08fE<  fE]t tfE@@<@T 08fE<  fE]t tfE@@<@T UfEt`AfEfEfEAfEfEfEeA.fEfEfEAfEfEfEAfEfEfEAfEfEfEAfEfEfEAfEfEfEAfEfEfEAfEfEfECfEfEfEAfEfEfEAfEfEfE$ hfEfEfEmD fEfEfE (08@HPX`hpx`$|fEfEfEL$-fEfEfEM$fEfEfE (08@HPX`E$vfEfEfEhpxK!fEfEfE afEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfE afEfEfE afEfEfE afEfEfE afEfEfE afEfEfEafEfEfEafEfEfEafEfEfE afEfEfE afEfEfE afEfEfE afEfEfE afEfEfEafEfEfE afEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfE!fEfEfE4!fEfEfE!fEfEfE!fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE B!fEfEfE B!fEfEfE!fEfEfE"!fEfEfE"!fEfEfE"afEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfE afEfEfE afEfEfE afEfEfE afEfEfE afEfEfEafEfEfEafEfEfEafEfEfE afEfEfE afEfEfE afEfEfE afEfEfE afEfEfEafEfEfE afEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE!fEfEfE!fEfEfE!fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE!fEfEfE !fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE!fEfEfE!fEfEfE!fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE!fEfEfE !fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE !fEfEfE!fEfEfE !fEfEfE!fEfEfE!fEfEfE!fEfEfE\?!fEfEfE\>!fEfEfE\=!fEfEfE\<!fEfEfE\;!fEfEfE\:!fEfEfE\9!fEfEfE\8!fEfEfE\?!fEfEfE\>!fEfEfE\=!fEfEfE\<!fEfEfE\;!fEfEfE\:!fEfEfE\9!fEfEfE\8!fEfEfE\:!fEfEfE\7!fEfEfE\6!fEfEfE\5!fEfEfE\4!fEfEfE\3!fEfEfE\2!fEfEfE\1!fEfEfE\0!fEfEfE\7!fEfEfE\6!fEfEfE\5!fEfEfE\4!fEfEfE\3!fEfEfE\2!fEfEfE\1!fEfEfE\0!fEfEfE\2!fEfEfE\/!fEfEfE\.!fEfEfE\-!fEfEfE\,!fEfEfE\+!fEfEfE\*!fEfEfE\)!fEfEfE\(!fEfEfE\/!fEfEfE\.!fEfEfE\-!fEfEfE\,!fEfEfE\+!fEfEfE\*!fEfEfE\)!fEfEfE\(!fEfEfE\*!fEfEfE\'!fEfEfE\&!fEfEfE\%!fEfEfE\$!fEfEfE\#!fEfEfE\"!fEfEfE\!!fEfEfE\ !fEfEfE\'!fEfEfE\&!fEfEfE\%!fEfEfE\$!fEfEfE\#!fEfEfE\"!fEfEfE\!!fEfEfE\ !fEfEfE\"!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\ !fEfEfE\ !fEfEfE\ !fEfEfE\ !fEfEfE\ !fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\ !fEfEfE\ !fEfEfE\ !fEfEfE\ !fEfEfE\ !fEfEfE\!fEfEfE\ !fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE\!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE!fEfEfE!fEfEfE!fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE!fEfEfE !fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE !fEfEfE!fEfEfE !fEfEfE!fEfEfE!fEfEfE!$fEfEfE4!fEfEfE!fEfEfE!fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE !fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfE!fEfEfEafEfEfEafEfEfE!fEfEfE!fEfEfE!fEfEfEafEfEfE afEfEfEafEfEfE afEfEfEafEfEfEafEfEfEafEfEfE\?afEfEfE\>afEfEfE\=afEfEfE\<afEfEfE\;afEfEfE\:afEfEfE\9afEfEfE\8afEfEfE\?afEfEfE\>afEfEfE\=afEfEfE\<afEfEfE\;afEfEfE\:afEfEfE\9afEfEfE\8afEfEfE\:afEfEfE\7afEfEfE\6afEfEfE\5afEfEfE\4afEfEfE\3afEfEfE\2afEfEfE\1afEfEfE\0afEfEfE\7afEfEfE\6afEfEfE\5afEfEfE\4afEfEfE\3afEfEfE\2afEfEfE\1afEfEfE\0afEfEfE\2afEfEfE\/afEfEfE\.afEfEfE\-afEfEfE\,afEfEfE\+afEfEfE\*afEfEfE\)afEfEfE\(afEfEfE\/afEfEfE\.afEfEfE\-afEfEfE\,afEfEfE\+afEfEfE\*afEfEfE\)afEfEfE\(afEfEfE\*afEfEfE\'afEfEfE\&afEfEfE\%afEfEfE\$afEfEfE\#afEfEfE\"afEfEfE\!afEfEfE\ afEfEfE\'afEfEfE\&afEfEfE\%afEfEfE\$afEfEfE\#afEfEfE\"afEfEfE\!afEfEfE\ afEfEfE\"afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\ afEfEfE\ afEfEfE\ afEfEfE\ afEfEfE\ afEfEfE\afEfEfE\afEfEfE\afEfEfE\ afEfEfE\ afEfEfE\ afEfEfE\ afEfEfE\ afEfEfE\afEfEfE\ afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\afEfEfE\! fEfEfEi!fEfEfE!fEfEfE!fEfEfE afEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfE afEfEfE afEfEfE afEfEfE afEfEfE afEfEfEafEfEfEafEfEfEafEfEfE afEfEfE afEfEfE afEfEfE afEfEfE afEfEfEafEfEfE afEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfE!fEfEfE!fEfEfEafEfEfEafEfEfE!fEfEfE!fEfEfE!fEfEfE B!fEfEfE B!fEfEfE!fEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfEafEfEfE!fEfEfE!fEfEfEafEfEfE afEfEfEafEfEfE afEfEfEafEfEfEafEfEfEfEfEfEbpf!fEfEfE $fEfEfEf$>fEfEfE$fEfEfE$sfEfEfE$fEfEfE$fEfEfEAfEfEfEmfEfEfE$fEfEfE $fEfEfEAfEfEfEAfEfEfEAfEfEfEAfEfEfEAfEfEfEAfEfEfE AfEfEfE AfEfEfE AfEfEfE AfEfEfE dAr!0 Xo;SdԠk}tKF n[)LfG 74";tx t9v#(WAoU Wf Zك?>g X ѰB(s~'x'#?͚((F(_% {eUT"|DZZueBvemEA?y9@}!]w.(J 7^j}wbk,Ws6u@6y X:W;8 cE xb>5 "X$9:€h`-[6dz9paUZ;t;juQ%ucJ8zJd#Y<TAgQYMƿm_kFГ( /=Z#RzEip-,|]G *^t . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4 L4 (zzT$T$TѠpLLT$T$TNetBSD;PaX NetBSDearmv6hfeb4H H D0P/!p@-@P`C`F&a03/T@p##LA-`0`` 0PpU(pGpG@Pq`P03/T@0US Ob#`@-lPQMK \!\1 P` 0 R: 8 0S  /S 0SP 덷00S5 0pp WI2I0@3)1*03/ T@p0pWH2H0@3(1*03/X@ UbL0d 0 P0 0嬸㬹#@|h#H#΀ $爀@-t ttPl@dphP L冘Ws0`POU |P @%x, P@-@ bH0`  BR` pRp RX Xp/%% O-pP  b 00CS0w~p@ [E0S TX 0S7 0T0 R0S p I|16@' 0@ LA`M000`00<16@0 0S +16@ 0S $p @ T T 0S ^p Ip0S TMxp -tp @000 ^jp T?@0 @%,%D0\% %t'aO-@Pp`0ĀĠ00S 00P  0Q @P pҮ0 P00S Ѝ @0 P0=T0`00 %%,|P|tA-1Mfv1 Ap$0v`S(0S∸P0 S(0( QP$Җ$0S;(00$0( $PP  \偮00ЍD$ ಶ0PPU%%,f%Xt'O-PTqTa@P1tLLLMt@00SC 0R0P0@tt@) I R ᣶@P"pᰶ0: S ᩶ o0 P00SЍᆶ@P0 P0g0s s0T ጶTM%%,|Pt@-.0 %x 000/%\pC-؀-`P p0M@ O@ 'I @{{z(`P Ѝp @Y%\%x@- M @00@0  P Ἥ Ѝ@-` x1V0zP 0 c@P@TV ]PF $$圭 W@V4  Ѝ9p20S@ 剭@0;0,P W 0pWW2Vp 0pN20-S T`h@@5p ,P@0S W $|%pO-5M R  @P| Ѝ 囵p P3@D5Xp0S 45 0500P 5PPUP0S50S+ D$`D00CS0@Ȥ Pp  @YT y@0 @00CS0 0 U,0 p8Y00ꔶp :p`300 άC80: Sx +"p`  p* R@tPU0@@ 0( 043,P$05u00000 R00SQ 0 0 pE  t@ 0T 1(#E0 ô 0P# ||~@ 3P Xu@R0S P $\hݴTAٴ! ,+,"0 R@D 0Z0TT$@ 兴p00 R0S pp;0PS 0 9(ቴ Pl T PH@T c@P@0 ?oR20S 0  0 0R0P @vP ll@0S L"P@ P0Rt00!ᠴP %$|t%`%h%l%d%|%x % %x%t%\%%%0@-MM@P  p  ;0U$C djP TT岫ۍЍ08 7P ,(0P XA$|NY%tQ@-@ TGP DD叫,(P $ 0P@$|Ne%tQ@-@ X(P HHp0"ቴP $ 0P@$|Np%t@-0 Ez%x0$/&`0$/&@-{T@-vj@-q@-l/-@-0! 0  0 Ѝ&X@-0! 0 p 0 Ѝ&@-0! 0 a 0 Ѝ&`@-0  0 R 0 Ѝ&@-0  0 C00 Ѝm&&`@-0  (0 10Q) Ѝ$@-0! (0 00 Ѝ&<00/@-0  0 0 Ѝ&&<00/@-0  0 0 Ѝ&&`< A-PA!q!ᘁ M`V0 |! R0B=00 B  T嶒0L!D!7 Q<A 84100 ЍB P = dP 0`00S 0  p40P      0 3/Q ! 7000@0@0L`D0&&&`=#&H$%ReX0p@-@PP0 00R00 p800 p0  B0Sqs &&`&0 0 0 /&`&@- t@-@-  t@-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/pq.0S 00t@8m@- PЍ (P Ѝp@-(`Vp80@  03/PP8003/(PpC@-@P`P 㴱80 (0(3/@E. P 㧱?.PЍp&O-2 PM`P(`,PB  0SP0 J0S %0X\0Q0 P % pHp 81/pq4 c  ?P p 04 L-0S4  p0 )0 )")0 )'0 %)0 VU)4(0, SR* '0 ' 0 R,P0(`R0 *0 A 000+- |tpx 0$ ЍO'0 ''0 YX' 00 0S04D0004 0X TЍ&L&ptWtR/ R 0 0 /P0PL 0L B0R/S/  AA  AA  A A  A A  AA  AA  AA 0S AA@-|BM0 0  `勰0 0  @僰 /$`(b P}%BDC`0bH@P}%/L#b`/`SP0!!!! d 4 !P`4(4 P" Chh `!d44(4 =" C !d44(4 *# C  d44(4 8p<@ 0 ? Y( 0?S(\ pd@44y(4 Ѝ&XɜbM&:YfQ@-NLyG- A  `004P#"6`8` ( 1/pq $ 㬀夐pUЍ80 $0(3/P 0 `V`PE0S0C0<0  Z $`&`t&$@-`AM P040 !38 P (5/pq$ |P<  080 0( 3/PЍ80 $0(3/P`P4 00V0:0p080 p0l( 3/pPp 4 00V0* 0`/PRP `&tm0P@-@ P M4C DЍ&0*O-臟M0@S M. 8S+ #='0|ο0S( 000| #" ! |!x0p0# #|0 P& D% ݍ Ѝ'|# 0 Y0 S 0E0VS06  S  S $0S0 600000S60 060 00 6R2' R0r0C0C00Q0 0S, ,B< ($6  崿Pp`0W$0,0 0(0PU`$00,0 00(0 0S $Z# 5%Z(0S%0 %00   0 p5p兿,0S `5`%0 0X{PYX<5 %8Y; ?Y07* ' 0 &p x' 0&0 o'0 ~&P"0 00,0 0@"<e00@0 0@ P|H3' J'wY㐫* ?Y0:$0Y300 0吳+ ?Y0:U(00S. ,0S#$pW   40S \ ?\0 * ' 0"& 0@ '5&" 㥾  |0$p[ㄒ2 0  {0$   s   m"0 00,0@ 0<"h巾1,0S P0:  R R1S7#P P 0SWA吡S@ @@  nP<w&ӼT P傻L00CS0410& 0`00 Sv#PT 0@@00S , P* P   P 0@0CS0\00@  &ɜ&&%&H&j%x*&x*ADp@-Pd`d@000 PPPPۺ0P0CS0p(00 Hp&&H&xG-@0` V V?ЍpPP 0崀 尐R`00@`0SpP 0S 0 h0  0?o2S @`sP&X&&&P `00CS`0p S00 P0S X0X /X3%G-p`ㄒB儢0SS CpP[ U\ XLDV00 0pPZ 00CS010a U0Pd 0@Z e% p 00CS0h10=uPU 0PL1` 00CS0`0 P0` R0V00P%z )g00CS0p00 UV 0 00 0 @00S 0S XH&p&d&&xj%xr&*O-- RM `0000100010S @0бq`  0.0P0 0':0J?oT20SS SRO fd0S  RZ@T  Z     00 10S@@  0 ;P 000CS000 Ѝ S 0P  BR l  @0S Z0 0$&d&&&p&&%x&xA-0P!S`iP@I$奺 0SbKpP0!S  P .$劺 0HH8H <00S ,,$00CC%x&L&A-P@dp`T0S P#Y$ F߇&pj%xO-`@ ؀P0S p0 T T R R 0pgP Ѝ PP P   P Pp@&p&&&dA-p0`!S@PP# 0姸 @'4嵸 P0!S _P #ܹ 0PP劸P^D00S 4 ~T@G@ЍiC%x &LO-@pb00CS01zpW PU>ءTpp0pp003P"<#嘹 G 00CS0Hx10 s@p@P0 5 0p0CS010x0 S0 0  X 000 0 0 0@ "P t= 0`00h0 P`0W0$0T P 00 %&t&&j%x*&x&&l&$/O-PpP0 SPEUP ЍE P 0C0 X0 Ub000嘶P" 嬷 00C0S.20 & 0 0CS0T200 9 Z0 P CPEP 000S S  `V% V000JP R"宸| x]t 00C00 0CS0D100 0X 0PFiP 0Z0 CPF V(崀VPP0PP00P "lt plY 00C0m0 P0CS0<00hj00`6&&d&j%x*&x&*O-P@`p ^P`T !. 0PSxaP 0@^S00\P0S \ [ hP @P@+0P00A$FO%  @-T @0D 㘦P 0S( 0C00S 0C0 Ѝ&x@th$L0 R QQP0R/@- &xlG-P`P@ X 0S@ @0S @T@@DT pP 0S 0 0 gPЍ&xXG-@P tp0SY`VPUP 0 @,P @Pl&xX0000@-@U 40aA R    0/%Da&x40000 0h@-6 %D&xaO-R蒟@ 刀p0 pWp0#s) 㼢0`?VJV$ V0 00 0S0 =D  囜1@s4 0"S00 @∀ FQuSU|U|U|TUPU|U,U|U|U|SUPSTTTTTTTTTTTTU|UPU|U|U|T^V^V-Vk @ 0s000@^V-V00@R f  p F1@s@\ 0"SR 0.V@0 @R J /Fo@P0 R00R  G@PR 00;V0 00 X@} T0Sx&x%D&xl0@-@00 005P 000 0 00 ,R;R 0S  S   0;SRp&x p@-PD0QS@@R0p`VP 0C&xp@-P^@P 0, (ߴ$ p 00j%x*Q 0Q\S@-Ao/`@-0S*  0@0S! PwpP zPP @P !0 S</R/    e 0 &xi( Q 0@30/@-&x00@- R 0C30L&xA-plA1S0PR a  R R S0` ` `0S 00 R0CS .R R P000`P 00CS0"0 l W  LU0圁0CS00 pP&x%G-AP pRpGWR0`0`0 ` 001S 0100CS0H89 lP00CS0' 0S  \P 0Sp`0 0`0R00 00C0p00  %`p&xG-p0A 0RSXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*Pv`&xG-A 0`0P0 P 00CS0-0 p& 0FSOp L1S 0p10EP0CES0&xO-PB`0pS"P UB0S0001XPPPP̱PD 0Q0CS00KM!1  P[00`F`0[P/  P P) 0100CS0G'(?P; 0堑0 S- S   凱P 囲00CS00  0堑0CS00  *0Pz&xɜj%x*A-A`qW ڬQ1ECe R1 0 C0|005PP>嚳 I00CS00 v 0q0CSQ00 \R `R `&xj%x*0O-D0!108P` Ѝ0S/T SPPP  PEX TP200CS00 ! `0Q0CS00! P1ȃԣԓ 0 S*"Rʜ0Upppp00塰P 0r0CS00 \ 1Q !@o!S/ %S pW U 00 0rP 0帱0CS000!000\Q00pPR# QUpp0pp00CPb 0q0CS00ik0p 1 1S 0S11a0S S`l   P5 0a0CS00<>10P!pE S:`00  1S `qP ʼ10PE pBR    Pp|000կP 0q0CS00 &xj%x*&@D( Q 0@30/@-I&x`01S @-0@!S @P / P /&xϼ7@-A00 S1 RUWʐ0\00倯PB 唰00CS00- 000 @P R0 R P Ѝ00!S JP I0 Sڴ 0R0CS00000  \00sP 00&x%Dj%x*?A-O0 Q .#p WO ! GrYQWYRT~lllllllllllllllllllllllllll~,lllllllm\loTpllllllltuxlllloT{lllllllllklllm@noTpqqr rs$t lt|uxuvzl{0oT{|l}8P0 nR pR lR 00 S P0PP1S *PEPCPP0 nR pR lR 00 S1S 2PP0PPPP0 nR pR lR 00 S1S P!S00ЍP0PP!R "RP  RD 00@, `P P0 nR* pR# lR$ 00 SyP ZPPP0S!S  40S 1Skt \P0PPPa\ 0100+0,+0 R00@ <PM 0!S 8 P0 nR pR lR 00 S)0S  cIHwP0PPQUh /P!G@oG`GooPbVWP 0 nR pR lR 00 S101P0PP0SOP0 nR pR lR 00 Sh)0S) \\ }%P0PP0S/P0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Su1SP |P0PP  P P 0 nR pR lR 00 SQ \P0PP`PR 0nQ pQ lQ 00 S 1PP= 0  ?P1P pP,0S `Vm0VjVPPPVPUH p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SP0 nR pR lR 00 S2S040S402P0PP0S 0l0Cs0S 30 S}1SP 2SqWPP00@ 0S0 0h`Py P0 nR- pR& lR' 00 SY1Sc1S0!S p0S1S Pc PQ 0S0 1P0PPP`s0 gRG  R: 0 B R `塓@p?0"S;b$pR1 rR1 U p020 R 0 S< 0U0b0 ' `P$00CS00 P00 S2SP00PP2P02 P P 80b200CS00U0 !2R00W0#220# 020 nRL pRA lRE PP0 nRE pR> lR? 00 S1S"\(P%D&x$$+?&|j%xl[p,DX&X&@i&$xl" 0"0" " P0PPmP_p PPZ0S- `V0V PPp0 nR pR lR 00 S/1S988P0PP0SP0 nR pR lR 00 SP0PP QR000P0P0@m `P 00 00  P0 nR+ pR$ lR% 00 S1S0!S d0S1Sr bWW P0S0P0PP1S 2SqX=0S 0l0Cs0S 30 S0 P0010CS 0nQ( pQ! lQ" 00 S3 00SL` `S@p0"SZ`{ 0  P0 nR pR lR 00 ST0\S kP0PP0SPRP0 nR pR lR 00 S2P VD⢧2SP0PP 6P(  X-@- 00巩 ЍЍ/'&|-0^S0]S0]S S]S[S .0As0S>30   \  R]\0G-霁`Pp0 SS'PG(!RJppU``0``0,0O@P.X崫0 ,c(00CS010 [S@ \S@0 S @@Pp 0(a0CS,A0p00,A   L0 0pS G 0&&|&j%x*&xk&p@-!0 PJ@p P@01S?0A0S S n@P P0P 00SR`0`00 咴P0A l0X 0O0嚩0aLP`0, (˩$&X&|(&d&h'j%x*O-bB0  %R R 0R0P   BR  t   R ( Qp B  RʼqU``0``00]P@ 0A0CS0p10H 0P \RI0P 0 S 010S P/ 00P S)  R [ U   P0%偪 0n00CS0L00} \0`00Pp8 P&&&&x& &%j%x*A-@`@0@P X0@ p>P" 0 R00R000 1BQ@ @X序@p0"S,@gR000&&xO-@cMpS唳唣00 0GS T`SXsTP0PP00咧P( $妨 00C0-0&SM 0 L\  DQ<Y0 0C@p \  0eP 0lȩl hwd00C0S @Ѝ,20   AQ  \S9 1B\400 BR0"p L\ DRW  B@ \   P AQ 0 T Tp p pp  P p BR   @e0 P0CS0,00 0 r&&&xj%x*O-M!@_0P0ߍT40S 0 Q0 000(0pP@Pd p0 S pSx 00 0,0Y01 Y  $ P$ 咧|  B Rd30    BR  300S 0 4   0(@P#Qb 0bppG XxlY 00 0(P\1卨, (<$z00C0S4 Y( Y 1  P1 m Z1  B  BR p100S 0    @ Q 000 "2 0 0(0P1 0 0CS000SUW 004 00 T00S 0 P o @ 0 0S&&&j%x*&x<ɜO--p *ᬡA0Q0C` M01 00C S00`Pt :  P Ѝ5 .P!` 00000`P00CS000  [  }0S00CS0x00` P  P&&&&X&&xO-RB0M00bsp 0saЍܑ0ԁS 1 7  000P@ 0.#⩟ɐ Y Gt10S 0p0000000CS0D41< # \$ \ 0 0#0L\ 0C000@000000 0C LN '&$&W&&&& &xA- `P0 0Cs 0p 0 h0 d   B 0CR0@pT x:@&&$&G-@p0 PR` 0 P(S%0  d  P 0 ,K(&j%x*@-r0 7g%xO-eGM0PS@pM$Q403/P ,GݍЍ0: S00W ++ P8:?0ӔP0: S 0S⻔P0: S 0S 0S 0/S&ᩔP7⮔0p0p P- sP 0#vӣ PvO+E0P ]<#P⿣]qP 嶊/&P/&P 0P,I [)H Z& U9.<. 0JPT:.<. 0>P@!D0Q\ TP1RP o R00S$ 0ST 0: SP|PO 3  0G=00 04K G=00J0SP/ HqXG 8X-00CS0<p Pp  pYW NX0 X p00CS0 #0 ȓ0S ᚒPP 0 dc R;c 00ᚒ&t!F":% m%%xz\\ 0\\ X X0p@-DPD@@@T` U H H0Rp@\\ ppX 0Xp@-DPD@@@T` U HH Qp@\\ ppX X0p@-4P4@00T` U 8 80Rp@\\ ppX 0Xp@-4P4@00T` U 88 Qp@\\{ ppX X0p@-TPT@PPT` U X X0Rp@\\a ppX 0Xp@-TPT@PPT` U XX Qp@\\F ppX0X@-p tp0t\@ ^0@\\1 X X@-0tpp t\@ ^ @\\ 5S %R R S R SSh -^L^S R 0/0/0000&O--QMTt @ `u @ 0 @0L0@@@ @D@H@$@(@<@@@4@8@,@0@5 SS$\ Pq0 !00`V0SD 00刐0L0S{ ,0D0000400800$0S00(0( C$/& $pⓡpN ,0S 4 @?C000`$0D0p0H08D0zp5  00$prp- $0S00<00@0#0pbp ,0S 3 @?C 00 0S 000 0#pIp 0p#pAp0 \ C@Q C003/040 0S ءYT RS0 00 R0!0L0S XP(0| xS$0H 00$( PDH050D5[@1t0pQ<< @0 Q ,4.Z(.~X 0 0 ,8 04 , # 0Sf QA 0 !XӠX0:Q= 0 !dɠd0:  0S0  0{ 0R  P @P0o@m0S00P0 0P00 PP\0.S~0S0 !x0P: .0P: 0  R P0&P000Ѝ&ѦUUUVJ3PO-@a!80S  PP" 3dpW  ЍOt <0Sp|xxx @P  @d  @ 0SJ @n50CSP,,\ao$\\ Zo00L0S \0.S0S @0S40S _ <0?oQ20S X J040 Ѝ&HѦG-pP0EL0 崐P0S%00D0H0夏P0` Pt0  ϣpYX5T H0J0P 0 8aP T@5X0 s0X00 00dt |  ` `R`S Y ( ?R004(0'R S S Sp4 L0Sd4 T0SX4 0SL4P0S@4@4Z  000Ѝ1@GPpdp4@LD\p`X(8Ph$|0PPL0 P 0PPH0LP PTPGX0s0X0 0PPLPTPHP=0 00PPLPTPHPX040LPP00PPT0LP P0`P\0&0\P`0"0d0``0<0080 `000DPh0lP0DPhPl0 004@pXl0 h000  ~L00S   Bt %x"&`&d&<$0\ 0S 0-&h"t0L0S/0 000/@-0M0S 0 00! pxp Ѝd0d@ `0R@X0 0C/ 0Ѝ@&&&08H&$,& P `00CS`0p S00 P0S X0X /X%: S@-  S  S/ I* S  S%|@=A-t1`@pTXPM !T婝@L10S @10S- ,10'pq ⎝@0 000( 0@0S00S 0: S@Ѝ0嘀 d0R00C/0 _T00S &Z&&08]&`&d&\&l&$R& & +P3  R (aP 0 ¯S ,!0 0@ '!@{{ z0 |p00@0 (P <pp l%P I0S  cX0;X0XP XP 20-S  KPUPppW  D嘘Lp@Y&h %x%!30Its@-@ `P`PY0PI UHzxЍpU >;\@lj0 P4*'@p$il@-Q~M0pSM 0`  0 `峈P `! p~,P 8!K1@~܍Ѝ00 `啈P ~,@Pʁ ~,P0`  0 `wP W ` sQ  X00 00`PU 0$ 1$m8h00CS0 Ԙ0 /O-D`LMp Ȇ000xTx$xt000 0000Sɼɼ8ʴV44`0p Q 0SI\#剆P0#0V 0030p Q  #lP0 00h#0V00@30$#UP0#}0 30002PP0"g0I0 0LЍp(0: S / S&p ⡇P000`P40 0-V'V{ЩVrX2PUT 0  /*0M1PP S0 0 00pqi0S0 0V00Q V 0V 0d1\!00X!00@@D!S9~<0V 10S0C ^:ˠˠ\:PV0 ~,0 d~\P0 P ;  0  \U0Y 00V T0<$&&€%$$$'k&@8m&`&\$}D00S/@-4@~M0S~, hP~܍&$0@-p@$0l00S Ѝ0 00 P0, /6P$&-L0@- R8/P 0 0  /&M'l&`A-p`P@ 0PPEU`@T@A-p`P@ 0PPEU`@T@p@-P@T0` Q@P 0 Q @;;S p܄@P00T@ X(0( /( .$&&`s@-R@T` V0a@$00 ?00S 0CS1P1,0 S7@.@ЍpPڀ;;S! 0 009 P0Q/}P@@00" 0S @@0ES TT 0$00S0S 0S 0S $0STڄ00Q Q`0.T( H).(00 w.$$&)'m,^\!0SM@-LQM0SA <100CS09Q000SS50S0@pT0S 0pLPo 070T p SQ00 t 0}P00 0S L-Ѝ00/ -&$%mHG-0 Q@ ЍpPPڰAQaP`0 Q Q 0@@PP)@ -Q 0S$&|@-pA`MP \1P0S0 SQ0<900Q0p0 pP -Ѝ0Q R(0S 0P 0Pڌ U0 /{0 d%-0 L 0ȄP 0, k-$&  -&`8m NO-rM 4MR0`RX0@FPz F夒 0S 0  F F0S(0S lr  \"娓X"0  0/08"⛓>00 "#┓Tq " #>}܍4ЍT 聟0S =! !|!0`#v#1# 㮂0S1!p0  00@!]>0H!041 04q 000`$1尐(00C0 E  ? ,0 ( $0$0 x - 000 0 0 `#!## XT%% &'m,&x s ~ 'lѦ&ƈ &€  &h$ C-PRPb0LBS0000 Ѝ,, 00 0S 2r0S ~1 ғp 0S 徃pP (0: S0 0倃 p10S10S P'4P  00 0S q49> 1 800 0S000p000 S(00(000 P@0S "000S x0P 0 0t;P 0Xb$&€&'l'l'l'l'l &%'m ?'m, F&x&h KA-MM4 ⚁P0 #+G ⎁P$"+bR$0@S 0@̂0S2B+p)P| $Pw 0 t S( -x.+t,+p2Tr0h0CS``#+ +P+L+H+D(+P4P0@0@ + 2 ލЍ+0S  R  sS SS YSP*yS*0q儁*x*H*P8P 0SD @P4 o(1P *0S *@(*DPP ItP0@0@**'l X r$&'md'l $$  % {ɜ V   Wt 'l  , " A _   ϼ   2   Q k00@-@Rp]p`%O-ql L|0S'P6@PXXLP&PV,L0 R4T0S  h*@ET  A!0d#0V`@P@UPK*PT0S d>*Pꓢ" <2/PL0!ᓢ#, 0B%%&% & 'm,O-騁0@`PpM∱ @FbQ PPPU3PP*-PT,010S( $)P@!0$0 3/0P% 0 R T @ A 80 3/P}0Pp00St l) Q < 002/P0 " "Ѝ'm,&&ƈ % &Ek@-AMP/M@PAލЍp`p\P/0P0 UX0X )L0_"I/0P0 0@ 0 `)&ƌ&00CS0 㟑0 /0O-c$M00P[ P$ЍP0,03/P000 0w`30S LCLPPPP 00 30S[ P U P!P r4 CSR pPt{ h* "PzG8@"I)0/S?Ph AW V 10S i P0S !S 0!202 03/pP X4 \ d1  0S HQ0S 01;00 Ph0D0 3/P 0S 0 R 0pU0403/ ~B00S 5'Q0h0CQ0PP'm,'m &ƈ'l'm&&ƌ&ƍ'l'l&'l'l'l&H@-@@P( (&,@-yp @@ (I@-@<p0 (@]p@-MPp@0S  0C0 `p 0: S `S NS Ѝp@C-MpPЍa0H03/P0 03/PuphA]P@ 0AS0@0 a3/PE 00P)3P/P :P0/SP7 As0 00s06@ Kp '0(03/ T}[\0P'm,&ƈ&ƌ&ƍ% %r'lO-MPЍxe0H03/P0 03/PsP>u<5p0S (5}P %'50SD]7P 0(03/ Z}P 0AS0@0 a3/Px4C00,TeP D4 C(P 40S  ~P  00  ~P 0R S $ d 0Q` 03t Qp00xPdjP PSX3d Q`0$30/S2P[  A 00  S~P0SV 0S $ d 0Q` 02t Qp000S "SD 0Lq 4S P \20SiL20S Pl4S S1 0CS+0S'~Y K0S! 0S 100$ d 0Q` 0L  p1 (6 P RP $1 IJ Iu @ 9/0S 0S 0S 000Y\0C00%4S 0S 0'm,'k%'m &'l&ƈ&H'm&ƌ'm'm&&&ƍ'l'l'l'l'l% 'lG-Q@vP@ЍT  T 0 %H03/P0 03/P0SA0 Y Pddq 008TaMP P9 DP0(03/"P 00 @0S 0 00MP@ {eP0 l0O X0 0S &PY ]P'm,'m'l'l&ƈ'l'l ?'l'lT0@-0SePP 00H03/P@'m'm,0O-MMDp$0- PP 'l'lA-M`P@puP6,10S Ѝ 0 RP  0RP  0: SP tP0 JguPW OtP  P W0 @,'mWt0@-:(4@: SM-0 R P000[ P0 :up 0: S ,Ѝ000  s:P/  0 eA-`QFZDT@sP*0@!81P @$<nP10SP+(0 000 =  "4S `sP`0 t0p 40Ѝ(tS|(tHPs s00 >'l'l%%a'kO-Z#Q30`@ (tKMMp 40CS񟗩hl3lP\30S t0P0 0$#: SQ ZPX3P @$<쒟 ?o2P0S(4S2P =tPRtP{m0p"0 + 0S820S{ 4m0C?o2 000! "DmrpD0!Z;Y- Y10S- 0 !K>0@4@~z=0 C^szr 4q6 rv PF@$<P>4S(4R0(4p l$hR\00 V0S 0(4} 00H 0KލЍ0q'l 'm'l'l% F%x'l/O-p@M W 0DP 0S08 0<000SPP0C080pG0S 0`S * 0R 08 0 x x/  P8 @0 X2@0@/P*@0 /0嘰 R dP` dЍTT   ` `@/'mp'ml!'mx'mtR/s@-@0 @`PhPA0@ Ѝp@ $qP30 ЍpG'k/0@-@MPPq00800S =J" Ѝ0'lG-z@M`Q M Y #P yqP 0P 0P=! RS J(Dݍ ЍrPJ8| = $LH0RP J(DP0 PPȄJ8 ^sG- AP 000qPU+`00CS0ǬpU 0 0S U 0 P 0 SP P0SP 0S0 0 S .P 'k'k%% 0 0 S00@-@R000x00S0@000S XP DP,0P'm'm'k'l 'lp@-PP 0Sp `@Pd @P0/S0080f R P@@@@p'kh0 RX R  H R/< R/ $R/Q/ 'k'm'l'm$l0A-0S X0XP@0P`PpT R S1 0@'l'kj%xG--c@ 0(MS 0SzB0@(Ѝ0 0P50C S=$0$|$D$|#$\$|$|$p$pp20S 0X0 00!P 0 ! " PPP  0!$($!# 0!㓭 X #(4 : SB  S<  S)  S08 0T! 0 J ,!y$1$a@P@ 0 S  S0  S04=! 0400S -ЁЂ ;Ѓ" 040+04 oP0H 00  'k'lLj 'l Fp@-8M@  HP{0`P`gU0$ $ @ 0ZP8ЍpA-t1hM0@S ThЍA}`Z(|="(<p@|1WpP0 0000p084 ⽀40CSL$0r"60"$寀0( 媀4 CR+x ᡀ?hЍB>'P嘀S+<  jO'lj0bx K@-@XM="p:(_|0 XЍ7@-@PppP Q Ѝ0 0 * Ѝ0@*0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//Pp/@-C0S&P*00! S , 0W 0@0BS0B0b 0 0000@ 0 P*/ P@-*0S0@ Q0$? S^@G:@!  SR < Q R 0\ 0 Br^00@Ct R!"A@Ct R "! \a0Cs R"! @-0C0S@# ^#:00N0BSBb 00 S!0 02W"0N ^*040@-@T@@  'm A-P0q0`Q VA-QQ@@TQ S AAE3:TP0 dd?@ 0:S@ 0S000 @,D'k%V%xm/s@- `K QP@0Q!0*0S mR$ bR kR%$+ 0*S xS SЍpwR!$/Q0P@0$+*$&#Q00PG- 0S芗`P |0P  p T@R 00T0pT0S ,@Pp=PP 0~'ks@-@PP0@l C300Ѝp0  R R00`{@P 0 `F 00'k@-  ({%x0 Rr @-/%@-00($(( ( ({%xaO-pဠ倰 @ Q0P0 ,p`0, Y/   `QO-@-/lM`봯P_PFpP 0 pP|/||_00 `?`/pP?L?A0s 8/S XB\    CRX 0F>c{zP񟗳8D6|36|8<6|6|6|6|6|8l6|8|8T8\8d6|6|6|6|86|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|6|786|6|8 86|8$806|6|6|6|6|6|6|6|6|37(6|6|6|6|7D7L76|6|6|6|876|6|37L6|76|76|76|6|6|6|6|6|6|556|556|6(6|646D6L6T6|6\666666677 6|7?<Q w,PM>J=0 -R,Q0 000;l= =p, 4hPPPU @ P@g t{`P jP "PiX PcpPX\ dP *\50S  o XP  ZP@5嘵00KP:% 0 |p B;$X04L50pzR񟗺F4@@@@@@@@@@@@F,F @@FDFP@@@@@@@@@@@@@@@@@@@@@@@@@@@@@?@@@@@@@@@@@@@@@@DhD|@DD@E(ED@@@EXElElE|E@@@EEE@EEF @@@@@@?@@8@L@@`@@@x@@@@@@@@AAABBB0B8@D\2嘃iPgꬃP2Q_ x- 2P U 2P PP3P 82 J P2 P E(3" A 2@P < 2P 7 1\ 22\P,-20A 00㨁圑  R [ aR eBp Q PAAAAAAAAAAAA !00000 00|[1~PZ P1Z  @1Y  0Y Xx 0010L0w1Pe X'l 'l'md'k$%%%x'l&\&'m%'l'l%'m'l'm  ?%V%L%B%8%.%$'m$%P'ldgO%% Ǜn'm('m%'l'm.$ 0'm &'m6;'m^&x'm'l'l'l'l% 'l,D&m'mdG 9%x%0 .'m,%8%'l$ H/$0@#dyL#ty|"$$0   1W Ì1Q0 (0,<W7 L1V 2(1\ mP0V0' P"x10PU 1U  1T 1 1S1]PS2PR <2R  L2Q  \2Q  l2p x222 22"2 S0p02007 xBbr0e0?o S c00CS0 kyQ003XQ0 B{Sv008300R x0 d0S3# S*SSʤS|0Vy PK000Sm30VK`F4}PMP20000S D4 P0P  /'kl0P/`0p@-0 PL@LPP@0@{P' gx3'k'm,.%x'l A-`  @PA?\. \ *\1  Q R+ ![\SPQU !\@@]^1!Lo \P/P00SP PS QR S0*S S 0PS 0 P0^ p-W p]WW UU @U 'm$p@-0@0 /SN00N P\/pPQP`Q*LC T030 00Q*pQc @-1MP MAaq;P/P w0P0Sۍ Ѝ.S@T|`l @ @'l !!5!W ϼ!` !!!!O-cM M33 "@p`3]PW,0 00S 00 0 0jP{$00 ;R SY @0 0;T*Q  DY<5 cݍ Ѝ&Q) \Q$ 1B\ 0 BQ "P P BRCR0 r 0@&R\R  @E,0 0CP;TC 0S0TP* R00;T 0S Y 0 "0tYpi Y 0 0S ddv0S X 0 0Q0 ( vK'l """@%x"VC-`PMM RP s\SP RW P0S #  P0S?v\SP R1 PgQ PQ' SQ GQ Ӿ*v 0 0@pQ sQ00000Q0 R @@@ۍЍ001 P ᤾uts@P p ހP ; }0 $pu"`""'l"y"A-`P 0St]ps@PP P`P80 PP p@ @@ @##+'lX0A-@0LPL`LpT  S- u0@'lj%x#XL1p@- RE jDTA ,PU; P8 \Q Q 0T + qu04#♎P  0S/  00P0S/  0P0a @0/S000 0DPpR0 'l'm'm$##0A-j40@TPp 00S 00S0 00/S @Tt0ohPL0D0S sP040 'l'm'm(x2A-0@SP' 0`.S0.S0S/S 0=P 0 Q CR S.R  S.R0S/S Z 10S410S 6P:4 CSR ! xQ`V 0/S0S.00 p 00C0V00$ `V._ XP:$0BRSR;  IP C 0C0 0B 0 B "0%DA-Q@pW :P7 ` /0H PW,Xp C !.XQ  PE R cR CR MR000mR000 !r0    0P00 \ rD0 R @ @@ @%%&2&N%&&&j'm00G-@T pP@aV@ U@ o@P Pi @T 0 SR0p 0`@'m@=&@-<@0S $pPD 'm@ &O-1MXA $PR5 84S01 {400 @ 0`[ @ 0SY $P ^ 0@0T 8o@P ⫊P  0000Anqx Ѝ d  $0R  0CS $00 0SqQq'm@ ' 0A-@T:8$R4 CSR [4`x!A0pT0WV0 $P ^  @S0qAq'm@ X0A-@T`D'L@PU pP qqUT'm@p@-@0S&oP @px x0 S0\P0唬P0p@ 04  `@'m@G','l'W'l%'e@-<@ 0S $oP G 'm@'@-<@0S $woP2 'm@='  @-o`O-aM0Sr K4p00S W00 $p p0PP0 0+ P UY   0R  vPPE ZY00W00S nP7 0 " 00  RQ4 0S0 M0P  PQ CP ` 0 mP 0 `0 $`040,  Ѝ "'m@'((@-<@0S $nP'm@=(^C-d`M0S PHp0@T " !(@PUЍ'm@O-`0-X@D'   p&PZ 0 Q P QP (0S0tm@P  P p `(AoO2'm@=(A-P0@T `p1AT  RQ(  QP (0@ 00zoxo'm@=/@-`0M0PSpM 0/S ᴾPP ۍЍ( m@P  pT ۍЍ@JouP 0$`0$!#!0 00 @ 'k(('m@A-P`@p娀TЍ000S$0S  00 0 00! !:<00S s oo@'m@'l%%%7@-@@Q@0A@P!!0\S q  10@: Ѝ0 @G-鸑M@T- `P!ApT 0S! @T {l@PP 0P0 0PC PP5]" 0`! Aލ00!0 PQ  { P    P]$ 0\0 D Zvn(  'm@G%))()@)`)1G- `V@0P WpY  l@P) zP! tP AZ @P`P 1n\P< 'n%n@'m@)))d0A- @T`pH PATWP e@'m@Ppp@-@@,P\C \0@@ \ @0@@0@ 000@@@S:Q0^ACBSB 3b 300pp P <  - R0 R:00R:/A-0A Rh1\pP.@0MTaMQ 0  C0/S' 0 ! l 'P3ڍЍ *\0@C ?\0@C ಀ 0pC00C 0 0 l P 0` Tl P 04 $l %D* **#*1p@-`0Sp@e\ 1e #@ P1m000p 0@-*<P00S/'m`0-p00@^SQ 0Q00P'm` Qp@-!0PS   p@Pd @t Lm @@T@p00@ % *f@-P`p~@P  P 0|Eh0` l@ Ѝ0 0P 0AQ$ 0 *%**+'m`A-`PPЍ8"l:0J840K0CS 2  `40 01 +  dV (lO <tJ @ |pq}  :=/$4  0 -BL2P ! 1P) 0(5P/S00)040(84K0@SKP 0 04@0q;;@004(4 :(40/S04084(49(p0k$'ml 'mtC-j@EM0@S(yyzz`zDz$z4zDzD30S EߍJ(eJ(J(J(!LI0\ @ 3> c 30R0Pu[[(D1  =ЄЂ0(p ]0P0<0x V0P0@0 OP0 0 0 FPP w000 :Px BPOQJ(XNWPP P ='m`+)+R+w+++, 'k+// Qp@-(0PS$ l` W@P|Jt0   X ~ `!V0  o@p ,1'm`,9,O-P`PP Ѝ#:0J84YqW V#/00p0K0CSt3l IPi0 0H3  _  d ( |pq  x}? 0$00004JH1↸P tc@0 B(1<P lU<0 㓍 H K06S 0S 3 CRVgSy K CR[0P 40r;;0(49P(4nxS!04(4:(4P`04(4P9(408400C /Q0PP($4S**00($ R44 @P P4&"**0p 02S($0 *4($040)($84 PU KS 0 0P 40r;;P0@KS(  0g( $ 'ml'mt,,'m`,,,O-j4@SM- S p0cS:t& SR0d0C0 PR/R0R  E?o2R0S%  0CS!L 0\ ` @ 3 30QJ(t S70000=0 s++ 10>L  Rp0<x P J<p0@ P J11  = 0upP J|<δ@VXYE   cXM  c} 0 OpP J} SP nP$PP P >P $p pt 0q0cRaSP'm`--w--- U---U.'k.0."0@-PMM@ ` =X X 0P\ U+@0  $ $ ,  ݍЍ0$ ['m`p@-@ PP hp@*.)A-0p-S0S) "hPP%Ti 0NЍ0` S0 BPm@P,0U ᾑP` .?%.R-@-0@P   yqЍ@Ѝ/'mp@-@ATp@0 R P6P ` `P`p'm-P@- 00|0 x0 t000 h@0S Xz600L0L <g ,~y$ l6 Ѝ@ Ѝ/'l'l'l'l%x'lqp@-xU@PlhPP XxP pFU000S  p.si'm'm .| -P7@- 000@ 0 000 P0S x#600l0l h@g X'yThD 84g0 6 Ѝ0@Ѝ/'l'l'l'l% 'lq%x@-X gd.%x@-M@P# 0/S {/Pv/P Vp `Vp 0RP 0RP @ލ=.#Wt 000/'m@- fd.%x@-q`@,MT xxfpAPDi00CS0@ؐ@@a Pp= @Y@DOoB0S@,Ѝ0P: S _VP 0S b Q 4! P000岲@ :0At@ Tf0 @00CS0ፐ0 'm.%x%.!30/O-PQAMR @ <R =R @ |R@ 0&S@ 0=S@y  0+S'@p 0-S(@i )e&c#a@ ^%D'nt5'np'nh<'n\PЍ%='w=1T='nx==Wt=@-5$0Q @ wP @'nx==p@-L@Q50P000S LTPP 0S{s@@L 101M00CS00 L 0 L0p^Rl'w='nx>%>4G-pPp@R` V101 Pp Pp `R\TQ @0Ti \0DsQS񟗀hd@00CS00 CL 0@ 0 @T0S 00CS00 ,L 0 0SX00CS00 L 0 K 1% 01 @0Q  0BPA0@D@@@ @ @ @ @ @\@%ڣ>?A-@ ` PR 0R 0S SKp0S0 R 7L0S  0LU  LT%L] xLu Td@00CS00 K 0 A}K%'n'nq%:t% @-0S 'n@-@(0Q L'n@-x0@T   @@@@ @J@00S 4060S QЍ'n'uh%-$0@- R    'n-@-   0p@-'n-@-0@0 H@-@  =@-@-   3@-@--@-00 " ЍЍ/@-@ Ѝ@-@-  ЍЍ/ L 0S0 @-4 4dK,S0 / />K'n0/'np@-@KPPPP /Jp` 3J`P #Jp` 'J`ps@-P30P d0d`6 N {0X0@T PtLD0 0@ M@Ѝp'w% B'n'{s@-`P0@S'<0`z%kg{{'jfk[P[x hZ06S 00S TpЍp @0t0S0T.S @N'n? 0    /'n@-@TЍ0Ѝ0CS  T`  000 P 0 3@ 00 0@-@M PU PP 0⧯p $+P   PPP 0☯p 8 0  Ѝ0 Z0 0'n%dRQ%l@-@P 0S0S z3P 00 0 Ѝ'{G-`0S q0P00#@\T0PQS$@X&$00CS010S -Ѝ00S P UIn[8  R 3)P00CS00S U@0SH@ UHPH@'n'n'n?C-s@P`^PM( UPG*릐) QĤ<(T`üü(X|U2$PP^0S2 0S@*T ^0S2$ 00 *|20S G0S X2$PPPU H^0S 2 R$0S20S (E@yP10S E10S Eo^0St1 R$ R @T$@L10S D(10S D10S D00S D  @06 $0?o2$0-x0$@T $ fd00S D 4H0WH Ѝ%'n'y'w?%G-PMp@)0 -`㠀堐堠>PP D *Vx0$`W U ^0S W 2P 0`S)Ѝ'z%%'nP8PG-P* `0@00 0R0Cp0W S `S0p 00 PA*?*S p0@:)PD0(00$.* 0$ 0$/%%'ul'nA-P`@耟0p00}^0S 0S 0S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R SR 0$`S S'n%O-P࡟$M^`AV $`")pWS0嬱p0p0✁0WY 0S, |1b2GlG G00CS00 nG 0= H00CS00 \G 0 >G  J ^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 ($Ѝ%'n'z%'{C-@$M p䀟( 0 0`@T+ 0S0 PU@ 000cP 0t 0 SP0 0U$0 @ R^PU $0($ЍP0'z'n%G-P$Eo@p0婒S' 0S$ 1a11!GGZ/GUG00CS00 F 0 FtaU000 M&PE U04q$0! ?#$  A BPP00CS000S -@00CS000S U0S0S<0<0=1FDFG0;FUp%'{%'z???'n'n'n?p@-(2FM000000 10S 00S 1 `1 1FF0Q@TzF1FFPP% t1 1@{=0S @T D1E fA@[F4YF 1E0S  1$ FߍpA 0 000 0?P00CS0 0@ 0 00t0 >=00CS0 0S &Fl$FL0EX00S L@00S F'n%'{'z?%@ 'n@'n'n@'n0 @-`o 0 00^0$MSP4P @#'000P? p9%0P 000S D<D0 p000CS0(00S ''$Ѝ%'n@&'nC-@?mM0$08@P0?_0 0x?0,@0X@ &d@`PჀ 0D0h0 0@Th0p@ 0o lP 0p@T 00.P0p ,00d0S,_&d0(S( 0L0>60S t>0S,0S(00L0, (01C(0L>0S,0S pl@,nT@(|X P07S 7S6 =0S7 00SB -0 008 04000$0 0t00P t=&0S(7S% 00S 0 0SL= @  =, Ep@ P 8 = fJ@ = <, R , ᝸4 0 P$P$00$0<<0S V0 0`@G<.P  @J, 0 , R(0T@= < |;I/DlPUdPkUH 0k PUX00CS00 MD 0 ;.DCT 00CS00 7D 0@@;`P }E00CS00 D 0@jE @PT 00CS00 D 0@TE @P _?P @P078:0P PP@PP: RX00X0, (0P0S `-V`-V P0E0R9pPP, \ B, ( 1(0 P,0SX0077S 0Cs0S0)SS ?70s0S@P$0 Q AqQ0(0S000$0S  8 @  000000H0800<0,8D0800T0圝@P8 7P 00Rl 00 =,0SX0077WSlG(0'000(000 7 0'0'0$0,(07( 10103/$8 $7 DP7P' 7H' BT0S H@ 6 6 H RM < 0 $ H $B&00CS0 NU60S .P 60S&,0CS6p6$6` l8 I54,00 $0$00$0E400 T"0E$000SJ4|$ x5 50S S@5,0S t8Bx90%0850S A 0 @$0 ?PLE\_<0 000,0 0C0(000D0004 @`N00CS0p40S ⭜P% 40S#)\0S`N*H@ 48 3  3 3墜4D )0093 8 0S '0R\#CX#0LClH00S0ڨ\M$0 #0C0000gNG@ 3TC  2 2 (08 02 \0S"00CS0 l2 R   $0L2L0S#mߍh9H20S 08"SS2 @0@ T0P@H020H0H0S 1 H0S2 1$ H0S  t1H0s1 R#$0S1   B H0S H0S7SH"D 0 10S 39@,0S 0  S;,0Sl@Q rC0,0(0P 0D@T00St0 x0@40 0)L2Eq'{'z'n'{'z%0'w'n@&'{h'n'n'{%h%'w'w,D%%%%@7'n'n!'wp @I4 Bc0/'n0 /'n0 /'n0/'n 0  /'nP@-@&P<80PP cR   @h'n0 S0/'n0@-0M0/0@0P AP 0: Sl  S` PЍ0AP0 : Sa" PP'{[/q@zp@-Px@x`M$P)00S Z"0`H00``00!!`~"$Ѝp'n'w@-`@P$G&0S0S 0C0BS00 000'n//A-PM)@vr @ (`D0p@H8PLP, pP  0@PЍ0%@A-@P`?KpWU KK! 00'6p'w'nO-pWC R``%` P0S:S2EА @0S,W@  @Ѵ0T/S/00L0 00S00P R:R0:SPPPҷ@DOO!S!%%'n܃@-P@/` P*  0 ӻPU0 "U# "`VZ0S  0 o0S 0S PM! ~pPP<> ER~   0x'nѦ@- P@MRq$|P1p000 Q`!pWZU x@?U `?T?U<@ 04AS 00CS00 v? 0* 00CS00 f? 0 ЍU ??U P000qJ00CS0L00S <??0,'{@@@t%@'n'n@@@p@-P@@Pp 0S%SpP @:p@-P8@Pp 0RPp@:$- D0D0S RP P\ 0%'nG-`P@唀0吐00p 0S0 S0S00OPP|U00CS0$00SGTp'n'n%'nG-@Pp0`0帐0 Q :RQ :QR``R %Ru -$PPP0T:Sp0  4@0/PSu`P'{'A %A-`P倀000p 0Sp00J(O@T`|V00CS000SA'n'n'n0A-pPS R+Dh`a@T"W p000l0 @0 0 J00CS0H00S `'P `@'n'n'np@-P$@Pp0P0@:$@-L@000@00 N00CS000S@'n'n'nO-PM/`@ 0P @@@ (>P00š0 ù0S 0S 000y#   P@ )P @cP< R R R 0S 0   # R00 m P B0000S - Q p" R[0 RL"00p@0  Pp[ X 2@{ 0=0p0ЍQ 0S/Q0S[q "P  P x"P R  R  (=P0 Q<Q 7 ޴0@D[ P Q  pP@0000S R  p  BR 9D R5 x3 s'{A %'n'n%CA A%A'nO-@`pM2%PP2*0S*[ 000`"0  p0Rz0#| 0Z8 RhB<01 P=PЍbPEU````````````p  `@Q 4,V  00X!W QPYXV E1 0 0 W0S& 0s1TP P*W 00SY0 [  P 0S<XT 0s  P ao=TA,'w'n%A6'o`'{%p@-`P0000S S@5H000 00 00000CS0p00Spp@w'n'n0@-p@M0 0000T0P>00G 00CS000S XЍ0'n%'n@-aP 0SGO-`-pP@pM$P0cS    @UpP` vPP VP@ H RrYcS" ;U;ܢ[<P VP  R񟗆 0R cPU`D;%U 4; `P& ;;[ 00S A00CS00 :; 0 0@ T Ѝ;/0PVd!     [ZU!Z;;;PUx;U~ڶ6MU U UU;;0 f@000AAA'wjAb0A2AAA%B'{ApB >BB)B>B[O-p$M R A0b@ @T- TT:T"  T /T" 00CS0@  @0D S( E$Ѝ0S R 4a@T00000@0S?@PL:=P@ @ #T ~̰pX <W 0 0CS0s0 S00CS0 0 00CS0 0 x00s00%'od'ul%7A-(A0S 0PS0 0aqP0S00 P000J00CS00S P 0SRh`hp0P RP000J000CS00S j'od'n'n'ohs@-0!S1Ѝp*S@SP``00P Q0C RP00C S@ᔵ `t1@፵0S00S=STT00 D0 R 0AD1U0 0S 0S%'wp'wA-dp`0PS@  R R00PH @'odO-s@0M00S00 00,`000Т00<000000C <`0 00@000$00CS$0C0S00CS0(20S P8P(0Z00(P8 P I(P 1X0 DC{0@0CS0t10S Ѝڴ0SJ$P 0[0. [`+ V , R9@ 0C\A/@`F 0SX  BR r R  B ~   B `FAQV  R@ @'od%'n%'n'n'ul71O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xqQBP  `V' Q`:00Q@  @% Y0S" STP OP@GP PB DoQP @@` 'od'{'oh%0RCA-XPX@X`P0p00H0p0CS00S 'od'n'n@-¯C@mD>0@ Ѝ'od@-Qp@0` 0S*00DP@`ܰP@0`SP Ѝ `P0@P0`S@0S0O-@p [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR3@P0P/P 0S xpPS@ R0B$x r RP R  \$Ѝ$6PX:$P 0U0/Sl 00E1pP $0S/00E0S``0` xqQP /000S V/00D x0s0SR00Q: 0 R @?s0P . B/o.Q" R  0P V 0 B$'odWtQ'n0 q Q0@-0 @QC\0CC/x~^ࠑQ@ Q 0 A-@QaT0S 0@ @@?S*S  [S R 0 p00$0S P $$$ F0$000CS0L00S 0S 0P 0'od'n'np@-@ PTp 0@ @@'odG-p @0s0 ST@D0P ̀`V ᫰`RxpP VP V V@ S`` S =RR QU  ㆰ0P @50G-p@ Mo oF0P ^8a000e U00SW-00E@`PIPE@T Ѝ00CS0@'ulO- R@@0`-SPM S! C RTTTTTTTT?So @Sy 00C Shr0 0 Q,`j0S\ 00S=SWV70 Rڬ7 RN0aF1@ 000U00S pgpWpG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P6솟p覟ԖW@A0S 0f0CS00  P6FBЍx6P6l6_0000Q00S 6 pR&V(0S 0 0S/0e0CS00 w 00CS00 v 0S 0|e0CS0]0 00w0000v00e: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000v3г 030`3 R L 0ppUppW~|0m R  R9 V} WHs 83 BR  BR j ~  B Rs `2 BR  BR  ~  BR   f ~ `   0S q QAQAQ   Q50  ' ~ AQUd Ra 4q B R `V~paQ 00S T 0s0 S00CS0 0 p00CS0 0 00 00~00O 0  00400p 0  00'w'wp7'ul'od1X1\%'ud'n%'{%0O--$M000 06 0=``zdVdp0  P600`G6 @ V 0@P 00@S0(00 60P@   R@@0% T A*% R *R@R Z  JRG xA@TZ   + V? [7 0  BR & [0CSV0F V``f` Z74 00BC0A000000S1 0@80,  [0  0+ Z R CR 0S0[0F0[0 0@S30S 0@0 00J S񟗸"!!H""!!!!! `3 BR  BR  ~  BR  ~  K R  BR ~0 0  BR ~0 0 ,Rw[B0 mT@ 000ST @Z$ЍT TL aQ00CS0)0 儁000I0 : P 0C A 000 1 1 0AN0000T0 0:LP 0 00@[@R p R0 Rp Rp B\T   R0S5'od'ul'{l%%Bk'wp7O-0M  P0 4400̴̔0@ 0~Q  0 pd匤0@Q Q#:Q =Q Q Q     BR  啛P AA  p A P񟗁'$'''$%&8%%X 0S@ЍQ Q@Q =R 0p(0  BR  pw w p    BR  u  q u  BR   ` ( R  0BQRQ B  X  BR  v p}< v 0Sq Q AQ~@AQ  RX ~     ?@@ M  7@P)  ~R&=Q0S! 00   @'{%0'od%'ul'zG-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S000`0`0CS0!0 0@p   0   0  R 0r00j 0p %'od%'ul%'z'o @-0l@T%O-XAX`0$M`F:0PEPE000PCP$Ѝ0000'od%'ul'zO- aXP q0@ 0 R    0X00P X 20P E00C0 Ѝ0S L H.%008  @D0000D 'od%'ul%%jB1TBO-@ 쒟rP0  DR40m0 R`| R    0T0d2P`8 T_ T@-@FT+: fPR0CZU * TR Q  S0D2@ LP80Z0Y0S@@T: Ѝ@FT: 6P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C0`FT000@ D00C0CS0 000000C00000000%'od'ul%C-PpM@`᠐ 0嘀00000p000CS00 p0@ @5Ѝ00p'od%'ul%A-Pp@-A00CS00 U- 0 ` V-00CS00 >- 0 ` V`-00CS00 !- 0`%p@-B@-B00S/ R%T0QH0 0Scq o/P0//'o%0    B /'oA-P夀0@000p `R$  0 `0T @ `  0 0C  S000SAG'n%'o'n0A-P` @0p0W0 gP 0X S S0 000 00 0h0 $P   00T >=00CS0 00SA %'n%'o'nA-4b4B0 Qcr 0S T,R,r0S@0PP0/+P2b000r0Sc00CS00  '0S 0X0#S +P  +P, 0 00P0 P   PERP S   BR 00E0CS0000`0L00S Q,80+`Q%'o%%B%%@-L@00CS00  [p00CS0@R'o@-T T@08     00000 0$00'o%A-P`@000# +V |`0Pڕ#p0PS  D0  0000CS0 00SA'n2`%'o'n@-4ap00MP0*@P V,P(0: S$0 j0  *P  pP*0 00Q0 *d#T*L00CS0,00S Ѝ'nBBBCC/'nA-h@Q0P0`0 PHpP٢<0`00CS000SA'n'o%'np@-`P@00P0"P ; 0S00;0X 0000CS0p$00Spp@i$%'n'o'n0/%p@-@,`,P0SpSTpv%'oCGp@-P@0Sp%'op@-@Pp P0Ppؤ"0@p% 0 R/% @-@0@1^ P   U`p W Q Q 00 r B"Q q A,PU 0  0 'sOr5%A-R0S20SP`AR p M")pp{PpW* 1N *p !!"5P ) 0P z&&&) qP !*pV<  5p,J< ) P *pߥ;<  5pԥ0< !00f&c&`&`'s'uh%.sC^%<'udCC0S/p@-@PP1PDHAtP0a 0(00R 0S"0D@^05#0s  0C?o2^0SP>zp|P ;DP p0S *00CS0p\00Spp@ Ao PQP'sCOr5'nDC'np@-@\P0P00 :@00CS0p00Spp@'n'nO-@`TM R0 TЍO)ؐY. PPY   p0 SPs   0S0P0S PP PQ 00SЀ0S@TЍ0S{22 F!0R+  p  !R -  "y)⯠p 00X" m) 壠p0 sR ,J50p) 00CS0(0p W (e Z 00CS0(0 00CS0(0 | 00CS0(0  Ѐ YZ|(000w ) #40  ) )P S#4s:  0 ,0p@ gp  (Jzp0㓉(ЀHp0's%Or5D:DCDHDPDYD^Dm@- 0 SS0C 0.^\Q0 p@  C/o "P R pO-PP10 0%SX P 0@S"!Q@ C$0S 0S  R-S +S %S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  "P T"@` D Pn P G \0@00SJ R Q !" R @%DsD'sDDG-$a${0S Qq0l0@S0 @ 'А㼠0Sʰ00CS00 a' 0 (0 R  0 S !''s0'wOr5DDDDm%A-pP`A#P00Sʄ10P 0S hjPp pPP gP`W@ P$1@@A'PV QPU, 00SJ r'0 k'`00CS0 &0S 0 0 00S0 S 0 0`$p$DD'wE'sOr5E4%40@-@T  oP@@d'sD8 P  /Q 0SZ//'sG-Qp0SPR@00SnZaP000L: 0@C$ @p T0Q000CS0X10S 's'w%p@-@#``Q000 R 0S <1.p {5!0S 0 00D1  S  Bo00P0R p` R\ p`` R00 0S00CS0000S p'n%DC'sOr5'nD1@-Q80@S U#P`q0SP00CS00 " 0 $0d.p 4.g!+#PpP000T00CS0@00S ) Ѝ'sDDtDm%%C'n'n@-w @ 000'w@-@ l @0p@-`@0 0 p 0Qp\ PU"00p'sEO-:@LbLPDDDr0U0S  U"0PE0P ЍS S =S\ 'S " C 0CS^T^^_t^__ _^$0!PU0 R$ \S0 \0 0S0 @ P   0@ P0#P"0!0 P  0  @}00 S$0)0 !"0T 0@ 1 }SP0  :0@"00  'sEEE%EENEEA-@dcdsdMTZ 0SW0S`ba aaal``aaabb(c c bbc``bbbbbccaa R0S  "%#00CS 0S2h"!\@H<80@P bU0SЍ0S PЍA 0S  ztp|xt hdT0La8 Pd Pa P^ P[ PX PU @,'sEPFEEEE?'EEEENFEF X-FFFFEEOEEF(@p@-@P@`TpUPU 0S G@!3p@-Pt`t0PP6 R@N0S@2@@0S. @D0    p 0 p's%A-0P@`Tp R@ 0N@T P 0S@@n W\0HU 000000V0@ 'uh%%@-@ p P0  Ѝ@z20ЍF.O-P 0qM00S 1a Ա100 0000 S  @PЍ0SH 0 RS/Q  C P0 (ͱ0 Q0000X00S) R@ PP0S:SU@!00S-@,* @00CS00  0 ( `0SH0 @Q00't'{,'t1T'{@'nF?%'ulFM%%A-M`&P8q8A0S R60V0C?o20S 1Tj0^0  0P!1U00V0S^0SP60S .0S PP PЍP ^X8 0P0C?o20'y%%%%F\'s0S/p@-P000@P00CS000S TpP@T` `@V0`0T0@0u0S V00T00p@'n'n%p@-l@0P00aP E00CS0 Rp@00S u'nB'np@-P@bPUpgp@-=-PF@-.PzF@-儖@/+ЍA-@0PS`~Up~0000 p 000CS0h00S *0p00000PC0P0CS000S %'n'nP @-( 00C00/F%00  0 00   /%'ulp@-@tPt`0000S0 000D0 00CS0p,00Spp@00.'n%'ul'n@-D@ 00040 00CS000S@'n'ul'nG-qA0@0000I?o2 V0SPkPP) 00=0 000E000PS V 00CS0l00SG~ E P 0(` ᅒ0`PP'n%'ul'nT 000@0A00CS0/00S/O'n%'np@-PPP`@ P T @Dz@p00C0C0p%'ulp@-(P(`@@Dw00C0p%'ul( A00C 00 0C0/%'ul-A-@P(MHp@`DpPVP u )6T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@)0 P  pFO--@ 0,M t T@0)`P3P0S pV@ rV00 dV000T UP ~w!3P  l#llC p hP w0\Q"\Sr 0S!YPi R Q X BR (  "p JQO Q   P h߇P W p P|X  BR    嵕P  BR 0@! P R   0 00 l1  `TApW    p AqJ0 0Z*0S  @P+,Ѝ mP hoXPJ Wp X <  BR 5  0F'w'wFdRC%%'ul1TA-PB`Pk̂000p00CS020S 20@T[UU  r0@0w 00 C@@x 00 C@0@0  0Dr000w  B0x  B0 00 Cr0P 0w 00 CPx 00 CP0P0t0E 0I`A01 H"`ЍP(7 1 000 0 0A^[0@ 0QS$ 000OPP :OpD,00CS0H00S UXd- <-l 'n'n'wG%GG*%DG0GOGoO-f@PLsMO`P=8s0SB(30@TCUP3X   0 ಟ@ tyfX   X 0SB01 p`ЍSVP aV HVP@ 0S$X0S UPP; p 0 /R9RW :s(0 BpR 0Q0 x' : p-D0  ׇ 0$@EqpT0 p  SP,0S|'w0wSp w{tk0  ជ 0PaG0'wGG%HCH_G GGHHH't`H8k BR00/0S0/@0S/ R /0@-00@00C S ⮐0SS 0S!\0*ЍHH000C S0S//QX0 0@- ^ @P U@R000/%p@-`@`P6N0Spv@Tp @ P p@ %'tXElHG-pP@R`Q7 @O`r0S 0 d `V@A00CS00  0 @aq匁 Q  R  A@TPP,aHqH0 R R +@TP@00CS00  0 Q 嗒P @1@ST@Q@`Q ᄒPGB`V0 8'%H:I3H%ZwIIIDI+II 00\#P0@-%I3I60S/p@-@PPEPp@))A-@1Sd`p@DPU 0@P00` P`'wpG-@P0LaL00 Rp-Q Q8 -Q R8 P+Q, 00P T00T 0P 0T0cP0 oP0S TPT40@@T0SG'wp'wI3IJ%A-P B00`0QՖ 0S 00S0S006X pWՇP чP6p60S0S60F N0 B/oS60"N00S R 0 0-S0F0 1 Q0CSRC0SQ 0S!! P0   000S 0 0^0 PA. R   R0 0'wp%I^'nPG- @@P0S`p0C 0 XZ0OA0C R 0 0CS0@00S 0S (Il'wpI}'n'nP0 @-\@000D00S 00CS000S q'n'wp'n000C S/ @-P 0 'wpG-0p RP 0S6Q 0S!0@ C?`B10 !7,h``@ ``0i `` -R \ -Q0S 0`@T0:SE 0R@/T/:Y  @`/@T0:S   @` @? `0 :\00Y00  T@0 CB!0 4$@ ЍIIII%0P@-HD0P  Q 000CH ЍI'wp'w!@-$0S Q,0S-\\ -\\ P0 ^:P0S0\HP^0@:T($'wpJIp@-H@HP080Sp0u`0CS0` 800C80%'ul 0R @-@T ^'0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @% 0S/xqQS  0s0 S/00 00 0S/00/504 00 0=S0/S 0050 0@-0%Jp@-`R`@PP t0 0Ppd0 Pp0-S0S0 0pV ($00080@p't`'t\J%O-RM0p0p R pl"l2lb @d 0SXy XR00CS0`2`@@20@0@Ѝ\Y7R @@ P*  BR @@000p 0 S B Ry @@ Y000p  B Y Y  YR  Q P Pp P  Q  R P000<00 { i Kn%1t%%'ul%ܤ0-0@ P RLM00 P0l l "U0L 0T<0< A 001 0 %JJK%1tK:K@-@$M 0U 0P0SȌp`@T*vpPT @T$PLP @0 ᓉP $Ѝ@%%'wKJKXl000S p@-XP@T T D0T@p8040@p 0/%'o0Kl'{T%'{@-0@'op@-d@dP\Pp P 00008  P8 p@%%MG-DR0@T @ B 0S 0 @ 0r8 0 00CS00 `)V*V V v va G ` 0F S(4 V@0000 @\V. |V ;V&P @0 ;P @0 J@0Q PpBx&P@0 ;@0o|P@0 2@0@0@03p P  00P000K 0 %%'o'o9"G-pc0@0 T T+P,0S)㰀" PP @់ m@@`P  0R͌P @FDA@@T 0 %2p@-`0$P P e 0R$, (@R   RP8Pj    Q  00000S@p 0 BRp@ U080@ p%K@-y0 000%@-@oPp@- @fP P @0 000p` P @`@`% O-鰑`P0  Pᔱ@APp0 CR00S00 t0@X ',10S @%X U `@P@W W- V- P0@PpGWPV oVP 000 0V p0S 000%1tG-JM0 5@0 0 00$040040(0D0l`P $0S $p#  40  |4 lt$0000$`SH4 `$D,4( ($00CS0! 0S$@PU3 0RPPS p10SP Pv '30S l3p@p3p0pH00 0S  0 x`PPA P5 \P p'200pi PP0000 0 0 21 B#20#"U0"P R \00\0@0 $P00CS0 Pd@0000 Z@ "00CS0P001@@PsJ n@m1000S 10 A0 SGl!|V@0  剆0 @00C0,000"0$000CS010S [0 0 0 0 02 P B1 0R z0u`@0PEPUZJߍ600CS0`R {00%'n%'n%'n%'ulK0O-ԟԯM0ϟ0 Q02202280?_@? 000"`00/20S@0Sʸ@ 2P0pD|$,/Q00S .00CS0.0.Q00S 00C00000Pa210S5xPVTP"P_ SPMpMxU0@#SGl( p00@ Sr0pG A0@Sr7pGa0@SQrWpG[Lpw0 S00C0t00" P *'P 0p@W00@S p p p p p pq00@0pGSq0pG`0@?o? @2;R0Sp $ \\P\Pp ?PpXWX 6;G S 5:0 S@ W*00C0?0'3?pp00s0 S0 0C0~0 0ĕ@00C0pW'*00C00'60'3?00 r R~   B  ĕ?pAp00s0 S00C0~00•00C@0W$*00C00'90'6?00 r R  B ~  ĕ  B 0'3?00 r R~   B  w$00C00'<0'9?00 r R~   B  ĕA0'6?00q Q~A•W?p00C00'?0'X,UP0>P0 |P000P$@: 0ЍP0 ,  0P% 0&P00 0<P_ >P &P000p0p0((0 @ -P 0(0  p 00 H%%8 'ul%'o'oKLCKLL(L_LlL't`'t\%%D'w5L2e%L9"76 {P B@ < } p l {S  D  B p/#P0p*}P0$  @@   ? }P0 P0 p 0I$  @ Jp0H! , s@ BR #@kx!0  = BR@ Ĥ0T@0Wj%S` :S/ #S0[ 0 p@0C Q s@ BR @;W0 0 @ R+  B 0)0;F"p0ᜲ wP H02!R1S p0HS2@p0 pXp| !0X2 ` !p,!!k00S Go}S㫲[| p'P023Q w0 00"0 `!a$0 0 @ B "  0$2  `!G-`̠̀0@T@@0PU @ 0S 0 0  B/o"M`0p 0S 0 Y 0 0 0-%8 @-0P0@-2_M0$ 0 L< 100100寇1x0000>fPI@1x 1Q @<00 dq 0S $Q. 4QG Q (0  400,8  (]000 0 0 0 0 0 S00_ߍ0  p0 `0 H0 D0 H00SeS,0 0'n%'n%8 %'n0L G-Vp0 00 P" 000P6LLLLLLLLL0$00p@]P 0 R 0`     {0@0S 0 00' P0, RP[ 000@ 00 00 R, RP4 D00300 0000    BR   00p` P 0000 CR Sn 0 P P`  ``zs 0 0008 @0C 0 H00;`0 Sp寃P \0 R   L000`0S0 R Ӻ0 0P 0 R000& 0  qP 0@S P 000d `@` 0P00`O P0 000000S$ T 0S 0@000@00S0P0S0S 000@Ѝ0$00pX%L~%%A-Q@`Q` @ p0 P0 0X@p 0P R$@@`.R ( W% R"pm0 `4 mP ,/t`P 0 08 00C0%04`Ѝ Q  0Sg0 00 00 @ 0%%LM A-P@0 P. 000`P p@``@@{P 0`0 U000 PPe``0SU +P%%M%p@-@|PP 0 @OP P 00000Sp pp%M8 P/0S/80 P/0S Q/0'wp@-@ `P?00`Pp@-`W P幽À PP  tЍp @Piuuuu u   @& 0P/'wRQ% Pp@-@ P@ P `6 h.pNA-P`@XpT@Q00C0V PM@'wp@-X@X`0P0000:00CS0p00Spp@ 'n'w'np@-PH0@TpU@`V P`'w@-@h 0 S000C T DP ,03O@dA T @0@@%fffg'wp@-`@0 Sڌ S  PPT p 0S 0 S P0S 'w't`p@-P @90Pp @  0p'w@0@-@ P  Q @q0'w 0 P/ R/'wC-@sP0 U00000@0CMS񟗧(l` -@P @2@奃ؼ  mV ' #Uh20S T h`H"H@P(2V0S' `p@" wpoPkP 1 f噼 0: SX00`x!`h!x `V'qP4P  04 V U0S00  vP ( 000CS000S Ѝ @{J T  NP`Z 0X'n'n.?% Nz N-'nNQp@-@PPP U0p 8 x奻ap`U ͂VpU  005NNpO-`PppW@p  40Ù`ȐȠȰ0S UT  "O   0@  U   T 0S@@ `U %02l ^! Nɜp@-P  @pp R  pp pp pp   pp'wNp@-@PpD0 0RPPp03/Pp'wO-@M0 @ 000Pp`@A ``2@ 儲|U  0Sp"p2 0Sd2X" Ѝ@0SD2 R@00CS 0SP P H 嵺qPmP pT k0SR PMt0000 S|L1 0R  Fp) B R$   ` /P 0S  %P  ꏁ0SP 00CS0X00S &T0 0 0P_'w't`%%%'t\N#'nN&'nO-`0@D#DSM@@s` `00 p 0V 0@D<TRG 0p0sS vS  V`p0+S -S  P} ሢQx PR: ?yP    PT 0 K@0SA0cЍVW p p01      r  %5S bpр- $ 0Tp0€ 勹Y0 !pW gP00S0S|P0ST00ShjT00 D ,D%O(,D 't\'t`NO-2lO%OOvOROA-PQU 00CSQHq1QL R@ 0r`0CS00 `01L00<S0S  0qL0S 0CS>S0SSxd R 00CS0K0 - 2lϻOp@-@0TP R R R& 1S# 0 PpR!Q QT " "D0600S0T0S 00S0'w'n'n%@-0P00 6P0   ЍP'zQA-@ 00CS00 P `ppp C?U U P@U00CS00 `tɜA-@`ptPt@0000S 00S ]p`V@40`00CS000SA&'n'w'w'nL0P  A?Q Q R:///'w@- b@0pSM10S 0SPP10S WUT T TP160SPPP0SP1N0SPPTP `16 R4T! R00SPP0Q7 Hpp0 0S" UEoop$ W`RU50@D>T000 0~00 ] Pt0N R  DTR 60SЍQ Q2 1 @D@'w'uh%'wհPO-P@p {P `{P {P 0PEpSUpUX@@&` PP{`Ppl44{PPEpU]X P$d$t$ 0E0 10ST@ T@P@UT @Pcs1 R 00ST|y@ TL@P@UT ,@,s,Q0S 00S iX@@T`X `Ȣ娲pGY P& P?U*X? X, 0Sl <20S pP@@0-S0S@UpP ?PP P4PP1 ~` a0S\  0E T0 S R0T00 $@1 R  U@ ^00CS010S aPz`PP@ᘀPq0S 000pT 700CS0t00S :@@T00!ڄyPNP%'w ɜPPPf'njQ%PP'nG-PP ?p0@`吐 D0S 00S Eo0D0@000CS00S pW@UG'w'w'n'np@-H@P02`S@20CSp nV02p'w,0T0SP/0S//'wC-p@`1010r!Q0@S10C1 ЍqXPU X2ٿUPḸ̿P 0S Ͽ'w'n@ 0P/!!R /'wp@-8P\2Sp@xur\Bp'w0-MM 01`"R !R X"R   1 1d"1!d2S 0ZPh10 0ZP L!0000ZP(10  Q @T0d`0P0 U @T 0S ]P=00CS0 !!Jm0 0$0(0,00D>S j|00  q"!031'w'n'n'n 0@-`"d{'wp@-L@'Pmk PPp0B/U00p3 p@-T@TP0 0P0 0 0000CS0p00Spp@ȴ'n%'nA-p`@PU l0PPEU` XD{0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S gsDP`0000 0C0'z\'n'np@-@P@0SH00Spp@00CS00  %0%0%@-@PGEЍP-@-   Ѝ Ѝ/-@- 0  ЍЍ/% -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`]jP$ 0S! h}t0S00CS0>0 "  u00CS0/0 " 0S 彨pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU SPP 00CS00 Q3 %0R%@-@@%@-0rSKQQ30G-@0 p0R(0帀P0=00i=`i`F@V@p@DR000 S=S B`` R`ť` @G~P%'ul%0@- 4@ 00C00 0 0MЍ'zlQX0P P PR /0@-PP@^ ^ R0L00/5A-鸀' 0S RW'p`@PU pWp0 \ 0S 0S   3/P@P00'z0SeA-@sPuU p`pp0S'SSP@DAL'hPP(  EAPQ`Q{Qxt A-P0`Sp@    3/@PP@X "W p0@=SPUP00 00CS00  0 00CS00 w 0 T ;%^tO-A0Sp 00P̀ 0`V S 0d@PU* ЍY   R Q ʁ m <0aP`0 l'zl'zD'{$@ 0R S=R/=R/A-Pp0S=SRpGp'vh0h`!0aU@`T 0S  "BPU``@'zl'z@-1`0@S @  PPV 0 `  K d傱  `C Ѝ@| @q   R <0 2/0`h  0R , R  c0a00 0000@!L @UP U0 c00CS0\00S  ЍY0#L 00P P %Q'n'zl'n@-@P= `&P pTpP tpp0  BR = T  `\ Ѝ00@0Q-\0GM000 0eVP00$0 0  Gߍ'np@-X@P0` @0U<% 0U`00 0p@'zlQQlEH!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ]$Ѝ'wpQ'w'n%'tXp@-@`TP000T 00CS0p,00Spp@C@'n'n7@-P@T@ PP0 P00p Ѝ0 xP 0 @k%00000 00P3h'zlQA-Pp` 0  $ 0 @TPUA@ 0@00`'z @-:@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =#f@@'nO-p@`0QrSP W 100S V'>nP pPW`0I?o2V0S Dp`VD10@T0  ЍOe @0P=S7 P( PW0 00 0  į`U 0 X  ЍU0 00 U 00S ,W DP,HPPPP'wQQ@-` pj@P@ Ѝ0  R@ PR000 00S x0000     0  @@DT@00S خ'n1T'nA-`pĀ@TP0U0  n  0 R R   0 02/0  00 0000'zl%%A-p`P@P 0`0PPEPvT` eTp` fTxTp`X $@V Y@R'wPP@- 劮 aR C-ԑp000P0`-S㬁@TQ _n@ 0@00`0CS0`10S 9 Ѝ @P=dP 0 @0 0  0 00 000000  RP 00 00=S l0T 10=S010C0 PPP'n'zl%%'n  '{lp@-@PTpw@p@-P@`P \NP@ xP@ IP@"P(P0 P pXR;R)'w00@/ 0S0@/s@-@t0 0`Pt0S t0"S U1r0!l%*0S`0T婭000 @0C?o2R0SЍpR%DR@-M@ P ލP@0D SQH0PP0@-M@ tP ލlP@ D0RPH0PP0@-M@ SP ލKP 0RP 0RPA-@`oP13@ 0SC PUA PPPpPJ! 0RA @- 0-RS# 0S0 00t3 Ѝ0SX0 0P0S00 040,0qP$445R40@-0P!S@M0SPЍ0P| 0SyPUo U U .gPo U P? PPEURXhpPxPP PPP4D N  P  P  P  P  P  P P t0Sp00@T @0(S0)S 00pnp@-@`P'P} 0Sz00CSt t        4 L ` |    , PapoopYpPSpNpP-@`)TV"`@VT@`V0 @`Q0@`Q0@`V0&C`0S0!SPpp(S0)S0S pp@-@PoPPEoP.U)   p   0op=Pp0 \0!S0P p(S0)S0S XpQVRR@-妫0[S%@-$0$0 00 M'n%S:@- @l0 RQ0 P0*  UЍSO-`@,MxV0pF P-R lRF 8R -R| `(@P 2 000J @P (pe pGWP ;oPpW P``PE0%SXe`Px80pW 3sR R`3pV`P/ RpF@@W1 000 }PPP@U[(p (P hӪdi㱪X1Dn@P (@P0S0Sp@q0 0 l 0XS ̪ RQ!p *S`0q 0Rpv`  嘪TT{ w0%D!QwbxTSSj%,nTS0@-DMm0   0@@DPU#@0 ~    aP x, pp LdDЍ0=f`P "h'o'o,T%0d IElHTTEp@-00S 0x 0t 0yl0l l@0   PU L@L0L D0D P p Pp'n'o'o'w%'w%%%%%p@-@ܠ0@其L 0 0@0PU@000h@0\ PB0S00CS0400S vp@g@C'n%'s%'n'z 'nP/p@-@PTp000@p@-@P`0.S0@*S4@YH哦<`$@0xY0WY BYR +%Yw AY* X0I S%        !$D%T%!!! %     %   % %  %E0IS0QZ  $0'S"S"Z 0S 800吪{Zv' t  iTP  h~P T" ^d\s00v t 0 y 0%UU[UU%Dt'|T%>?'{U\\0LS$4$<$$$$,$ $##############'\ \\ "\ 0 \M 0\? \-@ÕÅe0\fnrtvabXP E\X P ? \  P\  xl!s v  t 0 0 ɚp| X0 , 0v < L幚t  l屚0 R0 0D@000  B( 1I 01 +t   v0 t  tk0$e0$ Z 0 {t 0 sNVBT,Ѝ3 ޤh0C- 0`qMP` Pp @P 0 0p@PC 0p W ) PuY <YhP0P( 0ES zP H 00S00H l^YPH0?S0 -S00H0,Ѝ&VV[4[V[\[d[[ P@-  ;;\\)@-0@0 0 \XPX`Q \ W 0Ѝp@00  P\>V\i\pO-Mp:VZP0ԑԡԁ0 @P1 0S. =CZPP00  IGc[p(hP 00 \a8i[LhP 00 4hP +G 0$00SЍl[hP 0 0o[gP 00 gP G 0(0 `Q 0 SgP00CS F0 0 0SW\\V\\2\0K00M00P0D0 0C0D080;800,0/(#Q00<00,,8 8 ,0/@0D 9K<@0(080$00= 0D00<00,0/+@$g0@-0$ 0d8 Ѝ@-@42000@-@4*000@-@(0(S00 0V0,0Ѝt` p@-@PPj{|8|<|@|HPD\`|U|\|`, 8`V0,0p@-@480,0@-@4ݞ80,0&@-8@}z( R n8 ", 8 <  < D ,-D  , /(0S \@-@8@0<<@00,0@-$ P /: Ѝt\@-P": tn\@-P: to\p@-0MP`0@-S00(00P0 0  P0P  (Q\   R4 0F03/Ѝp,PW\[4A-Pp`@Q`-VPQfP 000 0 `fP-V 000p0p@- P@@0P ,pT 80$P< D0TP$ <0<PpX$YYZp@-$@P0S c00Pp'|\7@-l@PU X Ѝ0dHP0(0'|\Ѧ-t Q+ 00CS0@-  M0| 0-0 0BQq0^@Q ^ 40 ? 0 C  / /'|d'|\[\O-M`pA  Q 7TP 0XP t*PW `$PU  PDoT<†pS Z Y X W@  U PCT<p S @[  Z Y XW   PT7pP  X W P T;%S( < S. &S)  S$ 6 CTy"  W(  * /49>T`P($F$V0S:ЍJS@ThZTcYT^XTY5CTT5CTOTLp5CTGX5@CTB@5 CT=(5 CT8U@T44CT/4CT*4CT%4CxT 4 Cq$ B 0hT 0S`\`TP4@CYT84CRT[KT 4 CDTZ=TY6T1TW*T3C#T3CTx3CTXPL T@3CTW$ TW@T W@S@ S2 CTWT2 CTx2 CT`2CTH2CT02C  0 d 0 @PpЁ0SU ?t=T   Q  0녑0t  P U tP p^__%_2_>_E_L^{_S]f^_ZV_a_]]]]]]]]]]]]]]]]]]^^]^^#^"^*^1^8^7^>^E^D^L^K^T^]^\^e^l^t^^^^^^^^^]n]b]j^^^^^^^^_j@- P_o%x@-,0, P 0 0 @'|ln_%x`s@-@`$f000 #S@cPf0S  0p600S 0 `6Ѝpt`t0S/#Sp@-@,P$p0P 00p'|ln c@-PRP@ p`+p 0R" Ѝe0"S0SO 00SS  00@O%Dp@-d@P0S 0S 0SS 888 U   S$ Pp'|qh @-@Qx5 bP  X0    P      Ѝ@ @Ѝ`h4'|0@-@PPM 0SLD00Ѝ000 0qP0 0 hM'|he@-Pe0S S S8 4 ЍbS$ Ѝithh{i=0/O- pPMpap  R  $, P R  3ߍ?!0Q R b@s   Q Q@ Q@?0[T WpY: R D9 03/PUPP'|iiUii7@-lP$ R\5@4 H-$0S p (5 5 Ѝ0'|i'xj$jOp@-@P 0S D]0PS 0P0 H 0R0pj@-PD@D D`DpD0S=00 cjj%xܬ@-TCXPL0 p@ad0"S4Ѝj'|j@-T(XPL0 p@Fd0"S4Ѝj'|j@-@PPM 0S00*`/`0 5P$ /Qp0` `0 0%PT 0`2# 0 0P!00 00Ѝ hM'|'|jC-@0M  R2!<#( xd, lT0 `D8 T44 H$#4R0" ,$"4S "4S !4S !4S !P0S t!T0S XpLal匑P8W0 ~$ЍC>T0S? 4a r 0  0 0US- !S 13 0U SS0C SHIHIIIIHIIHS U01  `0 l[pPk% `kkAkHkOkVk]kkd0kmkvkkkkkk kk O-(Q ,@Q 0QxP Ѝ4QPTuPQ@o80S,00 80<0S#<0P@^PP@WP1 QB"=M`p㼑弡弱8W0aSq R : <0R 2P)0< S (P0pS:`(_Q (_Q @P0S0 BS `a 0ph R R* \*a  `0(S0<kkkkll0lp'|lmZm-mlCllmO-4+M p*bP 0$S ߍS @P$4+p@P 4 0娫 S0ZQ$ "$0f0Qf/jZ,2!S!R !SS0С1,21S 1P P @ P0 0ꌡ1P#>00 P,2 S, P 0 @pY#>00?s0 R* 0S 0pHjM P 0S 0 p:1Sw j(  P@M1S jC f/jZ01P P%Dh 'x'|mmWEV}}m΂VEW0n&n`nn'~L% A-P@`+Pp5S$ Pv $0f0Q h1%R 0R00000( '|'xn'|p@-0@7P  P$p@P 0@- 0S, P'|@-P  '|O-@-: PkCM M00 p*8P 8.LP008800SP : KPP  |@00t Ɏ0hS )^P,X <(5Y(0 0 $ P <P:HHἂY9 0  $0P$0S ?$02 ]P,唙唩$ [ 0S$00 # P$00  P$00  P$00$0  @ ]P丟$& $ <P($0S  S;ƑZ0;s 00 0P$ 1\  d@  Y= 0SX8 0 S(0(0 0]P |) ]P  w] P00 $0dP$0S ++RP0  0$ t\] P 00 $0IP$0T0 8L] P 00 $09P$0`0 <] P 00 $0)P$0X0 ,] P 00 $0P$0\0 ]P t]P 0 0$0 P$0d0 4]P  50 $0P$07 \ P 50 $0P$07 \ P @50 $0P$07 r |\ P 50 $0P$07o b @\ P 00 $0P$0x0_ R \ P 00 $0P$0|0O B80 aHy0S0S _0Y: Y0 l*1 0TPSH (H 2 0S0> 0 0S @pCލ Ѝ30"0 00 00S D 0[  RQ<0 r(P04\  BB! Z 0S 0 0SO 0Cs RS[dQ@[dQ@Q@\(Q@[dQ@Q@[Q@Q@Q@Q@[d 屌 0 0 R0 00S 0 I0  d2000"0$0 0 0 $0P |6@$0!S .,0$0$ 2 L 0S P C 0$S N[v8 0 S Pl . 0$S 9[$ 0S[y 0 Sq PP  0$Sh [E '|o jhesdo.Q\ao7oM'|ooo~oW'|~'|oooooZoopp ppp,p7pKpfp'|hMdd%Dpps@-`0PU V  PX@P hЍp`PD!V 00I0@ⳌVddq>p$00S "@-^00%Tp@-@5S4 0PSP p@VPp 0S 5S 1S H.|Pp5S T \Pp< HPp(( Pp/.'|'|Pq/AdeAdrqMs@- 1 AP(000( ;ge V( 4 5S P]0S ]0S 005S  P0P_(5S `ЍpT TkPH3`0bPVEW'|dfq^dmqo%T`'|dgq@-@P f/.V@'| 0 D%T'tdm0P:/ 0#-3@-P(P P 0S S@@ xtP@Ѝ0@ Ѝ/%p@-4@4PQ"p@`  @%\ww@-t@t0MQh  `P0cS CS SS 4喋sS00ۍ0'xZxx!@-\@\0MQP  HP 0nS yS0 $s00ۍ'x.xJxq0@-MM@` PP 00YSP ,UۍЍ0OPxxx 0 k'L% @-@M0 XP ۍxW@-$ $0 ЍJ'~L% 'L@-YMM@p ip\YލЍ<0< S <f%Pژ10YS<0<0Adrxxy @-*0gj zgzz'z'&z'z{zgzzz { vЍ5y 7@-P0@ 0$S0S ⷹ0S7 TQ,BQQ,P010S 8@ 0W000 0 Ѝ0C0ASfffffTffff0ffHfffffeLf`c0As Rtpzg{{'P{ zg{{{ { { @'xy4yCP `00CS`0p S00 P0S X0X /Xi%G-` 0pP0_V@P ",@pGWT@Y @ 0@GH-%PFBXpဠ 0  QI V uWPU PP pXZЍyc% O-@M MP`%u倅倕0S0#!pO P XP4 0P(p0 p3 P _ dtT(p  P 0 n7P ZPdⅾ08Hd8tDT( p P 0 I7P 0(0csS, p P 0 17P r0,0cxsS0 p P 0 7P Z000@cs'duѦ0@-PM wdP@` p D+& 0 4G00+ +?Ѝ0'@dzs@-@ p  &0  #0 0`P   0    0  h0  P0  8Ѝp'@dt30Qx( p@-@PM`PU ep  (  UV V dPЍp (xMH( Jp 0% 0'@(d}!C(d~3E0@-PM @ WMP 8v%4P 0"p0 q%Ѝ0S'd{ѦC-P0@p!a嘁,M00 5p0S@dd@@  p  <G%eP qP pP $0Q `0S*@P %%@`QUCW U 0 @ R001t` 0S,Ѝ00* *  !P@,D%~'d||p0T O--PMM )@QP3040}=Ss$0(,0$ p X.4@,`L8V "0(000SڍЍ!# С!! (@`FlQP BPp $]Q@PpR8>p|Y @0: S h"hh?040}=$$0$0(@,@0@0  &p ,4p`V4(000(S0P:-  0P6`p  v됁向吡T !  kpp ` 0R0$@(gP(p8$ (G`F@ @ p0 Q` 0$0+4Kpq 0`p *,# P \. RD{'dw+^ dxOl/dz%x% hA-PM $ @KP D KP $#rS  嘶0P0`S dS0"S U1r0%*VWS  D0p0S IS 0"Rsp#PdPd `尀p@p0 8#0Ѝ(P'dyѦC-p` PM Qk# /PP 03/ЍC@@ R; ]p Q#%'t 0@- F#'ѦP7@- P@TOP DOP804 p Ѝ0.'dwP7@- ^4P@, p2 Ѝ0'@d.@-(0   `%xO-,M00@Q`pP0000 0$0X,Ѝ JP  p"$ P  |p $0 S TP@㰐尠$0S" 4 0 00SW   ڀ0 S 0 @0D!2;p@-@PPG1P' 0P, 8>0P 9 x"0P 0P 0Pp@蚀Yp@ 0x@dp@U@@僀PpdictaraynmbrstngbZTRkt0"!#/P/'A-PT0p`N@N,0T@@DA??@@@'?0@-<@ 202,0fMQ0  Q* 02'> 0R//G-`pB 0PFME N@PP W 20CS20CS G0'@-@p 2SM"n#^   2" E 2"HЍ@"2l`E"2HX"\4Ѝ@'%+R`j as@-P`*Q   0SЍp00S@Q0"S1Ds@-,MT$L00 $ 0 00%xA-`P 0p @TʬB! Ϡ#q0d /0Ipq  RЍAQL`N0S`@D@,I Ѝ%,B'@-`  ppPp@0h Ѝ!$LR@ @dQRQ @=R_U'}p@-4@PL2S0Z( #:P0B1p'0/p@-XQO@…`^p(AB?  Ƞ̌Č \ @0`0 P#3pAB?    P   @'\0P8"< @-02@@18 < 4 /'O--bd"%P   00 "+4`]} 0 R40 $R0 S h2000#1-R0" ,4⻲4`P@(Hp0P00S x`P  r`P  l`P% 4`#}0400 S; CK0g2*hiU$[ED1?S%\2 @JP@\2CP0p0PXBp0 X@Pp0 X@TPp0 X@TP`4`(0T$0000Z 00S $0 0(00 0l @ P<Ѝ P @'%'%:j%DRC 0-s@-@p00CS0 P` Pp pp60 P00CS0 0 Y@oЍp@Ѝ/%T:G-a0 pPpO4$ e@O0 0Fpq 0Ѝ  RЍGx 0` 0R Fpq `BE,FG 0S %Z'0p@-"@R  lP"n/.G0!!UU08 T0p@@PB @N@Tp'''G-lbpH@,#HPPH < P UW00剔LI J$ P30,MU 02U!U !" +I s?@sό0QX2 G    <1 81 41#(,sO$@w#(,$mk ,! (! $!0000 08<  4 U0 08< 4 I 0 8<4?0 @H20H2'y'p@-d@ P0!ps?Ġ2P@0`^`H2̌ C B$ 2H20CH2p'O-@00Q040p`80; 0 0T0$" 2R 0 W) 21S% 02 P   0 T02ST Z>O R[YS2PX( [82<"#0 2S Z LP0(Z300 @@0``0Lr`@H2[ Z H2S S021S 2S P Ѝpr08<#4 s0 SRHY+ZZ 0 SZ pH"02 BJRKQ]QP$1H20CH20 @@0```@k0rt!R Q0!(,$,  "00 P0"R0 Z  p  ̠ Ƞ Ġ X2# @02 ,! (! $!0g,e(c$a'8UFrO-Q0p4P ЍQP\ XX<˜ S8 YIPpD"@2R0B2080 0#RZHb`VJ0S 0BD!R !(,$  VX B Y0Q00S 80S 0s¡F '@-Pp0E0@M 0 "$20S WU ?Pߍ`T D `` pP!0C0,,,\ vKP'=R- "R 0S /'O-M@DHb  Q|PpߍO$z @pQPw0@0P(5 00 2P!00$ pP@0# 40/G4"RJXQET-Q ) Q Q54 32S !1?  !<0 #!1?  !< 0# 01xS"0?R=ʇߍ@P hQS-2SrW#,| 9p` !0в0 i 0`p1W!002Rph"R p p< \"QX20P"?J 007 1 RS Q0S!Q10!" x12S  ?01P) !Q|10x@! ?tq012S02S 0 0S>0)S Z0)S  "Q  R  Q !P00 0F0<  P2S<''iHsr0%$F*\HDLlU8N@-M rWP@p@fЍ@PP0" B`1 @00$S$Ѝ@ }{ 0vtP Pl1 g11< 0^1 Y1 ?0S11< 0`J1 PE1 @?0Ѝ@='00N^m~O--0  0P \ BEx02S 0S " ` PH0 SR d0P=R'0A-da0 0XAP d2SD dP4x!p" 2SPqH2U 0"0$~pㅄ"[ Rp\EU$npM0 00P d2SX )PH=Ѝ0"P 18<4%'dmqu?'v'aA-@T2 @PBP BP BP@ `p@T 00S p`V@APD00S @@A@P='%A-Pp`+ @  000 0@@@@-@`TP @p@ ? 0@$ @ Ѝ @KO-MM p4 P@T\D AP @ <AP44 00(04QT(0 ,0 4@ 0#0@,0S @@((@`@,0s0000CP匃0P@PP0 l!41P430 (3Q,#  $ s4T0> gp@: PE ,0S ,<(00S<(00@1 $'<P*'0FSʆ` P0S -S@= 3P00 @@P,0S ,܍ЍA0 0P @8800  G0 R00S' ,10PAPQPa400C0 CC0S0SC0S0S C ⹾0S C ⯾C⪾C⥾$0#p t PS<(0  PӦ'0    +%",0Ѧ0/'0/'0/'-@-$@  F 4%xG-P`p?C@0S  0S X U `Y 0S X0S [ Ѝ'qao-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @Pݍ Ѝp!r@p@P=0PPD@rOP00: S0 RP0 00PPrP81: S`P% S  R  rPPp[PPPU rPP @P'Q't@-P 000, ,x$Ѝ  o'"0@-4S 3/ 8'@-?B0 @( 0$ 33B@'@--B@?22#B@@-p PL`@@0 7/P0 S Ѝ b?00'ՌO--:M6M@  @  @ P0 0 PH @| `PMF 0S=f vY 0R R0 p 0 0X@OpT 0S" P%5 uP吅eU \ 0PP0HH@ލЍ03/0P0  PⲼP@p  0S0SW SW hP0:0O.: ; p` H ip 7= 40@0Z0C @ `V)` 0  0 0!000`0`00 Z!v s p 00 +0 0=9P0 0S `*>Pg Z :v@P ZH Yp Z\D0S< e So Sl pWp 0S 0S  @W 000 !020S# 0S,aQ000CS0"4@ T 00CS0!* P @YT Y@DOoB 0Q  q @OoB` 0 @0  0 0 SNT'ը%% .0@-M 03s0|c00@SdA 0S=PP R5PP j 00Un `Ѝ0S 0S @ ' 0S\0Sn\  0/0@ \0Sp 0 @u0 @5kp 0S0Sm @\0Sm  @"  @0Shm @D <P@ @0 @ `0x P|"%   T    P  @@``A 0 @` G H D'ը'մ'լ:Pr4fG-0@  0P 0S< 0  Q*v  _PPxo  7 0`P T{ !URQ ,Z l Z>0 p H0 0W40p }P D u 0Q40   040 04$00 00$0 400X 4 0048<(0! 04"8#<,0pP  P 0SD00D0D`` % $0+4& 8' <"X0(0R* 0H0`|- ,034. 8/ <801 0042 00$4  `I600 PQ  `Ѝ   0P SP yM`P1S1S1US1S 3S3S3US3S, L D`P0`$ `030(3 1 3 1300`500 PQ    " 0P`00S !14!8!<<0!14!8!<@040  540  PQ ,  0PA0O A0  P 4; ࡟ 0R  2 eYNLJXpW P0E: 07#;;S`TXD $ R,0T T0,0T0 RC9D0P 2L0#1\0\0Q 0P 0L0 0#00P 0L0Pd@d!:\x}RRaArrAaU4Wo@-p@`P P00 P5 00PQ  Ѝ _0P< 02/!@ 2/! P4 00PQ 4 &0P!\7@-@P L0 R0!0!0%^l00l0 ~p00p0 Ѝ0^ P ^3# ~\ L ~H00L 4L ,NP000Gb#]G-XP p` P 7 Ѝ00$H 04PQ D& /X0 ӿX0 PfO-@,M0p@l@$0`P P " pP  $Ph;$0 LR0- \)̌ PPP;p P ^^^^ \\\ \P PŸ Pu p/  P@P L0!$@S@ s@@P0S$0p 0 0,Ѝ8(} L0 Q$2 q(@,"  P "  @P*"*  P0P S "!"0  0P@P $7 + P r0 r// /37O-`P@M䱟䡟0P0S Ѝ p W 0G s 0C0A s 0 0 q s w qpp d\P0P@ 0 `P 0 00 P 0 00` P0A s0 ` P pP0 0 P` P >r/CR0/0@- PBU02S0P^0A-p`|Px@P  PnP P0R*"R0R0 ]O-0p` P\PPX Ѝ$P  qQ 0 0Q\@T(2 R@0 PQ SC0 BTX t0D s   0 TX Q  0 0 n x P [ P J BPTQ2P PE(b O-X`0pM@PPdЍ 90Yl08L0  S 0    s   00 P䑟P#б 0 STS sH 0/AP {2  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 )"03 010 PQ 3 ļPfO-@`Pp㤡失P0S00S <q.p@q8WO$0S  0S 0S,0 ( 0  P0S P  LPpl Q P l0p<0P0Q*l0S 2Sp  lXP0P  RQ@0 P 0)^dW@-?`XP\@#@3P@T@TpW @@T`L'ָO-P@H@M18 00TP0S<0T D0S Ѝ1@ 00 `p0Ds#p ᓷ0 0 00P Q P 0X:0 0 00P Q PLK  ۻP<0T 0B'ոO-M@L0Sp<`@DH SP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:Lz'ո@- @/px0%B?kP0S 30FS `C 0p@@0T Ѝ?  C0'ո0 PK %/'ոO--` 1aMV  0/ SP0 S@0P`(0<@@0$0 00@8D0% R" X0p1#r380#  ,080/80, PQ r0P@0`(0<`@0$0 00` p0C##   (PW  q240pGDD04 SD00S   40, 2400 080/80, PQ (100  RR R0(100@0D0 p0D0G =d $\&P2  (1 0(11 J    0 0B0 @0Paߍ0@ S100S  S:I@(1  0I0@;+ u P(10(10@0 00 0Sa 0@ J /o<0(0"s R`$ 00P `, 060(0 0$00 0<0S<0! 0C<0 0< 㓲#P0P 0 P P :P R: U 0`$00`P1Sh T U70$00`P^(<\Q U`V  $   P`$ PK/Tr6 `0p!P0hgQ P P0S*0`Q`  0* U$0 0 `H0h P H0 00  P@`  Q . A0  L L  @G?LL0CS \Q*V 1?s L0t!s0<80t10V3?x1 , m.000(00UTX0$ V0 0  T$0H 0$00L0 00  @Vt 0 S1S IpQx1PPt!hR T4,P PPL0sPPt!.0It1@tQUP0U*0" 00 0p x1S TP@ 0I 0000@x1``2PP 1t!R0 4 PP 1@>03 s0Ps (0RW U 0`$00`PO1 SR`2P0S 0S TsZR P0S02S 0S0S 02STYTTt!:pQP 9PP 00I@P sT > t1HH 4LP PPPPPPL0Is0PP@x1K@I `e2P<PU `t1VS P@ ta``L0Is``@P !RP \PPO 0 1t10t1#40L0s]?00t10PP4> K/T-PP05P/U U0@Ih00h0uP0U*0RPd0x1ST0x!(P %4xQP0%8%\0 P0PEd0U03:T(y {P Pt!dx1Zb" :0 0t12P0P`* 4 40PI!2S0P0 S0 U 0 P$0X00$000  @ D00S, 0 80,80, PQ40 R80 彷PI 5P0e'ո6]'ָ6+WtϼNbz5b C-P0@2SdaPX pP, ЍP K/3D00 8QP0Q:" 0PS00  Q pqxPh`P 80"8 R 00 05 !${'ո$HlAp@-@5%SQ% 5 %SPR UU{yQQp  0Q Q0'ոA-lP`5p@ @ 0% Ņ{@ŕ\'ոO-POMp*P> b5S5夢05ET0  v0P05 ET `T 5d 05 1dP 0Oߍ RR- @ST$52 S$5P R` d0C## 0 ?+0 PQ d 匶d0P Eh0K/0h0 20 8!,qr0d  01(+  j 2  2,10,1#40L0sK?00,1001001#40>00010 00 000T0 C*(5,%PQ Hd d0P{ E'ո‚¤'Ocs3‹@-@ P {0 5'ո0/'0/'0/'-@-$@   |M%xG-P`p2@0S  0S X JU `Y 0S 0S  Ѝ'qao-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @Pݍ Ѝp!r∵p@P=0PPD@rOضP00: S0 RP0 00PP⺶P81: S`P% S  R  r3PPpPPPU rEPP @P'Q't@-P 000, ,$Ѝ  '"0@-4S 3/ 〶'@-10 @( 0$S"{1@H'@-u1@.F"C"k1@O-PMM`@pP@P0 P: S3/HP 0rS N100P 0#0@0@b @ U  U.P  P PU +100@23MP@ S @V`ث``P70: S*^0"+P@PTP V0 S R"፴P-P U 念T@\ ScP@`-\[P@ `UPXt5p1 "7PU00`00  9@P  ⺵P00SA`X PPt奵h0 ⠵PL囵PP ^W80% ܍Ѝµ½ F F@F0/p/p@-P@P( $( $(0XRX0X00\00`0ddhhllppttpp@-@ P  ( ((DD(@@'HH'LLPPTTXX\~`\`0p Qp` (P0@ S p@-0@"!Rc0p@-@P''''pA-0@PJ04S->C'->C?X'9>:>C'?n:>CF' 0? AC>'}C>G'mF}'EnFy'E~Gu'X J.X R  $$((,S>,U'}S>GP'mFL'HHLLPPTTXX\\O-@  $$((,,0P04 40TQȑ\5 S L5sT 0K TTXXp\\``ddh~h`lzlpwptttxqx&1[ hepb`0 `$Q*\5 S   0S&P%@ PSزK 0CA0Q R,2.0) T U0+P0sC@p/0@-@R 8< M4 M0h! @SP ۍЍ+?'000 40 0 0  0  0  0   0 0 04   Q R S00ą ą0 402"8<"4"rb ##̠#4rb2"LABLA- b0 Qsr@ J) PP1+\#-0A0 0 00L B 00 00 00000u0#$ 0 ',"'("&8'$"2&,&42r"bF 40Ѝƻ@-@0S"7'x00S/0/'Dp@-@PD @ P ,00S 70 0pp'8 00S/%'D00S/p/'DO-M 봰 P2P0pS@00 0`Q `0X #WQR0 0  0BWFD RQX*10S@Ѝl10ST@Z000@S0@0 ppg@`P0AS4T0  0W ,(\ SP @T P( 0@T /T @@V@TD00S 800S0PS E@'8'D''''$'p2O-0@4p 0 L0PQ7, (0R000U00S,  5`P%0SP Ѝ\6  prX001P``` 0,00(0S/", (R00Z P000 `0` R0(0, 0 Q 0R000V00S  P0P`"`F0S/"0PS0P X5 P PpX00 0'''LG-@`D5(@ppT@@@@   0@S)st f Pt崐0S 600pD KT 80 00(00S0p0 '8'<'DO--"MM@`PX +0Pvh0H6[$08pd00`4@(,#[lt[p<5@o 00 D?[0F -  0` "%  N 000G 0` 5 @<Y` ` P0 c1S C^0\03 U00 Y 0100"ݍЍ  0`  01S0  0 87 0*0 0Z0 q''0p?0t0 0p00 P0 C# c.37,P00 Z<5   D5 L0 [0S |#3 00 M0S |# آru00"0 Sc:0 0P2 0A0\1 : a7:Y0\<5   D5 L0 0pSJ G %10S: sY0 040 1000$?0 &R8 P 00.!(0(0 (0phh(   [   0 1P0@00p 0R 1QQ_tQ8 4 p0 1( P( Qh@h'4$''% '!-'LA-P`p@54p0S /40S"0 SRp#4p0S 40S 0 SRPU@PN@A-P`pF@ `$P`P>00@AO-HMQM $80< @02`0F/ Ϡ _ 0%P%P(P,Lr 04P3`P "`0S_(P,0ۍЍ20S%  1pVW03?00?s0?0P 0 0"0S_S,0(P0```00PPQ, (0R0 P 0S0S0 0 0@Є3/`* 0 000S0 0  00 0C 0|* 0h0o40S %0 0k4''''8'D'<''@@-P@p`AMM(A$O ㏽0 P@ ;3T0:t0 S0*d $@A0P 40  P,, $AލЍ;'Mi‡r7@-0 Ѝ0@-\M`PpX @ (0H0T0 `'!D0DP Rp)RLt$Pu\Ѝ'4QA-`:Hp`Q#3SP3S#\@A'O-M@ `) @Q0E:0  0P40$?00  9622Q p{ q Br sQ0<30<420S0 yP2p R 04  0R  @P/( 0 1ı r0 4 Y: 10S0<00E0`-20` Ѝ 0i 1 020S 20S 0M` $`210010S op1p1000 ^p[X'%'D''8'4O-@PGMM X `'pA:0 5 R"0xSc 0S! 000S`H_V00 1000 u0 0{5 H0\00`0Q4p0Qdth%" 8"0S/ | L000 0Pt  HP% 4$0000S V0 0 I.P3GލЍ.P3 0G"0J 0 > @p  0 0S ㉻s'  P1 $ " i.P Ѐ䢟 L000W0 H  w 00`02  0J0  0004r00STP2r0"0H000H0H 0p 0 S 0 RC 3#004 S 0040P!mUi 0   0  000b  0 000C00 S J8   0 0001   pt0000 f0 !0sv  0  00S ƺi‡V''4`'߀%U`y'`ǘo'LǑǣ 'ɜϼAXG-P`H@pXpAZ x10S l10S 00 0K P4ЍG$@PEU<  1 QP0H 0  P!`' H঺0S"00S U Z 0S T0S Gp_pЍGYX3-P H0 ЍU'''k'߀%i‡qȖȬȸ'L0/p@-PP@0892000@ 00 %/0@0 %p'00S/p/'D 00S/'D 00S/'DQ000R0S /O-02@ SP`Mg0SD S0`ď080T C/ S ! R 0C00 0@ ἰ? 0 00!\5h!pS 0 00Ϯ0 ?@U '  ϬR 8 R  00ع \5S0 0/070/  0ĹЍ P P R  00D屹0 0400᪹'''T *CQO-0`P:1 S0* 0댑匡 Up3Qx 0 U0A: 0@/<#\%@ 1R  0 ?>#‚ @ 0` A 0a<0@0S   0 .0x@ 00 0x0 0 ( R'h'߈'T't'4O-hCM R S  0 R0* 0(&Y 0:3 ` 0 p/<#\\%p2R  0 ?>#‚ Ppx0 `0 C c10d0Pp Cc c a$5bS]Q,040(0ÿ 08G,10SC 180X Ap0!X (u! RKK/W08:‰ W2p P| XG 08o,80<00<0S<00<0ЍGGGG`G W  R0 K R R'߈Ɉ'T'(' '4'`'<'$G-1 `pP00  0C0@ 0S !0 80`S P`P 0Sj 0Spz 0S\a0SH0S 0S( 0 dsS80!"70  " " 0@D 8 ? 0 0E 0 Bd! 0;0 `0SR "0 0S  0 "?  0,ß0SŸ9),04(0AŸ8 ?S%'<0p 8p S0[ " |̮0S lǮhbPUt 〮@0S H弮Db@PUn u,峮0SP@PPDP_H0S  `QCn* l=xl%|0S lHlC0p00S0P0)% 0,0UA:׮000S 0S P H1 H0S 0S,0S |P  P   000(PP 0S(P KP FPP P'u̘̯*Nl͍ͲXmΔΛD'Q O-H0@SPpM W0R0: 0P 0 H"6@"  S0 h20SY HЍ` 챟쑟  BR 0S#/  !.U  R.. P !`\  R0 P  }P  (" < 8 `8< P㬫P0H P 0 3$ԫ RP `  ^ U VU V ' '+'' @''LZ7'00S/p/'D00S/0/'D 00S/'DO-M,Mp' @"@:$Z 0 0`SDZ ` pP$ 0`VP0 00 0؍,Ѝ0 (P  X0`VPh0S  0` h\ P  a0S, 44; $; [+Z450%00! ?0S S00:00/0S 0 S00 :0V00#03  R00S :0S; 0 p ì6h: 0S RT fP 04[@< R04`?0: :R00p00C/= PP%90S 0 勬 0 0 T 0.P0 90S, BP$0  ZP00 0 S_8 R;80S7 0V0;Q01*h0S. 8(8d001 (P Yd80S (00 0(00l 0 `4  @((70S0 h0!7'(5SY/V T:'<V  3 #P  RHSQ: 0 0B 8 U0$000(p d0 U(7PQ0yX 0ZztP] 8' 0 x0pPP66Pm"h0S0P%Q_ 1Q 0PQ^100 U0 EPQ P00t A?0#R 10S0C0 " ᗫ  Z$0S 10000S x50S $0S 00 (xt0/}$Q  50S $0S  $] Qg 04 0 S0 0 0 0000 0P$000 0 #600S<40S `4 PP  @ p t 3RpRLtRPXd00H00SS1 0S |30S* \P00  08<4P 2 12 0\00Q&&:0 @000SD2<`040T/806#e PR8P<`BhI0B\ DP 10H0<0`0APp0`01PU`0\+<5 D5@ő0LT 0 a31 Q>P`U`00S 00p@30PpKD$\5S Q5 " 8D0/0   40S40E SE 3`V0`@0x@S md0, s0 0030SC 30S? |0S( 3S? T!. 0 / s\@T`00Ϡ% 0 S  R~0S\00 0T @T`VT0? `@10x20共A0Y 1:1XS  0@T 0P0 K)*000Q 0:*  00 VT 0!pW @p \W@ S00!03S%T@1:@T0,a p@  00  P H0  ST XQ! 0 `P 0 Q0*: B`'l'T'o''''' 'D'4'8%x'' U`'Pyҏ' ҳO-` @ 0MpԐ԰ 0 0  BRЍ PP U  QP p@g` {{p @Q RP Q @p'8' 0/O-@lMX J0`X0D1Dq0@1@ <1 0,0SlЍ0S  d0,P0 P储00P԰ 0E R`U0!:@P 0 AQpR Q\tR ` R P@''''8%x'D'4 0440@/00S/p/'D00S/0/'D 00S/ 'DO-:M`PV`@@M90S P 9 Q0*`0080< 0.娉Y pP 0 WP p)l Pd9p `0S 0S 0) P00 9 < 80R0Ըp0S0000,0 0S80S1?180< 0#q    0P@pgrce]00C0T 6100S 0y P 0sK0 S$ 0S 'D0l0P`7|`z 40S0000,0 0S70S1?1'p0pp00ppP*0S  YP` 0 1C`X|MPT @p` xp0 )#0 #0@0C0ş 0 00R,*0S  P 0 "0SPލЍ0S #0 #\50S PZ@0 00$001 c P 0S #0 #40S >@0 $00 S! Br ` yp qQ #0 #g00C0@.8P< .\RP$ .P  $PVPP3P` 8< 0Bh#R0#5 0=:PpW P0Sp〣倳-%0AS񟗶tHS43 0020S04000_P 2 M< 80R00" JPL2: 0 07< 80R0sQ# 0S0SX" 0 4+Pp  : S000! 0 0 < 80R0 Q   0xFQF?`!`  010 S% HJ?< 80R0 š!ʡ0S  0R !0 H0p0P``000C0WPpyk % '4'<''8Wtg'LӀϼ'Dӗӣ :('%5F''\UQIoԗԡԬԻO-MM70AS񟗀XhXp7 lP \7 k H* DsP y,7 00`A0  6^P 60S 60ԆV6 tX  0h06`$00堦100V3:6 Rp|||0S0`@aVlPVrݍЍ0 PP   .q 0S e @ FL1 0N0 @ؤ00@(0S Sppuh%pP ($P) 4 /  B+ ! _ 50SV 00(0 _/v 0S >p(0G% 0(SG dp(PB],x-p4p0(S9@0W7:K,0 S1 #0 R) S000000W!"!#*Wl% px4  (  0_/*  ,0 S1 #0 R S)R ) *V { { x0 S( R , "2 pR)@ W(,`0@' aV!W#Wl p ^@ aV @0 (0S $ 0s00P Q0S 0$ `010S t10!Q!00C0!E P0 q00000C0!" upa0S@0 !0C0 00@}'L 7'8'T'dX'''ϼ 9U%x'4'x'ՌȬ'Dȸ'ղ0/O-Pܢ1EPMQ@Tߍ0S  d`@EDAF@D0 xx`C00@  B 0    S,"[ "[ "[S[ Q0:000S 1p`  1R R@0 S 00"P T100C<8P X   X ! ! Q ph0R p$`T0 hQ\tR a` /h00!P\ p00 p000'T'd'%x'''' '߀oT'4'D/UO-( 4弰p/` @$M 0' \P1P 0/ ij0/ 0 !30S30X SX 0 S 3 S h9@ 002 P00 00CSGTY" P 80R000303L00000/` R b3",Q Q0B*42 l20S =P7 P8B P$ЍS   4Pt?00 1>!W 00S>>0Q#_ ! RN 3 T0 0 S`0?0000/uR00S>>0 30 ! 0S H0S 0 04040c/ $ 80QT $00$0 40 4L3 0   ^\ {0{< 0OPp3''lT'' 'D UW''@'''00S/0/'DO-plMX  2倒0|B0,0SlЍdR0S  d0,`0 ,,`T000P㸀@ᇡ 0D RpT08:`1 PRp@R\tR`Xd00X00@SJL  `V %P 10S  0 w@PPP 00S  0w0S  RQ {{00姠 (0R  000 P  H 08S '''z%x'P'4'֢kO--oMM@Pw00  S 0t2x?0SX0S $5ST0SYHPZX0S $XnS X R g?`0V\2 PT20! X" \" B 1\"T000B`X$dP|0A^000h21`l2\B1d2>V2d20C:=SLq QT20B  0S 0 H$5P> *B0>$>0S KF0 0|S0$5  B11  !`0P00B1- 00 S $|0S$  봀 -0⃀Ḁ$1BP`R!BD LȞPP | ex 8PN 08S  <P| *堀<<0S 0 0/X0bA?:`<5A?T0 =80T0.H0Q  ;0VHQ RX0`0@ <0: 8 <48ϡP b4{ S X,0 Sh?^ <PC 8;0S < A>+<B<  CўP:"  <0\ 0 0009J*Tx:)l:0S ]X0 0؍ߍ0800~8``!.Q  R  `0" pi0S @d,p  0@ << p 000(y;!"\Q 0 P0/ 0hhS90w Sw 80S 0(S 3S x0S y0 080S |8 0S8(0 0,( 0W 8 <8;."\^ `0 0/dh pN.' `n3&>+?D "@ D @ 08P<LRP$ͱ 7`V=S؈<0D 2L0VpC p,00C S=SxmzS  0;!"\Q 0 分h0/ZY `6+0S <jP#50h ?(60S L0%\Q\u5P50 S555 ;."\^ `0 0/dh pN.' `n3&>ag@} UG9Pt0Up Pd0 0S L P<0 0S ''%(''@'Dٴ'L0/'<0/'<0/'<-@-$@  ^ Li%xG-P`pW@0S ̙ 0S XÙ U ᚛`帙Y 0S p0S s 姙Ѝ'<qao-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  㵗C-@M Mq` @Pݍ Ѝp!rXp@P=0PPD@rO⨉P00: S0 RP0 00PP⊉P81: S`P% S  R  rPPpsPPPU rPP @P'<Q'Lt@-P 000, ,吘$Ѝ  凘'L"0@-4S 3/ P'<@-W0 @(㰇 0$#K@'<@-E@;@P/00@-0@S 嬘@ 'q@1Q0@?o2P  R9 -P0 P0S 00SS0 000 000x PP  P R0 T XL PQL H 0 0/TTT 8'\'D''' T8 t0 p000 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/'0'hT 8T8 'lp@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0H3H3L3u/L3P3P3T3T3 h p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0kH3H3L3u/L3P3P3T3T3_ [EEP  U4K44K44h 4I 5- 5d0Bd00000P5P5H5H5=CH5h H5S>S>p@U0 \\L5SVPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//'4O-4`@MT 吴py+|^ :ltl0_0  @P @Ѝp\[P 0S0 40S40S 0 /: s00Ph Pp \3P3#0S #S7|w P p0S d/0 CS nD*U0S c0\%R##\%\5"0C?o"20Mph0 S 0X"4?S%Pd0("0 /:010SA,0A1,Ÿ "\ P 0  R0/ 0SR0S 0ȡh 0S 0|\%Rt!\%P l10S%\}XQ L!0 0@! 0 * 0S 0 0 0@0@ 0PhpJp0p 0 0U* 0R A'd'Hۧ''(U' 'h'tڇ'\ڦڿ'D' 8'0T'4 ''p'%'@'h'l',bxO-@9*@0MM08x` P G壗 ލЍ80S Ḅ:P1南 h媕 0: S L LP@080X0,HSP 0)00S 動00 7 7 8   ٗ ԗ8@ Ηp8 ȗ[WppTpPpL7WD P 6@T NP {E@8P 00786F R>0 0p 0<&00P @P7@0@60@w>0 H0p jp2S  )P )P ).W4PZP-`Y 4[ 0S0=<관Xt V.+0   0,P $Q 趝 QfC/_P`u 2S<4$040404塔X02P#W20AT2@02 r0G  0l H 0/p0l3& 8 S20#"20#207P` 2Sd#0P\@Q=S00P 5@ ) 2RT0 S @y,S!C 5*< 53 30S 0 0@20S 0x3 0 S@ T 10S`"`2QTh 0@b 3 堂=C2t@,00 J ʯ#ā0  *L0@ S葟0S0S0=S0S p-80000 p 0L%000P%X30,q  *A 10S KF0 0','T'X't''H''߀'pB 'D'H6 clܗܺ 4Tcݧ/݂HTjޒ'N۽Zߣq'`ɜ-R'p'@9߀NE'8w'<'4'd''@')''A'Pe'`''\'T'X'd'h'(' ''$'D7'L=S%0S& <0 p0P%<<00*X300 00S 0 00S5 0 >0S \PLq 5*N> 0:#: 5p1_ $10S 0 000S(8P0q0*j1? 10S sn0 00<cQdaP 0`r<0*Jp2 $20S SN0 00S0L%r0L%r0H00q" P 000cH00SP.P$s*4320S "0`# 0 00L40q"  400cL00SPs*330S 0$ 0 0t4pW. 4E ^  \pWR 0SPt*4T40S 0$ 0 0t0Q,%R0%45 RS! lk004E0S|PP*`5c50S 0% 0 00(0Si xQ$ B0Sx < 0(%0S^,wP*b6750S kf0<& 0 08%<5HRS$  H00<508S6IP*46 |60S =80& 0 0@%D5LRS$ t L00D50@SPp*7470S  0' 0 0 7 70Sa0S0SZ0L5sV0SN PT(00070L50P5?T5V>X50-00$ő0!00B\A`0PPPB 1D500L 0H000*880S 0) 0 0T P[d P4VQڨ0QXڌ Y 0 0S Py*|9Q\90S 0) 0 00S3 6 *0S0QQ*P '0 0Sl _P`z*Jp:$:0S SN0* 0 0 *0S *0S  *0S0+ Q^ NQ L *0SQLd *0S{v<Q x*0S r*0S l*0SH  <%L 8 @D%;0,5S0SO  ,000;0,5<0(5H04E0/<5L0LL08%/@%D5*0p<$<0S 0, 0 0<0S <0S(L*<<0S 0 ]h < < PTL PO\= 0S@ IPL Z P `d}娝@TUʸ=  ?001>0%.P 5  ,@ю,>P8( 3@N S;0L> 0 S 05t>|> >岎>嬎PX>Y@>@00@DT@8 L4H0/dL A! a,3 @1 P X) L?0S   h?8 L4H0d/ A! a,3 @1 >?0S   0P00`_ P?o 厑<6P0 V0$& 500060S 1S  P 5 5 @ᘨQ U0@ `P @@0 8< 4 0h%S L50S PDLP 0  0 * `` 400 0 0 0 0Q Д +0SXfPY 04 S 0S^WP_ 04 Xh0Sd<IPe 04V:QQ  /Q R 0Sd0Pe000[ 400 Pz c 0ScPd0 0 0ipm(0S 00 0 0 001 40 X(0S 0 0 00 400 0D(0S 0  0 000  400 0l+(0S 0`v``&$` 00 400 0`q(0S 0@00 400 0 1 1Q1Q,+ 0S A 5< 0 !00|!@0t!0CSq #0p R0 !40Bs00XP `@f׌0PьUP0Qy R E/ !0!Y pG  g'l''Xc'`'H''(LABL'i-Ka~TE'''N'P''L.0ɜx00S q: S  S :C / S : S 0P/@-X'D'U1A-0`S lh@ T L10S@10S08(1 10ST00S 'p@ P00CS0ῷpP U 00CS0ᵷ P PYU ŌYU0 P0  0 0 SNU'h7't'$''u%% @-HP 嚌 $8 PЍ'7O-p,1 p$1p 100 $P0 ppP 0P  ppPPP(㨊 @ PT`00 WT V ތp pXP @@ 00'x't''''O-@-10$MϠ,"4P`` 0  0Y P p0 @u ,UP$ U  0 wpP$Ѝ?0 00/   00P0 0100?00QS / Ϡ/L0 8p0P! 'H'DΔO--` M0P8А:@p/2#@ Z 0 Ѝ 0|PZ ЍO蛋 0/   ʅP 0/ ̋0Pp'H' ΔA-P`U@ ,1 UP0 PP0 0T3`p+0 L@D0T@S  ,  8 L4H$0/d@ @ `.3,0dz0 S  0P00`0@TЍ'H07B'''D'$ 0S/A-@p dPe E e`3aU0 000SR P00@00 0` PЍ'''$'(@-0P@T@TAd0 pCà `cnj1ƌ3` VW @00 0 0 0P00@@000 Ѝ''hp@-`P@XMX  0 `P @XЍp0@-S H0@S  >T00S H$004A,~P00'tp@-<`!Q ''P'%0O-\MpPRS E00 00S` tp@ [00CS <\ЍO`T `0YXH`o0`0E0 0PE00?00F`F+ B\ЍO000D0p P 7 x00pPD@ + 0F / `@0V @:p PQ'֞U`ϼT\%2R/C-=@SM|QPG 0SV PV.10S $10S/ L5as0|pS净 #0S  W0?00S   0S t ?># $  $0 \# 4$$ 0<$( 8D$ @HL$C0 5L5s0P500ߍT'' 'D\%0R/=S/ 5044 0303040 40 5 5L5sP%P% s,,TPC-@40S 4$00DP(4 40S1 40S- T0SC #3 `3R0A-R> 5S*330S 0P 0V`dSTSdPs^PUU00Q AP 0S ?/@#?=P`"hR0"00S7 pr002Pb0S) xA0S) 0R0E>0*X4c 2820S lg0 00S"WP10S " 1XQ h1*7\1 P10S @;0 0P10S D" 01P 0*000S 0 000S d0$ \0 Vt (0jw ЍCfw Ѝ'<'L'$'('','d'3'4''H'@'D'''lQ'x'tf'h'0'l''O-@PMp80S #C\/ " / Q PaV``  [ΑYP l0\P 0/@ 40/ ~0   2 r0S0b Sb 0!S 3S -0W? 0!0! !0!S`0 0 0` Td/00Ϭ0L3 80S30Ð0C03` 0S300CÀQ"0 0@**00S 4`. ` `Ѝ iS  $00C$0 40S $ 4 @@ @ T'''T'l'' 'D UW'''@A-Pph0``ATR M@P<W0S @ o1p0A'L80 0 1S/ 0S/'L`0 5< ÒL0\ 3ÒS\ 3:. SR///'ԷF^QO-0(,P0p4@8`5 P P0P` 0S 0 S   0  0000 S 0 S L0 x0   pp '''PQ/0/O-@8`堠 眰P8Q ЍP p Q0p8pQቐሀ@pŸŔ`0SlH4P/100s P000sB00s @-8`0S  o/0! 2/B1   P"/ @-D`0S|p00/1000/0B10B1/101/ @-T`0SL000/1000/0B10B1/101/ @-naG-p$Q  l$Ph!Rr lR`Π|S p  $@Z!T P*B\  @@Q ! L@Q% LX R @T @ pW   PP AO-RMPhb  @P L@@< 2WPpߍP)  upp0S k<08 0(00,0 000040!04 04$0D0(0 P fVpl qp 0 \ HW <W 0W $W W up up  3 Qup  X` 03#ˠ121 Q`0 /0Q  as 00lRPà00S! }% 0 %p3sp(0 RXl000R X0 0pp<P00'N'''E'L'L 00S/'DO--pM 0`@Pᐱ0V000Ѝ000/U0p00 0 000P00S v000/1 P0 0 000T0SpP8Pl}p'ԷF^'\x7R/G-P $` 0pV@`0 @`` V`@ &!D( `G-@P 4pS# Y00000`auP0Y0\ \! ##0Pp/Ѝ_uP: ^FF^ :p@-@P`    pp@-`P@ ((UX0 3?X0pA-$0 X (P,p0@4`*^0 *^0 *^0*W040P/ Q\/O-@Pp02#U 1!J `R$` J U c9# S!V Q  V3  0P$ I P` 0 c9# S V!Q V3  0P 0$ P ` U `P`P Ѝ 20A-1àQ`P x0x xxI0@Sp$P࠱ ` p@QL ࠁ PQ  ep@-@P0080P 4 PR*SpL0L LS@04 <<I0C800S   0~  ,0S/`0@-0@  L,~0,0080S 0  eI0@}'/ ,0@-S ,0, ,,SI@TP }@}H& O--LMPpU`@( %88S0@ @84@D2@D1@DS@D50  0 00P[} U0#03?[[[UWX{@D @0P 085Q 0@}O0 0 }<D 0XR @P|"!H08pp$0

l ?C-`@0(Pc,0S0 4GpQ |0l x@PEU 0P !  0 P P ЍIƩ Ol QX0sC-Ђ0@ P@` 0 00 07{ 0 P*Ѝp''$X0sC-Ђ0@ P@` 0 00 0{ 0 PЍp''(A-0PQ t@`p0P R   T0! z@P 8Q4P+y+'t''87@-,@P,0S ;00'@-,P ,\  D Ѝ'p@-@Ph0h 0 SX0d0R 3?5 @006.4 Q#3RSpp'4'D'27@-0S S+,Ô2 R0 ELh `Q tp3PCxaQ* Q( H<&P 4,B 5*< 50d30a3210S  0 00@ @7.Bt#|3 Ŝ & 0 P xXPA 5*< 50d301$10S ܵ0 0@ d3S+ CQ+aQ# 0AS"wP |0@a3d3*|0{p00S ᯵0 0@S Ѝ04'''e7''@'D'0/A-pP0`R@9Q2W8$ A<O--0p M"##0@@` 0$0P3 0S, Z}pPs0S  ]0P. # 00"2 0sq)$y;lU tU bU0Op|P+$[ A P80 (  /0S (00,0 `0$#;BIP PnV0 ^ЍVp F  pP `  tH DpP `PDV:P@V( 0S00$4 D0;R` P 0 0;RR P 0 Ep n 0 =p 0T P  < P0 P%%4 (fG-@Pp 0P`6oW  14  4  G %40p040O-0` mM$0P@脟004080 0 V|pp40S+ mߍbW AW LW |8x4xcW iW0 p8^ 4@B0 0@4: S@ @0(0D08`,0000400NP  P 0 0! `T| hp 0Q= $0 ! $∡匱(@P 0V$0 0/S ᠑<<Y; `ix`0"< P0<0$v`P& gP%< ly gw <ExVD <"$. 6 PP  "mp7 PR P* @W0 0 Ѝ R *P*?"?   P* !& *?"- O-0pP@@儠\ㄐ S RẰ00@0S0P 0S0P 0S0PP`S( ?0SSU:`V *%@@6 p 7 @LPu`R@Q0BR ! 3Og00G-(p$ @P+s`P 0㙥T$0 0P Q fu`Ѝ  dPC-p$$ ` 蓒Q%p@ 0 P Q Ѝ cP404-@-0  Ѝ Ѝ/-@-00@Yv 0 Ѝ@ Ѝ/-@-P 4(t z }tЍ Ѝ/qO-MP`p@PЍ p0P_0 [P 4S  0tPHTE$-Q 0PP 0S 4S 0 0X"S4 S 0  tSG0`!!000 0 0  @ 0P 0  P~ 0: {T됩'P+``4`VS ڴ 0y `  :p0 p`PI 00PY: tpltO-,MX`\@P_ 2R 4S 0t,Ѝ 0@Q Q0 '  PS_ "S 0 d000 00 @0 Ps4S0 S: 00 000 @0 0P$0 oO0@ 00SS $!!P "(p   0(j 0@S4S 0y$R  pPm0 RS  $ 0   pPS P0P 00000 0 P-p; U,HSfG-`pMMPr@PYЍTC^t# E@0$4$ 00; Ǫp+p a%s@Ucp` @4$$: S! R B.< Icp, $4S  (4,$0)B. 9cp 0 0dR04<,$$4(40 K>؀C $4 0E 00`d$t؀E0 PQ0`0 04S  0  Pp 0Up 0 p pxp p0 ppz P P 0 0M Sp5I*pEc0Z "@d@d*@Vr@-@P 4B BRP bp 8:4  DЍ@&aЍ@dp@-@PP PP \ p4PS4 PP-RA- @PPpT `X p@0 p@@l$$ @- P  <P sK#H 0@-TD 00    O--`P@p M7>` PЀPP `00000q똰 V:Ѝ 1*00 0P0q`P1 0 0qP UP+0%xC$4 A@-]Q@- |`S@hAЍpP ኯP < 0R00 *,DO-Pp_o 0R0`@|MR(0S00S $ 0R0oU |ЍP PdU 0SJQG (0QSC 0RS R:$ 0R S R0A ,00S00hP0#  7/p  7/p 40 m0$ 80(P P HP  s@-`@P0mPЍp 5/p 4 5/p 4 C-c(0Sh  Ѝ$T@ 0 t0 0`PS 0f0  0 PW0%9rO-0 0`Plp@᠀堐唠T Ѝ0  0P 0 0S p ql@  0 ,D A-P@ ` p0 o@TO-`p pPd@dX吐0 0 0  Q   @ T0O-M Q@أ   00 PЍ P PYR0B  MPP0  40 ` p p 004p` p  0s@-SX`@ P!=?o 2R0S  kЍp,D@- iR sR aR p` O:7@-@P ,P{P  0 Ѝ0,Dcp@-@T 40`PወP'pp,D~iR@-. 0 aR bR LR) sR& tRP 0>P0S00 Tp` Ѝ(h0 ,Dp@-@ M\P`ᰖP0 0͵0,n0S n dnЍp0A-Q@P M Q   ЍA~␀ p$!m!`P h`B~ `PP n=RO-$M@P`P tqP`$ЍpP0  0  0 H0$0X1,"P0*Q p0 0?X S0S pX 0p G 0p pW0 pp $)mP8 000 00 P Kn 4! 00004TP4J0V S0C8pw :$$7 3 0H RP0%*H{P1 T0PsZ.:L0SZ 0pQ L0 04 0 00p00%P> 4$$   4 p44.cp% Hc10S 0@-@C^M E$fmE$4 0 hPaЍ0 @1q !Km0 p0 \|X 80 F D7mP<13m%%#5Ja0$ 8O-PLM@p4 K1嬑嬱D0 pp  0S$ ! R p!LЍfR lRJ I@1` 0S  P mP  _ /m蠟 jP؀  !mZ 4 0l @  Z  ! ` 0 ` [P` pP%s,D%%~A-p`(P@kP0 p!`P @00 0$0@-@P$0S l@lO-p`$MHLPPDT  V  \ D@> `h@RS00 ^ Q00S P UP 4 0 KT0P 0X0$0vP UP000 P1!!U1112@aP 0xPPM PQT0 0X0$000 @R P TP 0 \ 00 @=0 0ZS @R PP 0V GP 00   0R 000P0@SP<<4$$Ѝp zO-4Md@`PT0`X\,! 0 0  0` !` 0 0 0 0! ,0tWL 0Si   R  a B  [  \00[(000$0 0( 0S 0$0 0 0S 0G 0S0C 0  T0  0 v0 0%4 0 ( 0$0    ,   p4ЍT0$`( 0R"0 00 H0 00Q(000ppO-Mp؃`EJP@KV 0S 0 00 0 @PP @000Sp_- 0I( 0P UT P @ T 0 0P@P@ 0 T0  P @00 0S 0 0 Ѝ 0  0I(P T"VP @ Q 0S P Va 0S 0 SV Q 0T P 0P T 0000SpP @ + F j     P/0S//P/0S/C-AP  `pSP  0 X0 0SQ@-@,MP@p`mP<$,Ѝ ( p`iP0  4 @-鸃XPLLL0 Hxj@@@8P8`@\Th+   %x .R R R @-@R R///// p/0/ Rp@-0@P! R8pppppHpP R|X`hpp B R"S@d d i\0 T pppppp 1 pp ' $O-0M `.@P,wPЍ"0PP [i@PP( p0Y:4S 0Z $4R@P\\\eX:iiP ^PP04S ڠ0"S1 @h0 + D03/p# 8 H0 90(6$0P  0S  0D$0 Q:PEp VEW   !$ 'O--0P`p$Mⴃ0  llp@30S`t ZP 0 0" D pT AT fT @$ЍsT0 0p00 0*0:@ pq 4 `0}p0: 0: 4S 0HQ-<2!0 , R8 +R.R+  R@|!|gt1R R8 0SL, 0S<1 +010` 0`[pOpo Npk 0oO@@ **:C p@@XT 8 H00E "  0 Q9`F @% F%$ ` '4 yh A-@ĔQp Mp  A^PP`|t`,P \PЍpP ,0 P=R   G-@`pP+ V$4 ' AnȐp `$$  0 P 1y0OpP  Hh 0$p0Bn 0 vP=R  7G-`-@"Mjp ЍG20SP`Pdc 4pS $RK  G S 0g PQ   ЍX W $ 4RS 0 . 0V pW 0 S pPP@0 0 0 P  0,p, ?o  0p0 00 pPL@P %% W n  U@-b,"  :b D@rTYލЍ  (b $b 7 5Q] b  A ( `0!0x!P XLaDa0!0(a$a $ 01P "݉P$ 01 "a m0 $8 aa# @Paa  (;.@HtsNy0%^G-0p P`@M!\ P Jep@20S!>P @1 9lP`Pa@ P uP @ЍPP p)PP0S00 P 0S 0S P\^ 0 Q  .a *a4pᴀ崐崠W a a + )Q a "  1 p `S%\%h(;.@A-HM@Pp4    0`\0`D0 dp T$  啕P 00S0 TR lRx{HЍTpT8*p%.%0 Q /0@-$M` 0 0@P!!`q ?dp#0S00; P 0SB0S? P\^; 0T 00S! 0 *a@ P 0HTt!pT T   H$Ѝ%%./-0,M$00 0 00 00 00 00 0 00000000 _,ЍHp/ 01@-   0QC-@MP1`  000sS̀p ᚔP0㓗' ~p0lS|p` ᆔP0㓆& jp ЍpW `VpXG-pP8M(@ 0S   P8Ѝ70 060050040030020 0100000.00 ,04 P #00R R 0S T `PP0h# TXPyXp@-PP@M `8@ @ !`  5/V@@ЍpXA-`P @ p!7_PU@Xp@-@P(`$Up p@XA-PP` 4  44000 00:#:900 @0<<@0 Np@p Ѝ M PXN@@ W*0,pWM @- {  M1PpP0T Q8]00ЍP ,D%% "=% iq)ITapy -7 p/0/O--@`p\[\\M X`p <;0S ,ЍO0FS iSPC>`C$9P Y Ѝ+P&P Y00 dt:PKP` \`P%>$[PP 0 `僿pq 0S$$<03"spq$0P`@4 0Pe 4`P `~P @ H.PT H B.PN D0 S@00L0$ RH0( 0~uJ$4P |`$$jJ$4P` 0V @aG`P$ 4]GP xM$'ḿSGP yR0P: 0#8:   t>`P t>&? 0 `pqwp -P$c3ppro l .P  T -P < -P  $ -P   -P   -P q -P   -P q/  -P q?Rr?x ,0-P rF1S 0Rr/0s/07r? 3s?xr?  -P &s/ -P sa$$I$4Pk QpPe =`P =$4 `0Xpq\< p0< .PR <pP < t < .PB <PL ]-P7  4T-P.  hK-P% ޽< H.P $ <8 -P 8 X*0rB$ Bp $ -IPp$$03`"pqu$ IW$ h0T"^  叽$  刽($儽8P0$00$`1T0P %Y\X T $4`壽pq0$$H$4PW`\7 0$3`!"僽pq$$H$4P`PW,D%%[ WLq= 7- 5[MqUm)ITapy0@-@M P  # 0 0Sep< <V 4Ip$N0Ѝ08-i'-@-SM@P, 0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`pk gD Sߍ@i-䀐i-i!-@-@  U ]Ѝ1p@-0MS1`0`SMi@ A. H01P A!⯼AtXP 0`0?oS cP 05P PP$X0 0A. 00`0P A ₼AXuX0 0A. 00`h0iP AT TcAXX 0 < 8XލЍp'8'0....%.3.`s@-?PP kP d O`@T9ЍpP  00SUV + &X@F.j<0 R !O--M@Pp:p#+`P"    DP+ 5JDP8DpP )JpDP "Jt ^*0P0&h 0R0 0 p "( G*Px 0SuhQr @ Hpgl I 0 00  R R R[  0PW t [ `寓X (oD㦓W 0f0S, @ hKHP@ `EHpd HQ L 40R !/01Sp0S 3/p\ R 8 X&Hp \ 0S 0@ `Hp ЍP-.jo.x.T.t....@-`B@P@ ЍBPU x:P EprC P 9@m:T BCP@- +P ЍüA-MP p*@P00#p`ЍpP c ˆ0 Gp 1  0O+.i@-@p @A-P`BpP00HP@?0H 9 F)A-P`BpPk00HP@:b?0H  F @-( f)PL00 Ѝp@-8M@ (PU)P1!z" BP# H  Q0s0S00?HPP"  B@68$p`8Ѝpl s  $H8 PB`8V.`./<i0@-@BM M  Lp 0S 7  /  (P(@0S700$0/ (d ՉdP(@0S Bލ Ѝ0=Vᙽ@5Vᑽ@i/F/|/0@-MPB@P HP Vl0l l!H 0 0S ,pЍ0/</m.i/@-@M  -  p@oЍi@-M @{(P0 !x p !Q0s0S08 1p`Ѝ/(./iis@-`Pp@ @@E(P0 j!S@Ph~?G P@ Lu@AP 4 UЍp0=3o/0G0Y.x0s7@- P@2p\ \UTSA PH08 DD/!0<80A p` Ѝ0B.00/o.x7@- P@ pd d,0PH$A P80$ 4! {A p` Ѝ0Q...0/p@-M` AP0P0ЍpGP@Ux"S@Pd0 Dp<8 P@ PP RU8000̀i0@-$Mp@Pr00$ЍF`R@Pp 0 XpL峐P@ P`@ p$㭐U6+01i1@-CT ЍT 01,0p@-M 000  P2Ep `R@P} `@!Ept P 0 d`R00S HTTRU ?T}TP ix181Q1wt0@-M@PP  !p  DdR1p@-Pp@`@@7@PD0D D MFQ P$Tp0`/0G@-F1@-M T@&P@0@ @04 0 p :Ѝbj/i1@-M T@&PD0D DD08 0 p$:ЍeUv/i10-M $00 P  ȏЍ䀐i0@-@8? P,0, ,,$@ p`00/.x00@ S/a0@SW@/A0@S=@/@-=00@- M@ 0( 0 p兏 Ѝi1p@-` MP@z?P E Ѝp Xs    $E( P?@5$p`5A iv0@-,M@ P&P0 ( p,Ѝ0 $ R0 s0S 0  "DPP  0?@4$p`1d/5A@-PM `@@%{W{G 8 8  SЍ$$T ?0T 12@-\ @%P0@0Ѝ  p@@  92t-$Ml@=PP Ȏm吭`P00L0刭P  0  gSt0@`Vm`x`PT0 0XX@ @@@@SSb4P03/`2%X02227%x2////0 0LL/%X0 0TT/%X0 0\\/%X0 0DD/%X  d00d0/%Xp@-@pP 00p00D S 0A0CS0$PᾹ>P޽ 0@p%X@-p0' 0`P/ R/%X0 O-4M@@!2T0*  D`iBpď$P(0 !pSڴp D@T PoS@ڄAP`@ up00M`p`P R  P Q R07 0TS $P\(P  1/P @@0S  Bp 0$ SR(0 Sd妍\0 2/P W0 [ { O'4W;e6<4eO-MMPp  X p`$} pP$ 1  $-Q  | Bpl8 P Ap Q 4oQ ,Q8 p# Q _Q$S賟X@Tx X00@0 0APFQ@U 0 0Ԃ l,0@4@Ap 08O0PH0h 04 40,@Ap ^ 4QoQ H0S=I0S:Y`@T 0 3/@: " ⍄렢M0S:00 % p"倄pM0S  PG@ P?@03/@~ JmI1PJ/UApNI!1Q㠌a`"%J` 1 0 d1 |tp 1 `T!1 DP`<#%J]!1 @ t1 x!|1  9PP@Tc 03/@ 03/ݍЍ-4{45 i5i~525:5'%Xi5i6663'5H55ii4o:i`6A6J>v6T6_6w6O-M@pP  p T >;@<;PT!c; `P l P``U T1O0S O11 LNW   壸P /Z   嚸P & L$P! K0S 0 L0S 0M0S 0 N0SO0`S !PPV O 16<ü'% @-,MP@hpP ;P`(  p)0S hか H!P00< <u0 $g,Ѝ.n9'<(i89%99@-@ } 0 @S9C-@T;PP0 0`@ XpppbAUA hP }pPL OH@@@@ Ѝ:d%#2:'<gs@-@z;@P00Ѝp-AP Ah@P <` }PpOu :R'<\7s@-@P:@P|0| |AP@`h@P T` }PGOu( hЍp;hd%0:'<\7A-@!:`P0 P@@p@/hP }p8 =400@@Ѝ-d%<:'<:]@-@ \C!PP0P PPhL 0 S@@00 >00Ѝ:e%E:'<%x:o0@-M@c:P^:P Y:PpT:P d0P P P P坹 4PKp <Ѝ0-;h:R:'p% (?( px" <@T t8PMl2P\M UR TЍ0 PL@P㸉 $@]>p {Mt 0R Mk)}M {MP ``Mtqttt` R#Q\M fMmMP8ЍOMP\ 0P   Q1   M0! RS{ |MzM" 4M0P R ` V 0P `\p\\.n&(-(i8i::%T::r9;!3&&80 s%;2;;;Pp@-P`@Q8P V  ~9`P .`.붸 00p=8Tp.p@-MPP00Ѝ`0 00p0@ 0 P >0P 0 p 0 `P0G-@(Pw00!p( ܲ Q1r0`*0PU 0V0$ 0R0 X"0U0"SЍ 10PI 0 , tp 0 @0@-@P W.@ O-`@pP,(0V0S 8JP$P$P 40S 04S 0S(0p(`8P0S$0(PLO-M00q W$000Ѝ`Q Q 00 PP4P X≷U 0eP l,,t,\4@[T /@P00 Dk0800@0000 P0S U10[0,ЍO-(Y%00p`P$@T0Q 00S   *P e6P@0-S  P(Q Q R3L4F6P @6P= P ٵ 0.. R0 0 p4000 p0C% 0 ;A-`V 00P@ps=0 p pP`A-`p$P@.IP0`0P 0@'A-`p@PIP0` P@'A-@p`PPPU0S0P4JG0PPP ! P000S0PJ@-p`(P H@P D0p0p0p 0pPJ@ Ѝ'@-P`, 0H@P PPH0B$$P(  pI@Ѝp'O-pP`@M8U[ DB! R:  p DB!U R:@DDA < Ѝ  0 0A-P@p @`P  d媩PX0 000  8p`Wā=%Di:=b@- M @pd d幁 XmPT00 Ѝ0, 1p塁(==i9=@-(M @p 吁 P+00(Ѝ T00S H 0P 02 , pj(-==i9=@-M@ lp 0QS S  rEЍ==/0d 3?S $S HHH S/< S 4$0 ,/(/$/PP֞=PP====0x 3?S $S $S PPP S/D S <,8 4/0/,/(/֞======O-Y`@p 1!0R ῨP A^QT `峨PXD@XZY@0PE00OO D ,JP,ϻ@- M @pl幀d PT0T TT0H 0p@@,d+ Ѝi=> )H>i>Z@-@(M!  0P p< <}4 pz(ЍW)W>ji>|@- M t@$Pq`0` `I\ kpL 0@ 0bp,S Ѝ>)a>i=i>ZA-M< Ppp!40000P "` # 0(0Xp0@`$`<0FP8100 0(00080 &p' P0 0 0   :R@p00C⬀0 0p0 "P00ݍ@ T0S P0 0 0 P0C)u>>8i>>%D >0@-0Mx @pd dT0PP  041p 0ЍC)>?i?%x?%A-@BM`(  dpP 0 P P PP  ݮ8 ٮ! lծl pz l RkClmU#0P 6op 6S30S zC0lP 6]p 6S\L30S HhC 0$P 6Kp  3Q?ZCI0P 6=p 2Q8LC8 ~ -p 0S0 B8 "pu p | p 0@ `wPpP2Q HCBߍ20S ,C10S C  C0  `0000pBPU0``0` Rڬ1000 0:S R TUPDB`p0PQ BV pWP ,B8BH0S LB vB~B! !RSB`0Q B _B(i8i??i@'@@@" )@-@;8iiii)@s@5@D@K%D>@S@W@cZw@}@0@-@P@-@M  ᔭ  Cp4~Ѝi?@-MT @P@0@ @@8 (p$~ЍC)N>i@A-`@dP)Bᅩ``V``<A@pP`0FSBU>AA-AtO-`MM@ 4<0PT4 lPgE7EP4}7U'S 0`@ 0 @`F( 0RtPx['V9 09 09 09090909A(@ !!0P pR  ?B0CSU 0     -B$ BL9##!``F 0^k 9EIcCP S@BA`p80P0 a A!0@"0$0$0S= 6A0 P0B'S 0؍Ѝ (8R  0CR.B B8R  ǟ#110BS00 2")B B,#!% 7R.B7.B3"" N-B B00Q0pg*S SS$l$#%<###%X2SK Sp 0S9 R< )SS0C'S񟗦*p*h)***h*h*h*h*h*h*h*h*h**h*h*h*h*h*h*h*h*h*h*h*h*h*h*h** *(*0*8*@*H*P*X*`0S 0 t( t0 @0$ 0 B$ @^ R `%Sp@pW>@ R0 0 @`0S @0S `p0p00 d@\5H3TT娀XP0  @ @p` @0S W@0$3?S9@0S qw@r@`ov`Y*!1v`pGov`w0p(,0T<4PY$( 1`, cfav`VqI@}W(0S`  [ (( 7@3I0P  #P# ß P# "@p|P3Ip#S0S l@0S.  P @)S8@0S! $@ s堢 `0VV /r  !" " 0?V8?0S \q?D?` ov`(Y1ೀ⸏x 0G p(0Z1p( `&&V1j (m( ?1I!0P  $P! P! h?p`J  QS| x!Stlhd`\XTPLHD@<0iAgAJAAAA'?A'A $'AA@@t0OA= ABBB$BB+PB6B;B@@@@BGB P@P=֞BSBXBq)B@BASA\Aa@@@@AA AAA"A,A1A:ACAJ@p@-P M@` LQP0 aPp@@% ЍpiB@-< @=P$0$ $  ЍB)>@-< @'P$0$ $  Ѝ@)>0@-MP "M/@PۍЍ0@i% P+ -P@[%ۍЍ0@-0S0S1iSBB0@-M TPp@@?%Ѝ01 mz@iBC@-T @P@0@ @@C I \p VzЍ@F)A>C.@-T @PM<0< <%   >p8zЍ_)>CJ 0 /%/-@-@ M,00(000 P  Ѝ@Ѝ/P00  @@@@0ܚ-@-  @@ ЍЍ/@-@@.C 0S/@-'-@-  ??٦ ЍЍ/-@-  ?? ЍЍ/@-h0M0S@ 0  0000 0 %p@@Ѝ'C@-@-H,,p0;.kpCDD @-|MPP2P0S 0@P 0 000 0`p PiP@H 00@4P8PS``!031 0@-Mt 0@P \x :LPP @ (@@ 0P 020Ѝ0% Ё'r@-vV4@ 0:=  3=:%xF{FGm8P@-d0 !T| T@0!6q0\ (0000/F6FKF`P@-`0` X| TD0!6q0\ ,00 00/F6FKF`P-4s00#p^0<\ 0000/F6FKF`P 4ps00#\,s0P00/00F6FKF`PH- 0:# ^4 0P$0000/F6FKF`PH- 09# ^4 0P$0000/F6FKF`P 4 <# \,4P00/00F6FKF`P- 0:# ^ 0P0P@d|0:0# PDD#^<s0\ ,00$00F6FKHyHF`@- 0 00:P Ѝ5%(A-Pop`@WЍ P 3MP@ p7@-P@U0  (m; Ѝ0&mKA-0@nS0oSp@ pmP``7P;0nS0oS<PP<PP' @-T0 ;g9K%xO-MM<(0<,0:X 9V , *p p@ PH P z:x:Vw$0S ⶝p@ 18 P0$#$#49 HRʈ0"lp0Q -Q!@ 10=㞔P00 @@   P 9:7:@0S V*V ,((0)p<s 8B8b8r4000 h9uC0S  [ 0S70S40 O <8@80@D0(  ,(P(0T0(00 VqLlꃞѦO-@}MMȐ⨀p 0 8*9P(b((OXU 2V^0E Ÿ " P`0 90SP 1PP9?+P8a0SQ 'pUx 80SP h8& h%8& X%80S;008! P   P00@P  0S u0P @8ލЍO 0 0S 00S P0l  080 0P `p0Ul<ލЍO8PLII JT &0L\Lqt'LLLKLɜ]Q p@-P@AQ00opP 0p/'A-PP 0nS0oS 0P Q@P0DtP,WpWZ6PP`88p@,@P@'O r@-R 8w6P%xO-`Pt p@a00004!444400 ;p0PEU!+ e@ PH GH0GGH<GGGGHHGGHx0000000 0gPls{g00P0;480000000p0 Ѝ,D%Q%,DOQ-BMM]@0 P@t00x X 0~'p0 <sx0 0/ "  o" 5Q,Pp@-@PHPp@(@0/Spzp@vQQQ@-XQ 85P%xO-p0000@P`᠐ (,嘰00 -;p0@DTq oP\0 fP<>sf9 O4%,DQ ,DQ@-M@A>0 0D@00 l0&p0S SH 9 00,00 rf5 SS\SSp@-@PῆPp@(0/Spp@QQQ@-P 7B5P%xO-p0000@P`᠐ (,嘰00 :p0@DTq oP\0 rfP<rcf9 O4%,DS ,DQ@-M@A>0 0D@00 l0s&p40S SH -8 00,00 vr4 SS\SSp@-@P6Pp@(.0/Sphp@dQQQ@-  4%xVO-`0@P(,p娐娠娰0 ":p00@DT oP0 ePP4re  4A+O ,DU%Q@-MM0An H 0P0 $@%p rh4Vp@-@PąPp@(0/Spp@QQQ@-O 6G4X%xO-P@M P0-`r"9p+x2 0S00)0x0& 0 x`1p0 +00*`&0`k &pY quPfPMP9 9P$ GP g@PQQPQPQPQPQRQPR8QPQPQPQRhQUP|0 0|00|0|00|00|00pt`x0 ePQqd|Pw[,0p0Z00t0X 0;;0x0Ud0$00|00|000Ѝ,DY%-WQ-MMJNP0 @P:00 x0$p0 \q0 0N/ 8 l000 0@(5\3zQ,XDY!7@-@P w0Lo S? 0 p Ѝ0Y]@-@z%0P@n@-@'0P@o@-@ I0S 00S0?  pЍYop@-@PsPp@(k0/Spp@QQQ@-p]@-~N40 0,0,0(0(0$00 0;52]]]f]%x]]0@-  @P 0 R\  dpЍ^p@-@ PX0 㵟0(pMPP(TpP2p@4'O O-@H `p啟H 4坘000V  8p60`FVQp 2@FPXLX(VVVVVVVVVVVVVXxVXXVVVVYVVVVVV[V[V\<\VV\VVVVVVVVXXXXVVXVY4VVY@VVYL[X(\\0\H\V\d\40S = 4 40S 4 0<007aE08:d$0000000D30@90;g)ݳ04 0I 0(80@008 0IcPo0@B (Q  Q@       b20  xb0$000 Tb0 000 0b0$800 b0<:00 {b08:00 qb0@900 gb0,000 |]b00000 0b0909Rg01ra0$000 0 0tT0,0wM0 0xF00007000+0劖40 F Ѝ%^s%,D%'''YQ.'0^7^=^F^P^Z^e^k%A-RMMI>0PC@P@(0L BH`q儁( `L0a"p"0KSh0  R< (Lh00 T0 2#0 cn( h0^/P  iPP ` p,@.`0T@ P <F0\ $00X 00P00\0|00x00t0 0p00l00d0M2RݍЍވ'_NQ,\(^^p@-@PPp@(0/Spp@QQQ R R @-m/_0@-@MP`p 0+!000 X"PPЍ0P0 0 0)"0  !0P Ks@-0`08/00@P  P0 E:Ѝp0@-M@P R0 0PT0 0R0S PU @;@9 01Ѝ0'@\_(002P0/ Q# 0-CM1010 000000 0 0 P j3, (1H00Cߍo/\ѦO-Mp8@@`pЍP PPD⛜0$00 040D0<08P0,(0t0PF0<0P<0< Dp PƜH000S R@ 71'@_`]_O-- M* P`@pQ0GT0<0p0Ѝ 0 3/X0p 0QQ 0 `@J P* 00 H D@0`@3/ppdPp0QTP`@P] `A-PMM`p/ P@1L# N4AD0@@ 0@00 0p@,p'ߍPHڀ@T ,'DO-`[ 4MP8@,@P :8@P`W4Ѝp p⣛ 00P 0 S@P 7 0@@0  p0p0000S X0Sp00000 p  jP@0Q  D0D00X000000000@ 000<0'`!ވ`N'D@-I 0I.a%x--0M 00H0 @#P (ko zg $pЍbb*O-P@M$ 0䰝0p 0@"b0"@0@@ " 3p2 0BPa g@Piliiiiiiiiiiiiik 0p00@0np yk! 0 )_Plk_ -P   Ş 0 S Q Mk lGkMz e!! @ P   壞 0 S Q /z ' mp 00k+   p x 0S0<S0@pS(@p @Ѝ?B,D,D%c=bC`tQb^bcbbbbc#cJ@-MMCN@800 0@(00 0p j 0 .".!.($! P(0l., P ,0T.0L.ލЍ4.(.c[cgctcccccc7@-@P $0Lo S? 0 j Ѝ0Y]@-@'0P@n@-@ 0P@o@-@ 0S 00S0?  \jЍYop@-@P ~Pp@(0/SpRp@NQQQ0/p/p@-P@ᾑ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P zwtDDn@@hHHbLLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@P0-*'pA-0@PJ04S->C->C?X9>:>C?n:>CF 0? AC>}C>GmFEnFE~GX J.X R  $$((,S>,Ð}S>GᾐmFẐHHLLPPTTXX\\O-@  $$((,,0P04 40TQȑ\5 S L5sT 0K TTXXp\\``ddh~h`lzlpwptttxqxC1[ hepb`0 `$Q*\5 S   0S&P%@ PSزK 0CA0Q R,=}2.0) T U0+P0sC@p/0@-@R 8< M4 M0h! @SP ۍЍ+᭐000 40 0 0  0  0  0   0 0 04   Q R S00ą ą0 402"8<"4"rb ##̠#4rb2"LABLA- b0 Qsr@ h PP1+\#90A0 0 00L B 00 00 00000u0#$ 0 }'',"'("&8'$"2&,&42r"bF 40Ѝƻ0P:/ 0#O-,Mp0`PTXP; $ `$ 0P) @T 0 gbP( TPFPG@BP 0g@p \ Pzyyyzyzyyyyyzz(@U@@ @ @ @ @U  T0 0D dS1R "P  T8 DR0UQUDTP 0 @@@0X 0 0 R 0  |'Z0 d00 S  H,Ѝ0 $g0 etee'ef@-D@ PU xx+ppF0h`SPP\@Lp0SM)D0D,+  +@'f:%xfjcfnf{00S/@-1)'0/s@-P0@0S 00S Ѝp@0001!Ѝp@s{l0`1#ā0P0$V F, 0$*"(Ѝp''''T'\oR/s@-@00S#000S 0 Ѝp@<{?.PĀ\0`$V l, 0$*$(Ѝp''''T'\p@-Po10"MSPMU`aO0@OS@ 04 1#0,q `_1Ϡ P0< 0/?>0U000S/Ud E_0 "܍Ѝ@;_0*Gx0 R `\ :V 001"_0*j"܍Ѝ''\''@eO-S ` d 0A ap0 <0S  0#‚ @x0 8`0 C c 10 d@ AA 0aB:C0  0 0P!\ Qx0 p&s0S ( (X0tSX d`mVFhl  00 ЍO ፍt0S ppЀৌ XА`ࠌVhP,m'\' Up7pNTTP00/1000/0B10B1/101/ )px%xO-  d 0A a 0<50S  0d R\[PU[L` Ѝ$ş P` ` b6B?0L RU@QUrR3pL$P/R<p\  D r P D!!D!$ "r P "! !) 080`_0 V PP`أ  0$5S?00 1>lW0@@TNN@D@p @00C030S30 0C0 0#0030 #300020SQd 0A0 a/6 e0"ST0T00  B 0|"PSX000X0*d娐 0A0 a6 /Bɿ 0 <  ."3 0+,0/#0 00C000 xS p10S   d 0A a 0<"! ! R[(N40A\80 C 00 080 $0C  $$  $ q40 040 @08@T@dpT`@O@?00p1>Q@00S 00p 30'\' Up7ppp%x%qp@-P   @ ẋ@00Sp0?0 00Sp0?0p'%d0p@-0@SlkP ㏒00000B0F0p'LO--MMp,q 51N_R0ePS yqሢ儒 ?D 0STT ?2?D4Q/~D p؍ߍ51/ 2DŒ@ 0L 04;20d04 0D0  00@4T@:T @:T @9T @ 9T @8T @8T@@04s0p0]3`0S7w 0䣟00 00p 0 0  `  0S  00X0S ``a   , 0"\0Q |?,040<010(08? 0$tQ@Y " Dő@L 00 /4;0 0@d0$ 0o 0 ? 0r aW5 pm|S8 yq/0/~D22220OD0?0 0 4)0 D@E0L 0/4d;$!0 0N @n104 01,?\0X0`0d01{0?(0{{{{,0 , Dő@(0L  0?$+4004 s 0 d 0A a, 0<w%''\%X%hAo'<'TO--M M: c>0?0 0 0D0Dp0S3 80`V/,0P0  0 #''''@'Tt0@P`P 84Dm P@   4:mpU 3T@  'CP` *㪐 'P S(㠐0S0,5 S<0x0(5002 0,%S0022Q04M%T 0QE%Lb" 0 04 0A 7%> 040A d.%5 0 4QD%%, 00 Q*$%# 00Q(% 004 Q %1 0 S0 C( \1\cXYY1X0S|$ 0X RR $%0 bH4aLBϠ<A8ŃDϠP@ŃPT\TR`8\PR001$ `4Y 0R0 a 31 Q0RC00#!3x000<44$0<0t D0`@`aY0|00`XcL5P5 P4`F 0/{8@pD0/t ?@Y=Yt00唀 ! o  A   >045<4 8$0S$11 p<4800x0 08`S¯PR @P0?@ : 0P@QQ0** 0 @QP(5#R0:P@$0Z`- 0(00 0 a`0 ?001>!0. Z`0 c1 S[Q[30Ϡ 0 1 00 R00CC  @Q`0:#"4 0/-V`1V`#T0`10F 0⩊I  0* B@TP 0ἐ 둈!0  B!00BZ` Y"00B 0R0C1I C0/y 0`둈!0  B!Z!`S1BQ 0S t*#1\u @P`x1; F0<48ĔCP`0S8<4$-0BPQ,`QɑRB1ȁDL0 0 0000L60S|0` ?H4 0L4 0 06jp>'.\#R2\3PPT`` Q  ^,7\5?>C00!#4t x0WP708!"T a31< A202!0 0͉P  04 P ȍ 0L$4  R$ (  B, D%LV.  R*h ( < ( X $( \ ,( E.?.XT+BA.B -4 HU PNax8 @40K PWW0 ,p B i A YZQ!=WZ 0X Rű{A pW $0?. t{ 0 R?@440PD$44 0L4( 0Āp<2 R 5#< 5 23`r0S*a됺z z'wz {' 000d0 CSQ c6Rc;R`! @ z犸 z'(Ȋ0 (08V;R,h! 0  R0:1P000\hP2#00@Q@0 0dip00 R00崻&A0 ،0S`` S! PQ0 t`y6 K  VZ⋰>' 0,@0P0 L>0S `0S x>0S  R u00|:x*0eP>0ScN C>`>?.0S003040 4004ppCVW*4cYV.ʁPLoV.GV⸈0S  t?0 PS?\5=S,⤈??^0E/ᗄ0 0S 04  dHLĒ 0A a04 <,$0S0S 04 n d ,04 0  04 ލ Ѝ  $0Edp@vS`YO-RMPhb  (Y@P LX@< PpߍP)   ppu0S <08 0(00,0 000040!04 04$0D0(0 P yVpl p 0  H] < 0 $  : p 4 p X ׇ  p ybyy%xA-a,0S@FT:pPP $Ɩ 0 @1AT@TG P @C1@1 S  T R*21,6Ɩ0&,6@p  p 00C 00@'x!yO--@PGM X?4F@0VD ?`0F  mT?0V 15: T*; t`T T8 \T 0 HD/P@/U㰠Z ,0 @ / @& d &F0K WM TӬ> S`$|T k3;0 [R1Qq0G 0C 0RDM0 S 0008cS05>0:=0ᐊ $080UC$0 (pP$0(   BQ 00  0 pF0M000 60 6 =( 0<(#" \ܜ0U p$p, DH @0LP\P`PdPY 0T0h<0Lh5L0Sh0h\ X<Q $ P$8 0 Z{L f [( \P%  0 A"  Rp1 1C 0tF0D0$ATpfpfC 0CP!;PP\P ;Z $ vP@$ <,c 㜂 0p$0d0p000\0p040<802<02P(0 0Cs0:0D000C,00SKZDJ0S0@:#*&:C1 :| 0 04:`7`/) 0 (@ "*% 6 !0@ 0 0:^Pp< i@&E0SX9 S E R0`pL00ed01D0[` 00S NP [ 40S80``,0S,Q 0CpU (01$0P @pz:<0D(S 0wx0S 0St庰0S00 0  0C##D( @48P ,pp  PPpuR0 SpG S~P@8:`0S ,rL0S d0 P$ 0<4#S E<&,"z @&! 0 B $0 n~" dL ~60CT 0 0C0CS`: B i䖟X[:̖刁XW: ,6儢<Ƙ6(㫱 tI H DTD \ ,6 0"ƙ$6&1(6XU:t0TSL0S d0 GP UJD50S0`V?@Z SPNȌ01 2104! !0 SH40## 0T 0d$6$[:,6 0ƙ4&`.]hF 0V4# 4  `P0SVPEPU 30S~ V :3PUCL0S \0u2`0^ gJ PP1 P# x╀T376|0\0000v096 300P> p[E{781 < =/ * + (;R  PPP 0 @@@ zj{ k{[;R[g4Ѝ00B:k{{'*k{d;RY?@@?6C-@Y)h)%K))8p@-cj0d2Ss)@0@-0S0@d2S|c`2"R2%) 0@-@ 8!<qH 8!c{  { ,00X@ ?ə?333333)%O-DDDd`2-"4TP1pRPPM=p3 204i|`@Pp@}@ P! @P;  0P@0 -d R=3 P&P0Z`Pȕ @pP @ VIT &0S%0 0C!0R3 0S0S 0h0+jP h0%jP b=0000,C 0  R+ 3-D t3 W3 0 l0l0`P 41X0F#P00 P\'Yp0[0Wp40QT0^iP0!03@H0<60X`0DX0D S#@0S PET  Rp 1 1 S 01 \Q \p/A!bR000D LB&t3 R     Y   x [   `0`P0S 4PD00D0 T0 SL00L0L H0S# )h # mdP0S  0# h h# [dPcݍ Ѝ#  h< # h # HdPPA0S. ūP# g # 4dP# g # 'dPs#=00C\0g| \dPPe@`0SXT喫000+# dJI QI`***Xg%x*<mv"׍*8%)pw>** ^6Jo0`*T* $7WtϼPfffglrj\u@-<00iS03S !p NPA**l0@-h@   LM @0H 0C >*$,5*@-@0P0D0PUQ3P X0`0S D0\@@  0,$`JЍp*T%* >% CA-PPL! C@XQxM` 10S  'xЍ  iR R R0d P 0V 0@  0 pP 0 )  hP 0000 ` `g V@000*T%* M% ** %b` @-@X 0C @T!0R3@ 0P   0S %*TO-xQ0S llXT @P 0S @DM@a@qP0 0@0C!R! 1S1 J T`PpԀܐ 0U0(' @P 0E!0R3x0S   x0Sc @TP`2" 00 @$ * % h*P*T*H* *O-% 0Ca0MV3p8`5 PP P`91 @P0`600C?oT20S Z1 P`  0S 0S `V1//P/81..0822101.10US 0S@30S !  000t30S<U zZX 0M X@00X0000 00020S 0S  0Ѝ 0  0@00820S  0  Zay 00 0X@e0000S X0000000S  0 h0 Pp R@Q  $1 @$ 0 @q0S - @T 0@\0P 0 hy X 50 \8- @&*T* % %x$A*c}t1G-0S dd唨`@XqX 0T0 :D1 Y 6  000PU* * % )8*H0A-0S 匦`Pp倀 0U0(@TP`0  RF000S (@* % C*H\A-p`P@P pTpDorP 0L0 0C?oR20S  P r%xp@-? @PW$ Pp0 SRp*@-8sf0S$0$ 0 0y&* %x$0?S/ @-UP*%A-0@0/0000 SPnڨ/0>+b!T0 L< UP0? 4  LK00?**9%!0@-@0 0C^AЍs@-@P`P @TZ TT ?00 /(^+"+R  + wЍpJ%xp@-<tp@ P(s@P0P0|p%! G-1@`pVBMu Qp@0DWBߍ`TV B/ e 0R ?s0 0a b@PQ 0 ?2/ 0(10S 0S Q0000 (hX:0000R%*0S 70 0S .0 000R*Q l\0S D[`W0`S **3*A`% n* O-l3P0_MS XXTsTC L0D#Dd0+b! L<SP L A0?0H @L }#PPD d P l#P.Q|}_ߍ* % *@* *%!*9i%*C%QQ *`f^<>*)%x%%@-$@0 00: S*`G-@ q a P U+ P00S 0 S00P R GRڄ00S t3P Y \6aP  0Y 0:0S $*H* %xQO-AM M` 0lpP@0 @ Aލ ЍO/9/P( 0`!`_PQ D D @P ,`PD |@T `PD r@D `టT Aލ Ѝ  A>00C 0  R + x D L@D q`0 `N 0 D p*9Wtϼ%x4\C-M Mpp0 /R @`㬐嬀 GPP 0S P@ۍ Ѝ00 D =2_`D @P 0V o[P`Q*9p@-0@ @P CP @p@-@@O-3tM0 S ppϢl300RS\3 P3P#0L4DC0#S844tЍO趢$- P c]   0p`00@Тв?` _0@ 勢W6 ! h`V5VW U@P p0 j?0@!  if ?0@ UR!tЍpJ\1P0xSiS?P 00@ 000 0C0T10S 0`S#Y \` dXdh0SS   80S d00X00%K0P!Td0 8^d:* % **@* C%%x* **.Hi{*8k@-AMMP 0pP0 pPd!d@P TT#LRbk< 0AލЍ QD D<`PpU U + gp 0P a< t0S0p T0TP 8 a$8 [E q%x*9**`5`@-(P@-L@0#S 0 v4#S0 @l%%!0A-@P` 0 Q0: 0xtp0/R @$aL00S$`@pV0 SR$`*Hj*-*  0S 0 0/ R  /0S0 d0p@- Q0@P*H`0/iR Pp0 TUp$/p*H*-0p@-P@ 0 Q0: 0|'x`0/DR!1S 0p@D $P\P@@p$ 0*H*-A-PM@T 0``p/VVP    ^P @T@ۍVP @p@-/Px@P@p00/00@P 0S A-P/p\0@oC 0T@@DEZU pDP@D*1G-pP|\`04PSp@P`0PP0C0 T`4 $D@*-*(#G-頁P6pS` @Pti0&(0C0T%Q&F( $06 `00vPPE0P H\ @$  (@/nw \ 00 @ pP`"0` P0@0 P $ *-*(>`y@-@[00$D *-0@-S@ ]0S 0S T 0S N0 PEB T` R 5dD0&F$ ЀP 0P  *-p@-@`PP0S ? 0P0 @/vPt[M\0P 0 0s00pO-2lM0`S ,2XIpP u_X TLm `  @0rP 00*P  Q 0?*A Rg@ !!!0 80` 0 08000A(**3*<* %P.s*9LC-paM! [\ X  0 00@! N 0A0 08 !Q  0"Q/X. , 0  0 00`  " 8#`Rp00"0Ft Fdq00@ L,Ѝ*% *`%x**&2OO-鸳@0EMSP8a  0 @|00T*0 ?o2Q03S L30S @3 T<#<  0S fEߍ0S3 00p0"0S 0"p! 0 qV V V-    0 B B B  0h"p+ @20S LQ0@   0 B B B  0v"   0 B B B  0h!0S  02XP 0 ,XP. 0S x峚V V V     *8!!p0S      9 V V V|      lx p z     L * % * k0<]%%v ,@ 0P/00S !1%%*3P0O-`EM940`SM P 8 450SppލЍ90Z 6400RSp 40SppT)9S140404$04j뜴圤 K Bⶽ00  4 S BPHZ0 S 0 ᔩܙB)R)  0B.1 B Y pl l!d庙|S LDJ Bm P PdBWP u $ R B ~ UU SR V Pu  P_Zp2 005P 20S )4n00A,0 S th# QRLSP PU  $   )a#0)90S 3) 0S 810S.0S~ 3 #W3P) RYPER00PES @!U<1<0 oPUJBJBGPEU 0S 1 4S 04.3P UB-PE*3Q*X*9L**`%x+r J*<b4:c\%%** % #:*@*0vT 0*`*8DO-hChs5 SW0 R_`P44)0SW  0PS9S00P0S 0S 単09Q ?oV20SKUNU5E Q5 IY`Vq``p\2 RE R; R< 4<e820S?,{P;n %+=909909 ЍŁ01 +"+R ! R  tEUY0+5`LlP d8X $`e #X0S ; PeX p000/{Ppq V00S x0S 905 ;#;S T%9H+X O=*3** % %x>*`U*$%%* l*X*=`@-7M0@SM&6PP lP P `ۍЍV0S60S 套00VP l60Sf LIF C @=:71hOhO0*04'48$8<!<HHLLOOO xx|]|O9^E~OE{O:^EwOET0AS{{zLzl{zL i Pl 4PE Pe\T0SP40S DD00 ((,,TTXX\\``+V0 #  1 0002#22 02 0 (0#/",0H0T0d/%X0/&`0,0O20p000%60, (0`20=S" " X" R `HrVA@S<"< 8#3 $ 强1 !x30=00 1R 00#| # #/%80/&0 %0L0<040h0X! AQ|{||{:9-0CS  h R0 R R 0N\ \0\|0=0- 90 `P*lT*3* % k* %%"l%x:RkC-,2,B P000000 MRrM0S a=0= P 0RP 0AS_,~d$}=0=`、0VhhaP 0RP 0!=0=0S `20000000H00%"4080&"<0<0%#L0@0h0D0"$ 0 @-Rڌ0=ۍЍt0 h0P0`0\0S H,@bQ*`*`T*3**@*f%x*H0MO-AM0U(0 "S f#s0(CA#͡ 5/0(0#S00 #0Q0У0d[0 (0S  B(0C5/0(0,0S3,0P0?0!#0,0@# P Aۍ<ЍP(0S #s(0AC#͡5/0(0#s0;#͡$ 0$0  BRʠ0@SP (0S 1 P@0S& 0$00S  B 0S 8#S00SR 00S \0l 9P tlx3  P8P0S*`T*3*%%*` * %  0 *`^@-@0SS*` O-,M00< 0040 8 0 0@bPb  0@ @ HL0P Dpr`P* ` R  R  R;  R 0 xxmPL RM  R"  RP60S  @@\<60S (6(PU&-P8T 050S  ;P% R P 0 d% R  TT! PЍ08U00<%88Y0S40S  40S  PP 0 8    W0 00"t40S 0 X # R  ,#PU# R ~: 00 /P S 0l ~ ~W 0 8T30Sb P \L 0 gK*(#P0 0020S  o2PU/x20S 'PNS 0 / /W 0 8fc20S 0  "P0 00t  10S 403/  !PL^W00 0PT10S00S 0 800S 0 t4\p 03/PU 4   00pP *`"%x* j% ***3=%P^`P`{*3*Y^**7ac/A-1, 0  S !@ 1 1R 4S8 !4|q04@0t\a00S/ P0S  R+* RS-JP- !0 010  QP 0PU 0$N P ЍPC00P;C0P|90S050 000 @ 0@0 0*`*`T*3=*HjO@-cM0S pp弑lClS0S Yv0SR\0#0,,  R0r 2r  0500K Pr5"0C590C990C9000Ph|n xr0S \2d"`2Q090 9P 0S 0@TP0@-@  U0  xhO0 dPI0 P8C0 < =0@ (7 *ApYbkty*Aq@-@P @0 40D0Q3NЍ*T%xA-Pp` ?@00CS0Lp@ T 00CS0B P yTnTyDo0 @00  0 0 S%x*<-@- T L00S @P@0P#}Ѝ@Ѝ/%x*$oR@-p`P0@T$P!O-0  ЍR0@TP O0 `T@H00S <U8 0 00p@*%x* % .@-@   P   P  P  h~$P l Hv\0QX X (n Hj@0T%xElTdv0@-@MPPPP8  P$0$ $PЍ0P*Ep@-0@ M \0 00T  jJG ۍ@-0@S g80 0SxP 0@00NJ0 DDЍ@800S ,,Ѝ@Ѝ&*:%x* K% C-/`=@P p/@D0S Ѝ/SpPP9 0<P000@-0@S  0S  0 000|0 0SP N0 DDЍ@800S ,,Ѝ@ЍYp*:%x* % @-0@S 0 000x0 0S3P \N0 @@Ѝ@d400S ((Ѝ@[Ѝ*:%x* % @-0@S 0 000ox0 0SP )N0 @@Ѝ@1400S ((Ѝ@(Ѝ*%x* % C-0M.S`p4P4A0/SS 婍0 0U  噍  响        p  xX  d 嬱00@ <Ѝ*#0@H OV_hovO@-C-@`PApp P L0 S000 ЍW00tq*Ipp@-BM @P`0E CR V  WgMP10FS `0 AS 5IP0P S00@$=BލpѦ*IpA-P@`I<0 pIW A*Ipp@-M% BP~ = 0S$P  Pb0PP 0@ 0*<PS ! 0C R: p  d!  `V$@1@a0P0!! A   0S X0Sn0SA0S@ @0 e+po$ЍpT 1S!0T0  rq 00 CT !100 sr 000 10 0( )00 0 !*VHG5O-lb0MSP@ἐ qpTp> ,pHA,0  +pZЍF \ 0?[ I0S2  +A0S@ 0 *poLpT 1S!1T p 0  T 1!0 00 0 0  $ ( 0! 0 d ,0 ,   0$0(0!00d00 , 0  , *VHTfуC-0P80圐 ,MR/ !!~/P`,ЍC|`@ @\9(0`0$0Fo lP%'*V\*VHQ*WO-\M`a<P@谟Q% 0rS 4P @0  0000 0 00P    RQ  \ЍS @0  0P@*W̤эѝA-8Q夁X@`!1  0AN!pRS5V0 1SV YAVS A 0_/VtTPDP@\`XU HzA 6tV*VHѭ%' % q0@-P@0$M00PP0 )p$Ѝ0 R  h%d0 0 1S0=0 000 04*VHqG-pq` M 8@0D @CT Ѝ0YЍGhS" !10  @@0 O)p Y PP   @@0>)p !R CZ tt00CSشרררר4z( *VH*V\AhҔҾ0@-P@04M0@PP0 )py4Ѝ0P  "!  0 Q T0 c0 8Q((*VH%'/k p@-`@0M 0(`` 0 (p4Ѝp R  B|P10 01SL0 DX1S**P [m!K*VH%' O-DMhpXP2 0S 0 000 ([CP (0((  `/@PDЍ0(0(0 0$``(0s(  ``$0 U(pDЍOY(P 0u(  0C$ S  u'P`㤡失向( r00R0S X 0H0 0,,`!10; 0( (0(Ps ( > (U( $( 0 0  0 00 00 0 00$0 0 $0 1SD"!!!! *VH%(Aq'C-M⬀p`` (6W000 0BP !  Ѝ0000Pl@P! PP  PP 0'pЍC 0R  (0W400(00 P(| 0SQP l0 Pp0!00(aP0Stpt1S`\p\`D0S U  P*VH%(Aqg0@-P@0,M08PP0 .'p,Ѝ0 R   0 01SL zZ{e[jKZfke[KK{K;R*VHqqO-MMpdb9D00PS@ ITO P"y J@ < 䱟Y:0@@0 &p/o>ٍЍ<0 0 <p  Y  \A  < "QPR !$%*1 "! 0T 1S!1T0 0*T !10 0*s}p8 0ky o@8 0  \j*VHTt ӁӒO- JM M`@pPe83 <_80@0 0C?oZ20 `4  Sc/b8 TK'1X0 0 04@XTTT4S <U08+080;<00U0 +;40@:@#TRT 1S  GR:1 W00   D 0p3p0,D&,`&T ,@ &,80 &$倀  , &,  &  , &, &ĩ  , &, &딩  , &,p &d  ,P &,\@ &4  , &,0 &  ,&,&Ԩ  ,y&,u&뤨 ,m&,i&tX 0 (, L\&,@X& 0(\LQ L(D W 7  0D# /34@pS pR,d.&,F\7$R [[ 0WSW \Q;X PD0;4EH0 1HL00 1`00D0 %p)L0 1\0@s\夆4 0#R0\00Cs 1SLh\0@siW 0 0D30; R 0Q(0Q P  34尰 9fWP Z-F  0 0 0P:/00DJލ ЍWD Z H0$p00DH0S  0 @3S,H0GS* TX !<0S0$RY 0 00@0P0@3A4/ 0 @3S`1$04S# 403001P  0*$p 2Z ^:0 S0!%,sP40S0$ 00    $ $ 0``00040 0 0 S NP8 B./804@U08080S@00 @ c/4 4 6@ @ 5p8 80 @ @0Y @  1=0 ! `0400<0@0, p6! !105 "404qߍ 1PS co p0 Z6dtD`5p`H @ pH0SX ZB6H-0A1 Nd! `0 D00@0`q@ px6 !10`100CS$$1" =%@P qߍOdoob4S <04,4 (04c0(00000,4, pp;W,X RT=00D@ Q.`P0=S "8 R  xC.P 0=Sf "8 R b  D5.P 0=S x"8 R  qߍO( T V0@40,@p^VD@90S  1S%X'  PPP `V-2t T 0H 0(0 0,003Ap06/00 HXTt t |t00( ,p0,S(` T'&5 Xpq 50"S 5 P0 SX0T R $00Sc SW S0Gh0l $0Cs=" *VH#%'Un*k^`94KP;nՌ.հ9Wַ֙7Pk̔׆י׻@%(6_ -*YCDVԱ*V\0P T0LP0PT0ppWdo&000&00' T0&P0.T0hP50S[@@T T TS0P 000@L E0' 0 0 & 0.0080h 00؂0`DPV\]PP P\0pp WqߍO40S0 0\0u0 00 n0000s@-@P   x l ` T H < ,9%xܼ(Gbuݖݽt0p@-@PT`1 P  rp@0zp@ *[6-M M P $Pۍ Ѝtp@-IMM @`PFIލЍp P0 w0 lqhP 0S 0S0 0S   Pt /*[@-M @ sPDۍ00 R   Pt*[H-p3MM@@YPPXY GPܮ0  40P00S` = 0P  !P``V - Pt2  ` `P_ H2P @0P ,"PP0 0|U,00P`0SЖ?W J1!P J ;PP 弖J1!@ tP\10S P 0i00z 0\c0PPPUqWP P 0 V_PiP`ZZE_oR0 .$P  4S J P tg60 `P tTW*[a'!k|fxތޝbxުް%xJ"O-@M M`;@j/@p" P@@@ ۷p p0Wp0Y:0S ķ@Pm Oލ Ѝ0W@P @p/0P 0Z 0 p 0V9 H1Z ]P Z.$ pZP Z. 20Sa000Z0 00V9 0Z 0P Z.p @)0T:Z_P Z. p$d| Ade*[\߈@-0`0 06PP 0@PT 6P Ѝp@0(PP 2 Ѝpܯ!3O--\M, (@$0PPʤ`\ЍB0P0  P`N U  HJT] T` Tc;((T8000 -<0$ 0S0R0S p 0 @ p0`@TW*303# 0303P0<0;܋ 0`ZG*$0S 0kS0TOt  ㌃ 0Hpy 0$+0@po @ H ]6䂟R801؂R800S8<븂P0ȂR80M-Wp1Bn,0S 0( S4@F000 0S+ Z竸J0相S $80/, <0 D80/ 4 00,@4 00 , {{'0 {0Bnw 0 1 0@0ph-0 h/H$0+4p 0D$/$+4P}p @0 0<0y {{'0{0P H80/ $ 0,@$ 0,0 l]N@Yr"+y;E 4?8Xb0Ϡ0SP0剴ëd0S? 00 @C%  pTP 0pP@ p ?$ 0+Hpw /$+4P pm P0H @80/  00, P0 *,` 0 !,0 P[ڐ竸z0`;: 0相0剤S? 02 @ `PQ@*0 @`Pp( ?$H 0`@+p 0 0C/$P+ `@4p {{'{<0  {{'80 A/ { 0+? 0 + 0 +<0  @Y0 '@-B D%xG-䐟`DTp  PTD PEE$U@X ,P00@,P 0-40 HP @ 3MDPE@D*[DiJ t @-@Q0 0  ,P  @0S `#P L'0D 0@ 0Ѝ R$w#%(p***ΰ*ά*Ψ@-3400S (0 0 ppʲ 4**ɜ*_P@-@L0@3@00S ',0, 0S00'**** *`TC-pQ@AP@pM0a00 M0 J+ 0<P @0 @09ۍ Ѝ0 000nS% ?S aS@ 0@"pS qS @ l0h n@<0 P@0 @ @* %*%@*-*P h$00S 00S/**A-X`0S L00S 08P8@p0Pp00****@-RP@tM  d P RQ ğE R@S% h4` R0Pt@D\ <8    Q(P   CR @ 0S $ L". 3\ P000ßx^;0S@tЍ R Q$P \P! P 00^`\ 1Np$$ l \ VpH 0P P0 P p00$0[^ ! \^ $^``` 0QD p1A$\% lH` CQw A0Q  $QTO 0Q D R QH ]QK p`1A$`VR lH` CR B0 pp\^ $^'! 0QD p1A$\ lH` CQ A0Q^,^ ]^Lpp ^0Fm?\QQ Qpp,Q ]Q %D%@*****,PA-@@P@T T-@ P`p0Slm d0 m@ P,0< 8c(0@A%(p!3* E?**ΰHA-@P@p0S0P0`|0 R d R 0L 0S @!P@`T !*Ψ*\*%(pj*P@-, 0 S*P@-, 0 G*cUP@-, 0 ;*P@-(@ ,000 ***@P@-(@ ,000 ***dP@-(@ ,000 ***ΈP0p@-AM 00@0 0@S, ,1 AލpS> 0S0!C:P 0S0=PP 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&404 CP:P**** G-MP0, ,4 ލP 0$C1:P @3@/ PY30S CSc D5PP / 3@cs0S0S PU~T30S4 0 P. H30 0,30E> 3 3Q0RQ300?o2=&Q20S  2 0P0002@0 0R R00 R P (2<"0P00  22\Q100?o2% Qy10Su 1pP0001ph, $C+ $0PQ$0S0Lގ$4PU Q 0S 0S 0P 0 000 00QQ000?o2%Qx00S  `0 0ZP00080*#* @*_P*********/PG-0JMM 00`0 0`S* @1 JލЍS2 0S! 8P 0S0C<PP V0  x1x t1 R0 0S0Q)Zp% 81 @T ,1,j ! 8P⩯Z@#P0͡ *0S @%00 R   R 0D J'p0P04pq T P0R0@l* *****K* {0 0 0 0[* 0 0 0 0Q* iC-KM MPX* x2 Kލ ЍP0\"CX8P @<2@82000(t'P 2 0S@2i-  P0 baQq0S 0S 00 M3@P -`1@0S pW5PH1 \+0,P 818!00,1 0J0S ٮP+ 00 000T   /o" &l0Q00S 0@0P0 00`0@\*** **K @*_P******i*{*@-PAMM ) 0 AލЍ@ѾPP0 崾` pF x!t0p 0hphp0+<7Pu0S 0 `W*** i 0P/ZwP@-0@S)000 u0**Pp@-@PoU p pQl0l0 YpP `@ᄿP00 }P )pZw*0@- 0**P@-) $0 00S/0h*** 0@- 0A*l*Pp@-Q !0?o20@0`Q  0S 0 h0S P (00p`@tP T0 HP80 4P400 0ѽ**Zw*q* *P0@- R 0**0@- H 0**@-(@(0 = 00S 0 ***0@- - 0**P00P0SA-$a a(00Ѝ AP0q?oѣ2 PP%᭾P00\ Q 0Sh000啾P ,{ 7`0T0 0R0D00$\(  ,E***P*Zw*aX*0@- 0?**0@- 0H**P00P0SA-@ '00PP.p`CP 0 `0 S   S  0S00d'PL03P < 0?o20***\*XZw~dP00P0@-S ' 0 ЍP  5P 0Pd00}S`00S T0TJg0HP 40 0, 0( 0******0p@-PP00008@Ppܫp d呢p@?P p@P'V2@ 0S80 0r00g****P00P0@-S .' L0 ЍP 4 05P 0 )P 0***@-M P ' D1 ЍP0! 5P @1@*P0P`p %0@P*0@ 0 S0 0S P P l0 Q0S  L0@ 0P000$0@** @*_P****@-P& 0 ЍP 0S t 4P 0S0TP0@P ,0 $ 4P*<DL*2G-@PpHoᩒ @#P510S1ЍG*fZ0a1^& t1 Ѝp.ZP+L#@PA 0|S@= 7@P 1 T ЍG(kP*Z j# 0P`0`ZZpʤP0 Z pXM(PPP 0RP "u5|0@0 YP0 0080"**^T*PYiA- MP% 2 ЍPO0S!3P 0 1C #P 00|S )7P P 0t"@h1d@) PP!@4Q-400SU0 Aڲ* *! A-PP   R ЍAP  R  㽲@0S00Ѝ@`p*%(*080A-p`P0 AxP@PLp @A蘲P T00 厲00** APp@-X H0 p@00Sp@000]0$@$P0QPp***R*0@Sp@-8 `0 pX00Sp@H0H\0<@PP0,/Pp***** @Rp@- h0 p` Rp@P0P\ D@P0P ,Pp **** - BR0 R  P R 䅲O-M$M PQ  x3 ڍ$ЍP 0\#C*P HS@p@3`X ,3 (ڱ PP@* 0`t' P0S 20P @B 0S0B(00pK\"lC\<"0SP$S \S0P0$ 0""  0 P##00C   BR 0 D*b0 0B@0SPiR 0PS 0 D *b0 .@P$18[ 1 R ! R0 R Ȱ[ & [  尰2/ R 0S `0* PE0 0000wX& 0`SM!****O*%D*****@-@P 00P 00P00 -d0lM zT00S D 0d P,00pp$**f**bX-lM[P00S @ 0dЯ P(00pp o***bX@-@xPp `0 0Cs0S03  ,P0 S 0Cs0SP03P  0 0Cs0S03  ЍPs@- P@: P , 0S1PS !|,tЍp@,*`(P %k P00 0, S!0Ro p@-@P 00PU  Pp00pP/0S/0@-@\0%\#0S P   R   0W7 0C20s0W70 0C0%Ds@-`P0@P<v0* .n0St 0l R00!~Ѝp  R  B0 0Cs0S03 *dC-pPM0P@ +PP0P   +P 0 00P10S&" h|+P0P 0 U ))) 0 01P1 }9oЍ/ P @)`@ P 0PS 1` P):`p P P)*P &:b PP000S`U'  u|0S 00S0 @Rđ.0 |}@  ^) `D 0S 00 0 s) 0S S St0 PUt 0`Sa)H0PU X),P*T*Q*0 - BR0 R  P R ^O-0@!M M P<@8@4@@0D@@@*P4` 0p 0S 0S 40S 0S |@4k!ݍ Ѝ<P0S ;0@P D˯P 4ƯP $P| |0040S 0S **%x***O-eMM0PLTCX\΍t|xp`hd0 0P40:x6000 :p1 I'F'C'AC?0.TA0 P 0S \P0PP 0S#T0dT?0S0{L0sVP0sWT0sXX0sY0SZ\0sY \4V'>0St0 /.P&tt&X>t0S t00S1S000 N  0  A+=0S ^t;P' 1Sc=- N)0S N3)TP$+l=`M0 0 #)00 aPD )@=0S'4= R* ,t0 Rt FP=0 t00|S Pt40S<0wt .[M `< = zt lL,(\<@0S  1RS8  S, ; ,p 0S 00S C? 尐0P{ 0Sx 8&P`ċtx@P@ 0S :-PTV :F'@PU `@`0S1S `0S\ : 0 PD$P @%P  00!I/1,1(1$100p 010$1S 0S ,AT# 0S pP ` yIs0 0x0S 00S P @%0,10%,WI000!R pp@Q000090t10.x109`P V)公0 D yP\P\0S!$ yyfj9PW`@yTu  0^0P0/3/P\80S ÚPP.@  l00S P P>/70S00?o 2$PdP0 P70S P 0S!%P 0S%7Gp吇VP@3p*l &d70\7P f00@T k ?P W00@T \ 0P H00PP 8N`FTP<\i'(P<50S#P`@T%!8&de &&0 0( FT & C@60 <5@T C?0T0%0.@!&t50S hP PT5T%Ts& `D%D5Qj&,f&pp0S``4TUPX 40S l5 @ L&V 30S ,5 @ <&T 7&&p pdd30S 4LgTX000p00d000h 00 000N/P P Pn A!0SG2 0? D@1Q00081<spL2 000 Q 00S$ 820S0d03THALt~@RQ t 0Ct傩0S 30tBtX1L Rʄ2"t1R P 81@y#2l2pT0ǟs T0T0@hPU &Psw`0 0l2l PR 0"0C?o2?v "0"l0ApC*bXl)3*Z* *(****tP% iŠ*c\*/ 0fQp*H֞0****** g4*d.@N%bw*` ]:H @ fq*$Y *B@o 9** *f**0l0l0 R ;R LlP |e0l0l0 R RU 0S<0S$0?"$  0"+h0S ?0+U0+͡P!͡!++S0l 0"R0+͡ 0u%`P&%PPh0Sh0St10S%@P P}!4 0 +S0,(0"+ 0xx< 8rp8< D @ @PD #P V tT Rl20S h20S l2h P !h0S PEU0S b⢗.0S PZ0S= S0 F#$3 $3pŸh U00R0SJ PwPu %PPPUg i30Si#0Q c# Q03 X4#J7 ,4R0 sr ^>+!0hA3/@t{p4@ u4 S04LP TXf$0S,(5t 0R.EC 0S 00p0S p0p0x0S x0x0|0S |0|0deލЍ0S 03/t0S tڦ0t0s@- P@"P  "P0P Ѝpjo`P  "P 0x F7U 0S S TP 0S  ("0PP Ѝp@O--`AM M0B=H@p` 0 4@P< P Aݍ Ѝ ,D4傍,0` R 4000@  PH@  P8Z 0@P 04Dt`4P400S Z Z $P@ P 00*S0 tP,0-S 0vtP 0Q0,00000 /R0 *R0 ,D_tP,000000S03 0$t7P 00,  0 0P 0 00S0{eP 0j Pr\P WP tTtelOP\LtBB=00B-0 00R(<P 7PH P 00 6 >(P8V V XT tK/FR02 U 0S p41 0` X= t:H! 2S 4sX0 ! 1V0S 1 囥B= 00A-0A=80< 0  0 ^B=0S 0 健B=  0dsU 4%D*(*  PX{<*bX1***W0@-Mh 00P P10S 0S00 0 Ѝ, qQa @T0 S 00S 0s 0 :3P 0 S000 B@ T d P 0|S 00 0S00 0000**  |*bX*T*P@-P$M`@ 00000003p 0P/S:S T @፤  H`& 4p0/0&@P/:&`P r@jP f$Ѝ@/000`0 ?@PV@`00l0@@DcT@@00@0CcS1S@Q2*PP00/@-S (0@  000H@**dh@-B p0@ `00S T0 0Lpp<0000S %@***ɜ*dh@-@\00S P0 0Hppk8 10 10S @**ɜ*dh d0@- T00S H0 0@ppH00 101000***ɜ*dh* -X0lM@ sd @80 00ss# *u**e|@-0lM@V0 0 00 0rS sS ld dd XkP0 00ss,]d $***dh***e|@-PP`@ @0@ss00V 0ss0000@? P UV 0A0T00Ѝp00CS0 Sp0 S 0 /ݣO-- LM|0xp0?W0 \ "?p0pW (-P`PV0W B8< ,0(0R8 @ 0PZ0S= S0D;0Y 0   們@P+0S 0#S |0pS D!0 R 0aR 0#  tp uLЍ 0/ `Vį  (PP 0S 0#S@DT|0S "P\0`#R" 00 "*B@*O-@BMMU@ AEA? 0a>0@@0`P5 p`5刵P<00CS00 S(P50S5U <% 00e  0We S00G00S,+ 0S 0 S Z000S800CS0gPP00CS0\0h `?0 @P00CS0 C00 0 s`83 ap0SS 00   00BލЍ@d3@<30S VW@@ c030!30 V S$ " R 5U Q Q$Q V RV"d 00H"0O0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 01U 0   0ZR@0 RX P 8/ 1X YS P 9/0E60Sd00S 3/*dh  **d***h***B*x* *%D*D-A-` @T do 0 ЍAЍ/0p0$ P xK h0h  oB0@S ~P 5/*!**dh o *xwO-@sFM M`  @u  q  0m 0$0p30(0$ 0,@/0P S  0 (o 3 @.0 @,Q(2@@ಟ@aGT  n 2 . 0 PD0P2d $P x"xd d0S 00S D 0@d n $PP ds@0S00?o2 yPڎ 0@6.6 D01@pp xJH1p὎D0(66S0d00 0d0ď(' A "0aPS gnP P  0 00S 0 0OP@ 0 @0咏0@,h匏 0@Fލ Ѝ*jx*HC***֞**j\*i*0O-FJMMs~0`薟VXf600S00p @ 9pPX t6l60 9]PD孅860 0 0 0.97S\ 6 0S# X5%0S00]%Q0*P! R % BR$5J00E0S P,97S9 \5dIۍ004@%@0L0 RS0$000(00000 `PO 4 4X 岍0000Y4Ip40܀C XSX L4t00$ 0C h00d00`0H0 C/P 40(4\ 0k0$<` ((0d $r 0+ <7$ &S 30 R0S R3(0008'PP3Xr97S JލЍ000 00U0S   0Lp廄S8'@PX20 0 0@05 0 7  4pp 087PP咄97Y] Ś 0S [Q0sN0010S ;7='0:7<0?70>7AP0S ,0< 1, l"P!1 R  P 0 0ZP 0S 0097S0 )0S [[ZX  ST000 00⯍K*dh** **j*X*4**<*\*** &*j*f*Sz*j%Dr@- 2 Bp`WLM LЍ@ XpPl  Qpf 00011 0S<0 ?|q0 (q , 0R0 0SZ=9Q ='/?@#b!"/p80S 0#S 0(60 8 pp 0S ~0#S 噃  pp 90S0 00 0 0sLЍP4k00** *dbM*dh0A-Pr@L0 @2T` R ] B P2  Q  ,]00EE?AA?1 R$!$! 1 (!(! 1 ,!,! x1 0!0! h1 4!4! X1 8!8! H1 0 S _0*DD P p p( $8S 80pP U 0S ,8S = (8S JQ0p 08F 8$ 0p3/48S 0S 3 D0R <4 Ѝ*;*%4  |P/ @- P,< P 4 Ѝr@-<@0s(00pp0Co%/*p4p$0 00/O--KMz@t Q 0 0SZQ=9 =:k{'@8`V0 @P @{P-@P0F 03 3# ( `#0坑{p`Yڐ T <#Z030(0 0f$#兑`  kZ (f 0"t`<  P  0 00@ x0 lwP T0 LnP 00 ,eP 0 %D*_& - BR0 R  P R 䓍1A-0aS0P0P2U >P |100.S @l`1h \HT1P@  D(P00T,!,!,0 $1$ U 0!Ќ0@p000 00000P0 0pS000P0T h0h0 @U t0P$0`<7*\*+***0M*H***ά*ΰH**D R]p@-@P Y0x 00p @0h hP0d Q0 P0P H0@D0@ )80@0S, 0p******T* *<*@** H0@- 800S ,0 0$ppz***ɜ*A-@)Qp0S `0S 0ssz00`Pzz00000S t`0S 0sszߵ000080vT  ?p*** * O-2AMp2 M0BS t20S Wt tW ᱵpt W` 4S4pW  $Aލ ЍtWh1P+;004P/S +o+kPq,zpUp們0| 00g000000000S H1o041 1 R100CcSppW000S 0o 000000~'{tWU00Y$<YpP*x gP0 p0~*****LQ****iY**A-Q0qS0`00@S Q05P 0P ,Y0 R 0000@ `ЍPl00}S0s00T 0S$@,5 *\***  A*%D*O-쑟Q0AS0`00ԁSp4M Q 1k5`4ЍPF P0.0lP00XP" H@P$,!0婊20$A$000 0堊@, ?eP 0 咊@ *P 0$0円pq`00P0}S0s00W 0S(@<5 A*\**** I r* z ~*   @-,@02 P*  s@-P_d`[ P@P <@P (@GЍp : T n@-@P* 0A- 0@0PS0p`0P㬀" P 0S 0"S0x R S  p`"R"^ 0 00**\**=**p@-MM P  ]`PۍЍp@Pho4/S @ P;0@TP/PWt O-@pP`V1@@P`3:`E0P԰0Y/  0LT@1PSZ 0 10S 040 R >-0S*00 010 Ѝ*0*@-?L0@0 <pp>ypP0 0SP0 0-@Ѝ*@th*0P  P @-zPx0000Q/`0000/0S <S0C00S/ S/0C*$*, *(*0@-0 000& o R Q 0S0000S b0Cs R S  l l l l  l l l  l  Ѝ %D%@@-(A`0S0 0 0 0!0axp 0S:S50P0S0 0 000 Ixp0S:S5000h `0P2xpTn00, 0 &xp(nЍp*t *p   1G-@\〠pA`^ P \T1:00"^ ^ N~ W\^ \ @2O-p@t`A0S00 Ѝ%S V@0PcU9 &/U -U4%U V% 0V @PMU0S2 2"0S00C R mU.R T* @mU nU0Sl2`200C R T* @0S 4cU.U   0' 20S0S /R 0R0P 1@X0@LP'*S/@oP0\  R  JR.UTr*PP?* RP?*@P0C Ro Vb @0CS/XP0CTT*/ P *< \ R*9Q*+ @ T =*>@R *0@V1@P9@,@*@(@&*P**0**/A-p`P @UP0  T  `00T  0@ R   `FVx`00CS0 M PpTL000`000 0 ST00 N \% nA-pP `@0尀T 1 00@*ax 0 @P`0 \kL00D P 0 Ѝ**  %  **O-MMP @ 04`0  P3@`T P 4#4T  30S- p Q pWp Ivp@0P00E.002 P E"EPplލЍ upp0<<T l@ tp@ Tl010PS v$0 0/" tp@OL0$S*F>C0S  v\$$(0Q`$0SZ=9Q =)/?@#b!"/0 0tp7&0S "0#S [0AS  T0 0000 0up 0S 0 0 tp@@r0T4T llP<00֞* >  *dbM@-@Ѝ@wuQtp@-P`L@P@ 00P@ 0S kp , 7@-;P   Ѝ [@-BPP @-YPp  Ѝ P@-뎞P  0@-PlMQ@00 00 T  40S P @00 P 70 0v 0 tPIcsPI 30S ,@)@@` v X   P `(&P@ 0S  Ҹ@P@    P@ TN T pS 2 @0 S7 x@P l0@P/T2 P 02 P 00 PU   P 0 0PU  P lЍ܄/m0S f@P@$ j0S @P@ \T 11@T  0P 0p`VPP*000n0 0 0@Q XgP@*T***Mw 7* %(  +(**********7@-P2 1 Ѝ0Q0S 1 1NP !)0 CRtA R hS0R L1P 0S0s,S 0HP 0S 10S 0 0@ @20 @0@*0 @$0 @0 @ 0 00S 0P*** D*t***P o** cU*ΰ*ά*Ψ *d*` *@*<*Έ*΄Q7***00S@-@0M, d 0ⶱP0S8R@0Ѝ0@*/-A-,<00(0*dbM*)0A-S`p@  P;P0 000(0(0S PЍ,0S Q 0PPEUPG 00 00 0P 0 00 0P (0S,0S 0S0 0X忀PP 0 S@-p`P @P,0S T000(0 ЍT000@ R   `FV 0P 0 ST(000(0T00 N \ n/@-Xg*80!R/P$0<1s0S/10/*%2 @-4GM000030S3QGߍ2 3? # P t#1Sl!`R< 03/@3@CPQ@ST$A 00@S@ c?S=@PJ brP xOPF1$P @00S 00,S00S0 @10 3/P 2Q  00000000S0S 11 03/ 1RnEiP0 P0 0 S៪Z000  P`Q0 P00 Sც>0000S 00,S 00 S00S 0  P 103/P ]H0Q  K  000000P*h** * $*%2*%/ **lRC@+q j0*@- 0  )*@-" 0** P `00CS`0p S00 P0S X0X /XⳀ%C-Pp@  l1s0S `l娾 n㢾0S { 0{`V   Ѝ*%2*2* @-v Ip( P@ P bЍX0/LAP 00h*,b*IO%2%xo T`0@-0@ Mn1Ps0S 0S u m Hm@0 n0nS Ѝ0*%2 *ɜ*k-\MP \g P L00SD0\ \ЍnP~}*`%2Q@-@80mT ~7 }*D0@-|AT 0S  0 m%2*@-< LA/e P  0 "Ѝ%2i @-@0S S S 0\ \ \P \ @P0PA-`0@/00嘀/p00/Pt 0@_~P@T*\ЍAd01 !QTUQ s00 G~%0tOG-AMMP`PxB  d2d `2  mT2 P%m 0 04R 0 0 m 0R  0 S!G`b`dpP@D✡0S1 l1 0S000SR&@@T  lT @<1<1s0S d0Q ]!  1 l!lAލЍP0S S  S00<1s0S }p 0圠0CZ lZ < 0 @**=****\*t* )8%2*d*0@-EM,P jmPc@PEߍ0 ,PP l l ql~l x0 <  TP6mhl  V{ )8%2,O-pT3MP@ `<<l8p(#d3 $lUPE*pcR00CS00ᾧp00 R0S^P1s0S2 Pp1 Ps0S 0 0^%\PP2D2l1s0S  k]x0 PVS,1s0S : 0 S 1s0S <1s0S p|l1s0S 0〱0ۻh1 k RHP1P) ͻ X $11s0S V`F'Lc`P <1s0S0 nk ЍS R   R\P0 0Uq QLLDu**= (*t**%2***\**d:Qp@-BM,\PP3L1 D(k$!w1 7k @PA`0<1s0S b0Q 0 k XurBߍp bP`⻜TPp0kٺ\YN<{;z*=*t**%2w**d*ep@-BM6,hXPP3X1 Pj410! (1 $j@P`1<1s0S ob0Q G0 j  Bߍp WbP`QTP|Pkkl<{y*=*t**%2w**d*e0@-Pp@4Mc\0PP <<0000<<0  4Ѝ0**d0@-@DP4M@0 0P88 04Ѝ0*@-M, ,PF A e 0 001 j1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍%2*=Zw*@-(@ $qk @jk* t{ tz@-@HTfki@;p@-@PPpP p0@-AM MPAލ Ѝ0jPUa0!OzjPPl1LAd1T@iijii0!P0 ku1aiii+i@i )U0S S 000 %Ta   T lzt  10D0 S B/o" R  0C[.%2Ȟi* %xj* @-MP Pppp p8il@PL\܍@,z, HP xj܍,0 < ** %20@-MP MP%@i0@SۍЍ0@ P551d dhPPTۍЍ0@y@ 5y , ۍЍ0**  #/@-#P xxE P ``tzP DLЍ@y@@Ll1s0S(0Ѝ@+uЍ*i1%2*p@-P MP(P0@Sۍp@5P5p`<r> 0˺4Ѝ0*X%2@-`0S@ fcP0S 0000q20\ @[*X(H7@-0Pl000p@h R R  l R  R4Rt03/ Ѝ0Q P%2%00*Xtp@-,AP1$aS 0SP t᳍AP00pPP0P P0 P P0 t pth:0T@T  "  \ p0%2*X6^<a6%x%1*,0@-1s0S 0P Ir%2*(0@- b@0 b***p@-`BM Pb@0 S0`01s0ST01y0 Zt0Pn00x0 bBߍpB/ BR 0b00P y0001*%2** 0?o2 0/%2H-AM M r 00000P00챟a1 dbPھ0  XbP 0SS WS BSr1 +Eb P  nUr0S T `1P0 S0Y b1s0S Ԡ0S  Q@ |PY 0@^ST00CS00  S00 P0St* X|**%2*\*p@-PH@P@p~P P wP @%210/@-Nbo/A-@PP" p00CS" ]l ] ] ] ] ] ] ^ `V HPPr P0 P00TA  0S P0000 !0S0R 00 < `00CS`0p SX0X /Xs%7@-`AP00C!S0000CS/ _$ ^ _x _d _x _x _x _ 0 "S 0S!Br?r0 0P0 0 d,r0"S0P0 Ѝ0@/ 4!r0 0P0 p Ѝ0*t<[0@- R RR \R ^R^@N  @0 Nr@T 0N~@T!0N~\!n0( ^00@ 00S@'G-@pP2 pqp =`P`oPP2 00PF 0P  V @P 7@0S@0S 00@6PP?7P PPP P  0!SPsq2*[%2A-@MPP\1 q r@P `p崀  @@Pṛu00u0ۍ0 P 0@ 0000S 8q  P00 Z%2I*`Sp@-`@:PP 0 lTp$PJ@ps@-@P`@TqЍp _ a R ya xua(R( d_0PP O<P K(P *@f<8 tx ty*0@-@M@0(@,0 0 @P Ѝ00,үx0 _˯PPPP0S p00@SP e*%2*@-p (,_*@-@  aV akkP Jk L_0P3P xfptdp8h ` X9_.k `g_Ѝ* tx ty|@f0@-4MP3P4Ѝ01<1s0S 4pAc 0 9 0_k D^<P4N0 ^,0E Ro ^ ^9P 51PP Zk0(0S"=Ro00ES h h h h h hpodo`\XT HoL%2*% [*\R5؈!@-0 ^@3*[-@-]X0 R   ЍЍ/*-@-MXm-@->0 R   ЍЍ/*A-ARp`P@1T b^pP9`@DO-- \MP@zmPtm0P0 0 (8$@ P@  p P @ `00, $0SS  R6$0SUXE (? P00P$0o0$00娂0000U k ll l l l m m8 mX mh m m m m n o( o Q 0S0dnao _o0S  \Ѝ(^ 4 @` 0C$0c6 PP QQ E 0CP $0 Q 0CP $0 0CpP $0xWPu pG   0CpP $0g 0CPt $0_WP[  PW Q P0C $0O  PK Q P0 PppAW P=80l" PH \ F0S nD n n n n n n nh0 0(R00S @` !W0 (r  5    P  0`0O 0[ !P8,00SX < 1P$0C S  R$0PS 1P0C [$0 X 0孾0   (c]plG@` UX _* &8J`x mO-- lM$ kkPXPP)8@ 00Ÿ   0<0`2`@0\2 @0P 002@P 4@p` 5Pp`@0S( P @P mm$0@lЍX@<@40S(  \ Pt ( 4( 0`4 0-P,0-P<  B, ( p( ,0RQP(@S<@ 0H2P&<0&8s00&4s00v0 0)<0)8s00)4s0\ 0y0l  P$P@_@%5  Hj2ASC-a0MS@p0P |!0 00pq  \?sp,E`@ 0 @l00; Ϡ 0pppppW0@0 @`4O <@Op`6t00 }>?@d kl00 S @. @ C< Pm0ЍCl0%5 d% fp@-M/]P! 0 :  S00R P@` sЍp [p P @TPT0dHS 8$    /*O-0]M-SP M0S 4P ]ލ ЍOv/s]ލ Ѝ@p㤄\P$ 00S0W0S 0S\` DjpP@ w s@pp0: S  SГ0S [PP Zu )[W ]ލ ЍO\l\P [xF0v: S+S( `P@`Pg  ZP p  0010 00r 0S0S`-ZP`$[`ZvH`0S 0 +ZP V ZP {z R[yRwZpPT \Px!1[Z h 0Z[Z[UiZp`4 0S!P0!0v0j P: v?b  0S -vHZpPv妕*P-PMZ 0S HZp<q*%5 rB'S5 av &%0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T000TP@-@P@@0c0S 0S Gn5Bi*@-iP[6Óp@-P)@fp 000/*l@-@P 0S`P f g |EPЍpPU P jR0P0N*lN#@-@P @ 00S@*l@-@P$00SЍ@Ѝ*lA- `pP@P000 PP0 00@-@P P0P00S@*l0 R  *l S@A-`0QS@X0S@ p8P8 p$ p0S@*l }p@-B0M 0SB 0PPdb$0 (0S ,0(0xeKPj >P^ ,KPX #P1 2P 1 0X00\00`00G?000x000<20"00X  P0ЍpnP X1 KP4 P. P ,1 P 1 K P1 K P+ 0P$ P 0 P 0 P! 0P 0 P 0  0 0 t0 h0 \0 P0 D0 80 ,0,*l+(,<*7@- YPP@0PS0 P xP0S00UdPP P dd0SP0d0(Pd Ѝ0@th*lN$bu0@-@ ShS0CS $ , 4 < D L T \(S 0h i0 hЍ\XTPLHD@{P0ih0(*lNNNNNNNNN*@-MM0DP 0{P00P00m5~{x u0P000tS ä0000000P4PT L4000)P44 , "P004P00430S 30S 4ST4STP 0S0P0 0S P 0S0P0HP 0S00$34P 0S00Tb400PP 0 00404 0000404 000( 04t04p0$0`PPTTPd D25<P`Q0`S PdPS!tPpPQ0pS   BPcP5ta \UP`L eOPP`4`H0PSe 50S 0 ލЍ04,.P 0S J*lsN NNܤYx+0*,,<(f+*0Nc6w>]*<:NaG]|]N\[^-,)*@-T@5SH00S< C000S ;05*l+ S@+ 0 /*l S@ 0 (*l S@ 0 !*l S@ 0 *l S@0p@-0x@Sp d00SP H00SP 1P0S05p+*l S@++ /@-0 !@ *l S@0 R/ *l S@00S1+( 0 *l S@ 0 *l S@@-x@5 h 5 L 5 0 5  05*l S@ 00@`/%5@p@-@`P X  @  (   |Ep*l S@D0@-0S K00ET@YKU@+*l@-@05 0@*l@- Bo 0 H*l S@A-P/o"`bp2pq 0@P UA1p PU||PHXU`X8/pL V@ P@T*U A k NNOO O5 0 0A.0 00S/*pp@-@ P 0s  1@p%58OIO-P`嬐0娠$D0@ ?990 FIvU00S[   q1 RP TP*O^%5 P 0S  R $ ,0/8<//*O-鴔M`VЍ0(S,t  RQ0$R00:?002P?00" 2Si@V 0 sr% 0S 4 30S $SdP 4 0 40@!0`000 00 @ ` 0 0 PP00p @@0(t,dvyf`p{V0 Z4$SRA 4? 0 pq0td2 0Cw RQ&0$0@R*0S 0 0 0@0@ 002  @@04 S*0LPe1 qO   10S 1[0?0S  S0$ $  [ 8tCB/*A-Ā`pePP#@b 0 DBC.B $-0DBt P 404?0$rdA{*`*p@-`PUp4 @ P@ D4p QT 04p 0 cc0@p@**` 0P/*p@- @@0S p@P BbS .S 00CsP U2"cS T. P:40BS **OOp@-PP`@ 01S E"0S *Sn0S 0Sn0*S x0sR  dR  kR  0C^S0SP@uR  @@p*%5@0S- B 00P!P* C\/p@-@P& P`PpQ P @tPQV`- PPN0Sp Ppp%5D%6O@-lcdPP0P 0S .40!0`,@$!$Z3cP@P@P@P@0 0  @P0*P*P x*Ph*P LsP 0OOP=PH*PQP_*P PP%D*P6P P&P,P1 0p/*@- p 01SP0|  Qppl]h ЍR @0!0P0< 0`Q 0! C*Pi*Pmp0 R R R R 0S//////0S! @-@PPQ0 0 `" br Q Q S R0/@-@@P (?? q? ??  ??? ?? ??<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P p!lq? `P`ĕ ?`ll@@`@@*0A-`@PP QT4@TT@DQpW E@T0t0S ;@* %7 %; Q p0/*P@-44&\,P@P @ $P r0 _0! KP0!T0@T0  T03:T03:T03:T030# S,,A #c!4,!0St ,1 ,!?   $CPi*Pm* %I00P0bA @SP//D%A-RPp @8`TЍ`lP 0T0 0fPL 1P TP00T0 0*s@-I @P 0S PPЍppP Ѝp@T1 @P 0S  `}(00 0P^TPT"p@-@pP Pd0 S P @<` Rp_@{0P  TUP P / ֞*0@-PM@ p  0 BRЍ0@-P , @` 0P FBЍp*@-`@ (8R808Ѝ 8 0 CS  8 0C 8l**p@-@ M8S/ 0  0S R(0 (SP8`000 0C?UR B( 0 8 80C 80 CS Ѝp 0P(**s@-P@`8 R8 R8SЍp 0b 80 S08s) 8 0 8 0P0S08d)**p@-p@XU 8PE`V` D0 p8Soppp*%J`p@-P@M8`0 0 0 00C?UR  0 R 00C8.Ѝp 0P00S0 0**@-@8 R 0 0 ( 00R0 8 80 8(80S Ѝ0CR80S  0S(08**(080S @-n/*p@-P`@!p Q0(0p0CR0R: $0 p00*%J`s@-@@`P@T  :A@P Ѝpp@-D@0S PX 8P 0 pp*%J` $0 ((( ( 80 /*%J` 0( ( ( 0 /*%J`C-@ĀPp0S Ѝ @`0S 0S  80 8808(P oPgP (8 (0**7@-D@P@|@00S Ѝ0 P*0P$/*0S/p@-@PP` P  @&0 00P@@00p@- @$P $8 *O--474G0pPS`M(X/ Q008(X 8# 0S0S  P0S08 Q00((XʜP  PЍ0 80 8XU080H?oP20SЍO$Q 5Q@ PpP0@S D ` 0 ( ( ( x eP 048048TPP0480488080 SA?0488S0S S 8S0S S ec0488A04880S} 048x0480480P48k0488S 0S S8S`0S S]8SW0S SS048(04880 S 80 S C80=08:0$48X3X3` @R( B WH`X  vP`WH80S 48PS8P \088  80 Zt2"8Q WD 0`48 wD(<8RqDPp4@P 0480 QZ`Z ` 1弁 0 0 0 K Z@PX@ 0"ST  |)P 0`pU%J|U(%JdU00 ,0R0S/0@-MPP, [@ZT% ppJP0: SppI\ \ZX LZH D 0Z4Ѝ0@貄Ѝ0%J`iUjU(%JdU0%J|@-@0 700000  0  x0  h0 X0  H0 <44@,0*(U7UBUNUZUdUoQ֞s@-P0@@@`0/00^ 0S V DT T Ѝp@*(cPUrl7@-P@0$07en Ѝ0@*(A-p@Q `P0  P0;0 AK  |-0@P    P  $%X A *(Uv@-*@9$p@-Q@0%S!S0C Sp Sr    l     0C Sc È        @ X /S 7Sp!p@A,p@0P S+S@ AP Y0S0pup 0!00p 0p@ 000Sp p@.0!S P sY X00Sp HPDp@00`Vp$Xp@$p*(*h*,U0UA- &P Ah0pq  &H00S 8P8@Sp`  p`*@*+ *G-@, eC`T00P  00pတ倀 00ST  0W0 000S T82 **+(0PP/*(@-0 0!$ Ѝ%UUp@-P(0S 0(0fPp@0%P 0S S S p,P `@,`X?o2(0pgp*(@-@0@, , ( *(p@-Pṿ@@@Tp8T0O--e`㌋4B4r00200$M0?00U0 S 4-10 S D#,0S4,$!P a P w 2P|10S m P f1P D0Sp80 S% H"80SeVaP谟 ZeV0Sl Sj SY S S U UP'*P x"Y 0S:" "/S 7S *(*X*+(*+ *UVE*dUU*0k++t NUV*,PV*V+*8VVVcVr0UVV+VV*`VVV***l+***00E.U S>dPy0SP0 P. MP+ 001`P V 0FcS  x D ׼ d h д  Ҍ d Դ ՠ Ҹ d , t Ҁ @ 0 р h d T T $ Ԭ Ѭ h @ Ԑ ר d d  \ ֔ d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d 0SP0@ _U0 0Si U U00L Z# 20U 20U 20U CP+U U !UR00-UR000@0#Pw 0 a0CS00 0m P 50 0 0P 0Sa0@S @PW 00Z"L 00@0S" aEQ0p$=P40U \40U h40U 0S P0P 0 /6PwUUs0E So ` τ Ȥ Ȥ Ȥ Ȥ Ϙ Ȥ Ȥ H Ȥ Ȥ Ȥ : 0#0-*U @U !UV<50SP07SM < 60SG07SD ;07S0> =P 0#0CS>P;40 7e`!S &0 0R0?0k60S  \ e`!S '0 0R0?0P   0R00 !ıCt70S 0R0  0R0 0!ı.  0R00 !ı$70S  0R0 0R0 0!ı  0R0s?0t80S `E!S 080S !S 0  T&~s 0R00 !ı?h0 SeR0d0 !0<0<VQ0cO0S|9 }FC$  <990S0Su @ 9 KP& 0 00R00 !ı50:0<0 0R00 !ıl4`000 00R00 !ıY!``000<2&.`G:\  `@ 0S  + h;0S`l; ZP  ;0S  ; +0 ;"{,P j 0R00 !ıP P P j  0R0t<t< 0LX,P G 0R00 !ıP{  0R0<< 02 0R00 !ı,P & CPb+pq^ 0= Z 0R00 !ı,Pd  0R00 !ısP @ <=` P/4#P m. ,000 0V000  0S@ . \0 L-oL>P0S \>0S h>0S P P 0 W>P0S >0S >0S P P H0S %;?P0S ,?0S 8?0S P P.P0P`/% h$PV0  Q 0R0? 0S?0գ?0/!/0 S00C0 ?  0R00 0St00գ?0/!` 000S 0 4$00S080w?+**!3+00S/*p@-@P/!ኾpO-pSP@`MP᥺P80 `0@0 Y:X  80#1  X RH W0H 0Ѝ 0S  R  P R  AR  QQQQ R  X180 R    80 SP }TDZKI  P R:p@-P\ HPV@^^'P gP dP fPpdpT ^gP PP0  0S0A0p0   /O-PR p QPP @䠟PU4PP0p0 Ѝ S@0X0`P`@0 ӹ0S ``F0 S0S P B0㗽 0R R@0V @-P@*lV @-P@*pW 0 P*l 0 J*l@-d@ CP xP  0S 2P Ѝ*lG-02@T @Ѝ`APQRU Q0p A@ Q`P 0 @卵pq5R @@?Y W 'R0 R MR +R GR  SR 0SSj SER SnR0SdSPX0EP` 0 @vT cT eT @ Ux@T@ @ >   @P *,*xW%P7@-@P JP P@ _P (@Q Ѝ0U+Wb@-H@qq (  @ %JWWWWWC-P1M0PS; 00S7 00S@/ `p P@P  0@Sd@ 0DSd@ Td@ 0DSd@dT P vPEUЍ@***@- 0 tPsr :X@`V - p4Q000 00 !Ѝp*`*O-@.`P(PPPpᤠ夰0F R ЍWpV R  0X0Pp@ U  PPUP@QpP RpP%Jx%Jyp@-@QP 0S R SppQ0 QA QR P/@ PRP/@-@P *`P/@-p@  0@-M@ 2_ @Q?P c?10S@&PaP! DP OP AP dP cPoP qP:i0|00SrPЍ0 ?0LP 00㹳pq'?00@*TWW%5 X0G-lM0S @0PS G0`S  HP3PT{#0  0`pP 0S iPO200U p2PW0dR0@p P D2  0B,2P 0S H?P"!! 1P 7QOp>000S ]s!1|W10Sڐ`O tP00 X P00 >P OW  O<OOTZЍG>P00S rP|P `` YP >>*`*\P**@*d*$*P*h* + @tXEN+X]P @- 0@*`00@-ԭP  @*XPA-P`XpVPU@JTP0+( 0 *` 0 *` 0 *` 0 *`p@-P@@P Pp@pp@-@K`PPpVU Pp PpC-M@pἐ@PXЍ`PPPNY04Pt0SE*`@- 00S S Ѝ*`@-(@0SP00*XX@-@%0P 0sS@ @G-`dOd@p00CS0 xp PP 000 P U 0D IS  -JRN\p@P@- 0PXMA-@L0 0pR`@0S00 R0S@00,`P0S U  jP@00%Jx%JyO-MpG`@ P1!Q[ Z@P[@P* 00p00 04MЍPP P : .PT0T VP/#P  IP00pWp%Jx%JyX@-@7`P 0S PP Ѝ@s᳴@ᰴ@@upH0H 0P0LM s@M ЍTifx@-p`P@ Ѝ0S PჴPP=L@P T0P 0p0L#P<P`M@]M!<Q/G-p@`P@ 0S  P@0S0# CV* UR@ R %S #SP 6@# C V* WR   R %S #S 0P H@*`*\p@-MPPލp@0 @Jpq `,; `P|` 0S:T  30S 0S   ) 0S*PTP@+C-Mp|1P0S ~s \1RPLЍ42@P,A 1R@ᵳpᲳp믳p``s0000 0p00K L밐@@ᖳ`V  4`~LV @s0SrL 3kLiLP*,PXX%Jy%JxYY[@-  R@b@(P0P K@pᓴ`PBL@?L=L Ѝ*,Y!1G-0S" 10S`p|P 0 |R@C0 -R DfP P$H@0 PPP0 NK AP KU T!  xx:P rT@@P@T 000d0@ЍnP4S@r0S+*,VMPY%XE00S/RC-p r8`P% 'Pڔ ЍCṲPᶲᳲ PP@wP0 J@KT  ЍCr Ѝ*,Y?YI0@-MD P;P@@JIDOoB|KЍ00@-M2@P0SP x?@"GmG d;Pf@XKЍ0@T@0: S W*@G+%M1%MA@-M@o;P͡0 00ㅮЍ/i@-@6P P0@/R00S+(h00S /pp@-pq G@tqP TUpp*@-P3Q03#0 R/ *O-4`p@P08V `20ST20 S/ R 0200CS$0S 200CS ʛPQ =tPQ 1`V1 f`^`Px0Z0KJY)Y @ PVL1L H100 tu 010S1 10000 0000S!@tqPX  PPAP pq Z / 00 ЍO0 `V *++ %Ml**0+`+YdH00S <0P/000S $0@///*++ *'G-$@p`P *P@T 0@T@@XJP0Zs`X G gTRX T 00SS*+G-p`P P @P @tqPV00SЍG0AfP0 00@ЍmP@P 0@tqP **A-p`Puq@VЍAm0  0@cЍ0P  P/%Mp0P  P/%Mp@-P@p@-@PplPY 0S 0 0@S8 00C0PIp@MI  B 0*`%Mp*0/*A-pP`@T0 @0 "0UP00 00(@0@000 kP @   0S 000%Mp*P// / /00//0// / /O-P@,MutP@Ѝ30Su2  0/QQPp0p P^=`V0THp@ P P``0t TV 0PS@m!! gQ@_ P10S  0Q  P *2t10S``V P PH p wЍO(100pW0r 0`P `V˯[:Z T`z0Q PPڔ0[00S0Oy PpbP@T0[@Q_h@z0 7+(+**+*+++ O--p@MT0  Ѝp @20S2T0T0 00x2000T:0:gPH20S P U U P P@ p 0 P;P`FP ; p 000000 00 00 P0P+H1 D100%. X#*0 S 0ˏ0 |p`P0Q 1P00S00S 0 00|0S 00PZH00SQ 00*:PG * D+(+*+++*+ pqp@-P@ Pppp 0 P P H0H`P@t@PP60P@pP@%50H%5(O-PM@`P!@@T L0000 00 `F>@P0 @20S1 ЍOqtpP ЍO$  0s00 T 0Sq D Wr 0t!`F0l!0\!H0 0@0Ѝ00[ 00S 1 0000@0@ 0Puq@ pPuq@ Q0` 000CS+ d00SB`H0`0 0`0@W+Yt***+ @-p`Puq @P 00S h0 Ѝ@5V0 @P80 +, Ѝ@~ p`y Ѝ++YY@-  Ѝp@-P p@db Y@P pq@`  Bp@@TPQpp@Y*p@-P@`P P p4P@000S  p@6+A-`ppq\cPuq@A40 Q0T0A YZ +@-04 ,    00***$*@-04 ,    00* **(* $1Pp@-0` S@pxP@SP@P%pPi`P @@R 00SP 0S@[P R @@PG00SP **G-` 傀 D@DPTPpp P  P0  V1PU(0S 00011CPH(PꘑQ 0 (Q20H0@` 0P `2R <10?Q 0`@U 0S H0S0S \0(R0SH0 Q0H @`ʈfPpP "E E"ETP0(0E7PH00C10H00PP(0*+*****@-(@(0S&>C0(0*G-tAp0P 0P0W0S %> 0`S@U `0PS mP 0QR00 0R 00S W 00S0S 0  00 0   0P00SX 0  00*+Z_***0 0@ /*d0, R X00S P@0~0/0P 0/ 0 /*+ 0,  /*pq/G-`P@PKp p倐x X 0 . 0V 0U@00CSʜP Q 0)@*+(QG-P0Q`[Pp̀@ 0@D P V 000U00C@C@p T `P0 0C J0 Q@ @D 0@DRC*+(0 P/0S/  0S !/* 0 R  +Zc*p@-L@ 0Sp0dS 0p`$P `w PUp 0* Z{T0 0Q 0<0< (., 00/*P* + PA-APU ^%(`P, `(,, RP0`VU, ,0 0  P^P Pp0࠱ P 0* 2G-P0sUPPP@Q0Ap`@`V 0R00 XWP@ V$ 0W QS 0*XPP` @ Y0 0 s W0@TP0 0` #vq +@P.PP t@ `W 0 0I0  0`yq @TP+* +(Q0G-cpPU  0R0!RS@ U W0S Q0*P @P P`@V0 0 0 .@0 00r  0P`Pl`@W 00 G@0 00r  0P`V@* +(G-`R @Ppl0Vs 0S@P`? @Ptu TUQ*00CS0 Sp0 S>0 p/O-0P-SP  w &sP,p,Xp,P,D9P0S0@ 0S 0S%@T :=f,,b,#BX B@  0 ЍOs`P ኤ@ᇤ@ L@C 0A ( <l=lɜ.sTZZ*fxG-@` $PP( cpPP` A@yz  0Z`rp@5d - `0 r(p Tt Wp@ pZiKlɜ*C-`xq p8 @tq@PP0 .Y U0 0 Ѝpq0  p 0a0@S , /A0@S'0@@- +PZ.Pp@-2 $P 'P7 Pp0 srpp^PP@<@050O00pPp\0,\ O  B%@ $,P N $0ON0@4ppZ+P*`Y*+00 05S /+P@-o0@-M@P P'  000Ѝ0*`@-] @ 0 sr NΎ004Ѝ+P*`7@-|P! 00N.P ēO.|~P@@BT  $ @P Ѝ0@ P Ѝ0*`+P+@-QP ,0 0R H*`Z0@-5 P@00QAC R0+P@-0@Q"P P P0@Ѝ00St vT0,Ѝ@{D00S<Ѝ@0,00*,Z*P[%5 [3[N[Z 0 *T000S/$  " ?A9c0/%U`*Cރ+@-P M# @0.S 00S Ѝ 0S 00 0 R000l"{P0@  0R 000@0,0[h%U`[j[+[[[000S/$  " ?A9c0/%U\*Cރ+@-P M# @0.S (00S Ѝ /0S 00 0 R000Hl"P0@  0R 000@0,0E%U\[[+\[\,@-@PP  @ЍWbP P/00S xt0/p@-i `\P p@Puq@ 0p@ *,\P+`+P0@- S S00 Ѝ@0 0 0%U\nP/ (0@- 00S @++QP7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@Pf:C Ѝ04@P,0  0 10%U%U+(P%U+t0/0+P/ @-@P @DT@M X0X PLHD@<840* \}%U&\\\\]]:]oC-PPM* 0&@PDD-P,|+ L*`++ P*P*d**4=00S%Ul0@-@d00SOoBL0L0AD0<00A400AA9 0 +++ L%U** **d(0$00A00A0A!** *%U00@-  0SR@^@R @P P @S@ @^ P @T0@6000s@-@QP`@ P$P "00T0 (+`@@0T T0TR  QЍp Ml0P  +(`+O-M`DH RQ- 00DPH@@0PE1p?0@0J QZH0 S60 S  0 000H00D000 0CPЍJo ^P DBZy@ pP+(`%U0 @-oP/ 0     /+(`0G-0@S $(*ut$ `1 @_0 rs Q0 P@0s00V 0S (000X 0 00 :000P"(,qp P!"ut ^ P @` @_ V p`8000/V`Vp p `+(`*0@-M^P @ut 0 PЍ0@- 0 00S@+(`+A-0Q@Pc M 0SFPI2 :P  4P20S 0S   Pv|r0S0S 0S 0 00 0pP`! VN|q" ( Pq0S 0 0F0Sy10SVPW 0 Vda|~XJ=S V1p0X &|~ |~  Ѝ000 00@0 0  PP`` 0U0C?o20S ?40 P+(`+(h+jj+$*+j@-(嬇$ 00000S@ z+(+,@-(囇$ 00000S@ { +(+,@-:(則$ 00000S@y {P+(+,@-@P XvPsHp@lifc {P { z 1A-@TPP1 RaJG}A 0@ `Pp0S0S 0` 0?00g 40 (00Sп+( { ****X+A-` pPڿ@ Կ&0Up0P ſ&@-4@P $0    0 *%U+(O-bAMM$+p*W Q Α W@P T0S0000AލЍ0!S  PA>04S S S050@S  0 [Q0#0S 0  C Q0/ 0   ^R000 QR S$R 0C000S0`0000\R00000%U+(O-pQpPpWCM Cߍ@tcPSTp`3`#`C \\Hs PZ PUA (3T 1QpP 0S @DT2P@  @@۾ 0 X ) CP@ )T@"0S 000P @B?1P SQ@  1 Pp 0Q 1T PP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0S 0S qPm0/ ^0p0000-+(%Uj%+(%DkMkǰ0@-@៑P嘑P |哑P l厑P \剑P P%Ukk#k*k0P@-@P DP P P(@Kk6kCk\O-P1M0SM A0 ЍOv` 100; 0p `xw@PЍ0S  0 |00 0؏ 0P 0S0S S @P@P+(++(km0@- PPPP^0S @T 0 @ +(%U0@- PPPP^0S @T 0 L@ +(%U0/+(0/+(00S /+(@-P 0 .s+(/@-H@ p P 0S00PЍ+(FP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-P`p?P@P$ ?0P0T0S@ s@-0P00`a0C@S $ , 4 < D  P  000@@0Ѝp 0 0 0 0 0\/\\G-1!0 @c \ [@Q`V1!0 /c[0F?o[\20S7 @`^V`00]QQ! ]Q0[Qp.GqQ 5 p`0W]Y0`QV0 0 b\Vp0[W` W nW \W`Rp0 V0+:+:kkk7@-0P| @R RP L L D D   Ѝ0@mw @%D+:+:l G-1`MQ@P㈡``0pW0 p1PK P1 H1 000 (vb\W R T R 00P@0  p0 [R .BqQ  [TS[Q@]R  00000T[@T[T@  ST  SR(0 R Ѝ+:+:+:l*+C<00@-00M/SP M $S, +S00, 0 0 9S$\S @P0 0 b0IS0@S0 W00ۍ Ѝ00@00 S00@+:+:lil@O-@ MTЍ0tS bS rS aS @{S000`Vp F` 0S0QU 0W0 0oP 0 PUP @0@ `0 0a2pP &+(+Ct+:+:lO--`?M @}Q ;Q <,0 ` \ @\\ `<`,0 t@T @@ (<(,0 @\\\ \0\ AP@000J S  4P <40 @ R @XT;0S008+8rp  G`  R @   R @` @ R @S 0R @ Rt AT- 1p @ 9)0 4" X 0弌P00)9 0:@@\QQd9d)0 f$ K@P$9$)0 pV,1S0 K$0,4 @00T@S0 8 0@090>: 009 Q00A0 0C S0 00, 4 P8(0 t\QG THP R,4 R $H, 4 00P@0) 00A  0哾0+ 00 0 00)Rm0I gRu b9RZ0RR R 6&0 PT   9R/RRA@ &R- 0P0 @  y\R0)0\ P0 Ar R(6(&0 [Q 50)0 0)0\ Q5%0 (~0;Rv IRpR wR9 iR0 R @ 0S <5<%0 \000) 0)rS0o0 0 0 @g0"S T4$0 ,=09@0C09@0I0)0S 00@<40 0)0  0) QQ L4@S 4$0 -<$4 0S$p5 0I,1pS0 KT% 0S @;S>B0110@\SS434#0 ~ P3#0 x4 @P 0S 00@0   pI#pp,^p2p"0 0$ $7#p W 020"0 20S$000 S 0Q 0Sz @;S> }S Sp 1!0 0w$ 0 0$ (0 0> :p"p000p WH 0S  "p U] $ "ppXP  0$ 0     呻!1 !  0 0 $p$( $ p$p|! +*%D+*+:+:ll%Uqlm2mHm{pq+: tpp~+(mmmn&+2no`nOnrnooDoopp2%pep+:+:l0 0 (\<0< 0 LJ]00܍<ЍG-@`@Zp圀P䘐U@T00S Jl0h0CX0 0S0 0 ! P+(+:+:q0+Ct+C(+C<+C8p@-P @%000P @p%W<@-@ 0  @0%W<0p@-P`PUp!@P 00CS0Kp ᅂcKp0 ZK+:G-p`dBd 0S2 SQ S$PUVP(00S S  x!P$0, \0000 00!_ PQ$00P0T00, PP (00S(0 #R nR0V ,0020#00$0,0$0J P( T0R #R nR   PH \T000(0V0(00PP P 0\$T 0\$w 0(0V0(00 000TPr+:t<+:r-@-@X0  0S 0S00CS0Jp X庁0 o+:G-(DMX0`SpM00S 0S [3#X0X0\030 `00d0XSXP 00CS0Jp X偁X %pP0 p[0 X PލЍP2 FJp0S ,0P 0 P mp4S 0p0p4S \PP $JP X00\0P|p0`0d0S00d0000S 00Sf P00 2 02e[00S +9+u P0 T[+0+J+0&] J?^ 0p! P*\PP I@ P\c 0 p,p\0pp! 0`PS(00PX5000.|0\`0P l000S S0P@ 0 P00 00 lD(00(04+:r3%|'+?$+;t+;$rWr`rrirWri@- P Z ЍrP@- ЍfP Z Ѝr@-P0 Z Ѝr0@-\P@MP # 0&0 &Ѝ0+C$@-`MQqM0S000@03 0@/0S *  0zZ 0 0S S ` 0eyl6@P *0  PH 0Qy00ڍЍ+C(+;+;Ѧ@-@P   0S|>Zp`0 R `   90P S t #ZЍЀ+C(rl3G-Ap0唁0`PU , R:(,50(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P     pr  Ppu PE ,  R:(,0(0   |n 0 +C(%DA-@P p0R`*W00 \n 0P P 0O-/MO00PЍ080?PU 0PH0\\e R7 0Sd?0 C0R 1SiPi PS4 0 PS>0@oP 0 R >0R*0 0HP0S40P 0 R D>0R4>0 0S> 0RR0S0S4 0 S=0@oP 0=0C>S񟗐 0         4 d       |                 X 0    P     <  \ D   ` D  XL0 R: L `0p 0080S << 800 [04 0|w<0S H0SSP80S4PU 0`  EJyP080 A E4 "m0T P$ 0  004 0 0  0:40z 0 :0RḚ <00s {0P 0S 0S 0h( P2S 0 Hq` 0S0`V: ^$ 00@ 9@备0S  0W  H0$P x0 H$0>$ [P9`0V:D *$g d` 00C 0 0P0 S8 0R:`8  0v `[ p xvx8P0  R:d`dd8K \N`((1 S:` 0   079!R7 800 g04 0kv<0S dhP0800 D0$XP80S g04 0Ev<0S  80S0p4  Hx`P <000F400<0吆04 &v<0S V 0400<0H6 800 0V04 0v<0S tL0 R: L . `0pZ00pY R  Q l5 50V4000  P 04`Z Z 0Z000 G 400 0 0 V ,Z0 QP  0  0 0 PQ@ `Vp X 0  `G0P  ßH`pL(L<Hp(L<(0000S c04 0hu<0S ` P0 000Q00 0  00`Vp P\  `VXp0  `Pa 80S0s "T p0 (V04 0# 40P0 0 P 0S 00P80S0s$"$+ p 4 040P P P R0x5\0`pL<0p<s80Sp4Xm P!p 0`R@l0#0Va*00000S(0!0  (0Z0  0;H0  0 1 RN0P& 0 0J1+:+C(+CX+*+;+:ɜ+Cx% %WD@th +;Ѧk{srr+:r+C@ t0%+C+CX$ (1 0X`4H`pL(<Hp(<x0h0<0 0R0((Q 0{Q  +*0+Cxp@-@P`Tp0wS {S sS 0p jP 0 D*U0`@p [P `tG-`P2p9PW00U01@ R P o0PV(AGdU !R <BqPQ , h T Ā h   T    :R 0SP0S X00 0P00 0V 0S`: xsPP 000BS r+Cs&s-p@-P0@0`T P QP# 0S Ŭ Ŕ Ÿ 00C?o2S Pp0S000S000V0V@+C,<* 0@-MMP@P  PZT Wp4RT+ l PۍЍ0tsJH0  BR Rp Rm p/%%x@00CS0 S0 / S%@-,A!w0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@&^+D0-01S ^00oS^ P0\ S0S Q0S R P0S0S00QR ,A@+D0@-  `Ğ\ @ T\    %R    +D,A@A-\A0 5S <0S 300,!<^P a q 0U&%0 ! R8  (P  I0  ,P  @0  4PP sA%00\P MP @ $00, PfS,A@ Ɣ+E %x+Ep@-@0` dT  tMsd lP`PT p qP000ST0 @%%xsZ+Csos@-P MvPd8@P-0?S0S@P` ⧭p Ѝp/㓙P@HP 0S S @@0S<00RJsss@-x0 >s%x@-0@<TQ T00 *0001S R0Slp@TX` T@0$ @H4T(8  @,+Dtt%x,A@ttt$t7tA@-.0 t%x7@-@Pہ  V0S 0@T ́00 Ѝ0ǁ0"S p`@-@P  p RЍu7p@-+ e@-6+ e@-.+ @-  &+L A@-+ @-  +J  @- 0+  + B@-+L @-  +I @-  +l @-  +$0Qa A@-+@-@D!|P d 0C0 0@-0 |1+ p@-X :X+ +l @-PPL04S@n<l  !X X+* +@-<<yP d(0C  ++0@-<<yP d(w0C  +i+0@-<<yP d(a0C  + ++0@-$@$P 峆+A-\`)qW 5@P |A埆0 [H+00/00/00//A-P@`100# 1pS021(S%0t_x10 #1Ux  Uuaq wRb  JW80S  3/1SAQxL0s( r S0I`e sB!3!1O-a@0M0 0M``&P`P H P  kpP0 0G0 0  sW 0S1 y! 0p@0SpGpR!  B!ġ C10P5QP6Q00\0S1 10 \P(0 p0 0L1S1S  0ks! M HQЍOR01PE_Q 20S2 0 0P G7@-@P  0  Ѝ0@@Ia@-@Q7 $ 0 < H 頸 A50S04c @   |TxP X03S h CX T T L0"< +l+j+k.+i ++  @-@Q: ( P \ h A50S04c @   xP t03S |D Cl h hd d`00S  0< ++J+ ++ +J +0 @-@ Q? l   ( A R 0$b @;   B wP \03S x Ch d d` `\00S  +++l+I+L+  +++* +J +0p@-PQ- H A50S04c p@t l/ @\dwP 3S/ C, A. p+  Q A8 0 0, ,( (B /++L+l+I+LQ  $ 4 @F@ 80 , ,(00S  /++@+J +0Q F, x$ $ B /++l+I+LQ   , 8 DFD [< <8 84 40 0B( /++t+K+l+I+LQ 0 06( ($ $B /+K+l+I+LQ Q QA /  ++L+cQ Q QF /  ++t+/00////00//00/00///00////00/00/00/00/00/00/00//00/00//00/00//00/00/00//00// @-@0@+K@-@0@+K B@-+L @-  +I B@-+L e@-+ q@-}+t+@-u+ @-  m+l @-  d+I @-  [+J @-.0+0 B@-J+L0S00/ @-  =+l @-  4+J @-.0+0 @-  #+l @-  +I A@-+ @-  +LA-T`)qW 1@P |A\0 +A-@PP 0S t`/P   /`1S0bP /P 0p RU .`@-@PI P { l0 0nl000A-@`\@*T<0p " RG\<0d$N R 2%WX@-@K@-@@-@M@-  DU %xmp@-@PUP,LGPP( L`aP 6 㟐'Pmp`qupuG@ PP , 0@ S< 00p+E,;%WXO--,M@0P0 T; R~0ATz 011!0 S01  R01;bP ,0S  R3/00S 3/[1P PP m0P 0 0S_`: p` 0 011S`@S0` $0fP$0pr$0P``PpU$PeUP$0S000 CL R RڰDPCPE_ C B R@ RDb 1  pdP\ 0 `p0C0CS0V`0Z `1Z0Z b 0 000 0 H 0 "P P [rV`x 0CÀ  S CUPPEPE_P0 7zP a 0 00@0 PE֍P N7m1 0 z  Q 7>z90#?@0CS ` L  `!0 R$ P0g0w0[PP7000ᗇRQ0!R0c !ġ1S 0C" !s0R11$`V0,Vsps0 yP v1y/e%`P0PSY ' G 5m0 m u8ddY[ Pd50xPe'~Zj}GV S0S 400C`$a~H1Sb !0C B/!?1!1NSRPNQ0^ B0жs0xP00S11 ;zP`PxP@a@1S0020+ (P%J @@P8   0@S%  $ L    P h3P?P <P >P PP P$ZvP P1QF P x}1S(ʰ1 F P xu}P 00P1 RF40S 3/Pi PP i P,Ѝ0R0 N` 0SpW 0~ 3/px P 0`F P x gi `/}bi0010A^90 b"P ] 00P000xPdP <P >P fqP uP P ʰ0P <@0CSV <000C`FqP Y$P P 00P+Eƻ%xG,;RS%D,;%@ 001/+EP0 R0//+EO-p`*@PP [ ! 0P @ Ѝ0s00 0\"<P 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @+EP/D0 R/0@-A1 P h@< s+EO-Bp0 W Qk0p 000F Ѝ`$Z 0S qP [00010P@P 0S 00@ Z 00 {qP Z0S Z0 00` Z0S bqP Z Z 0 0 00U0 P0HS0SPPEq 00Hq0S Cq+C P ZPU m0X!0Cs0S 43 000 PEZ+E,UUUV%D@ O--$MPZSQ0T @ 0 $T`B <0X0 0S 0h ,kjn@p pp0P@0@ 00t0000. 0DSDU 0 E 0U00ө?0U0 CR C 0ER 0 0jpY 2 j0  B}@cX Pp} PC ! PZ P P#0STkpD EWPE@ @&j#j, j@P00 2P? P AP7 0JSI1000 C 0 E0W0@pP1Pp1 W 0p00@0p00@pW E@DjWPE]{pGT@D¹0 X@P kjnP@U@§0S 0 B0pY0S 00 0 0Ej$ЍO0XS +E,:QV%D%xA-lP`Pp `o@o@0T s`P@ P P+E,@-P@Mp 0pTp NP@@Ѝ0 00i0 0\` @MJPu ,n@P s %m+E,'Pp@-@*TP0Ps D` R :^P 0S@@A@p%m+E,@-@iC+E,0m+E,0m+E,-@-0 0I Ѝ Ѝ/-@-00 : Ѝ Ѝ/-@-   ЍЍ/@- Ѝt@-@tp@-P@`M ,0 0(0 00`Ѝp@- Ѝ0O--0M P` HpLooUs\0 0`X 0 YPc 0S` T00S\ l@PPT00PXP@ 0sHਏȀ0 0W 6p _PUWpV`JЦo`0 S 0`J0 0sPF 0 00`>P\0 0X0 0T00P0X BZ  t be+y]e[eЍ@00Y00S 0S clT00P@#@3@py'tP 0 st뜰!IHMgPg TB 0 E0GsYP`IH`1g4g+E,,;@-,, ($ Ѝ0@-P@`$0 0   0 00`Ѝp@- Ѝ0p@-P@`M ,0 0p(0 00`Ѝp@- Ѝ0-@-00Y  )Ѝ Ѝ/0p@-Pm@mp+E,@-7@- @c@A\$-c[PU U% |`.00h@PU E%T l`.00000S$$] Ѝ0+D++EP%x-O-pCM@`P \\\ P|.Cߍ@ &@ VC60P0 ^P@Q Nk 80P0Y pW     0 =RP P h0 0 |g@jo Dj%xu1@-]0O-MM 0p@t`P2 xPP* P k8P 0S0 0    5PnP*lP 0 Q0 0POrۍЍ0P 0 0  0 IQ,00S/ 0P C@-++4@-TbP 5P <1@(,"P@QC-@$M  @fn0S0d%P-   Yn)0S$ |P :0Sm Y0] e)Pf BPajD' pD* B^'$ЍP@RK@7P@ A`P'='P'\20S ?Ap0$A P!@  X $P 0)AT P vP  ^AP  pPP0 +Q !Xp 07'WpT+pAT3 V@p 0T3:X#  APQ  R@4Q p0Q  R@ @P`Vp003/P,00  h0S  R l 10!@+++t0@-M M+@(e+(}XB+(eB+sX(@PP B @PP 0 ` @@@@@ @@@@&Pލ Ѝ0B(>"-MM+ e+L AX+ e+09X ?P  >ۍЍ"0@-@M m1@@ #P @  pP A0$*!PRU)QW&Ѝ0RL00S 3/P 0$003/0$q*l@P3P/\P+X@P'@P# 0P~ ҈>~  0S 0_ Z'P z@P0o,m%(M*00++,;,;@-@M l0@@>>#P* *@P  pOP 00*!R00$Q *@P  U0S 0` 'P%(*Ѝ++O-`M!0[#*0S ` 0B00 SS@@@`hp @(0 S0 0`0@Nh 0 S:dPP@ B 0p00Q %Sg0S iSD %S* dS $$0T !PsS$200P 0 倠ಠ@Z4!@ P %Q0@ 0S0 aR7 cR 03/P Ѝ R R P10 R @ 0QR\P0S  S 00@Q0 @R$R0PPR@ $$ Tl 00S  0! S 0 @S$SS0P @U:U 0 c%D7@-@ PU 0! l W\*00 Ѝ0llP XZ !L T ?\k( 0$[+i 7@-@QP T40400 S  0  Ѝ0@J9++DѦ7@-@ PU  f\9*00 Ѝ0pPP | P[d00S 7kL 0H[.k0 ,9+D+[Q %xs@-8Q`@<lwZ|l b geb!ga bf8g|bw9|h 0 An@Pxx咪8aP CHCaa ᛆ^|Ѝp,;t%x>O--* {M`Pp $^0  p@(6 F 0S  P R  0S  댵P 1[|P ,[Mp@T Pc   @U0B? 0E,P  b7)@P  Y.)00_gPZgP=; P  h8; :0S :P : 0D00{4$"0{ߍU23 ,i0z"!׋؋ 031,0p0,0L,0   L 0\P60 0p0z?"!!03 Q PW p WU l @2 0S l2P  :i0S$P0   T 0  <SR 421P GZ 1 W @U$2@lPU i Pz?0WC(0P 0[0 R0SQ Z0S=P 0`z{0SP @u l 00TP@@ $2 @@ j+%wtptb{@f+D+jw>+J~+4jo 0@-0,MP0 00 0\PPP@P DD塨@0Q ,囨,Ѝ0@ (<%w%x+D -O-iMs?!0YP 00iߍOЍ/L|`P81P ,!,0#`P z[p 3P@P)PY-'U0P 00GSW030#[0S [00pwP@ P}p00P$+Dx/G-O--p(MT@X  ppĖ`V 0 @Q'U` {WPP*dP;@P 8H E0ᴖPU 0'SP0U*S!/ dP0 0qmX/0 0P c0@: 0H: qP10Z ]k徕p`PUQV 2S022SP0220C2   S`` ᱃ty0000 0PDU  @0 0 PA eer 0`R  {_U 0 0C?oV20S 2_c/_`celyU @ v 0P| e@>_Xy(00CS0000&UP a0P D\0S  b9V7i8yB`PW<UU S & 0%S @S, B* Bg& 0.R> 0*0v_P6 00Zp 9@P  0A0* 0ക! P9hVx00F  ASz $c^;ctV P^xkd(ЍO Ѝ/B^<]s!3@th,;%ɜv0@-CMlNPP 0S .QV@P 4"_Cߍ0 P_ +ET+FSG-p@ 堐堀PB`AT:00Z W ,/Z 000 UP EQ 0 @}%DA-`Pp up@ Xf ,p^ P.@+GRA-Plb@ibopl ^0S DQ0Q.SP @$ $@Q Q 嫥娥~@Pcdd0S aV:=80$d 0w-B$0B. ._  A &_0`Q>d0 ]@400a0 ,]P40,   T~Tr @W R?0 2p0/Djp |#x3 R0:P$P oP @0a Xp] `]@P  Z]P@; 1sS1lSD;"00`&a`P QP@;9b@P,C]*0x*0wr!bP\8 0\8TY0 yV *0z*0}\8t*0|[\:VT* Q0:$DR@* , Q9ʟP \ʟW艟^ 0/HU>H B0C   PT  z8T@Y RU0X649 @p A\)0p 0HA9ip H0S[, ,)A0$$ @P @0 H0@H0A ip A`A`LVp@fv! d! HdH p |P p0 +\6S 0 ?88k@P 5(  [7S #l7 P~L7'A/A\@P Gh@P 7T'TP\804'8\8P$G 8\8 SP0&08P 8H \8 4RP00 60&S\880\8P 8[80S X&8P 8[8 RP000S\80\8P0S\80\8@Zn08E010 ~g`P `P |`P l`P `P H`P 8`P0:4X:4SU 0 PM 0$AtP !@64SP  0@?S @P i[ 0{BQ0:$R##ßRl#p$Rt#W%0RT# U>N /N B0C   [0S1 -pP 2@T \ᩢXxHHup#0l0S T 0S `"8S!3S3 V\ #C?00N?C0C YQ`0  0@F0@`sFP;A??p@`x080C4r@,0,SP$pM0S x^Y0X6W5S  !KoX1SXF0S@0 <Y4!S< " 0 t0 Vo i+D%x%D%w+ET+< ,oQވ+FS+IR+J+J+=+I+Ip# x+GR '2i7+K#Px|y+JV`I<E6!3Lg%i 1Nk+GP+M)Db0X6S/+ETP 0/x0A-鿏P@,Mp _P3S0 `0 0` :00 0`@0`00Fo/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ߍ|@-p`CM|@^PlP#d0RXPP @ W<0080 `0(PCߍ0+L+H +@-@ @+@-0  0 P @0@ $280 /P $  mЍ+H Pd+J+"0@-0@XMP70  0@ P x x0xP t0E@10/Q   LL B1 0/R@, ,@8Ѝ0+ET Pt+H+J++H"+@-MMP!^@P  /Y +Yލ0 00S@\0\ \y@P L0 (0< 0, +lވ+H+I++L++p@-bCMX6S )P \8lP'XT20S H2\6S 81020"(:2PPr m10 `]:4S / UR\@aU T10 G:4!SO *00 0 B<x9||2@P) ;1l /\,T)D&0S 4!4,!,0S    1 hP \6S U PCߍ 0 B+ETWP+ #+GRi+GP  -+Id  F Qy|+FS k+IR ;j +J    7  0@-P@ T\ ! 0C @TR 0\  @B_TQ  S"#0  @ S! 0  @ S 0  @ S0S000S\RQ @  Q  G-p@PhM 0S'phЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/0 PQ0//!01000/ 00#0//O-`$MPA@T 8[ p|WP00 0S 0S0S$Ѝ@-@MP Mp" :  *`p Wd5\\ SS=S 8 d3R 0 ,0 ڍ ЍTT  G-Pp0@0Mw'PP ]`ĐĠ0 R PЍ 0L03/P 0 0Z놁0 Z  H1,0S P HI HI`+ p@-P`40@0S 0 p@,Ѧp@-0MQ!0`L0 3/P< 0t@T 4/@0 00CZ0 >Z 0H,0S HPI,0 HKIT `HEI HAIHOZ0S0CH ,$H K,Ѝp+ !3:ϻtP P00 S r[S, R ,0S R : 8 80R:P#3///@-M`p@ 孌PPЍPP @[PTP0 pP@$U@@T @ @cd0 @mP   0S/p@-P@ 0000p@O-p@P|M YyP+`P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p`H`P 100,`00S.0 0P1<00 m0apP <@D<-@0S sP 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0,0 0 ,0 [d XH@-[ P 0P 0Pc PQ\ QTaPQD "P 8040P/(/$//x$Wgp@-8@Q 0@P@DPp *Pp%xp@-P@P  +U G00pp@-  p%x@- | p%x(G-`PzM@PN/\ U0  p0S1 0S@zߍXP# a,P@l0 1h0$1d0(1`0,1>1S$ FoP j?%0`J?\0S \0SAT FP rYP @pp̐( ``$`R PN H# 4$0{Z  4 UP 3S7 lc [ [0000? `܀09Pu 0Sr'S  zσ0z/76`  `L0B(QFo 0C Q> 0>pP lP P  ,4101PŸF "r`W2P  @000@A0t"@0@N?@@T@0S z?0 C,4101P刀 "=0!`&J` l[T If[000`011!10100%F! $ X8a4p1P,a( s1S%4 ∐0! 0A 0~ ,001 "P `0  ,001P "`0\ yu  WfuD}+NQ 0%D  '`Q +@-@M`p @@ 0DpЍ PP  l@@ 0DpD<@P 7/Px!3@-0 0P Ѝ b@-0 0PЍ bO-aM,MQ0=@PeP6 X`P - |WPP- Vl"dTb+"ELbZ+bE`VP@``Vt aV+"E+bE!-P P&0 Q%3`VK0$P 00S 3/p0$aHbb>0Ep0 S aݍ,Ѝ\QQ0GoG`FWP 0000!9`P 00S 3/p003/NaV $P 00S 3/p $aV P p0 PP pxb.;9/ 0 PPpxP;".5/0 #X R1   D NR0 0qP`lqllV b +PPY  DqPQy+"Db+?"PPi WP# WP WP VP VP VP UxT D  DP (0q` Qx$++8 : =tT  >00C-$0pP M`A@P00 P > C 0 1/PP0@0 @P@00003/Ѝ003/$Qg CO-PUMM.dx`@4PY.zYQ_$H kRWpWp$[ Z T   70.07 00P00@\#Pzx40([Z4S =U?h400C2(7\4=1 W =6h400C26\4=1 0 00  000000pp  y044040s -14s[w0 00 00000 0zpp 0440j40s -1tPw003 E "Pt5@ UݍЍP =2 (XL=1຀P0Nc ⺀ h \  pw00$?00[000ӧ?&N?`/'#tT4`(04@ T<40S N?/$$D4pW84 0}10  A P "zP vP04 1p$ ,01(.8,4  1A  B6T$!0(!!R)!04 $q ,0(4q8,$1@ Spw 0 0r ^ nWl <В@p "s 0H$10!$+4Bd|2P p>{`{ $107 ,$! 1,0: 0G80 ,! 6$40`040+,;% ,Rt%x0++8+h+0+D YPP  (00/0@o//BO-@P MMAE0*!Rp0)Q`U0 $0 >  P  Pp ,*(0$0 $$(pP l4\,Z ܍Ѝp @4@B40Spp0 @0 4p0SW00y , Rv  000x;8,9/Pc 0  x08,;Q(d \bx+ W ]  l s zܱ   '   *  z          O-eM0M*Q8U"U&D'@y&u l X p&0 h0T RQ @B@$Q )qWe4p} nP9 FP ' P : @P) @ pH0X 804pR#Pp< P ,U \@D`@ O p PU    T0S3   0S # 0P000P FYP #p40 80 P 0 0 ,0ST0 S00 P0 40040804 0SS 04  0x; 8:/0PST0rԢr S S h Sb  SU 0|tr t<0QP<0PLpLL"@ @ 4,RP Ÿ ,0$ 0 ( Pd 1Pp QP0 0ꜱ5S0+^Lx1 pG u 0R\0sT < j@m%< 00 014s10 5@*( [%Y%W%0S R%P% :EލЍ+ 3i(+D 8 Q l 0 b +E Q@Q       # +y*  K r zIOU^eO-@BMTM\p P`P f @P`T$$ [ P```PP@BލЍ؃ГCг @3 (4@$80DP@<@T@ \  * P  ` " 443 0 4  3 $0( 48@YĒ  P   똢嬂   x2 08@h2@DDAT T2T"TT#P @2 <%PI02 ( ' 20)ATp !0   P& !*%0 Zu#P@0SW K0S0@4 000@0x;8 8/P6  %P !\%P 0  { @$$0 m@pW: p@xn } ox opmx+  3+t(d0(0p@-`M2 RЍ!,^0P @40 PP@xp0 ;87/P  PB+N+P $0@-"@!Q0(@+N@-$@2S 02+NO- PPPBpPP   `PP `NP@Ft$र@`V*J ЍD xP P    R0SP jpPBND%D@-@00 qP Q P 0=Ѝ XC-`PJMM```p 8Q@4PTaH$P`VP8 Yo`GFWI 0OP 0 000!00P < 8<1P#<@XNo<0S0 0< 8`PU 40,01@ 01A010000 h@@@@,x@0S6 0S'8JݍЍAT\P0 8 RT<0$!QQ@0P 0 003/@#S0 S(0S 0S8dn(0S003/@#S@+8 [ ^L%y 0S/p@-@P` !a(0SQ 003/@Qp@7 R 0@-Pp@`4M0S4Ѝ0 0L03/P 0@0P`180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> o; 0@o/b 0 11/+T10/Np@-@4P0 `!I1111p+TO-P@p`АРа0* C  !0  PP0+S   +S 0P,SR0B `p@P X 00,0` 00000 Ѝ+T 0@-P@M*.SP1( 00 0d0@00 0T0@@@81 0 000@RP(#ߍ0 +TO-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+ { 0 Q{ 0S  jH0 0P  P 0 0H  R,  4@T  8X $ T\ ( p` , d A- +R 0  P > >܍p,F 8 FA @@PP@Dڸa <UPP?8 1!}8<DQi \1 08808@TT OoBQP@10S nt < R t00 00000 00l0pP@ m(t(0@C!+l+H+I++`0 yB8 4++p ,O-0EMSP;q @ c 0!@)0`SPW!000 @qo@3/@P EߍW! 000Z 0SX 0 @KT W  00 0  0S h00S X  L0W0 ! ! 000+H+J+t+0+T@-Q@0  R < 20 000]Ѝ-S Q'O-DPUM<04Q $DŽ D $ ğ0*S^P3s0胟C0`*V`1# 0SPKBU@c A@ |~PpJP XsTpHm@1 U$c  P P $0RP P G^ 0 10S 0S< 0 1S800 000S MP+0pG00 0%2GF3V!0a  0! 0 0R R` 10 1000pYR `0,S RB  0 P a+S  *SPR Uߍ` 1 00000000 /UR U@P@T Tt z+,+%y+TT& Q%*IS,;,;@+HGZA-Ph`hp@TUSU /P  nP`%htO-@MMp\@ @P HrPP6P  M"@ڍЍ -rP %rP )P;PP PZ`P5}*b Cq0f? ;P0=S@  > PZXT #P @P  5ꤠ刐P@ @P K@ &wt-ij*0p@-4 P@B0 Pp@@-G-`P4 B@T$ `V! p0F&04 p0RSP pPp Pp40Su p ;Pp@V/0 R/@-p`0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ PbBP  p@+@-@ q(o@lA-P@p`p0S 0pp R\AY05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-0pЍP@`̱p `ᾱp W Q 0៨`IVk0 t@<T  \::PLmP <iP @WfuD}0@-@M M`p;@ Rp  PpA`zA`tۍ ЍA-@P ApP` P  0QPd| @dz@-@M Mp;@ `p P0 @R`6VA`ۍ Ѝ Ade1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP":00/00/4\80S0 S001/\80S  00@-\\@!SR0(SS QU S!0$0S\  0yX1p@-S@!0a408,08 S0040803/P,000403/,, H0 , 4 T 8 X $Q  0|P!SR:pSS P Q408S Q0  0yX40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 Br Rt0! 408 00803/P,000403/,, H0 , 4 T 8 X yX000/O-0@p 4MPPp`)04ЍO$0 L03/P Ѐ0 P p!ФZ [H * R T Rp 98``pp 0S0P 004Ѝ, [ 0+0 F H0L0 ? H0L0 8 H0L0 1 H0L0 * H0L0 p# H0L0  X H0L0@ @ H0L0= (tЍC !SH00000P pG d 9/ 000(0g0+gpyz{}~ d  0++ D , X - <36=DMT`hpu C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``g0 0pp07/@-M0@ 03/P 0 00000 H003/ލ@-`,MHP 4@0 0 0PP@,00 RS THP pW ~9P00P00P0,Ѝ @T@0/W/0  0u4H P00P0%DP0@-$M@D0X T 0P 00 00a0P1H0Dd$Ѝ03O-%,M@PU \sXq pPnpDjP`88 ,pVV !R "2 V pP P`!V$UCb$U p 0 0 00 00 0% 0MPP i,Ѝ ѐyX~y C-40PS,M80S,ЍS S S !S S 2@P `p䐟`I`X 0 000 00| 000 0 00 0 0M2`Pz+y P O-P@0p(AMP U  0唂0 `!"00(p1 "UP 4P R300 P xP %0p0P0k[@e0 ` @0ABYA0  0|!CO @p0  T! -E P0  ,!D;P8`6P@!@3@6T -`|:T@D@`0@@< 0 0K-n:0 0@`0P ت. l 00@` PHAߍ #"0P0RPP0++gpO--T5M0 04PA00 00|PPPh0S8@P 0P40 0H03/0pS,0P p p0CD 0@P000P`鋟@0 St pP pv0,01v0(pp1P !r B B%2":  R B *9 90 R80pP0 R#,500y6000Ѝd2R 00@D0 U0 $0p0pC 0D@D0 0Z@  0S0 S,0000A4<0X ≡0L0 3/ 00X00=C0H04 0.$x"U 0S  T0Pra0 000H0P0 F0PT0S x0P 0S4 `Q00Q0S 0L0 aA3/P ̐Ƞ0 &003/d``p0F0P *@  0^. (0Y$00(0 S$0 0R0$(@0D 000 R@ 0S8X$a`v 0"0)000"ꌒ Ӯ0 ".0 xxʮ 00 .0 @⼮0 .Ȑ0  Ხx0h00l010h  t0pH+ + H H0` S*pV 0 T` U 00 0hT`0 @T`T0P0#0 Q030#Q0S ,0 A, 2Dfp0 $&(= 0 PL02/ L0PP`P+VMP S$0 0I(0 Y$00@8 C 0 1/P  0R$LH R>0$0 R 0S P P 0$003/0$a+$0pQ@-4忻㨵 #"T R0//@-(@T@Ѝ0 HD0 0003/@P吻y/@-|M)PP@" @a1!@p@P  *0@T@pT 0 @p|ЍT0| dp0p p}P P D A *+HQ++ /@- @@= ///@-0@Q0T@o?0 \ 0P000@-@4M0  +P0PU(000U0 00  044Ѝ0+//A-pP@`|VT0S0S 3)PH0P$1U(0U0 00X0`p@+\R0  /p@-P@'<0Q"4` 6D0# A0$!Bp++A-<`P@(Pp( $ A+@-0@-AM w+0 h坺0S XPP0P@0UU 88 0< $8Aߍ0]^a+l 2P1G-1`P!M@PM/1|!1x  pqpqzl`PdLs +H0 [!ލ َ@P Y>B' #@P 0=S6'!>A@ >p@5T@  P 0 hPP L G<  W3EҊj ]+Drkyt1s@-1P@,PM/1\`\ 1  L L P D  00,eЍp+D3p@-0M0-000`00P0@P @T 1X 1T1D 1 S9P1 1 Ѝp56 0@- P +KC-`CM P@ `g*P pܐ܀0 `0`G0S1 1 Cߍ5S % |p pP\ ``X0S  @ 810 1+l+k6+ :KZG5Qp@-P@#1 1  p+17@-@P屸@學 0 Ѝ0@-p@-P@P P.1 1 p2p@-P@1Ͳ1(1 P.11 p@-и@G-@M,p)T+R@`r夒T5 TH To20$0@TPp"pp0`pDBpP0Sh Sb  @) 0` 0P@LP 24]PP ލP :P !080 0)P |!0t1X 0 , %, 0Pᴾ0 }% nX,1,1L0c,a,0!0P PM?00P0@ ; DE`; 0 0 0F& 000 p 2@{%+++k+l+ +/2+D27S3,;,; ,E ,A-P$p3f@P a-@T ( C"MP( 0 CP  0, P :!@oЍW\\h P< 0 i+Dk{Ҋ1ah//O-0:{4`~@T Ѝ@T@T& ^$ L U [Y [Ѐ XY P{ UPE P$P @ $@ 0"/+ O-4Mp(t \ ZX0,P@ P @R00d``p ͱV0 0%$0 V0 $0 QP0@P@!0 000 0 T000 Q0#02S4Ѝ;0 0Z   R& S  P@ 0    0@PV0V0 #0 QP0@P@ RN RK RH  R ࠡ࠳ $(, [Q$[4TT [ 0Z0@PV0V0 #0 QP0@@P 0 T00T Q Q0   }(0@-4MP!!0  P PP@4Ѝ0@/@-@ :@vp@-P@/>P `@ H0P P `Ra BQQ pQQ 0@S:p @-H⌷0RH #@-0@-P@04MS1$! P4Ѝ0 P*   P +0R0#@"*S Q 0R+0p@-@ ^T00PUPU' \$ST ^xp 2@Q.^U@P@$ @  $  0 00C 0p0 p@-,@P&0P ;pA-@H`HPpFT00ԗ@"T01 PS{+ 00S@- /++hC-麋XP(p,`3@( 0 XWaV|V T0   ƺ ЍАYĐY R  U:0V @ @T0  奺@-@P 0  庆G@D|0@-0@S~0d Ts0"S  @0<00R( T40 ++ +G-錑P0`Sp@Q 0Q02@1;1':X 4却pB 2 SBpPTPRTP  R T R0S0T0S @00 00(Q $"p Q 0S T v! 0@1 00 00T"1+up@-P@mP000p1O-0@Sp`P 0 PQQQS SK0UȰБ r0 0 S$0 0 "60(Q $8"p0, 1QX#  E vQ 00  R [ R @R H0H H幅 R# Ѝ 0W1Q:P +3|p@-P@P0Ss!U E p(0"E0P4 305050 0(2#p++ +40@-0@SYDP0@Е+{XA-Q`0@SG!V V p0耟 ST  4V(Ѝ0 PP P4p00 0@0$`p0T !L p\ P04 `0'p(0,0P(+++ 3m|1A-0`Sp@P0 PQQD R<0 $ 2  0 !rRv?000 RU (0$0X3,000 1Q\RP 0 00  W1Q:P0+K@- @Ȇ00S T $ֲ@Ѝ7@nO-X0MSM2"处\0@S2"`0Sb2"d0S2p"h0Sx2T"tH r0SLǴ8 80R[ , I0pQSPPSP7 @†@I`P- @ \00`0d .0h X 똱;S/ʌ|!|@0剻P@_oƨRݍЍ RQ8 R 0:S 000a 1 0 0 0 0C0 ;0CS||yPp|.  i  / S j {{X  %D   ɜp@-\P@0SB Q0>q   R@Cp+O--BM MpX\0 @P 0 ` ;`( pP-H0 `P %@Bލ ЍQ 0 0d!>`q0 00!$0`4X00 $00 0v0; SỦ Ph岺P +RQ 0P \Q S0Rʧ0S R2 S - S S 0S 0 ˱  0    -P 0S   0 R$ ? ! "S0S "`Ade O-4&"R p 0O`P0++[ Dp0 d00\ `0h0|0 0X00 `$P`Pl0 (04H⍲000 00 00p;|H @-`X0Sg0 墂\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP0 U06 V Ѝ}0{O- 0TM,00(00P$0040 0{{ {{p@00@uP40ZYTЍD`@Q S S L0!401< S80< 80 " D40Q@ HS H L,$Q` D@,`\  0 pS `Sq0Swp+R ʐ10R02p1;1':Z p(00PCQWQSWQ 0S0W0S0G?o2P0S p2Ȱ`(,0,0(Q $p$0 S  0S G $v00p1 00 0"S 0 "ıW0S "S0G"1+uO-M00G@TЍpP`Ра@D0SW@ 0   0 0 `1/Y  S      Q R  0@0 00Q0 0`p1/P +|HA-Pp@`0S  R 8p0 S7/P 0403/P 0D03/P0403/A- [P@`p1S 3/P P`VUd0PCT0P0S@000S4000S(0000Ax}H++|HXp@-@4`4P0Sp@h10S 3/@++0 @\ \ P0000S/000 0#0/0@0/p@-P8@q 0X0S 3/0P  P  01 00080sp `^4Q Q0 0`40$ Rp `083/< 0 2 P   `‚ 0S0P000 k,00//00/00/00/10/Q@-@@L 0A0003/Pg@W @ tC-B`0pSPGM;0@0S80 Sx0 0S`)0SH"0S_0S0S00$ R"000< R&0pG d8 9/ 00 (0` 0 lo)( a0SW XP Xx X X Y$Q 00 00000 DGߍ0 00000000!t0Q0 0 Q0 +yz{P++G-Pp 0MS 1ߍ0L08 3/P H0 8 L00S4A 0Se0 0 0 0000P@T 4/@@1 00`0  0`hA0 R Z/0 00T h0:/P h00S0V0S ZZ?V F 3 o ?0!CZ? fh0 010@0`0*++ tO-PM0@0` P8 `(b0 K000 .p!ᚲ0 00"@!Ꮂ00p@Ƭ b@q29@x巬 0 `!rf㮬 @p0 8!h4夬(!(p 0_`P0 R   P;Ѝ 0p!僬0i `? `OT0 0-p @ Y NT R ` @0++% +!!+)!0A-@0P\03/ p`W@@P@P80BW  \W[0 V  0  !   0 00$ 1 x    l   C`  0SJCT L0L LL}0<D@+k h `o U!5}`y!i lds@-P,`@^01Ѝp+p@-00M0P,03/ , 0@ , S:000 00 00 00p` 0A0u&0Ѝp0 k VO--@M4(P PЍ ,P ` 0b 0<  p@W0H03/0SPpHPA0 0, 婰PP 0l, S n?2I0C 00A00000,00咥 ự0S e(00 L0P 3/P T\0PPXP0 S8hPY 80 S (- 0( S001x40P ≡0L0 3/00 P0 00006`0p0`0 0廦p`ᷯ@↣ᯯ0S @, 0H03/p,U@:@0 0S001Ѝ%<++ Vt Th0@-@80q  003/P4 04ЍP2 @-0GM0@00@3/PP$0SP `p0 000 `p0A0S 00@03/PPPGߍ/A-@xM`D 40Pl00$pp0Ph@P3 P p0d$0\ \+T „P 0X*0L08 3/> 016 0100 0 00pP& 0Ţ=p0S 0h 0Q*08 @,04/P,qP 0r00 0S001xЍ%< d% Vt ThO--@0lM0$3/0H03/2`0PTPqX0pZxV`0`p P` 0(3/P\ Ly"##$ 0H00 40R! H 3/0L8 03/p@ 0L08 3/PP9 0 R6  #1//L"P#0X 80T3/L0 083/p 0倰$0Y 00㓩.8$  p` P(;/P PlЍ +O-5P0MS J?0SWU 0SP5P%PPy`VJ @%@T dO@Fu5 050 500d @@qp`僧0p,|0y` 㔤8 44@`1  `40 0,0000 ,00幧0$10O0\$10I`\0@ pd000S< p0e PÁ| ,t3 000000 000 0 0@0p↤p` v$3d,0Qɤl0S> S@; SO@`%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS@` 0ST 8+@P$2Q XЍ@P00SZ 3/@@OoBS j0 06e10@!R|!@!x|pPptݠt0S|0X*@H@P TQ 0!@x 0T:x0S@ ,ݬt@OoB@|0xT:Ѭ@+!}z!i++ YR [080 U U+ Uo U+D!>O--dS 0UM8 :L40@pD kP f`Pᗬ UߍZ0P,0 P Tᇬᅬ,30 00S 0RC 80S9(1SJ!4J ,HL! SA <H@$+4<< 0@PؓPy11@T "2B ,04 P0S 3/P|20 SU@0%0cD0ps `2R宥M1Y N Z㣥 ,!L12HPH@"pPpT@句P +p @ 000@ @040奩 @ᨧ    0 坧 0 ┧֫40P1: 1 !  00 ЙPJ>00C0/S04!e+s S ᢚP+ g P*%P 0/S`0oo`bS p & 0 PV+t P*+ P*᝚P@ᛙ@]ᖙJލЍWt" QI@-V㰨@-M @P(0 : d@P Y P p m0#((R  sQSЍ O--M pP @P` WP`0PЍ R   0P:0*  DpP幐 P W`0    Z"""!G-|Mr `P`P PP<a+ J@P@U 0 @ 2(@P#+J{ J.0Ӭ+Jl  J.0TĬTX 㽬PP~D4 ᴬPPu$+JL 0J.᤬PPe+J<  J;` ፬PPN+J% tpll40 0J>P 0 .nP UT 8ލ⤙P@Y+J J⣙PPp0J.I@+  >P h lJ>7PR " ")"4":"D"P"!"y""" 4"""%"%"/"Z"c"m/00/00/00/00/0@-@0!$Q4M0 P\ შP0T0760 P幢 U@P  "4Ѝ0+J++O-AMAd2 (000PB(0 0000m 80sS0`p(00 00$0 0?00$0 s 0W`5 0T%P500@%`20,0W,5 #g5P00 0`000 00W D`4D 0S_ @X%SYeQ X:000` @@`~@0S 80< 03/P0p80<P LЍpv'80s @0D 0 0Q:8`0S}0L0` $3/P$ `0d P[ Tp|Gorj 0Wt 83H3 y0 D P%0C?o2000;00H03/W0A0 +0X`0  h0 00;000Q!{  (PS `p,2;0L082Hp ,1PP 0 Szn?2@|1 01Ax00 00I@ll咜Cx0ST(^PPM p(P01ᑙ!PS0P(0A x 0`R b ",0kx  Bd   0 008P0h lϾ(0, 040x0?o21000Ѝ0᛾ᘾm+ o @O-p@᠁堑堡,M0 S0 0000 /00㷟0S,Ѝ/S  /00`pPU/(ڣ`P p呈!ӣPP PP%0(` 1` 0 400`% ,08`؟01000  P 0 0  P.y`+QvO-P`@\M4 p儰K!SPV  0  [  0S 0 "pP8\ЍO*./Y Q0:0pQ ",^T ^ 08 +0p0000Y (0Spe p 0 R{H03/p` 0[ 8 r ǟp\   RpW "W  [p  SQ  0 p 0 0  0p #  p$ $P U p[ P P[wp  P PQp [t/[  R& 0!Q0 0 :p   SQl  0  0 Á\  PpX  R'00  S  G  00  RQ  PU pZ 4 Z0) Z$Q0Qp R 0R  R  0   0 0  0 \Ѝp0 0 ,4PP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P 0 0 , 0R 0S 1 pR $$  Pp $  P 0 Q0ppT R T  R X p( 0S0L0( 3/P <00S D0SS000(( } L0( 3/P 80<00S "S400 [ 000 p( \ \xAQx [[t8qpp W ebp 8p[  * N[p同  RR 8q 0PUp pv S R  0p0 0 0 Ã+<}++Q'O--`M,p#@PVY p໠pPT Pp0Z:`PU`J6ERUA 6&Jm00#h R 0  80s0`F`pHU p h0S 00  80spHY pPp h0l0 0L03/, 00Y:pPp嚡p0a0P805ЍO@0H03/,0$, ($08RPp0P(p$P<00XW:< R.*p,0 PQpUpQ `0 $0PS(0 $05(0$ 0  !SkS e0S 0`p8P0V^:40S00000040,0(X}$0( 0c2#$ + 08`@ <00< R:pp8`Op0< p 00<<) 8`q ,0,( 0L03/0 00 0`VV0$0S(0 $0(0$ 0 Pp0h   008,0,p(p<0yS 0| 1/0 0Q  RS 0 ሰ 08;/`0Ps0H03/pt0D08P 0@00[q*p0 0 `<080sa00^ <0 0RX04 pD R@ 000 H3/PC $ <0 %Q 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 000 0 0W 08  0 7400000Pm#]#+<!04 Q000p <0P80s00}  h0S} l Yy* 0L03/Pj !0 儐X09/P` 00040$0(00$0 0 0 R( 000 H3/P/ X$ 003/p5 0 L03/ 0$0( 0S $0(0$ 0 24000000040@0(00$0 0 0 0 00 H3/P<00`0<0p 0R04($ R ( 000 H3/P* $ %Q 0 0X 0T80,3/00T00X S \ $ ` ( d , ,0S P0 P  R0P0w00040@0(00$0 0 0 0 00 H3/P P80sb 00_ Q Z 0 SW 0 R80X T,3/00T00X0 0\0 $0`0(0d0,00S 8/ L0 3/P @0D RP0 RP{ 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQ;Pp`,0 0U::8弞p" 0S ! p0 SUpw`P p P0i"RTp ZT Ye:PpW00 U0#Sw p`Ѝ #"08,00,L0 3/P p开8 Q 08y\  WX 8P@DH P0   8 rp08Hp0!8p 40X 00 0S 0P*p ` %80s0 L0 3/P 08400H0, 00,0+$0T00X0pPx 00 80sh p Pop@-@P(M(0SÜ(`,`0P00 0F0  0(PP`PߔP,(۝(P(Ѝp000妑,(ϝ0,`(P,; @ R+O-hpM)1$AS TP T(!0 "PPPЍ0 @0> C 0 1/@P0$A Q 0 > 1/P@P 0U:0@!RP C$ 00S H @3/Xz$HLP`X U["1/"P, (06, (0;P0L0 3/P 00S 0SPX003/PX0PH03/0 ! P5/P%$%$)@0 Q0pPYIP/Q P, (01/(0, Q 3#gX$Є  0 2PP 0 , Hp0  @DP0 ᄐY80Y> PPne,0S Y0P p@H H 8LP (08/P `  ` @(08P 4/00@DPH,p\ 0,QQTQD@@@P QQ0p p@08L0P 3/P `00`00P80P 5/00P  P 0000000 0P~ 000$++04p80  $ 4+ D o Q$&#0 @-@P`#}4Mp@0S $ 0dL03/P #` 0 #8PWV`4Ѝ 0R00S0 //O-X`P@ < b"0800 c#  p 002  0 S R( 0S% p  q' R Q0 2T 0 < k+800 c"p0p00S    $0!0R!/S01/+!0 /+$1p@-S@ x1SP $003/p@ۚx1ؚP$1 0SO-@0`PKMM0((0DpH0S >I @0 0<0o- %#{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,║ppK܍Ѝ(`ؑ(0S*< o #80a&@@ ,o'O-`0@PMMhh,00p 0S ( 0R> 9 HG 00 0 <0.%#@~40kP`0V,p0U 0000000 0 0000000 00<p`ލЍ,,0S*< #0,0A#X0S000C0C0000S0 0,0A$P+ ,o@-@-0 !<$10(10,1P001.@-@0 0! 0O-4M`@(0T`X\d0hpP 5"\ @ @,0;/,0P R7P ᙘPp2CF p W 2  0 " ( 00 0妐`w᠙(04ЍO/P*4ЍU5p@-@Q- X t Ì ð P 0 P 40 Pp <0dp@P80 P<,0 P(00 p!$;"#$E%&p@-PMV`@ܒ  V Ą Ĩ $ \ Ř Ŵ  D lPŒ 0GP弒 =ލp`屒P00S 0`壒40PlP坒80 S80 V㕒 0X0S(!M@划 0P倒\0 `0S 7@`od0Ph0S '@l0S @tp0S@ @PL`Kt0P3$O$Y567`>9$e$o:;=>?@-PAMV`@1  V(  ǀ Ǩ 0D`qK0 @0S    8`V@ 0 P 0Aߍ(0S l 店@d,0S D 尗@00S $ 妗@!3)$O*+$o-0@-AMP@0Q* Ȉ  ɔ ɸ  0ő   ,q0`N 0S (0S    ,`V H,Aߍ8塑  q q0`N 0S (0S    ,`VP け $0Px 0 Pr0 Ptl0 Pf0 PH`0 P4Z 0 :!3t$s60S O-@MV M-Pn 00x R# S0p]娥娅qt8`  0@0S D` PN `  HPC  D|  vpW00(0S%⽖$Bf00,0S$Ⱆ$BY0000S$⣖$BL0+ 0 p0B/Pp᭠ C"U0S1 ` ` |똣0p⇞ 0S  X  T`,pYV "n$ D|`֎ r0`0"  ";2ލ@Î 0   0S  "| `PV 宎 0  "1 S ! 垎 0N0S @0S"@劎 2ލG <0040!00"=@0n$ 0DL03/00 Dp p q r0S |!0 #LD` 0S " "p8`Y0a x0QW < 80RN   0@ ".,@) 0  d 0R0Uh 0"ۓ  %^P%o&&q!33%zt%%w% @-x @R ; @0p0Ed㣭 @{%@-D @?000(0,00000d㎭ @{%p@-|A`0PsJMd!   021SB  ٠ ٬ ٸJߍp@0P 0 0PP@`(PVU@@ 0 (W0 0(0 00@0(3P(3#n,P0`0PP`%o./10p@-aPM,0$0Ps@!   0(Ȋ$1 SP ڈ ڬ ڼ h t ۀ ی ۘP$1P$凇PЍp 1 ,},0S$06`@VTPP 0 00 000 00P0s03P03X`@P`@o@<` @`@%o+    O-P`0I1P/S @(⮉0(0 00IV0SvU `P  ( 0S `P $ 0 SX2vU Z xY $1 0V!7 0  0\!p⸌L1D!Q$1S  0Q p $ (p   1!5:% 0p P o Q 0, ($!p p $ P\ 00 8a4Q101R/++L+8Q"0'"&&0S@0@-S@00 0S/+PI0O-P̲EM 02@T PP0 2P  |1S# $P| 003/P \2PX @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 ]pPP2@0S- $P* 0 x0D 0SP+I+Ĭ(%+w+L !++Ĉ(2A-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R(p1@l1@T@0SP.H1D1^0P@@T  @T7 @pW4dpW1V 82# @ R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0++Ĭ++Ĉ++\0p@-T00P DPPp0AS@  1SA+h++80@-P$4M0@L0 3/P T0  P   R4Ѝ0 ^ @^ T  RR""+ p0\ Q0/\ P@ ^U Q0000@-+ 0O-`GMM40X2@TL2V 00 0 0000000@@@@ ~0hop@c<  M G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 t0@W 47 `4|R4 VH0 <0G, ,,L+8o ,+0@-PDM@T P08 @\ 0@  Dd  30 0DЍ00S+0@-@DMP/ P0, P\ 0P  0T   R X  0S0000000 0DЍ000S+p@-@Q`P@M<E@P   T0 0SP@Ѝp@w0 @00 D0U@Ѝp+17@-@SW   4 Ѝ0!'|P4PP<<0P0<0P0<0P0<04PP<0 S, 0<0vP<0 S@  0"{080#{0,0${000|@-@PD x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍp؅|@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P 0 $妯<  <U~ ,0$bP 0|! *|Ѝ0+[@-80@SP`4Mc00 0҆P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0 (P;0p@-PQ0M0@$ 0x`0 6/8 `Px1:x1a1S0C€10Ѝp(Zp@-@P 0P  Pp0S@}p lP ҉Pp0S 4! B! WP  彉Pp0S hGP R 0L 㩉 4変PppI(lw(|(((O-uM Mp, Z-H0cS_ C+0SS9zB0S ヅPBԒ0S9zIJB0S+z2 P     P x2@    PP2 HD     Pa0x0001 @@K @P @ PHPP< ,Fh@ ,D@/1K 01R010|100P Pd0G}p@  PI5z} 0S10$1S10 0Suݍ ЍPaHPkPj1S |!R |㝧P %+++Ĉ++L++Ĭ+++l+0+P++Č ++8Z@-O(00S P  Ѝ䠈 Ѝ+(@-@PЍp$QU 0 `P PP> C 0 1/0P $1$0 0LH R>+80S @-0 Q/TR$ m(G-`@Pጐ匠X0r2%S80S00 00 S80S0|1 P S$1S00 0OJp@-8M`@8  QT P $QlX$00S U 0 |1 08ЍpP ᐭP P Q ? ᦺ P | ĭ CP +A-M|P8  U`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 p`XOH0 803/PDI0 ``p'!!p` 0 3/P"#"#00 03/p 0` L03/⾬ %Hp` 0SXpH 0!|1 01!P0<0S P L3/0L00 3/P @0D t0Rv`p0L00 3/P @0D t0R 0 `04dRP  w00p 0Sw`+TR2 (O-RMPhb  @P Lտ@< UPpߍP)  rtppf0S j<08 0(00,0 000040!04 04$0D0(0 P jeVpl op 0  HNV <V 0|V $xV tV +tp %tp u  sp 4P7 #P.0'% D0S(0 D (2d0{S  0 ( 0 0{ X@00#@#000@4(0 0 0{@@d** *҆***7*s*Y*J~*p@-@P} # #0S S `|動00 00$00(00,00p@-`00MOQЍ S 00W@0u #0$P (0Vp  P0W D @0W  kW0S U0ąA-P@\^ ,,Mp@-`P Q@@d`Q8M2"€ 0)r000% 0S 0L0 3/P 0  ** +"+s S    "S 2006 L8Ѝp+p@-@^P8Q @ 2"p282w@-04Md 90 J<Po@P0 000 S0 !0Q "<0?020 2l00 2'P 02020200A4Ѝ+,M>p@-xP@0S0S DLR00T0SRD0  p"@ p++08S^/++ݸ p@-@ 0(  P0R0PS 00Si ppC-@NMMP`< Ѐu%@ @@0 ` `o@;@ PPD ``p^^ NލЍ)_dyG-xM` @pᜠ壐%P@J!0@P 0S PU 0 R<\1\!\\e;00S 00" !PP0 0S0L0H 3/P H L0RPP T 0$RP 00  x@ 04/@xЍZ Z Yd   ZY < n @ nM, ,M(d$ :A-P`@+ p P  ^ R Tl000 L"̠"Ƞ "Ġ#, #( 0#$0 0 << 0+A-pP2uoSvwO10000“R\œqE ᲀL ȠA- P` \V`` 8ž\ @T_g @ Ƞ̌ @Č @ B@ @ p Ƞ̌pČ P@ "0q1APAA m00@V08B2P080}@ T\ 0Sp`82S @4008 o2aq0R @Q2T0S X 22040TP 2SX,O-P`\M(@4000PS}1 0\  \^T 0SQppQpW X@\ЍLfb,0(F0 0 Q00 P PQTP Q8b0 RX3 0pP W P\ T 0pWbV0V0N21 SR 00(040,082S`40!$02, 2S01  $ 0w PBE X2p Q R @QT aB` @V ````Z R2@TP@@ 0S1!`02#38, R(00XL veI 04 ,0$0oS0  40"0(0(Ʊ@P4 80  02 S02@0S SP =l@hD0S 1H0Sp10S 1 S  o00(@\P`` 0ST0` ``72 P B!X,0,-7TRTJpl,MO-`|M40H@p0V00P8(M7sPV75|Ѝ0P }00UQ\P Q^2140 0 R X  Q000S 0PSV7 000 Z0 00 0000 0Z00040 0800(040( 0$0 0S0$ 08BVx6u?v? ( R BT@2,0q? r?(, 0 s?0800 S 000T0S(00 S$00b < jP< 8V50ao_P0"H`0S SP )k`T08 @}U 0 o?0 R S: RQ  0^.?0o_R1P2# 000( R$ 0C 0S %,02, 0HI`0S PS j`BC $0$0 # R 28 0C0 04" ^HL00^PT00H`0S SP j`Ճ0T2S2X00diP (V"? 01@22aUV 00w?2" S0 D    0 @D @09PD 0X0@HL0PS B D 0 20 Q0 $TP XX P T04"o0H`0S A<SP /j`Z<PR#3P8 @001@ 2S 0238S0Ro_PPUPo/ @T \ `TV R& \ Qw?0 8\ 0 000( R$ V00>-~,M-+<UJpO-dM⋐@Yp` 0P 40 PP;Y dЍ003/00S 0( 82V 0P" 0  P 40<P "#"#0 0D00 P 00SY0 0 #1/P0(@#S 0P 0"P25/  # @1/0+|HO--:0aM M Q@ 00/;۠`PPaލ Ѝ uYp *H6P:0@ r,W 2S 1S2"40u    '      0S"?⧻t  0 d T L pbPdRUW , ( $  , ( $H L&RQ  01Y!)??  @ 0Y!)??  0XfpP  @b?XT D , .bh?X T P@dTR,MUs@-RU0 3@7`d0T `Š#+ Q H ;`04 oЍp- ,M-s@-@P04P00 3o0S  `VRUp V0P 003/8_o$hV hЍp@h)0 k,Mp@-@0AMP 003/00; ⚟pP   f`P  VgVAލpO-p0\M0SQ `sa8Q P0/g P0b0@>S@ P0g P0b0@SP0 0LH S  0/ 0//Z[\ Q @10`d! ἐ 09/0P@\Ѝ+G-` p0P@LHR0418S ^ @Z R  `0 QX0?Qࠡ࠱000^ 0 G/+>0@-@0M 410810! a0 P0T0T a0 J0PU ! 5/Ѝ0+M@- .HbW@ U@-門 *0 Wge0/%x@-<@0s V(00ppb0Co%\,-$M ?0 0 IV$Ѝ0-4M 00 000>P4ЍO--pMM U V " @V4p !pW(0 0CSpW$ 0R 0 ppğ $dD0S 0s H0SMߍ0S P 0Lb40S` #1e`#T 06 1㋟@0'*@{{JOdTd@00#fex3` \3R - BP  i BRڔ838C"B ,#0 f#2e`  0ß RSPS0B1000f"e$0 ` S(0 0SZQ=9 =:k{ѥ$2@\0 80 @{Pץ 0 \SQEA00 0A ;f#;Z0S;#;0@d^4#.P0%U[?;#; 0 #5;B% PX!'e,1@Q0'00 SPldQ !"%+0Aq,Šˌ0B%W5 d@0S00d d@0 00pp&T@YA.,,,, ,t[,t,_,Q0.fp}ɜ,~@!1 Q!'0 @!@k{H7{z`0W 0P  dP~@<00<`~|e0 d@ d@-l@\h@QRG-PP @ RZ700pP:<`X:00X 0cdPV@-P@`pP0S -S :S S  000`  0 !0P0 ЍU0S00T  KP%Dp@-P`Sp@  ySPSV@70@0pp@-P 4`mSp@  CSPyS@p@-M@ Tp$ ЍA-`p@T/  PP *P. @P0 @ R R0 RR00#R0;R0S Q \Q  "Q0# #Q S 0Ѝ0pC B 0 @-3M M Np 3ݍ ЍQp@-P@|@LTpvPppA-@Pp p` j 0W0 t0WpX U`0\0P P  0h0@ fcЍU0 0  P-0HXH`HhWt@-`0tM0F?oP2p@ pS SpRS@tЍSp p2SSp D0V4 - 0 Tp"Rp0p@- @  p{0 S " 0PUPUp@c0 S  0 0S cc0S   0 0S cc0@-@0  c IR@0@-PM 0@     Qp||*Ѝ00 S   000 00P0 PS0 . p H1 C-p@PM$MU `0S@PE8  ឿ0Pa00ۍЍXV700S @ Q@BPE@C0 00p :0S 60#S u@UX 1HHH@-M@ 4 Q0S\ۍ p@-@$`P`Pp0 @ `P0 002 0pj0p@-pMP` 0Qp@& vQp!  pQp jQp  dQp  0P < k p(XpЍpTt UQ1+  p@->@P`ypp0D H  ,0lp 0 ; pL@p@-P"R q@ 9 Q01p@@@dq ) Q02p@px0@-tM0 p@ = PpPP@tЍ0C-QM MM700ۍ Ѝ   Y0 @`V P@pP`A-`R(00Pp@0ST`@PT  Q*R@00 S   0 0S0 S *`P `aa ``0000`0 @ 0@ p@-@t @ 1<@-p0M0@M0$+pV Ѝ / 1SHA-P@/h $* 0    !      rD  #4S4 0>P&0 fPp0@ AW  g/080P040Ѝp@-P@ ` 08 l, >U\$( 0t 0 008 , D1pp@ H\Hp@-`@1:@11SP0p0@Tp 0S  00:00T1p@-S@\1S#l1S.RU9tRUpxbV:t`tbp1C`T10CT1T1XS`0X11C`\10C\1\1`S`0`11C`l10Cl1l1pSʴ`0p1Q2,P0C2bV`bDx2,P0Cx27@-@0 %PP" P1 0L1Q@8@ D@   (   )    ,  Ѝ0@~ Ѝ0@-b@ OP p 00d @ 1S70S`^P 010@  1et0D1/@-@d3'L0S  P 0800H0S S@ 'I I@-x!@RM Q|0 x Ѝ!x1SI0@-800@@c? P@-@ NP p 004 @_ Q 0 @1v-MM+ 0Np06S , ۍЍ;04@ 1%xap@- B@bNp t PNp@$ P 11P p1@ R  o&lwQPEUQ T`00CS`0 XM`0( p@SX0 X 1% %@-@T 0S g@ 0S %/%p0p@-8P` J4  :0 G0 P@p@P@  @Tp@p@-@ADQ:$01`%p4*0 gGPJT4*0 `V$: I0 ppp@-@ D1} ` l!1P @1R$ L  Ѝ@|%P P 1 p  Ѝ@ PU%P P0pP Ѝ@o 0 ,0)#90 -1S O _ 040VMp\ 0 9044M041 ЍI81<IIIO%xHp@-@hu D1-1P`PUp@ 0S%P4p@0s4eH@-p0@SPLM 0$M0@(p= 00 p0 `P  LЍUtP @ t L kU`  P10L12IsI@-@MPP` p` 0R  p 0 0 UV  Ѝ@;ЍII0P!LA-`@x0P P ЍA 0 00  ` 0  01PU 0" 0S HP ЍADT 0S 800 IP P ЍIIIA-(M@`K P,H`p$C PD 0Sr PuPUn 0 8PU,P A Dp(ЍA$d5 `$T$;080SI $0P   ! p0S : U6 A(ЍA U. 0S V  L0S p`MP Np,p RˑP 0S H: 0S &8;$(ЍA#(ЍJJ7JIII2%JZJ{ 0@-@ 0PHH0S$ `@N H0p@-S@P` 08PU $00P  t D1 0806? $0080S  p, AY p p@2:@-@@O-pP`@టT(  &P 0S!W 0 8Ќ# { 0 s? X(00U0X0S @ZGX   ^dJA-D1@@a 9PP` q`0 P  4 KphhMЍP& P P' P, 4JP5 P!! P0 0M P Pp L!d10B0P1]t tLHNp\ ~Pʦ2SHK JJJJJJJJiJJJK @-@4Jp X00@1 ЍP 0\2dKAA-p 0S0 00@`gAPP4 0S,p`l[P2sA-q`@  @P00Ѝ 0S  M~0 S   0` 0 pPdm`u @P 0`0P@[ e PP 0S $0$0> > >0S **uV o 0S U`0 S   0001  @  0S LAP0 S   0KgK~2KK0C-MM000@!0"Kp00Pȁ+ IP`pQvU07S Q0 S W X00d!h1}`P1 ލЍP  P " R؀ؐPU Z  0 S   0  pP 0 P1p  P  0S 0 P2KKL@-@+p07S@d0 S 0VS@k2A-`R@p@M PP U 700 @ЍASP"R 0S 0 'r>XU$  *P 0S <0 *< p \ <02 <V>P  *@ЍAL@Ѝ2ѦLLGLdO-@PMpP  P 08I ЍO9P `4001p@Tx HP1D@TD11D1Ѝa@P000 @@T W@P`@`   T0 00V`l`J@YD3L#`H3``Zp#3b D11D1kQ NQ@ 6Q`4Q`UQpQ xQ nQ 0S0 0 @| 0 P  X S 7 p 0 0S@i0 0 X S  pD11D1w 0 P `` 00d : 0( @10S 0@@8P 0S (00:00000ST 00S 0P 0S 0000S~00 00C00*LLLL%LLL3>0S p@- 2R0@P0U?40000> *0>0Cp/ǒp@-x1PSM@`("%@P+ T0x14!V@1t1%0 0`0 p 0%S  P 00@X@ 0S T`m`VPHf|A|ЍpxA>0S$ P01@T t1S F @>0S@ 9`t1S  q0 @>P 0  @  B.(05%p(4t1S TTTTt3(UU4UvU` 0 R/ 1/, 0@-T0\@0^0S\P*\@0\PZ 0Sk R0@-`pMP@G (0p``FSЍ Rp5 p5 :  B\ *R B  0L ;G-P p$qL1L!LW#W@14!<41Z`P(@ 1!0S0S0\,0 0 @T0@TvU@P0\400 (P p`P,00@,@0S  0 S0 0@@U31UU;U/G-@PЂ@1@!@@"p0`,1!(qP000S3 \L0Q  H7PPL0H0L0 \ 0 S   00S000@0`PP0P0 TPV`XU3EIUVJ@- Ѝ@- 0 ЍP@-0 "q@0C00Q 0S80@0 R    R 0700@R @ 0@00U3XU@-^000 Ѝ ^   ;@-0 Ѝ@-@P`p, 0B0 0p"# ЍbMB@p@-P(`0 "PUPUR PU PTP,PP@4P`P4\pQ@ U3q#UP@-0 !0TP0/U37U0P0/P@- 0  !#08D0U3JUA-(MP` >1U0@0$00 !0p@000 0<0S Dp(Ѝ8010C>Sd@( ( 03(00@000 0<0S80 wp @8U3nUp@-XT@P EpPV@p0P@ P00(P,000P400T0p@-@Pp0080<0P  P(P0PUHUHPLPp0 S   0U0 S   0U0 S ,  0U0 S 4  0U@-@@UC-@PM `rP0SY 00C01@0S D3/H2H"HH!(PU0ST2j0S R,0 S ,  003/40`0P4P1  P0HS  0  Op00S `Ѝ0 0`0S0`   R 0q   QRq  `  PP U 0S 0 SIr 0S Yo P0S 3/0s0S 0S 3/, U3U@-4 0%g$@ $p t@Ѝ%x@-`0$AMrPpM (E 0Tp@ bC@AލЍF U ڠ# "U  RU@@ C  4,0@0$   XV%d%x-@-   Ѝ Ѝ/p@-MMP@ ̿` 0S"V 0 뾿`ۍЍpѦ-@-   Ѝ Ѝ/-@-  ЍЍ/-@-   ЍЍ/-@-  ЍЍ/-@-  i ЍЍ/-@-  ЍЍ/-@-  S ЍЍ/-@-  ЍЍ/-@-  = ЍЍ/0/%d0/%dp@-MM p Bp@ P;00 dSV =0@0ۍЍp P0 4Qd%dt0/%d0@U%dp@-@PPN; @e\m UT V00pp%d%xyU@-@P=:?@S@-@p Bp B1ST"@SC@-@M  ᐾ  0 Cp1$0Ѝip@-PM@` w  0 TCp 1@ R! 0 p`Ѝpii$00 H0s P/0  ///A->PXMUV0P0XЍU700p@ `R0 PU B0>000 <0  ,> !PP> *V'@-@T5>@@-@T>@0Q/ R0 /RG-@P(M*0'0S  SP P LP:>`P $0 01 0   ˱$08S0 $00(Ѝ080 (00S # p`$P `P ⤱0 P 0iS.S  `P┱$4P 040:S%DO--[M `F/@P 0n9`0 0*hD1 U48#88 S R p 'S 0 S U  R P 0?D0a p 0L0D0}>D0 P4 000H0@@@3<VMVyiVV0@-@PDM QP@T V00p@DЍ0U  cP @0SA-p`P@MTp@Ѝ 0S P 0S0Q   <@P @-000Q/P1P/$0/0@-@PM  ᧻  UP 0 0pЍ00 @ꀐii~@- ` R@0$Mp0 PR  RU U 1 # ‴0PP  R@T!@T00$Ѝ R @p@@-@p !p !p`?88 Q, - q8A Ō8   "  Q%£ £    "  Q%£ £ /A-`P5i@P─@Ѝ ΖP\OOP0 qP ipP 3O-P@0p"S0W"SpGP Y 0@s` P700 ЍY\ T00W YT X0#0%: T X3#: 0\Sf0`xSmS0SD bS S\ Tn C RPPPPPPPT0 PT 0 0T 0T 00 0    00 `` 0S& T  ]60P`0 NRU`0S  G6T P00T0` %DP /0 S S /S/P0/S 0 S S/0/@-`RpP$M 0S0U00/R@P 0 0 0 0  ޭ0S h$ЍU 6PP, T/00DU 6VVO-p gPPx ЍO|=`P TT ЍON@@巵 Y3NgPP  rP9 0QA0 Ѝ N@ ᛵ`@ᗵp M0P! 0 @ k0p00@[   P 0S g@P!3WA-@P,p WN` 0e SP,pNN$` PP(0e S$EN0(0$0PPO-HP` 8HPi 2HPl+HP!`Y <  0c 0   ,:4 Xl?o2=y L QW\ bPlHPc GP GP` GP` GP` GP ` GP@` GPh GPd GPe 0GPe l HGPe \GPl pGPg GPg GPl~ GPlx GPfr  PfW ZP0&, P$ FPQPP0L0wGPpb +_pP  R2  R/ 0,PSP00,0%00 0$0(00XH` p @ ũ d൰Zh0PP ʎJZ d0PPdZ Z P<ЍU `P0040 00 0 `DE4pYePP$ 0  p` 0S:$[PBCP  0PH |SPp<yEP`6| &!xvaPPUd 3PH6P06H0P"800H0P80H0P7 00H0P70U> l5P0Pp2p2SS|PwH0P00qH0P70kU! `P 00`gxP@ `P [PPSPSVP MP tHPPP7H0P401H0P30+H,0$P,$H0P20U  0pHP9P H0P00H0P00PV 0U0F\ `  ᓯPU d0@T$(@A$oP[k[[:[YxZ/O-pЃ`P@8 P جP PgU@1L ЍOJB$0SX0 ,08 ЍO4 Ѝ3W[4A-p1CPP#H0 3700& 06T06@1D!0`00 0:0030:d;8O-`S0$M; @ 0QpP  8 Ā:0@10  0H 09Ep0 0000 000P0 U  $  Ā00$Ѝ%LL3,DA-PQH1`Sp51Sp:1pS> PC@CTC`fd6S?`Chfl6S@hCpft6SApC|f6SB|Cf6SCCXCACC1pPCC1pPCX  +P T0 ST2d6,`0Cd6+l6,`0Cl6$t6,`0Ct6{C6`0C66,`0C6O-MDM` 0PB F0 0 5 S3p 2 ;(0 X0 0 00+ ,㢦0 P#Z1H@1E,AP0`d68(0@≦P4:؍DЍp@0D,0@04CqP0/@,`6hv2d62`dl6t SM@,hCpvt6t SGpB0&h6l6p6t6t"&x"6688@ p458!(00P 00 R @0<   C 0 0  1 ө @0 R R R P\R p@Y@V@@000SS H3@ P4400  C 8y?o@20@0<@8@,0@p0n0P s00 R*': ЪPT0PO Z: ǪpPp@@04CP000#Q00Sw r뒭0 0;$ g$ @0 R R R P\R @ * @ l p@Ph0pAlq`[Pplq @ HvP 0S 0P  iP 0S 0P _pP@w@0 #0S  R OP W@0<   C 0 0  Wx0S 0*4 0000, 0@:s@P 8p`:^P@-,0, ,, Q 0 T_:^^p@-@P,0, ,, PP p^:^P@-(0( (( T0S<@iO_:^A-PQP0  iU0x ` ᰢ@T ᩢVp 0S 90S@`:3^_5p@-@Pp PጢPpT0 p@1@-0@T 0@0T0S@-0 J  _:^A-PQH2H"HH< T0@ pR0080D10 2T T's@Pp t0 t0 x x0R`5PP P PT T0R88uP `(|0 |0T T0RdPt05 t02 88Y`Px x0R p,0S &p0S p0S lPV &P`P_;^_____A-`P Pe_ỡ@T ᴡT0pSС@p@-Q M0  T0S0| PUx0d tPe_`Ỡ@P ᪡0 < @>  Ѝp_; ^__` O-P`@S*`"P!@03@000C>S`"P!@03@03$333 -3@- P Np @ p@Ѝ0@ Ѝ/R A-@P8p`B0S p/`A-0Pp`@S:0SS 0  RT R0 `V1S* \P a 0@DpR: Q a8;`a O-A 0MTP` 0 {&@@PA<!@ 0D1 0S  tp 00嗣PĀ 呣P 匣P 凣P 傣P }P xP xspPp 0S \ @p L61@ R 86p 0D1#?H00 &&'p H0S% S% p D p L p $ p  pw L0S p0$0M0p H pe t0S@0D!v01Z9:p M ?P= p@ `PG0 \dT$k圙Px$x p+ *` p.#p_<t p 0S P Q Z T  :p  #:p堢P^ 团PY 喢PT 呢PO 匢P 凢PH X00S 2"Q`` Lp  Fp %P /%P01`30  2p X00S1XppW@0h1SP,rSڕLp@Qa a! pu%P`V%P ps0S   ph !tpap0S   D mpT 08! pKpPE 1 R 0S  P7 Ѝ 0Sp po< a~ayI IJ7aK~Ha;aaTRbZs\Jxaaaaaa;b =aLajarat!3bb$bMb/b?"lp@-P@pp p@^RRA-P`@@pH0s  S  U@ p@@@dW0S  R H R U@ p@IaQ/p@-P0U@ST` L00p jP@@T:pb_A-P`1pSMBT  p@Ѝ hBPЍA!R @04  @f @p@ @bpV 0 !p@`P  p0S t|n0 0 0#40  DPmH SP   1: 0$<)bdbi<:Ѧb'b~b @- @0P PT00Q  ἠDPp@- 0S @0\`0S4 SP U \ @ m00p.S0.S`0_S-S,  00  ?RL"0T0 00p%DP `00CS`0p S00 P0S X0X /X8%p@-h1@SPsQPPE @p BL0.SSPP X/P H*P 4,P 0  .'PP)bp@-@P'U^ 0 pk70 `f70 Pa70  @\704,,)$&#  @       *70  %70  70 70 x7p@ P NPbZ((cccccc%c,c7cCcMcTc[c`3chcqcz 0(ƒ -\ tx Q^ ,\ ,@-QMM@pPWp000 j6QލЍA. !. d0h ]6p`0SPE@Ep 0S:0@0DLRccO--4Ml"Ph2 P끋` ( (@P64Ѝ0S  )P@ #g 0P@,p,$0,PGY \P,p0[.600 P,p, R P A6, R, R0S p R $6뾡0 מP p!6,0S0S ,P!  pr @P !!! cc P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-`P@MpVU:U 0U00E0S00T@D@@;V00ЍPW1"0$?S 0[ `W R``V?R0U  P 70 ə.0 IP0 0IV:D X0 0 @UR  ES`O-@`0p 1! Y*QP T Wՠ700 Ѝ%P@pG`  00T W 00  'P     \Eo p  ' U/U$吠\U0 T WPPT W\%0P00PPpG@`T W PpG`%D0S *gP @TP@@P@`귝/0p@-` (M00>0@SP  '0x Bnp0 M0t0 0 y0S00 0 0S0S|0@0|0 0  Xc40Qx0 \TT0S (Ѝp0 8P 0T0S U0PT A-`儂VPPFPP2X@p`E-1P 刂"20 V0  ۜ2PRp@- P`!p@ F? "P @p@-`@MpP! 㶜 (Ⲝ (+X( 8p!PU@ T700@ ⥕Ѝi///@-!M@ 0  U/PЍ00 3"p 000)00d!pxxD000@ 0T0V!p@D6 0 0" 0J!p+dEddp@-Q@p " Z101p@U1p@->`FMV ~0P0Fߍp@PF/ '9  0垔T01 0 `$ 0@P 0*>   6 ii@-@MP4@ $dP P@ЍEQ@-<0< <<v0SSL`///dF d_$00 Hp//@-M @ p000p0@0M00@-P@,M(  ḛ  1 P!p 0 00S p,Ѝ0(i8p@-@MP ᔛ ` ⏛   (P PЍpi:C-PQSM M3#T0S2"`V2"@p@"b0B01801T0t0 H00C@L0@T0H @0H0L00L0 P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0t 0`00p0H0 L00$L0T@120@ 2T@@D@@0@L0 X9   @L0  XH@L0   @L0  XP UPPEPP@ D$r vp`Sލ Ѝ  ʓXH@_Fd___ C-0`p"M 0 `` 0`$`婄p@Ѝ P@ `-PP  `` 0╄@p @@/0 ( P|0`PlJ (uᘑV 50@ T*00Y00q/ @T@F @-@P`DM p@  G   X0 U134  8R2$ @0 DЍ0U@ii$0@-@QM P Pp 2 0"2Ѝ0@-]MMPl#p@ P@P -R B00@]ލЍ0S0S Sz SS wR@T Hnp!@V@T@S  CRPS @@ @p`P -$0 Bp 80Sr S~ S00,0S  R000@0S  R00@ H ` 0嗙 H150H \0pYә0S ϙ01S \\[0S0 0 000 0 0pwPq>S Se  @gPa@PU a NPK 0H HHO@Tw?0SG HEM P N0<00S6@iF*d@-40 000 0(ЍF42S/2S00/@-@@PV002S00/@-@@AV0002S {b/F0S0&0T0IjT01 RpR 0S TT0Q  0800 >0S  p@[e3p@-`PK@R*Pp00,000SA/00/0KpcScO-ᴀĐEM@ pp %00KC'*PPJ d0S  GRW ( Q  R 8)Qh 0 00> 0200BS* $WW   00 RS90 T00K4 $`B\` D RW Wd^ h 0 \ FQ 8?$000 FR@' p$ R D RW0S <0S @FT60000<0 @0W0FS 80000t7 S0@0WW00W  R 8$R  FR0+  8$A 8⠎8$0 @WV 8    FR2   0@08 RG  FR3   00 0FS70 @000"0, 0Q/ `6 ,0d&Rj G0S  p (?0S= A F0Q 5%00 0WS W(0,q0 PW:@QT8 0, 00)S P T(, "r  PW: ART  ,0  00D0C00s W0 0FS900000@CD73S Y 0 FSM007# ҍ730@(1S 0 F0S=00(  (100@ 0S W02S 0 FS<0 0" ⧍20@W0D1 0 Z00 FR P0@ 2S_ P 20 FSQ0[0 02 0000[00 W00  ^00FSpt0p0p95SE 0 FSd0^  9% H9E@@6S _pp0FSO|0000x60|6S" @000DKP9:Eߍ0 0P0"9 ;0FQ -0   @  0FR000S )   0 000p0, eKcSc25egeY79ee@-PR1!W`0@ 0p\ 0? R1 0R00  0M 30 0 0P0 0:0 00P00;0 00P0060 00P00 ЍwP 0000t |0 00pS0 00zp0 000eG ee0@-`0i0 MSPp$M 1!ppp@0S i `*i@ 0 P` D1Q50 00pP%P4  ۍ$Ѝe%$ѦfGf'p@-`\@T  PP\C0S \0\08  p88 0 pu%pf?G!Ѧ,@- 0080WPP@ `V@ @T %@P  ͋00ЍpO-IM PpPHLL `PR Ўt%@P0yIߍO'0,0'600 0400` 0 p00,0 PS2 V30a2@0 0 ,0T9`0 P 9@@P5Iߍ@90 Px VT` 0X`0T90 4`9PfLG.@fQfa5ftO-@pP`Q`,R尰,P2,ES#P㔀U`,@ ,&^P&, Q 0S, & J`,P0G8ffRO-700"`p@PT:p ЍT  X ⢱00U *"0 p0R0  Ȋ @"90 'p 9  'p_^ @-RM M00`@PBT Tp@ ڑ00 0wp | p ۍ Ѝ0D8 &p UPU pt@- 80SsQ S   00 0PЍ 0SЁO-04MSP hPP p_0`8 o0  00 0@P35T0 PP0 00 0@P 0 $ ( XpP 0$,0(,8 4PP 00 y0v@P2 0 0S0P 0L0 S-00! \*""0 0P 0$0Q0  $ ω 0@ 0c3(00$ ,0S  S S0t0(0s $b(_,8\  PP 0Sx0p 0h0 h 00304Ѝ 00 !0PY @P0 0T 0 SR0$00S,0 )@PP,0$S S S0t0Q41S|0 2S000s(0 $(,8 qPP0f0fO-P0M@040`0`p 0 ''p'X; X8l0S,0S,0匒0嚘 2S,08`0嚘 8d6S,0t0嚘 x"R㌂0,80,0H00`2 S0d6S C7 0Hpߍ0 0 0(p (  0p 0 0 0,p (07 0p (7 0p(,7 0Pp'0z0,(04l0 40pl'0k@0!04,0 40p]@]=d:k,0 !P !,d ,hS  R0  P 0  ! 0  08, }R0 RP 0  B0 0  0 !P !0  P 00 0H0 0 0,!ffffgg@g*vlp@-PUp@+80L0pp@- P# Mp@ 0` 0 ` 0p@ Ѝp ` 0p )X` 0p  00D0 U100pO-`@p 0崀SPM$H` #000 0 0 `00`0! 0 `  $5 H 0 |A000p4H0D1v \HЍO <0 $5 '0004@0S4H000s$80405 S #00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!5 000*S:kG{{'{*z8 S zkg{{'{* z$u5 00H0S0SZ h W 0R<0S 0SX2T2H000s8040 P424 .P 28 (P 20 "#z00@0S0i m0.0 0p 0h`  H  P0dh0Ѝ0S8181a P@1 S0(0000S  0R`V dp`RЍOk0| ЍOW ??g<g[aygbgggghIghnhf hzhhhmhtI8GPA-@PT R0A 0p800  l R 0i0&P 0S <0S $4  y 4`0 y `(" ``$"0Hp00` 00`8 0  "00 0$008 # d0h0hO-RPp`@\M?P: H0 #3P 0 RT0l00 gpp h@@K p 0  0 @P 0x !X P0 \ЍL0S0 0@S@0L0L }`I000P H0 h"d2P 0 Rzgjzzz{4T0d0S  $Y P $[ <Y* y !0 D !C ! ! ,  0  4  <  @ , D  <H  $@(@ A8pL@P@T@pT {y :0 0(1wp00s0 10 `E00`@0p0 pRP00 0 \`!!vZ J04S1SQ0D1X0 UB7S@ DzhG\hiPiCi?DCigit @-@`P.0 3h0X T6S @d0  0    3  ,lЍp@40  zTiyl.hi |p@-PUp00CSp@0@ $2  (.000L0p@i 7@-P@ xC800  B`000H 0<0L008 # Ѝ0@ii| jA-P`@ c 0h 0R0/P3 0D1HABp` P0D1( A P     Pd0d dd 0d 0 PX $$AjjGjPeG 1e LC-`@ PR0  R $ RP608Ā p<2  i@ R PP  P0  lHD!@1$?'((7008 Ѝ@ 0jwI0@-@4MD14(0P 0S 0 0qP 0 0P0   000 0 0 4Ѝ00 w1  4Ѝ0@j0p@-8 PR@  90P   0,Hp@MPpp@jjGG-`Mh0 P@D1@!8 8C02s ,pЍG0|&@1 2s 3p PUP 0P`00P 06iH00P0 0p0  (0(10K#R/   P(] x ؂0 + 70G (PD  0㣹 0 `pPFLp  ppp0 ? ЍGR   0|qP() (1 (1  0(|!x>ppwp[P( p"(1* (> >Q  0*[   M ЍGH|  ЍG80   0S 0 0F ß Q 040 PL#000s  i0pPpq 00 Q R   D0 00$0C40 040800 8값0 S0&PU 0S 0p0x060L  PH ЍG`0Hl0 $X0  0Sm 0Sj 0 Sk$H0  60 <`:0  @ R 1@ ЍG X1@P 0 Q0 0 00 R+ $0 0@00 S( pP   fPH  嚁00h0dp0h0 \0 R: 0 00 0S_ЍGЍGI jjGjcScjIjkpp@-@P (h00h00L0p@{k00p@-80@P  Dh00h00L0p@g &i0kikI\/ R/ . d0S  0R/>0/IO-0M 00PS㴠 p0T @R` 0 fЍ> R*QP 0S D6S<ƙ Hƙ[  SN/  @!  Q 0 S:500 0 p0 0 0  l 0 S 0 0Cs0hh0S0 DS0L00 !p 0 3 {00 0 P0 [ 0S?60@ 600 0p0 p0 ` `P @ 90 S\ 0D1  iP@5P P0S0 0<S<0P0B!0 0 3 {00 0 9P 0S6[[0 0S40S;0 4e FPP   2l00 0 2P0SS 0KSK?3 05 0$h0 :[ ti0 P<4 @+SS  00Cs00Cs0 > $P 0 0  0S  0  X3@ 0 R@ S$ D ;0<0D1>0; P0 P4 000 000 0[P00S* GP )   py @ 0]600 0<mP0  0S * jP #>  pKD1 T000H 0 000 0=0 \ 0000@! 0S  0 % 0S S0 uS 0 E0Sp0 00 P0xPb0 ;[ P- l m'kkklll'l3fLl>l:lxlNIllllGaylllmRA-P@`)- 0l A`0R- 0 D0BSpb ৅0 AmO$mrO-`Pp0圠0 01@T ЍT 0S R T0 S> R * OP  0 T@mC-,M@P`PP Q0 ,ЍCCPE jUNp0@SJ 0SG0UD:p1S@ U=: !R5 U2:!DR/!CR,   $   eP` 0QU q `q`R  NU r,  <,Ѝ  B!B00Gmm@-P` M\@p0M000 Vp 0S LL  ۍЍ 0c`V \@T$ѦGp@- P@3 P<p@0S0p@\0Sp0p@G@-0p ;M4MP@ p`@ `0堄0<000C$00(00$0C,00U000`$0 @`c0Gp bݍ4ЍHp@-@PxT  (@1S pRq U;02p 502k02p0S 0Sp 7@-PX0D @P 0S>0P 7P7;020C0s0S0270000 030 Ѝ0@}oX zgjzzP;R, @ 0J Ѝ0Dzn0 $0 00  0' 0 p0S t;00@ t6P  0@R 0 0000@@H<_^.xo\o{s@-@T`Ѝp`PV08 :*SQ h0S KXH/Q$` P (0R ,0R   `P 800000( ,0@P:0S  0h dd0S  $0R 0h0d`0SHϵoo0S/0S/   O-MPD0R8<`@H0!R00ЍpP P0 U@ UP R R R0 2P!4Y@PЍO^ p    @@0 0& , 0 0S SY000000000Cs n@UЍOeHI_^0S/C-P@$M T 0p `! 00 0@00 @d@$ЍP/@-@TP@30S   0,p@-@PPP "p){PE 00p0000S0p@00:S 0S @\S000@:S @, @%DP/:P@-^@S :RS:SP:P@A0 ^S:RS0@S0/%x @-@A0S :^|^  ^ R S \0L:\\ |\ O--CMM`d4!SP I SLEpWH `0P0B@ 7P~ 00p@@3; 040S0 00,0:= zpP 0 R0 :R00Hd400 0p0PP u0S  FCލЍ P ; 000P2PV%0 00{vp0PP@0S!+ 0P R $0$0SG >~@ :~@P `P00 P000 SWB p@DW:SZ @\Sp S Spp0 0T:C P @D 0SS Pp0 0@0` Z@S 0#SS `P@?0U u:00h00>P0 0Q :Q0, C B  RpG:R:   H J B[$0 0 PC P[P$0 @D pG H  0S A0y @p P D$0b$0 b0e @E 0S " D0A0 0T*vP 0P:SZv, @%x 5@-0  0 Ѝ@-(@ P K<0 0, @0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ s0Pv Ps @ < Q0NP ލЍ s0P P 0@P;0 PP U L-P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0S@Z\R    B{:R|R  , @%D"@-@DЍ@MG-p= @P@ d'Pv| 00@^S0S:S^ `00A\S`0S:SQ 0C^ 0@0LT1 0L\TS`ASBC\ 0(bC|^0 0 0 0 R@Ad:PPd @0:SS0AR0@A P Pd : A-p= `P@ dPPd0`F| 00@0S @AdPPd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P P, X~G-Q0S`pԑʯ  PV00c `a  jP00CS0: Pp0 0 S  +W00S(@ xP   , P P00SW  X\00S 0 47σ,P R   S@T P R  ` ЍR , X, , `@0@-0S tP [P, X,@-@RP08G, Xp@-P@PPp9Pp, X@-<P  J(0@87STЍ, X,p@-@ PS P@p p@-P #(0@87STЍ, X,O-pWP`@P @ Ѝ0S K P 0wP0T  RT1@ S //////0@-4@0P P,~O-T@00SPp4b  4PU00~ P|  iP00CS0y9 Pp0 0 S0 y W00 S UwP  P qP00SW00 Y00S P ZP00S  P P P  P  P  P$| : iPwP Ѝ,kX0@-0S ;@@0@00DVP0DЍ;P,,@-@`0P0`Sp 0`;P P Ѝ P,@-@P08D,p@-P@PPpy8Pp,A- P@`pP 0 `00P84SUP@Ѝ,@-$ 000B;P Ѝ,A- P@`pP 0 `00P84SUP@Ѝ,@-$ 000B;P Ѝ,@    /0A-P<<`0@ 4'0p0D0& SQ[O-@P DupDpG``b0Y:0z  Z# 0@@ Du 0DA\0:Z: [=0 S: p` Ѝ `p,A-@`Ppt ,t &t  tA 0p@-Q@T 0 do `n2 0$pAT doP n $!0p0Rp0@-p`TM00`< @PTp0TЍTT0 Mpqx@ ',0@&$0$ 4/00S %|ɜ~,A-P@ 0s P0p`ppGWp0P ```pT @@P ,p@-@P?0 ?@0R:@@pP p,0S 0S/0S R P/0R //p@-QM$0Sy A1` 6/`1!6/&%!Q10P! \`6/*)!(Q'10P! \^`t 6/ ,` 1 !P6/ 0`0 06/ `|0 6/ 4`s0 6/ 8`j|0| 6/ `aX0 6/ PX40 5/ 0@ 4/Ѝp,%|0~ɜ̊[h~) .#~~v~BIVet]0<P, < /,Ԉ @-@ 0 0A11D ^Q  $ $    ,O-lQpD0H0L0$`PD @@ @$D T:d 0jHT:d @DL0 0R:P0a Ѝ030@4   $0@0 80@4 0$ (0@% 0  4/0S ,%|0O-EBMT`MV`v0 0000, ``z`p0,0IW0@ 00`o`,,U@Y Y +p B>04@tH R|Yv 00$0S L ğ0 R 0 >80H@`@C^3A40LC32 0h  2l 3 p  !dC 2ttt 00C0'0DS 0 000PxP| P,0 & 9 % 4 @ P B, * R' \  B\ !\  $   R B @ @P R B @ @P '  (  )  *   0 0#0  3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00_l Ѝ0S/1>3 !/0S 000/,`0S/A-0p @RP:``S * DP`A 0 PQ0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-@0SP`(0aL T  $ T $ Q0@ 1pC !%M0`0sA-0p0@P`MⰂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SQ u P0( R, R)\\&|\#00 |R 0S |0 3/000Q R R0SR|\0 Q QQ Rt0S 0S   B 0  BЍ 0S 0 c >0000  B 0B B00 "0 00 0T,`A-`@0PS<0R"0!31<0S 0R0PP0S! !x000S!!!,p (B0PA , (0 ,P%%@%>>>>>=>X>>>>>>>>P 0 B 0  B  B " A A`0 F  B  B " A{  k`PpG  B0  BZ`FPpG|S`FPvA]p@-P@,`bP@tp Tp~TQ 00//~T,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0P`%%@% -Z00  W3 0S- W0`S 0`00S<0W00Z0S Z4 0b?P  pgwp400!0pᲠ40 P0`S 0`0{  P  P @ [m 0]S Q^0s0  0  EB#ЍO%,`%Dp@- 0@0(M! 0 0  |  p 0Q 0`0]00000P0`P(Ѝp (Ѝp@%D%@% 0S 001006PX\QV {RS00<0PS<* ,R9 Q 7 810000 'U0 R     0 S *R\Q}Q00 0RR \P 0}S 0<0S 00,000$EoЍ[Uy`,`)>{%DA-0@pp`?Q $0As R SQO,O,O,O`PLQQO,O,R^QO [Q \Q PUOO{Q |Q720W:0S00500 @0P U1@P(` )0 S*0)S  ) U 1L  0 S:0S00500P 0)SP  0  $  $ RK*0?S{S*C\Q@{SP L$ "!,Q  R  $  U   R  #  ?S m*S +S 0S* *B?RP {R  Q  3000 Ѝ  0  (  (  0PP 0000^0 0 0P 0]0P0 ~o0W:0S002000 <Q >Q qx9PP iS &[N L]{S0 PSp* ,Rm  1000< U0 R  !   50 S*}Q00f 0RL}QF \ 0  B_  B   B0S  BC   B0F  B 0  B;  B  B " A 0000S 00000,`%D0S G- `M† PQPE \PL@P 6U: pPp P P$ @pxp_0  pt0^ 6up|0pp P   $ ( , 0P4 8 < @ D z000Q R:0S005000 S=:  c 0A0v;P  N00Xo p0 P>3S, 9S $S S <0R pQ00< 00u04|04040 -  Sc S<0RxQ< s00 p0QiS S S>SUSQP>3S S/ "S 00 0\ S:0_0P 08 BB0U0 RB@ Q U B!U 1 EU, ^ 0C\!1LX0RU!U! 0>Q% Q% QS 00 080Se 0S  0H 0@0 @0x00 0  0S <Ѝ0R 10C/UUTN,`IH544Ee,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0cP`%%@%<0p@-0PSQ@ʡ@8QD@ p<0S P pL0@0t@@P(00Ppp@%%@%3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T 4P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R tVR Ra R >c D2 H0 00 P0 0 9>c pr0 pRd[* A T0$  %P0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D/ H0 00 8P0  R(%D+O-P`p4@Q{ V Ѝ>3S% *S" SY SH SR `P SX SX 0 P =S[ S SG S03S S S6 "SY SF S 0H S &Sx.S$ *S S0s0S80 S xpPr80 0@r0s0Sx[X00>@4@505 P`F`FV0@0>@>0> ^0C0>@01>3 Sw 0O-4M_0@0(0X000 001( 0  |000_V_U0^00 0,e,v_V0;0  R" ( ZP $0 00`,G0P,vu00_PU0PSPU R  S0 04Ѝ%DO-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0800 0 X7  IS~ S F S 0>#0DϠ0@ 0u800 0 lX I0  0bP  0p @0P  0PTP 0PP@ pP@0<800p 0 3X G 0 PE >#P   0#W 0  0Q>SP!>#"RPE P9@]0>#" 00D 0TO--P@pMLP0H #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R tVR Ra R >c D2 H0 00 P0 0 9>c pr0 pRd[* A T0$  ]!P0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D/ H0 00 8P0  R(%D+O-pP4@0s0 W Ѝ>Q. 0Q`$ Qh QS Qa pP Qn QY  0YP0 @Qs Q Q[ Q6Q QF Q@ "Qy Qf QQ g Q &Qy!.Q0 *Q QqQ8Q y p Pr8 /rqQy SY> EQ\QpGpGPu > j  > >c V >  > QMO--,M , *4 g0*0 0* (0 @ |V  0 `  0R   sO0 Ra  R [ PZ   R    ``R  0P0 00 0 UC D V pP p r _U RQ v     _V RpuZ P# r   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  ` pdX0w u r R ` pS0!u  vR q   _V_U P  ` 30v0_V` P R  R5   0$ 0PZ& 0$  N0 S 0 yN0`  :` 0Pvu _PU PRPU0S 000S00,Ѝ%DO-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0z800 0 qX7  IS~ S F S 0>#0DϠ0@ 0T800 0 KX I0  0AP  0p @0P  0/TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D 0TO--,M , *4 g0*0 0* (0 @ `T  0 `  0R   WM0 Ra  R [ PZ   R    ``R  0P0 00 0 UC D V pP p r _U RQ v     _V RpuZ P# r   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  ` pHX0w u r R ` p70!u  vR q   _V_U P  ` 0v0_V` P R  R5   0$ 0PZ& 0$  fL0 S 0 ]L0`  :` 0Pvu _PU PRPU0S 000S00,Ѝ%DO-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0z800 0 qX7  IS~ S F S 0>#0DϠ0@ 0T800 0 KX I0  0AP  0p @0P  0/TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D 0TO--P@pMLP0H #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R tVR Ra R >c D2 H0 00 P0 0 9>c pr0 pRd[* A T0$  P0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D/ H0 00 8P0  R(%D+O--lM $PQ0U @$QP ``M     Q 0R S g  Z0,Q~ 4 Ry 80S0u SHPA@@@$P(P,PPP PPP9p "`!@03@0 }p@& 0 ;;p@ %;p@   ip@`I0  P$;IPI0 PUIPdЍI00O-1MM @`Dd!P"$"4 "(0 Qp C.  PpV[@D;@8 (0Sp p p̱̑ 00Q$ P %0!p)p@ t0!0 P P +0S RI0@01ݍЍI0S PEPU R- Pp 08D<4! @ P0 00 R 0$0h,R @PY1ݍЍhL1ݍЍK֘`HtF Ր՜Ռtg0@-P@M 0  PIp@ ,p@ P 0 0Ѝ0  Ѝ0A-@@`v0 PP0P!0 upp pp0`p0H0`Vp H``pp|0`p0H 000dp@-@PCM3 /7P5 8Op@% ` BPH000Vu5 09{C.P F {@4EP @Fr<0@S VS 00 SCލp@@0S@l0l 0P@0  P@1:H?0@0@H0@0 @c ршp@-QMP4@SMZ TE /7PB QP0s+ EP lQaP0 `pP @0 @p@pqG H \p@ ۍЍp%0si/1p0" +]@p@0 P@0 ? P@1:H?0@0p04@ H0#S.p@ H00HPG@PblׄbHal@%֬aHϸ@-pP`O-$(PY,pR`@0U*00ï 8W0 0 080 R0*V&G 00p&C{p@tp4 2x 2 r@pwkP@s`U0@-DM@ CP- 0P0#L` AC6P/ 0 E`S0LT/1 0S 2 0"#DЍ0*O-60 @`$M00@<+@ H\_-0@?o2S00. 0 P 00a 0 tutQS 0 0000S  PP!#ό000 0NY [ȏJ0-0@?o\2  y 4YP$Ѝ x0s P$Ѝ0@Pa (P aP (P0 )P0CS 00P P p R4000.P0S0 0S  00000S3 R3 t 0S( hRf `#S\ BPV PM P Q XCP Q000S rp!~Q CP mlCP4 XXcQ wCP0.S000S00I R ؁ء  Q SCP 20B@ 0sS7 tts=CP Q 0S 0`0 ,a,`n)CP' Q0.R  RQ  CPb QA CPx Qs0 0 >   ama.m.pmp.m.4,(LX @0A-P@U 0U0PUP!A`FPFq ``P 0!Eq1pP 02P''O--@MD(0p0 D@0@ 0(@,@@@@ @@@p H0T L0X @݋0@p#  SE  !o0CV X f‚!  3Sf&] ZYxv4-&PuUF@21#"tQ <200,1SD(" 0=S 00S1X"R 8 Z9T  1@01S O<X A {{P XPL0QEaC0 ?L`XP0 L t00X0" T 04!0SNQL HXa PA&*021,1S\ U1X2Q SP0\XL S p |0L 0P XL { X {1/ @oTmЍ ȼDŽlƼ(ŬtqHl$ Q !X"R$R: p L \0 L1XZ X C@s S@JQ\,1P  PY  0P0V: pT L`XP1 L 0 X 1 @P\@H(00(0000,00,08XP,0\0& <Q0! 0 =S000\00@DX h0$0SXP"ExPX A PP@H^XP @HUS@ XP E SQ#XP!E SQE# &XP$0S 0(0 0 <P0=SH L^LX\00h@0 0D0XP0S  <RH@^L X\@D0h$0XP0$0 0XP0 0$0SXP"x(0XP0(0,00,0(00(0XP0 000(0~XPL0P dS&ǡx0 d0` {{ {{{{{0{{0{0aXP 0RN{{AP{W@0D hPX0\8 #Pk p0v> 0d0?`0l00T0?P0h0<0?80d0D0?@0`0L0?H0\0\0?X00 000XP#%XP(0S   R $ R`d  Q 00 0 d0>#d0 >d0 >% T2>XP0 dS  Q P $ Q&$0TP08<XP0 SE Q\0s E&XP E !0 XP E!XP  P0000  R00SPT8< XP  SQE#XP 0 Q0t* ^n*{ r0s{PT 8<0n0 XP !g '%.""""0S(0SL XP80@0 P0A: c0  =0  #Ό0^ !#/1 0 d0 = 0P #.0XPE0(0XP0"0XP0XP 8180 P0:$(\0<Q00 =S$00$0\00h00 @DX 0c0 =0  #Ό0^ !#/1 0 d0 =XP0280 P0:Q00 <S000L00h00  H 0XP0  0C0  CQ $0 h00$%XP @ D0 0 h$% 0S 0000000XP00$0Sw"xXP|XP0(0x0XP(0t$PdXP0 SQZ " \"1 x"0W$0XP2t rt p p MXP 0  S8 Q5#S0 & E%8 S(  PQ%8< &## &0 (00dRV@0D 0 $0 h00% 0C 000 00S P0 0$0h0 BQ0 @00D h0 0 0 C00 00S \0 0 $0h00 $$%0 %#DQ " R01"0sad0 `<d0 [<$O--MPp@0k 0@0U`0 W  0 2c10 刀 00M@P/ 0v> 0d0?`000T0?P0 04<0?800 ;0000 000P :0\0P@ 0TP 2 dP 0P0S~ʴ R{ʠ RxʨQu006 0S` d0?#0S/" ES}> `  d0 @DP@0 E0@ @< L0\dT`` 4p0 `FQ@ T PQvNNhl @D P[^0`00tx|\dPl`p@? RW S S|\pTlVh0SdU`0S\0 Rz{  RRzp8@0>C 0C0t0p R@ix0S ?0p`tP( 0( \0:EPJ p'?0! P ό 01l"?! R1 R?U0v Po 0 *;X7v~A pG0/ PQpp 0 ;Sl00h  Rhb? 0  `vqP  0pqP?0S [ R@Q @T >? 00 ߍ 04?\ zq0 N 'pQ !'/q S=Q9 RTP\0 P0,P0  PpKZP S 00@ >0\ Ӻ`>0S0000 W\ ZR0d`o ``庺0\T0? P0ⱺ0\<0? 80⨺0\D0? @0⟺0\L0?H0 ►0\Xp0e >0SI O937'3gS:3ß0#cP,:*PIy01@P  刀dS_l0 [ZP 1pv0psp>@(@\P `p P ?/& Rß%0Q0vt0W :0 #0Q #0P V m`V!10&/ " R#Ό3à\"= #,30 S(8L^90 ( 0qpq2  P7o >#00>0SL ;\| РR00"c01 2c1 [ï sQ =T00=0S$ 0=0Q !1&/`P 2&>`\ 3à\&= #,3=0 0z w0=T00Y=T00#|0lP\)\( ɚv @-@ LpT taX00 R 0 R 0Q/  /    DQ 0@-0P S@@H  ^ 0S  Q 0#0S0 0/dTH  Q j.0 0#  Q/̐00Ɠ\ 0@-xPo> 0@" \ 0 0 /tA-@P `p@P@0% .P PPA-`@@6S `pjNP@ & P 0SPpA-`@@D0S `pH@P@ & P 0SPO-P M `P9 p젟P nP P @@ %  P P0Sp O Ѝy X p V N8  !p0`0pShA-pPQ `@Q P 0@DDB(000S   5@- M`pPPp) 4< 0 0@0S (<0"S" 0p000S0 7/ Ѝ<0"S1Ds\0pT000S @ Ѝ1Ds$ P 5H4@-@ @O-p MWP  pp2S``PL P@C jPp G ,P P6 0nS# p= *@P00Q Q P R  \0 HB"A 0 0@00oSp\000S ^\` Ѝ,  QO`T2 O--AM M@pq;L0 0cLP:*PP  WLPm0: 57P PC@@u0K PP 0 %p 0  00P: 0 *PP$p ` $@P! L 0dSPkPU0 Pp` !p| ᬾ (08P @PP 0 PgpR zQ P  :00P/U` P cpB:0SS   3PAލ Ѝ 20H0PP0 $p>  %P:00 Z02l! 0 00:0D0 022:!0 %Q0:&:00 Z02~t:00 Z02sPqg:0`0  P02e@dz\0H 0@-P@M 0 P@ $PЍ00@-P>@M 0 P@ #PЍ00@-P?@M 0 P@ #PЍ00-,M 0 >PЍ--0$ S   0/ 00p@-P2U@p9?( ( 0P 5/p8,p@-P$U@p9?( ( 0P 5/p@-@P 0003/@-@P 0003/Dp@-P?oU20S@ 0 0 03/php@-P`UV00P00S@p$ P05/pp@-PS?oU20S@ 0 0 03/p(p@-P`3@PpE9(@0 p@/p@-PZ@P p 0 0 03/p-@-M  gp@(0(003/Ѝ@ Ѝ/(<@-mgp@0003/O-`$M ؤP @,0Sp$Ѝ80,P@@  4/$Ѝ<dO-`$M ؤP @20Sp$Ѝ80,P@@  4/$Ѝ!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////Lp x`8 xhT@0xO--0:p0*S 0pG000PZ0G"` `0 U0SXU Y <00p00C0`0 Pp(V ` BPE @@R> 3P 4U * 0 0 00*0G0PPU  <32 7[`= YI Ii XR3"^P<^P `0U 4@ YFX; Q8V ` BPE @R> 3P 4U *000 0*000G`0[P & < Y` `0<S Z>03040p 0R 0<ЍPU *@ Y,PU ` * Y@@ Yp;0:,d;0:(Y 04 P0(<p A FQ ,p 0$00)Q!*AQ V S @0S Q} FQbQ0  `302 @10 0[0 X 3 "R Y 0H0PE00 @$@S 1>03P041U * 00 0*00G0, PPU`<03`2070SE 00P0=S @Z? 0  `,)Q(P 0 BPE0`$@S>03P04U *00 0*00G0dVP 0`PU4 Z [PU`1401` Z``0fQg [ 0 L( ,!3 0 ` l:. @3[ X3"30Q040 N Y 0H0PE@ $@0R 1> 3P 41U * 0 00*0G,0PPU`< 3`2 70S 0FS 0(0(0S40000G0 P0 PU`0(0 ``<0,( 0B($0<PQ0$0 00PU 040FSY00,0@00S(0 P<R00S$00$0 00U 0 4 @ZR  ,*0S)P 0 BPE $@R>03P04U *`00 0*00G0XP `PU *Z  [PU *<0,0@Z7  ,*0S)P 0 BPE $@R>03P04U *`00 0*00G0BXP `APU *Z [PU *[4 0S1Y 00H0PE00$@S 1>03P041U * 00 0*00G0  ,0RP`PU*=00 <0,(0PU=030440*0000GP(0PU`0 X00S4 0X+:Y 00H0PE00$@S>03P04U * 00 0*00G0 ,0RP`PU]*#00,0( 0PU#03040, (0 0[, 0S)Y 0H0PE00$S 1>03P041U * 00 0*00G0 ,0RP`PU*=00PU0#0%=03040305,00 ` <0,0e,00(y,00u-M{0{0)Ѝp@-P`M0@ 0# 4/ЍpG-PRM^  `UpP*/a@%#P T1000< pp Ѝ80S 1 000< pp30S ЍĠ 30S 0 < @0000< @ pp30S3 0 3 0 ߬tCg@-$$@M ЍdȀO-EM MaX@P+p `E+ J0P@+T! 0 J0P@T 0 0EAP ( $U0Eލ ЍO3 0 Eލ ЍG3 0 }<H@-@` pMP\+P, /lJ 0RP  rR' rR  P   P @0C7Ѝ0rS\ 0 @*Ѝ0 Ѝ@r2 0 @?A-`@ ip@ 0P/S /JP @0 Sp  0 S +@p@-IMM@`PP ᖷp 0: S p0 0rp IލЍp2@O00IލЍp@IލЍp20@0p@-IMM@`PP ep 0: S p0 0Ap IލЍp|2@O00IލЍp@IލЍpo20@0b0@-P@M 0 P@ PЍ080Q 0 080/p@-@PP` U >PP u "P  p@_*PPp--00 M (0  ЍЍ/(--M  Ѝ Ѝ/ -- MM<P 00  0 ЍЍ/((0-@- M@MP  Ѝ@Ѝ/O-,M `@RPP00:A!0@00Ppp0 0CS? PY P@ 0 @cYP vM!,Ѝ`4@-@0M 4& 0Ѝ0 00 D(p@-`@POMpp p@ @-80800M@ & 0Ѝ(p@-M H0H 00@` %Mp  Ѝp@kЍp(0@-4M@PMp %@ X4Ѝ0p@-@PT T  0M` @Lp % =0Ѝp(C-,M pP`PEUP0R@@t0 0:2 0U @P0 @T L#!,Ѝ44@-@0M |% 0Ѝ0 00 d(p@-`@PLpp p@ @-80800M@ S% 0Ѝ(p@-M H0H 00@` mLp  Ѝp@yЍp(0@-4M@P\Lp %%@ f4Ѝ0p@-@PT T  0M` @ALp  % K0Ѝp( Q 80 @-l880@08 880/880 00<P 80880 p/p@-@0@00S 000 X t0PP  `00A"/L00p@#P,, (\LO-t3M0@ 0P 0 `0Dp@ P P00U tpp0 0CY 2ATT00  RG LD@D T]:[ 2 00p0`K K0 V0 W8 P2ATT 0`Fs 0RB zK 0  0 B0SH fK@0Ѝ V0& 0  TK 0 0pHXB0SG 0 =Kv 0 B 0 B@ 0 B  B$K`FtZ  0 B  BK 0 v 0 m 0 0S J00( 00 ݔ(p@-@PJppp@ 0RS00 /p@-@<0<00P  @Jppp@ (808 00 Q0R00 /(p@-@`PJpT T   p@pp@-@P\ \  ` @JpTT  p@p(O-1!000, S1H0? MPD`d 000PV1!p !q1 W0C@(t  ,0@@KD Œ Č Ȍ A`| @p4  W R ? \ QQ Wt ,0 000IC11E00Q00, Ũj Ѝ0۬ 0 00{ٸ(@-000 000 @!@P80@080ٔ@-@@P80@0800-M  Ѝ0-M  ЍO-ϟiM QP@qaԱ  PX? `K͌U P? K͌T P> F͌(1S P~> F͌(W P}<> C͌ V vP{= JB͌8[ dPy= ̌1S QPv`= ^B͌`0=@ 0S078 H0P `P P P Pd P@ P( P P@ (P PD (PPt PHT PxP'( 4Q780L0x100C40S0 00C,0000h0000a0P06 ,0P0@`U 0e1P U.0q10 `00V0q0 `pV, 0U @ `dp少Wl` 0 Z  Piߍ`0 1 S  ,00 0! 1S 0D 0| 0>p00G P ,,0$ 0 @< 8P!P H, $  B @ 0S% 00P00C1 0@S3 00 Q!1 p WQ  pW,000 p0S,000P$0U1p㔠 0 W ㍾Pp~80Sz004 0R0031800S@@X!0@< 0S00!$0P 0S@@@@T0S0 0 ,00C00P0X00Y,0 0CR0@,00`0QQT d!@YP0 p00 W0 puW0T,00` pp少W䰍 0 X P0080S^p!f p!:|rQ R 81 R 0S ЍQ  <00 IDh0 T  Ѝ֘D0h0  S/PG-TP@pᨤMk +(@($pT =0CS0SX33?DDP 0400/($$ ଀膃0尀:p㴀%LȈ㸀͠x胟H pp8At`l@Ãd\X(TPPLHxD@<84($  h2101:|@ R 0S 1q810S \ЍQ  x20 dCh Jh@ \@  00(PU(p0Ѝ>㞸A@<㙸^㖸v㓸8#㐸:㍸0'㊸#ㇸJ #ヸH#〸p-}-z`_w|toqpnrkyhze{b@|_h}\x$p(bֈ!t+!%,!-!.%0%`&i%j%k% l%m%<n#o#s%t%$u%4v%,w%x#p#r"dy"ez"`|`DtA-``_` p @ 0^ 0(`V(PpO-pTT7 L7L00MJ]070 P0\0SZ  p p P` + pS`H\$ 0` s 00bRS 4S 600/N 0 ;0⥷ $Q`B`q 0 ;0▷p n 0S,0 04 0 s 00bR44 $S `%5 0Ѝ p P`1  4` 4 0 s 00bR 444P500/1QP p lR Ĕ P $ $ 0d0\0S0 S 4$00`e pg |0`@ `00 4Q0`Q40NQ  000r0  cR$0S0I Sz= p? T0`@b p6 0 $ A` 0 s 00bR 40 ; 0p P p 40 s 00bR44 $RT0`$#0 0Ѝ0 ;0Ŷp4SL 0`@  $ `004S: 0040 s 00bR $4S4!SY 0`@s  $ `004Sc  20 2"00`}` 4!4 0 s 00bR L/o 4"101!00#?ca p 02 0s440040 s 00bR44n40 s 00bR40o0 00#?c0`0040040 s 00bR44T00S \ \ t0t0! 0ㅳ dHpAQߔX$V 0$  0* 004 44/LO-T4P8 `0$Q@DMh v :Q{#R3Z 300S 8 0pP0 @P`@-@ZP% HTP PFP0S)[P& mR R@0R0 1BqQ;RS S0 CmSr ;S R R0 S0S PS0 C;Sr  QR0RRPPO-0tSp@`Md`Z|P T0ɍ <rr  00bI|"0R 3S(0$00 0pPK?T0 ᙚTHP ᐚX 0S$$ $ 0|"4`0T 3X 0 4S0300S5 p0S2 4S, 4S 0D#Tq匑Tl"2 8PR t3l2Z& L[# `P P {0`3 1V 0H5S4S 4S0?o28p22Yt2 PV 2t22Wx2 P/ x2x2hЍ0 D p$l h $ <%$(fW >P2l2Yl 6Pl2<l2Zj -Pl2?;~0l2Y "P1x2Z Px2?;~0x2T Px278x2W  P<1t2Z  Pt2?;~0t2T  Pt278t2|200S0X0  rr WH|"R1S00 4S,^L%R)TZ8p2@0t2e8p2,0t2ZNN(NJ40 00H@-0 0`$pPpP `@`@TPxPX@l@ h` X 0 0lptx"| @S$\8 80 00\ X 0//`O-\ M`p0P@T \2 !0S S0SXT Ѝ 0 C-a\` M Q Ѝ |Pl@P QR  ㉯PK 0, R 0"0 Ѝ 0 ЍPq Ӱ P ^ P GⰐ帐 少帑  QLղ~<0<0 0 tƲodFpF,F`A-P@pP @P `D`@D0 x0"P0VP@0 j 2P p@-`\@PU 0S1 RU0S@80@S2p@/G-lp@`S0 SV0S"Q0S 0SVC-@0M0`M@ṮP0 0, @S@ @ jJ~ 0圐†p 0|" QU  P* : YTۍЍ 㺮ːDp@C-P PM 0 R  * 0  Ѝ`0 Q0@-@L00S :T g/dA-0 0`0S :#pRCq# # Pᙯ0@P: #C#S# B0:#!Bq## -L0LM0 0\ 0ʌ   , Ѝ 8 80 00\ T 0//p@-PZ|`p`@0@ O0SP0P0:3S 8 80 0\ L0:#p\O-``3 0Xs0T*PL3B0` p (VS p p PO p   r  `R  01Q @R R3 RV@ X `20X2 `mpv  @R `  R i \  lp P ` @q lRQ 1 X6N @{? ` 0  S, q lRQ  1  ?p Boq`R s0 00#?c s 0\0\0 0 <  <8LQŨ=<G-(S(3P`@Pe 80$ RR a ʌ3S23pSxW " Rp .8' @-\Ӣ5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@@@@ PN U  ^Q/0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@P!80-^\ , 0 B\ 0 ^O--J3dS0 dMbWSUa 3,p0CQ?8 <3 Q7SA0:pP8 , 0pb3S0>0P 0p3@ 0 00p, , E3, P 0 0 0)   0RdЍ|B0 9dЍOh/O-*,M0pP2U 0!  @Te ` @p$ $TK):0`SO p 0 UPP,Ѝ@`00S S> S0PV$0S-00 04S,ЍO>0@0S A0Q  B20RP 00C 0PV !00C 00PS  Pn@0 C`PQO-DM 4P3 S-0S*U= 000  0@ 000@j Q k@` p 季PJ @0S 0ɣPЍDM P 4A " 2  0ЍP0P[P0  0 /$ D0D M000S :P Ѝ"Ѝ/Z H0H M00 0S :P ЍЍ/Y404 000S :P /YxH0H M00 0S :P ЍЍ/Y,404 000S :P /XMDD0P  P 0 ЍЍ/X@-|0| 00@T 0J#4R |B0pQ 38@-P @@X8808 000S :P o/WD0D 000SP:P4@//Wd000 000S :P /WL0L 000S :P @-p @/VA-0 00pW* Z3$SP! #R`@4Sp`3@Tv A|B0tQ 7A`-Vp-0    hU000 000S :P r/U\A-00 0M` V$ p @0p{p   tPP 0pop@   0-@᭡Ѝ@UP  P ]/p@-JP 3S P`4`玡30PV刡  0s3$ S"0EP |2 $R 0X0S 0L3 |20X #$03p03ppp(p@-jP D3S @P4PH30@Sp@AA-`P\ J3S%sW" P@P033SĔ S*/W 0B@ ^0,  W0p,030!C  ! L! \0|! c0000WP3PSSpP4Stpp3PUpp@-@P PX0:|"C0T0XppG- Ѐ\-P@p  `ߡP LTL!VW R T VW  H000S4080 ʡ0 0P|O- M0@DT  =p|PP5P( ] U9 Ѝ务P&` U$ @အP  0 C 0 gh `  @RYd ` `< Ѝ Ѝ0 % @0@0O|0@-?S0P  0pP0@X p`a p@^`  00PPN4A- Q@PP% pW# 0 0S0,000 R   R   R  P 4ݟ`T `TX *P Q Sp  QW02ŸMp@-`P X0@:|R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S OT00SpX@ |'(@ 8Q 0@0ppp@-Xa@P`Q X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \PpP00008P@078@0pGpJT0T 000S P@ ?# Q @ $080///I((0( 00Q0/H((0( 00Q0q/Ht(A-T0T0 0PRp @`?`,GHH8(T0T 00 R X@0|78@08Q0@0/G(0 00Gh(0 00(GD(0@-P0P0@ MT X0:|20T1S@0?;@0c@000080S@078@0u Ѝ0G(P Q@0?30R @080///RY/R/p@-PS `0H @?DppP X @0*|"7 8@08 R 0@0/P@/'0@-P@PP M X0:|20T1S@0?;@0><000080S@078@0 Ѝ0EL0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/D0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/C@-MT @0@0Ѝ@%B(@-@MB Ѝ@p@-l0l 00 Q@P00R ^ p@# p@Bt(p@-D0@@ 00P #pp  p@A(p@-P@#pp p@p@-P   ` @#ppT0 T ^ @ p@@AT(p@-@`P#ppT T  R @ p@@Rp@-@P00S ^ p@y p@rO-`A-PUP5P`0@%@00?C,5p 00TP 5 5 0@0@0@0  00P 4 4 0@0@0@0  00P x4 t4 0@0@0@0 00LP ,4 u@ (@ $ R@0@@0 0 (P !R 3 Y0@ 0,@   8P !R t3 G0@ 0,@ T!R   P ,3 5 @0;@0  00P 2 & @0:@0  00P 2  @0:@0  00 P x2  @09@0  00P <2  @09@0  00P 2  @0;@0 004P 1  @00@0 00P 1  @00@0  00P L1  @0 0@0@ 00P 1  @0@0@0 00P 0  @00@000PL1S0  @08@000@P L0 } @00@000 ~pdt|p@-P@P0@P006Sp0 pG0 0p@Opp@-APQ@`Q }10  R* 0  0W pp!R!  Br (00(!C R$C1Sڸ0J @Tp!Rڸ  *d2 00000S / @T *@TUpx00 QPڸ0 Pڸ  4040 K @T|  -M 0ЍC- `?PpPEIP$Y/ P@  N @DT`F࠱V HX $ P 0Cp@-A1@`P0M@00 !P Q `Ѝp ( 5x! h!l1P 00TtP1 0@00@0P5,10 R00S Ѝp@  0P 0 S0 0@00 @0 0P 00 @00@0 0@0X P@00 80L * @08@0P ~p|tdA-@`PpxTV,1 @ 0 @A O--/? dM$ 0*#R{$/@ T<  ( ` (`RP(080@80@9 @ h?0S`$?@ ? 0D000D0 RP (@AD000h0S80@0800 0S4$ >0(0 R, 00s0S^4 0"( @ t@T,0Q0@t@T<0(00S,0S (  R( , HL ,T,S(0 040,100 180<00,0 10 0=$ 0p0H |0D00H00`p 0H SL0HP1<08 0,0000O,08 0Y0Y 00S0`S0F0Q<08 0,00 1 1 01IY0Cڸ P0oD00 L RQ 0YP@r00PPP 00P P p, 0 R S R  0\ ɟ`V0JZ 0Z jp   0R A VdP  P  `p P V  0Rt  `@:$00SID QC 0C00 S40( 0S(00040 0 S(00 R4 000:3s L  RL   000Q00 0\,0(0s0,Q0,8P 1 11RY@ڶ  R7 8 r  b q$0`V 0\S0JZ @  @NN Œ Č Ȍ N LL\o00ɟ`V>:p80PT 0P TD0D0 R 0 R PP! YR *Y $R  0E0| xp0  0E n D000P $ 6  ZD0@00!R 7tq <000V! B0C 0H$0P=X 0*1d"0p,<6$  y 0@P`< 0P8, Tp P$T000 @0p4 1`11QUo 00S400 <0pD0 P|pV0A0 0C0 R d1SYdЍ꜄ 1P U00V0S 0    z4$$ R 00S0 ?CQ`FP@` 0?3T 1HX1QEP `?0D000L00@ 0@0@00 XX0vP0L0c^\ 0S @(080 z <00  $20 p`dЍ80 00SH2$ 0D000h0S(00S;<0+00@ 0Cb (0 Y0<080 @0 80R00C\0Rʙ @t' =,1$ 0, QUp! <,\`@VP  V@P P0,p, PQP1J q <@,T`V@ d 33|3l|*X)!  < epV@ P0 , PA,\,PY AIa,@IpE ! W   P  X,00,0Q00 , BCR4 R0<084 00C, 00S<,04 00@0@0 0,00400 00 S` @` P 0, !Yp, 1@  Y@p oP0000 00S000 00 0S 040C04 R00CQ8(0 00, PEu1 PAj0, \, p(@0<00  {X 0*1d"0p<0V @ p30S  `3$  D0@0 0Qb R_ dP\  Y R d1S $ 3 A 0PU@`W0Vm0Sj 8Q004CQ{0各V0F0<00DP `P | <0`0PL W H D|pY uPp:U U` p ,`FV EPEElUP0 0 : ,0R<00,P 0 apC0Y 0C040 % 0%: 0:5,080@40 H 0X00X0S1!0a~0S00Y0SvW{W&0 S 0PU0@8  K , @DHTH K0E @0PE0PEQ! 00 00C,0X<00,,0100 0R0B<0`0,P,,PT 0E0p0 0E  .D000P8, 080(000 P0,0 00000X@Wt 0 CD0X0 <000P`P4 pQ S4S Yô4SQJ H5S4L  9$p@ 0 pPD 00p0 pC00Pb  0D 00 B0 y0p p&0 0pl0 p \oSJ 0 00D000r$ :@ H0 pC0p   D000ȔY  Y 20 oSP+4PM D00  X sPP p0SM 4S 4S Y00ôQ0S9 L5S<  ;$ @ 0   D0 00p0  D000Pc  0D 00 B0  K00Q0@000 :0gD000P  T P $ 4=@ 0    KD000P) =$  0 V R- X =$ @D0 00vXDp 0 0Lj1S X 8>$ Dp@0 0XL5S 0 0R{X >$ @D0 00L@0P0PU 0 U @"P @0pD0 0HpX @0 P: 0}P    p?$ D@0 0pX000 D000H%RQ    p40$ D@0 0HpXpp@-P0P`@0M R    80x t00 0 000P80  D000! B/ 0C?0 0 Ѝpڴ 0 00(C-M048&lp\h@`Pp\P  Ѝ|80 800 0 pCB`Po_`PЍ| @-@P @TG-1!00`0DSHp0?sppS-, P !Q@QT:!80|0Zp@U0 S00? P R!R0 S   0 00( 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP0 @ @T $U0` V P`:Vp`0P 0@PUpT` @"T @pp  ! !@-@P@ T R/A-p0,SP` @T @T0`SP R0Q/ C0A "" Q/@-pQ*P`@ 0A "" T0 "" Q^ 0N "" \^PW`@@-@@@0S P$0C$ O--:z0*Mp$P( , pPx l00^b Ss @@lRXapH\ 004@Y @A@0 @TI Q@@[@TAP i``FF\W0^0  | aR\ p`Q'`Q"  @CP(@ ,4QT SI@0S P$00C$0xX0C,4Q~ @CP ^a S_ʔ80,40SoʀHh@` 0 0, $P,04CS (` R 0 KR 8 80 p pP] `' 0(@Z q @@lR@A'@T 00P0SZ  P$00C$04' / 00Q4 70,0' 4(0P0K0 覟F @&  $P)0Sl600S00l0S$ 0 S! & ,40Q$0 lP,0S  ZP$0CP$60 RЍ 50( $0(0\CEe@` % (00 S5$%P0C (00xP0S  P$0C$@8% 0( 0,@0(@Q |4000XV 0Q[Q $ { 0$0C ,0(@ 0 K[ZP pD40,0<$ , 1 10yD4@000P ^$ $@$#` P(`h0 Ru ,,Uq  P+ x# * l# (`$@ ?#R WH( , #\ $6 (`  P 0(`$ R  iP $`B lP " 20,,40 SO   H20$ ؀0B@0S ;P$00C$0$؀ 00P0 ! ı 00(@S7a` 10(@0 T0!0@Dx P(@0S  P$00C$0`,0( a`0S P$00C$0 l`,0Xl0x\<,h,lhP Dx\O-PsP3pLC@00 S 4004c`(,P Zg34@2`0T5"0C S402P00S00h0S000S200ʐ  0@DS(00S 00lP 0S D2 4204@,P0T0hPr RP0 @P 0( 0CS SP1 P1040 ,( ݲ@P,P  e@1(`0 R&T !P @T 0 R 0 P'  00 lP @T00,P 00( 0  04@S]CPE@DSP4@,L04Pl b00SL004P|   l X Hp   H h X D @- ,(4 00  @-  ,(4 00 LO-\1\!0 T *⤒Y|20 1 W0!Q:|20t0`1=}Q,00S|20l`0 80!Q:|20hRl0 *s0!Q j0!Q  p/p@-x0x 000@00CS0 S p0 S P00Gp'zPp00p@-0CS@0 S p0 S P00)p zPp0p@-,0, 000Pz@pp@-Py@ p@-|0| 00@0J0Q P R, !Q0000X(0JP\@-\,AP /0S/ p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0PQ`@ ypP 0 0C S{sp ,0A10A1S!000A CR  (  \ 01A K" R T 0 0 0J T0K0 00Y?3 0Pq  vPP| 0Y0 00 W0(@p ڼ T D H0W D@ 0 ( 0C P8b$Ѝ00$ЍNT0 S80 E 10@N @D  BT zp`$ЍHȏ$Ѝ 00C! [z @ D0 |0p H0K002 [ @T @wT @ @\ hl0 00 (p@-@Pppp@p@-@80800P  @ppp@(O-X6dM0Pp$0x`P @Ku0P0 X0P400Y000@p0@SUJ6+QP`0PZ0p@00@D@TX0 000SR 4 M  @ CpDR2C.-40T R8 7 040 [x$ 40p0[uH0`00000S00U0EDxP`F?xPJ`8xP0p0C0 D S    @R4,00 !R0!!۱,(@Q 40 0R!1 AAaA"AR[ 0 0 0`F[0A40Z00 00, @ pp`4 84,0@,@ 0 <8'@T 0 p4 00C 0 Sj , 0 (0C0S00 SRs 0  3 w R $10`0  0p K0000 00 00Se @p0 000S00U0E~wP0J S 0p0Cʯ 0I!a@Qp``P@ 0H00001@DT D0|0p ;vdЍ#`@ 0\40T `R0@40 pxP`; `v~dЍ`|`vHP /0 0[(M,P   00ЍMЍ/(0@-\0@X 00 MP p T  Ѝ0@0 Ѝ0d(p@-@\ \  M` Pp T  Ѝp@Ѝp(p@-P@ppT p@ pp@-`P@ppT  p@p0Q /0Q /p@-00 0`@P0 0@\1000C1.T 0*\ /\p0R000p00p00 0L 00O--MS LPP` 0Z p H 0@TK !  5/  @T8 $T0<SP1 0000#10#.R00S0>aP0  H 0 v00 P00 Kr R0S0?@P5/@T YЍ H\00r R0S@0刀0}@P5/@T ZT XQ" @-@ RM !R "R pPĜ\  00@XЍ/0Q " @-  MS S PpP$R (@/Ѝ/$-4M0 Ѝ` @-P000M, PЍ 0@- 0\SY ^S9 %@@ ,S'Sv{cScXÁ0@4Ÿ^C110N0000q0}00%@000@0>Á{C0q)@@PA 00@S801pP00A 0@@100CT00C0q S\S:S '000L0d%{tQO-M  =q\PP 0p p00047 000R0pp ` @ 0,R6Ti \ 0@ 0  @ 0 0 Rg  QS%R +0@GSSQPNMLpoIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! > 0 Sr" 0P0Ѝ% 0iP 0@  `fv`00 0 "!.Q *Q0 0 0RZ@0 S\%p 00 @ 0% 0dP 0@  d 0 @0 S 00  00000 0 C@030 S`  00    0 0 C@00 Sm\ %p 00 0%@@c 00 a 0 SH\%p 00  0 % @ @@+c0 00 0   / 0  0 000  0  C00 <   0 @@0D0 00T0 S\R$ W 0`C0@ T$<0  0 m/> 0000   0 0S0\S 0 S0  S S Pp@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0T(dؤA-@0MS0H0D!0@p0S? `g 0g1Q!1!1"b2cP0A @ 0L0L  00210BP 0 pW$P@WP 0fSpPЍЍ 0 0ЍTN K,gȧA-@0MS0H0D!0@p0S> ` 01 ‚0  @P0P0A 01! 0120B&P 0 pW$P@TP 0nSPЍЍ0"0ЍLk I>C-@0MS00! 0p0S2 P 0`1H $@0!b4!b H1c$a1c0@` 00  0#3c`10BP pЍ 0<0qW X $`0sSP p`VWT 0S lPpPPPЍXL?- HS*0 O-LM =l mPG $0$ 0 0 : 0 @PP: @P 0S  R 0[ M #[ =[ =\`P` s000`0xxtp?P-  [Vp p  RR nP X,     PkV k0PSo H0 1$ @ 0d#ds112cp0@0L!112c0A0L0 30`b1a`@0Pa `0```@$@b`Hp, `V @Tp@0k~=0 P@@0%ks`VP00LЍ`f 0f!q0ƒ0p0@ 0200A0!1 120BPH 0`0@4`9 09L1N $@0!b4!b N1cq1cp0@χ 00  0#3c`10BLP 0tS0cS0S``d0@0` 0 0< O`0Snz ErN DgȧpLk C8>L?- BXS* -hO-@Pp`0\ %\0pS sS lS@ 0\TT1DW 01 CR0@CUPO-ϟqM pQ P`P? 00S040H $ f l0H \[0   RU0P GJ@T %0%T 400 R,B*Ph p 4 @@TP, 40,qߍ@P%T =,0,p:T TI 0DSECB@?>=<;:98543210/.-,+p6mP" 400p,1S 0C11ऀ R 3400@ R,*P 0 Dmp 40P4qߍ00f0\!0D]SAA t~x|{|x!00D R`@0A?S@:T `Ѝ@P  ` 0 p R 0S 0P` Ѝ` 01 1P  =P`L004@@@+  P *@P  r  0PUa V LЍ@0@S p@tP/  Q 0?s0S 4 Q0 0P)0Ax RE A/RVqTSRQPONMLKJIHGFEDCBA@?>=<;:[`76QY3210/A-?+*)GUQQ@ Ql%,0 @ 00@$,0`   `p`p^"*0 4((` 00p`0` 0`0` 0`0` 0` 00 ((``ct 0 S00 P*8pp`0(0 `0BQ ,0  00Y T(0刁T0HX `8ppi 00 0s0 PI`p@tp@tB , R 0?s0T4 0S00 R00 0S00 ]P 0  yP0000 f0  P Pp@t0 0Ps 0 2 P0#P  0 R` LЍ?V` A0  t0p[0 h0 `d < Y pOPbY GH G A ?t > >` = = =P =P/$P00// =@-M@0 0!1l!1"b2c N0L 0 0@@0#@B!A@C0$PЍN =$gȧ P0`0K?// <@-M@0 0L B0  N\00L 0"2<@0#AB@C1dKPЍLk <4>$0P00?// ;@-M@0 0L@N $@L0B!b4!b N|1c1c0L?AA 0 0P0@$$C!d!b8A@C1PЍL?- [(S* :p@-0P0M`2ڽ@P 0Ѝp}Z00  R 0S"0Ѝp PG- 1 !0 qP P@3 04 S0`0`2,0pPP00|Q``  ^VPeȄ`EQ  SV|0`0ȇ`H00lJ\d$@-@P ^^^ ^$^,^^,00!R  ! 001/001P// @--@o X@X0@0@0s H ~PJI HH @HlHA--(M g7`0@[TpSo[jW4C@-whO<(q*]{b~ y\[9&Eo8k  )SRQPO_LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " k{WF{{!00 (Ѝ0P0 P 30 0WBh {kWkc!00 0P0 ~P T30 0W0 "P  0cP0L30{kWk 0 P  0cP0I20[DW{ 06{kF{{iPq  0cP0x20W 0y0 "WP=  0cP0y40 W"  EP>  0cP0}10n[DW!{ 0a2!"WJ-P0  n0cP0%ژ0 W"  R `0cP0$d10W 02P!" P  N0cP0$10W 02!"P  <0cP0@00W 012 "P>  *0cP0@ڜ00W 00 "P  G??GH M L J J0 I I I8G H H HL G G Gd0cP000[D{k{F{W{ 0# P  0cP0tT30{kWk 0 Pb  0cP030{kWk 03 P  0cP0m20W 0^2""nPF  0cP0Kڌ20W 0<2""\PP  0cP0H20W 02(""JP  0cP0D20W 052""8P6  y0cP010e{W{ 0 'P  h0cP0ڀ10T{W{ 0 PC  W0cP0@10W 02!"P  E0cP000wWB 0 PB  40cP0jڼ00W 0[2 "P^  "0cP0%x00W 02< "P   F F F E E` D Dx D$ E D4 Dp Cd B BXG B B B40cP0000W 02@ "P  0cP0(t00W 02 "P  0cP0ڴ00 00W". P  0cP000 00W" nP  0cP0<10{kTF{W{ 0 ZPq  0cP0d30W 0r2#"HPe  0cP0 30W 02<#"6P  w0cP020W 02""$P  e0cP0Xژ20W 0I2""P3  S0cP0IX20 00W" P  A0cP020 00W" P  /0cP010gk[D{W{ 0z P  0cP0ڈ10W 02`!"PN  0cP 0<10@W 0' Pc  0cP0Z00W 0K2 "P  0cP0ڸ0 W" 6 P  0cP0qt00 00W" P  AX A @ A4G @ ? @$ ?h > ? >d >( = =P =L0cP0_(00W 0P2< "XP  0cP0h00 00W" FP  @P  00{kF{W{="00 r3030vx300#W"*"00 _H30@300#W""00 O300X#W" "00 B20{kWk!00 520200"W">"00 %x200p20c0"W"!00 @20|0p"W""00 20200H"W"!00 1010$0"W"o!00 10a10100!W"H!00 `10:X10l0d!W"!00 (1000!W""00 00000!W"As!00 00300f0 W"c"00 00  = =< = <| < 20 0 d20 0@20 020 010 01t0 0ݰ 1T0 0԰J140 0˰x!00 X10 0ྰR410 0൰h10 0ର80 000 0I0p0 0 ? 2 2h 24 0H 08 / / 0L 14 0 /8 0 / /4 . /8 / .T / , , , .T . - - - - , +L , , +4 *0P0 0d40p0 0[.X00 0R|00 0I\0 000 0;n0 000 0-180 0$o41X0 0&X1 000n 0 h!00 10 010 010 0@2 000@8 0߯H2 0002l 0ѯ 20 0ȯ20 0࿯" /;R\0@-L @AQ MO!Q0PP P 0 0 QȠ\ 0;BA{ 7G 0 Ѝ0;B Ѝ03Q Q 0A@@1 0^46` 0n0 A#6(7(k@{6F{7{   ;B Ѝ0 , +/P 0S $0S 0S P? @4@P//A-Pp8`Q) , R0( 4", 0R40BV@1@! GV @D 8,0400G0, 0 40@( 0 (3/P840, 0S004R000@-P0 R 0 I H SpTP @$ < @ ˁ?40P R $ R  R S /0?0$ R(400  0@=0U 0PE@T$0S0  0@4=0U 0PE@T$0Sx  ($  0  88 (90,K  @Uv 0PE@T$0DS, 0 D0@+@<0U] 0PE@T<($(<,00@000;00SB [t<00 00CS:0S ;008@ Q;0(0 S0(0@080t0 8904;0U 0PE@Tx0S  :00;0,@:0000 pC0 0,0S P<@@B0S 0*S3 W 0PC000000 00 0 0#1<0 S@0@0R0 RR<,0 0PUS0S00)9 0 <0 30DЍ  R S R  BP>0 P 0pBS 00 0 C0 S 040U 0PE@T00  BR00S  \ 0S0($<,(<0$(0 R x80090 00 80B4 R,5@0 000DQ1  P !ADL B \000D0S707 UR00t0 0P <@@c0(S0 ʆ  P<@@ ;TU 0PE@00 S  SP S> 7威@D00@T80PE@TULQ60 Q H0 @S0 0CR*ʆ+R h6006000LQ`D0ʆ;460\0T 00T :0PE00@SUld h ^X0Pt00001p0T :0PE01p@W0U Q 0SU 0PE@Tz 0Sw 400d50Uu 0PE@T:0ʆD+1 0D0@D8+Ua 0PE@T:ʆH ;0 H @D;8^Dp840WR Up1 0Wp!WC 0 0C 00 00兴D0PE0CD00*Dpl `R*$0ATU% 0PE@0 0Rl @Dᨁ:R (0,00C 8 P0l00X0S>0p0P0?0X00 p0tP 200L30 R=0 U 0PE@T20H?o20$0S0G $d2r ($B0#22cR<0S 420020 0L$Q   R D Up1p!W(R0 D ! $ R D ! $ R$!  $ R40,0000 100HU  PE@T  ' !X$ 100T100+000;8D@Dt00 R  B0 D  0P00 '\ 'L $?6?7?8?=?>?N?O?5 !p?P0?M |?H?A?L 8?J ?C B h?9?:?;?< t  l?D ?K d?B  | , h?E?R?I?F  ?? (?Q?GU p I$0Sp $Q (D0S2D57ZU0  0  xZPE0[00U p I$0Sp Q D0S2D57ZU0  0  OZPE0)y ʆ@8@D 10010X ʆP ;00T :0PE00@SUS98@Dplp7 ^,0 S ?0S2000$Q P N Q 0Q 0 !  B0 0  0D PE BD 00S Ss Z|0PE@ Tv*UT@ 1300pWUB 0p4U= 0PE0 3>0@\4 @Dʆ+8_,4威@D0F D0B(8<#0#xpW" h400,40:Q  ;8D@D _ 0;=04HL0  : 40040 0@S4Dp0I Z0PE@ZU8tgx|p@p ⨃ ^':l0wp 0:00pZl.  0S50P0;T050- @D{5威005@D0 %:@z 60050@ 00l(4890 (8(8:0; t600T606l 0XZk0PE@ZeUx 0C00Sd  0 7 0pe41q岠pT*US 0`4`UU PE1q岠@pW0`8@DQ{8D@D,8tgx|p@p㨁U7L0R0 PpC% 8(890@+Z\8@D 0w@D(3"8l0R0 0 0P00<0@@50 0`pC( (0R@D0+S(0,80080 0X0S>0p0P00tpXp040P40. \9008 (89= fSR: @3 0@0L9@0l900900 pC \ p dT 0  \ h P H:000 00威@DpCx:00:0 0S:0=0 pCwp@-@PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 Bᗰ4 08@V000PA-@`PpP 0R| S  P00S  9 60S  00?>?RP 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000Pi@Pp`W2@ R2Q <00 0 0S!B <@0 Q00cS R#2^ S3#Q0S1 R[ @ <00 R<0@ l0pWPV H R 00cS  Q # 2R S3# R0S  l0pS0pCp)x0 00 0P,04F0p0 p0 0 0 30 Ѝl0Sl0@@@d?S??P 0S $0S 0S P?,A4 BR/ Q /@o/?AA-pPWPw@ 0!(`3/PPp 8XG  ( 0(3/P00@d  Q 0  `!0P S>0Rp:oRS B P T  B T p X0Bp  (08#8Pp 0BS.  p 00@ Q 0  ` P S>0Rp*p 0BS.  p ($03/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?00@C/O-PM@ @㬰(0@U 0C0 0$SP $Cp`0 sRpW($0 p p0Ѝ0` Q`V00p<J\S 0W0T0S20b60s0P0U 0 CP0S 0SCU\! V ! 10T2 0 T 0SЍЍ0D?o 240%R00S020,0@0000,004@0D?o280(00<000 0 0 0C$0 0S03pP05 :^`033,0%N !@!00%!t0&00(@<90C1@ R@P00F3 0S C 0 $Q Br R$AVG  ` V$  \ F Y( V F(*Q BR  BR^ : 8 Q  Rc4 %Q  R]<  BB!   S @1P <01( 00 040(0( 0 08@, 00T@ O-DMX03 0\0300 C  2 000ӗ1х1&=  tx l0J B0x t HH^Hl0:8HpXT`!Dp4`ᶐH@ᰐ00Rx0 Pl h`0 \0S8 B0l0\000S\ tDP`ux0l h Rl R010#P60 6SC \0P8 Bfl0\00PЍl8  Ƒ R0Ƒ0Ƒ !  h0\0P8 B9l0\0|00SЍ|O-T $M t44Yl08H XT "D 4@@QH 0 , CA/B BP`&P]pƈ0Cs00&#ĠƘ@ph# 0C s0!I.S8# 30җ1Ӆ1&=  `tQI Y 6R06t0l0080EV` l H 0U#@H@0 Sl \P8 B0 l0\000S$Ѝ8ƈ6&6 &!9096tl I Qtl 1Y` +t1QZ 0S Q. Ql0mR ,l0`h@A p400D`H0` l @5!0 PH0 ` 0 ll R1#:\ 6S \0P8 B /l0\0r0P$Ѝ\0P8 B l0\0`00S$ЍO- ,0 IY!0 M@pܴ0UWZ0c&P* U! Ep:\l`T`F Z PUP!Y /ooW"Z  [ZW  0u0 #4 B %B B  0BV V`!0\ 8  \  0C  PEU``\  &Z  BP 0 P  `QP ,8\t06 AҦ,0l06\0 `QPl0&R65UP    R\ S#P Ѝ<``FV*\,\8 CLl \०6&S06l0R, ` 6V`!VX\, Q* 65@ 0CP!P 1RW G/o"S W  R  PR#P`1`!WH80  N\00\0_Pl<N^ Al 0Y&lR &&0R8  0C G6,AQ  l00l0&l8 q, l0BP0l0\P`1`!W 80 \00\0c  PR#P" 0S $0S 0S P0X*SES[SgSqSS9 C0//O-PM@`?o2P0S{@0S0v S t0Sq0,0S$ RgL0Dp 0CpB Ḭ*,0lp\p v`FP0*SUtpWR 0} ,00VpE*0*  00 P  t0S!ԥl8P pLpD@4H0P  ;. 0`RH0`0t0l t0Sl  l \  60 `h  00Ѝ* ЍA-@P 0S $0S `PlpP l0t,@0S@1VTU@80C =pp@-@P$ 0S! $0S H`PP`0 S0c``,0S`  *00 00(0p`p 9006p@-P@P pP,0L D0<00 B@C 0\ 0 1 0|0:l@\@t@Fh@H@x ` plp@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P( 0S% $0S" PpPU0&0R:`k6 @cU@ĠL Â0 6PUWtPPA-@P P 0S $0S p`P0p`P|0A-PQb!Tc@pTeAP0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`䯟0P 0 X  0@S P X 0S\\ \((PX\ L\  RL/Sv0S[Q gQ 0St0S 0Sx RH R .0 103/0@S0S>0 X0S S000 00#400 00 0  0#400 0 w0S0c0?o20 Ѝ0So = 000>Sq *S/0Sq00 0 0&S+B{l0S=  B0#2 2c0# 0l0Sm  q00010S9QI [0t0 0 0  R 0,0S0Q0Q0$ s0Q0s0R 0s000 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E00Q P p K 0S  0PESp p W *PG 0 ,0 SR0 B0Ztp 6l8&`6&6 &!909&tpl0pG0Qtpl0` Wt0SX$ :Xvy 6S \0S8l  B0 l0\070P0S P{X: X(0S0(0 Ѝ0S 0=0 0 0 0 0 0 S0 S00ӈ R01q 00 0SEQ0X P7 R #0SS@ }S  y 00#  #800#"0 w0 0屡 ,0 QR 0 0I000S'  0 0S0   0S,0SQ9: RY,0S  R0 0[00$0S,00  0$ 0S0   0S,0SQ@:T R+0 B0y00,0S!  Rg  S 0 Q10S 000#40R0q000SE 0 B0D0#  #800#"0 IQ"V\ R8 C0 l0\000Sjp\tZ(l 8`pR B 0 ^L 6ƅp6ƅp6ƅ!9096&tRl0A0tl0 Qt QX Q Ql 8`p0  X 0Sq0 B000 B000,0I ^ ^<00 Y Y Y Y Y Y Y Io^ᩒ#Y0C0KS`00`S&ƅ&p0Cs0 ƅ0 01I>  0001&=  &6tR` l0A0`ptl0r\ R8 C0 l0\000S500 0C0[,B:XF 6S \0S0,000K  l0 0000 B0<L0DC0C Цt0S*l0\06\0S8l  B0} l0\000S(10 \0SSQOMKIGA-@`pPStPB T00V0SI0S: (0sT Q 1@0@!A00000 |0 `jp( 0S*t l00\ R$6S S L D0 BC W060@D0 0!1 0Rppp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pSz $0Sr wpViV`F0HSr0FSRnZ WkFoY㫲[dV @!( `4/@Pk * @ 22)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOv `fx00$0h(0 ~ Ѝ@ @0  000'TĪ-M 0 AЍA-P@APUPq 0`0@ 0S  00 0x!(3/@PX `!@0 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/80S. @ R+ D PR% , 8 , @@ L DD  0 0C006& 0&;> 0$0;/ dO-Q$M Rß  0 R0#s01#0 000P hß`  % + @ # *{0@$qz0t0q0Qr01 `!;~`p':~)4~P(>6"r ~!P%0# ` R ` ! \B "@" ^$ 4 "" \$    ,!$\" P%P%%,!$\T"   <14 R#00S8Pt!@ 0SS.~S%T.,| S%. pQS.%,| QS.T% pS%T.,| S%. pQ@D.%,| QT T%0 0B00000S  00#s01Q #$Ѝ0T0 #2!0S01@0$0Pf 0 T ɘ h 8  C-`R! p `  0 H^00# PL  "`@18P\0 C @$! , C-`R! p `  0 H^00# PL  "`@18P\0 C @$! T @-@Plp`hPp@` 0!ȑQ0 0#B   | @-@Plp`hPp@` 0!ȑQ0 0#B   0@-1@4P\0 C @$!0 RG- ph Q R@O(sR$cW-mPVMD0@D\\\ \ 0\  \ 0\\00 0\\0\00 0\\ 0\0\0\ 0 00 R8΃7` cVV- 2T0HN0 T"R @0Q1X1H.7cHN1P @@1^NNTUD0 P P, R0R0R R0R0R0R0R0R0R0R0R0R0R0R0R00U0 l@D B @0 QD0'7b"c2HNVME1@Dq%R&-7c20Bp c!qÂ'b "0C0 Q H A R,A B8P C(0@P @@ /qR&-7c20Bp c!qÂ'b "0C0 Q H A R,A B8P C(0@P @@ /q/ U/ 0`0/T46ς 1O- p:PTU$1` Q U @ σ1\KU`0 ẠZ 1 @1: 0V: Q- ^ pQ Q Z @00O- |ş pjDMWP@TĆP4Q @Q- NP0P4 \ˀB XS-ʨ&σ pPpp Q-Yp& B&^ ScB C 00 p&P4 À fXQP4 !\˒0C`K P4`ˀXT$`; BXKT$T;!P P PQ͌Q- 1^ 2r6w|&A `{6P4pST.0J`@T41\0 Ѐ0 00P 00 p0Ӡ !Z㲰_Q=0ⵯ00 PQ !  W Y ^PA ׼V БR"S & &  R[P- Y> 0 Ό KK0RPKPG 0 QR0C Y> 00 B 0[0000C01 KR  00N 0 @ 00T00s P\ R @02^02N00 R0P\DЍWP 0 [Q / !@LY0S F0GC#6pQ@Z p J  =A-P@^1RPA@D0+}n@R- R1>000^ ^P0T0 S ^ SΌP^00 P0P0 S0Ѵ000°0Ѵ0O-pMWPP00RF@ʀ+m!k `  Rp: W1 R5 Q^pp`0`0p#406 R`c^@F v0`h7W@Hs`s0p R`vpWk @P0 [ЍZ㼆`f Zv` !.0@ cR(r C0` P`P`0P`#4`0f`fTfἆv`0Pc^h0v6v`@``@`.0C0nU6~ BSr Y3@s0P0P00@#4PP06cR.0C 6W W~  @[P0U R: 0@P0dS8`s0000`#406@D@0cUSFuP TcN0~ Dt@P@P@ 0@#4PP06 c^ 0C606 @0P@cTh0v@6v```@@`$D@F0C0@dUD6t@ S1 Nr 3@s0P0P00@#4PP06cR. 0C 6| @[P0`ἆ 6 Br T@PFgX@uPF Br C0@6[O-ʀ6k^pS㼖Mw 4004@0030 0300300"10` cy Rwwppp p .0CnV~pp~漖6S&00wp @4  `! Ḁpb W zp&z帠 B pp't pv pgXw&wpaY taN~bpiW vp&v``` Ipp`&d`v pg^w&wp0CS㎀aޕbޅಐaᶀir^wwp` pp p"$ InX~pp~漖 `#R~ `d0Cs0yb ^wwp@`pp`p. BnS>sps6pS἖_0 c Q~P~"`kNPP!``0C0aR! 6Ѝp἖8p἖p἖0k. 06Ѝ ʼ6@-S k>@@0 #400k.06S0k. 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&}pʀA-@k`P s0! Qrr  pp "$pp &bS1 B0&u 0  u0#Ġ  <##4U0 0 ԕ   *60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-*k΂6 Sq@q;0PP@0@#4PP06c^ 0C6 S0Ҽ60k@PP@0@#4PP 06 0C6S S00k@@6 0C6006k>@PP@@!PPƂ0O-p0@S M,0S ─&]P+ (+%0 N. 0r?010S@P j600&6 0!R1Q  S030#Z0Sk0 r Y9s00 00#40编0iR# I⼖r0(+ ,Kr Y9s0k0 00#40编0iR# I⼖r0 Yڶ 9s0kΆ000#40编0iR3 I⼖s0 Y @r 9s0k0 00#40编iR! Ir漖D Mk> ! PaR, A   / ! YqqP἖   00`" P0Q ;S ;S <SE S 0R  , &] Pj0S  Z R, 00G. 0R0 0xS0   0LSI>W&&&& Ѝ ЍO0 &k0p R2 ʸ006N.V l s000 0#406 cP 0C6s0漖@q9s漖9 9s0漖s0漖 ` :Ɠ0@-PV Ɠ!DPV @Ɠ@QF 6@o0ƓAƃDQ  !I.!ѕ"х&  p@-@P`d0P \0PV  @T @咖 00@pe'@ araydict@-M @PoЍ蜚@oЍ@-M @PЍ荚@勚@Ѝ@-M @PoЍ|@oЍ@-M @PЍm@k@Ѝ@-MpP` @P \@Ѝ \p !/ЍL0@/T 0p@-S P@0 C`$'0@ T @p- 0 p0A-S Pp@0PC`'0@T @000p@-S P@0 C`0@T @p 0 p0A-S Pp@0PC`0@T @ٙ00֙@- MP p 0S @p0@C&`V ` Ѝ蹙0 0 Ѝ貙 Ѝ@- MP p 0S @p0@C`tV ` Ѝ蔙0 0 Ѝ荙 ЍA-Mp@P `P p H. 0S P0 Cq@ CT@ Ѝc`Ѝ^0`0ЍW0@$.T` Ѝp@-@P\0PPpdictp@-@PP$0P p6!00pboolp@-P` @P   @Cp@-@{@@-@u@@-@o@@-@i@@-@c@@-@]@ @-@W@"@-@Q@7@-@K@L@-@E@a@-@?@r@-@9@~@-@3@@-@-@@-@'@@-@!@@-@@@-@@@-@@@-@ @p@-P`u@P  [ @pp@-P`c@P  I @pp@-P`Q@P  7 @pp@-P`?@P  % @pp@-` P,@P   @ppp@-P`@P   @^pp@-P`@P   @Lpp@-P`@P   @:pp@-P`@P   @(pp@-` P@P   @pp@-P`@P   @pp@-P`@P   @ pp@-P`@P   @ pp@-P`@P  o @ pp@-` P@P  \ @ pp@-P`|@P  J @ pp@-P`j@P  8 @ pp@-P`X@P  & @ pp@-P`F@P   @r pp@-` P3@P   @_ pp@-P@J(0P p0P 0pstngp@-P`@P   @< pp@-P`@P   @+ pp@-`Pb@HP pwP U f00ppdatap@-P`@P   @ pp@-P`@P   @ pp@-MP#@ d0P @Ѝp  <)`P  @P`{+Ѝpstngp@-P@ (0P pz0P 0pstngp@-P`@P  I @ pp@-P`@P  8 @ p@-@R . @ p@-@0"Pw $0P p]00pboolp@-P` @P  A" @j pp@-P@P |"@[ p@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@%@-@!@:@-@!@O@-@!@d@-@!@y@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@p@-P`@P  ! @ pp@-P}@P !@ pp@-P`l@P  ! @ pp@-P\@P !@ pp@-P`K@P  f! @ pp@-P;@P !@ pp@-P`*@P  E! @n pp@-P@P !@_ pp@-` P@P  #! @L pp@- P @P \!@; pp@-P` @P  ! @) pp@-P @P ;!@ pp@-P` @P   @ pp@-P @P !@ pp@-P` @P   @ pp@-P @P  @ pp@-P` @P   @ pp@-Pr @P  @ pp@-` P` @P  { @ pp@- PN @P  @ pp@-P`U @P  X @ pp@-PE @P  @r pp@-P`4 @P  7 @` pp@-P$ @P r @Q pp@-P` @P   @? pp@-P @P Q @0 pp@-P` @P   @ pp@-P @P 0 @ pp@-` P @P   @ pp@- P @P  @ pp@-P` @P   @ pp@-P @P @ pp@-P` @P   @ pp@-P| @P @ pp@-P`k @P  n @ pp@-P[ @P @ pp@-P`J @P  M @v pp@-P: @P @g pp@-` P( @P  + @T pp@- P @P d@C pp@-P@. (0P p0P 0pstngp@-P`@P   @ pp@-Pz@P 2@ pp@-P`o@P   @ pp@-P_@P @pp@-`P@ HP p=P U ,00ppdatap@-P`@P   @pp@-P`@P   @pp@-P@P @pp@-P@P @pp@-MP5@| d0P @Ѝp4  $`P  J@P`!'Ѝpstngp@-P@[ (0P p 0P 0pstngp@-P`@P  $ @Mpp@-P@P _@>pp@-P`@P   @-pp@-P@P ?@p@-@Q 5@@-@R  @ p@-@0 P &&p@PPk 0S f pN_ 0h@-$@@F ENxP 0R @-P Q Ǝo// 0S p@-P`@`PPpwP p@  PP ᖎ0 o@-0  0@-P Q @聎@ @0@ a0 ( (0( b0   0  @-0< D |m0@-P M`0 #@P 0P0 `  Ѝ%pppP` ! @% Ѝ%L<|@- #@P $0 0 0 KdA-pP n#@P ~0 0 0 ᷌`]#PP  ᒉP `0 000 ,0X @K L  @-@P @ te-@-M(pW ,P0  P$@P%#`P  0 P$ UЍ@Ѝ/Ѝ@Ѝ/ 0 0t @  |E Q@-@P Q@ 1"p@-@P x0 00R0 P"0P Q   p@bppI, ٰp@-@P `0 00R P"0P Q   p@pH 4P/0 00R /H P/<0 00R0/P///G ؼ0P @-od  QP  QQ ~ /G 4P/ 0 00R/G@-@P \0 00R  V"0P Q U 00F ׀P/00 00RP///Fl @@-@PM /o000"P R Ѝ R0 ` 0 `p"PP 0 S  R L  # `PP H$  00F L @@-@PM 0 00R ЍQP! 0 3 pp !`P 0 S d P e# pP` $000( (0( $0 rE h 8+ P -/o<0"00^ R  R/DP/D0 00R /@-P !oC xP/D0 00R /@-P oCd P /ol000"\ R RP Q  Q /C Ө ӜfP 40 00RP ҋϋ/Bx HfA-$0`SM"P@U Ѝ P0P !pP 00  0wP S U# !@P d0 0 0 @Ѝ4 PSP  (A 0 //p@-PQ& @R 0Q: Pp=" P  `0` `0 |L0L L0 t808 80 lp , H (  p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ PpJp@-@<PEPp/>P Q 7P Q>/P p@ ) 0p@-SP` @ 0S P@p<P QQ P/P >P p@ p@-\@<@P(@Q Pp$pP p@  $@-@P@ dp@-@P  PP 0, 0p!@!p@-PQ@` 0 S S   CQ R 0 S S CQ\<S0S !S0-S0F?o 2-R0S0S -S 0-S >R/S `(` 0 S S  /S  >S   C\  R `Sr 0 S S  /S  >S   C\  R0FU0 P[ UPV0/S_ 0$00>Sc Sj 0SI S S   0CS R` 0 S S   CQ RS3 `0 S S  =S   CQ  R  S! 0 S S=S CPQ`B`0"S0S  0"R. "R+ Rp`FV0S 0(0k(0S0$00>S`0``000 0pL L0L H0 e0`tC  >R00p ( P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /@- ToO--l1KM0 ` 0p0: 04A @ Q, [ TPP 0P3/P 0吊0  @04/P 00 0 PPPKߍP@ 0@;/ 0 @PKߍ N|G-@,PPD aq`p@@0 S S   CQ R@<S,  IP   CP   =P0 S -S@0-S>Q@@0 >SS @S@P@ A-PRMePp`0 @T- 0@0W   W[ 0 /R C 0CW /RW  CW0  B/Q !@C@T@!  };@04D.< 0Ꮖ  R0 *( 0 0%[p@  U 0@,f뒊0@ۍ茊? 0 ۍ腊 0 ۍ S0p PDLp !pe@ xC-`MjP@P5 , p`H RpB pEe0R:p#0 `if00 p*  00 0Vfp" 0PPЍ0 `Ff00 p  Ѝ @Ѝ@@-@ m@@-^P 0 0 # l xO-IM  @T V 6/ p0  !PS @Tv 0 R 2/0P`^a P0 p 03/V@ 6/T o^T T @T@. 0S2 03/P V 6/W^0S @0 R 2/0P`[^ P V 6/X3 003/Iߍ 0 0C/ 0 0C/ 0 0C/ 0 0 0 |0 l l0l B0C/{   x h H D $ E t ; P p@-P@PP  P $0SP  R PpdKRP P VPP , `PP \P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0P 0 $ \00 Mߍ R00 0 0K/ T  } 0/0/@-@@:P 00#  R0SSQ///@-@ L`Hp@-!@(MP  Pl  R```[P(ЍpP v(Ѝp  : x ~ $@-@@-$@@~X'p@-M`P@0 @0Qs0*0 00 Ѝp0"Sp@-M@`ׇP0 Ppq 0 00 Ѝp‡0"SA-P``,I?~@P A=(*pP :0&~@P (_p~W@(0( (0 &8 | | |2P S0 P \0/S 0 P*/\03#//0P S0 P \0/S 0 P*/\03#//0@- P@M @ cЍ00@- P@M @ WЍ00@- P@M  @ IЍ00@- P@M  @ ;Ѝ0@-@P ,0 00R# /P/0 00R /2 S0Q  P*0  S0 */@/0S R* R0:/ /#4P $0 00R //"tP $0 00R //"<P $0 00R //"P $0 00R //!MP |0 00R 00Ѝ/2S!  P * 0 Ѝ/S * 0 !P/X0 00R /2S! P *0/ S : P/X0 00R /2S! R/0/S : P/X0 00R /2S! R/0/S : $P/H0 00R /"0R 0 /SP/X0 00R /2S! R/0/S :\P/X0 00R /2S!  P *0/S :P/X0 00R /2S! P *0/ S :P/X0 00R /2S! R/0/S :P/H0 00R /"0R 0 /SP/40 00R /! S *0/PP/40 00R /!S *0/P/80 00R / 0S00/P/80 00R / 0S00/tP/T0 00R /2S0 S0 /! /(P/80 00R / 0S00/P/40 00R /! S *0/tP/40 00R /!S *0/,P/80 00R / 0S00/P/T0 00R /2S0 S0 /! / P -/o<0"00^ R  R/$P/P\ /QQP/ZP/P\ /QQP/ZpP/P\ /PQRQ\/ P/P\ /PQRQ\/p@-M0 P000 00S Ѝp$0@S `0-S 0S0xS P T P ?ЍpPP mXAo/A-PP@l@Pp t{0,p0P4080<0lP`p @Q@P@hWzl@-0@ L  z@@-(@@3 1zz ὀ⺀@-@@O-4@T `,@@D¤@`T PpQㅑ ⛀PZ P PZ  0 0 l od lz @-R 0P< P 4Q ,  D D0D @0 0 000 0 z\ n l\ l(c n l lp@-@M4 00R<SP,0 S R( 1`V9 P` 0 01P 40, 0C40P0 ,`ЍpS 0 0D =Ѝp ЍpR t t0t 0D %\ \0\ X0D H H0H a0D  m k ka m\ kT j m8 k jq m k jhA-@`,pXPP W 0 !u{,P0`,P0`G-@P MpP j 0`0Ѝ!0 `P (0S0 젟0 P (0S$`V00  0^P 0S  `OP  IP X `0 vP %( (0( $0\ g| Xp j i hLI 0  @-0 { j h< h 0  @-0 m j i< g0p@-S `  Q P@30@-p 0  0 Lp i g gL{p@-0S h`@`P)PpP p@D 0  0 ' H id hd f40@-S , 0C!40R @@ @0@ <0B/ , ,0, (0B/ h h fP h gt f,p@-@PP0S ,  Q <0 0 p@`O-`p@40Sa HP@ -P 2P0UP 1001000`SZ 0<0S 0  R 圑 # 00R&P P [H P ?P P 0  03/P PP 0 S NO 00CS 0 0PS Pxq@` `0` \0J/QL L0L H0R/H cP b a f e8 c` e e, c<D@-@tx0,S<SSo4PG-J `P0pUIU@* 404 SS= G000,0 100,0$ 100,0, P  ?o 0 2\0S PP*    0S!PPPPD D0D }0., ,0, (0. c cL a< c cP a G-PP& 0 0R!p4z`P 4 R @, 儡ᄑ! hf,04 儑@ 0T:80#b` 0P 0  Q@-P80080/p@-@PF80080p@?p@-@P 80 0R@ pP14@.ppp@-@P \0 0R@ pP`00S@#:p5@ A-@` T |0p0WPP X000L0000@S 0< p pA-`P 0 0R4 p40S @40S,0 PP@ppA-@P 0`0VpP0S P @T @ @0@ <0R/@@T _ _ ] A-PP /o0`0"Q@@T 00R pu @P @T j@ 0  0R/ ^ ^$ \4O-@PM 3` 0R PЍ4 00R80p > PP @-`<P /ЍSP uP3  004Q\  4[_ P,10Q1 0 |P0ZUPE Pm 0P !c 0 ,0傁1`4 <0 04 <0h z,XG<XIXKLPUF ء0Y E L  BuP" D 0,S<SSLtPP ,0P`<04 0<0v100 puU.  ,P<PP_! c,04 `<0 0P4 <0P 0 |0^/l l0l h0^/!T T0T U0c/xgtfX [T YL X [0 Xl X [ Z X\G-@S ` VP p P K I00C0 Gr 0 0i/Q Z Y W`-0P M ?o@2 ^0S Ѝ00 S Ѝ@-PP M @1 0R Ѝ`@ 80  Ѝ AP 40 Sp@ R(*,P  C!b400C40<00<0h h0h d0s/T T0T P0s/@ @0@ <0s/ X W UF X` X< UH X< X UG P/?o0 2 R0S/00 S/ 0P -?o82 ^0S 0 S/P/0 000R/pP/0 000R/D P -/o<0"000^ R  R/ p@-P@P P 0 03/P P @ p@pA-`P @P%pP $P p0P  pAV Q0p@-P@PP x PP p|0@|@p@-{@P 0@ P@-@0P P 0R R@-P0S /Eo/808 80 $0$ $0 V| W VL V V V,O- 0S7 @`P. X0tqPpP 0 P  P X0UUUB!#1<00@.B,? P@HPOX% XP0@#r 1 >@-@DDMT, 2ЍhL,L @-@P (0 0RP/0 0R/hP/0 0R/@0P -?o82 ^0S 0 Sj/ 0S /$0p@-S@ P0 P 0 P tt8h@@ @@pLLL@*@808 80 |B 0  Z@-0 G ? = ><40S 0C40/ 0  @-0 4 ?\ ? =0p@-S `  Q P@s0@p 0  0  > =$ =lZp@-@P t0`0VP0S R <0 0 p@$ $0$ ]0 ߌ >4 < 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@3o P//-ptx` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@Pj80 0 @ 0 048# /UUUU3333  u*: S0@- d S V Sb00Z r - w-!= S @^ >S-00 @Sx00: r-w- 0 SPD !S-00 Sx00r-w-0T! P8 P2 P8 Px 0    0Ss00 P! Ss00 @ Sp00  Sc00 ?00 S&  Sw00 Sl00 S00S00t 0 T 0 - 0 A00a0-00{d00xs00uG-bapP`8 cP3  cpP$ 0A0b`@@T pfP0=S AP`0AT CU !mcbA,n 0 ڤC-dd"d2dM 0 P%L\Xm P`` 㔐嘐圐堐夐 P4_p@Z xp  ,_p@e 7,P  $(0Yp@] `0<S0<0x0@S<00<0@DH!(<](_(0F(Qc<1<0 00L000_c(X %m0S ep@ ^ ^ @ЍjOoBЍ@m00 ^ ^ ^ " " "l !t O-p`M@ hP-TPn +T@`0 0Tk W p p ? 00{^ 0t^ P p   @00Ds \a0DSW0DA0DS70DURX : PQ   S  R #m "000R00S 0qS 0F0 0 Ѝ0S R0 Ѝ0@0`00XS00 C R @0 p` 0 A BRW ppp@-BR"^< p@000N@Pl0T0Pp\p@-BR"^p@;@Pl0T0PpO-p`M@  hP-TPn +T@`0 0Tk W p p ? 00] 0] P p   @00Ds \a0DSW0DA0DS70DURX : PQ   S  R Ul "000R00S 0qS 0F0 0 Ѝ0S R0 Ѝ0@0`00XS00 C R @0 p` 0 A BRW ppp@-BR"^< p@000N@Pk0T0Pp$p@-BR"^p@;@Pk0T0PpO-MHP@Q@0@U P0 `8pDd8d c 8 =( Db` 5匵(000 0(ph z@P!  PsI`00S/ E`0=S0`S0`V`X`V `ሀ]P2`0#S LPU @$4 0 l4 30GލЍ(00C(0\o `@h 0 P3yP_@ Ph 0 P yP 3  X  X0S(00C(0{  0`P,0lL#`p(0 [  P[0U0 P0@008`_0 %Pھ0 0hPC 40`-V0`i0SW SU h[   a[   Z[   Pa, R'F0@  f_0 l 1 0,P(0,0 S  P (0S 0  0   ,p_xP P P_0S 93$0+pgd#(   4  X  t 8  X ( @C-`D!p@1 \M04!4P@0T00  0 x|0000000 $(,0/P!Q P,P[PVP0 "@ d T0 0 T0 30 \Ѝ@  $ g  , -MЍO-P`! dM \ !<@  p0᐀刐匠0$000 0 (,048ȁP80Q ,  VVP 0S 0 @噁 0 0 \0 30dЍtR0 @@p 0x    ( -MЍO--  M  *в Eo0h-04P MPg 1 S Si #@ # Sc  0s000 S SU S0 R R R R B RQ@  BQRS 0 S1@+S8 -S\QUp @Uv0S Qx : 0_o0p`R0+S6 -SI ZPPUpwd WP` Pp@ S S 0QUp @U50S_ QA : 0_o00p+SR0S @S%: PP  /_opR0S @S-: PP`  _opR  _op`R pPpU+ t0 0 2 30ߍ  ZPP I  D ^ @R O-Ÿp2 MM0ȍP`&N 0AM.0; APY \V ܰ + T0+ G` 0  0  0 @P @ P3H0: S8 1!0 &  !d1 0 8 30P ލЍPP@P 0 pzP a100S1!0 &Rw jP \0S  S 0 0 &0 0 &H0 |0| 0 &0 p; L hD 0T 0 \0 P  A-0M@P`p [00  0P @T@T 0 PP a0Ѝ @[P0ЍP @-|| $M\ 0 0 4 (0 0 0 30$Ѝ x-xx $MX 0 0 4 (0 0 0 30$Ѝ 4A-@`p GPV[  0 p 0Lq ^aLQWLALQ7L \  R AAQ  R C`0C R0 ą S: C    0G-h@P?0 @RP:T !2*00a00q,,` pQ. ?`??p  S*! P* UR*0 QS * 0U000?0R*00x?Rp1?p#`@0 V,0S0 ? S*: 0 T:   4p@-PH@H0@`M000 ̈́@wЍp\0@-M@@ 8 @0 ЍD X-,M$0 0 00d00000 6P !4 0" 0,Ѝ 0ߴ@-0M,0 0(00@$0l0 00 06P ! 0" 00Ѝ{Z 0 O-`10TM0L000!008 0000 00 00y|zPPS @p` 0 p@P= 0+S+0S(( P,$ 0 (% P 0$,$,0S 0 0 L0 30TЍ0 rP N#PZ 0  xO-!1 0IM010pUtpPPQ @`T 0 `T@P; 0+S+0S( P  0  P  0S 0 0 1 30Iߍ P VP{Y 0 ] 4  0/80@- 0 0MPQ000@ O0  @" 0S0 0L @0 0 0 30Ѝ0!PP ! ؈|@-@ 0FM M 0 `0d40pۅ PPd@"+ P (Y0@#Y @R@ 40 0 d4 30Fލ Ѝl0@-P@lMt p0 00d00嚅 奅q0 (0 0 d0 30lЍ033@-<@<M@  Q0 Ѝب HP1Spp//0@- 0 0$MPQ000 @O0  @" 0S0(0T H0 0 0 30 $Ѝ0)PP c ռG- M砐 pP e$EP;0F U08p;t0' T CPP!  T0@To0XX0@SX@  0 0 4 30!܍+AX0@! "0%q0 ?p0%0?SP@@g ?L0gS@pG"# ` *~0S@@:`F A&Lp@- ! 1 0M0 00 P@R00 113R0 0~? S `` 0~? S U PE0"0 1<3R08 (0 0 0 30Ѝpn , m0@- 0 0$MPQ000 @0  @" 0S0(0T H0 0 0 30 $Ѝ0)nPP mL lG-p QM稐  P 0e4EJP<0G 0U08C;t0' T D2PP!  T0@To0R0@;R@  0 0 5 30"Qލ+R0@$RU@ 0P PJP@~p p`@KElhkx0 - M Ѝ0@-P@tMt p0 00l00 :0 (0 0 l0 30tЍ0jj< {-0 00000{   gE#ͫ2TvO-tM, l 03?0 R `00 @ (p 0 " 40*i (0 8` h;" 0#0<8i;b iˌ! @D`ah`#h,bhD͠lbˌ @b+`c! . `@$ @dLb,Hp`+ak,`&i[` Lp c c;l{"p'0Pp;a;ab{ p'Tplhlˇ`{#p' Xpɠbˌb+c{! p' \pb)`+` a{,p'`pc c;l{"p'0dpc=a;ahpPrx|p pP%Pb{ p'dkhpllˇLp[rx|p p. pi`$`&`#. 0 ŒȌ̌gˌ ʠhlbeb+c!,/Ll̠`ˌak. `ak&` p @c nk,`nk&c;0dc=a;lk `lk&a4an`k#``k&nXlck!`ck&lˈ T`bhl ` )hk`jk{idkʠ`ˌa. Ha)` 8؞ p p'dK@HeK@( nK,lc @nK$f{c;\0N<@eK@Hk@d[a;plK @lK$< 'paip`n`K#@Ppn`K$@LlK0c!plˇc. Tpn`a$p a,` Dpc d.p d,c;0@;ŒȌ̌kˌ ͠jˌ 8a;n{ pn{'ad8} P%plj{hdp`[#PdK`[%PH@|BHLf{@\fK(\n[cK!@cK$nP@` aK%@aK$` `` gcKPP茠kh+l@`&BHL@kK`P@BHflLkk@)kK@PJe)4PlKRX\Pl˅SNzmv03T@e;#h 0g;:j{i ( T0P@fa"ia(fk`H@hekb.b(e[P@@]a[n&4@an(L@phbb+ `(f%@ f!id<@ne+(n  `@e+" p'd ` lp\@b)f+h !@fKh 8@ @l˄* ꩠlKigK @ `.p` (@le a" a,enM0hKb  b,jhDPna`$P `,a`Pabd.P b+d,8Pˠ`ˌn+!P n+"` dP`da+, a+"d ` n{XPg+, ` PT`l+(` nl+"eZ`[ h(@ j@$4`@MiK ` ik`Lb*a+h 'fjnkh aXlg "g lˉ hȠ0hˌhb;. 0Xb;#0n c<g 40n{,`,0p'pl0g|b{b+D0@g;(0l0l 0f;0l; 0# -n`;' 0#0c:l˃g;. 0# 0L e;`;<l+ d`+f * ♠j n , ` g Pp8 pj{ !`aePp"$ nh $h( l#!\ n ePhi+Zd[c ! ahlˁ lep`. !pHg}c{c;0 "gH da @f "nk,`& d@0-i+ @qp@F F`,00vF0@@NP#@jF fF`,00]F0@ @P  @@PFMFpЍpЍ'D*0B@@- M`Ztqt1pP@P`@@T 0Q 8P Ѝ$ }ZP @ Ѝ@ qZP"0S- -S?@0 0000 P H0U 0SP0+S@@D!0DSX GZP0S +S!@ ?@!@ Gx  X ?P L0P00 1 R/@P/!R/E(0 @>R0 00//Ex@-M Pp @7:`P`W0D>S 0!31000 :Ѝ>SH 0!31000H00H00E$/-p@-MP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( DDx T 2x=Q-C #XA\#\ !  +A qR   R  +S -S =S000@Rh-+@"      000000 0@-A @0RuS#WSRX0CSH6 ,0!0R \PSPQP\     0 T 0+S -S0@IO-`VLM 0`8@ (P(0,00040+p # `G @ KBG@T2h7 `000000$  0pa0HSvctsrqp<nmlkjih/fedcb,G00G0@QG`@LЍS!  "=X  R"   P:0$`iG @ $AaG R$ "@`0 偡   Y 0 S:$`GG@ $A?G0S$ 0"0C`ኡ0W X  0 0X ,X +X@ 0-S=X000$00 0|P @X B R񏐕~|{d]hvc`S  Z0$`F P wAF RV$ "@`0 偡   , =Xx +0H?oY20S ZrW 00 X00 Z$`FP CAF0S"$0 ""@` 傡 0T 000 ~W  z ;xI?vI0t0rW  n |0S 0 S3*-P"+  @ LЍp'}C~p=X   00$`LFP @DF0S $0""@ `Ⴁvq$`4F P $@-F0S" B`01DsP{F00LЍ{+\-L 0 +0B XR R  +0B 0+R XR  -R  X@PPQp@P @-0@ M  @/p`ЍP 0 @-lE/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`4P+4U PU  0  qP@P PPr\P \000~p@400GDx0 @00S ` 6D00@ Ѝ$2tϬl\@-<1T00V0S (04  A0|#R0h0$02``0 0,00d0 `>0,8C@ 0`V<Ѝ200$020$0~20,000PGU0$UE Pd@1$?@PL@P|2@TPQ0` 0 q>Q0`V0 S 0Sn(0Sd0 \> `0 0$0/ 0,0,01!  0`1Q1010Q!1S0400 !!/P(0:,10`0040d0P(0/040d0qP (0&XF>00Z0!Q5A0H$0A``0@E0,0 `0@p  0 h`M`M`K2@t h @zGG < | \ @  }SQ x |O-0@PMQ:Uf ` V# V* V U 0T STЍU` V V V ^?@ T @P00P`岀pX```` `& `X `p0 Up`0岀X 0 SU:0S#pP0Q P 0관` X?[*!]-E@-0 M0M040K0s0S0 0@ $03/P H0 0 4 30 ۍЍlPW''\G-`P``a V00 "5E@P5 apPI 0SH 0p R0CÐP0P1 U  |\   1`V*o`Cq pP Y  !@-A 0   1  O--``ş MMMčDş尠 UEp` 0AT/*0U@@ R R0 0C?o2 000TU$00 S0E0 %0S}0000Sl`0+(09(0 @(0 2/Z(0 0@ 40000:0F,0 03/P   0S00*  0.S 0 S R V: R R   (0P8 (0* R $ (0TP(0 , CQ/ 31 C10 0 0 P000$0 000S  0P80: S 0p" $2 MލЍ Rv 0 r R u P EZ(0w@T  r R c0/@ 04/P 0 000c$0 00 P05 k 0.Sh0SS 0. SbO Rh  0@ 0)  2/0S  00.S8 G (0Ps (0 C 0 &P% 0 0? 0Rt%C0$ `Y? / 0 %d%@* d "tG-llŸ KMMč\`pؔܤ1 //\P  @P\/\   W!1 0 4 30mKލЍR8/\3^*`PW0/\ \@ @PP 0   R  = V/R * R( R 0 0 00`  0P&K r R @ (03/P 0: SW/0 0Ɓ Ɓ T#?/0 P0PHO-@ğM $M; ~R0`PM 0 pR  ᘤ嘴*R1 r 0 @ R ?R! [R!^ 0S0 R@000WS 0GZ 0< S L@V 0, @Ⲡ \< 0 0\S 0Ჰ@ 0  p G0 R/R00B0 4[S 0G*0;  P4S 0 0CPJR*0S0;R{ W @G 0Gz +@PV t"; 0 2 ۍ$Ѝ@P 0Dj Sq 0]S2!^020 ]R0  r -R0]S` s0010 ]R0 @, ! ;   LXn \Rk0LXh 0\Se0@* 0Q 0A  001A0 `)Q Y;P\@0  p10Pd0G*0 ;PU 00 [0!^0 0@0SJT@aP?**[!-]l O-MMQ@`P8x9  @ |60S @}\ \ [\ {\^! N\]\@ \  ~ލЍ @ ]RRR @ Q+[S0 S]S*S [0 {S &,S^Z ' B0S00 &0[ 00ލЍ0]SS 0]SS }S^NZ  J B   5  A- 0` PpM 0 S +{\ @ \ {\@0 pGP  Ѝ Ѝ0}S0S ЍA< 0 @-M Mp      `KP ^    ލ Ѝ`\ [ \T@T@I\@L @Tލ Ѝ@\p@-`Pp@0T1@D 0CP@DP ktg000p0S. *S9 ?0Cs R#S 1  \0S /Q0 S 00 /@-0SD @#S@7 S S$ S" 00S "S0. ^ \S 0000S\  00"S 00 CR S 000   0@-QM M 0P 0 0@050 0%p @EO0 0P0 p \0 0 5 30 Qލ Ѝ0D04 P 0 d< cX fpH epTG-pepM` p #S$u;0 P@$ 0S %P @ 0S;0SЍt `p+0@S 00 40   0Sy ltlpp0fS0fS 000#3R0 $ 0000@SX 0oS 0oS0nS 000#3R0 # 000 T3P 000#3R0 \# 000H >3P 000#3R0 # 000 (3P( 000#3R05 " 000 0#S RP@0 S00 *P0@@0Ѝ0 S SD 2P 000#3R0 " 0@00o 2P  2P0 000#3R0' ! 0 00RЍ 000#3R0 P! 000<< 0@S 0 4@  2P =Q)0P0 2P=Q 0 @0 0 ༝ )0P0p oPo a ann0m `Pm `m,m _Hll ^ ^k ^k ^ k ]j ] ]j0A-0 `R % :PpPpr@P >7P $P 0S 0P@ p0'@0000@'@ h0 UT@=' R P@ᐺ#}800 '0-'t8Z0ST 0 h800  8V .  Pᐺ0S @Q800'0'PJ8P0@Y0 0Z P30 0@0@ ' 3 0 00  " @t@'@2 0 00  " @t@'@0'0_p84M 0000Pfl \0S 700'0医'@7@ vPw {f E@' ^(w7000`00R 0SCN @@ H)x0@' 0>0@:  @' 400PP800P40@*@>0 7Y0 P @ᐺ0H P@ᐺC0S0  ' `00C0  ' P㐺@% P㐺@ P㐺@H@{ Z@ UX Z<8 T@ S R R0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpFpP P Ѝp^^`A-@@0`S&@@Q)pPpPS @P  ᏻp @BAQA3M0@0 |p tp ^L^4^^p@-p`pP`P@T T0T0 R@@upP00j]@]$TA-P@P`@p\0S |@@2 R"@`Nr/@P0060@;\\@-ú 00 [C-`\MPf*@P- 0S|00V $"$ UpЍ X0P  $ R%pȁYT™  0N|㠁0඙ಙ|xxଙ0R1 0QG Br&Q&R-.4 p0ሀ Wtq{\ SzڙHv N r N[[ r NT q N N M q p lH L OO--044% AM M $ %u *%p  000 0000+0 P0 40 4 P P @\ P 0S p400#S \ P 0S 848d0``\ P 0S 4d0``\ P 0S 30   \ 0P 0S Aj30\ w0P 0S 4jd30\3PE0 +-D3Dc0P`0P\ \@P 0S )1P0[[ \2P200xS0xS0Sc 0P" $2 Aލ ЍdR @P\ $Pk 0S 8200#SB \ P 0S 2R0P\ PV 0S 100xS0xS0S 10 0sS(0wS%0S"x! t1tQ0P \ 0P 0S i@10\ 0P 0S i!0 ! 00P00 $ 0 000 00r1P LhY$ LYXX@ KX KpWWWXWHT V IVU I<UUl U0 HTT GTT G GT\TL p@-hPP0S P@L@@p@`@` 4P@wSSd F H, @ A-P@P0 $S Uppp^1P Q0Pp<`<`YPpJRR E Gt A-P@P0 $S (ppp11P $0Pp<`<`,PpR@R E F 0p@-dPP 4P pD`D` P@ ppQ D FD T@-@@P00QO-ş,MS 0 y p5@0`|5000000000T 0PC  00s 0?S !SR *S T 00  q*Q .Y Q" /Q0S "pP [S7 \S0 Sp 0T ≐  R?\~ \ *\ p[\ \\0 SpQ 0 0vY,ЍYm /Y T oP^\!\00 $0 00P /S \S U T0  0s0SE -R X0 T ᱰ0s0]SZ$0PS + pg hT ⊠ẰqQ]Q \Q A X XY /Y( .Y)0S& 0W 0S 0W/S,Ѝ/Y00  0S6 0W 0S0 0W/S-0Sp0ST n UT  ᲠqQ p&P [YpqQ 60C 0T 00yY 0 P%/Y[ 0 /!P @0P@-@ P Q2 0 Q 4Q>oa >\ >Hp@-@`PQ/P LK/PT00pT00p"2 0 p > =O--0 Ÿ M apb @T ` !1 0 2 30]ߍwPW 0  @pL  k`P: 0S;p 0 0P`P* @@0  +p@ 0  P0PpW*P<  ?0 "C 0 p@001`-0P0000`i0 `0XO--0 Ÿ M ҵpb @T `E C!1 0 2 30]ߍPW 0  ᱵpL  `P: 0S;p 0 0P<`P* @@0  ᜵p@ 0  P0PpW*P< v ?0 "C 0 {p@001`-0P0000`0 `0(O--0 Ÿ M Cpb @T ` !1 0 2 30]ߍ_PW 0  "pL  S`P: 0S;p 0 0P`P* @@0  p@ 0  P0PpW*P<  ?0 "C 0 p@000`-0P0000`Q0 `0p@-T@0`P@ P0P0S SfP p 7p@-T@0`P@ 0P0S SMP p 6p@-T@0`P@ 60P0S S4P p 6H0 00 巳-H- M0S000 0 00  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/t-H- M0S000 0 00  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/ -- M0 0'--M  --M  .A-`ppQpP @Q 5PD@0 0000@AFdX0P R   0//|O--4ǟ47 0@T@!|P;P 00pUP0 B@T@!8@,@0@/S= `0{-DM  {000~p 804S DЍp@-`Pp@ P 4Xp V U ph ಯp` ᎰደሰVḯ@@ ( _P?o?o 0C-@c^?c%^& ^ `pCc&Pc268271EG2&0H00. "0;:(0C0 /0 @- /?!Q P/o/o G-@b^?b'^( ^ @pBb&`b4')4(1VX4G0Y 0. "1;:( B0 /0 @- / k{0   ;B 0/AC0C0 0[k{ {;B{7P/AC0C0 J@ @-q@ J@ @-q Jq@ @-nq Jf@ @-cqP `Į@-:+00?0/R//R/?0S/R/P/R/p@-PMP`V ⬾@T 00#Ѝp{ : { +p@`($ N ;; #<00 R ⸯ;$,@-+00 0S@F: /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  `Q0"QI$\)P A-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`R&@ i;P PXY  P @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍ薹PP @@ @W0(@$0坹|XɴO-騏DMP`00 0P0x? 000 00S 4 L/ @p%S{ @0@ R0`S 00S S 00(,/!/#b!!"AK/ "bQ3:bQ#3P. ! P0 00 0 0 #|>1?3c112AK? .##.cR 3:-cR # 3 00 0010!00C0 0 0@ 0R PR0:R0@@mWjp%0KUSd,ba`_^]\[ZYXWVUTSRQPONMLKJIHqTy-;(>=<:87 -,+*)(Q4ih".{s(b 00 000; 0`0P `DЍ0@@0@000@0(p,P8 h0$ @PCp$ 9P @ T$0S( $ 0(p0,P$00@PCp$ 9P @T$0S $ 0 `0 00 0V$z[0@$ 000 GR +Ri -R 0400``PU:S 2a2c2SMR0c$000` 0(050 4`0tU0[04000000 @Wd0`nW`pW\ 0$ 0 0 9 0I`0 844 40W0C`00B 00 0c0 4`0@0@0W%S0NW-t=0 `0r W<;0  0 p0p S00W0 0` 0 0 0U0 ^`0 0 0 0000 M`0 00 07c0 4@0`S0G 0P4 ?2c111400 00 0000 404c0#0`S400111v>C 0C40 &!/"b!!!A0400 0@@0@000000C S0`0`0W0= 0@o# @8P e#@  |8P` 0 0` Rv40W010 oWm 0 0` S0pYWW_ 0`0N00J50 4`0  044 400C`00> 00 0440 4440v>C 0C`00+ 00 0x40 40T$/A!b!b0C`00* W 0 0 0  RM 0s 0 0@0 0 0vP@ @ P)` @aJaj B  B0 UR ZRU R   @K 0,# @ ( 0$04`L(p,P@ `W0` (p,P@ `W0` "!/#b!!"A0K/ PP"LbQ:D2bS0#03 h"10 !A 0  40DSd040ռ0 MRY 0@^  @~Q 0 "#^  z K/o "0P6 0`0000C/#0A Qa@\0PQ0N#όD0 0  F[ 0 #0A Q 8P 00`0 0@z[5 0@R 0 TR RQ ` @F0 CR < HP\)\(  Q  n t l'I$ Zd dQA ALA|r` \V6JQw8 @ 00 (0b$0 00\00C4PP00P01?2c 1A;S40`2ca12D @0@000@V@ A\N A R$ M a@000"b"b"$ (0(p,P$`(p,P$`40 @) R& @" R 00@ `p40 `$ 0P$ @0004 0C$0(`0 0`$0P$  @000 4 0C$00!0(0 ` 0 P 40@! 020( 000c$0k 0 0 0>8p@-1 00M0,00`P @  P00Q Q Q '% 0 |t  , 2 0Ѝp H0 40  0,t,t,t0@P/ P @/G-X# `p V@P0PES  R  D 0PEV R  SS0@0D@R@- 0BAs@ @Q 0CR l$@O-` M#VP0 A @/P;  `pP< w 0p01S Y% Ѝ040PP 0 0P 0 0 0=00 )d$ 0 RQ0@- M@@ PP TU J$0P Ѝ07 Ѝ0@$ 0 Ѝ0G- MMōhh P N`p PᲧp> @P<@ X0^00pAtA坲0Oٲ00 TAXA\A6 q$@P0,  (@ @ @P P t `0 0 5 30ݍЍ@#0@0#0@00   4--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-,R @p` M R00?y"00P @ P e00 P! !  :1XP<   VP WE V[X0 SPpp` `2(!(1 00 Ѝ`pP2 PPSPpp`000XP C0PP00 _ Ѝ `f` ṵpP V ᲵpP `\@-@ M2(0S2 0 `0( `1/pwqP0  0 0 PUR <0PU ЍPpTP 0S  0CPp"0P0@-P M(0S< V0 #p0( p1/`vq@03  0 0 @ToR <0@To1`VP ЍP`T@ 0S  0C@o"T 0 " 0 0 R/p@- @Tp0 Rp0 0R0 D P 0S P0: c (5 0P0 00 S+,P '4P #8P p@eEp@-@$PP۰Qp@԰H(@- @@ͰQ@ǰGpp@-,PP R@ṰpG=<;c9876543210/.-,O*('E?$#"m `WQKD>#V 00 @@000p2000N 0`0p00`F`0p00p00p00p00p\00p00p00p 00p 00p 00p 00p 00p 00pcQPdQ00ppdQ 00pp0<00p 00p00pp00p @00p00p 00pl X T O-`pMWP 2 @ P@ 0  DR6 \L 00pW @U 00 0 Ѝ0S S Q  0E  0 S0\ 0 0L0 0 0  00  * A-q@pP`Ui !4"#12b! DqW7 0S$ RP QP0S! 1003/P P $@00W L!P0 $@ ಲ0V0 P100S) 3/000PP0S 000S) 3/000(p000p3/P WPVSP 000SLP0P000 3>/ 9 9\ 98=A-q@p P`Uh !4#3b!b DqW7 0S$ RP QP0S! 10 03/P P $@G00W L!P0 $@ '0V0 P100S) 3/000PP0S 000S) 3/000(kp00 0p3/P WPVSP 000SdP0P 000Ȃp7 7066A-PP} @`Py qpPg  00Rc<!"#b!0CaqV- pW PWV $00dqp0ST100S004 ,1003/P0 0$0 00``0S 000S+ 3/000(ޯP`0003/P 003/0000S PװP00003>/5<5 t44t=A-PP| @`Px qp Pf  00Rc<!#b!b0CaqV- pW PWV $00dqp0ST100S004 ,1003/P0 0$0 00``0S 000S+ 3/000(PP`0003/P 003/000$0S IP 0$000P32<22<SR: G-P0`00Sp 3/0Y @IOP R T 00 00 Y @IOP ? T P00 D0D 0 p`P/1|l0SR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP T P00 D0D 0 p` P$/0``L/A-@P QP P@`p\P0`P qPpW 0"S Ằ@00@`O-PM M Q0` 0 Q /Q P.00F PPەۅPp/Q/ Qp @0/SS.Q6 0E00 0C S"/0  D0e0 I  0p  0: S+  S/ A/o" R_/Q P?0V0/0000 Nލ Ѝ DR .QRV  u/R0W03ʨ !ٞ0Pu5 060 Q)0 (/QPpPVP/0000ލ Ѝ ­`P `c5001>00-00)?00%00! A-Da@P`: 00QP0唭P= 0p0W& 10pp:W@^ 0 \S 0@ S @ 0:Sp@:W W0 0T0P  <00 0 0\@`@0P/:P-0 S\ S:RS0@S0 S S@\ :R \:\0P:P 000/)0@-A@\  \:^|^00^0S R B|S0 0:SS O--ǟMM t<č!^pĝ  ^ TG@`V 0P0(  ɬ@P 00S < [ & Q0 00 P@ 0妝Pv00 ` R0Pp`0 S Wp :S \Sp S Spp p0Ui*R0+  x P 0`0 SWZpP 0#SS  ]P 500S0 005@0:,0:= pP 0:R@h @R0t400 0p4WP/ pP* p):00d00Z  0S mu00i:SZ P0U:H 凭P PE @P4 0:R` ` R,0 F C 00SpG:S:0D 0 I0HZ 0 E0 04 P@C300DpTpPETgH PEpG@DAP Pp@@0S ֜$ E0AU0: 0@#2 0 <4 30ݍЍ0 0 0GP@P ⟫@P} ᡩ|2P00PS0-0`Sխ`0SRM 0@ɭ@00 ᆜ  傜 :Pᵭ  4p,@00  `6/p P0003/004`X80,`0C0000 p ?@P  03/P$0p0H?o20 0@m 0 @o@c03/ 0  0Za0S 4\\X0S 00  |8 & 4#@-@M0 Ѝ@-4@@ P F0 000h O-ß3 M0 MȍC\@ 0夓S p` S P@T 0S l @P 00 C R 830000#30:Q0#Q0S(  0R\Sz 2@0T  P uP 0 0P0 P  20   >0S00S\S00 R{AP8 0S7\S5 00S1 :S000 0 Sc4S\ A 00S :S|S@0@ A@L0S't!D1 0 8 30H ލ Ѝ  ,@P 00 C 10 Y P @P p @@PP P g @ 00   0P 50 0Pm H @j,@, 4 քpL t0@-TP@P 0 MS %0 0 00   Ѝ0@G-`= iPP d㭩@P 0:SS   d: p \SP0* Q@ 0:SS ^S 0S:S 0Q0P@ @B dP 0:SSd@ 0Q BPA0n0S:S 0Cp\6BC2PBYU?PK<;:9876?432802.-,+*)('&%$#"950+000Cs^/000Cs\P& P0 0 P0} Ppz 0 P0v 0 P0r Po Pl0 P0h @nPGP PP P ;P|g 0P0wA-P= `P7 dpP9 0S:S@@c0%0:SS   \0@Ad4P pdA\ @Ap`#pP@`@@@ 0@0p@-P# UP 0Q @0XS@@<,00As ^a ARA0AW0AS70ATppO- AM Mhßh3 00(0 00SK @`p0/04 PPO P8T   `00CS4%210/.x,+*)'&%$#"    4$` 0:S 84St0S00"2 0 (0 30s K\ P( BKI8T 0:SSa0㼡44 440$0<4 0 S BKJ;4$ / 44$0C 0$C0$! <4$0C 0$CPu04BK I8  S:S1 R5 0B44 R0  0R!0100M P@@  ᾘ0:S084  % 00ULPrH000044 x ؤwL  % ,  #h0 00 u-H-M0S000 0 0 0@  00^100M 0 @R0    R L00 a@ 00 0 0 30KH Ѝ/ttt<4@-G0 @ @0  O-P@,M$`x20Za z 00p v0 ?2 0GP Z p P p J  J PP0 S"3#: &  V(10 r# 1$4S!1$&t@@x!00P @lP0S?"@!1 0 $0 30= ,Ѝ100S  V r pP Р P 5SX0( ,UT00#    4 PP : P0SNJs|x ӌ ӈr], ˠ@-(@M@@0:PЍ  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A@{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T P0 0# 00Ѝ 0Ѝ0-$M  00 0P$Ѝ0-$M  00 0尖P$Ѝ0 -M 00 0 埖Ѝ ė ˗0×/@-@P uM`p8  0xA|A夡8OPP8PTAXA\A``0 , @4 (0 0 1 30uߍmXm0   lO--ϟ MÍ$000`QY 0T/T ,  0(0 0 0  %pP0(%Ypp- 0S0 R .> 0 3 30 ߍ P0 P 0 0C 0 S 0 B `0 zR.cPLKJgZ~}|{yxevutsr0p,+*geG`\[Ys``YBR000`0C0 :PB 0S 00 0@@00S0  @DT<< P0 @ P 00CS0000@ 0D S*v0L0 S00D0 (`I @ 0L` H4  BPR '+Y 0vpC0Z M:PWp! 0jPP P`p + @MR^V\TZY@NMNMLKJIH654321A@?>=<;:9876543213/.-,+*)(!  XM P 00CS0000pWP0 LS XR    0 $ 0$         00 0P0 0C0000 S000@VT @0 V P0@ S0 B0 0 R P00S000000S0L >. #RR 0@00T0C0 0 >. #RR 0000C T0 S P Y 0 00+ E  P BR  X *@PNU 0U0P0CS00X 00P*@P XR P@P7R*P  P0@@40 s P:D0U0S00CC SP0 0[ *@@ @P0ESH 40SH  P 0@0CSPH00 4000T0y: `8 <@DV*T -T0`0 @Vj 0$0P0  P m$00 h400S P0Ss 0$P0 00000S @0P0CS00T 00*@P+ E P BR  X ;* @P  P @0P0CS0 0IU0P0CS00X 00*@PW(  R H  R~WW  BRp P n 0@@N 刀WiU nU0P0CS0x0X 00*@P RP. ARJp P BR @ p; P8W6*@0P(U P BR  @p$ PW*@0P NRp P BR  @p 00@<00 0E@ @@HꈀX     SL00@900 0( 00  $  0$  㰀  + 00lT ͈k X  P 0 M P 0 0C 0 S P `00@00   @00@<000 0P0^U@@00P080800,H0iU 0$40A4 >>0@<@pD#C8`0-S ]Sn Sb P4 >>08`#C * 00000@ 000 0@ 0   +   +    )     00@90 0 0s *  + 000@ 0d0 0@0^ @40S@@@XL  M ~PN BPS40bS; D P 0@0CSPH00 00 0P0CS00R-*P00 SP P0  P1 0P0CS00[ *P"4X | P 40@04X p P  P00CS00R*PfSâ?L00v0D0 @b PT* 0 P@@0P0CS00T *P00; PT*0PXp`pT$0TPP$0`5000 00S0P0S(@T 0@0 0$@P >. #RR  PR  B   P 00@ P0>>03SS 0PU0C0000P000- 0S P PYV Q 0$@0 0000C P0LP00@0 4 yP4 R*0P nPX*0 @PM q  `P R*0P00YkaSP00[ * @P$@`PPP0 eP 0C0P0P `V  0S ,P 0$@0 0P0 P0PC PT*0@PS$0lxPp$00400pTPX` ] P 0  B0>>@I  vw0 p P p0S P0SYx4Y 0S0 00 0 p >>3PS 0S0P0C040p0400S PkXi*0P0@0 0 A P; 0 @0>>` BF vo 0 姡p0# P p R`80<@pD00@ 00?<@pD`P 40fP40 S@ 0@00# ZPyXw*0@PZ PPoXm*@0P$00 P}i$00 9PX*0P@q .P[*0P800C0800]S0  ,0 uP  0PP80p0H`80v`Yp w PP0 0 P400P PT*0P005 PXZ: `8 >@p G 0 0 vǟpD P)YPE* 0pS,U PU TP0 T P@DP UbJ0@P0C 0P Wp YPE`0pS kP W P  0@-@P M 060 00@6 Ѝ00@-@ M@P 0P0@ Ѝ0I2pA-0P7 !@00S5 0`1S010g C000PuP! pW@0PA `PS 0 00 @ C PC0000  Q  Q*RQ) <00@8 BP0P00`0s0 P + B ?#A 0#@ # B0 PHp@-@P z0@p@- $ M0@4/@PЍM @Ѝ@-X0 T0M0$@ 4/@PЍ3 @ЍF@-0M$̓0 $@ 4/@P Ѝ @ Ѝ@-@0\ \  M $, $@4/@P Ѝ@ ЍE@@-0M$̓0 (@ 4/@P Ѝ@ Ѝ@-@0\ \  M $, (@4/@P Ѝ@ ЍDd@-0M$̓0 4@ 4/@P Ѝ@ Ѝ@-@0\ \  M $, 4@4/@P Ѝ@ ЍCO-M@DX@P`p# 0SP 0$,  ;/0$ 0H@ 4/@PЍ]@Ѝ$ @-$$@M ЍBL@- $ M08@4/@PЍ6@Ѝ@-X0 T0M0$8@ 4/@PЍ@ЍA03?0/@-@`pPQtt0l尀 T  @0 FP$ ᫚A$ | 0EO-,M`PP pE0P@0 p00EPs00D5ʿ000 0   @0 0! B b190Bp   U\ @ 04B@3A0S0 vTvtsrqpogfedcba`_^]\[ZYXWVTSR]PONMLKJIHGFQDCBA@?>=<;:9876543210/.-,+*)4'&%$#"! #       0 Dr R R Q  R \00t0!#300@ 00@00 @0`PUF*,Ѝ R\ 0M$ 0$ P 0` S^?0@00 0  P 0J ZS 0  0J ZS 0-00d10000 ,Ѝ0\r  `0\s  `0\a  `0\ S00 0 0``0\b  `0\t  `0\n  `0\v  `0\f  `} @壛P 0` [0\  @`p@lA- Q@Pp`! ᭛P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0! P0 Af hA-@P`5Pp$T0 pAQ_T !T '0DS%(0$"0@ !1 0 8O--TTǟ UML<ǟS 0Ppခ儡<  s@㠙0P(0 b`ᘙ0P,0 0S0080o 9P40 H  T. (`000P@Tp` U T 1 # 0'0P?0S0d PjP P5%0 f(0@FDA T @! D`N0P$0 0 :^40S V D0$ 0C BP$0  ? *H500R  ` '$50$0R` 00` 00` 00 `"00@`\00000 tpT0 (`,$@T+ 0 7/PT0@0$ ,(8$$3 0 L1 30Uߍ<0SP=<;:9V@DS3/.-+)(5h[$zxD B)Q [n (-= 0 |0 30zЍBϠl4 @0 P $08, ##,cR:,c2S <  @@ 00CL``C@ @r  ^^A!/3b112A0<  ̟# cPp<5: cP` ;0!3b112A0  K0 S 0! [ K 0P Qd; Q00dP   [ 0 S  R  |;  B2:Q/0A!b0dP   [ 0 S  R   0  ``: Q00dP  ͇ [ 0[  R   0  `m 9 Q00dP  ᤇ [~ 0 Sy  R sd)d9!/ b !Q Q00dP  ᅇ [_ 0[Z  R T8 Q00dP  m [G 0 SB  R < 0   ` 00 S00C  B8Q2@80/A!b0dP  > [ 0 S  R   1 '(0 dP0  $ [ 0 S  R  1 p'0 dP0   [ 0 S  R  [ 00[006 Q0 0dP   [ 0 S  R 0 01?2c 1 R11Aãd0Sâ/d0CS0c0(6dP 0ๆ [ 0 S  R  08  8   `W80S0 R05s0dP0|5 0 [h 0 Sc  R ] 0 0  `.Q0dPS004 0j [D 0 S?  R 9 [7 00[^0  0  `$ 0S!8 ែpq    pq 0Q 0# S! -R? S30 [ K  S Q X1 "`aa!B! #<0 dP0   0[ 0 S  R   0  `4   0  `z`0  0S0  P圀P u [ 0 S  R kPw0` 4m0 S  1h [e K 0P^ QX0S 1 [P K 0RI QCUP 1 00 dP!/ b !Q    P [* 02L,QlP\)\( m T Tx F` S E S@* R Rd Q Q< P PP Y$ U NP UL M L L\ >8 = J H Gn 5 5 5 5I$ OD E< D D S  R  1 h 0 dP0   [ 0 S  R  8  0L08008<00dP@0 0D00H00L0 0X0I! ʄ [ 0 S  R  0l0 S0Cڜ [ K 0R Q0S  [ 0 S  R UPUP 4B28" @ $08VS_ gS 0 `^ " " N"N Ϡ$0B!l0 8 <40c1?2c!1!1!L1A0#/"b!!P1C  ã/ d0 S  à/d0CS0c0h3dP 0A [ 0[  R oP 3Q00dP  # [ 0 S  R (4`0?객<[<$Xd $0< ߝ 1|$<0 0  dA- M`@P00p<0@0008 0@pPP T p0E Ѝ" 0 ЍT 0 @-$$@M ЍLA-p`P\@\@M ~~@0@0  0 @~Ѝx8A-@P`\p\pM q~~@0( 0  0 `@c~Ѝހx8X0P @-DQ4g   Blh0P@-X  S H@ @I0( (@ sݠPP APll0R0 @-\@0@PQ 0 0 0R B/ fr000S 0 00 9/`-  0  ^^$  00{{ANm{h{,0 0 A-`pAQq@"0F P啀0Ch@12c` P@RH00p`PPUTp`zPzN _z`p@-HP@P }0S,000@ p@ }y\yy,G- p P@`| `FR00C0A10 0USU 10p   t |?U0T!P 000<10 j100 C0B100UU$0 P 0000 0 P 00000@ ` |0h P 00?0P00, xyxy4xdx<xxwxTwxwLw0wG-@0`萟&䀟 P #Qp[| PFR00C0A10  00 0UPQ@pG@P H06&```8800A @,|vwD <vLvuv@-(@@ @|0@|uG-p`P# `Q@@PppW@Q`Jd X "0Paa{0O|pG00wTaXa\aX@Z_ ;|000 D.@-,@@0@P0S@zlA-@P匀@_}`P(p0@aa{0O{ZO00TTaXa\aXP(0( $0 0 NH|H0p@-05S P |P0SZ sX@ 0CR\{p@T P ZP@{HPty`sst/0$! 0/p@-$P@勁P $允P p@~p@-@M P$`0.KP  FP DDO00S 3/Ѝp003/ 8 8C-$`0DMSP 0(p0 0@0$ >PP 0 (07,00S 3/DЍ q00,00(3/  PP 0S /A-M $P@0P 00 `pP {Ѝ00pO-lhyM(p`4PP  @Pp 2 z20 RG z0!$@ !  00p0 4L  00 0. $(p,`/ PR 80 03/0`0`cP"  !0 0 1 303yߍ         fjP fdPfZP``fRd(b(b< 4 4 4 4 4 4lP00/sXp@- 0VM 0PP0T10㧙p" 0P1cp@o ` o0P`` S 0!< ,0 0 T1 30VߍplΈrp@-MP@]]`P`Ѝp K_P \P  \P 00 0  P͜O-p`@(,\PP pW0SP[5 WP) @ :/@PWP0S 'S[ WPPW g~P@@e P00P WP 1 1lG-`R p@P8/PP @VG-!1 0M@Q000`PR UH U .0P0!1 0 0 30\Ѝ 0p ) P00S00 0oPP  0oPP o0PSWUp$0T  oPJp0 Pp0ꀀp npP 0 @P媳0 00nPx(/0 R  B   /0 R  B  /0 R  B   / B/0  Q B  /0S 3 %0C  0% %//Q0 /0 R  B   /0S :p@-@P0C0 P Pp/0p@-S@ :P0C0  P Ppp0$00$00  /00p@-P@ ]P 0S S pp@][P p@[p@-P@\Pp> ]P  \P 0S S[P p@[p0p@/p@-P@\Pp >p@\ \0@- MP@[P Ѝ0\P 0S00 7]0 00 S /p@-P@[Pp\P x[P  s[P p@m[0S S  /0S0/ R R 0 /0 0 /0  0/ CR  0  0/ 00/ 00/ 00/0 / @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030p< VP7 4YP P (! 1 0 3 30?ߍ(3@ R. R  0 P| p0S 0% p 0 | 0 8|  R P RՕ , ' '8O-DIM@,MI͍$$J͍@Pp P0`S S  p( $I= $0 2 Iݍ,Ѝ RJ- RW# " " B J=00岰h00#,8 jJ=00 l 0  P J=00PJ= 0 $0#C 0 { hJ=00PnJ=  00S0 S UVZ J=00p4:0t2 00嚯000J0 ,0MRPg @/0SF0S 0S0"S S 0S0"R" #<UVJ= 0 J=00p6Y) O < bUP.  P WBUVJ= 0 p8p6 p2S S]J͍0 pp p 00S~L2Sp S SJ=00Y0  UP pJ͍nPpꪔ % %` % $ O-ğ MQdH4@0P0CS,z6)('&%$#"! 9 QVW00 R04 0S SQc#3 0 0 30Ѝ#|3 0 0 300 HDp@`ЍOqVW <# 0 z @W1:  0 " tz`PT0S90S D " czPT QVW00RT3`XT00P00Sz "0 PdEX 0 S A-x!x1 0 M0000S@> S0  0` V" p PQ 0S @ T S   0S QRp`V| t0 0 0 30 Ѝ P0 0 0`V    @-`QM @QPp Q Ѝ RR a PR'U0S S 0P R  Ѝ  R RD0 P  00 :@  G-`@ p_uPP   @ @ !pO--P PM4MP-,, @ &l8  $``40E&< 00jh!S`6 &< 00 S &< 00S80 0:0S : _n0 0F P0\VpP00  03/P &< 00 SS00&, R0S00q )P0<040UpE\ [ZP㐪7,@0D0>@PH0(P$`0 Z PE 0  PV@P_00  03/PV @V 0`0VVX00S V5 &< 00SVVV !VQ V <s!P0S(0S <JV80C$0LD00S \80 C , 0 0SP, @0(PS$`A @T ̕@ pPlp uT3 @0 0%|%x% %%  0000 00uYP ,0q0 R R 0   PR, VuTU LE0S| V00S @$= ,0 2 ݍ4ЍU0@0&< 00SU  F'VR2!pW: X:40 0 <r!PS0`S`V0  0$(%$50 5#S (0S: J80C@$0dRC.@&< 0P,@)(#40%P@ v@00SC@tU00<:4Q 0< x t$0DRC.@%<0H v:@0SPPiUPe00<0<2zo0 0  TP00  03/P U00@T0  <](00(0Y8U0 04U000Up1Pzo0 0  LTP00 " p P r@P !@ L0R4  4S P 4S @0@@0|TP@0@0S 0R $R R $R 0@' , p5t ` hO-@ğ SMD`qPP  qP $p 8YP00[3  P00 000 dP @pPY 0  RPss@P#x3 0 D1 30Sߍ0000rT Pt 0 .P0P R R. B/o" Sd d!"S<*0Sr 0 00 00DD0Q 0 pp00 Paʲ0=S 9T0S4 S* S) p0S 0se[j0S %T00gsesP0  PoT0S00G 0 f000  Q000S000< D 0PEd!   DD Q000 0 P5 p30 P-S000 DD0Q ~0s S00S00rS0P0-S00) 0 UPxUO-`@VpPM 2 0 S[ `P 0,,0H000 0000L0P0T0X0\0`00HS? S7 S wS00tSP* P( PЍ0 ,0pLp8 40P0T00  0Ph h0l0p0t0x0|00 d1`0S 0Ѝ0 0p8 4000p4080 pP h8 H U  Q410T0 00 !   R" 0  tP 0 p P !0, < @ D  80  ,40*P=rY0 d1 d0SVK E00P0T O-p`@P"P2$M 0L000 0 @HP0S@ Q@P@T SP-  aJP  P@P!1 0 0 30^$Ѝ0SQE:PPB 0 @P-0;00S @  P  Y0SQ  PP 0 @P000SPP` qqV@@ ỊP@ ᴊPꄊd 0P00\// $p@-@P@P iqgqTpO--Pp/M ذ " 8  X@0x`P0 , (0p Y% 0S0S p t@T P@P -q+qT0 0.> 0 2 30ߍP P|0 S0$0 0 pP$$pD>00@,0( p\ l7<2 L520\0 |0 S   S  Q  RQPP  XP[S|0R0Q0S P0^㄀Sf : P|Q ,0 0S Q0S %0P40  ᯉP8w 4 0 B X0P00^X[ 40 4<@@PDP@XH 0S0S  0S S 00S 0 `Pz0  =`q R R R`0S0S;0SPU ;5pS0$00|0 `C4D8p00SX\t0S0SB xpp=@H*H: 0 @*0 4 4*80p Y?,$@@ <0W 0 g372 G52P |0SM0 S F SRCQ Q : \Q^3?oR20S QpP 0 pP04 00<080`e?0002Z@P񏐑0S ZpW pt`WpV(B Y 01P@0P0@pTPU 2n0P0 h帐`nP 0 @@P@ THPPMot`0S 0S Do t0 p0 |02_P)]: HP| R (00S Rx00e  }P : ,0P00:0S p,@$P00vpW0 $P,@ P@@ 000 PvpW  R R RpWR $@@pP nnW$@E 00Sxs0 0pp~ 00P 00 :0P00 0p@P nnXcpa 0 0Q P  400U  R  A/o"\  P  R; R V } pp2 P P0 R   L" l1,P0S 9P 008Hnp kP  0 @@0P`H`YPkP HIH HT0 V@0T*#n30:0$Pt` P@ W`@o `_輐0Y|0D Y0  00 i: А ]P \P40D  L L0]P00D) 0|0 {0T SR S  ^  Q 003 Sዱ*0 S :0 SJ i\@$P1 00 "t0R00mPP @0T 0@m@0T@zmt`0+p,@$PD0P}| 8yt 4 vHs TМ iI. 9> ͩ <]P1x00x0BmBP@0T00T0@6mP 0pO-xxqLM @ p vPP0 0CPF ``0S S S T@4P `0S `(0( (`P00 U `V`V 00 `V0S 00SU$@LЍT @  ! "4P ğ* $! ğa @#, P@dğD 0"0#P 0Hğc>  !,$P,$ʃ  $ "0P$a @ # " `!`&@ `ßj "! @ ßa  # ",@ ß$ 0&0# 0pßc> `!,`jD@LSPP"P%P8CeX@ @#@$@#D 0 ,l̈́ 0 !蒟$ `ab``P P%P"`X @ 00#@E0`ጒ`& `xŸfm   "0X"a 0P 0#PX0 ,, @(BŅ@` @@$@!D`dM 0 0#0a `̑`& P`VP0p: O0hV@Hp` E0S@@:p`F Ap@-@P0M0` 0 00 !? 7R8 bx b  D 80 0 0 30X Ѝp@€mp ׈lG-D"D2 0M000,2,"00 P00 `p4 0R @  0XS@@ rY<0s000L T $. 0NrY)T  aA 0s00C 80BS$!1 0 0 30<Ѝ.R ^V* 00R P 0FS0 S S QY00@^*0^0 48 <^*0 8<*llkt- MbP Ѝ@-L!L1@ 0,MT0$00 `pVP ?o2T0S9/o"T R @ 0 0 $0 30*,Ѝ @`!(0r @$0RV$B R T0 R ( $Q Cji ӴA-@0`, rMX0P^ppAtAa`0O`00TAXA\A 0TdP" 0 kpP 0@e0P 0d X0 0 1 30 rߍP wf00 0P0qhBg0   g\ -- M0 0 ЍЍ/--, M0$ 0 Ѝ Ѝ/gp@- M@M Pt00h` 0`0 `P@@X@u0@wT  Ѝp Pf@-LL1 0M` !000 Vp @P  d 6Vp T@ 0 0 0 30(ЍTP@pW @@T PU 0S$P@>T90@0~f(iep@-@P0e(0Pe(P,Pe 0p0PP 0P 00 0p`00eP 00 0p 4    / 0@-@ 0 0 0 0 0 叏 0 00@- 0 MP @0ie 00P 0 A?o20c Ѝ04 00 0 0p@-@P0 0U0 0pp@-@P 00 pZ P7 1@P 0P00S S S@ 0AS A@PP 0S00 00cP  cP0@@ X O-@ 0`p M,0(Sw: (T[0T0W 00SS 0QM@D@T0PH 00SD000@D@D0P0S- T0Y  0!0J@0PI 00S$0AX000  +0S000   0S& ~0p@Hd0ppDd(0pAd(p,pm@ Ѝ[cP  (,@!(0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0yP Ѝ0:p 0$  $ 0 2 Ѝ0O- @\ULMP$0  @@0ոP0F$0apPA  0@@ƸP6$PPU 0`Q QB QR Q% 0U 00S{ caPb  `0 @ 0p R  R/ RY R 0 @Upc 0J[I0 0 LЍ   @QA@  0U` (⼐Fp 0  ,I  p0p 04`>W G`@1 @U@ 0 @7cLЍ@ 0@/cLЍ `^ P@Q  QA@ PU ^ QP @ p, 0S QARQ  R  P@ P@  A X% X X9 p X) T( QX X X0` ``  ` `  `Q@ @  P@U`b @bRO-P<>`p7W `$096o3?@p $`(0L0V,0N0-0( P QK0⛃#UU0*0U' PS$Y:V' 0VV #((RP Pp 54PE2PE1PESPEf0ᎾPE:puP4;Pa 0 @,bW030#V,0V030#-051-0%!0Y" #((RP Pp 54PE2PE1PESPEi 0UPE8puP09P P:04  P800 0@-MPp/ @Rp6 P0u0(04{ {@90@Pt 'U A0P  5P Ѝ000QЍ0|P 0 Ѝ0sP A-'Qp@D P`P0 A00 ( / @-\(,\ \  Q:^: A Ͽ|q<Ͽ1 0  0 C-P$0@SMR 0( ] 40 :B1I;p1L$`0837>1L-0 BIS  # S 0001890L>1 0 00LЍ 0?qs0Ͽ| 13?1<Ͽ0, 0 0@-S@ 3/@`A-@] Qxc Pp87` 0 @ &"F@ NN. B B.&"@@ NN. B BQ"@@e N @DN T . T}" @D  2/  0`2/P  E&"`F`Fd&AA  B B &"FA!@@  B B!"AA!@@ b QP'p87` <Ͽ L &"FL,N N. B B.&"LL,N N. B BQ"LLe,N @DN T. T T$ T  ( <Ͽ2/ `PT%T 1 T- T `Č `T T @D2/ P @D 2/ ` 2/PvTt T T T Pk4`PWlh \ X T7y d Gp@-1!0P0`0 01000C 11.Q 0 @ 0P0: S@ P Ppp0 P 00C1 000APP00t@M ; pA-|4|$00 0@P@ @0`C0APP@`@ 0PP@`v`V P`Pp P0pC0Q``Pp@ 0``@pwpW `` `0pC0a`.S 000@000@ 0pp@E0C2S20/.-,+*)'&%$x"! to fXT@2S2L0/.-,+*)@'&%$;"! :, 000 @ @  @0`y0000BdABdAbdnAANBdQReaAfaAP^p00 L 0Gp00 B 0pGqp0净ಀ00pG0 0 2`LA-`MPpM&laa`GQQNHH0  @ N 0Ѝ Q O-@`!-0PPRPPƟ FM MdčƟU d@8006[0P40 0 0p60: d6P0: X60: P60: X0,0(6P0< 0<0 0  P?o0 2R0S 80`1  ,<0p 0p 0W T B^T0P0Sx50:,0lu?Ⲁ`5 0x0ppWJ X,00?Ⱀ$5 0?X& Y0*^PT,0? )R 04tp   %P,4 ,p4 0TT4 004 04  0 p0S]P 8[0P40Z0 #D3 0 d4 30Fލ Ѝp: @\0S 00SU80`1   ^ ]"2 0 d4 304Fލ ЍO<]pX,0!(?q0r o]W["吺 DPH@@Z\_]@D@DT.`t ᲀR. X pP] J] Y0  ᄷ1@ 000 .,Y@D0 @DoTDPH@x0   aXX0 Y 0 S,pL@@ ] Y0 L@?0@ 000 .+ W:^ \[uG$G   \3 3 T2 x  Ր d C 0B  @  \O-tM@@ `4VPPk0 P p 0 0  04$`18 $S, %ἴ0 岕   46< 04 (Vc 60A>< 0PPU R800 0r\`1S   ;`1S0 ࢶ0  0PL0  0P9P  PP&0  0|P0  0pP0  0dP0  0XP0 0MP`1Sy40S{ < P0ppW  0R 0[pW 0pW  0R| ,0[pWg 0pWb  0R4 00[pWHpWE 0 PS 0 [`1S   0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P  0|001p 0q001p 0f001p 0[wt1p 0QZ6\L @[tЍ tЍ 0 t/0 m0 f 0 _0 X 0Q0 Jx0 C?L ,l *@ \ (P t P  p P 0@-@`0 0AMM0 400p00 :PP0S fD 80 0 4 30AލЍ."{s8H70,@-@ M pp P:`PpP 0S <0000 Ѝ00S.S 0S ЍPp@-|0|AMPt 0  ` $ 0 @P 8 00 0 4 30Aލp-s66p@-P@Q`  @Q WPV 00pV00p@-@ M`p!PU 0PU  0\W 00 Ѝ_00P0 `2W00 Ѝ p@-@MP`0S 0 @S 0S@V00ЍpO00@0 P V00Ѝp @0@- MP0@0 @x0@T U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0"(  Ō `p@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@!P  0@- MPt0@0 @?@T U Ѝ0p0 0PU:L@@ Ѝ0<00@00 0Px Ѝ0 ( 4 X 0@-@ M> T ' T2T7 0DS3m~0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@#T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP x $ h | x  0@- MP@O@ P Ѝ0 0( 0P Ѝ0 $0@- MPxl0l@0A> @0@T U Ѝ0O,0@ 0P Ѝ0 $ 8Mp@-@ML 0 Q0P0<00P@ ` 0. 0lT @D bS000T H0 0 <0 30 @Ѝp@Ѝ/.0 Tj1 q. .$O-PM`@P P A p =0 Q  ЍSv RSPP -\00 +\00 3P0 0  R0N1011.\ 0 @T@  R㞀( 00 S #3@  R\ Z 0S#30 "#T$P+<0+80+40'<0'4 0(< 0(400'( ((P p 0R0p d 0T00@0 P   0R00#3@0 PS \  R#3 000#3TP 40 T @ P P 00 S #3@  PR \ 0S#30 "#T~ {00H 000J00  0L   3-pO--Q0 \M R "Q 1|" TSSNxB0c8$CdbBdAAC22c1Ab^f,RnjaLWEP0>%S<_2eRlQqQNDB<">"br!LgLH @p qNo o o[H LP0H Z J Y L (D $T@ < 8 $, 0*0Pp4=[ aVZ ]VY YV\Ѝ  BT꤀R(l  0 0\ЍXZ HY  8gi tbMӈQ  (h h y y y@-@(P0D .R S0*SQA@0T.S 0@-MP0@0P Q 0v. 0 0 ,O p=Ѝ0 LC-@P@ `p MPOP @U SP@Wt Ѝ @Pt0 0000 0 P%#@0S0Toᨂ# 8%4 C-@P@ `p MPx@P @U cSP@Wt Ѝ @Pt0 0000 0 P"@0S0Toᨂ# $ p@-@Pᚳ00CS0 S u P `0 P㑳pU`u00CS0p  Sp R 0/U@-M@*0  00]00 !R !Ư0@ZЍ@-0 S 0@Q0 R  004S 0@l@Q0R Q  R  Q !Pp@-DPD0P`@0pp 00p@,X0/ Pp@-@ @ `@0Ppp0p@, pPA-DD p@0P`p0 A PC- P0`pMpp@ H 0D @ <8 !@Ѝ5PC-tt `pP MFp@ ( 0  @ Ѝ4P0 00/P0 00/xP0 0XPA-TT p@P`M p 0 tЍ4P 0 0oP@-pp pM`P p@ ( @Ѝ4PC-|| `pPMp@ 4 00  @Ѝ4,P0@-P@(0( M0 0 Ѝ0Pp@-D0D 0@0pP p@پW4pPP  0 2P R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-M,`(@Pp 0i3PE0 R# P R8@  0 0 000 CЍW R  Q.R   Q. 0 .R  P P .00p@-P0@S` ޶0 0C0p 0 pO- M$@`PP(X0*00T+:Yp) Ра@  Tp p P@ 0  P0 Pӽ000000 Ѝp00 PG Ѝ | ~|@-R M @0ASPAA p0`0SA0qp0@ ЍD0iP Ѝ 勽0 0P` |O--OMM@͍<<͍0͍ 0͍=8<00M00D?P00=@^.M04PDH[ =P 0PS @0 8`P(0 0@P0:=40=H 0YpP= 00- 0C0H; 0H;0  $03$0hP0>d 0- 0 $Pm$*0JPdYY 0IS񏐶?ur8ou5y`7SuS}f('~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      TP][ 0S .St 0Sq 0Sn00S.Sai\9YD =<00S 08)0C ( 0@ BQP5D0Sy@  0D;D+0S0` p【0pSW 0S @0D+@T 0Y4  0d  0 wP4(= <0 2 ݍЍ语@0 (08` 0 ZPP0 0P:<=<00D S1D;d 0D;p70~ 0 7P( 0@ BPH 40@寭@0 8`(0 0P D;0B& <Q060d I 0 PD; Rl6l00 0#4$0$0 0!8D+00CY pp!<Y00CD+ ^7 WJ : PYYrʼ: PO0 0-PG5Y00#$ #(#< 0T5 D0N0C0 . q . 00CS Y00 BA: PD;p0D{W:Wp 0 D PD;"$0G `D;pt0pd 00 0 hPD+0D  d  0 WPD D 0D+0 D+d  0 CPD+0D;pW  D;pW0D;  0d 00n 0 'P(00,PpC 0@P 0 P 0 @P=<00SD /D;$ D+ D p /D;$ 0D;, X2d 0( 0 PiP:D /D;r0D;pd 0 0 PPD /D;0D;0d  0 P=D z/D;d 0D;\10 0 P*( 0@ B>P"D0p C1 PPK\ Ԑ Pp/U0 0 G}P0PE0HS { 0 pP x  p0 p D ` T  yP $ $ H 0 h $ }* } }L |p |l {H {H {< y z yP y x x w wX w,  w wd w u v u` tp s f r r q q pl oUUUV p | o b m m m Zx=<00SD .D;d DD0 00Q 0  PD0p C@1 PXX ` p/Y 0 0 GPu0I 0HX  0 PgqpD D  PD :X 0 PS+YD  =<00SD; 0 IP=P D<<0 C 0 8P=<00SD ,pD D ,pD;p0D;`82 0_ 0 P 0 D +P D;xpD  0 P 0 D 0P D+0D; 0Py 0 D Pr D; D X  0Pf( 0@ BzP]=<00SD; R$-< R  y0pd 00 0 P:D+0D  d 0 P)D0D d  0 PD; D+0SS( 0@ B!P  0 uPD D 8,D;D 3,D H[D .,D 2D;H[0D;`+=<00DS  0d 0;0 0 EPDXD'  1R0̐p` 0000= 0 0H+$H )= 0D;X00B- DH 0 0S  0  P( 0@ BP  0 PD +D;|0D;pd 0, 0 PmD +D;0D;0d  0 PZD +D D +D;pD +pD;d 0D;=0 i-< R 0B. -< R( 0@ BEP)D+QmP>A?C0 Sl 0 P]= 00H+#H{ᆱ=D+ 00 p0C D+H{0 0 mP= 00H+#H{fD+= 00 H?00#$ #(#< 0wx: D;0B/ -0/0C ( D;0B/ "00Q0D:H  0 *P3Y  0  PD;pD{X@ 土 HQ1g D0 10"3T/= 0;D0000;D020 20;D00030;D0#100;D0D100;D 0 PdD{pD{0S>0: 0D;D+0S0H 〰 0S? 0S pD+pW 0[7 :d  0 P-= D0 10"3- 0;D0000;D020 20;D0D000D;DD=  D010!3@0;D0000;D0+D200+D;D+D+D=0 D !  ;D+D;D;D;D;D;Dw D;0B, P0 P 0 .Ph 0 %Pp  $0D )P 0 P(0 pCD;T0D;P  P 0 @PD; R 0 P}'D;d 0D;|30* 0 Pj0H#0C X4 0 PZ 0 PR < 0 PFВ p D;0B" Xڨ 0 Pz1p PD;XXn X Pp/U0 0 GP0PE0HXM ፭ 0 P 0p0D{W:J 0 rP t 0 fP [ D;0Bt! C D;0B`! =XP 0 LP01d 0 0  >PX 0 3P nh n n nD < l l( k j, k i i i h h h 0 f h g g( e e e N e d\ d( c b b bh b, b bT aH a$ `L ` T _ T| _ _ ` `H SL ^ S ^\ ^H ^0 ^ ^ ^< Q< \| \ O [t 0 Pv8 N^XP 0 Pf D  0D D DD!DDDP4D{XpD{ T0BX! @- @R  MAP  ,0(; Ĝ0$ ЍMM$000 1 2Ѝ/A-PSp`@ @V0 X :@@PU %P}@(00@X@D :G-0pW-:@0`T0'0 0 0  @T T P0S0 PUT0 "$P P@@=( 0 A-QMyp$0PS@` 0! $, (0v(`Vh0Sd(0S0! , $P, (0S+100$PX, 0 Q,0S+,U,(0T0PT(0 S50P$00Q (0, Ѝ 0FJP,, (` , \&:,000\,:( ,00(0 S PU$P0 "ЍЍ路 0 ꯯( 0 A-QMz`$0PS@p 0! $, (0w(pWi0Se(0S0! , $P, (0S,<0000'PW,0 R,0RU,, (0 Q0QQ(0 S50P$00Q (0, Ѝ 0GP,, (p , \&: ,010\, :!( ,00(0 S PU$P0 "ЍЍ) 0 !( 0 QC-W`@ P0 <S.A&a$Œ?F(q@p`  0 <S.PA&a)Œ?@0: `Q`Q QP Q@ =Q| WP [ W0@0@PQ 00@ =Q  >PЍ`@QxZЍ`[`P W`@`_][`X`Q 00@=Q  P PZ` ZQ Q 0@[W0S `QQ 00@=Q` T ۼ T T| T` Tl T\ TP TD T8@-0$Q0SPB00XS=@ 0SQ.C+S^2. r``p 0000s0   0 C R0 37 #`0CVs0 X     0B ^037# B"  ׈A-Pp<U P0 @x0W``W 0 .p H\p@^0070.200 0 S037#P00 \00/k|o/٥kd///m@-` @0 0DM0<000p2 00 RP~=00P@0P< 00 0 <0 30DЍZ $ N ԤO-1쑟P0ਂ0M #੒ q i C2'r0ApqB# C@$AQh!dP`3 @@C.*T6W>YFX @00 SP$Z R 0s00    00 R @ЍW 0 pPD0 fPW H0 \PY 0 M QP X :$I% A-`pP+0S.@ T$ 0D0 .R T  S\R C @D.R @0.  0T  S\R  @@( 0 0@-0M M 0 P@ 080P Ad P>o8 ,0 0 8 30ލ Ѝ0Y H 0-@- M0@R0  ?PP * Ѝ@Ѝ/ ( Ѝ@Ѝ/YPR0@- M P@  P P0 ? Ѝ0@n0 ꪫ00 Ѝ0PR0@- M P@  P P0 ? Ѝ0@J0 ꃫ00 Ѝ00@-@Q M Ps  P P0 ? Ѝ0@0 ^00 Ѝ0p@-P@ 0P p@ p@ p@-@P 0P   L  S f P {  p0 0 pQP@- 0R R   0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!   P " T@T @p P  ̪ 0 pp@-PP @ P   T @ |00S6 \0S D0Kl@k{{6{ D0Kc@k{F{7{ {@{ \00c\0  ?A?^ {k{.\0S 0##K#K#KF@0SD046S @0SD0Sg 0##K0##K1{k{Z0l##K{k{'{ {G{ { {k{'{ \0S{G{{ { t0S t0St0S t0S {kF{7 {  {k{7 { D 200 0"S%$K"KD056CD0 D0K@{{({ k{{6{ D l20X"S ,0L"S(0s% 42D0 0@0 eD056D0 /0S! 0jS{pk{{{:0 0S00 0:g{{ \0S{G{{ { 4 00Bk640 D0K@{{({ k{{6{ D T100 0S) 0R%{{:0 0:{kG{6{ \0S@0SD046S {(k{8J{%k{3{!k{,J 0_^]^[^Y^    @??A?5?55?5??|9P  03^1^/^-^+^0S \0,0 0(0 k {{&{ D |00S 0"     1S 1 0S {G{{G Kp@-@P*Tp (0":k0cSp:@ p 0 0 $A-`@V PpV0S @ ᔚP 0S V@Ep@-P@PP0 S :pSS00 0R:ppp808 8e0 $0$ $f0 x # $h # # $H #A-P`L@IT,EP: AP- pPW 0P P B $$P W 0 P d d0d C0 3L L0L E0 *4 404 D0 ! #@ " " # " "\ " " "80 0#@-@PDQG-^8 pP@`  00+00CS&OC#<!  5\U0 S\p RXV``W`Q`VP\\T0 S@\` Q@-0-rw0-0x-00= 0 7 0 0S wS -S rS  0S /xS  /  p@-^ PB2 p 0 pP P//0S/ S S/0S/0S/@-@ɜ0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 /    ??SS $0$ $p@-0 / H  `P P P`/AP/Q/Q Q/?0 H0H Hp@-0 Q/?S0?/0?/   QP0 ?0/@-k 0 A- 2@P `p``\ PU0SO0P@5IPp@-P0@ ES`M aЍp 4 0PĚ,0S 0 p@-@PpP Q 0S P40PS4p@4A-X Pp@PEX `P@``O-p MW " @`IW   PP @0SW G!0pGp1 ЍP Ѝ  4p - BMMRč `` T @P N P"      0@- @-Ÿb M M`$ȍ@|PpM WF b"@$@ p` M0 H",2 0 $8 30ލ ЍMB^"P0 @Mp r "0 B^P.!0 5100qp0P0 N\A AL+\ 92( PH[L 0D  DD4   @CX D A0 5\   l010/C. *    A-RP`p(M @x 0 @0@0 P0 P04N P@ 0 (Ѝ  ,h0 0 5CS@/0cS#:*'R@/0CS!023@/@-@T  S 0\\0 0NO-PpM ` ᖙ@P-ZV +Z @00ZS U Ppa㶚`=p"@ 0Jq \ aJQW JAJQ7 JUTPRQ @ 0T  R S` 0I0 0 ЍS T0 Ѝ0 0XQ0A Ppb P A@PUPpbp@-BR"^8 p@,00m@Pᩝ0T0Pp p@-BR"^p@[@Pᗝ0T0PpO-p`M@ P-TP +T@`00T Wp pX 0  0 ?0X 0 j  0 P @p Q 6 P Q  S  R- Q 00Bs ^a0BSW0BA0BS(70BU%| XZ  P Q  S  R  "00"00 0S \0F0 0 Ѝ@`p00XS00 C R@0 p`0 A BRWvppup@-BR"^< p@0007@PƜ0T0Pp @p@-BR"^p@$@P᳜0T0Pp | 0 Q?0S @-wJ-- Mj ЍЍ/G-`P㦏00 !PER !@T2UpU= ᴍP- P@@D @000獏  ឍP0 0PU00u [P@@D0 @0? 0@00Y XRA-P@pJH`H0``@p 01T  C A p@-@P%00CS0 S u P `0 Pp1`u@-@ 0`00@- M 0/ Ѝ0 000 /O--0`MQP 0 Q`\0 0(C.PL 3p0:30 :` ᩆ`P @   "P0@ S0S S#Y`@T 0@ G T : @D0S Y@Dpn P  9 qPYp@D_ R<0 0` 0 e00ߍ S S0 S S \OP 0  0C?o 02P@  0`P 0 !W d*@SZ @0P ` 0S S S` SX W:* p``P @0S|0 0Q  T:@DP“ 0pC Z H  巓0@D Q ZP ȖpWy(.P G P 0  /r(.P b pG 0p 0P-/`^R p@-PP L1PM0LPQ`@0  .0 P + T+ 0  0v0 MP [/  0 x0 0 L0 30PЍpLMPL @  0 40 0 0P@MP00 ЍpR R Ք/ 00 Ѝp0S ɔ 00 Ѝp0S00  0 g| tLPO--LLğ h, g gO-dd M@QpPM (ZD U U U Đ 0 `Ѝ0` Ry  ?0Z' + +`PP 0:/pq 00P @ P d%00 0 00 婃ЍZp pP0  * R + L UY pp 0kP 00 0SM   00 0:/pq 00`QÿP < `V̿:X0`w R00Ṁ0 mP0 :/{q`0 d 00 0`VÿR < `V̿pX0P[LS 0PU 0<`ÿ80 0C`V 0Y 0!QK`L0k/  0`:/pq@ 00 `P  @ P $00 0 Y 00 OP)0 S&: 0C 0`ЍPT` 0S  0C`ÿ 0 0C`V0Y 0  0LI `P` @0P g$ 000  ᰂ`᫂`ꅏ 0 dpO--SP\0# ` $M  0 0 0 0:p#0 B0S0 Q6  R00S B0S0Z  A#P 0 `p0[] U0 00 @PS  0SRRV  RR00S R Pd 0 D P0Pq ^U T~ U^  C0 P  Q CTs \b X  P04 0SV0 }P+ R0" P0 @  R TP P! P( P0 Y  R  冊p0Sp$ЍZ P 2W P PP P X ᡁM# `p@-@0P0FG p 00p`0`@pd0TS` 0 pp@-@PPeP P 0 03/P Up@op003/P U 0< p@0/p0 p@ 0/5 -M0 3/Ѝ/0@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0 R R R //00/00/ R R R //00/00/0@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@- 0R@P M R R Ѝ00P03/P P Ѝ0003/P PP0@- 0R@P M R R Ѝ00P03/P P Ѝ0003/P PP0@-@0TP M T T Ѝ0003/P 00S00 Ѝ0 0R0 02/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0R /C-`@QpM Q) Q PЍ0 03/PP WP:UR X$ ЍC0  0003/P PW*UX  0P0U URPЍ Pp HH(P0PSP ΀ ;A-P`p@P  R 0 R 0\A/U 0A/0@-M 00@SP`p SW- ᝇ  P R`V V V Ѝ W` 00 R D0SPVi 00Ѝ` 00Ѝ #Pp PX #(p@-@PT`M T T Ѝp0 03/P 003/P  Ѝp0 00 0 3/P 003/Ѝpp@-@PT`M T T Ѝp0 03/P 003/P  Ѝp0 00 0 3/P 003/Ѝp@-M@P0.S00Ѝ@-M@p0CЍ R? ..R0) .Q -S.S AL#\0A QS' .S 0 .Q AAQ0B Q AAQ0B QS  \0A Q-R 0//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 / JPM0  1 0Ѝ/ J0// 40/ ̠ ( 4 0/O-P M R  <4<00 \O 0S XJ@.000PC @PG X=@\RARZJ 0cZC1 00X.p0Z`ڄ P Kg[p[P[D Z@@T  R0P P*0000@( 0  ЍAS0S~!0X@\!0ARI0SP \P0" C:R:Y8W654SR10/.M,+*)('&%$#"!@; ! C]R#X`!`a##"!!!Cr b0Cs0!0@ D0DQt X 0@Xx0@,010. Z009ZP  0k3 ""pE dk+ p;? 0 Q0SJ*.00?DŽǀ$pQìO-ğ,M X0 t4tt0P`@p 0)[X> :xP @Qa /xP @Q㈀ $xP @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] wPj  HZ$M0xSJ3  000 A P0XY /Rl ]RRP ^0/ $$ 0 ]R& PR " YXuP   Z J b"r R ZzA @Rg .R`P@z0@,Ѝ P` 0D0C  [4:k( 0 ,Ѝd 0 ,ЍP    Z"    R  PXY  ^0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYy E0G- aQ`>*0 S* \6 p0P0S0 @S# 0X+U  @0s00@甐@@ |P 0S00BAU0S!PPQP0X( 0 @RO-P3P#RP3 M0U 0p`\ @H @R9 R R% (00 ЍW@ Ġ[? A @ GRPR@\ 40S @[A  Y*@T*0P 0A\ R!ɑ" 40S 04 0- M ЍO-S,MP [   0S 0S@0Ps0v @P` \qTp000[000 0P0$@0C0@TW @0S @S]  0r XK*PT p@0T00S 0 Sg*`V_ ] N YZ R0O Y PB Ԇ(00P0S !R* 0G S 0S 0 $p0ATgP0"1 0\0[ 00婆( 0 ,ЍATX0S"  ! 0SPT4?<00 R`v``V0 S000R0 ABQ AAX QS R0SY 0R?0)@ *S 0 ,Ѝ !0H p@- M P0 `00p @ !p < 40 0 1 30ލp@3 : 9A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ3 9T 8Q:/R/0S/S:00/@-\@3$* 0^ @R R R Ѕ( 0 0S0QA^ R! Q 0Q" 0 ARL @-  RQ0A  RL   0 C葅( 0 /C/A-@P`TP' UVT mP @TP 0p c 0 ]( 0 0QSp@-`P@ ?PP@`V  0R p/pA-PAUQU@A`pPWڀ1AP( 0  0 ? 0 Q" @-ASRB 0@S A 0 ( 0 /-- M ЍЍ/@-M@ p TЍR/0-S0 \S  R 00O-@` M P P-Yg +Y` 0Yi T @Q 2p N`Ppg2pN`P" [)SQ" K0Iq P0aIQW0IAIQ70IT| V[SQ4+OJ0S \0J0 0 Ѝ  00YXP 0@ \@ AL\T@p@-BR"^8 p@,00a@P 0T0Pp 1Xp@-BR"^p@O@P0T0Ppp@-@P M``8  0xA|Ag8O8 TAXA\A`0PP08 @(0 0 1 30ލp1 0 0 0   / -- M0 0 ЍЍ/--, M0$ 0 Ѝ Ѝ/ /|QPO-M@b 00S000p!R !03  tPP E`#3?`:0P*Q30A !!!! PP 4 0 | U 0C pSBP0 0@pQ 00S  Ѝ3T 0 @00Ѝ( 0 0p@-@`PM 2v0 0@2vЍp0 0- -(Xp@-0 000St@@@pdPddPfT@Po@P B0000 0 -t D@-@M҂ Ѝ@A-@`P1ppp0php T  )<0 r   A ,~pKH@-@kP0S 3/000S@贂 ӈA-pP@`  F g000h@P p@-@PPpp@@-@!1BMM 0`PF040@@@ @@O0qPpS p10S d!p0@ ` P@A0@ P> 1 0m!0 0 4 302BލЍGP E@P  4/P Q Q 0 0Zmx0 00P )0 0 $ @U/ *| *@|, )\ XO-qQpMPu Ap@f aD ` @0Q 0]1PI 0SP p Z [ @@P 0[|pP w0PU :Y nP``S@PP TP 0@U:W X0@@00 g@Qx00p@@ ЍPЍ<0 0l t( (d<}X Τ 0@-0@P$M P P0L0 0 KP $Ѝ0  G-RPL 81040SA a q@`p #)/0@S-00儑 000S 0 00{0 00 xs0 00 \k0 0 @c G(00xhTG-쀟0S@P$0S!0pk`PP @0S PU @@P 0U}00 e8@ 0@  P` `,tO--dM␐PYSRßQ @!3 000Sc`0S00 0|#00x3 0  0 0pP `W@3@0 083U0 @ 0 Q  Q P0S-   3/0 0'@W$U 0 L00L5PL 0SI 0 <00@00<00%P< 0 S@Wp@ RP"00S-! 00C0T@dЍA,@@@10\U 0,0S/  R|1|0$   @$(0se@n$0@S(  ( @0dZp+ p1S `bPI 0@0C000$   @$(0FP6 @@>$0S(  ( @04@$  $(0+ #t ʸ$<  | t 4 ǐ t@-0N~ \0N~@ T \kT 0 \a 0 0@- MP@0 P# 02c2c200:S Ѝ0;0 P 0 2c100:S<0 P0 000F̌0@-l>0F. "l@V,h @P^QhLl -R 0 P0R 0R R0 dA-$Ÿ$20#Lc\*0Sm S} 0C l l;Sàʌ͌fc\*0S[ S@a 0Ϡa^l@Ҍ 1C0o 1fcf Qq P@\ pp0T0CH` G41@?L1c1c0P0B0P0BP`N4PQ` @PS( 0S l lVàڤ0@00002c2cPÌ l làL l là@\)P *QfffgI$L 0P /0S/ 0 S/0S/0S0@//O--M0 @  S 0H$(@0 48<0L TPWLW^ౕŠPnnAD(@,j\ G 知N౞LΠ @n nL,jR柵Ɵ쌰,౜ΠϠNl !B0 4 jQౘ柵Ɵ쌰౜ΠϠl 0 A8jpƟ 0@c@sTP0SjQ@@v@f@V@F@0Sj ` `U1:`X1! R4 PEe@Ϡrllq q qC CP Q B^WoPU4 h%80 c s<0 @j( ;RT0qQ@`: (#P  UT] WVb V0 PPp @`/  / R0P@V0 p` 0   vCE `v0;2T;240ğCy00 0ɯSpW0c0  Gv0+Q_P > >vPVpW|c0  4v0+ao` > +v[? I$E`@DP 2T1 0 cQ R@ 0@ V@! Bqgqg[pCc0 v0)  > ur?D0CpT1 * ?B1c1c0Z@ 0B0 (1@502c2c2B !@" "b1C S/  0@ 0Id0 u0x> u0{4:`vc0 u0&qp> u~:.EQ9ku_"ncSmI$ň@PxPsPc0 u0+qp > uPF`0@ 00T @ @D0 S0@@ @$ 0Ѝv c0 cu0)  >Zu ^<00P<44P<00P}XyT 0 0@-pP M0P0@@P T0S V ZQt<ß .\001 P"> 0R \ 000! 1 R0sx 0 Ѝ0 S, 0Q0% V 0? VQmt02P P%3PP ΌQ V"> 0RR!:∫ RF\0h V0PC F. l V h@Y(@ lRAh X b 0V00 V 0?0P 0 J0P  V    PR/R  RPy 0ЍP0P0 0P  R V,h ( d P/R  $  l `Y`Y @O-@PF"F,l Rl0l0U"RP*;<Ѝ"R 0S*0Zh4 0*P;M@PP00C R`U``,⸠  `PPQ 00R 0R0S 0V0xW`2 z6 @S%VCD00S R ;S,S S@0\- 0 (\ 02F0S; >SPPE3@spP=/@mpP* @00c@039@@i@V|hlp崠hpx|…崠 ራ lltЍ +Pv  0p jY   10!0pS0S >S0C#1 0hH0: P 0,S\0:P 0S   @Dl6 khƎp60 |ax倆0*;$吺<P,@P@ğ处头00p(pYpT @D b[1:XtbW 1!/ 0Pppc W p$@P(,@P0@  @ @0 Q0 3#哴#cR01:#cR010! 0 cR c s S R  x3@0@j00,P04@8$P@(pP#$38#!BcRl:#cR #30!WP Z c8! \ Qaο ce8偱 ^ , \DR/ 0" !c 0@?P00cSC X>*p  1  @R -S +SDP )D`1D P D00cD0W W  0S(p,P04@0<0f΃g>0IpP@(,@P0$  0(p,P04@000HSh0Ű14*r0s14002Hnn@̀\)\({ 3Pp@-@@#0S p@PP @P x0 h0@T D00 8 -q@ @ d[2HhĸhG-@QPM 0SB T`P_ 0 000STH0SB `V _ rPPUS lQ8 X1X!@0d0 T000(aM@@`F T0P0\  R@ d?@D  @D0P0T0S 00 PP@0 0 l0 00WPࣥTD,iŒP e \hT[e |\P@-^ F=<;:9r7n3l10/.,+s)('%m#"k RoNMLzj TyvNK|S WW[ 0W0   0Q񏐫00@0C \$ShPe u0Ss 0Wp1!PI  u0S 0Wp1!P9  u0S 0Wp1!P)@@@1 /u0Ss 0Wp1!P   u0S p  0Wp1!P Z u0SW 0Wp1!Pg uu0SA 0Wp1!P `0*S6 0C P@00C P00C P`a`00`F0C P$S2 uE0SWp10P 5 u60S 0Wp1!Pu)0S 0Wp1!P * u0S 0Wp1!Pu 0S 0Wp1!Pt  u u0SE 0Wp1!Pc @ u0S 0Wp1!PT p <Ѝ 9 u0S p 0Wp1!P6u0SL 0Wp1!P) p l  u0SF 0Wp1!P  u0S p  0Wp1!P u0S 0Wp1!P p[ p xp0W K*0P| <Ѝ@@@@ Rp4a KpxZ DpS =pL 6pE /p> (p7v0S p * 0Wp1@~0P  pu0Sk 0Wp1!PW C u0S p 0Wp1!PBu0SB 0Wp1!P5$Sy`0P00 pu0SO 0Wp1!P)@J u0S p  0Wp1!P p p puq0S {p  0Wp1!P kpz dps  uL0S Vpf  0Wp1!Pu90S CpS  0Wp1!P00C P0@ 00K0C P$S u0S !p / Wp1@{0 S p  0 W p1@ r$S@O--ϟ oMMƍH0@00T ! R !0s0: Xa 0S^   Rd 0$00D0>ܰ00`0>T00@匰d0<\PPU @%U PU 0T  `J 0 R 00S0U`n0S <0S <6:0@0S0000PP )-= 0 6 30D oލЍ VPZ    R:0s P=*X1RRXOX.TQXQ\Qdˠ~@Q`G0D,TDT l(80< Q00 mS>0\ 0> 00  H d@8P0p0QS+\ > 00   0 R +0  S>0    X 0   0 R S0|@TU< D\  dN0P00jD0 0Cp0D HXXz@``  HX{0\0SE <00NSY `Wr~ʜ|p@P00L@(P,@4@*Sr0lsQ0( p@ R Rmdp R %2> P0!0g0@ M 0P oM0P00 0@*: Z $0P$ 0 p}@A y PH $ H pwE@:A Z $0P$ 0 p{L,PQӦڈ(4s0@ Lz`dhP, XRӉX,  B, 0 HI0Q 0 S0 M0P(  PBUPU ڐ0QP0;U@@ATTo P @DT0Q0S@DT 4 0^@0 P0 0 g0RP0 @ GpCTo `` (P0pZp` @DT0\p0S L0P000 L0P00 0r4 10R+ S0bB- C S!!/ @.cS#/L!b0C000A0 A00s@0A^B0. ^@0\0\0X0r(0f@(0Z $$  P4H0 PH0sY 0 0 l$ H@  PH@pH@$ P  H@Y 0 0 ZH@$ P  H@$ H@  ;I 0P A|@x@E SH0$H00$ 0 0\0$ H H P$ H $ 0 H@  PH@p ?Lfffg <0 7H 4|  $ 0 H@0L0,0:<7S R. p$@j . SH0$H00$ 0RY 0 0 *0@00p0 G R5@A@0 A R$Q R p>T 0倠pM 0$@p2RH $$$H &T †p6 RH0H0 @$ @ `.0@-@ M@P L 0P(0@L Ѝ0 0@-@P M 0K0 0@K Ѝ0O-[T/ M p0Pjra L ЍO{[D{&{(3`):0 SA΁@0c9, 0c33ѐ:g{0{H0A!&LR@(S 0D UUGoPEEéQz ??҇coCa?Ɗ(`ȳ?DPy  8' P, 0#`P0, T PQ,LH00QPC6j(0  P 00 (PRP@J( BDQ 0 P0 AP P  @B00 0 0P 00 SUWQY `Q`(( ZR@ R XW R! (QS 00 F 0pp0 D08` 0 `@0 P00< `U`R ,0((((,0Q``V  DRQ PX  0 0 R?  @P W P   pP`\ЍWpR0C@( aS( (0A0cD0(0,XL8 00/`P WU00X Y08 00 \8  k,\ T[{KP x {k&[@P {[IJk{{ {0X LK 0{@kQ;0F{5q [kDk6k+K P6['{;k&C{5{0JG[2k0000Z,XLL,Ձvk{{ {0 L{@G{5{Fk{KJT PQQ~(    QQ8`p P0 [ U[ UQ Q R8`p0@@P }P09S @010 8 0$ \ЍO_00 00$0 0Q \Ѝ `k{k'@F[  { [%^F[h $TDm@P00 2 ?@?@$@8WP00 UWQ00 000 `X00, ?001[ X{[%{{000100 -[ )'Zy 0 z 0 0@P00 aK 0P0V 0P000C 0P@PF 0S^L0SPE0f L =@P3 00S0S0JS0PW0# W N@P P0 Z0JV  s9R   E X   oPz ,0[00|@{;$& \ 7K{'k[E{7@{0 qz)k[3{Ck6{Z0^0SN 000U[ 0P0b80 01[; @@$?{&{ {{{kKEkk:Nk6N0CB:N@k:00s00" RUW W k6kEk*  JVO 0r9S 00 |pPr #Pl   ! L 0P0_ PJt X L\K{k[%kk8A0 N0X0Upp8`W 9S0 9 P  0000000ZX3U-Q 0000^ QQLQ S0 l QhQ a 0 s0R    000100< P0 L R{ E LwL Pp8`9S8`p Xʜ<`UY @$@P0D #460/\460//P@-@00 R@P@Rp@-@`0P0RP* 0PpP R 0 R VpP 0@!$O-0@MS]@DPqp1 0LO[1`q0&:0 @@F0 R0 W 0 *0 @0S 00CX:X@D* R @  P `00 0P W 0*!1R 0CX:X@D* R @Ѝ0-WM 4@.T0K  T 0      aCNC& jlX@-@-@-Qp@-P `0@ R @P  J00pQ ``0`0@- MPM  @P  J Ѝ0-M Ѝp@-@ P` !LN O !@Ap- M= ЍP/D -0")2b3c1@2`M1 AЍCރ0 00/ g0@-P @M  0P@ e;p`Ѝ0 -- M0 0RR ЍЍ/ p@-0@Q r P p0 S P1 p~ PP   ! %J @0O-`M p A QP +5[% 80Sz SQ  @T Rs Q)Q0 <0 *Q" $W `W `y Ѝ @lTQDQD@ Q A[  P<0   \ <0`0 <0 QCW   `V0BSTQ; ` b  <0V 6TP a PPl1 !P j P T@@p   2  _ 0  @0 a`P  0Q/ R  B / 0Rp@-@P*`0B @!R@ @B@DR@@@3 P0  `f2f`pS@ * A BP   Ppb _ PPO--pP |M@ 0-L 0lp $d p ` -R-+*)('&%$ | 000R 00B S0080P@1T00PCTЁ 0Bl @00B S0\ , EPG00 lp0l00+Sj -S0l000C PB0Sll00S 1CP)0Cl0l(000C Y l00L0C Y( @Pڼ<[<`<0dS 0pd|Ѝl0Z<XU 0d00< 0,0 BS( " S ?o2@0Zg{T@X {Уpp X ڐ8 g{0 [1k{Z 05SXӊ(0Sy (0Sq( %0hS(0pHpt00XS `l` 0R RIQl000Sd00d0R  p  YZiS_ IS\ NSl@r P 0 d00 00l00(S 0p 00nS 0p lpd0\w   Z$ \ BlT0 0C Y, Y l =0l000C Y @0J0d00 0 yPH p (tpHpWh  5J01{{'ZpJ h Pp: h t BpYtp p tphptp 0 A0SH 0Q00xGY  Rph r0h000800 St  H00Sp00H000$0 00g(0<, S? B <0 0˟۟:$ LL@y PP   ! Gp0n `P p   !GhptE @PG Z$0<0  p0 C0G$< pP0C pGpp W0 0Z 0SpGIJ$0SGQʵ(0SYZ  @P K pP 0S0S   ' @0SPYy 0 S # Z H00 S0d0 pY0Y IR [ Y0Jf,P00h 0#R00tS 0D0RI `\ PK \Q[pM  p Pp: 0S A ^H00 SihAh   Xh t0D0 Co, 媢RZ )K{8Ik{Zɋ0SW ] `PW lp<?@?A<V bNӌ?ġ pg  0J01{{Zp W'"Tp0h0{0?C0C*zp 0 Jk'AQZ0 0R*:?C0Cp46o JF 10{  0QF `000l0 R `00W'"d1l0{0?C0C*zp 0 Jk'AQZ0 1R*:?C0Cp46. JF 10{  00Sq l l00S 1CPl `0C0,0Q Pxl@P l00Cl0Pl0 0l000000p d0m p Pp* h0 0h0s 3<0@ J ,  B1{{d00 {0 G У0PtPF&  QZ 0 J ,P0  Pp A ^0S2 h 00Q0h0@P Z0P,0 ,0`%<PP Y' # PP"p Pp H0 0CH0t00Ct0 p-00 ΋Z 00P0Z{相@0 zSI8` Sl ˋ`8aKPH{|I:țxd0P 0d00S h 00CS0 pPpt  t00C t0 0JHFLDB0 t0RW0 00S S SA p20p00 d0000 @BAR *0    rK00  0 b3"  0Sl 80S 0P0dK"0p 0`d00Q00d0X @0d0K"0p 0Q000 d0p0 K"000 000p ?XNAp UPp t0h 0Ct0H.E0P@!0d0 0J!, P000@000c@02  -[0 000lp0Pdf0p Slp0pH00H00p,0tt~ H,G00 Y I P/pH00Ct0 0h0Pp TTTTQKR,!$\ <Ut0 0P00d 00 5t2( 01t[ t00n&t b00`"J @0(5S!{{'d 00 {У G aP1 [ ,00:,0P0相00cP0[,0R0,00  ( B0 RPSЁ S(\X У  3J0@   h{({' A1k{'d00 {0 00C1pr 005`S0!0d0^ 0A jZ b 0S} ph0 |tP0k0 0!0 0C  dh t0>ZA!0[d050H 0R0. pP IP(0 d0t00Cph t0Pp0SC@ 0 00dp 0Sv 30p00000t0P0d0p0d0[ 0!0d0 0 0#R00Sp0 Z^ Q0d0 3S 0d0H00 dS!0d0p0 R0S800808PpC 0hhPh00h0!0d0 t0p0Cht0,Pp*@-00ԸO- 0RPP@PP  ``pP r{"8 +8!80X#0H0C X0003pFq WG @ r"8!8Y0LL#Z 0V 0 a 0dPP   ! B@`@O-3ß0 M00@Sp 21 `000`C0  00 0Sl  0Sg SB0S00XS 0QZ P@  Q R^T#3\QcTPQ0 ^ \ <0QR- U00\0S{Wc*0 GV*0F@S3 F\   |H0 RVOWM 06S ЍЍT@DPD@ Q09 Q0Q l  l>P:00XS Q0L)AoR^& 0 0S  0c1# 00Ѝ QN0O0l1 c, 0# Q:v00Q )Q  0 FO-Mp<0` /H8@P00S 0@0P 0 B@0P 0SQ^  H0PP   Q0DR0^^ 0S 0S S SK pPr@00@0 00W@ !GpT0 Pe 0SUP0 @0 0R R 0\Pb S 0CPPa R@ 0D0CSڣ0SpP[ 0[0 0 RYd*0  TDQ @J \  T @   T 0CC10BdPDP|0S0SCU 0S S S kGP@"00ЍSu 0CPP @+P~ -P% 000LP 0ࠃ:L0@^ > L@YPl #@Ѝ000 PL 0\@0Q  R  r KS S80S #0p00 0p b@0G"00@@~P  D21 2 Qn\ 0\0C 0 ^  00@Y 0Sg Sh S @0p 0ЍI  PePgy0S`F@"00Ѝ@ @QA@E{pPJ 0H0Y@HT  21@4PEC@80SjU U EP 0 00b80S80S800c8080S Tp0+  RP!@L80S L80SH00@X \y0l 00f@`  BR"@^ 1P5"@!@V+P(& A /A-`< RϠP@pl3 ^P 0 W`0 p0U0@PEPU 0 BP `@ pV  0 BPp0U@890@-M@P[ W  0 B@0C2S  6cJ @{k Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ 5E0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/è|ÄPA-^"PbA1! !0T2, lp(  T2,N10C#10R! R 0000T TN0NC1^0@- !P@M: R @ 0S R0y@ЍA-q1pP0S2 U`ec@T`* 0S00 000AT !0S 0[`te@!0 0D1S  00F0S 0? 4tP@ ܠ0p@-@P0p R pPQ`00App@]D ` 80 0QApp@ 3|t`@(0  0#10/sP30s R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P@pP   ! <`~ 88S00000P0 0/@-@P0@0O-0M[ pp @ S0P0= PaU*0 F B  C 0 X0 *0I0Cp0Y003 0[P^   p0>0 Y0 0[ PT@T 06S 0@ЍG-q0p@9$A QPiV= @ PU `  PP+ @ h10S~PP= 0S ,1 1PU 0C  P 00Sj`P! 00000000i0S x0d0iV0S 80 ,0R0i /t@qPG-`0b@TP塢ڃ0T'P# Zp  !pB0  n.  P2)0@R0C`0P003 `MpG P `C-0P!1^$23\ *G-0@P@DT`G !1PG*32\ =:Pp @@  Q0 0S 0SQ 0 A B`Q3 3pU  0 0S3#U0 E B S 02LS @0@P`P 0!p@-@ AP`DG 0` P0R @*P%&0;BpP ` PR `5,#5110;Bp `1<P0DR%& 501?C-p M[T`EP ܀4$66U0P 0X0   CHH5` Ѝ P0 `00 !30 0S  X0 C@@1` Ѝ0S0/0 R /@-H1HaP`@M@rPP3 ipP-0S  Q5 p 0: ST0P  uPP @0 $ , ( ЍAO000Ѝ\PA 0 ЍA 0 (,]p@-@400CS00 P4pP  BR  /p@-0rSM wS aSOP` aA`00pLP`0S e C+Sr/ ^R$ L0S@@p0KS0DS0ES0PS`@`P0p@-S4 @)4 P00P! !& 0S 3/PP೼000P @ P 00 `00aa4@0`` 0pf1P@ 0P000@-!@R !P 0C 0 0 S /G1p@-Q1P0@0S3 0 GN 4000S9 0"$0 3/0P:s00.p00P @ P _00< R 800p[S0P1D0P00s0+2p  0@000 p_@  0@00p #h-Ѝ/@-@^S S S A@ 0 H0@ <,0@ ^0@ S@6000 0 0000/O>p,aQp@-P P4ATp  @P 41S fP0p@>@A-4!@v pP31S Lr @P!k4Q ;0P0W0S!R PMoPP V!Rp MWw>pt>pq>pp@-@P 0@6@A-@`P] VapPPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V =0@A= @O-,M0 0 S ! (sp2/0, (Q0 P `@P@P0S$Pp LZB @PUXX 0 `P_ @\P0HŸUJ[e`pp,Ѝ 0 gPPuA $`hP[ 0 $ ]`P5 @\P0  0P 0Q QA Q  PರZ`K@(  aP 0 cP @PP,Ѝp  0pgP ,Ѝ 0 cP@00,Ѝ$`  `P(@HT 1SX0$(Q $(1ն`n0 @-@ ! \ @=,<00,1S@-@0@ <00,1R@-@1  @0<,< ,!G-ሕ0S M; Ppw`a@PK WQ    <P 0 p<|<Pލ xP|  0p pt 0 Xf 0Sc A/ 1p APWddPSJQOHğ  ! 2/@ PG(01 PP ` D!B<>1!0NX QWq0Qpp$4q$PP tphh3 d#dd@`C` 0! `pލOÿ}0&<k"<Q~b<Q \ Ƞj 28 `PP4 D;@ ;X~ Pp`V4`Z \3^ ,2,"^^eL48 P3k`P D H 0 P$` aPU)< 0E`B<0,`0(D L QZPP[ ;@Ƞ\ j ,$148 `PP DT;@ P;nPP ;PPU Pڂ;PP|;p_y;HPt;p@o;@ <aThLtD\O-@(`10pI0X 000; Iq00& Z#Z! 0J/S   0 0P00: S /0 p0 R I R.?004 <0 0 U! - op".0SY `0 S00R0J Z P.000S ᥳp p⡳P .ppGorr ި lhk`R Q0P:Q0Q:e'@-z7 h@-@@1 ! @ Tp@-@(P% #+`P! p@U O- 0@TM0L3 pP` 0L0 D@ @ (,8p p $00`4P<@ H@P P "  p'gbȌP% 0#  P !@$d(ah  P% l` ca+b(*alb̌` & gx)c: eg` .dH(ଊďeZ,a*aȌ b, 㼋dL+d<.00 0bhc`: \&eb(* a#a` *錈g|(gȌ,igx(ǧi ,00dH+bldY̠eZ&c:. ̠dL0A0om `j  h)pd `0   0p@  ᘱp Tp@@ @E REЍzY } } , }H |@-M @( 0T ЍЍ |O-D"D2 0M Q0|00Pm@  0Tm !1 0 |0 30pЍX@p  0TU @J@@ DU01PEX %` 0?P00 02[ c  0@@0S 0000VUX= [<0  0 0 R     0$0@ B<0 00  0 0 0$[ꓺH 40 0 |0 30ЍO膺<0 { Ҝ {< @- M@`)`Pp =P:000 U ( Ѝ` y0@- @] 0T@P x@-M@M 0T ЍЍ@= xO--1!0C$M0 BpPsr[㰀 0K 00@`Pr  X  BQv    Xk 0U @pPuPr 0@t@S[Z 0`Uv`:00s0!0 1(0  0R 1S0"s0&1!U 0 0C01 VP05P 501>0C0.@%01 U@[* 0(b僐 X @0Bt@S~[a{zyxwPutsrqpo'X0PQ* 0UN X !    {     rT    r0P@p0uP@[t@@t@ 1[@t@@A$Ѝ0   r00 0  r0`Fv`00s0W00s0Q ` P0MWC-Mp`:@P%  5PP 0!0 000 0`r 0@@!! 0 040000 00@PЍЍA-@P` AqP00P 0p0S   L| PV00  000 0 S$1  @p  P 30  wP 0 0 0=WO-MPp@Pk 0   qR1 岡-@@p^C z`P0I 10 岡 0@0 0D000#!"ᒾZP@ Ѝ S`P0 !  10 岡 0 P 0  00 1@0 P@Ѝ  ЍXAA-qPQ A @pq  qQ Aq⁀``X  0!0 0E Bq0 @r0 r R  Br `` PPV0P00 0 0 00 0Q5O-- `10C0s00C 0? P0 0RpW 0 10C0s0R p W`0 R  `p` 0R ` >P ` C-@P`Qp$M 00 WW 0GS ( S񏐛ySuP0GS&00$Ѝ( ?   0=pY 0S !0!0 n PH W W W(0XW p UW  P- H⨀Hx弁HW$ WA,0p110C0s RBk  x1p崀% P,0p1! B r RJ  Z1p  vP弁pP Ժ0 00 P(0r00㸁(0p= `P 2 00$Ѝ0SH 0SE  0X@弁9W` w 0긁0(0弁⼁(01ḁ0C0s0xXZW( p W  PtHxH꼁, 1 Pd 0WS<qW0G z弁,p 1q PK 1ᴀX0C0xs0XX0H1崀ሀ!0  1P P) pp 0Cs 0 각 0H⨀Hx0!1 p崀 ) Pp@-@`PP 0 00(0`00Q(0pO-@M,0 01 wpP@ Ap@D@t@T/ `@r`T PuP  P$ 0Ds0P @ 00!01P0 @ 0V PFuP 0e0P0p 0Ѝ " VR ! B r R p 0 `ЍpQ P P  ἀ@P  㼁0S0  뼁0@S\ 0H 1pP 1 X0C0s00CR  r DQ  " ZQ` P] !@ B  B  `PM B Q0S0 F@UTe 1Q 0R? `0E 1pP pa P1 0p1pP01 P Y @T *p  pA p`M  pG `:p  A1@D@@Dt@ vP@! @1 0P GP`F!@Dt@V@ `F!尨000/ YP@-@P L  0 0@ (h#0 ">O- $ h2M(P0 \0`@p 0 (2   p@@`P0 Q %g#" ," ! 0&&e!"e+" 0 10`0 0p1@0 `` pP  0 0 0`.0A1. @Z98#$5#l  00# 0% b!00#b! @00 0 P 0P`0 `0 0p0p Ѝ>xB/=iA-@P` $P?(p8 "0(0 0`0$0d0B0 \ h " 08R(@R )@ b"$8 ")8 b}"$0A-1?`P@p @f(XM @x$0刁 0@pG0($ 0p+ ?WA@`G?`@`(`0@ @T 0"< T"?pW (qD"p0 0$p?W@`G?`@``"@@< T"q+"0 "`R @-/ R@-@P P Ό 0 0@ (!0 "9@R @-s/ -p@-@P X00m]\`  0 P!0 $$p8O-H\M ~?00P0400p   L$<@(H`, 0$(4^_,8P08P@ `0(00,0 0P @@P$040.0P`.` 0T0 0 '!,',)' " !p 0kd0 " ,!0%$`!(` )$ 0%a+l c !$` `+ "   "ᥳ )$ ` +` ` $000(0 Y 0,30@PCS0<D8<H0 `0(``,`` ` ` 0 0H0 $@H0@0`<@@D004010apQ熏#t L p(A猑@8妀@&像3<.p'9.f1>0#8a`pIF᠎   (`%(p`! !7a9ǀ #"Ǡ"97Ɍ,;40# ,@ 0,P0#0pp`p(P+`DPp@P̠` P0%?+1  ?%1.<3 0)Ì0 P@ 0# .(@0 0E8@{ {0\ ` Ѝ0p@-@P X00k]\`  0 PG0 $$p.xR @-;/j0@-@PP M  0E(@{ {0\  Ѝ000@-yPdM0~P@xP񏐦{enhXRLF" uAgf~c|a~{zc\[ZYXWVUTSRQTJIPOFxFEDCBA@?>=<;:9876543210/.6P ڐ6P 0P#0Ġt 00sP0?CP 0P 0# 0 0}p dЍ0 0  +0#0 0cp P5 0 # 0# ,0#0Ġ 00P 0# 0#0Ġ0Ġ0Ġ~0Ġ l- F0# E0# D0# C0# B0# 0#f3Pl @0 00@43p0Y <0#d G0#_ P@0 0P0@4p[ 0/8 *0#C )0#> (0#9 &0#0Ġb 0#* %0#%0R 048 0 0# 0# 0#  0# 0# 0# 0# 0# 0# 0# 0# 0# 0#0hP4 0# 0#0WP  0#00040 0# 0# 0#0Ġy0Ġtd 0#`0ĠiP0Ġd0  i.l---t-H<4,H))))0G-` Mp@  000 0嘬੫VJ QP0S ㏯PPL W`A 0S7 ワP= Tp8 T 0S: wP8 @V (! 0S01P0PW 10 T @0@0 e M Ѝ WPTU U @ U U X00YY |y @u >x| = = = = =h~hp@--0@T 03/@TudPP q00@T 03/@T\pbH00@T 03/@T$p < < <\ < < ;0@-\@M@P Ѝ0P  0P pЍ0} O-pPR M ഁУ@  `880 S" 0SJ: I 0 Z  0080 S 0Q>0 3 0 0 Ѝ 2  0 0 2 08 @@ @ Ѝ  P00 0 00 0 tP00 ЍկP   ίP  000@-0 P R@MPQ   0 13/Ѝ0s?0r? 9P100@-@P0U1!^ 0C BS \ L0D0p@-P`V@1@!T 0N B@n\pSVpG-`P @P0Sp:ؑI Y `1`! | N PU p @P>pP pPO--Mq 0:P pG 0% PU  @P 0U`1`!000  0 7X0 PU0  ЍЍ0A- P@g P 0 a`F [ P@D pV: P/0@ 0A0S*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-40P$<D%LT,\ Ġ.̌8 R0 Ġ.̌ RA R B0-80P$8H%HX,X Ƞ.Ȍ8 R0 Ƞ.Ȍ RA R B0-<0P$4L%D\,T ̠.Č8 R0 ̠.Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-#81 ,Ġ̌%T\$DL0P  R0@ #Ġ01̌  R R B0@-#81 ,ȠȌ%XX$HH0P  R0@ #Ƞ01Ȍ  R R B0@-#81 ,̠Č%\T$LD0P  R0@ #̠01Č  R0@/p@-@Pp00Sp01H0(0 p0S(00S0!Q0:X Z c/ \@ c/<0p 0S 0 Z00 0p 0SZ0SY00H2S70< R,0:' 4P0P\ R,0(P,4`0( Ὺ@ 0  p (`V 0` 6(7(0v_V704`<X00 S  0 \ V Y P! P P X V0"2 R<\((\ :P00S <Q 4Y. @ [`@' X`D 0SV 0 PZ【NX 0SQc/ 0 0 0SP ZB !SR@T 0S $0S  !d0 0S 0@T `4  P!SR @T e0S?00Z【 c/ \C!SRr@T I R 00d"00$3 0 2 30 ߍ  p <Qf!SR@T  0S<00Z【 c/\p0@ [y&0 S c`aP((\X` `0R4< 0\R40<  \T0` @ +@!SRG@Tf `aX P2 `0 R$S VPR V`Pa `<@40嚫 !SR0@T 0S00RP!SRf @ f@ ``& 0PP ` X<@T@0@ Xv x@ @@ !SR @T N0S@ 6 | -p + * ~ & %0@-Pd@$M@`@ 080040 00000_0@֤$Ѝ0 #O-``ßp MWA5SQ`Pqx q6 @2 0@T`0  Q2@0"B   R R @0@"2 0 0 30ЍhTŸ <AЍOۚT 04S:`X ~> P Pp`     `X  TpK`PYH  mT  Q\ ( Q  ` T 04S`XA @p~ _X` `H`pT`@ T W`@Z~~ @-@4VDp Y ! 1=DpU VYp:q?oT20S@` Pc0e 0 ^2 y n nT y x m l@- A0@ @ €1<p@-P@Q 0P ! "0 2pp@p@-@P` VPY p0-P@  P 0S RP0/P *0?c0 ?oPP0/0/0@-@!@1 0 MR020* ^3 0 @TQ*QQ P1D"Eq0^ R QQ*QQ  Rl d0 0 2 30ߍ0D800230ߍ0@ u t( sO-p0$M "!  0 00 P0@@࠰P{+ (P P`% 8/P 8/P8/PY  0@0 S00 0 @0Pc8/P`T*0 0 @T:8/PY Y| 0 SYy 00` @TP* 0 0C0C@J BS0!AQ RS Y B10V T0Sv* S:P 0pC 0 00j0SPg0Pp$U\*`c⃠@W*0 0[ @ 8/P Y Y 0 +  T [0P0U:$Ѝ  00SjY 0 0V Y0 00 0 `r 00S0 e0/R$ЍY u 0 S 0 @`YF PSc  BYYt  0R08/P8/P`P08/ PP 8/P0 PK8/0P o8/P 0 J0P 8/P S  8/P 8/ PP P S*0S : 00S  fP 0 @c P0 Y 0 R0"! RS  B#10S 8/PU 8/ P PPL8/P8/P8/Pv8/P``o8/Pu8/P``` 00S 0 0C0C @J ES0!s 0 0C0C @JS E0!hR Q0P:Q0Q:@-`C- 4PS@ M  $3/`t0  "PQ` ߠ4P4S  $3/000 ЍZ 0 A- 4dpV:@T@T 0P R 00 R 0 00 ˥@P0`0dp@A 0A-`M p@P"0: S妥PP P\ 0 tdЍP00ЍPЍ( $$4/p@-P$0r0" @`Pp4 $ U0000C0  0R 1 00 0 p  0% 0> h` 0@-S N  0!AR 00A0 jO-4MSw`A`ↁP@p0 T0? S-Pj 4   0% PQ 0R  $R PVS00`000aS0@ `d 0V 0  $6/ЍS    00`S0a  R` 0 0 0  0000Ѝ  0  0 O 0 0Q 0A00/0@-S@  R   0 ȥ0Såp@-@PT @T 0 Xpp@TeP`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 !!!0 ?oP//RQ3@-p0#03Q00S@PMVЍA0` 0 P` F! `Ѝ%S |T 0`@0 00G-SI 0P{  Rx p`@p) ]T B,B R  l R!1@  0 0C 0  ` BR  T0`@p`@pT  T 1+#,03/P0`0CS@D0R) T1 ! 00PXQ}R],03/PZ ` 0`0CS@D0 T0@pT`0  .P@7Pk00S *R *0 00PO @D R3,03/ PDRr* @ 0X:ⴣ0P3  H  00 Z q0Z0C00 00VP  _00C0000@L R000=P~ 0@00 0 ~ 0 0% p@-`PV 0@0@DT`0@T` ,0 3/0Pʼ0@00pD0Spp@//0p@-@P0 `0 Pap; 0P0, @K PEp ^0h0@-0M 0 0000@>S@P  !02300  <P0Ѝ 00H0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ00- Mד Ѝ֓H-M  0Ѝ- 0 0 0 M˓ Ѝ \@R q P 0S/ /@-0 00@0S 0  R 0  00c0      0R0Kb!0 P @P R0 0 $0s0  [@-@`p`pPM piP0:*C/o" R; 0  S  L 80(0P  Ѝ ; 0Ѝ Z@-"2 0lM0d000RP@ C 00  "2 0 d0 30lЍ 0`0S pᙠ0Pq L"L p PR00 ppMPP0000S!$p@ Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00 +{ {*{ 00{k 0SQ ` 0j ppp  00 pH_PW  Y Y Yp@-@0MP00TaV( 0T!R OX0T!R0` 00UTX!\!R Ѝp@\!00Ѝp@ٛ00UX\! X\!0 000S/ Utp@-0 00PUp@0ⷛ00TQ徜U0` TQUP ⫛pX1P0X1ꭜ0T0`X1 Uth0h 000S/@-@0␛0X10CSX1 @⇛T1O0@‛ U t0 000S/g Tt0 000S/p@-P@0gU0 \AQ\ X10CSX1 p@W`j0T1OⰛ0p@L Tlt-X X0 04M 0,008 00 0 ,0 304Ѝl S S 囑@,tO-MHP@Q@0@U P0 `8p `pVP0STA 0ST@!0 0 $0 305,Ѝ : @`1( s0@$S V $ C0S 0S ( !0$ R0 H 40 0 $0 30,Ѝ@4' ; ;LՈ :O-p`M@ P-TP +T@`00T Wp pX 0  0 ?0X 0 j  0 P @p Q 6 P Q  S  R- Q 00Bs ^a0BSW0BA0BS(70BU%| XZ  P Q  S  R "00"00 0S \0F0 0 Ѝ@`p00XS00 C R@0 p`0 A BRWvppup@-BR"^< p@0007@P0T0Pp 74p@-BR"^p@$@Pp0T0PpA-@P`dUT0p  R *MP @TpR MT@p@@EpA@0 000/ 50</0 000/ 50</0 000 / 5p0< /0 000/ 5,0</0 000/ 40</0 000/ 40</0 000/ 4`0</0 000 / 40< /0 000 / 30< /0 000@/ 30<@/0 000/ 3P0</0 000 / 3 0< /0 000/ 20</0 000/ 20</ @/ /H-M 0ЍA-`Pp@A8#@W 00@-@M?#0S!Ϡ/"  Q O,!Q Ѝ  0S RP/0?c0 ?oP/G-PPp `R Vh 0S!R] Qp B{ ooAQ7a<@QV  v0R) ooHX@@ h7P<QpϠ  P X@P00V CVS( c0o0a7530ooAq@P! X h7<QV  0z0wV0boa00m@h7P^N<Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /x 0@-@ P  000| ״/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R R  // U /Q R 0 0S00/0 0/0/00/Q- S Q P 0S Q0  0P 0000@-Q @% TS$ C0 P @D^TPPU0N QP Q  00S@ 00Q0 /0 U0/Q0@- S Q0CP S  @P 0@ U00Q 0000@-Q @ TS Q@DP  ST P 0 U00Q 00S @Q U //q 0/  // R S 0Q00S0 0/0 0/0 /R  Q 0/0 U0/0 0/0/R  -/@-\00 @@0S0s R S   0 /U/0 0/0 0/R S Q0 S 00 /0 /U/S0 0/R S 0Q00S0 0/0 0/0 //q 0/-Q S Q R  0S 00R 0@-Q S B @Q R0C  SR  @ 0U00@-0 M0| @000!00ww00q s4 ,0 0 0 30Ѝ' " "0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$ $0 00S0/ t@- @p@-0@ ,ppPiu0Pp  t////// //O-qPp@`T4M z10 0 $(, ( 05/4Ѝ0S-    q!Sp0S S9 3S0SQ00 X00Z00q[0 0 \ 00!" R 0S@L RT\00  L00 S00        P <///O-˟ MQ 0 ; 00$0p;0 0 0%SS``S= P0p  0GZSZXWUTSRQPMnJ~}|{zyxw?>=<;:9876@43210/.-,+)('&%#"+ UP.% .|x`\tJRW P 0,p,@``P@^\ V [`4 ^ \ Z0˄S0CP [0404 R*d 0PCUPE_ Z 00˄PU*Y00Gp00G S`   0 00Sq0-`p Hp `@T u  0P 0CUP0 `e Ep xp `700 `uI 0SU00BP @UP0Lz 0X Q   0pp@ p*W 00G SPpQP00G S+`p 0 pP 0`ppV `pP ` 0,@, `7 0``0` 0u 0SU00P @UPV0LP0/, ` `u1 QU*P @3 000 0 3plWp 5p倐2 0 0u``0 @ 10d0Q00 S000D0@@CE @A 00<z ` `' 0% 0`uS 0@0!2> 0 0d00CE @{b< `u ``d Q00%0!P%: 0 P@T000i 0 MdU0* 0P0@CC0CE @N [  04r [p* 0``Zp˅ ^iAQAd Z0ࠃ˄Q*^AQAS0 Z 00˄Q*0K` L r 0``0 0{0 [0K0@"(2 0 0 30Ѝ  b 000?0 ) `0 `l ` `` `P0` @$00= * 0 @q` ` `3 0  @00r   0 0@  q0@@# 000 0 0 @q0D@B  08 0pPUP 0WT0 0 t$  p|A-`T0T 0pP@PU J0PES 8/`uX@pW x 0SS S 0R / 0R0@o/ @-VoG- @ Mp<čP`0@  0 @0 <4 30*ݍ 08p ` 0pP ;t 0h pL+  8ۋ7ꕩ (  cG-0S0 S,QU) X&p`@V 0`S  0P4 S@0S 0S0S0S  P PU@0D\  R!R $R0 R RO--P AM MUčHd 3 p ԰PE @PU*:0 9pP @ V:pp0 @YPOPL @0 0 4 30Aލ Ѝ  O-@@ AM @ MTč1 0Y,:0`x0(SP3 0pW"WpG/ @U: p p0  P pW:t 0  oPP D0 0 4 30Aލ Ѝ0x0(Sꛨ d hO--MMΟl h . 0 w @TL 1SI 6 Sg`1  0 $?0X0 00h l2 @0D0 >00S/ SB`vP⨐0pS KP4 p 0O 0P)0S1Ss5P @`TP00ST`0v_Ⲡ0Sqs`V0@  ^  0S< X @, \P Tf0<0080v?@0h0: 8 0T S<0#H 1S0 x00S S00L01< 021l0:ATX0D0Sl00h040800*SAT} H0@P| @0PpPPwz 0;4@  P @0PAP 8 <0 @8 @ 0 T<0@ 0P  SP  D0S*,0SU < 0 h0 S00D0#*p㐚x`tP6 0  0P4/PYt|*h: 0 6 30ݍЍ0X0 040T0 s pW5 A8@P@0Ppw !9~@0Pp/0 = 4`0 @|P Z0 t PD w<0PSP0S  P@ U00 P`F $ /kE0(0 萰 Pd1$0ူE0( &||PI [0Z  QP `1  0 80 (X0,0P&  R ,0E10,0z$0 0 @0 SQ@0b0!0p?A9c!V|P 0S @0P %0'0@0'0 ΍ (,0P,03 Q#  #64 0 P0`1  0 70X0 ,00 0 0  ,101 0,0`1  0 60X0 ,0p0 O 00 L5xP\0,&0<  XjQ80x00S;0L0 0 0 0t06 @X?ቋ0&0& 20X0@0P: r0'0@4'4 -0+S .0CS!@0P W0|'0@' J0'0' 곢P0@ 40(0( ݉/0-P@@0/M- 0  0 R1#0e(6,  Ѝ/;M-  0S R B 0S N   Ѝ/;M  0S 0 0 0CSЍ/RЍ/0@-$MP@$yP$Ѝ0 ,yP͡0ıġ0"c110$Ѝ00@-$MP@yP$Ѝ0 yP͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM { ?!Ac{Ѝ/bMO-1 `0AMM0 40ppPH d.PC @ + 0PWP7 \4 !P00\+ @ GP0 @R  R R @ @J @ރ @筲 ᩲD ,0 0 4 30AލЍ膡 p 4F O--ß BM M$čŸ@ Ÿ 1Xd$p000S000- 0p  P?QP0P\400 PN0$04 !/ S ! 0  ؇\40 0P 0  0 0  PP P0/ h S- h (10$430;Bލ Ѝ0S0Q Q# Q h  !  ! l/ h0 th ~h 껠 Ux@$@ |G-\\0 AM čpP`04 R< 0CV@ @@ T.0` 0PF8ĝ 0  0 0 4 30Aލ PP @@0.S L0PA>@dD4  hW p> O-ß BM M`$č@pPPl@g[: 0.[@[VS5.K2o11T- d1 #T 010#S T4 00jP 00S 1T0) [ 0 '0s"2 0 $4 30Bލ Ѝ0 QvPN l"PH T4 00j0 D DR000& 000SG .SB T400P`0=S 1SA S5 S6 T000SB 0sK0SP0S kg00d1 #2 @@T>00& D DR0 0 ! 00000S0000   R00S0000< !0T40 0P]%g00W@;gQ[   p@-@P`MvP p@Vp/G-p0tŸ`M P@`"T V h0 "  #8 0ŌpU@T 0 `Ѝ10 ,00L, 0௅V`0 0  0 F$fP0swpff0SUPP   B R`00 0 BfP ffff ⺐H`Ѝ0 `F 0S0 s fwf f0sf0S  00H0 LG-@0`P p"@D T@')]fWpWf0`  Lf If0 @00D('# G-@`P p嶒Ẃ E0S@P0WU! f@fP ,2EGpfEO-0P䱐 M0S5 @@d@t@`p S S0  nP&  hP0 bPI  [P00^ 0  SR 0  SRS Ѝ$Pd1 02d1 H$P0   #P  P060 $P0 c P  P090\ K000<Di0:0  P  P090090| P010r  P020h  0P0[^ d@ ?R? #  0 2M$ 0P0[C @ ?R? # { 0 (32 P+ @ yP010  oP010NNdM LL3(2@-@(MHtx2t% |Ô0{ D   0  x{ 04tx(Ѝ @-AMT  s0000 00tЍ@@ɼ0@- 0 A0tMT0l00  s 0P0#0{ @ 80 0 l0 30tЍ0@@ꗜ ܼ LA-@PQr 1!01n0SPpvOPp @rp0Sp@-Q@U x3s|p g01P a01000p rcsVxrP //WP //8G-P`@>V%0VQ\@ 0\!R p Âp p "p O--Pt+t; 0_M M050X;@0$0c0bT 0, 㧀01(0`,4 05@ d!A  d!. 0`11110ᚁP  J0@ʏpz( p", d10 d1r, P. `@ }`0D@SH _h S\  S S00 Q@0S S R: 0CQS0 C0SQ00000X9X΂P ~/0 8 * 0}0+ 0PP 1#S;S 0(S# 8 R 0(S> 0(S 0(S 8 R 00sS1 S S 0( l8 R1 S S0S 00 S S SS@@ `0 d}_AF0P0@@ 0Q.0A#A'S? 7R1 S S00(R00S 0`0 S S00 l@q@0S S 50@ @@@@@00@00807uO 0 A*0HnPd4@ R`P 04@ 0R`I`L 0d!S 00 00d1  Aep0 |3廫1|qpA τx0`0S [ `0`SH@DH .S0S[ P`.V00K[0S 0 0TpP D% /04%004 0 5 30)_ލ Ѝ>#0(,SA T T0 S400: 0尔 ᐪ P$P,p T T@ TT  ;T RP@T P$ ` p ;T 0s000@@T  jP 0 0 LP  80  qh1WP1 @@;TT 30 0s000@@T;T   $P 8 l! X@ P,pg3 Rv1 S Sr0S\ 00 S S SS@@Q `` { _AP@`0D`SH  \R?* S S00 Q`0S00000)}O P.P `A| 1x#|#3DQ aD@`Q|%0 SQ  P 8 -0!1 0h!R$!R! l!l 8h!R$!0R  l!_ `*P 2 t(`r. U( \-Hdomasearnamesortoption~inRer},:{d{X <zzchwdw|wT!1 p@-P@hl(M QP T 000(Ѝpp Qx#r c!pV p 0xP00'pPT $000(Ѝpxu8A-P RP0p `V pP0\\C\ `@`@ ꃃ `` O--40OMP0P:  4}0P 0 0@`         UpP ;}PV" RP0 G 0N/!I`#Ve 0PP }P0S V00A R' 0 I0 @Q1 P`   0`QUI #V @Y* P   0 /00 Oߍ ᐪ@ P` 0 0CQ*00 0 S  :C X 0 q:H00ᬠ@ @ p`R    YpG:0p` p` R@ H:T,  pX:  0H`V  0 ~ V 0 j}~} 0 v0   0 l w!@-<0< 0@P @M 0 0~ X r@-$0$ 0@Pa00 00/ r@-@P @wM00~ rP4@-@P@000@- @P  0 p@-@@000M   `~PP wP {T0P  0 ЍpЍp  0 Ѝp q@-d1d0\!\Q Pp 0 RpGS`M, `gp5 Ѝ  {P! 0 {P 0S@ R {P@  0 `cЍ|| | 0 WЍXX X 0 `J HH8 DmCllBlTlBld0p@-0PMU# 0U#0PUP!@@``F|P $|P `$0!E1(`P 0Ѝp2P''l O-Ff@0`S M, 0 4 & $0( |V|FP@RB 1ȖqYT0i(1<0 BRO#)16:  50(< ܅ 1 c0Aş0 p('(p4 < P 0(0 PR hup40SgX% 1S H 40SkH6S (% 4 0Sup00S S404 RR 4 w,00,000Sğ0( 0 0X B2*3Q Pq Q^P( 0D$ Rp (40$1%40(8(LiP0440^# 0(p Ѝ! qQ 0Q*# 0$|3p040(P8p!@(%01Rx$#30<!^ ^ ഇrp S:p 0("< !0(0% P\4+|20(  l20(<  X20(<  D20(< 020(< 20(0 208(  0聟0(0( 10( 긁(0(10( Q   x1x00d10fp (4p Ѝ:p P5p 0s^$psp_4  Z 00K U}p% ¼klkhPjXj00 ili` hh,,g`g@hD0He0edH:O-41M0 X C* !1 0aQ ,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y$00 Ѝmmmmd@-$0 0B{x ]A-@@`V 0 CQPqzP pG PyP 0`0i@-@00 R \\  $0!0D0 0@ ($ TH@-@PL  0S  T0S@zz@zP/0-` 00 0Q,000 P0($0 $p@-@P0`D P 0(S  1T  0"00`pp@-`0Px@P PwP 00p/g A- 0@S  1S p00  ( $ 8PP(p`0S 1xO-|:|*4M 0 , Rz pTT: +^ 0,0? 0,:p` :0Z  P^?^_00}O00 0 0R `^ :R ,0 00^ 0:S Ve \90 P9Py00H9HY0pP0 00H4S   !$RH S(QPOV` , Q 80( R? |800 R? l( 0S  !R L8p0p( $ p b Hc@(`P 0!4 R B  B QP70 pH'  ( |'  X 0 hG @400 p20  0H0C(01`,0ǟS0,0(0$  00$$SfS_(@CPs @T  B P$ , R  A  r,p p$ P  xP p  B RS RA 4Ѝ50PP @ `%0 0 0  % 00@T:p5 B0P\500L50 4A Tn 5000C?00 P$ ,p0 R`1j#S$0r $ P@᠔ ( p 0! P 1@ V @ P $H$ $`V $ `% @T: $ \ 030$@ \ `(0pp00>0#0 $0T` #$ 0$`1,hC@ 01$000b`,0/w,0 PY `F `1$0 0,P (xP &0SJ"P( 01 (0wPP$ 0`,P1 0,P$`1~Py @` P $m0b$0`( 0$`1j(,@@ P $TxP, 0` 1R(0 `;1!0<0 ^ςS0}00@ P +.000@P$! /1:^0   ^00 pp<^( hhxh0h, `PgTt  Xb(T4hx^@^8^ ]_^^]p@-@P200Q  P   $00<0 0@ ($ dp@-l@@`VpPPpR0U1pPE1PSp ( 0$ 0p QA-pA@PT`QV0t@P 0 pPP``p`(`,`0@[ A-p`@ttPP T  0 000P   ZZ@-@@0/ S00(/d000/P004/<00/(00/ S00(/000/008/008/A-x``PU pqW@PZv404 0 ,(0` RshuDv/-< <0  M00( $ w Ѝ Rd%<Y8@-@o0`00@r@-@Q :00 2 ? 0 G-L`P@pM[ 0Bp TW 00K 0 000 00- 000 0$00PP: 0 2  <R 2"  "V &= " 2J 0  0 pqpo W* W+ 000@V ydP@Ѝ00@T0-00ӥPP 02 2 2: 2 (eP0 0? 2< 2D10 04100(10 0 10 0100100100P 0 R00   0T 0 2  13/p0SW 2: 2l P 2 @0 2@001P,00 <@l0QC-@`pQP M @00EPEUC\A@E=2 2 X 0 R0S 2 +13/PP"?o2R03S HHPA (0$( p 2P 500 Ѝ(0 $XP ЍP00 Ѝ(0" $X000X "X00"?o213/pP  Ѝ@-@`pQP M 00U,0`V( 2S * 2 P13/PPF `P 0 p~ 2P 00 Ѝ  Ѝ0P0PC-1pPS M-:b V%*AYp pY %0 R P Ѝ 0 G P`V: ЍKsP `W 2< 2 ЍO--rMWb9*0P:A̱姝p V [KDs@P+ Á @1@DT0 @ 2< 2Ѝ0 @D* @ P0pSЍ0 P ЍC-"1`S M2:rWB R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍrP"! ЍG-rW" RbM"*R* 0 @0\ U@D0 z PpY  U 2< 2Ѝ"ЍЍG-邀഑@ 0`P9  Ip1v`wV0`F1v` 0 \ 01^` |0N 0 L|\ L|0S00s060 R2N0C20p0@- M@W0P  PP   Ѝ0Pp@-P`@Q 00T T 0@0p0Q 2S@3:A@P p(0 2S $A@P$00C$0@ 2:0 2pC-P`@Q4M 00 Vu 2+ R2 13/p) 0 0! 2$  00 2 p`0 9/0P 0 9/0P  `0P 4Ѝs$ 0  rq0 P 2: 24Ѝ?p`(0 0,9/0P 0 ,0S0S Q  #00 00R#40A 0S 0Cs0 Cr  0 Ѝ ,  00##( Q#<A A0A@0@ @0@}O 0 1Sp@-@M PmaP8 \,0ZP8Ѝp*pЍp/G-@B@M@Mȍ qŸY w@`P_ 1 R2X<0*%@R[ZZP ? B2< b5<R 0PipF YPhX!8 0 2 K؍ЍU9P`J8 M8000S "! !.4L0L.8.0LL\ Z0J  CQ"$ C|pp\@0V@0O 0 ꔈ D `CxO- P `:m@P H1嫲p0q1 \ JX  0000N`ⴜAO-40@S M0S0040000 P`D 0$p`B17v0C1f0V0N P V NW 0 ^V!B! 0SP|  R 0S  p`s"`fRΌ 0!2!$0 Q0A$0U @ UY  QRQ2QqpeWa 0 P 00000 pBA0 ЍVD $ U D L @ppB W PUgp1 PD D00CD0 0 10CR= 0 B Qs "00lRwp31pwpP!@ A 0$ 10C0S  0"fSPW1 ] 0 Ѝ RpP0Sʅ `P1D p W D wpPU PH D p BD 01 $1 1 ?>\>L> @Q 0SQ} 0P @P0S 0P%@P 0S0 0000SU 0 QP 00080080ЍOÝЍ 00008(8ⓢ40PЍ0000PA qC 0 0@q  0 ᳀0 00pG0 0p0@ 0lPP p@- @`t051@0JJ@0D @$ AR3@D$0@N0!PR T00t 2@@lRDAp@誣2 O-0- `ş\MV@ `Pm0P 0Y 0 e P$ Q v`0 000 00p0S,`G80 @:`[ { J  `00K00Ჰᴠ000 R@ڴ R2 J 40 FP { 0@0<80 :y洠 0B,`s0, 0 A0 0 p000$ 000\Ѝ 0,``$04@At@Q 0$0(00`0000CSv@@ᴰ[ pW(swpQb@@QDQH ZPu   0  x000@t@Q@00 pW80S BAD  @岜0 S0QDQ $0P0> 0 0 0@ 000  0 7  02Q00S 00(0H00 0 00PL0S0 H0X0 P0S(0 `00n 0F40A0A,s0@TL000`( 040P(0 p`W 00wpS 0,p}(000040C(04,p00B00S$p(04000p,07 O-\\p0@S`P @L$P k jP' Y  0z S40 . 0(10S0 1$10$10 0S0ҠP 0 P0S 0 P  00S 1$10$100O-@P M BXp0rQ `pV`!0 0Csp ݻ0 p r Gp p 0LPPHq X]0p00Qd Q 1 !r[ `ರ K{ pG଻0㲰F0F000 Bೀ0@ര0@000  BrW. `0P1! 0{ \@x Hx0 pWq0s00Hೀ0@0ഀ0 00000 Ѝ0@000``Fv`qQ 0 Cp Ѝ` PP 0@000 @pA-p`P@0R"  0S00 0U@ 2T8 P0X BPR RQ 0R0Ӳ00 00R00Ats0 0r0 B 0000UU800C80O- @T @P@D(0t@S(,W 0PPI# yP @T @(0@Dt@T `pV T`  0 ϞP``p@-P@ 0^\ ^ P0Q; Pp\ p pG-@` 0PS 0S  0Q@PS#  00S p\= 0 BS5 P@ 0 \P   00(!S%$! $! 1Q0 P @0徐p 0p 0 S 10 B\r ᾐƞP  $10$1 !( 0 O-\0@0C@LS`Pp M P i ahP& 0 0  _P 0z S0 ˹ Ѝ0 0S0yP 0 0P000@- M@ P p10 Ѝ0O-M 0`p  0@DHPpB T P. X  z0ᐪ ⌰ ⻰r ^Რ N|ᾠര0 `p0`000S XЍ 0 P  Cr 0C 0@00P @G-plŸw?`0 (MR$@p_2 S?:0JS< #P| P崀2 Sk1L PU: C rX0: L|0∀1  p 20  2T!L1 0 $0 30J (Ѝ P? ZP崀 Z 00C @ ɸ1x \p# 000 p  ` 00 pLP202 p pL qP p4A-@pPQ` M ]00 2   Q a:1Qw0" B!2!0 0 VJ XGFZCBH@0PU; "R!* 2 13/pX "P* 2<00@0 PFP: 2 J0 EP VP V$P "0* "  Ѝ 0 Ѝ0PU "R:(0 $P0PUP`" feP   ЍfP 21 mg@--M0 @ 0 0 Vh hP 0PSP000S 3/| VWV k8 80 $0Q/ $0S/ , k\D"<<0 0R/$ 0S/  k L"A-@T 0Sp`/XP0P@Q0@ @@igsP 0A/P$%%xA-`MPhlhqA ojp01A,4QSX 0 8 0UpL|BS b0CS<S9@P`lx M(00000 00 00,40000000k00" fЍ 0 0 0 0 0 0子Pw0,D%,%'% %xO-@PMp`шg3#gp#3H RPGPP/ H@ P,PXP f@QQ$@0!C!-\\ R0C0`20pW WT Z( Y 4圡PPPXPrPT! X`P   PPc 0+0V!YqPPpUp`@ tm% B R8PPPPPPZ V  X 岈 7/ P  R L $ :g  84 $ 0g  t.4Y^P0S @}c0$T@,D%PXtѦO-`,IwMpṖf`` `` hp8pGW( 0RZ S 0 0 ۠vPePRP&GP?f0@S$<<0<<<<<<D<L<<<TH0@ S<<<<<<aP ` ` `` ` ` `$(,S4 0S000 0S000-(T02T pG4-T` 'J P C`P/V  00010ST0S0000 C C0S S/R PTp~0Sf ,&uTn0: S (00/V%%00pJ`V  RPpS SPP0S7 0P0@ /Q50CS $e 2 2`0SE 00   B R\ L Q,Q p / 0 pPpGpd 0 Pp K/R  S/R/    C  R:  J#   30SS/Q% 0S& T0sX/ 0@!DR\0P!TR\ `2X00: S  CCS0: S H1: S u : S  Sy  Sq ˜P9 `6 Sf S0 L0S !8(0尵0 [ <:2  ['8Ÿ0 S802" /Q SP,0!SQ  3cH1: S 00[0S 80d!0CS80d1d!dPQ X0~R ,10S !*0S ! ;aW(0S0S 0 CSp!Ş0: S0 W %\0%$tW $|iѦϼ9%Y6lI?tG-@PaTed@&kfp8464f@(F峞P60` V n0S0 m `QP 9⟟4P0805H`40PP0%.,0@xP7NP0X T5T%H`jQP8P H04 0, %43/00P08004 /bd-P 0!FP ,0?P 0 00000 .@0D 0 tP0; S D0( @, "1H `86/,dP0`$ZRif2`` `0Oas崓0 CS 01#SP0 0, (S* B#"!0 0 +8PU H003/p\0S@eH0803/p$]P` 0 &lh 0 S0* X  0 $03//?0 -S0  S LEH0  0 -1/0  5HP0 0 0 ,&0 &P0* ,!Þ0 , ^R0 00P  00 &0 &0 00  000 RO0 0013/r S S=X`\P0N , f"PU`!0X`\P? <c_0%(&|$&`'&t& &@$$!L&X!.$HO-MMpᤃb댗G匧 dp 0 Q 0 0\m0(0G@-P񟗓$\h| 00@00$0<00D00000$0100000$000,00$0;0H00$060(00L00 00080S PPU RnR oR0P<0,`P |_P808P,PPPX `z `^R' , 04 `凔PQ4 1SqH0S880S5@0S2 L0SP nP4PD0S H$O<00 +,p P44X(D`尠UV 0PU 0040D0S ⺟ލЍP 0`@0S0H0S 0  P L T3R㓥' F P3mY` Z ⍔P 2 H^P ] 0br40PEP PPP FF0: SP4 01!P4H  P  0  j.  凡P 40\.YK 8SH # WpV=  00!"0 +00!"0 ,$0 0!"0 ,,0(0! 000 0 -.0 .0 0 ./0 /3]P"   P40SPP`S ,0ST 0,&,D?%xi% " tN 'A-0DWP000d0PTr0C?o21 bp 00C00S4 000-S/0 2R$0pP EP SP x  W_]sP xP 30202020100000C0㋨rP>x~@P5 Th db0S\cT2S  D_00$CP@T B0p/S[/ P 20 S:  *`p c P`0&%A-`P@MZ~C3 0H LP  AK  LP  7K LP  -K KP  #KPHٺD3P0<3P P$P 3( 0P+( P3( P7(  P;( P?P ( PP( P SP8$@Ѝ(P (P0"i(0S (۷P(0S (ѷP(0S (ǷP(0S (⽷P| JxPh!p XU`PPa D1R`RPU 0E /R XPp(PU  00,0/00A*00CSLTP0$0~00S p圖0s00.'l%x$"P'lX$*Wt%$J$p&px&$A-@PC}G\`p K^p 00S VPaLP PP ``P $奶 0@X0l%% %'O-`pFMPᘖ} \` `  ^p l6 HX.0S ЍfP WP! PP p `RP dP vP iP0p0 `rPxPpp0p0 p$p qrX 1S ޸VD`e``PU gJP$0 S8500S4@R@X*/Q /P.QQ .QQ[(  Q00@  0P0SP$0`S0S@ pP 쓟PP*0S 〕50C SVŒ D0$S P h[ f(00 $ ][ 0$Q0S $ ?RR00R0SV0 $0SX  P !0C0  IP 0S 0S ?0S 5S 0S 0SIP 00 0 07{X  PtLHFP l0S 0Se 0?Sa 0SIWS Z '000: S R'  S/o" R 0: SHP 0S  P SH 0S IP E0S A0?S =0S'm/70%t/qѦ/A/aA-P@O{SZp` W\p 00S PA@PVpPp @HP%?PW` /8P 0S 0S0P%HP ?00R%tp@-PM㵴 7 $ 0Z YZ <"p0"S dG +"p ݿ0"S  "pϿ0"S P 0Ip3[0050 00001 00 00m0k0i !%\DƟ  R  ^%PS00 00055X ;aoERU5SPP5`FV5S UU0U%0;͋pPl%5S 8gDP@0: S055PEU@ܰ$,V05]V/a4P$040XS⸏pP:?}PP Cd$iBff%hg~\D00 0$00( 0yBwPP#2 (qB CB CC۲Pc`0 v0S #P͎p@Ud0#S (JB:C1t0E?o2? (7BX<SPP9f/uv]}X `PPC`.S^00CS0 }P Pp PNU0 P00CS0}0 Vs`0S:00S:0d1V51a`1S(1S xZ<[Pdh!iBe%pgV|SP 4i ]P,0V0< '`P(堎0`FV} ΎP  f/0 T  >NZPW`'|qrwdr,Dqr2rPrqqqqq%T%'~Lr"ti'|%rqbxrȞir% dmqoo!'|PC-ʏg 0P !@㐐`p@XPaR Pj`00CS`0 kS@T ЍX0 X @j'%LO-P`@dMu$P(P,P0P4P P  Up4pK[lTT1Z03rTdT00 0Ap0-t$tSPPP@S||||||||||h|||a0@Sj3P0 0dT5 RT ST# QT040  嬍pT[ S0lT[ 0 0j  $uH$ GBp8 dЍ $g$ 9Bp㊍ 8Z8 ,Bp( 8Ѽ 8JU  HD[K O@P`p xv `[X\@T8 BpD<@~<P,",%!% t&"0W#P3U!  #P Q !+=0P 0[`&?Y@|;Qt8QQ2w08jH8 pP0 @,U TS djnQ` V8 30P 0P<@P0 P HH@ Q%B,D3D~D D{.;(D|JWfuD}tQaraydict %x0O-O-222 22223220p`_aM\ 000 qTpr4?`PpG ŌPC 2"S 200002^S R2SW10 dbV% ``L0ɥp LNpP  ``L0⼥ppd2S P@PX0: S0d2232` 3`Sd2S}0 =4Pp̻0S  %03PE/PF1@PCX`h9P<HHHpHHHHHHHHHHHHHHHHHHHHHHH8HHHHHHHHHHT8DHHA@9Pgj007000`, ,b,000S0?# 㴋0d20 202020202 @[k @OTaߍ0220202D;/`XP000S ipE 00[ / F`P000S ip3 00V /4P000S ip! 0 00t*2\j000 0B\ B*P 000S 4>3 S;3Ť*00i 0 P 000SX"\2RRX2i/ P P?PX0: S00y `P O/ةP 0 HH "P4h>`P 5V*>QM?p \:{X10 [*=[ 5!14(Sx=̲03%703 7p$m7037 P 0 S 0R& 2S# 2S 0s =pK5P1 Pd6 f/\H7T0L7P'\p 5=00Q\1X! \:X1\!0\ h2T72P7p4%>pV%1=p` P4==`$hP !kxU s Qh srW 3232 32lT\2S'"2Q\2X" 18<4h!0(,$h P+S\" CX2x4C pWRpp (, $ hp  (,$h   0CC2L2H,ijPH"0bd dhp0P20H2"2R/ S/2 H2S\հ#20g|2rz2 S2 S2?S ?\8 ""2P402%*劵L008 <04hhPX1d2SU<RL0< 0CL000 H0D @PhP'H0L`8DL<4S@03ˎ 0S  \ ש0P u ᛥ!EpY0\ 6 4Zሡ``L00<08 4hP 4 R808"<02#L SpW Vk#<0bR$" 2R0;\2QP 0'%r%',DH''"'8t%'U<NZ.'''+5AdrhAdez'8'F>%%':1 SR !R QRQQS 18<4g 0  g0\0H2R0H2 18<4mgY0pS "20 2LqSBD`XaP L{qx LLd!4PJfhP ㋟s`` 2g< !` 2Pg?0 !0 ` 2$g"fhP 0 000  0m2S2 bV/2@te@2ShP" K뛋r0/00_gP@lhP P2!` V!0T2<<23S_ h2BS```2S p($90 BhPM ~k|kqGg`@ T  @ET   @@e @   RTY Y|0   Pm0s$ pyK(T sK"20"0X.kPxE(kPd?\ Jdz% 6b''8Gjsl-0O-tUM M@ 00@00`p@@D@ 04%NpA0000050`Vq P j{P/ PZ4$JZ`P//oY" R & PZ  jzPP<j/ȆyPcP PP4 TP9 d4  mKId0@S,<|XdHH000000 t)0 00000u Rq : JPs  [ Kq_ -PWqV0S0S9 RnR"oQ090 0pBp$0P@2 q00,"($2$"sލ Ѝ P' P" P  T.@; p@. ?!:P;9pAr00 qX`V  :p.  9c>04P)`CQښ. .a0C 2 0⺅',Dq%Ade t8Q%x';'% 0'=' @dz''O-`@p̑́Q nMp%W㬑 0S 0S p1`VA P `0S H@`V-Z ЍyPmPPP fP tn0@ SXDl 0 0000000000p9W 0oP /tPtP b8X,D'ը%O- 5 %$MpP 9P!!8`80DĴĄĤ00``` Lp6Y00S 0S 0S l``4pWQ* 0S00YP (T0S NJ00W30S$ЍzPOPBP4 FPt P@*P,ltx<D\0000DP02 =P20v00b 0 ݘHj0 0 %P0 0^ d P0 0U 0c@忘PN,NI000E00B00?0 m娘1 >0S +00000'000#00 00000000000000 ` `0SaP` 倮0Y0S 0 q0P .`HPpG 0哮g0X7^X'',D'H%Ġh'q78_\bsg%$ϘϫO--MP0}jaH p PUPEǰvPlP*HP6 TP8 8px@|p `,9  r@tqp!.0S * 4 P40@Zpx tsm@ P  ` p h x `("AKp2 R Y R !$ Q P$  R  0*8^P8j -RH 00@00 00 p0G@P@Ѝ0 0y ,.?0,0P 0000R0S f```0pZ0S0S ~ 00 0@xp` @@@ @P Pn  03/p T + $ ?% Kbx,D _q%@-(@(?E>@Q'%,lO-P8M -pF,8 0 f`^ p p㣂6 R0 l,8 /%4PP0\808pHP,,F U86W`E`hC0IPHPU0 EJp0(5O005SO /5,* 0(0,00(00 0GPv1PPP%PDPzS `SNSM *AS> CSP 0p0jXaC Q($,WSL4$  d$ ,4RD +K L J ~O c{05xN 0Vt 3M pH n$0%0 1 0 c 6$0@S. pI (3V``R zS NkS CS BSHLS aSDcBl0CS>        0  b+b)Zim^PeH0SbI0S_O005S& LNP" T( `pH (0S  0C#P @P!#@p``ip! (P! %P|! 0S1\!,3/ 0☰p@ P\91PP(C<01P010!0G7 HR # 0 (p+-7 P 0 /700 0S0 pW%X'% 6% `6'%6% x%2,D7% H7%% % 07"7/-.j7K7_/7{5A0i77g iu7m@-yP ̀A@[&@'Hp@-D@D0P5@(- ,>p@D'P%p\p@-D@DP@( &p@,'l%A-|@|p `(P,0`8P@@@4,A'%pG-`M'4P(+gyP"+4P0 bp) PX4TY4@P D4@28ŸP8"0 0200@ 4 Hp HQ *4P * @  p1a 00 @ p0 @ t080<0@0D00P0 0 080$@P  82 HL@P@T@X@\@HP嵠 H㱠333 0400,0@@,0( 00P7poPPUPh0PP 0/`ЍEEDFEEFZȞF F 1D%//..'O-`-Pl6MhhF(`0  rGp@6X0K ,V0Sv`@@0V}P 0SЍuPfPFP RPh g@Pl4 000P0 HI0#S 3P00 $*$00S  $*$00S f`P &0#S ( P $*$0(0Sw T $*$0(0Sk 0fP ΎPCq Cq C B` @epKWwQ2@23@0 RH0cS pS: bSAJJK[0 0\Z9W W, 88 0,3/8 RfV f@b2Xi  2PK0 0C?oR20S` ltZWJ% d~200 0 00 00$o,0 $00S WZ 0 %0S0:10S1 0S  0 P0 0  Q00s  d1000P,0 0!282PX`0d S R 0@0@0 #  R S 1P(00s  1p(2X n1 015G,D%'tGGGGGGHHN%DH;HaO-P@p'M Mfট$PP Ep6 @DT T/ TX 唶y`PK'ݍ ЍAP? a@PP񟗡!## # ########!##!$#!,!X!`!t5P50S $TPW }eE `pP%000P00` @P L;P <6P P  3P  %P P( R}- q|qPq/N}00 000#0 00$00 0<P@i(uPPLdD4}(00P(X@SW  2 P P( !P( (mx@P` T0P` 0(Ȑ⨀ qqP 00 00$0 00p@P `x@P  /x@PXx@P'x@P `ᑩP 匩P ᇩP !g`LP X  NP( (`m` pBP( !qp@PP WD <Pa>/pp+60S > +^ /cPm`` 0V@ 3r0 0/pp` `  1P/0S` 00 000$000 e( 0p//ç0Pa0SJ+S'- 29S!S 1aV`HL% M ',DL=Mt iJM+MTMvވ@dzAdep@-P@bap@-P@bp@-P@b] @- p@-P@b p@-P@bp@W p@-P@bp@0O-nMM800䮟p4`YPI 00 >R㸎0 00>^(00㠞$000 Cp@:x>P10?0S@>D$RP$r R  $t <4tA؀ @0<4x00<$ 0s/p0 {P IPp`FB@D4T񟗤*0808080<*08*x08080808**080808+T+08+0808080H080808080808+,08,L,,,-|-080808-..L/,.08/T08//00@P{ Pa P< $rxx  4< k $<$$r $c@@P ;$0 00  0 s<M0 08 < f;0A> z `;$60 00 0 O,;)0 01 \ 0 B: 0 08 , : 5:$0 01 0 (:(0 01 0 \:,0 08 0 (:0:0S E/P0 0L: 000 4  01 0 :0 01 0 :0 01 0 ,940 0c0 0 ,: 0 01 T 0 88길@0S 0 nP Gzm~P0@4w P@q 8(,z HPD40 PD40D4Z  %0P(0P `800!0 H0!f88C@  40P0 077000 c+$G: P巘P/ ᲘP y0S 0T4000$0 <4 L!H\=-<PFU [U  z0LVp0`R 4S<4[0 H4L$0!.p`r@?H4L80S 4I/I5LHY  4/٤ 5YHL0(4SL$H4R0 &,p`  .p  4S@ mP ?Xyk (vP `; Qu`Pd%d-p X1: SD 9 $R[,@P  4qP   P [Z3$R  $z?0$@0 p!$ 4p = ,0ѠP,0 r0 4P ⼥P$$<03}p4p40S0X44SH0S4x2S, 2"0# 噥Pr 0T40S 厥Pp*0ST4S x3H#t l}P `3 `s'x2S 2H$L4Q*px0 4HL$!3 fpL2 C  x$0+ pĮt=#  >P X ȧH$L4#"9 $R 0<0_S jkyQg+kkLH$ Q,} Q+Q +*0$0$Q0$S\ 4S$pP 44崐S04144 0S @4S 0  0@4,4S $4R#1ѣ1,4 0 000(0Vv *t *0S 0R뀊p@$ P& 0d!0;>0]9U̓P8.X Q(041$4+V T4S# = +d00";+|*z*x*TE+\4$H1L4L1x0<$|0@ 0 +p^ͦ\P Z > PڣPJ  <Ϟp  T< : =.00 <O--0p PDMM⼓c4, >pP^3`4pGs04WY `1  -XaL 4S<44S$$ 4R0#)p @ `b+p : 4S P,0S x=A|==>====>>===?==?\===A00vbPEUU@<===@l==@===@A====A0==A\ (!P!p00( R0C0s0SK p 0v044s04@0 00 0 030 08 < 0A% l0 00 T0  x,D%hhiixvk mgSmHnn%xgixhi3iF'wriUiii w-w''jjj3jMj0 0: ; l 0 0: ; `0 01 0 T0 0c0 0 H10 01 80 ;,00!0h1410(40Su;!qP!zu`*p 4S (PP!$m0P0!   $(@&P<2(0(p00S0 Z <00&p$T"x$` =0 P0 r04P P"0&u3m`$`4S80S4 1S 1!0 #4 0SDjҡP T3P#X\cUf000 $4 1 " cp3   t0 $ rUpԑ 8P ` 4$t $s(4S 008?W  <9 $tR $4&S 4%X0; 4 44 W  0'p0tpWܠX0:S $R4S   '0Z00S '6 4ʟᲠX0⫱㫠X0+O-GM MPh ⷣ뜔D圤 3<p40PEPEUa&@@5PGPFdGpG|FdFdGFdFdGFdFdGFdGdGFdFdFdGIhFdFdFdFdFdFdFdFdFdFdFdFdGHH4FdHPHlFdHxHFdHFdHHI FdFdI0ILFdJ4A&04000X6&r(83 &p0,@0p00000802"& 2&@ 2y&D~ 2r&Hw2"k&p0L0mx2`"a&f`2D"Z&_H2("S&X42 L&p0V 0  2C&WH1 <&p0X01!3&8 1,&`1p00 xp0(pp`$%  tbpwq`0S   < 0p[` _s0S0Shpl` 0 %A/P 0$ 0 0 @x7xP@P>s &Gލ Ѝ~,Do% omY-i $ O-- @ML K@'UPP s u'PT&p&&p  pY`C #:pIC 0{@{拟0{SH{{S &P{{Zy&P<;Sr&PhP w@$ K<v@ŻG8 ({:< (;@ST 302HS1<+0Y2E20SD M-C@4PRN\MMMMQMMQMMMOhOQMQPMMMMMMMMMMMMNMNNhMNxQNNMMNMO$O0O<O|OPQMPQ 09 0r PP0P 00R0S Mr_ 0;8;08;X 00d1IQPX,1 P00S  ( ?;R'r PP000S0? < - 0< 0: 0  r@0 00@; 0@0 00 008;0A@bMR`??zG{Ae,D) 85Qw% +Ie~) Ld) h0))%D)0#) /N)) )[|) P)h%% d ()X) P@P0`00S0? Y0P 00@ 00= 09: PP0p0PS <> PP00S0@S p0K 0!; 0001, 0! 0 000P1 P00S s  nY <01 , ,d;2S 0: 0 <>v8`P2![ \2`2VȌ0 V00̌ ň p+< 0Z3P< t *q 0@ @ 2 0@TePg 0C Sd0400000,00(00$00 0000000000 000000h0 0|0` RB @@5렃堓VB 4s8;p 00 L0*%p8; 00 L0%p 8; 00 L0%p\}8; 00 <L0%po 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;`+@` L0$P4r;"0#10@00 0pKpQHE  p   p 0$PMK0S `` K0$P@ 0  00 6$P3d G0 00\4464v``0 @$P``6`&`x$h㟐!2`(10kkkk,a0a4aV 0P````ߐ㆐+V<;SVY$>@ $tz{ @ 7㛟:SG$@ tVz{ @ 7I:`"2RifP' T*{ @l30S 0 ,' D*@MHIN2 X0弅"pX00 @+Y@0V0 00 D3@0\" .*00S O ` ,2#P Gz42AQJr#`,ojehk{{'8Nj@A@G)@8HIND,U ({*X|"P4+U8 0S4 c+<?0x`T0T00`0p+t["pP 0S N+劏#t;@000!R<  W/ 0 6+|E >3d2"SS 0  ?6C-A~8@$@@)X) %% )0) P) 8@E%xN)%!G@ 1PS 2R`2`0Cs0VXX0!Ld0 0 d20狟   g  `0/0h0lp0lh?){{7{{{P3{{ {  M@ 9:#`Rh2f0ch22d0W` |cE@0 00H 0 8-2 0BS: (SB; < 0|;2`X:`2p!00ss0S0 0 0G s0,r 2 0 *2q  0h 0S hⲝ;    0;n2 0* V |E@00 H 0 0,`0Y 0p1 JgP@0p<0SIV *0 0RpZV |D@00 H 0 0, 0 G0D l 2h`dp0Z`2 2)%s)0% ) #-ٯY0CS`taaccb,b\bbbcc<c`ccc0 ,P Q8`aa aaa,a4a<aDaLaTa\adalata|1 *)닟`1|xtplhd`0 +Pa @0 +PX Qabbb1c(10 +P9 t10 +P, j10 +Pp" 0 +P Q Q 84~0|0 y+P 0 o+P 0 f+P 0 ]+P 0 T+P 0 K+Pp 0 B+P L0 9+P (1  (/`0Su CSk S V |C@00 H 0 0b+`0>u !:Tj +9^,Hlv) S<0pKW0C V p[pBp0C<0p<00C p<0S|0 0D0pG'D0W0  <0K+0C;#pq<0 D0^(D0 <0 RpKW0CVD0* +W  $4ePVD0 D<0e0<0 \{堔VL(tX0` 0D0pGP'D0W0 D0&(D0G0VB0")O-M`PJ@0P-S@јP0 @04 $t3p$+4QP a`F0pP[N.PijQLpGK PL 1 k囘P@ X3\C d@P hhhhhhhhihhhhhhhhhhhihiL@0S* @HGG 0 0p, ,Y `kZ'=d`P-!P`4b2 R 1 10 S 1 1U+ 0 1!10!001XP͋ʋNjċ 㾋lp8 0bpך0S &X%!` PpŚ0Sy뻚@?0p   1 0k Vp`d* g%!3t^W@p}0XG O-PAM M)@`W댧P QPx7xW00-S% ,P G,Pj @ p H PZ %/`F0S0 ` @DDA@Dv ~2p ,0Stb@qQ 61 Qp  ,P -00 *`@Z-00  D0B5S񟗌olllllllloolllolllllllllllllllnooTlo`lopolllollllooop(p4lop@ 00S #jPj0 0y꼄&=4P j00k00hx400d x4 `0S `i X H4 T00Q4.P J  r300S P80$030(000,0-t0C?o#2p R0S0$0AP1150S ,2F3<:)F< 80R0 B(0/S +:3F.(0S 0 @4/e001510S (0S x1 0p04XJ9S <T|9r3(0S 0r0 @49#D^4]0z151FX39Pp+)UH 0 p4PTV* 0+,DMe*88%%'%xOp%)p- % ZuWt;H(O-PTM)@pP4,/0p ?t,#@DRQ0I @@0SRhvP cP SP- TP0(3 LP 6Od0@Suluuxuuuuuuuuuuuuuuuu0D003030800H00 30$30,31fxĺG-`XMPK~P,y,I, ,p 90`FVJʯN* dDP$ b0@SST`x0 60$60(60,6006046060860<60@60D60H6$&R <&4  <&,&R 8&R c4&R <&R 0'7QtTqQX0*P@D7=CP (P W0S  gP 0000婏P6T&0  $A(\PvP061 (VUwpp)i&0+S `PX.@.%&#`t @ P0p0L0005 000MJ<0 0/T0P& 5!0 s000:XAP00F0000 C000C2#S0d000 C000C2#d v>C 0C0 0B 0 B "00P00 C0 2#10C0 00C0P00C1# 0 00C0P00C1#0 00 C000C2#0#pq4 0Q0TPP+ccJZ2V x`'os`F `P$ 0SU030#:U 5%PdnP T]'1 <K)T&P6K/r0M3TvPS0 0S5# G@RPE!MX 0K/r0MP 0 0<6S"46S" 02Q" 82x01.)`$6S PmMP0W0`W 0 4Q0 Lӏ,6S m/PP C$㼏<6S46S;P1|Q0@6D&Sl1 0 00R\!  H&PRL! $&R@! 8&R4! 0&@R$!  !Q   @ . @((@D t0P0|*O,D%iʊR̊ʩ*V P*P*P@%D%(Wd^*7]ˁˋˣQ!ڣڄN^G-P`pIHM *p10PEU& LHP h0@ S S 08\@PHHII00pa 4ӉP ` 1!%a#PP a L<$@@`3@(@ @! BlP P0S PxW 'eP Xa0 0000 ^%',D% *V(t_ tyh tCq|0G-`HMp0uH C S )p 2B1 `FS 1S 0$  !RS@$ P+PT#PQ|axP`PAP MP2 Ma0@S@P`px 00 04044041! 00101@30@3101101101101ДY 000 06THЍP %PPp  a0S  OW%0 ,`POPV q V 6W`FV R $Sa (08 ]V Zk*VH,D%y%'^t*VLt% C-Mp`>ᔍ@PV (p-6TtF`F5 VE@T X|P HwP~\4 F0V (p6PU 5 `V V 50S aP tP0S [500@V 0S qpG [P`V" ``+% XP'%tP9@PA0@3SPPPPPPPPPPPPPPPPPPPPPPPPPPPPP$P8LP`lxPPPzP0S<0S00y0S00S00S00S00S} 000]00Z00W00Sm@0000K00H0 0d B0SZ<0SU00SP墌P0$0-:FU 0SA 0S 0S;`V UU5刌P x僌P ~P& UH U U6PEU2U( Q VP! _ U4 @U U0000  ]  U QaZPK#0000 0 ]P  Z [$0S \ Z p pq僽*{@q#T y 0 s#&  @ #4`#$P @P P`L#ߏ|f*[%'ު,Dߖ%x߳ t Tm 3G-@PMaqM &p10S `A⼑P R ލЍRP fP74^SP\ ^X@0JrP1 JKP/0: S2  S)J t^P0 JN@~p 0}"4S00pNyT0S n p d J J^PJ C^@PJ(`e*[D%thC-PGM MK$0L@E< <8<8X@8DXP<0D80l8"=`{C0X `XdXhXpXtXXXXXXXXHhLhPhThXh\hxxx8PP   P:?>$ 02^.K  孁P; <@P $PL ;T(X <@0P`l+TX8 呁X;P  0S<;4+,0Kh8S <PUD hX< zP@ ,弊OoB ;pp* ;(8pp܀P `ZT`hPdh0Jp኎P0 p#PT:T #P 0:h(p#P :T(X(L @zP 9h(40FDS=HTxl$0<`l8\t08(@%p`0xH Li8 W B 0،10 ܜl  d⠌8\0>0X `XM0P S܌8#0 4040X8T80<<0<<0<0<0H80L80P8g+ P: ? # 07p‰Pt780T80X8H70<887 wP 00S~ 7 \6 fP 00Sm 6 0t8f6pc0<`$` ᚄ|6@`̛0 ‖  `P  @Nkp4^20S 6(@0V0` !0000L85垛P'0`8d8#0e2P ՠ՝ 5?Q0*Gލ Ѝh5l `d50DL<<0P 0S l UP@P `d<S P 0S Y V(4 D8SQpK3 '`  v|t tC\t Dt ڋ,t Ӌ ͋ $Nj#} 廋w 嵋k VFC@=:0S0S2  {@h288S#8@PxsN @+ᡃ P:$B? !  081<S|w+&v P*m|0:uzP 0Pz@Pt@p dՌH?@P<ގ4 ێ0@` rMzPP0@P`e9x@+K00@0@8004`<0U00P<P8,8U0C?o20SP ,R  \0,0S g,8S= <,8S 0*\TjpJ%% ^`| %,DѦP%x0CSK Wo,DQMw!#/-3d=8H@ @  ( *  |WG-P`A,E5h8 婇P03嗥p2S l  PZU}PH p 㘤嘄9PB/PE0@' s "p`40pEWQU D4 000`)P L,vPE0S#3 4# 3YP { {{{P |ZvP303 }`pl d$`}PX34LE4S 11/΅01<2F01$1孨-+)0z$"$2Q4mp`e Pb Q1s0S `qԁԑbpo0V0C?o20S pP  \Ѩ=p`S 0 0000 ln1s0S 3S P P=?o20 P P lS1s0S 0 P `?oP20S 0PEx*Xj~%%D*h Q% %26%2*d* )Q]t%<[0`C-@`m7dPAP P1 LDqH O!p0,1QA= 1P5 ڰ00"P P 0 cS 9S0S00C0VS   dS lS0 0T TT jް0S*%5 %Jj%x[G-PC0`@00p0P 0S006L˅P00{ E:QHpz0W* s/R岅P0r0"2PP 5밂V 0+0C0SAP>P Ay ኅP`F p0S bP $2  P 0S P 0S10P  0S1 0$pW pV 0SPPKP|pP`FP7 10S 10\Ptヲ`0S0PPヱSPpq 0000.roPUP *M+_M!+ NrqNNN*+N6+`%UPN`+O-`pBPᨒ>뤂堢` p2 0 qQ pPpGz{uP`P GP( IP) EP 5 0 Ma@P 8`\l0000 fP@ CPA \`upPB rP p1Wc$0 P80: S0S00`P poP 00SpWW  _ `P  3 t3t C`@00PPPLspo0@ HA$P PR 9b%2u/u,us+ @P0@UP4PP.@<00Vn 4P ,] ,8w_00$2"21QY wc 1 Ѝ7 m0p 240TP 0<0S0<0S0`Po  0sP 0p}  l}>P[(0]PTVf`PP= 0L0~4|0 !00L1QX C0008ssP( pP02 0TP- 1P(*fPP$ A  R A$O m !SVQ 4 0=4;x0p zRPh R ,0,D%t000&0E0i0s%x@th00000l000 Psj PPp0S ^\!0/X!  $ PZ0S H $@pȠt70  Q   S  R#4sp:0S0& s TUP@Pp` u0O-PMp0 0Pd+@PX P%@PDD@勰ߍ@P/ᭁ?/x1?0$20H"2@2<211t122skmlgp00m10㔎`&$0 001 0 l.0 d>p0X0J00 JR1810 J1!1q匡Z0 @Pb}0+ = J0R/ =+00-181AVPMP 6P^ ?PU 4P000l=` 0N@P񟗭d0HT\,=` 0f@PP񟗚 ш <0x1 <J/|0$0yux<` 0q131k0$0001C` 巯0<` 0W 0 pP 0yP 0%$P~ 圯0 JR0 e@P 0 p0X 偯8d&`@z0$01@Tp wP 100 01Sp@(P ?,4@q tZ᜴ ׿4:$0P 1@ L !~|1@ tp  $p /1$@ 0S 0 0 Q IP819: I0  @V0|) t pPd /P ,4L '11X ?|P`0S9 (Q90(0 0+(n1 @ԮV`F`( q 8 P啾 !⣾pL V S7XhVV`` #0S 8X0S @V$0 RS 1S !10180X7"/0 ⍲<! <2s7"/0 <<2s "/ up<Y 10K@` ၲP:,!1 01 6 `Ľp-| - APVV``  0 $``#6800*6p $00cS$0 H6<Q04&< 1p !⫾P$A0S 1 z0S][s0SW o0 SS 1011'z?p`0S h%d``2pS0S @%0޿@6P q@ Կ( ܿ%孿k1S $!P孿1 t #(0p巿 m1S #00p bpW P x;60,A>0 (0t10T$t 娼m1Su 004p10($p 圼k,0(t10#t 咼m1S 4Np y0|4zpl1S 4:pl1S |#TTPh[-bp P 101<00@@00 76`P  <i0 10 pY !1! !" 125pD 5+&pd`"0 !R1411P,% 0$0!$0R0S"RB1w1t!P$0!  R !۾$00$0 Q[ 0M5M<L2QQQ,%` LL3%0QaJJ,DJJQ=QP2TmT~H@QQ{QP-Wtq3QQ]<R R0RIQQQR8T]R]RnRRRRRR%iSSS:SS/% S SESgS{M/M'M.SSlSSSSTT@1Y8 1 ჳ1pW41!( < V ?= :0սf1`@T 0S 0  @埻@ 0S    0S P`p P ( RV  R   1 t@Y0 S   0d`V5a  Q/0p@-|@0Ptt@ P T0xiRep@ 0 0$010j |l0j$/0@-hPMP@T Ѝ0@ 0@ Ɓ 0 @࿁<kk0ƒ S'* 0@- P@ R P@ 0\ R^H00"@ 800 0^$00"@0/`H4@-M @  \ Ѝh  0S/ -PM00 0 p 0 S 0 0 Ѝ4 6s /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/0*/)-*/=**/'*/$*/"!*/*/*/*/*/////^ */ */*/<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ l*/*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*//7*/>*/ 4T*/ */6 */*///*/@-@z@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress=T$p0Nb(CLFPLOH HSxZƜYƜDh ]c؅XiX $ou((+ '8'X6'x''ނ''(( ; FN&K(Wg0dg0lltPXx4\l0c,,  tR %6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory ]l  @@ül@@%`+l| 28$@@)#$@@>`unblock and -DNO_CONV?8hPD\ oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot close file descriptor on %sCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... >T >`>r>|>>A>>A/u>>>E>Z>? ?'?=#?G ?G_?Y^?YF?Y<?Y>?n???PATH= gtf!HsdHzHssMcHHsmHHslHHr R(D0pHC;nHHsv Hb    EOF reading here (<<) documentMMMMMMMMMMMKBMMMMMMMMMMMMNN NüMjMoMtEMyMAdEF&j/Fl}-+?= @ OOOOOPPP@EOEEEEOOabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.''{0R?'{@1RG'{,1RM'{8RW'{0Re'{0R'{0R'{0R('{l0R4R3N  N̊ +R T b 4i.#SjSq v!\MiO^t                  Wt4T5QkQdExd҆T:^DT@k<J~dhTEHTw>pTHp]<T(TN(TR4TX2@T[2PP\hn\Tc 4E.IDTX Tkh jqTrАTz bZ<TuTUhT Tx}  ]< T1Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(((...)<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalshifttrapbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:202405161232Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed[[ jm[[i]<[[\ \ tp [ ]^X^[:,\\.8\,\$,\,+\,^,\-\-l.]+".\-\./$c\.],\,;.\..x.]b]f]j]n]s#]r3]{#]z3]2]3]3]#^^^^ ^@@^^^^]S]R^U^]^l^t^e^ ^*@^1^#^83^>][^E^L ]C$]C]C$]C_] ]]]*]3]]]9]]]]@]A@] ]I ]]]]@]] ^]]]] ^|^^^^ ^@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.uSu[uc@t9@ui@uq@ux@u@u@u@u@u@t @u@u@u@u@uEuKuuuuuuuuuuuvv vvv v)@v0@v5v:vDvJvUv\vbu2vhvnvvv{vvvvuGvvvvvtyt~vārrrss-sAsQsdssssssNt swwwwwwwwww=wwhwAIw?wvvvvvvww swwww$w-w8hw=wAwEwOwSw[w_Iwewpwwwt1t9v~t?tDtKtRtYt`titptyt~tttttttttttttttttuuuuu"u)u2u7u?uEuKswwwwwwwwww=wwhwAIw?wvvvvvvww swwww$w-w8hw=wAwEwOwSw[w_Iwewpwwwswwwwwwwwww=wwhwAIw?wvvvvvvww swwww$w-w8hw=wAwEwOwSw[w_Iwewpwwwchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] HUsage: %s device %s device command [arg [...]] Available commands: forcerw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'i #DW~   I e D/Th} !#$&1234568"9(9/:H;b<=@ABC#DJE`FuGuHuJLMNOPQRS!T*U2VJWd\nacdefghipqstu4vw:xNj{(Hd 2Nf(0wE!=`s$6P`{ !>Vt4O.)Yz"/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.cannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]  z*  vvvvvvww swwww$w-w8hw=wAwEwOwSw[w_Iwewpwwwreturning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctbadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblockĔĔĔÔ        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %dw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-.$7BpyX  0 > Q f x  %4%%P%h%%%%%%%%0%%H%h%%%vvvvvvww swwww$w-w8hw=wAwEwOwSw[w_Iwewpwwwi #DW~   I e D/Th} !#$&1234568"9(9/:H;b<=@ABC#DJE`FuGuHuJLMNOPQRS!T*U2VJWd\nacdefghipqstu4vw:xNj{(Hd 2Nf(0wE!=`s$6P`{ !>Vt4O.)Yz"HFS0eC"UFS0eC(wE!haHdInotNeedEFI27*s(ҺK>;AQn|n֏- q+LXQn|n֏- q+gqQn|n֏- q+~Qn|n֏- q+Qn|n֏- q+w=Gry=iG}M;t?WmCĄ 3KOOyD¢<#*=(РD3h&  \M}-&7-ıܹчHw=H-ܹчHI]IZܹчH wI􍂱ܹчH*I􍪱ܹчHI2ܹчH'S@ۿ )Ѹê1*@ە )Ѹw1ۏx )Ѹbackupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?] %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps///setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatusprintallmaindo_setifpreferencedo_setifcaps6iz% _iyTTT% x.% TT% xb% eU% `.x% 7{% 0=% 084% x6+% 8H% x8% 8% 8P% x8P% x88899 99&92@9>9J9V9^ 9g09p@9y99\ܜ9 99 9@\Jxinit_current_mediasetmediamodesetmediaoptsetmediasetmediainst;qG;|;q;^`s\;|^` ;q^``;;@;;;|^`;media_statusmedia_constructor;U;^-:e%@:j;^-:e%@-;^-;^% ;h;^;h;U%;g;^:R-%$g;^g%ppaddr_matchT,p8\settunnel<% x<%print_link_addressessetvlansetvlanif=%P==%4==40setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanCeChCkCnsethidessidsetapbridgesetiffragsetifrtsC%C% xC%CC% x@F%`@E@F- *% x{%C%@C%C,% x_%@6_.p *% xW%@>%C-BB,@@,t> > %s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s input: multicastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %sQ5Q?= MG .QJK MM KMK@MMusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o kkkl0lhllmm(m[mxmmmn nn=ndnnnoo8o_ooo%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @&B7CFFRIkLuNO0SabcefhGiSk_mmn~orsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp  ` @  $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u%s: unknown standard format180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()^^^^^^^^^usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY 8aŋų?qƙ 9UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecFPFP*0 XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_print֌l l &l5E;l HlVhlu{يٰ٘lٿlммl/7l/Kl/[l/mlyڌTژlyڥlڷڿlll(l;Bl[qlۏۗlۏۿlۏlۏl PP4lFKlY`qܐlܛlܢlܧlbitmask_scanJ؆؍ؙؒ%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlnsendrequestrecvrequest0***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230505NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gz%J|%J%Jd-S SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data0T zLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i<9 v{+EN+J[0+Hc0+ox+=+++l+I + 0++0+*&0+/7+LD+KR+\0+f +to<+Ky+ +L+Hz+l+k+j+k+i0+ 0+*z+6+G0+R`+r+~0+0+collect + W %vvvvvvww swwww$w-w8hw=wAwEwOwSw[w_IwewpwwwNAME= *zN mount_disks>      !"      !"#$%&'() str_arg_substget_available_cdsvvvvvvww swwww$w-w8hw=wAwEwOwSw[w_Iwewpwww edit_fs_type_ext d   D , X  < 1L p_ o аedit_and_check_label vvvvvvww swwww$w-w8hw=wAwEwOwSw[w_Iwewpwwwdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskcdt 3 @ A D > D : 7h B 8 ; 7 7 Q > Mx = :T 2 9\ Dt HD K 2 2 L 8\ 8D 7 <, 7tdisklabel_change_geom|HDXouter_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default+P+0+Č+lpm_from_pepm_whole_diskgpt_freegpt_create_new#"1H02$//+ $h%4+p*l8,L"D % Q<:\>T=3 >!PH  P    2* "w=I !+mtm+++ z*++N+N N_w=+cN OOI+ww+gpt_get_part_devicegpt_get_part_alignment.p7X Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - HFS0eC"UFS0eC(wE!haHdInotNeedEFI27*s(ҺK>;AQn|n֏- q+LXQn|n֏- q+gqQn|n֏- q+~Qn|n֏- q+Qn|n֏- q+w=Gry=iG}M;t?WmCĄ 3KOOyD¢<#*=(РD3h&  \M}-&7-ıܹчHw=H-ܹчHI]IZܹчH wI􍂱ܹчH*I􍪱ܹчHI2ܹчH'S@ۿ )Ѹê1*@ە )Ѹw1ۏx )Ѹ! -. ."(.1w8A.AL.K.[.k .~.mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new|HH<[g`ZbgRMbN,NQRR4RlRiOO Qt@yeNX(oeW|O dlUSS<mbr_get_part_devicembr_read_from_diskadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_free/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.0_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.0_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.0_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.0_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.0_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.0_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv6hfeb/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hfeb/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICdtbgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************0usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump2Ykdhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_geteloop_q_timeout_addeloop_event_add_rweloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option\bcܜd\7eVf\;gWPhWviOj<k\Glbm\Qn\7o\Xpiqr\cs\jtWuܨv\rwQx\yzWy\A\B\CUqD\E\F\G\HXI.J\K\L,M\N\O\P\QS}T\U]V]W]X]"ZIG1]14]:6]C\0|x~]T}]_]]]f]v]]]]]]]]]]]G ZE]]bZ)]]]^^ ^^^"^ ^(^5^^;^A^I^N^^[^g\=^sdefault_configread_configrt_compare_proto$$"@"@rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt##rt_buildrt_delete" " sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init6nbQwbbb.WFbscript_buftoenv^\y^"bmake_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os@dddddif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @DC@CDget_leaseread_leasedhcp_openbpflog_dhcpn^ninundhcp_bindnlnndl:ng ndhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d %s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccallback != NULLnseconds <= NSEC_PER_SECread_cb != NULL || write_cb != NULL%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIASfwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated lease%s not foundNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedUVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\B')t9*-*<3*\*|9*[* *?*+d+<E+\BBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~T%LXu}ay}'t9-39[ ? @dE D @ <'0t9t-3@9„[  ?PÔdE/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error C00incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k1.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist