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[6t$0[ÐUSWV@[è6|$TED$G8$u!O9OuO9Ou 9u_uWEt Wա|$XE3t:`10KEǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3D/1j ‰PD$<x-.D$8|$AG $tJt PwW' W~"G @t;  8u1E3t%`10EEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u_*E2$t L$Xu$ L$Xt$AsiSV[M30t$t$V tt$Vj^[ÐSV[2t$ t$t$V tt$V^[ÐUSWVL$[ô2|$0D$(T$ 2D$ED$4D$D$h f!tW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃh ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4h ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃh D$4Pjjj 4449)4L$ 4QWPt$4;4}2Dž4t(D$4PVt$ t$ 1|$0fh 4)Ɖ4fǃh ff9t |$ u |$ t)Q)RK* t$VUF @f|$tG&D$@ 4444H44L$ 4QjPt$,e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4fh f1jD$` `4rփփ19‰4 4fh fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4fh f1*Pjj!Q j S[~+t$j[ffS[^+0t$ [ÐUSWV$[(+|$u2t PjP2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(+P谰tjjP/ ,GT'+P膰tjjP GX!2@@xGX GXO <W$` OT d2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V P6D$$<$$u$P HuǐuU P轥D$$鐐<$$u$}P Huǐul$Ut$Vz VȵU迵$|$~"14;>|Vݰ^_[ÐUSWV["fǃ| hu$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$!j T<TV$2@!4tV =wlj<$hVt$ V V 1rNj2Z1퐐T,jj L,LNp9u^_[]Í+PjS[^ 0[ÐUSWV [8 |$ EG8$u%O9OuO9Ou9$uxWO/t Wb`8tUEHAIL$WW9uOO 9L$u-O OQRt$ P8GGMIAG GAE3t4`10|xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R G4$膣=u8 $A @11 $<xD$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a qUR 8uE3 $tԋ`10vL$Eǀ3뤐SV[0t$t$V t V^[ÐSV[t$ t$t$V t Vr^[ÐSWVP[Û$t&T$t$2PWj $^_[ÐUSWVP[81$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[{T$9D$P= 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[Õ1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[D$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9 | f$t|$u!|$t'QL$ )RWlŃuRG @tG 8u=D$3t.`10IrD$ǀ3G @|$tmG  f Hȃ | fftVWa=Vt Hȃ 9 Hȃ f9ufǃ| f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f| D$DhhA Qʃʃ19 f| ^_[]ýG @tB 8u8t$3t)`10oǀ3g 룸+Pjj Q賳 jSWV[L|$WWƃuOG @tD 8u:3t)`102oǀ3^_[ÐUSWV[tt$339}3AP3荞t' 333343;33PQRP! 33t331^_[]ÐUSWV[tt$339}3AP3轝t' 333343;33PQRPQ 33t331^_[]ÐSP[-$tT$ 2Pjj $[ÐX tT$QT1øUSWV[æTAx43fTFT$P`j Z+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhȐto DHDHDHDH uǀD$ FF^_[]øW+Pjj+,7+PjjQX j^u+PjHffffS[0[ÐUSWV[ø|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQuF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|诱t1fF9vʋGPt$wW"W1^_[]ÐSV[=0t$t$V t VN^[ÐSV[t$ t$t$V t V^[ffSWV([ù0Wt$<2WV0^_[ÐSWV([yt$8Wt$@2WVd0^_[ÐSWV([90t$t3t PWV[ø[ÐS[D$t3t PV[ø[ÐS[þt3tPUtJ^[ø[ÐUSWV[{0Ɔ43t)2FttrPVPV,a3tR3~>11;3}:tt3PpT^_[]ÐS[þT$t$t$ [ÐUSWV[È93|$0t$,T$ $u0\MDH@utl$4D$ U 鐐t$ D$PL$ QD$ Px)t$LtL$9D$)<9u AT$)RU[t( $4T$4R7D$0D71^_[]ÐS[Nt3t P[ø[ÐUSWV[8D$ $4VjPjtSʼnt$UdƅtMD$ $t$UD$PVވtT$t$$V V u^_[]ÐUSWV[K|$3t P 3~/11퐐440t0;3|4tܞ3ǃܞwwLJ3j0jm4tW2Ht<@xX3~3P<72@HX3@$4Ƈ31^_[]ÐUSWV[+t$3t P3~/11퐐448s0;3|4os^_[]ÐUSWVXt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([X4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$W 1Ґ$t$V|$(WD$0Pt$$DŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V> $4D$)Džu |$ $tR1VT$ * 4$)tWj V T$L$ (^_[]ÐUSWV`[è14t `΋43t42NzRЃPWVPVHhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<W PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DP0y;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$PƒD$T$3;4}D$PRjQD$PRjQhNj$D(PvD$$L$ ;47&ffffUSWV[ë|$$D$hjjU4 t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ U D^_[]USWV[|$$2t$Ƌl$r:D$0FD$4%uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$U 1^_[]ÐWVYD$T$ t$w4  p@^_fffSWV[<t$VO~~tyы9uv0jv,j9p9p 9pt P}XjVOj1^_[v4>j9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PiffffVXt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[N|$ uT${[ø[ÐS[|$uT$ L$O[ø[ÐS[|$ uT$[ø[ÐS[þ|$uT$ L$[ø[ÐSWV[Ì|$u<t$D$9% ƉM1^_[øSWV[,|$u8t$D$|$% Ɖ81^_[øVX|$ u@1t0QX2#Q@Q@v~8tt$ Q@^ø^ÐV|$u9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZL$1~t$ ~9J$u9r ^ÐUSWV[ûD$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77N1^_[]ÐUSWVP[:t$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux hQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p `912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [أt$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV41 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[}T$L$ Aq D$t$jVPt$ ^[ÐUSWVX8$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQCE;~} K(t$몉SV[]T$L$ Aq D$t$jVPt$ ^[ÐUSWV[l$1t>19)Rju uuu0tPU^_[]ÐUSWV$[øt$D1Sl$HGL$jjt$t$t$t$0R[ÐS[D$~$L$ ~jjjjQP2 [1[ÐUSWV [ø1|$4׉L$hdǀǀǀPvF, $jW$F0|$|$@F4T$l$DL$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV Y(|$4t}\$\$0$Pjt$,IT\$ D$L$ H HD$4;Hϋ@,L$4p F fFV( }![ , fN, 49D$4;H|%T$t$ t$ǃD$4;h}pD$(p|$OoL$AD$$jG, 9;t$u 9l$ ut'9L$D $jUt$t$V$T$BL$( ABAcOPL$Nfɺf|#udt$T$ ։D$8)jVD$ PRPfL$8#|$T$t$ WyL$΋D$ )jPWVW#t$D$@f|$$ut$It$t$8Qp0QjP-ɋ$Kd0PjQQ f~$~gD$@u]D$(t$Fh2u&@9u%$PD$80%;\$6>v t6>vuD$@tt$ t$tNF$jv=D$@$ $0jP Ktdt0$PjQP D$@|D$<@1fl$<΃9T$$u뎐|$ ;l$,0L$|$$t$HT$0;l$ G;|$8NjL$DT$0D$D$,|$@|$L$D$D$,@l$99l$ l$T$ЋL$D9щȉD$ D$AD90 t$$0 0 $Pq|V\$UD BfBD$ALfBt@zAD$Rq|\$|$$uD$D$ KD$D$,T$D$,p;0 u4 D$Pz1r)10 $Ph WA\$ ƀw 0 $PQR\$ D$@0 L$P4 D$T$D$$)ЉD$L|$T$ )։t$,)3|$L D$P@D$t$+t$$D$@H0t$ T$pxpu@t*t!|$ ׋T$t$6;VaHTl$Ut$$Q}f 0UjPG jjjt$V(|$@UjppG jjt$jj@t$ Q fUjPAG |$D$,T$Lt$ )T$T$Ll$T$TI,T$DD$Dt$8t$0l$D|$,D$ ,D$H4;l$$;l$ ;l$D$@, D$L~9|;l$Tl$@D$P9AuqwD$ht2$VP\$t6uw0 $PV\$D$px1ŋG 0 $h QP| \$ ƀ=r{,t$G0 $h WP+ F$h Wt$ P  \$ w0 $PQw D$PGD$H$Qjl$H&D$@, D$H$QjUP\$L$89͋T$HuD$@,T͋D$0;D$+L$8D$0D$H,t1L$|$ t-L$ :$jjQt$Rl$E@$t$ 4b $0$QjPD\$ D$t$ )jjPjt$0oEHVPbxpuDt.t%|$ ׋T$t$6;Vt$ Lt$l$$UQ b 0VjP7C jjjt$W|$@Vjpp C jjUjj@"D$ PQaVjPB |$EFD$0D$,0jjUt$R1D$@ɉl$8tT$|$9zt4؋$PQa0QjPJB |$jjt$(Vjt$HHL$ QP`ϋl$H $0VjPA |$ |$l$$l$|$$@VjA uL$j|$ |$$L$ T$$F0VjPRA |$0t.L$|$$@Vj$A uL$ $jjt$(t$R$0|$ l$E@$Vj@\$ uUjH@ |$ |$t$$t!t$@UjHz@ u@L$ IQjp0_ UjPJ@ jjjjt$|$$0$UjQ@\$ |$0t$t$$@$Uj?\$ uL$ ɋ|$l$y8VjL? D$ t!l$$@VjL? u@L$ IQjp0 ^ VjPT? jjjjt$0@@p10QjP$? T$$jt$RjQ\$HD$ $jjt$t$R_$0|$ l$E@$VjH>\$ uL$L$ T$9Q|$ 0$UjPQ>\$ |$0t$t$$@$UjL>\$ u%,,+PQhrR4 $7 USWV [XjD$41\$t$LL$H\$DT$@|$| PQJ t*NjD$9 t#W $~ 1ɋ$0PjW+ | ^_[]Ë,D$0L$ `;> MIIlttt$ jQh+ j D$uǃ USWV$T$ [ôW D$PBpL$ t$tIT$$`| t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$,Pjt$) ǃ ǃ 11ҋ`D$8| tlj)D$4>$,D$8 $<t$u; } t$Ћl$)$t$@@9 9<$,PjQ0) @x H$L$T$ t$`ՉL$)4/L$T$ 9~L$T$ <$,Pjt$( ǃ D$ ; ;T$ 9<$ to j Pdox) @lt,QjP%( F t3 j Pox) j |j m  ǃ 1;  $,l$*ǃ ;  @@ltWjPV' yA t`j t$Hlt htðuu냹tt u1ÐXN@ xÐUSWV [MAP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21ChD$L$ /jt$[D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVP[IL$9 ft$9|$ 9l2uCUw$-4$t$sk&w&|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVXG2hT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVYE|$xv9{`|iT$t$p"fr"f1l2u@>_w-s y&f>2~w-s q&f ^_[]ÐUSWV[[EL$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZœDL$x?9J\~2D$t$|$ Irftf>vf1^_[S[>Dǃǃ9t% DŽp"DŽt" t 1[ÐUSWV[ûCT$L$l2uI~w-ss&w!&ff ffffǃ>t* f0p"f0r"DŽ0t" t 1^_[]ÐXBh2ÐUSWVP[êBt$ t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[|@l2tu6@t!|$0QjP (!G@f@d^_[ÐX@f@dffSWV[?D$ yOQW~ ;O~ t Q WP/WF^_[ÐSWV[|?|$D$OQW~ ;O~ t Q WP.W^_[ÐSWV[?xWt$W^_[ÐSWV[>|$Wt$lWh^_[fffffffUSWVX>tLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j #xL$d( $ș)l$T$ $L$$$D$wx)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$v7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$H'D$g1fT$t$j xŋd0L$ș)L$4$T$ l$lt$mD$$Յ $$v2x;l$tl$l)"Px‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K 'Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K 'Й~ ƃQWT$H ^_[]ÐSWV[,|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[~,  jt$t$t$P1[ÐSV[=,  jVjt$PJ1^[fSWVP[+|$t t9t QD$PL$QjPW]L$N|$kK)l$kK) 6;6i)`(PUPt;y t0q$t~fuUvu1 q d(^_[]ÐUSWV[(*D$$L$t@1D$D$>D$PL$QjPW\L$kL|$kC)l$kC) +7;+7i? ))PU.t7q tAy$t+nuUwu A)y^_[]USWV[)D$(L$1҄t@1D$D$8>D$D$PL$QjPV}[l$-?L|$ ) i)ʼn) i)kn7{n7lj*SiŠ)Ǎ*PD$Pt1D$H*<tzp t:h$D$t}suPuD$uދ} مt3l$,t+Et$WPuVEЃ^_[]ÐS[~'t$ t$t$ [ÐUSWVH[H't$\4lD$PHND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$U:L$QjPUXL$ȿNt$kK)kK) 636i)`(PU$D$$d(ED$j=UtƉH$$D$<$|$W<L$QjPWWL$Ƚ-?Lt$) i)) i)Kn7sn7Ɖ*SiŠ)ƍ*PWvD$5tcL$f <$|$WL$QjPW>WL$ȽkLt$kC)kC) +73+7i? ))PWtD$E*E!D$)Dqh $$D$gPUmPUUn,PU=FPU%0sPU tc,PUtrg,PUtem,PUtXEPUu^O1<5.' D$UNj$tP 1L$;D$v==wL$L$Qt$OL$uD$ 9D$ tf, UQS,$t'UW@|$BU胰4+1t$ 1 t]|$uf, FM $QP4$~  $LD=uVQVV $4D$ H^_[]1|$t4$ѯ1USWV[!h'WT$L$ $L$\1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG@'M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$? 1Pʋ$H $$$H $<<$Rt$W  /$//$H $>$D$^_[]ÐUSWV]2~:^^t@\|,$n*^ÍxЃs.ÉD$$\D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%\Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[K1l$E<%uEpuEπ r?уstlu~;|$~,|$t릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[ÍL$ T$D$$Pj [ÐUSWVXU$1h ։ͅu4$ u'$hA 5 @0t$E4}0u"$h E, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $=ȉىӉl$ |$uGD$1l$뀋$\DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $>$t"A$|t+H$D+$1$uՋ$1ڃV$t@!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,FRE,}0M4T$$V$0PRQ1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PQP=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$\t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$D1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$f1ۋu0M4A9s E,u,߃$Vu,frE,u0M4tڍqu4 $1$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,BtRE,}0M4$V$0Pt$QE4E,M4},$1^_[]ÐSP[ý T$ D$$1Pj= [ÐS[Î t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[M T$ D$$1Pj [ffffX L$ÐUSWV[ |$(t$ l$uPѓƅ>l$$uj蛹hjtL$tfjVP NjD$uj(P/D$@ x |$(u(-VqE\1F4,9Pk1D$tGuP|$(,x |$(tF|$(m,V|$(-Phht@U薾 t$t$tL$t RB(JtRtP)tjjPv IA(tPtjjPv IA1t^_[]Íx,Pjy=-VSVP[ì T$L$D$tRQPVƋ$t P.^[fUSWV[[ t$|$t$jt0ʼnVUƘ|$T$VŸS-Pt$t~Pt$tkX-Pt$it[^-Pt$RtKd-Pt$;t;k-Pt$$uA1 @VK^_[]ÐUSWV T$L$[ǃ r-P܏Ņt'}/u{L$$ t$  |-P蠏/P,}PVuU|DžjWWWՖtpL$v u\D$ VP$tIT$ L$$ Pt$ 肖V`'uq-1V='-P螎$|$ $~:s1퐐Nt:t됐tÍMwUPWi D, L$$ t$ [tu{PtG-T$ PQhR~)T$ L$$ t$ $-t$ $:uw1퐐Ot:t됐tÍMwUPVi D, L$$ t$ [tu$ $ȁ ^_[]Í{- USWV[l$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%"\$L$ A ZAthhP0+jj!G(hhP|$ Gt\$h(jP|$ "\$jh蒌|$ G9ouG)o\$UD$p莍|$ Go\$UVP蘨 W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP ~ gC C$ދ\$PF$ދ\$P~ F$D$\$jWF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|V=t.)9uUt$VJ t6u0,1(V貾9ſuUt$VkJ ^_[]fffUSWV [xD$48H L$@ 1퐐/t <,tEP\{UWPa .,v3l$4uW賋EED$\$cD$-D$|$j|WtD$4@ T$L$ t017t<,t\$RT$RD$PfztDl$VWQf Ut$PT 1<$WNjt$D$Pl$8u݄EW|$WV WLD$D$D$ Džt$*\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0ȃ\$<u3D$u'\$Ux\$8C k$K($fC K(K(|$T$ t$4-Pd>p1\$91\$-4$諈K\$-PdD$P|D$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ QV ^_[]USWV[ØD$t uy0-|$ 1퐐/t <,tQL$E$PZvt2ƃ$UWP_ 4$t$PK 1^_[]ÐUSWV[|$ t$FN,9vtU6辀uCu;Uut.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[:|$ l$qhPWڹuLt}D$x@ȃǃtVot$ U蔹)Lstƃntfuă뿐1ɋT$z HfD$8l$|$ u)1|$-WuPt$D/WApr-WuPt$D1TL$4xT$$s$tntfuσ1} t WPVO l$ E|$f>t WPV- }t0EfEfF}WuV f},t&E(fE,fF}(Wu V迕 f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[ |$ t$FN,9vtU6xu]uUUmtHnNT$l$f,Ninf|FFWRPǓ ~F 1^_[]ÐSWV[\t$FNy9vtW6FxuCu;WCmt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[l$D\EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1.bGj|U9D$tL$j|Uat L$U=rUPt$P 10^_[]ËD$tP®L$ =r*."D$t+P螮L$=rG.QUPt$T^jjPSutt$ $@ 1D5t <,tFP[kD$4 VUPX D5$(L$tSD$HtJ11t <,tFPj Vt$P D5$h|$t+D$Ht"t$Ga $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0Pn$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p m$D$t$HjjjPjfWjQ.VWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[Ê|$ $ ftGt @1@WG(f hwU#X =wb, Ƅ |)ƋtVPUW 9vD|ŃƋGtVPUW 9s D|ŃE$^_[]ÐSV[Ít$ taviviviv hv$hv,hVh19 uǃ ^[ÐX @ÐY @u0USWV[$(E$$4D$$0j:Wut*jQPp t0V$0W NjE;$^_[]Ãu 1tM ut6(u t0xf$O:t @t@uS4$l$w$D$j@UPU <:t$EF<:uEl$4$D$D$OtuP]P]CǃqbD$O@$$,PQhWj t" ǃtMJjjWPXWP/P]t /j/V蝊t|$uFA$jPRQV'FAT$ $jPRWUQV-/VPjESV[-t$ j:Vfrt*jQP tt$V,1^[ÐVYT$փ1ut^1^USWVH[Øt$dl$`L$\D$Dȃ=u<$yu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:`# D$t$DRL$D`# A @`? t/19<$d# D$D@ @`ƒ?t/91c# D$D@ @`Ń?+t/9b# D$D@ D$@|$`D$?t/;|$  ՋL$a#  <$‹D$Dpe# D$L$ D1 <@4$T$<`Ń?|$_u+t/19QL$ T$D $L @`ʃ?|$_ut/19 l$ D$L(D$<_D$$D @`Ń?+t/19 ՋL$ T$D |$_$D @`ƒ?t/9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0tU/R/;D$(Q,^_[]É<$t$D$x# VRPQT$T$L$ t$ ?3t/|$D/? t/D/ ?t/D/D$t//T$T$L$ t$ ?3t/D/? t/D/ ?t/D/D$t/D/D$L$ < t/L/ ?t/L/ t/D/D/ `# <$<$5USWV[$D$$  ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# Hy3y4t2tkƷ< sԃ1@tt# tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# Iy|$| t!qtAD>1tBD>׹@# HyD,|t.tkŷ< s݃1@tt# tр‍ ` 1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# Iy|$| t!qtAD>1tBD>׸@# HyD|$t=2t$Fi%I<<fw1@tt# tlj瀍 ;` 1ttD~t# z  fABy w~4ABy w~4ABy w~4ABy w~4ABy w~4Ay wʼn41 @tt# tlj瀍 ;` 1ttD~t1z$Qy$A# y$B# $u1 @tt# tlj瀍 ;` 1ttD~t⍃z# 0pQPQPQu# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فpzр3ʉрUɀʈǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ΀# D$# D$x# D$t# D$p# D$l#  ʋD$h# ыD$d# D$`# D$\#  D$X# D$T# D$P# D$L#  D$H# D$D# D$@# ʋD$<# D$8# D$4#  D$0# D$,# D$(# ΋D$$# D$ # D$#  ω D$# ɋD$# ? ? ։? T$ځ` $T$ 1# u# E# Qu# ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  ` d J΃  ` d J΃  ` d J΃  ` d J΃  ` d J΃  ` d J΃  ` d J΃  ` d q[ 4$l$T$ L$ Ń4` x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]s$USWV(]ŘD$<X%UUUUʁUUUՍ4P᪪` d x   x ` d x   x ` d x   x ` d UUUU $؃` d x   x ` d x   x ` d x   x ` d T$H l$ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $yX $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3` 3` 3` 3` 3<$t$3~3` 3` 3` 3` 3` 3` 3` 3` 3` 3` 3` 3` 1#t$t$D$|$811t$3=` $3=` $3=` $3=` $3=` t$$3=` $$1L$t$|$l$3l>l$|$l$ 3` 3` D$35` 35` 35` 35` 3` 3` 3` 3` D$t$D$D$$7֋T$ Bl$l$l$$xl$ ` d $x   x ` d $x   x ` d $x   x =` =d $x   x ` d ȃx   x ` d x   x `! d! x ! ! x 5`" 5d" x " " D$@P1(^_[]ÐS[D$1ɐȊt tT Tt t t4 uP1[ÐSV[jD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[`MD$$D$DD$@D$9\$6D$L$T$@jjPQjROqD$HPj =ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jPֺ$jPĺD$0Pjl\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjlt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]USWVd[5$|D$<$`# hjD$@P DŽ$@D$V$@8$u H$@D$.0$@UV<ljD$Pgt;uHd/WPCil/WP+iuD$[/WP iD$UVɘljD$[4jPW!h D$,u:|$$@PW#x$@L$,UVoD$l$0t$\$UVOD$ D$D$ D$$$@&D$ \$UVtt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DW"D$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V11$xUc$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-/PQR3_h$DUt$@VF j jW hjU hj$P D$@hjP D$<;$`u`d^_[]D$RW_D$t.T$@PQhR}l$ $[fffffSV[}D$ h`rƉPG)Ɖ^[ÐUSWV[8l$0/jD$PUc thh`) $)D$j PU $l$1}$K1D=t<$t h`tt$,aō/% 4$t$L$QWPjbVD% L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃/t$ Wt$t$Pjbt$(Vև% % %  % jQPR ;% % %  % jQP ;% % %  % jQP ;& % %  % jQP ;& % %  % jQP ;& % %  % jQPS ; & % %  % jQP  Ƅ;& jjt$( ^_[]fffffUSWVD[h|$\w 1o2t$`tD$@jPVd NjD$@9t8tnD^_[]n8"u tr'D$D$ D$D$D$<D$8wD$X$2a$/WQjPY0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ D$ fƍ$t4$$UD$  jVD$& l' $$ $ jQP l' l' $$ $ jQPk l' l' $$ $ jQP. l' l' $$ $ jQP l' l' $$ $ jQP l' l' $jQP l' Hl' @jjV D$;$uD$^_[]fffffUSWV[õ$ $$D$$AO$WiVUWQj W$$l$ UkD$\6666D$`6666D$d6666D$h6666D$l6666D$p6666D$t6666D$x6666D$|6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$|6666D$x6666D$t6666D$p6666D$l6666D$h6666D$d6666D$`6666D$\6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\t{E6L$\4\D$tdF$tB$ڹD 0D \0D D 0D ]0D  u$t D 0D \0D $V gD$\j@PVig $$VRg VWhVfD$j@PV/g jWV#g VWihD$;$u ^_[]fffUSWVP[|$l$t.jPUu Ƌ$9t8t"R1^_[]R8"u t7ސUSWVPXzL$ |$t$Q̓t2$1ې?t/9u)ދ$r`?t/?t/V ?t/V?t/V^_[]ÐUSWVPXL$ |$t$Q̓t2$1ې?009u)ދ$r`?00?00V ?00V?00V^_[]fVYT$ t$tt1ut q0^Åt0^Åty0^Íl/^Í[/^Íd/^ÐUSWV,[ht$@VcL$DV,~09rЍ,1V8T$$V(T$l$ D$D$|$F4D$L$ 9v|$VWuW$u WVf 1,^_[]ÐUSWVH[Ø~l$|BUƋD$h4$l$D$D$lD$ D$pD$D$tD$D$\D$D$D$ D$$D$(D$`D$,D$dD$0D$4$D$<D$@D$DD$8$PctUV |~D$xt UVP! $tL$tA$D$PW$5t!UV W$  UV 1V H^_[]ÐS[}jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$8@4[ÐS[|jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐS[~|jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[.|jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$8R4[ÐS[{jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[Î{jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[8{l$hU<ƉD$ D$P.ljD$VD$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$D$ tKWV(tD(1t$ t$  U T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[xyt$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[Þxjt$t$t$@[ÐS[nxjt$t$t$[ÐS[>xjt$t$t$[ÐS[xjt$ [ÐS[wjt$ h[ÐS[wjt$ H[ÐUSWV[èwt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[vt$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[ut$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXuL$Q##wÍG4ÐUSWV [t|$(l$$t$ D$45D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[>tD$ hPt$@A [ÐS[tht$t$1 [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[}sD$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[ØGD$pML$LjPt$lv D$h|$df$D$V0L$)L$D$PVWKD$ |$$v=D$t$.D$lp8L$ QjjVj V|$)cƃPD$2PL$Q ? $ $$m=|$D$lp,t$ jjt$>V VU|$)Ƌ $PD$2PL$Qk  $ $,t=D$D$lp(t$ jjt$>V V|$)Ƌ $PD$2PL$Q rg $ $,p=D$D$lp0t$ jjt$>V$ V{|$)v#Ƌ $PD$2PL$Q sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7JL$R)уtuÐWVt$  r!̐cw^_fffffSWV[@t$|$G@hjP  Tj@PW g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[>$$N$@r8hUtE\EXETEP$t$tAsE@hjPT  Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV  h$$VkLhVU< hV1;$u Ą^_[] USWV [(=l$(16t$ %T$$NP NT  ()`N`L$$WRP ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP$ 1 ^_[]ÐUSWV_Ǿ;$hRP RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$ЍL$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ WC hj$P  g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV4 D$hWD$$hPD$;$xu D$e^_[]lffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[)|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[+(D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[K'D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]%$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$n54L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$I5$FQ? T$‰ً$|$D$G<uD$ $4 $+u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4踾L$ |$ )t$)t$$t$,)wD$ L$?? n4 T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4E BT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍4FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N 5FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$QC l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj 4&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B j4Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?ፅFGPGX FGTG\GG?$L$u aD?4FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  6FL$Q? 5FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$5$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v't5D$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$5~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=+/5$FL$Q?P$4$NL$Q?D$T$ ߋ t$/5$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $sUSWV[æiE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRPv )t]D$)WPu8_ }43M(U,E4E09w)RVP. E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[Üt$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[+L$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU  F4n0)Pv8U 1tN0^_[]ÐUSWV[Ût$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[xL$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RRT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$4L$@D$?? u)D$(5L$(5É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+hT$D$tq01t ^_Átփ*tUSWV _xL$ y y$q9NQǃ8|$L|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[Xl$$t} t}$t }t9/t ^_[]ËGHǃ80D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPآ )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[|$$ $w9>~NQǃ8wHl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw sw o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw u o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw r o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQar F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw r o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQqL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw p o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw o o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw n o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw `n o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq l $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq j $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$X$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv X n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv DX n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv W n on)n)ouGGD$8xt1$^_[]ÐUSWVXH$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu S } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu S } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu Q } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu Q } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XϪtÐUSWV^ƨL$4t;T$8\$0Ӄs3I͉у1&Ӊi913tƒT$4zR13tƒT$4zR13tƒl$4M1ʉ3txT$  1ϋL$ 3tÃ1ؐ\=13t\=13t9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3t3t3.t3t $3Qt3t3t3t $3At3t3t3tD$ $3A t3t3t3t|$D$ $3At3t3tЉ3t|$|$ $L$l$11D$D$33t3t3t3t3W13t3t3t3t3G13t3t3tȋT$3t3W 1‰3t3t3t\$3t3_1ˋT$ )3t3t3tÉ3tϐÉ13tW13tW13tW13tW13tW13tW1Љ3tO13tRЃ^_[]ÐS[^t$t$t$ [ÐUSWVX($D$$tz \$׃vND$t$t1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVXH$D$$tz \$׃vND$t$t1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPXj$T$tfǃvEt $t1ف 1υt1Mu밸^_[]ÐUSWVPXڢ$T$tfǃvEt $t1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[Þt$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffXFÐUÐXT$J r (ù)ы(ÐS[~D$D$ P[ÐS[Nt$ *[ffX/L$ P $ d, | 0 x8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_ǛT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P<L$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXxD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$tPP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +8)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +`)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[lzt$舰ƅt|$7VC;G K ^_[ÐSV[zt$ 9tt$P:F1J J^[ÐUSWV[yt$tLƋ|$$l$ $P:D$PWU, 1uRJ(Vu 7J(^_[]ÐUSWV[;y|$GtE/D(U8]wU*t#V轡=yarau D$0VcI1^_[]ÐUSWV[ûx|$GtE/D(U\wUt#V==tcidu D$0V;I1^_[]ÐUSWV[;xL$A1t3)D(U6\NjD$pU$t D$8H0^_[]ÐUSWV[wl$M1tMuD1V[uVt(WZ=yarauD$8eH W1^_[]ÐUSWV[kwl$M1tMuD1Ve[uVWt(W=tciduD$8G W苝1^_[]ÐSWV[vPt$ t$ * t6D$t7<$D8WZt$WtD$ 01{GrG^_[SWV[yvPt$ t$ ) tFD$tP<$D8W`Zt$WQt,V=yarauD$ 01"FV聜F^_[ÐSWV[uPt$ t$ ( tFD$tP<$D8WYt$Wt,VD=tciduD$ 01"KFV9F^_[ÐS[>uL$T$ jt$t$ [ÐUSWV[uQ%Ƌl$$P5D$PUW' tgVbD$tz<$D8WXt$WtH|$$t@V<9t7V6EE 43E8Vu 댅t D$ 01E^_[]ÐS[tL$T$ htcidt$t$ [ffSV[st$t$u_Pz=tciduL$1=tcid^[ÐUSWV[Ëst$t$#_P(=loobul$VEloob^_[]ÐSVP[,sD$Pt&Pt$t$` D$VrD$1^[ÐSVP[rt$t$Vt$t$` D$V.D$1^[ÐSV[Írt$t$t$!^VP8^[ÐSV[]rt$t$t$]VP9^[ÐSV[-rt$t$t$]VPg9^[ÐSV[qt$t$t$]VP9^[ÐSV[qt$t$t$a]VP':^[ÐSV[Ýqt$t$t$1]VP7:^[ÐSV[mqt$t$t$]VP:^[ÐSV[=qt$t$t$\VP:^[ÐSV[ qt$t$t$\VPW;^[ÐSV[pt$t$t$q\VP;^[ÐSV[ípt$t$t$A\VP;^[ÐSV[}pt$t$t$\VP<^[ÐSV[Mpt$t$t$[VPw<^[ÐSV[pt$t$t$[VP<^[ÐSV[ot$t$t$[VP<^[ÐSV[ýot$t$t$Q[VP<^[ÐSV[Íot$t$t$![VP=^[ÐSV[]ot$t$t$ZVPg=^[ÐSV[-ot$t$t$ZVP=^[ÐSV[nt$t$t$ZVP=^[ÐSVP[nD$QP0t&Pt$t$\ D$V D$1^[ÐSVP[lnD$QPp0t&Pt$t$)\ D$V謔D$1^[ÐSVP[ nD$QP0t&Pt$t$[ D$VMD$1^[ÐSVP[ìmD$QP/t&Pt$t$j[ D$VD$1^[ÐSVP[Lmt$t$T/t&Pt$t$ [ D$V萓D$1^[ÐSVP[lD$QP.t&Pt$t$Z D$V-D$1^[ÐSVP[ÌlD$QP.t&Pt$t$IZ D$V̒D$1^[ÐSVP[,lD$QP0.t&Pt$t$Y D$VlD$1^[ÐSVP[kD$QP-t&Pt$t$Y D$V D$1^[ÐSVP[lkt$t$t-t&Pt$t$-Y D$V谑D$1^[ÐSVP[ kD$jP.t&Pt$t$X D$VPD$1^[ÐSVP[ìjD$jPd.t&Pt$t$mX D$VD$1^[ÐSVP[Ljjt$.t&Pt$t$X D$V蒐D$1^[ÐSVP[ijt$-t&Pt$t$W D$VBD$1^[ÐSVP[ìit$t$d-t&Pt$t$mW D$VD$1^[ÐSVP[Lijt$-t&Pt$t$W D$V蒏D$1^[ÐSVP[hD$jP,t&Pt$t$V D$V@D$1^[ÐSVP[ÜhD$jPT,t&Pt$t$]V D$VD$1^[ÐSVP[D$t$x t4hjWV0m tUVjt WV4n1PVo^_[]ÐSV[=>L$T$ 9t9r 1;q u4r0ЅtItRP1^[ffUS[=EM L$$D$e[]ÐUSWV [Ö=\PQ8' WI' l$UVtPcW ^_[]Ét$Wj BthʼnPUc|$GEOM,$EVÀW|$Wt(PcV蝀4$[p1l,$UW9uVMr8_88PQhMRUS[e<EM L$$D$e[]ÐUS[%<EM L$$D$^e[]ÐUS[;EM L$$D$e[]ÐSV[í;t$ 1t9u Va^[ËD$@$ÐWVYm;T$ 1t 9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZ¾:L$1t91t^1^ËAQ^ÐVZ~:L$1t91t^1^ËAQ^ÐVZ>:L$1t91t^1^ËAQ^ÐVZ9L$1t91t^1^ËAQ^ÐSVPY9D$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY,9D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY8D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY 8D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y7D$t9u@H@ty1ËT$ BÐSVPY<7D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY6D$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY6D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY5D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y4D$t9u@H@ty1ËT$ BÐSVPY4D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY<4D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY3D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVYM3D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX2T$t9uBJBuy1ËT$JÐSVY2D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPYL2D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY1D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY=1D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX0T$t9uBJBuy1ËT$JÐS[Þ0D$t9u L$ t9t1[QP:Y[ÐVY^0D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY0D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY/D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVYn/D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [/u t1D$D$ D$~N~(DN+t 0tV-usD$WPv.$ T$ D$1ɿ9T8"yxu2D$j\D$WPv# T$ D$D$9T$rF8"u<WD$Pv T$ D$!Ѓu 8"ttjPVl tu L$e^_[]ÐS[n-' jPq' PQϻ1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[M,D$0' VPVϺ1^[ÐUSWV [,t$4NswD$8t8@tlr@uppQj WjUVUZ tWVgWt UVY[1 ^_[]Í8|88PQhRWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[*\PQq' Pn[ÐS[þ*' Pn[fD$w sÐS[n*D$ ;D$uPt$t$w [1[ÐUSWV[(*D$ t$tP D$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋$L$qD$ tL$9QWP~u 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋ H vHN1 =tP w싔Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]ÍF9,98PQhRUSWV ]h'D$ \$$p1}<"$N<\u< $1ۃރSTl$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋ(Hptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍr9W98PQhRUSWV0[5#$Du wj0&11<o<$ou}u $hD$(P Y|$,D$D$@@@@ @@<$GHws 琐HOP} wP$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUW%Xt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUyWu҉p9D$9D$Ews 搐<<}jt$W tfjt$W tS9jPW E $AEtLt@<-Eu<-u}>u$h\t u94$ڭ10^_[]Ët$t[$NjH<w sO9t1V\ED$"} D$,$t$UND$m$hō9D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VuTD$0D$ jP^F,F0F4F8F<^[ÐUSWV[Ùt3Pj^tjj@葖DžuUOj@v1t=lPWH>GjPZ]o,w0G4G8G<1^_[]ÐL$WUSWV[t$1l9nU]N4 Džtbl$~4<$tC1퐐F,t1t$$U. ^_[]Í==9PQhRiS[Pt$ [ÐS[jt$t$d; [ÐS[ÞPt$ [ÐUSWV[kt$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPj-D$(Ct(w:a:9PQhjRQZGPLWE1^_[]É.%:a:9PQhhR@a:9PQhyR:a:9PQhRS[L$A4tPQ4I,Dt*Pq,[Í;:9PQhR-::9PQhRUSWV,[ØD$@xl$DuVJ}4tS|$(jWl$HU4 tjU3tlD$D9(t9$VJ$,VnJPt$D54^_[]jj͌tt$ At$DVL$*L$ql$$9.|$F=9PQh1RffUSWV[+j?zƅt]l$PV"FF Ft0UztUt$P  ~n V8"1^_[]ÐUSWVP[Úl$|$D$D$jyƅt61T$T$u͉ǍPVS!F~n ^_[]ÐUSWVP[l$|$D$D$jyƅt61T$T$u͉ǍPV F~n ^_[]ÐUSWV[ÛD$1t&|$tWxt>WUP蠞 jzxDžt!PWN Gwo 1^_[]ÐUSWV[l$19}EuBM1tDm $t: $Uwt^Ut$D$P U;1$D$jwt"WP$ED$E E^_[]ÐZOL$1t 9tËA ÐZL$1t 9tËAÐSV[T$ t19 uL$t r ;t$v1^[ËR1ttVRQ ᐐUSWVP[ÊD$1t 9t ^_[]ËHh t( $tDUpvt؉Ut$Pv ątv>g>%>PQhRl>g>%>PQhRMZL$1t 9tËAÐS[îD$t9u L$ t9t1[QPJ [ÐSV[mL$ t 9t1^[ËT$19Q ut$tRVqC ֐USWV [t$(>t~(t  ^_[]ËFY_jQvPgt҃~$tD$jPv  ʼn$u ~8"tD$N N$9u8"t=>>%>PQhR1jPj N,$Uft7ǍFPD$PU tcD$;$uZujPV tD|$u W薄1,$jtƅt-PVF~n WYt WGD$$0USWV$[Åy11T$G=w ⍋jAPQ踙 u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5%>PQjtR SV[ÝL$t$ 9t8V 1;Q u.FtRqP6= 1uyu"^[Í?>%>PQhR臺8?>%>PQhRhffffSV[PQ6|$ u( ' V^[ÐSV[ít$ 1t 9u V^[YD$t 9t1ÀxÐYOD$t 9t1ÀxÐS[D$t 9u L$ t9t1[QP[ÐSWV[t$~uo~(ti jPvv=t' !jPvvt1( |$PQ&5V7^_[Í??`?PQhR蓸SV[- ' VPƃ' ( VPƃ( 1^[Ð1ÐS[D$L$ yt,jPB2F,F0F4F8F<^_[ÐUSWVP[t3Pjttrj@jDžuUD{Wj@j1tE,$LUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[|$1tvL9uloUP1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[*։ $|$?uwG8]u<GcjjWb tCjPwwt,t1%jjPUt$t1U^_[]ÍBB@PQhRRpS[lPt$ 賾[ÐS[jt$t$t [ÐS[îlPt$ [ÐUSWV[{t$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%@@@PQjmROQoGP=&W}o1^_[]É.@@@PQjkR@@@PQj|RS[~D$H4tH4[ÍlAQA@PQhR衪USWV[8D$,hUt$0~Wp%~4tR,$ljUt$4V tjV2tLD$090t9$W %$W%lPt$0\ ^_[]jjngt#|$AD$0t$PL$T$rL$9Al$ F9(u:G@D$PP[ÐSV[t$ vVc^[fffSWV[t$NtFt\V9wqu QP]tFVL$z~ ^_[1tD[DDPQj9RԞD[DDPQj:R踞D[DDPQj;R蜞SWV[,t$t$|$PWtu^_[ÐUSWV [t$ F|$$IE$/wbg\tbwtRt$jD$P<D$tml$PVVEu:t nfrj\V&PVL<;~)<j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ð􍃕8DDPQhRUSWV[t$~ t 1j Vt ;~ r^_[ÐSWV[ì|$t$t0t*PVtuj Vm^_[1SWV[Lt$F|$uLPVujVm1^_[Í8DDPQh$R蓚SWV[,t$F|$uEPVtiu]jV}1^_[Í8EDPQhER裙USWV[;t$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Í8+EDPQhdR3USWVP[D$1ɅQh Dt$7jK1Ƀ#hK$GGG wtHt$WՃj W=tjW$$D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[Èt$@|$[fffffS[nt$t$jt$t$t$>[fS[>t$t$jt$t$t$>[fYXZQ̀QQr鰍S[t$t$t$t$[ffffS[μt$t$t$= [ffffffS[Þ1;D$[ÐS[n1;D$I[S[N88t jq1[ÐS[88t jA1[ÐS[88t j1[ÐS[þ88t j1[ÐS[Î88t j豊1[ÐS[^88t j聊1[ÐS[.88t jQ1[ÐS[88t j!1[ÐS[κ88t j1[ÐS[Þ88t j1[ÐUSWVXk ( ?) R4( ѐ>t1 @u~1ɍ( >t 9u#;T$t$88t ja1[ÐL$1;L$Ð1ÐffffffSWVP[|$t$t<$PhvtVj^_[ÍԶGFPQj;R诂fffffSVP[Ìt$t1Phwt@Vj $tЅy^[ÍԶcG#GPQj;R;fffSWVP[|$t$t3tRtu$F$=轇<ԶGnGPQj:Rāu$PhtVi ^_[ffffffSV[}t$ tjh^t Vi ^[ÍԶGGPQj8RJffSWV[,t$|$t w(w$1^_[Ía=HGPQj7RffffSWV[ܵt$|$t w(1^_[ÍaHIHPQj7R谀fffffSWV[Ìt$|$t w$1^_[ÍaHHPQj7R`fffffSV[=t$ t$&ff g#F F^[Ía'IHPQj;RffSV[ݴt$ tF(^[ÍatI2IPQj7RfSV[Ýt$ tF$^[ÍaIIPQj7RxfSL$D$ t9tEA󐐐€tuuuu˃t@Au<€tAt9AtAt9Au΋D$[fS[î+ Pt$t$h [fffffSWV[|t$T$(с wdp.c*?&b"Au-ta lsw--trN-ywNс@txuSsF-- trN-twNсtxuSsF--trN-twNtxuTtF fF ^_[Í J׍IPQj9R+}USWV [t$ ejV:$?1jt$V[; Ƌ4:|$l#D$,D$ltBL$4$t$$UTs u͋$|=uU99l$}q)t"uDur;MDMDMD MD9u>1 ^_[]ÍSJJPQj>R{wffffUSWV[U$áL$(3L$,9L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$L$T$ t$t$^[ffffS[L$T$ lPt$(t$(t$(t$(t$(t$([ÐUSWV[ƧD$@L$<;L$4D$8Adt$DuT$|$0ut$tG#r*11l$7xD$ ,xt$HWl$Ul$UD$T$x8t wwL$ ҋ|$8u$9(tZD$4l$9ŋ\$s ur"j9l$|$d$$jjdPWU$$|<$u;L$duh^_[]Í.QPjS[>L$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[t3T$8tOl$@toKVPt$DR芌KKIKPQhRo멍KKՍIKPQhR}o뉍KKIKPQhRWoT$Hk\ODH@utD$ j PW芙 $T$t8"u,t"t0_LFgPVQt$HT$ 9L$<lD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ)KWVPQt$H11҃^_[]Ë$T$|$(9ыl$,}K|$09Njl$4} LUWRPVQt$Tt$T褉 맋L$8fffYimNA90%ÐXL$ffffUSWV0Xh$t$DL$H|$PL$%1|$L$WAD$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$fC T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ *1$3l0^_[]Ë$LL+LPQhR.f$LL+LPQhRfL$XUSWV0Xؚ$L$Ht$DL$1|$L$WD$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPU< T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$U#1$e0^_[]Ë$LL+LPQhR_L$XffUSWV<[Èl$X|$Tb D$\}  |$T  D$u D$4tǃğǃȟT$PT$$9L$$0T$,LT$0\$|$ <$D$(\$ȟǃğ|$ l$XL$1L$uHD$4;L$$D$T4>-u FD$,t$06E<+<-~ȟL$ ğXT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Őȟ<0ğȟȉ $:|$Tk $)t$$)ΉD$t𐐐љȅuD$$)\$؉D$D$ L$T$-T$T , L$T$D$ D$ 9~$L$ D$T,uߋT$L$tĉ;<$|D$렋T$ϋL$T,,t‰;<$|L$|$T,; $|ˋ|$ŋD$D$0'\$ȟ+ğ|$ /Vȟtğuğ<-u ~4$<:tkE$<4$PV,L$ tEH<$W;:&L$A;D$PʋL$TTD$:uD8t}:t4$P $? t/ǃğǃȟȃ<^_[]À:uL$:tVL$D$X:L$u^W0D8t}:tjWPeWx:L$T$,L$ $_D$p70:t%j=R*@)D$Cğȉ $ȟ|$T> $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$V7ND$\(pD$D$ 1T$ $ $.T$tf\$QURN uUM $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8:hRQP… \$ȟ+ğL$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:tRQP@ 1L$\|1uD1 <-t<+::BtD8tD$X8:tRP?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:tRP.1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$80D8t}:t4$P趃 $E<-t<+u:}:1<: :LLLPQh_RTw MLLPQh`RTD$l]MLLPQhaRT|$T;LMLPQhR{T MMLPQhRQTL)MLPQhR*TnL)MLPQhRTfffffUSWV[ۈT$t$+ ǃ+ П;D$}? 9-u7yԟI+ t8--?П0ԟ^_[]Í0ԟj-Rx$tǃ+ --LM׍6MPQjRRR(MM׍6MPQjSRR+ ԟԟ+ ::tlQR#tXx:?u'1x:tПHП;L$|鉻 + 0ԟПT$?uП?̟::^VMUPQRrǃ + ?tqПc0ԟ:D$8:E?̟3UMfffffSV[]t$ tj jV ^[ÍNMPQj/R.QffffSV[ t$ tjVRO^[Í\NWNNPQj/RPfffffUSWV[ût$l$tyjjv 1trjtkNjD$oGG E}|L{PjQRjWtKjPj U1^_[]U8l$uEU8U(W|$7wU(릐USWVP[êt$ l$ME 1҉s9r J9sAEOQ0r t`U)ƒQjRD$ `Q E $}E T$)9w΋MVRPT( E E MU9r‰^_[]ÐUSWV[ۃT$L$t$ D$t0tUyyNNjNPQhRMpxA)9}8ITTi t?NNjNPQhRMx3rH HPp 9r@ 1^_[]S䐐S[ނt$s1[fS[þXt$ t$ Pr [ÐS[ÎXt$t$t$Pذ[fUSWV[[l$|$t$t1UPWV1^_[]Í ONPQj4RMŐSV[t$ tjjjV0^[ÍONPQjARLfffSWV[ì|$t$t1hPWV_0^_[Í\O!OPQj6RlLfffSV[Mt$ tjjjjV輌t^[ÍOOcOPQj0RLfffffffS[t$j t$t$[fffffUSWV[ût$|$tBjW*~G0t ujW,^_[]ÍOOPQj/RVK띐USWV[;t$|$ttft7t9fh L$f@Hx$p,L$ H(L$$HDL$(H P1^_[]ÐUSWV[øj1L$,l$(D$$t$ T$wGo Ouu u&t,t+$lt́tڍ,uft?$L$t: $fH f@xp$L$H,h(@DH OW 1^_[]ÐS[~L$ D$T$rRQ0P [ÐUSWV[Ë~|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[.~D$t$t$t$0P [ÐSWV[}D$8pP tWփ1^_[ffffffUSWV[û}T$l$t\tE0~-},t xr }$t jr2U 1Ƀ^_[]Í0P֍OPQj;R:Hu8P0P֍OPQjRQP { tQQQPQhR AL$h@FRQQPQhR@ l$2PQj2Uw]U6ƋD$XtPUt$\ ;D$4u 8^_[]9ffffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[lt|$t$t2F)F31uF FF^_[ÍUTTPQjYR?뭐SWV[s|$t$tg~uP\$wGN Qtz|XUTPQjwRK>VSV[-st$ t ~t/>"U/UTPQhR=~uр~|$^[ÐSV[ýrt$ t ~t/F"UDUTPQhR=~uN .wu^[ÐSV[Mrt$ t41~t^[ÊV u.wL$~9|ԍ"UZUTPQhR<먐SV[qt$ t~t0^[Í"UoUTPQhR<~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[ FfFF^_[ÍUUTPQh.R;뜐SWV[üpt$t>~u/L$Fy |y|9IL |F1^_[ÍUUTPQhMR\;랐USWV[8pt$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍUUTPQhhR!:UUTPQhiR9SV[nt$ t"~uDNu;V9r1-UUTPQhR9~t^[ÐSV[]nt$ t31~u(NuV9rT$x 9v ^[ÍUUTPQhR9fSV[mt$ 9y ^[ÍBV.VUPQjTR8אUSWV[Ûmt$|$t.l$tGMϸwG)o >1^_[]ÍUVVUPQjbRJ8뱍iVVVUPQjcR)8또USWV Xm$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQg9D$0 28t p׾$VPUX 7+D$p)t5u+VQA$RjP8 7D$)smH1 ^_[]Ë$"UwV֍UPQhR6D$4$VwV֍UPQhR_6g$V΍wVUPQhR16D$a$WL$sWՍUPQhR5L$USWV[jl$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQI7 D$ }+$x)t6u,WQARjP6 l$}<$)s8O^_[]Í"UV֍UPQhR4V͍VUPQhRr4렍WL$sWՍUPQhRF4L$;SWV[it$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9"UVUPQhRJ36VVUPQhR 3)뒐SWV[gt$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1"UVUPQhWR2VVUPQhXR1VL$t"T$ tփuQ^ÐUSWVP[zf|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP2 D$$L$(l$0O}^_[]ÍWW$UPQhR|0T$L$8D$4VU=WWՍUPQhR?0\SWV[e|$L$1uLwt?;t$w6)w*t$uQRjQ1 ^_[ÐSWV[Üdt$|$D$Vt$P ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [Èc|$$D$(t9D$ L$,ň̍gWL$]WL$U $t4EtM9wEM )9w+8t;9rt$t$ht$ -d$<뭋D$4 ^_[]ÃD$0D$4(+T$ ܐSWV[|bt$|$D$VPt$  ^_[ffffffS[>bjjt$t$t$t$Z[ffS[bjt$ t$ t$ t$ t$ t$ [ÐUSWV[aD$$$$$ $$$f2}t$pPQj VID$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6 't&6P]&FgPVQ11D$ D$4D$1ҋ$D$;$ȁĜ^_[]Ë$1ɋ$ύ-YYWPQhR.aXYWPQhRnSXYWPQhRV蓷USWV[øDD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP;L$u^_[]USWV4Չ[1DD$$0qƃ,- ,- Ƅ$/jjjhWUVc1Ʌ |$$/jjjhPUV8t1D$(D$$D$ D$D$FD$D$D$ $L$ ȫPQRl$Uj 4$|$.vt:D$.jjjhWvvuW$3Pu,$@$/u,- ZPRQj14$kD$;$0u4ȁ4^_[]Í{XZWPQhR h>USWV0։[QB$DE$,8aƄ$+$+jjjhPVW}1D$$D$ D$D$D$D$D$ D$GD$ D$$L$ȫPQR$Puo<$1t[l$l$* t=D$*jjjhUwwuU$/Pu$l$1PE;$,ue0^_[]Í{XZWPQhR $TZZWPQhR xbfUSWV[È@|$,D$(/D$wl$GQjPk  G1t$ 4$1D$-t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿et$ w=݋t$|$<$$t$&$$1 $+L$ r#E[΍;[[PQj`R D$,H$$t$,F $)ʃr#m[;[[PQj}R F$)N)!r s.^_[]Í|X;[[PQjCRZ [;[׍[PQhR1 몐USWV [>t$ ~Nƃl1 V҉$t`L$FшT$?r?鍋-1 $j@UPQL\$+-1 ~t0|$>L$:$u -1 uL$>͍ >T$1ҍl1 -9si$:[U;L$s>t 9sE.9r9s34$[h9s맋 $l1 9s$-1 ^_[]fffffUSWV[ë<t$|$pUl8PPWVWEUL^_[]fSWV[\<t$ W!PPV W^_[ffffUSWV[<t$tLD$F$V~nF:m1 PUWRt$t$QjV#$^_[]Íf[[PQj3R듐USWV[x;|$,L$T$ |$l$捃\UWRQL$QVPt$H 1uA$L$1 1 1 L$1 L$ 1 L$1 L$1 ^_[]Í[[PQjBR[USWVH[è:l$`D$ D$D|$\SrE$MUu}m5\UWVRQt$PjD$JP"$$G\PQf&jjjjPVoƍO,0 VjjjjWoƅQUVzL$\ QL$ QL$ QL$ QL$ QL$ QL$ QPV${D$L$ D$D$D$?D$D$@D$D$AD$hh@V.p 1lj,$t$\hVWo Ņ~UVD$ P> 0Wp0,$xj$uj!ƅth$\L$QPJG1\F LFuF E;$lu5p^_[]1㍃\\\PQjNRt'USWVl[H1$D$h$UD=$$U= uj!ƅtXD$XUPKF1LXF LFuF ;D$hu2l^_[]1ꍃ\\\PQjhR~J1S[^0t$ t$ f[ÐS[>0t$ t$ F[ÐSV[0\1 jPV  D$ jVPjX^[fD$ȉty!fUSWV[è/t$0l$,D$tjuj)蠭ƅtRUP1 F LFuF(;D$u6^_[]1ꍃ\P]]PQjFRur辡USWV[.$ $$P'h@VYl1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ y|=P$Pt$_k ƅ~.V$P$P |) u84$9lq8|$$uj)蒫ƅ~$$QP1F LFuF(4$Wk|$;$u^_[]1踠裟S[,jjjjt$t$[ÐUSWVt[Ø,$D$p$U$$U= uj)eƅtXD$\UPk1L\F LFuF(;D$pu5t^_[]1ꍃ\Y]]PQhRG~fffffffUSWV\[Ø+|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]Í ^]c]PQhR]]c]PQhRx$(ffffUSWV[Ht$0l$,D$tjuj)@ƅtRUP1 F LFuF(;D$u6^_[]1ꍃ\\^^PQjFRur^USWV[u$ $$Ph@VT1$|$$ $ u#D$P|$WBP|$`l$d$$ʃ|&jQPt$ |=P$Pt$S ƅ~.V$P$P` |) u#84$T8|$$uj)2ƅ~$$QP1F LFuF(4$W@T|$;$u^_[]1XCS[njjjjt$t$[ÐUSWVt[8$D$p$U$$U uj)ƅtXD$\UP1L\F LFuF(;D$pu5t^_[]1ꍃ\g^^PQhRkGfffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[t$ L$A͉?@)ύ‰Ul$P19wct,B$ WUPط 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP| ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [|$$D$OGD$ $?17l$ )ȃ8w ^ffffSWV[t$(WjV xqN|$,t?r$d$D?r'm- d$!L$jWV* ^_[fffffffSWVP[+t$tB$5 PQhRx>L$ $¤5 )QVWRs.5 PQhR5 = t@= ^_[fffUSWV[{t$D$D$I@t NQw |ى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]Í}_t_:_PQjbRSUSWVX[(D$lD$ 8D$DD$@D$Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]Í__:_PQhtRSWV[|$t$t5$D$ WVjjjP1Ƀىȃ^_[Í__PQj:RqffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[xt$(l$$.PT$(18D$8tP)rjt4)sD$(8rl$ ugPt$9ŋ$t$b趵0rD$8tP(WZs4$F#t$:#r01UPt$ҡŋD$G6#oD$ G = = D$8tP(G^_[]Í.`_PQhR &.`_PQhRT$(#93ásLjUPQRV/j5USWV׉L$[Ò2jeVj+Vt-1 |$WjPj%eyFu<$|$1jrV!t?b $UW`ft1jau%ų07|!wq!詳01^_[]ÐUSWV׉[ç= tu(!mu?ru<6!FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[t$0l$$AT$0818D$8tP%gt/D$08rL$ ubPt$Ӟŋ$t$]P0D$8tP9%Wo4$t$01UPt$qŋD$G6oD$ G = = D$8tP$G^_[]Í5`_PQhR迫&5`_PQhR蕫t$,|$(T$0VWU jUSWV[Ht$8$8tP#= t9ut>mt9uu+$8tP#贰h1VEu= $8tPy#|$jWu 5 ƃu V8tUntt$^_[]ÍE`=`_PQhRFfffffffUSWVH[D$`|$\t$$UVPWVtUVt$aǃu.覯8uj?~;$} VPaǍD$9tLV8mA$jD$P^ft&UPt$hWLV{D$$oH^_[]Éƍ``Q`PQj>R1fffUSWV4[D$\l$HSt$XoL$`u0tDunuRt덻`tǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ t0L$ V2 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$虛Ń|$jt$ RU||$tUjt$ RPe|$t>jt$ RPNl$t%jt$ RP5tjt$ RP T$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQWщ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WPƉр|$ul$э`4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0z0蕚L$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$AzL$,T$$ Qa4$Qt$(V0WRUt$h$[4$|$2jjdQU豘ыT$,t$$r`4$Rt$(QPVt$dVt$dn 9wijt$ QRTщ9|$}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QR轗щ9}T$ 4$T$\ijt$ QR茗D$ ы4$T$\BK`PQj8R莢D$l``PQj9RfmfffffffUSWV[5$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]ÍaύDa aPQhRM>USWV։[!$$F t%G HO =rĥ,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQx D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]Íaba aPQhR|[Taba aPQhRR4Taka aPQhR+USWVT׉X$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRVLuD$t @ t$?D$ h |$t$(${PVt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVPL)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtPTYt$FPBYF^_[]ÍTaJa aPQhRuUSWVY[T$tht$1BtBظkw+|tրztЃːt *u1^_[]ÐUSWV։[]F,F tvjFUPRl$~D$uNtQjPaD$ L$$t$ F1퐐f$t=tsAuE @u1$P-l$hPQ< E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu跏$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$PIŋ $fE$$UW$L$$Q$QP$D$,!=YTaa aPQhER蹆M lt$10dD$/ Njt$$E @D$uPPUu 8t E u;$6Ĥ^_[]ÉNjt$몍aa aPQhRaa aPQhRʅ|aa aPQhR装$caa aPQhRuOTaa aPQhRN7Taa aPQhER'L$ Taa aPQh/RL$,USWV[ƹT$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍΍ aPQhR蠂a΍ aPQhRuT$8b΍ aPQhRCT$8ffUSWV[$$c$$tu資1D$$tŋD$3l$ 11h@PTD$(D$$D$ iL$L$\QPctYD$|$D$0t$\ d$<0fD$PPju@] D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tPxvPWu uh~3D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P (jD$PD$0: D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$ybjPv_ u|$1D$Wt$ ;Ƌ$6yd$t$\D$|Ay DAD$$uD$*\ՋD$DJtDHD$D$ $@uP \ DAթD$}bjPD$pINjPD$p+ D$ |$t$ztG$`L$tZybjPq@jPD$p /1ҋ$t}bjPD$p1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8譀< 蒀Y1D$ D$l$t)pD$D$\PjuV |$N8|$ $%|$tcjPu~ |$t&D$u|$8|$ $tt$Dtu V,~t$jl$ U{ 1$u Ub=;$uEČ^_[]Ë|$|$[|jb_b%bPQj_R~yy1!S[^jhjt$t$t$[ÐSWV[,= t-= jhjVPt$$t8= 0jF= = tP+= u^_[ffUSWV[ë|$= jjjP = l$= tUQ= # = t]1i = 9= wHt Q; = W3+= t$UWPȟ = u 1T$ Ɖ^_[]ÍbbbPQj= ^_[]ffSV[ͨ= u*ǃ > \1PVܔ= tt= *VP!1^[ÐSV[]ǃ > = tP89\1PV[= u*VP1^[ÐUSWV [$ǃ= ǃ= ǃ= ǃ= ǃ> ǃ> ǃ> > = hhU虠D$ 1Ʌ$t$L$ $t$ > L$l$<ǃ= = hhU0D$  > t$P)j\WVqO t8t剃= 8#tj\WVGO t8t뉃= j\WV'O t8t뉃= j\WVO 68t牃= ǃ> ǃ> j\WVN tD8tP> j\WVN t8tP> h= |$$W" |$j\PD$ PMN ǀ8tWfu͍jUW0hth/UWhtTdUWht@UWgt,UWgtUWgQ> E5xxMf l$<$j\WVgM 8t牃= 8#j\t$V4M t8t艃= j\t$VM tOǀ8t扻> PWg"= PWftb4t`= D$\1c > PQ[ > l$tэQPfu= <$j\WVGL t8<$tP> j\WVL X8<$tP^> t$t$1ɋ;$u ȁ ^_[]SWV[ t$ǃ > = t P۞&\1PW= t*t+V= [eu䍃= *WP/ 1^_[ÍccPQhRgmZSWV[<t$ǃ > = t P &\1PW3= t*t+V= du䍃= *WP_ 1^_[ÍccPQhRlZS[n= tPbǃ= [ffS[>L$T$ j@t$[ÐUSWV8[t$PT$$t$,ZT$L\D$(D$D$$D$ |$\$ 9AEtL$|AyL$ DAML$Za*?$j t$ h[fUSWVP[t$ltttnL$VCtH|/t|$/uc29r9vzz/u)ρwG hUPVcƄ+G ^_[]fffffffUS8[EED$D$$D$ D$D$D$PQj tD$(|$0e[]ffffffSWV[́|ƃtk|$|$ucP1uP/jjP/ t8jPjWjW|Wٿ^_[jPfS[D$t=uQ[t$ P[SWV[܀|$t$tWhVy ^_[ÍO edPQj1RK̐T$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[Dt[Ḯ̀rS[$t[ḭ̀rS[t[̀ffff̀ffff/̀ffff^̀rS[ô~t[̀rS[Ô~t[Ḥ̀rS[t~t[<̀rS[T~t[̀rS[4~t[ḇ̀rS[~t[̀rS[}t[ḓ̀rS[}t[̀rS[ô}t[`̀rS[Ô}t[R̀rS[t}t[2̀rS[T}t[ḩ̀rS[4}t[P̀rS[}t[ḷ̀rS[|t[Ḷ̀rS[|t[ḉ̀rS[ô|t[̀rS[Ô|t[Ḛ̀rS[t|t[̀rS[T|t[Ḩ̀rS[4|t[1̀rS[|t[Ḍ̀rS[{t[òrS[{t[ìrS[ô{t[l̀rS[Ô{t[t̀rS[t{t[s̀rS[T{t[r̀rS[4{t[p̀rS[{t[j̀rS[zt[m̀rS[zt[̀rS[ôzt[Z̀rS[Ôzt[ ̀rS[tzt[S[^zt[ᐐ*̀r׋L$Q1fffffỲrJ!QJfffffS[y^GSV[yK tFK PjtsK 4+K 4K K R ^[ËK HK jjjhjPj1tȉK uj$Pjn jHS[yD$K );K t P[à QP [ÐS[x̏jPJK uP>k[ffffS[ÞxlPt$t$t$ [ÐUSWV8[`xuD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$y\DP@Ӻ\$%D$ D$$OL$ۀU|$ɋuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ P7Pt$t$- ZD$x$W7Pt$W @D$x$WW7Pt$W )D$x $W,7Pt$W D$x$W7Pt$W uD$x$W6Pt$WV zD$x$W6Pt$W+ `D$x$W6Pt$W <D$x $WU6Pt$W D$x$$W*6Pt$W D$x($W5Pt$W D$x,$W5Pt$WT 1D$D$$T$EHL$D$D$D$ Pp5Pt$t$ D$@D$ P?5Pt$t$  D$@D$ P5Pt$t$  D$@ D$ P4Pt$t$Z  D$@D$ P4Pt$t$) D$@D$ P{4Pt$t$ D$@D$PJ4Pt$t$ 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ |$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ eD$ e|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$!e|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ Vb-D$Pt$V ID$ V3-D$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$lQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$\ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$4A(|$€´|ejWPx O$BejWP[ 9$D$D$P"D$PWt$ % 7D$@D$$Pv"D$PWt$  j\$0T$L$0DHtJD$0$Pt6uF $jP9F$F(W|$*|$z$d1  $PiUB$J($1 UB )iJ$$dB(1UB $1+1|$r$L$B(aD$ t$ D$ L$ȃШ uNQi)1uB,i)\fиwi)\f1N Vk4<$ȃ u|$$uD$$FL$NlQkdl1u'ui)\P ףr1с)҉)i%Iэ))ƒʋt$$$Iʉ)ʋL$())uFЃFL$$ШL$NQiҐL$)1uE,i)\fuwi)\f1=‹Fk4 $<1ʃ;D} $r+3LMAD$AuNL$tuϋNQi)1uB,i)\fиwi)\f1Nk4$NȃF ?NQkd)1u'ui)\P ףr1с)҉)ȍ 0i%IЍ)ȃEHx3QЃs1΅$u t1$Ep]΃t1ɿŃD$ $D$,;$0u D$ e^_[]#fUSWV[H[t$,D$(K H9ttkH͐w ˆ|$T$ H w ,Ť,$HP x(@D$US =*efF F????F:?? F ?:??F?? ?F??? ??? T$̉ҍ)эeQPUt$Wt$$t$t$(R|$,WVB,9s1=`elQUt$ WRt$t$$P|$(WVA(9r1T*8^_[]ÐS[YK Pt$ s[ÐS,[ëYPt$ffffPQjIRX!USWV[;Vl$L$t*t$1Ґtuщ )4@tRjP" ^_[]fffffffUSWV[øUt$$|$(9jVPƿGLjVt$, t$(LD$l$,L$ t-|$,RUT$RT$t .l$(RRl$(T$tX$|$  tQPT$ <$EFt PF tT~tE1t(0F t((F t( ;~s F @ƋF PF,t PF4tPF8t PVx^_[]ÍRggPQjKR?ehggPQjMR?efffffffSWV[\Kt$8W!L PVmW^_[ÐSV[K8VL PmVΎ^[ÐSWV[J8W襎L L PQmW脎^_[fffffUSWV[ËJt$l$VvZVt$j[1u<$Vt$B[DžtpU7 t]wtуUP t u막t$~utQ ^_[]É1ԍ`hhPQj1(\DHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xshihPQhRF 0 ii֍hPQhR USWV [?L$(l$ D$D$(N|$$L$ߐt$,D$PUD$PlutxD$ѐwztM׊D$L$uD$ `l$ s+D$tD$u:t)2ȫihPQhR  ^_[]Ël$ u렍J΍ihPQhR >΍ihPQhRi S[>>t$t$jt$ [ÐS[>jt$jt$[ÐS[=jt$t$t$[fffffUSWV[ë=`L |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉdL uj(UƉDl$U|twn$Nj 0Q 1xL utjh=ʼn`L 0ƃxL LxtMjуdL @1t*n$FUQj PQ$|$z^_[]ËdL )USWV[;<hL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉlL uj(ƉDl$Utwn$Nj 0Q蜸 1L utjhHʼnhL 0ƃL LtMjуlL @1t*n$FUQj P"|$z^_[]ËlL )USWVP[:l$UNjpL $tOs;1҉v|L ljh=EpL $uƃ|L D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$lt0dL tuR:xt!jуdL tiE$SdL uj(vŋ$,tIEj |$WPA WtE@E$L$1E^_[]t$t@ϐUSWVP[8l$UNjtL $tOs;1҉vL ljhUtL $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$|t0lL tuR:t!jуlL tiE$SlL uj(膵ŋ$,tIEj |$WPQ WtE@E$L$1E^_[]t$t@ϐUSWV[6t$|$ tЋ`L t61=tDtP0ǃ`L D$L$ƃxL pL t?1=tDtPǃpL D$L$ƃ|L ǃdL xD$ |1^_[]ÐUSWV[5t$|$ tЋhL t61tDtP ǃhL D$L$ƃL tL t?1tDtPǃtL D$L$ƃL ǃlL D$ 1^_[]ffffffUSWV[4$tA$1uh農ƅtcD$E/$tt$$9ux/Ĕ^_[]J?$9u/(>?USWV[ 2t$tD$tdPV$xaa1ɐ΍,?UQֺt&UP$y.w8"tV: g1^_[]ffffUSWV[k1t$VNL PbL ƃL \ tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t P/ǃL ǃL 1F ^_[]ÐUSWV[K0|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]ÍKn}nPQhR]nn}nPQhRv6USWVP[J/|$t$t#l$ t?tajUjW^_[]ÍKn}nPQhR빍nn}nPQhRun}nPQhRxUSWVP[Å.$L$d$p$l 2L$|$$h\$T$8u{L tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lh诫$p $L$1xjjjU|$ `NoPQhl$XUjjjh@Uujh@6j D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ j ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$n}nPQhR$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QPT$ )ʼnl$‰$L$\$(l$$|$ t t$Oit$,D$l$ tEF4$hD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PU豱5))\$ )D$Ɖ$T$<*)׉ڋ\$QVPN Wt$DU@ t$$t$ t$0/L$0\$|$8T$L$ D$ɋ,$tt$T$fT$Ћt$ 9v8)PU|$u(Ur|$ |$L$1|$k04$*Y0rL P臥KL PL L$ <$14$$lyD$0P|$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$VD$xW螤t_WVPW UUx~1L$ ȉŋD$8L$D$8B\$Wܴ |$ t$dUU |$;$LP^_[]0WHnL$nՍ}nPQhRL$,8BoL$nՍ}nPQhRꋴ$tL$,nL$|$nՍ}nPQh RE|$L$,L$|$nՍ}nPQh R $|$L$,Ń|$ \$t t$kc4$in}nPQhR$|To}nPQhR~$|Y\$U|$ t\$t$b\$t$0ײX$L$ÐSWV[#t$|$tatY8t1t0:t+|t&9vt:t |u^_[ÍKn}nPQhRu}n}nPQhRKVSWV[,#|$t$tGtiL tPǃL ǃL ƃL ƃL WV^_[ÍKn}nPQhRunn}nPQhRpS[~"L tP#ǃL ǃL ƃL ƃL 1[ÐUSWV[%"$,E$$$(L uL ȋL u!Q0 L L t%1L L PQq1t $D$uz1L VwMVǃL L HL @MQP2 L u<\1DN@u:t#t L <|\L L L $ƃL l$L$L$ $Dt\uUL @0uًL t:tuT$ T$VP tfVǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$V]ǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5L tPǃL ǃL ƃL ƃL GVǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$^_[]À|\u ƃL ƃL Un}nPQhRM$<Enn}nPQhR$<ȐUSWV _T$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdDXƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPW>ƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u (FPU趤tL$(U$W2 ^_[]ÍKo֍}n$PQhRc|$no֍}n$PQhR.|$|$(So֍}n$PQhR|$&Kn֍}n$PQhR$nn֍}nPQhRUSWVYhT$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdėt]ƃdNJD$$ƹdEt#<:tu)FdPWfu`)nu N$UW5t1L$$8$o#o}nPQh`R$W苧^_[]ÍK#o֋$}n$PQh"RL$Vn#o֋$}n$PQh#RL$|$$&#o֋$}n$PQh$RFL$Kn֋$}n$PQhR$nn֍}nPQhRUSWV[ûl$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuPZ F(N8D} '~wF^ FPB^ uWv$1R tƒN ~?:V|@uH)ƒVԋ^ sLFF$BBQWP uvvQ K~?:uFV;~t^  ^ 8u^ F,;8u e^_[]Ë^ 茅S[î0t$t$ [ffUSWV [q} F FEFUVzRu)ʃԉF:FJFx9u0RuMP N ;Nue^_[]裄fUSWV0[D$(}PQVXL t$M L$ML$f|$ L$T$|$QRj WPBuOt$ rF|$j WP^ u0O L$FD$D$ PjL$Q蒵 79_t$} urP tgM9uWM % oQPR}Wuz19r"y";L$(L xjjP@ PFJD$t$ L$ WJt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V uEPVuՌ ;EsD$t$WkHL$%D$"T$ ;UwRPuƳ 1ɋt$;D$(u ȍe^_[]6S[^ojPu;L lh P{>P [SV[L hVt$t$t$%t1^[fffSV0[t$DD$@t2D$D$ D$HL$ $@D$1L$ jt$t$t$0W[fffffUSWV[ $$$$$DŽ$DŽ$$jPIO$8jPODŽ$PDŽ$TDŽ$XfDŽ$l$`$pVEƅ$d$t$$$`U$$Pz;$ļ^_[]ÍpoPQjGR$ppoPQjHRopoPQjNR03}1ÐS[N lt$t$Pt$[fffUSWV[ t$|$l$jULlWVPUjjU=^_[]ÐUSWV[ t$l$ |$jWUVt$ WjW^_[]ÐUSWV[u $$D$D$F0u ǀ$D$D$,D$8D$ D$(C|$ 'OL$ $PtRF$&D$ FF VuWPu뉐%$1틼$% $Bzh( ,HЃԃ $˃ $‹$tU% @뛁 $룋$z| $넁 $u $ fJT$ F%D$ FF VuWPRu˺%~Vc9cFD$ T$ D$~;%T$ $T$ $7T$ $'D$0<^ZBD$0T$ NT$ $ $D$~T$ T$ D$D$(~D$8 $0@lD$T$ T$ $D$D$(~T$ $D$D$(~T$ D$~T$ $D$D$( ~T$ 1ɉl$ύ$hPQ? D$004D$T$0‹L$L$ T$"L$$D$D$$A-D$ D$0-<]tL$$D$P P D$P P $WUP h1qD$P P $WUpP yLjP D$P $WUHP D$ 뒄tT$0]tD$ L$ $ D$l$~ V:$ ui$WPWPD$ t:FHN}V$$D$T$  t $ȃVRjD$0{L$D$ b1 D$ $D$b8|$teFAOL$D$tF~V t L$FPQT$D$uD$)gϋL$ȃD$,2 1 ŋ $D$c8|$Q $Pľu3FHL$QT$t~VtL$D$ȋL$ )L$L$ D$, E$L$=r $] ՀMJ ɋ|$( 1 $$? L$(K,L$($$? $@  $T$(S, $$?L$(l$,$ $9L$ ,$D$(l$W$с|$(tѺuu?tT$(t? $T$(L$QT$FHNV; E=r$D$ ,L$ ^_[]fSWV[t$|$jW1j VWU) jW(^_[fffffffSWV[ìt$|$t PpPQ ~^_[ÐSV[]t$ tPFtP}FFFtP}FF^[ÐUSWV[|$(?u pPQt$$oD$t U?}jjjj|$87#Gʼnt$Ptqt< t< tt$WHqt Ń1W/$FL$(A$AFD$1uD$(E< t< tt֋T$(BH9u<BjPD$ P-E D$ 聾L$ v8ukD$ $FD$,t$UpmŃzAA jj t$D 8 8tq0|$(tPϭ$tP{GGGtP{GG製01^_[]Ë$fffffUSWVP[Úl$t$D$ $ t t@u$Sq?qpPQj8RZ@QUVwЃt 0$^_[]ÐUSWVP[ l$t$l$ t t@u$Sq?qpPQj8Rȶ@QUVwЃt x0$^_[]ÐUSWVP[zt$ l$T$D$$$ t t@$u0qqՍpPQjpR2t$0@$QVURwЃt ٻ0$^_[]ÐUSWVP[t$ l$T$l$ t t@$u0qqՍpPQjpR萵t$0@$QVURwЃt 70$^_[]ÐUSWVP[:t$ l$T$D$$$ t t@(u0qqՍpPQjyRt$0@(QVURwЃt 虺0$^_[]ÐUSWVP[Út$ l$T$l$ t t@(u0qqՍpPQjyRPt$0@(QVURwЃt 0$^_[]ÐUSWVP[t$ l$T$D$$$ t t@4u36rrՍpPQhR诳t$0@4QVURwЃt V0$^_[]ÐUSWVP[Zt$ l$T$l$ t t@4u36rrՍpPQhR t$0@4QVURwЃt 贸0$^_[]ÐUSWV[øt$,|$0*T$>t .$ tEt@u%rrpPQjJRVE@NT$RQjjjuЃ>T$u-ks^smrPQj[RT$,$ t|$ tEtHHu0%s s׍pPQhR踱|$0EHHPVt$0t$0WRUуt Z0$^_[]ÍrrmrPQj}RaS[>lPt$t$t$t$t$S[ÐUSWVP[l$t$D$ $ t t@8u'sspPQhR跰@8QUVwЃt g0$^_[]ÐUSWVP[jl$t$l$ t t@8u'sspPQhR%@8QUVwЃt յ0$^_[]ffffUSWV[t$l$3$PQWz t"t$ VW @WjjPԁU 'PQW: t$fffffffS[Njt$t$t$ [fffffUSWV[l$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]~VUSWV8[Õ$L$4L$u$X$PD$u$P| $$Pt$Pr :T$$EjPjD$tk|$jWjD$,D$ tND$1ɅujWjt3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVW/x9!xt19)u|$T$(l$);$Pw|$$XD$0P螢ƃjPqitQ$1 T$|$$T@uX$L$0PVQW't5W胅D$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ *‹D$$t $uCr.蠯|$茯1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4Va DžL$~9t/;$WVQL$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j|$l$t$D$Pjt$ jUjV|jl$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$jt$ jt$i넍_t tsPQhR葥St tsPQhRryt tsPQhRSt tՍsPQhR`$t tՍsPQhR跥ꋌ$hRCt tՍsPQhR腥2t tsPQhR謤t tsPQhR荤LUSWV[D$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]{LUSWV[Ûl$ |$t$t Vz1L$1jUWPV^_[]ÐUSWV[Kl$$|$ t$t V*1L$T$jUWPVp^_[]ÐS[L$1jt$t$t$t$6[ÐS[L$T$ jt$ t$ t$ t$ [ÐS[ÎL$T$ t$ t$ t$ t$ t$ [ÐUSWV[HL$(T$ 7t$T$L$0D$L$11jUt$,jP`xD$Ƌ;D$u ^_[]JUSWV[D$(L$,T$$>|$T$L$0l$L$T$ jWPjU1xL$ȋ;L$u^_[])JUSWV[K|$t$t V.10L$1jUWPVp^_[]ÐUSWV[|$ t$t Vޗ10L$T$jUWPV^_[]ÐUSWV[ë|$t$t W舗101jUt$$PW^_[]ÐS[^0L$1jPt$t$t$[ÐS[0L$T$ jPt$ t$ t$ Q[ÐS[0L$T$ t$Pt$ t$ t$ [ÐSWV[Ü|$t$W{xuGكs^_[!t_t$t%<FF ^_[ÐUSWV[|$ u ^_[]l$ t$Wxt t- t(WxtWP u뵃!}/=<PFPF ^_[]Ã=t̃~~ŐUSWV[h|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tvP<$|$Dփ 6D$4)D$4@u \҉L$x MVEvt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉu$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/\DPg%0W$\P$D$4@uWtu#\DxuGws>4$$^_[]ËD$4  !rfUS [%E$D$D$D$PQD$e[]fffffS[t$ t$ [ÐUSWV[å$$%= uRl$l4$NƅtR~D*GN(~DFFJVVrPj(G(uwgHF,F(nTPUw7 j/l$Uwt5;$u~Ut(UD$HQUt$6 D$F,GFFF8N1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGHlG D$ D$4L$ $Љj0)t9D$"D$ <u !G OJD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR`8l$ǃt$<)l$ D$8D$D$14$D$Lt$8DžN( u" .uGt<.utʐL$tXw P7<ōG UTD$t1 .YMPNQPT$ Rb u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HR^F4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$踉1ӗ"utPQh1R較D$u‹.x1F)EHftf },$FtpPGu|$t$u N)$xDuW@8/tOF(uIljh@P tFFU$U<$u~yljF^_[]FUSWV[ët$tf8}t v$d>V }t!v$Bv$7v$EVEW^_[]ÍuuguPQjBR&vfffffffS [lPQt$ t$ ,$ [ÐS [ût$Pt$ t$ ,$ [ÐS[ÎL$T$ lP[ÐUSWV ׉[TT$4@xtbA=t= T$4t=uD T$41PL$HL$DL$@L$ D$l$ L$RPQUWV-=u蔆"كTw",# $T$сK1 $  ȉD$D$ ^_[]ÐS[>L$T$ t$[ffffff̀rS[t[̀rS[t[ ̀rS[Ĵt[SWV[ì|$t$t-9t!t F9u1^_[ÍuuPQj*R\fffSWV[<|$t$tt1WVv^_[ÍPf9vuPQjBRuύ[f9vuPQjCR~뮐SWV[ü|$t$tt1WVZv^_[ÍPf9vuPQjBR~uύ[f9vuPQjCRd~fffffffS[>L$T$ lPt$ [ÐUSWV(T$ [L$<\$%t$@|$t;D$<|$"v+覃1t$ \$VPo\$u<+t<-t D$1 1ҊD$L$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[ät[USWVTXD$|$tt$ht&L$ptCwm\$7x\$kw0wPQjxR7r뵋\$kw0wPQjyRr$vl$l1 D$͉L$4A\$P$gD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$Y0wPQh&RpV\$xwY0wPQh'VowPQhrVt$xo$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWPS  \$R&1T^_[]Ë\$w0wPQhsR4c$\$w0wPQhsRc$LUSWVTXؗD$ L$pT$htwL\$ h ֋\$ kw0wPQjxRb$vl$l1 ШD$ʼnD$4֋\$ P_:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ xwY0wPQh'V`wPQhrVt$x`$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVP \$ Qm1T^_[]fffUSWVP[ê|$88tqw$hG$t,GO4$6tV1‹n1 uV ;WujnƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$jUTƅtF PVW) u$^*jU!t@ PVW) 1*V8t uVV $tD$ 81^_[]fff̀rS[t[ḃ̀rS[t[SWV [Ʉt$ |$t[D$D$4$zU0L$jjPWjQp*1uSU9 u BU01 ^_[Í xwPQj,̓+>4 фuߊt*ɉ > u Hu))W3DLt8u;L$ u$^_[]fffffUSWV[t$|$t]l$tvr't#t utH8uΉ^_[]Í>x/xPQj񐐐9t uD$))t8t)Pt u+D$ PB^_[]Í>xxPQj@RLD$(SJxxPQjARWLD$(7fffffSV[-L$D$T$ y9xRVQP Q6Q4P 1^[ÐS[΀D$y%9xP PQj@RP P j@4R P [fUSWV[kt$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JPfOyxPQj?RJ눍[fOyxPQj@RJq1^_[]fffffffK̀rS[Ôt[USWV [xt$ D$P9ܠ7$|S_ NL$ 9t6ʉi)iAi ˍ $4L$T$ o9s9s}$?9r|t$^uA$t209r9r։t$^_[]É݃t209r9r֋9s9r9r봐USWV]}ܠ|$0||$4D$Pvtܠ)1ҋܠP1T$,ރ s;DžDžDžL$0AܠQ1@t$ sAs(1ہ1)L$$D$0Hމˉܠ|l$Pt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉)D$L$0t$^_[]Íyy\yPQhYRF[USWV[zt$ܠD$.̉)ō$P蓾tܠ)1ҋܠPܠt14$ D$^_[]Íyy\yPQhR EUSWVP[yW賽tI010ܠ$9r$9r$ܠi0mNA900W>^_[]ÐS[Nyt$t$t$b [ÐS[yt$[ffSWV[x|$t5jWt ctVW(1^_[ÍzyPQjARC몐USWV[Ëxl$t{jUt=ǾtUWUt1l$UPt$ L "19s#IH8^_[]ÍzyPQjVRBaffffSWV[w|$1t,mPWzt |$t=t=tƉ^_[ÐSWV[|wt$t-xVW tPW V^_[Íiz\z"zPQhR-B믐SWV[ w|$GPtƉx @xVP1^_[ÐSV[ývt$ t%xVPMt L$9H 1^[Íizxz"zPQhRvA뷐USWV[XvD$01t:>t41 |t$t$ t$ W8 uD$ <=u.|$$ P 9ttD$0P M9u;P s|9v9tfP7ǃP ǃP $jWP ;F04F8uyPD$0t$s )$jWP E0E8u4)  $PjQ B $P L$P ^_[]ÐUSWV[øtP tP 1t0xDtPVtP Hى|$xjjD$P tE t5jVt$ F:P tVt$VŋD$P 9tPǃP ǃP P UjP@ ^_[]ÐUSWV[Ûs81tR/tL,t4t$t$UX5 uD$|=uօt D$1^_[]ÐUSWVP[s|$1|mPWtfƀ<=t^tR)tI1 $ $lt+Vt$U4 u|5=uمxD$8.1^_[]ÐSV[mrP趷ƅt(C0^[ÐSV[-rPvƅtB0^[ÐSV[qP6ƅtB0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[JqD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[pD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[hpD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[oL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[(mT$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t1^_[WVMtGPVܓtۍGPV+tʍG PVtWV 묍9{|{PQhRm"U|{PQhRFUSWV[ëNt$|$Gt/uTot^REwn1o  u-GFGFFnFn GFG    #U|{PQh$R||{PQh%Rt||{PQh RMGFGF^_[]Í||{PQhR S\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[4Lt[v̀rS[Lt[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[kK|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1f}|PQj:R]}}|PQj;RVAUSWV4[uJ$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOF2}l$0PQjU!1UH $\9ȋ$QU$`- FfNӕQPR$`U$`01Ʌ9$Fx$P$T)}PURQw0*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LӕQPR$`$`/l$ 9+(t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`(~$PEDL$0}PQ|$W$`Uu.t;$Tg$P$T)D$D #P|$Wt$L$QR".L$)D$D Pt$t$t$R-L$)D$D Pt$t$t$R-L$)D$D Pt$t$t$Rw-L$r)D$hD Pt$t$t$R>-L$9)D$/DPt$t$t$R-L$)D$DPt$t$t$W,19D$F$PED$1$10D$ #D$}D$׋D$ tD$ $ 1QPt$t$UI,H)D$>Ń19t$un 1f$PL$$T)fv fD$ &}VQURt$+L$ ;$T$ŵT$0L$RQPWt(8W$\9vpD$0Pe;fǍ2}$0PQhWC+Wj$\9v QW$`O %1QW$`5 D$0P8eFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtPDž $y+aG2}T$ PQhRx&= $w89;$(w))΍L$ WQP D5%D$D1D$;$ ^_[]Ís}5}PQhR2 |Xs}5}PQhR $$bWs}5}PQhR;苰fffffUSWV[å=$8$E UP7`E 1Ҩk4$$4$0$,uRUZ]-VU]t9~uۋ$0tPv u*ft#Q$4ƃ1ҁD$D$ƉffD$D$hVQPKt$D$L$ T$PQVRu@m9t$D$ ff9|$$0$4t*G9D$D$u_GRQP uEt$WVU`24$1E u U[;$uЁ^_[]1ҋ4$E t菮fffffff̀rS[ä;t[USWVP[Ê;PaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pf 8^_[]ffffffSWV[:|$t.jW!G=tjW^_[Í}}PQj@RfffffX:L$rÐSWV[L:t$u8~}PQhrR*VtF~tP^_[ÐUSWV[9$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$WtGotPz܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$qf}PQhcR?F HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$0JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$1 *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RYNjD$$fxxt$ T$@>PL]fD$>P8]fD$>P$] f|$fD$f|$"D$<$$!|$hVWt$8RXgD$D$$fxxVT$@HVNjD$91%L$L$PVt$V 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8W"hj$P DŽ$DŽ$DŽ$DŽ$VWP$Pj%>΍Gfwhj$P DŽ$DŽ$DŽ$DŽ$jaND$$%MD$WMPt$t$t$DQ$Pj%荮T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWZfD$FP ZfD$FPYfD$h$!Pt$ Vt$8WUfNjD$$fx$!xV^VAV=*hL$L$t$L$L$|$hRQD$赀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~V<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$ht@\L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u yxn T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ VL$tL$8$tYt$`~l$(u2D$4t$%Ut QtFUt$`)L$8uBffU01l$(E;$%b%^_[]QapUǍs΍i׍}PQhR΍i׍}PQhRc$%]΍i׍}PQhR+.CY΍i׍}PQhR$% ύ(}PQhR$%~ύ(}PQhR$%MT4qWVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[|$F$ jP肅Ņtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$Pr ^_[]Íʀ}PQhR@рʀ}PQhR|$|Xʀ}PQhRUSWVT[Ö1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4D$ D$$L$j L$QKtL$t$ t$~e t tt,…tt$ P~u$ND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$PD$Pjt$G|$$"RoT$GtItu܍(}PQhRT$u뿐D$L$Eŋ@uaL$$Ut D$PT^_[]1ύ}PUhh RAύ}PUhi R~USWV T$[L$8D$ l$4"t$@jV1]F1t 1Ƀt @u\1<$L$D$ Pl$ U,1!PU|F<$T$t ;D$ P ljT$4t$@jtoL$ Qt$ PQ 1upF<$T$t ;udD$ PtljT$4t$@j*t n)tl$<UlGt!D$881<$;D$ ^_[]ýW裆t‹GwtP芆܍͍}PQhRCY͍}PQhRX}PQhRt(}PQhRMifffUSWV([$H$<$$E UPM 1U4$Um$DUtڋ$D0W+t4$DptPW tu뗐$@tP$Hp ոj$DWH1$@T$t.$@öT$D$1L$D$=wu4$T$$L$%D$&hRWP։L$a4&t$$DP藙 D$L$T$ t$$QRPVu%t?14$E t 4$1E u U;$$#(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$uAT$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$@T$L$ ut$t$$LUPQhRffSV[t$ t,FF#EgFFܺF vT2^[Í]QPQhR밐USWV[Xt$|$$|$ n? NV@)19vt$ fvt$Ut$$VPL$ ! L$T$$19s+D$ (L$@9rt$ 1)ƋD$ȃWVPÖ^_[]Í]ZPQhRleZPQhREUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [È|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWζ ;D$uY ^_[]Í ^pPQhR茴]pPQhRb\ffSP[=Pt$1Ƀ $ȃ[ÐUSWV$Yt$8D$D$ L$\1DKNl$\$1Ҁ0u.N 4 ʊ0̓+> ut+ɉ > t Hu)1Tt8t;L$ u$^_[]+XfffffUSWV[E$$$=\$DŽ$DŽ$$jP($8jP=)DŽ$PDŽ$TDŽ$XDŽ$lBhb$`$ptx$$DŽ$hDŽ$t$`PVQRt(Ƌ$`FP$t9mtE+$pt PrE۴ ;$uXļ^_[]ÍzPQjt 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RUWjP蠤 |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W-{ Pt$l$ U{ t l$ /D$D$<F\$hPWz |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WURyT$ \$WjR薢T$ |$L$F t[l$Et Nj,$U \$Wt$T$ Rhy E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$yT$ L$E E$\$l$TUGc/4$U4c$L$$9sD$DQc1ɉȃ0^_[]D$D捃1%PQj]RAW\$萡SV[t$ t Vb^[Í=PQh/RfffffUSWV|[j$o1tGljPWڀt)l$XD$\|+WQ W1|^_[]jjWjjUjFWt҃/D$ l$<$D$ƅuUW뚐USWV [|$$(rl$ NBCD3EB 3M t虣1 ^_[]Ë|$,jF0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPj[=F4~F:F:t1F;pS[t$t$&[ÐD$@ ÐSWV[T$|$9W v#wG,ʃt$<u0 Ћ0茠L  )r;GvQD$Ot$1^_[ÐUSWV[8t$,~$ED$\$Pv(t$Q 9quJi$qD$D$4$9t$2D$<$8L$HL$D$ l$D$$$$`$ttl$$;%`t %)l$ ΃$D$D$et$L D$0Fvt"l$ ׃$D$D$dt$L D$0vt"l$ ۃ$D$D$dt$L D$0ut"l$ ߃$D$D$@dt$L D$0ut"l$ $D$D$dt$L D$0Fut"l$ $D$D$ct$L D$0ut"l$ $D$D$ct$L D$0tt"l$ $D$D$@ct$L D$0t$t"l$ $D$D$b`t謆|$4tʊL$DL$ D$D$,$t0dƁ Ot yI u2D$4$D$E5L$@L$ D$l$$$记Ɓ Ot yI u2D$4$D$4L$[6.&+bp^_[ÐSWV[l|$xuƁYjVWu y2}WPVr$ ^_[ÐUSWV4[$D$0D$IuD$HL$j.QPjNjT$PQj.jR_y$tEL$PQVP D.0;D$0u 4^_[]S&USWV([xt$L$-uAD$QD$ +tD$ +u AD$Q\x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$\8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$n֍/PQhRvpːUSWV[C}PfD$|$D$ D$PKlHHPP0ppp RQWjV譌$r D$ƀe^_[]USWVP[úl$ PU^EBPUF PU.PUPUPUPU΃"jPU# 1uR\MDHt?tj PU t8u$8 L$A.&L$0t9^_[]ÐUSWVP[*l$sPU蹂txF u6jPUg" 1u[\MDHtHsj PUҕ xs8u $8 6D$t8^_[]fffffffSWV[L|$t$jWLGHO~;G~ t H WRYjWLN^_[ÐSWV[ܡT$L$Bpr~ ;B~ t 2~: RQ^_[ÐSWV[É|$(D$$u+$PcbD$D$D$D$ jWKG0u ǀD$PW>?jWqM^_[ffSWV[aHt Jt @t A ?t/t5GtU\$ L$ 1)D$ E0|$}4},1tqtk<.t t<2t[|$T$ `T$ D.BE0}4B9DD$ @ PU0}4D$|.|$T$ uT$ |$rx)D$FD$ƎE0 E4u!\$jt$jhVD$(\$1M0QU0E4A}4sKjD$E4D$ Cf U0}4D$u0}4WVu`Z C)ljD$ s2\$L$FƎjQjhRD$(D$ Ɖu0}4\$uuE1$+PWQjdjV8^9E4BPVu0< E49s)\$FƎjQjhRE4M09U0)E49L$ u4U0D$T$t$\$w)D$FD$ ƎE0 E4u"\$jt$jhVD$\$E4M0QU0E4A~~}4snhD$E4D$E0A\$Af E4w-FƎ\$jQjhR\$E4M0QU0E4AE= U ME4u0} PVu,WA!A9AD$1))lj\$}$&#u E PQjdj$+W\9E4@PWu0: E49s%FƎjQjhRE4M01U0)E41E4u0} MU }$"u D$ E HM HL$HM xQƃE t$ HV|$Wt$PQjdj$$+W2[ 9E4?PWu09 E49s%FƎjQjhRE4M01U0)E41u;D$ !u <E PlPL$ Qjdj$+WZ9E4B?PWu09 E49s%FƎjQjhRE4M01U0)E41u E P1Pt$ jdj$+WZ9E4>PWu08 E49s%FƎjQjhRE4M01U0)E41u E PQjdj$+WY9E47>PWu0 8 E49s)\$FƎjQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$FƎjQjhRE4M0QU0E4AD$`/}$D\$u M QU Qqu It$\$QRPVjdj$ +PX\$ 9E4<P$ +Pu06 E49s%FƎjQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-FƎ\$jQjhR\$E4M0QU0E4AD$#M }4E0T$WP=;E }4;E0 E4u)\$FƎjQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E PL$ Qjdj$+W/V9E4:PWu04 E49s%FƎjQjhRE4M01U0)E41E HM @Pt$ jdj$+WU9E4f:PWu0;4 E49s%FƎjQjhRE4M01U0)E41E E PE Pt$ jdj$+W+U9E49PWu03 E49s)\$FƎjQjhRE4M01U0)E41M AE  L$<%\$^L$ L$FL$ƎL$*M01U0)E41E E |$\$7%Pt$jdj$+WET9E48ƃD$PWu02 E49s\$jt$jht$,D$(E4pE ;D$8}0L$T$FT$ ƎL$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-FƎ\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru E PQjdj$+W`R9E47PWu00 E49s)\$FƎjQjhRE4M01U0)E41\$ E HM L$HM pQJE T$(|$$VPjdj$+WQ9E4H6PWu00 E49s)\$FƎjQjhRE4M01U0)E41|$\$E ^L$ L$FL$ƎL$*M01U0)E41E E D$\$O\$Pt$jdj$+WP\$9E4d5PWu09/ E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E ,PQjdj$+WO9E44PWu0q. E49s)\$FƎjQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0' E49s)\$FƎjQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-FƎ\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$FƎjQjhRE4M0QU0E4AE L$) \$PXE M4+U0B  ru0M4B\$PQjdj$+PF9E4:+Ƌ\$P$ +Pu0% E49s)\$FƎjQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$FL$ Ǝ\$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$PD$Q|$XWu u$u? E4u0} PVu,WI**E L$))|$1ҋ\$L$L$ FL$ƎL$$+р਀tsRPt$ jdjVD9E4g)PQu0:# E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$|$X\$PVQj2jWC\$9E4(PWu0l" E49s%FƎjQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$FƎjQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$FƎjQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$FƎjQjhRE4M0QU0E4AE MU \$VWu,P}$E PL$ Qjdj$+WA9E4&PWu0U  E49s%FƎjQjhRE4M01U0)E41E HM @Pt$ jdj$+WQA9E4&PWu0 E49s)\$FƎjQjhRE4M01U0)E41E E ;D$%L$^T$T$ FT$ƎL$%M01U0)E41E E ;D$@%\$Pt$ jdj$+Wq@9E4$%PWu0 E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-FƎ\$jQjhR\$E4M0QU0E4Au 'E PlPL$ Qjdj$+Wz?9E4-$PWu0 E49s%FƎjQjhRE4M01U0)E41u E PPt$ jdj$+W>9E4#PWu0{ E49s%FƎjQjhRE4M01U0)E41u E E PE E PE PWVQjdj$ +PC>}$u E E PE E PoE T$XPWVQj2jR=9E4"PWu0c E49s%FƎjQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W89E4!PWu0 E49s)\$FƎjQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0k E49d\$FƎjQjhRE46?D$E4D$W\$L$D$L$FL$ƎL$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$W/\$9E4Pt$u0x E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0 E491\$jt$ jht$(D$(E4  L$D$L$FL$ƎL$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$.\$9E4mPt$u0? E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E49-\$jt$ jht$(D$(E4\$9=}4E0)E4u)\$FƎjQjhRE4M0QU0E4AC}$n }$bPL$ Qjdj$+W[19E4PWu0 E49s%FƎjQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0g E49s%FƎjQjhRE4M01U0)E41E HM @Pt$ jdj$+Wc09E4PWu0 E49s)\$FƎjQjhRE4M01U0)E41M AE I T$(}4\$E0.E4u)\$FƎjQjhRE4M0QU0E4A g}4+E0-E4u)\$FƎjQjhRE4M0QU0E4A}3}4E0 E4u)\$FƎjQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7I$+t$I$ +f@======2|$7I$+2z4|$7I$ +r|$7I$ +rz t$>I$ +rz4w|$7I$ +r|$7I$ +rz4|$7I$+Rt$I$+2|$7I$+2z4|$7I$ +r|$7I$ +Rt$I$ +DŽ$ +====2|$7I$+2z4|$7I$ +r|$7I$ +rz t$>I$ +Rt$VI$ +Ƅ$+=fDŽ$ +==2|$7I$+2z4|$7I$ +r|$7I$ +rz t$>I$ +rz4w|$7I$ +r|$7I$ +Rt$I$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$L$D$L$FL$ƎD$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$%\$9E4(Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$ \$jPjdj$+PF)\$9E4 P$ +P|$ \$ D$D$D$D$L$FL$ƎD$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$#9E4M Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0 E495\$jt$ jht$(D$(E4|$ D$f E4w)\$FƎjQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u ηE M4 U0B  ru0M4B\$QVP"  ƋM49s)\$FƎjQjhRE4M0L$M0)D$E4z|$)D$L$FL$ Ǝ\$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P蒨PQjdj$+W%9E49 PWu0 E49s)\$FƎjQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj?}0W3 ƋE49s,\$FƎjQjhRE4}0}0)E4E \$u4u0Pjև}0WƋE49s,\$FƎjQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$FƎjQjhRE4M0QU0E4AD$w|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$D$D$D$L$FL$ƎD$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0j E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$FƎjQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u %E M4MU0B  ru0M4B\$QVP  (ƋM49s)\$FƎjQjhRE4M0L$M0)D$E4|$t)D$L$FL$ Ǝ\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$FƎjQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u xE M4U0B  ru0M4B\$QVP\ {ƋM49s)\$FƎjQjhRE4M0L$M0)D$E4|$)D$L$FL$ Ǝ\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$FƎjQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u ǭE M4U0B  ru0M4B\$QVP ƋE49s)\$FƎjQjhRE4M0M0)E4sf )E4w)\$FƎjQjhRE4M0QU0E4AE4D$E0D$|$)D$L$FL$ Ǝ\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$FƎjQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$|&D$,;$p+u ȍe^_[]Ë\$?USWV [XUt$,|$(D$ .ʋ7l$Ut$Vt$40RQĦ‹L$$7>tVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>s7%D$D$Q@(D$ 9s$FƎjQjhR)))x ^_[]1))lj$.&ƎPQhR뽐USWV Չ $[ÓST$8D$4 D$L$D$"u$FƎjQjhR|$4QA$93<$779$x"D$D$FD$ ƎD$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$FƎjQjhRMQUA+<$-i"^"D$4L$D$ ^_[]ffffYOQT$4D$#\`ÐUSWV[Q|$ l$t$~Jt$~2UVx(ƃ|$tލF9wȉ9v!(+t$^_[]ÐUSWVP[ÊP|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ } (^_[]E ffGftC,$RWסxǃ9w,$)xD$ hHGftf,$RW腡f 8 9Xσ95,$)5|$ oGwtc,$RW 8 9σ9,$)|$ oGwtc,$RW衠 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [N|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.Q ^_[]Ð~34$UOx(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0Quus]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[xK|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.^_[]Ð~34$U远x(ŃtߍE;$wMȉ;,$v [(+l$xD$$h,h,L$ H(ŋT$0PhRQuu苪U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0M(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV XH\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jōJďUPQhR|$ ďUPQhRϏďUPQhZRgfffffffUSWV[;CD$$L$1w|$ u 0@0 PUWVt$(t$(QR. 7XBL$uܧÐXBL$w1USWVXhBD$|$4t$01>0N xtNi|$|$8Z~D$D$\D$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$\Na$PQj>R ;\$qa$PQj?Rl USWVP[J@t$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]Íq$PQjgRr 1fffffXO?r ÐS[.?r ht$ PN [ffffÐ1ÐX>t ffffffUSWVX[ø>l$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMnL$"jWRPj2jQŃ9D$"PD$tPUD$pD$)D$iǓ$))ŅtUT$ T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ |$"jHQPj2jWH9W|$WD$iD$lj|$)ƋT$ D$kD$p\ txҋ9|Wy>TWPڋD$+D$pyxffffUSWV[Û;l$Uƃ;D$vS (`|$UW1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[:$$$hWP! x3l$hU$( xUWL1Ʌ;$u ȁ^_[]5ffSVP[\:L$t$D$T$ $xRQVP!x9rRQP ^[USWV[ :|$t$l$tt$$PW+&t ^_[]VWh!t W LJWVU ͐USWV[Ë9|$t$l$tt$$PW%t/ ^_[]VW t W LJWVUF ͐SWV[ 9t$|$jW1Ƀ PVW ^_[ÐUSWV[8|$tt$O#PW$tw 0l$VW/ t WRLJWVUM ^_[]ÐSWV[L8t$t5|$r#u#jV#tjV$F1^_[S[7D$tL$ ttu H1[[ÐSWV[Ü7t$t_|$G?wS>1RjV"t3jVU# tۃtjV"t jV/#^_[ÐSWV[ 7t$tAjVq"t2|$jV"wsf~ 1^_[ffS[Þ6L$T$ lP[ÐUSWVT$0L$@[X6uD$\V^D$ P-ǃx\$D$t6"f=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$$$$$D$D$D$\$$|$,Vt$8PQRWǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$t$,PV1D D$,\$hPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[Þ|$  g >L$s*D$@--tr0twPu@-'[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[üD$Hr} %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[ t$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[ND$ L$t9u[ÍPQjpRiS[D$ #L$t9u[ÍPQjpRD$t&L$tu1u 1tÐS[nL$ D$Qss)ǀ[Ãuu ǀ[ÍPQjpReS[D$tL$ t 1[[ffUSWV[ûj ϐ1tQ@@jjPj V(O8tE(W5(^_[]ÐSWVP[;|$tcOGQ9u0$jQPi 08t  G $GT$pw1^_[ÍYQPQjZRySWV[Üt$tRtC|$t3~t-0~r4;~rPV^_[ÐUSWVP[*t$t@F$t*.1tt$Vt 9<$u1^_[]ÍYdPQhR뜐USWVP[êT$J $Ћ*1|t$W2t94$u|$ l$tWE$F;$} $)Qtu<|uprP $كU|vx ux Pt&D$j.PWV!tl$t$x D$P賹L$QRPD$PWU} $t!Q4l$|$TG )|$TWT4$l$tNjM;L$Pt$hNt$ `L$TR< t< tT$ $t$W1yD$ L$L$T$H< t< tD$T$9‰L$r0D$(PQ~#D$ T$+T$‰D$2T$t$VxƅL$T$HoPB1t$D$L1D$1L$L$T$Ht$@$F D$ FL$r|t$DD$@pD$)ȉD$)r]L$@q $9wLQD$PVT$  T$@Bt$0J BL$ ) $@W藵L$ƃ)s6t$L1U$t$G(^_[]É $D$D$D$D$ VWPq D$@8|$tpD$D$wD$1L$D$D$ Pƃ$)W$Vt$t$ L$ D$@@ 9|$u|$@GL$D$LU8t$, USWV[ht$$|$%.VQt,$ ,$A h-qEhVl$ Ujl$UP‹D$p pp0Wt$UVHWt$ 2uBF tt$ G VD$@ ^_[]V߀Wߍ1 PQhRUSWV,[$@$(ȉL$ ? $Ll$LW $Dt $Dt1$D  j(ox ‰l$D$Pl$ MffL$MfD$E t$$9fl$D$|$\$$T$TPt$0t$0BzNj$Hfxx\$$PՃRD$ D$ ;D$$\$|$$;$DD$D$0$Ptȋ$@t$<$Du5QZT$=$L$P)D$l$<l$$LQ$t$8qDŽ$l$HL$ ;L$$$T}$PL$,)QPt$t$0t$0ZAeNJD$0D$$D$8D$D$4 $T$$Hfx$x\$t$T$HT$!l$ / t$$D$(9\$UDfD$0EPDǍEPDՃ l$ 91ft$0f"D$<-\$h$+Pt$0VQt$0U@qNj$Hfxx\$$'PT$HF;t$  4$T$4L$9\$|$r/(PV[w l$4L$)$1D$L$t$V=ƃt$$'PNjD$,)9\$P$+PVj D$$L$D \$#fh$+Pt$0VQt$0?,Nj$Hfxx\$$'PDB;t$ \$$'P=NjD$L$,)9\$Q$+QPi D$D$LD$$|$ |$Ht$$9wD$L$,)\$QP|$WVt$0,>ǃD$H=;$D|$ uNfff -t$t$PL$t$(c$Qt$@Ff$w-j5D$0$Do4Vd4PW|$t$8t$HQj%腔T$T$@t$$P6St$t$6Pj%H$D$@9F f|$0u D$(8gt$|$u$L0V1ƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WPT$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PRAs l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0V說=~ $!D$1$D$$1D$\$|$$Rx1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$<Ĩ=(ƋD$L$,)9Qt$@Pd D$$LD$ꋄ$H@ tՍT$$Lt$, D$D$l$)Ճt$,)9sC$LAURPX 4$ul$l$$T$8)ƒ)19s@Qu蹷1$X;$(,^_[]Ë$LnRPUՊ 1‰(si֍PQhRviT$$PQhRIT$4z?|$4X聳USWVT[$h>Wt1T$ T$G j(c¸hl$D$D$ D$$D$$1|$ D$ l$Pt$ Vnhǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< tPWgt1ɀ8 L$L$D$D$L$ t WPStT$$9s=ȉD$))9)ƃ $1t?tdD$FFD$F ))t$0uUt$t$ hMt$D$MD$L$ut$t$ hNt$&L$v^_[]ÍהPQh`RT$הPQhaRT$XהPQhbR蒧T$_jffffffUSWV4[Xl$PD$0|$LtCt$Ht\t{uL$LI;L$00/JYPQjIR뜍>YPQjJRƦut$L||$D$,D$(D$$D$ 1Ʉ.<:u~: t$LL$ $t$ ~D$SL$dL$1D$jD$Pt$$V ujt$t$ Vs t'It$) Ɖt$up1ɀ|$:"tA?m$L$09ȹVT$f $f1$|$ D$1|$ |$$D$tt$$p1ɍD$09L$f$f4$|$D$09t}+D$T$ҹtBlj1ҐD/DD.D9u߹)щtR)ȋt$NJT$ )ʈB>81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]ÍJoPQhR]>oPQhRBKUSWV։[_~\LZu 1^_[]É4$t$0t$u'_ dPQjnR^fffUSWVx[$D$t$$uz$|$ $OW͕t$6WRQPUjV6$79/VW$VMS %/1JzPQjHR3>zPQjIR#$=D$,D$(D$$D$ D$D$D$D$1$  LDLDT ʉTDuދt$11Ʌك|$t к$ʃ$|$|$ Jt'D$,$9L$ L$uT$4$у|$3t#L$,$9͉u|$4$|$  t'D$,$9L$ L$uT$4$у|$$ t#L$$9͉u֋|$4$|$(Ϲt%l$Ƌ,$9u|$4$|$|$, ‹4$9utƿt׉|$tƺt|$ tƿt׉|$$tƽt|$( σtƹt|$,t¸tȃ4$9u$$|ȃt|$F$ȉD$1퍃LD$0L$t9|;l$}9u:ِtNwD$t9 :u5u1$t tuR|$$uF|$,u?t$t)tt$4VW蹹L$9K$G O Wo͕URQPW|$JjWm~nL$t)9sdQWVN V{L$t|$uGL$t9s<:HT$t9s*D$F);$w$P1|$ ;D$tx^_[]ÍJ•zPQjhR1>•zPQjiRƛJٕzPQhR蟛>ٕzPQhRu(CffffUSWV[E$8u{kjUczE(D$t`$$$tWtvRUhsE urjjjuT$ !ЃE S耠1L$1$L$ D$L$ 1$uP}Tu'$tGEt@+E<$ $<$+Eu0)׃>t E<)׋$΋$x`<$1L$D$ D$$}T$uUt$T$ E ulD$;tM gE=t܉t$L$4QP{t$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QPH{L$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tR[D$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQZD$e ߋD$)D$Uyu E;D$U_otjU xİ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t Q&ZE0EEEe jUw1뙋t$uyb)EۍPQjGR/'PQhRD$D$ D$N>PQhRѕEtfffUSWV [èt$@|$4uu>FD$FD$\$jt$8t1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$uޗPQhRaUSWVP[|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]Í9{PQhR~uPQhRXaUSWVP[:t$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]Í9{ PQhR豈{h PQhR臈T9{͍@PQhR^4USWVP[:t$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]Í9{PQhR豇{hPQhR臇T9{͍TPQhR^4USWVP[:|$l$tcEtDt u91?$EQUPEQUt 1<$1^_[]Í9{"PQhR豆{U"PQhR臆TUSWVP[Z|$l$tStuEt8tu-$EQUPEQUt$1^_[]Í9{,PQhRuX,PQh R軅dUSWV[Û|$T$tL$t )ŋt1tXuQBWQRP t?t=Gȸ UQWP%BWQRP ttGxUQWP 1^_[]Í9{6֍PQh*RFh6ՍPQh0R资L$(,USWV [Èt$$l$ P|$(k6Et,t@EL$QUD$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$U ǀ|$tB}u.u^[ÐS[t$t$t$t$t$J[ÐSV[t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[Ϊt$ t$ [ÐS[îD$t$ P[ÐS[~t$[ÐS[^t$Z[ffY? ÐXL$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$JPQV ƍGэ}L$,|$ U(!Ћ$'W|$ƀހ:w7$|w;t$b\Gn߃^rxo;l$1\,, $*hwkdT$Ɖ*t$i $*hwi (Ћ4$hWm;|$Yȃ|$ U(!Ћ$JPQV xuD$ ƋL$$+QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$;w(^_[]Ë$wᐐS[.jt$t$t$[ÐUSWV([|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ l0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[nL$T$ lPt$ [ÐUSWVT$[2ɉ$t$4|$ |$0t=D$0|$ "v-d1T$VPP\$u+t-t$0u#D$ D$t$0t@D$u20u- PQjFR[p{>PQjGRX[ S[.lt$t$Pt$k[ÐSVP[D$L$T$t$4$VRQP5^[ÐSVP[üD$L$T$$lRQVP^[ffffffUSWV[xD$|$(u-|$ "8u D$ L$(A0u ǀy$1Wl$,uP>3 E})Elj4$|$t$(VbQ~6Wt$(V73 t)T $΋T$rsxoD$D$ ;0srnEt%  ȉ  ȉ ŃU2QtL$L$ ) $^(D$(H @^_[]F @4$utD$t0ٍęPQj@RXD$,cUSWV[ût$l$|$ jW7WUVt$ jW9^_[]fffSWV[l8ظ 8tfs(PQ Džu:jE t.P JGGG ^_[ÐS[ތ PQP[fffffSWV[ìt$|$t]WV0 ^_[ffUSWV[{l$|$[$PQVx t"t$UV| @VjjPt)W4'PQVw ^_[]fUSWV<[$T$PE$8FNt,$ @QP0,$NolȃFFD$$wD$$Vj Pl1Ʌ,$t$ D$D$D$ D$PD$XǍԚt$8jWPhVr=hVl\D$t}ƍPVr\tGL$T$RQWЃ D$ t2L$t*tB\RjQPv-,$V D$;t P[D$ u QP$tj t$|$|$|$ |$|$l$l| |$||$|4 ,$t t$ jQP1Ct$AD$t*L$tt$t$уD$;t P&[E;$8u^ȁ<^_[]Í ֙PQh~R6T_J֙PQhR T8S[ވD$ L$01h[ÐUSWV[èt$,INtT07RQPWq~17D$ID$ D$|D$kD$[$ t$7q;~F4UqFDtt$qFDtu&u8tMt$ pFDt4$pFDtt$pFDXt$pGj o^_[]Í ,֙PQhR9RUSWV[|$ 11 t5D$0ft$ 9rԋ <.D5tDot-1t P,9tGGPGT$JRWO ֙PQhR9Q !1ɋ I `QPt8 Il$u}ml|4 t 1^_[]ÐUSWV\[èL$||$x$+|$x8D$8tvƉD$HW tgi9t uD$tL$HD$ D$ W9$u8; H u(!D$D$ D$ WdD$PD$xD$<,L$GtۋOtw wуG;tP(R볅t Vǃ ǃ $0@ t,Qj P !D$HL$L  t$Qt$Ĕ^_[]ÐS[D$ L$01r_[ÐSWV[Ü|$t$wv>Bu 76._^_[fff̀rS[Tt[USWV[8|$ P$D$l$$lt$L$T$(PVUWt$<9tO $+t$ O"1^_[]ÐUSWVP[ê~t$vO8$l$ L$T$$t$,PUVt$8=9t5^_[]Ã19tiF9udFqF9ulFyF9utFF9u|F뫐SV[cV1dPmV^[ÐS[Îc1dPw[?SV[]cV覨1 V薨^[USWV [&c@ ɉ$tG$W$\$1=L$D ~5H $WP%\$uD$D u $hR\$Ɖ@ tPj3t0jdždN-00|$~H hWPO @ t(Ъ̪ǃ @V҉t$>iFs0hFށdN$̪t$>-00t!t$t0J$1ɋ\$+dF$ >-00uȅVaFs0`FށdN$̪t,>-00t!t$t=J11ɋ\$+\F$ >-00u D$D ^_[]ÐSWV[Ü`hRƅt(T$j!tV :181^_[USWVP[H`D$tBՀ:Pt=ǀ}:ju1ɉPDžF $1퐐9}h.dNP Ń=~߿TFFF fFdžhFdždFdždNUTC><$~81퍻1 9,$t".dNjEPW uƄ.dN_1^_[]ÐS[^t$[ÐS[^t$jt$t$[ÐUSWV8[ã^M 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtfL9| }Z^FD$ 9߉D$ T$|$\$#)L$ #11uj+D(H(4\$tg;~N|X1Ƀ|I|$T$ 9}'4}t$;tt$t}։9|كu>L$dFL$(uV*T$iFH hFdNP(}j̪[1+dF GыV+D L\$jhY`QPӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U|Rut]9D ΋u}\$-1kD$ \$uuPVftML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐSWV[ì[t$W1dPH PjV@ W踠^_[ÐUSWV[;[l$t$W|D u1dPUjV@ ;W@^_[]ÐUSWV[Z|$t$U H uƃH U1Wj(t (H(^_[]ÐSV[]Zt$L$t$j'tt(H(^[ÐSWV[ Zt$WQH uƃH W8 1PjC't (H(^_[ÐUSWV[ÛYt$|$UܞH uƃH UÞ Pj&tt(H(^_[]ÐUSWV[Yt$|$U\H uƃH UCt$jQ&tt(H(^_[]USWV[ëXt$U1dPG@ t LjP.U躝H uƃH U衝jjƉU耝^_[]ÐSWV[ Xt$D$t LjP4W<H uƃH W#jj/^_[ÐSWV[ÜWt$D$tF t LjP4WH uƃH W訜jj^_[ÐS[WD$t@ PN[ÐUSWV[Vt$tF |$U!H uƃH UWj^_[]ÐUSWV,[uVD$$$(=ΉT$y |F 'D$ D$l$jP$LP$LW*|$t ֋|$ ωjD$P$LV*ʼnր|$t |$ |$G $@D$G~$(PjQ" G>D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽%8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU(|$u|T$jD$P$L$L(|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ dUSWV4[ÈSL$HD$AD$ AD$A D$AD$AD$A$D$,D$ D$(V荘H uƃH Vt#D$|$L$jWjj'|$uL$jWjj~'|$t1ՉNjt$#0|$ xt$ |$H4^_[]Ã|$(xۿ뿐SWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[R$P`D u1dPl$|$@ tABR lP~;yQq|1)͋$P^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[ÛOUD u1dPl2|$t$@ tWVP ƉU蛔^_[]ÐUSWV[OD$D$fBt π?:t k?:u$,?/4$\$u(\$jW=\$ W?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrD$\\$hWP; j.WtU\$j.Pet59tx/ux.uHt/uэ|$H4$$," 4$\$h@ W腋ǍD$HhPW( +&y \$n0\$W"D$(WgdND$4lPD$0T$LD$D$T$#D$ D$`T$a |$b L$cy ρ D$\T$] t$^ L$_y ΁ Ήt$D$dT$e l$f T$gy Ձ D$hƒt$i L$j T$ky с D$lƒt$m \$n T$o|$y Ӂ D$pƒ|$q t$r T$sy ց ֋D$|$1T$1=y\$$ZL$ʼnL$,ȉ\$@ÉӍ/L$‰Ë\$$[B,9D$(/D$ D$tXD$t‰T$4$\$T$HЋ|$)L$(hL$,QWR8|$#D$ {|$t9D$t9$T$,HXp 1D$uT$1l$t= $Ƅ9>l$ $\DT$ՃD$ 9|$D$ Mȃl$uAT$j ŋD$X l$EÁy] ËD$h ݋D$X T$j ݋T$R l$] y M  É $Ƅ9>t*l L9݉9@1l$l$~iD$9T$$4$1><t >nm^9};|$ |$ 91L$tL$T$14$|$\$$L$ L$T$|$F1\$ ʃ{ s {y $dFJ|$,ӄiFRN 9hF9q\$T$N 1ۅQ΃1rY̓1$\$;8dNT;8eNT;8fNT;8gN9u\$1ۅt"|$41D$(/9uD$4$T$|$1ƄfNfDŽdND$81L$0L$<1ۋl$39l$l$@L$:.>unM߃$iN$\D$1. $tDA)>ii;T$tyl$lp $ Y I|$0,~;uM}|1ۉȋl$p{<$L9t }`$@\$ ۋ4$.S؃1Ƀ1ɋVr<$w̼  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF4$91tA ́ 1ҋ4$v~$x<ыl$hF$dF4$9ũ~ 1\$躳USWV։[@tK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR' $Ec\$jt$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0V >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$!8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$i QL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$L1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ@1i4Q9uB ^_[]ÐUSWV0T$ $Xq2D$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$D$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$)ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ e麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$7)jhUt$ !T$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9 l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP)Nj\$jhUt$ћL$D$|$s؉D$͉)пjjUt$FD$(|$\$jhUt$$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ t$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPI)jhUt$3U\$T1ڽT$\$jjdUR)jhUt$ޙt$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$@|$ 9|ځD1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$4X<+D$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jPn~ e1^_[]fUSWV[Ël$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]Í؛PQjFRq)؛PQjGR|$$bL؛PQjHR>ffffUSWV[Ël$t$|$tU6^_[]ÍEPQhROʐUSWVP$[%t$T U`t,jtPx $Hp t t 17"  xuxt)txu8u밾Ur`^_[]Ã듍EPQhRqKUSWV[HT D$ P `p t t $x L$ L$ǐ|$$tD$$9G t GtOt  tGwЃ GЋt 9tt DžuZp u';|$r$;|$s<$$<$C<$1p t$ ^p u#t7W衩u^_[]ÐSWV[t$T W^"  xuxt&t xu8uj蜘u $p@@ t t 1W^^_[ÍEPQhR&IfffffffUSWV[$$$$$tD$$DŽ$DŽ$ $$jP']$@jP]DŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^PQjPRpPQjQRqT $ ;$u ^_[]8S[^lt$t$Pt$t$7[ÐSWVP[+D$L$T$t$ 4$lVRWQP^_[ÐSWVP[D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[ët$}XjWE`HM`~;Ep~ t EXHMX WRjW^_[]ÐSWV[,L$B`pr`~ ;Bp~ t rX~zX XRQA^_[fffffSP[D$ L$ $XQPR[ÐSVP[ÜD$L$T$$XRQPVD^[fffffUSWV[XT$(t$$|$ t&t"qTN @14$t8t$jR/L$0A uy$‰Ņ1@<$1qyQ0uE)ljuދt$$$)1t$ ƉACAAAjQ֍PQj=RCK׍PQjQRՋ)v1WPV/ L$(9l$QhuC}T$RPV |$(Gy<)ЉAjQt$$jU$+D$1t$ Ɖ^_[]ÍXPQhR[L$8AffffffSP[-D$ L$T$$RQP[[ÐSVP[D$L$T$t$4$VRQPEB^[fffffffUSWVP[út$|$PVG1sht$t$ 'Q x=|PQ+fF FfFfn vF$F,F(F $tjjjV^_[]ÍxPQj>R)ffffSWV[ü|$t%jWw jW^_[ÍŝPQj;RxfSWV[\|$WG;D$w+t$9w 9w9w 9wPWVY ^_[fffffSV[D$;D$wt$ Pt$VɅ ^[謅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[ôt[USWV[Ût$F0u ǀFFF tVu"Vut) aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]Í@PQjL$aD$?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$Pݓ\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $XD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $xT$ L$D$n6 D$0 L$ I $T$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $P|D$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$D$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0Q覠,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwPƒD$ƒ;T$,v$+D$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$PD\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$͞H$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$͞H$PQhRUD$뀉׋$G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$͞H$PQhR=EL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$ԪB|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$͞H$PQhR2U|$뉐|$UD$xT$ Ӌ$ԪClj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZ t$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v PdDE|$8E|$8|1 uT t$ 9wS$w닔xwl$Pmt t$T l$PU\ / U| 룋$L$19u $PT<^_[]þUSWVP[XD$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$肑USWV [D$ 069rljT$D$uj$jWPH 螔(藔9$T$JHJHJHJHJ H JH RPE$jWP 8(18t!'0t$Q0*)4$PjV5 $L$D$ 81 ^_[]ffffUSWVP[EET$@t$DT$$dpU }֞jߞjD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjP  )ȫjRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]裍USWV׉['l$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[m|$hE t$p |$<$ MM$U֞jߞjl$l$܋|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPD )ȫjQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]ffffUSWV[pEx\$t*\$4W=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$֞juL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$ߞj؋E\$ȫju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wPD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$D|$<ػt|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃tL$T$vثtv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQU=1$t?$L$U6$1xL$^_[]þTx0ffffSWV[̧t$|$ty8L$tu1 1 ^_[Í9+PQj5RhrfVL$T$ tu1 ^Á1 ^fffffUSWV[M1ЃωT$(ЃM$U hE81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1F֞j<ߞj)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋܃$ۄ$܋҉t$$~@CM ~O$VRM$U ȫjQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$Lwm|D$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك|$tT$L$؃ݜ$$$$$݄$D|$@ػtD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكD$!؃|$8=؋كT$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃tD$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثtv#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[D$1r 1 9vW<t8Ɖ^_[ÐSWV[üD$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[-D$ PHpR=^[USWV XT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[.xSVH[D$0hjP Z D$(D$,DŽ$@DŽ$DD$ D$D$$jPj5 .L$(VPQj5D$$D$ D$D$D$D$D$jPj\ js[j[S[S[fffffffUSWV[ۋt$|$tK1tt (h1^_[]ÐUSWV[}uu)\$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$4ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋt$(PV'T$4D$(hPV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQJ D$p '3 |$4t$N  D$0P QVR  t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}E("P"L$D$ffffUSWVt$F98[-W |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[CVu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[[Ut$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXTǀ ǀ fǀ ǀ) fǀ- ǀ fǀ USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[LSD$H~( 1u 9r1$PƉ^[fUSWV[RL$8?tP裖 w̽ t{̽ ?u1>PƅD$t/Fn?tPCFF ^_[]1?tPT )ʉʁ oΉoUSWV[Qt$tbF!r VsO8}t3W荕}F̽ ̽ tWk̽ ̽ ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[Pl$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UEE!r\U/18}$P=}T$,B̽ ̽ ti4$\8}th$P1}F̽ ̽ t14$͒$̽ T$, ̽ D$TG^_[]Ë̽ ̽ 1␐T$1Ɂsrr@r"y(6s@sރx @tS[.Nj,tL$H@[ÐUSWV$[MD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU<8?t:V͌?E̽ M̽ $t#V訌D$̽ M̽ $^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[8HD$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [ÃEE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[åB$t|1a1ԶѠPQjERh P$1D$jjWk ʼn$tƒ9tt#D$PW&to#D$=uTtVƋD$fF $tu fF f~vF$F,F(F UOĄ^_[]fS[^At$t$jt$0[fffffSWV[,A|$t@jWaGHO~ H0 WjWB^_[ÍQ٠PQj=R 럐SV[í@t$ t%FHN~ H V^[Í٠PQjIRi ffUSWV[K@t$atrt!w 11ҊNtgtGɍyw@ؐ+u˽뿁뷁 ՋL$) `1^_[]ÍcZ PQj>Rg fffffffSWV[t[SV[=t$ t;F0u ǀVNuFH^[ÍPQj;RfffffffSWV[l=|$A8uGG Ⱦ uuL  O @G0taW@9t QG0GG81t&WXG GGfG u WG t'DV PVȁGOQPwW$ GO fO 1!t Gf@f  fG ^_[Í.PQjJRSV[;t$ tF Ш u V[1^[Í8PQj;RSWV[Ü;t$t` 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWPƈ6@VRQWPL^_[ÐX:L$,AA A AAAÐfffffUSWV[õ:$ut hj`1$džt.%u%D$PQ?1t+ 8$u! 8u $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hVu VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaF?j P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNCot(1VY(1^_[]14dž$j$観tJplHHH \H H,H\H 88oUSWVՉ[5jqҼlj1&NL$jP蜼$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u18"8^_[]ÐUSWV[É34jQ@# t D81t>0rPt_t u8~)1 9}8tQ݋t P\qV\t81^_[]ÐSWV[Ì2|$tOW^_[ÐSV[M2D$ p|$s t.jt$ 1dž,dž,^[S[1L$tAt[[ÐSV[Ý1D$ p|$t_dž,1t$t$^[ÐSV[M1D$L$ qt dž,&t 1҃ƒt$t$^[dž,빐USWV[0l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uNU׍KPQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $wbύ֍KPQhR1Vǂ $ǂ(#idž,^_[]Ë(Lyw+jt$(t$(VRu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[Ü-|$te^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[(-|$(o(o(OG0!D$;G9} $wD$D$ P$L$L$D$QPt$荠 $L$QjP t$%$D$ GjwB $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$Wy ^_[]ÐSV[+t$ t$t$ #F,;F(~#F0^[ÐSWV[æ+4aA?j P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>NL$a D$`$^_[]Ët$ |$L$$Jl$Dijt$@URV2uD$`뒀gt$l$UV݇ ut$f\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBr<2PQjbRvrUSWV[HD$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]Í<2PQjbRrPfffffUSWV[K|$oEtjPu7 EjWu,EtP茥E EtPkDžDžtPDDžDžU!WVU^_[]ÐUSWV[H|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[=D$;D$wt$ Pt$V9 ^[ffffffL$1s!t11҃9rfWV_D$tL$ P1 1^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[L$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T$<2PQjbRvT$(L$?<2PQjbRJT$D$D$른O<2PQjbR$u 1(^_[]Í<2PQjbR<2PQjbRUSWV[hT$0t$,l$$E( oM;dM9X$E(  D$($I҉t*t$BfD$D$Pt$UmT$< Pvƃ9Љv*t$BfD$D$Pt$UlT$< vƃ9ЉuXAtQjPup ƉD$fD$D$Pt$UYl jVu# T$0L$fT$|$(u 0t$fT$EL$jjjPPQUjT$LM(|$fT$MD$jjjQL$QPUJjT$LGM(FjPu臕 ƉD$hfl$D$Pt$l$,UVk t#jVu$ T$0M(E(jVu T$0D$ED$fEDV<DtG PU7ntkGt PUntNO, F)WPPbo ,$fnT$0|Vnft9uf&BMf9s $fMnfuvv9f$+t$0ftpt$ 1fuf9tL]4$f9r1ߐftMf9s $fMMf9s $fM)ȋ$t$ fs:t$,fFT$$J( 1uJ;uJ;L$0vfJ^_[]1ftMf9tTMf9r1ftMTMf9r1ftMTMf9r1ftMTMf9r1뢍<2PQjbRT$@<2PQjbRT$@<2PQjbRvT$@<2PQjbRNUSWVT$["A,D$L$;t$cFjv7 $FD$Du (Dt&A PWl$kl$}sBu`}U|$W UWfz;i ,E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$,D$$t%ht$Wp0 $t*+$hW>P1Ƀ89t$1퐐$(j?Pt$轖 taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$ZO<ՍPQjCRWꋌ$1Ƀ8cfffffffSV[ D$;D$w.L$t$ 9w9w9w9wPQV ^[dffUSWVx[øD$tD$pD$lD$hD$dL$$T$dPjD$@FD$\9tC;D$$uL(^_[]ÍFPQh<R j$jU0 볍<P'VUSWV[$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍlT T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø荗USWV4XD$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$LB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$ܢlPQhRے\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$ܢlPQh|R趐\$T$\$<2PQjbR腐\$T$\$ܢlPQhRQ\$T$\$ܢlPQhR\$lffffffUSWV[|$8D$,hEtjPu_ E wJrr G&E(uI1GT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZc<2PQjbR蹍I<2PQjbR艍w8<2PQjbR^;E,jjuK[ Ǎ<$fD$2E(uEf $fD$$E($EfD$1$8t$EtPNE EE($}fu E(jQt$xsB tt$t$jbPwэ<2PQjbRTD$<2T$ PQjbR(D$T$Ǎ<2֍PQjbRUSWV[˼|$l$t$FtPPKF FF($nf~ F(^_[]USWV[vt$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7<2PQjbR;몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU Ҹˍ<2PQjbRB!fffffUSWV0[u~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍<2PQjbRƒD$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$$<2RQjbPT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ :8u 9u1)^_[fYϲD$@P(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPIz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐY_D$`P\PXPTPPP LPHPD@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[nt$t$t$ [ÐS[>t$ t$ F[ÐS[L$T$ j[ÐSV[t$ tAdj@PV O FPhjPw F@FDFHFL^[ÐUSWVX$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPm FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[Mt$ tA$j@PVkD FPhjP8m F@FDFHFL^[ÐS[t$t$t$ [ÐS[þt$ t$ [ÐSWV[Üt$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVl ^_[fffffffT$D$fUSWV[MD$$&yddḰ ~? gL$9 \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <X 1D$D$ D$D$L$8T$jjPQjR@tD$8X D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$L$L$ƥFL$եL$L$L$LhjjjPQRCD$L$8T$jjPQt$RQ?L$81 u*jPy _UiK1D:0D$D$D$ D$L$8T$jjPQjR>t$8|$<7QPWVD$D$D$ D$L$8T$jjPQjR[>D$XL$ L$&hjjjPQRuMD$D$ D$L$8T$jjPQt$R=tD$8he^_[]fffffS[þ [ÐUSWV,[Øl$@D$D$ D$$D$(L$ D$QPjH W)1|$D1҃|$H1‰|$\ 2d l t |      t t} t{ ty tw tu ts d1`YRKD=6/( !    s#4Á` uH< |$9T$vQ׋ jjjhjPj! \ t+f@ fɉ9sfэ4fxtnF|$DtL$DHH|$HtT$HQ|$ tīuȫī|$DtЫЫ1|$Htثثt$jWj ,^_[]þ |$ $ LjjPQjRg:<$ ȅUSWV[;WītV6uV#dP7ƅt3>#̫tUmuW0 #ԫtUmujW>^_[]ffS [{ uoD$D$$ T$jjPQjR!9t1 u,YPQjAR^  [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[Kl$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQPOV QRP ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRP$t,NQW QRP FEE1^_[]ÐSWV[ɐD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [xT$0|$,D$(L$$)q092sVP[$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[ÈL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[x|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[ôt[̀rS[Ôt[S[~t$ t$ jt$$t$$t$$t$$t$$  [fffffS[>t[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[È$D$D$huET1}8XM4tI$PL E8*$$E4E0|$ 1D$L$j`QPu8VR0ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$,(0|$ WZ$Ƅ$D$TPWt.$Ƅ$8u$L$ThPQ  $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U !UjD$$PU 8 ʼn`UD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PWx h$PWb U|$|$Tt$h$PW/ |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$PCE$$t8ISltC$($,2D$XP$06 $0$$tRt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TPyB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QP t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QPg t$|$ t$$tP2A$$t P"$($,uWP t$l$$t$|$t$P@E$$8$j`t@8@P$i$t$|$t$PA@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP t$$t$$tP?$$tL$$s.SWV[L~tM΋uA~8t:~4~"`N4F8 I9rP F8^_[ffffffS[}D$L$ AQ jQ0 [ÐSWV[Ì}|$t$t+jP6 tH  W6,^_[ff̀rS[$}t[̀rS[}t[USWV^|$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLX{D$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gqo91pjPQw1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[ ht$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[ø Pjj%Q4SWV[LgD$L$Pt prxxp| pPxtz xyV1^_[ÐUSWV[f|$ l$9v`wDt9xtNȅuT$81$Xq3H7<871*׋PtIQPEjPQD$ pD$,L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~yk6ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p&2 D$ L$Q$ЈA1ÐSV[dt$ V PNtHP tQ P V-1^[ÐSWV[ldt$>gthGt tww$Ѓ gpNjPQw蕦;u<tww$Ѓ 4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[cD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[èbt$0|$,ttqP3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P| Pt$8=t +l$1jt$8_1^_[]fffffffUSWV[a|$(T$$<Gx:B tzu?Rt*d2 O2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj WV t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$xT$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QP7T$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]Ín2PQjGR(T$4yn2PQjHRm(T$4USWV[K]|$tpjWG 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;DWP=Wx- jW^_[]ÀO @1USWV[k\t$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]ÍPQjVR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[Zt$8uN uRt8F0t~@9tR)F0N FFfN ~u VkN u1uVVF11+NN^_[ÍɧPQj'PQjBRuK'PQjCReaSWV[TPQjUR]2KTPQjVR6USWV[ Nt$t^9vu}L$D$|$ ntWQPR!N tfN FPVT fN ^_[]Í/]PQjiR9vt>]PQjjRj_SV[MMt$ t$9vuCNtP輋^[Í/ePQj{R 9vt>ePQj|R뜐6̀rS[Lt[S[îLt$t$t$jt$l [fffS[~LL$T$ lPt$ [ÐUSWV,T$ XBLD$D$@t$Dl$\$t7D$@l$"v'1ɻT$ EVPu+t-|$@u$D$ D$|$@UtED$u70u2E GT$B=s\DP%[Íf[ÐS[FT$B=sD$ DP%[ÍŪ[ÐS[ÞFT$B=s\DP[ÍϪ[ÐS[^FT$B=sD$ DP[Íת[ÐS[FT$B=s\DP[Í8[ÐS[ET$B=sD$ DP[Í[ÐS[~ET$B=s\DP[Í[ÐS[>ET$B=sD$ DP[Í`[ÐS[DT$B=s\DP[Í[ÐS[îDT$B=sD$ DP[Í [ÐS[^DT$B=s\DP%[Í[ÐS[DT$B=sD$ DP%[Í.[ÐS[þCT$B=s\DP [Í)[ÐS[~CT$B=sD$ DP [Í1[ÐS[.CT$B=s\DP@[Í;X[ÐS[BT$B=sD$ DP@[ÍC[ÐS[ÞBT$B=s\DP%[ÍM[ÐS[NBT$B=sD$ DP%[ÍUn[ÐS[AT$B=s\DP%[Í_&[ÐS[îAT$B=sD$ DP%[Íh[ÐS[^AT$B=sDP[Ís[ÐS[AT$B=sD$ DP[Í{C[ÐS[@T$B=sDP[Í[ÐS[Î@T$B=sD$ DP[Í[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[?t[D$t8t9@€tuuuuH+D$ÐffSWV[ì>0t1fjWQw t u1^_[ffffffS[N>Pt$t[ËD$p1[ÐfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[k7l$$t$|$t9t5D$,tL$ z91Ʌ1^_[]Íش|PQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[Ý6t$t8D$ t|$tT$t121Ҁ9 11^[Í|PQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[Õ5$0ЉׅtPϋ$t[RWPQ$$$4UhVH$yPVjcq S[5t$jt$t$PUSWV[4$$$$0ЉՅtP$ t[$RUPW$,$<QhVt$t;}l$VPQhUJPUjep tWD$ hjP' D$D$DŽ$DŽ$ .L$VPQj $;$^_[]ǃP膺҃¿+w狔$ у̃ǃƒS[3t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[Ê2D$ D$D$$jVjn uƃ tjljj0jVjn jIjfffffffSV0[1t$̀rS[40t[S[0|jPt$t$t$[ffSVP[/D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[d/t[PS[M/[fffffffS[/88t3[Ë[ffff̀rS[.t[S[.j1[ffSV[í. u# V>u@1 ^[Ðfffffff1ÐÐ1Ð1ÐX.Ð1ÐÐUSWV,[-l$D|$@ |ƃƵ] =sdf Fw%  =uɋ 뿐 QUhWL$L$뀋 |$@l$Dt1 t& 9s8u+p /ƃ D$D$(D$$D$ D$D$D$ D$ D$  fD$ D$D$Uj(P׃8^_[]Í]PQhR]fffffffUSWVX+$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$ *MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$[8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$+l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$[D$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$[D$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WP}T$$4$4$4$4U$0R&U׶=r,j$ K;$u;^_[]Åt|.u|$qpUPQhWKft$|=(PVt$|UQ2$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$ExnNj$L$|PQ J$L$xPL$QI$ǃ$fB$) $W 9$A A L$|PQlI$L$xPQQI$Pj\I$PQ%I$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPbDƅxՍ7Pj H7Pt$H7PjH7PjdH$ 1۸$IUSWV[l$ |$t$D$@tعP) l$$FPj)GF|PQGfFD$@ u1ftPVPyGVjkGG fffG )^_[]ÐUSWVP[ l$0t$$T$ |$D$@tPT$$։)͉ $9L$(B99t$4D$,WPFGPl$UFGUVP誔L$4 )΁r&IPQh=RCL$8QPOF+l$ ^_[]fffffffS[jt$ [ÐUSWV[$ $D$0$jUEEt U uEEEjmU U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžhltkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU+DD$ djVU P!uƅD$$}`hVW ƅ_EH}DM\D$ 19s( w 1҅tމ8D$ Ϲրwr tt$$D$ PtPǍ$WhhPhE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$PA$<#t<;t΋$doma1$in $sear1$ch #j P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P5 $< t< 0$< w d A< vhQt$H ƅ_Pt$^nD$ kc$< t< H$< w& A< vhQt$V赇 ƅ_j VtuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< tPVe< D$<@@@@ @@D$@D$82}j5Pj j$P-D$PD$;t$ s E$EtJP|EDt%uH(PWYu퍃)PA/Pkt#V[ML$0 ;$u ^_[]VUSWV[ët$xP&"džft91 9s)tQ!DŽͅtMtt|5X9ut!xt P!WqdžtPuqdžf^_[]ÐUSV[äEu jPc$D$F$FWfF e^[]ÐUSWVx[CEL$ L$pu D$jPbD$3D$fGt$V jWV VWJGL$ ;L$pue^_[]TUSWV[ët$xP, dž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[ÄD$At;t$0UP EO $L$(T$ L$]L$dL$ F< t< tjt$V qjPVܡ j PV¡ 7jPV訡 &ĺj PV莡 j PVt 3zjPVZ  ѺjPV@ غjPV& ۺj PV jPV +jPVؠ jPV辠 jPV褠 j PV芠  4jPVm ejPVS $`FPC5d$/FP#|Gt^zGddGtAPt$'F P|GGtPQ7< < {$H׋$ut$0UP $4Py뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]PVX?r?D$PVt$y D$L$Ƅ|$PVnX?r?D$PVt$by D$L$Ƅ($H^_[]ÐUSWVx[H$$l3 h3 p; t|P9h@tP|x$D$D$%D$ D$D$D$ PjjjQt_ett. T$F(t thx 9tF F$F藋(t x r R| `  ^_[]19u뫐S[^'QPR j萚SWV[,t$8t t3x 9t^t, | z t t7x 9u x ~t vGVG^[19uΐS[t$G[ÐWVXL$ tsAQQBQQAA,t tDx 49u4x 4~ v| `  ^_19uSWV[Lt$trTt x t/<t) | z A)VPPT$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍+ݾPQhRyoL$4T$0^ EjVtE 1t u1@u )d1Ƀ Vt^_[]ÐUSWV([(t$@l$<}GtjP7> G ujU蚌0 81qujWjjjU 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P0 L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP` u !1(^_[]fffffUSWV[;|$ t$tGw#jP*džL$G|$$1D$@DA,Du!@Mu:O}GQWPUVu^/|$$KQ;v RPj)t2MQUQRP$ EG/1^_[]ffUSWV[|$$G,D$$jj78 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$<2׍FPQjbRi\$8=$roD$L$,td;l$tX14Eju7k7 t%MLH4jP7>9 ;l$unL$1 Gw)f_ ^_[]ffffffUSWV [|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$RE $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]Íֿ̿PQhRgT$믐USWVhXD$|$|G =tŋ\$jj$W?{$jj$W\$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$go ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$WgO t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$T$ PQhSR!bT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$PQhR|a끐USWV[VD$lAB9w}) >P2Q D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p *L$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$j1Pj^ _1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V 1Ʌt‰ D$0L$ЃVhPL[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$08C1\$$PQhRzX\$T$ D$4@USWV[HT$B =tL$|$ t1|$,t*l$$|$(tVz<t~UwT$ D@jf!P=tfOtfO1 NjJDHjWPVFi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P= L$,1TMGDHjWPVh t&dž(@f8u$dž  ^_[]ÐUSWV[{zA =tl$$G)B fT$L$D$ uf͋t P ,$UjI|$(todž(dž $FDGjRPVftiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PVmf t׋@f8u$dž wSWV[Lz|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[yT$$wA =tF)G D$ *$Ffu^L$t PG4$jtL$t$,t$,jWQPt$DFjWPQ,etjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[èxt$0l$$D$jPj |$ ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-11-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/netbsd-11-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/netbsd-11-llvm/i386/20251228112742Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/netbsd-11-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/netbsd-11-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20251228112742Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-11-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/netbsd-11-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20241129%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/netbsd-11-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/netbsd-11-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.0_BETAxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/netbsd-11-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist