'VG3 fF/0mǸNetBSD/earmv6hf ramdisk 08Ef<  Ef]t tEf@@<@T 08Ef<  Ef]t tEf@@<@TU Eft`AEfEfEfAEfEfEfeA.EfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfCEfEfEfAEfEfEfAEfEfEf$h EfEfEfmDX EfEfEf (08@HPX`hpx`$|EfEfEfL$-EfEfEfM$EfEfEf (08@HPX`E$vEfEfEfhpxK!EfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf!EfEfEf4!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf B!EfEfEf B!EfEfEf!EfEfEf"!EfEfEf"!EfEfEf"aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf!EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf?\!EfEfEf>\!EfEfEf=\!EfEfEf<\!EfEfEf;\!EfEfEf:\!EfEfEf9\!EfEfEf8\!EfEfEf?\!EfEfEf>\!EfEfEf=\!EfEfEf<\!EfEfEf;\!EfEfEf:\!EfEfEf9\!EfEfEf8\!EfEfEf:\!EfEfEf7\!EfEfEf6\!EfEfEf5\!EfEfEf4\!EfEfEf3\!EfEfEf2\!EfEfEf1\!EfEfEf0\!EfEfEf7\!EfEfEf6\!EfEfEf5\!EfEfEf4\!EfEfEf3\!EfEfEf2\!EfEfEf1\!EfEfEf0\!EfEfEf2\!EfEfEf/\!EfEfEf.\!EfEfEf-\!EfEfEf,\!EfEfEf+\!EfEfEf*\!EfEfEf)\!EfEfEf(\!EfEfEf/\!EfEfEf.\!EfEfEf-\!EfEfEf,\!EfEfEf+\!EfEfEf*\!EfEfEf)\!EfEfEf(\!EfEfEf*\!EfEfEf'\!EfEfEf&\!EfEfEf%\!EfEfEf$\!EfEfEf#\!EfEfEf"\!EfEfEf!\!EfEfEf \!EfEfEf'\!EfEfEf&\!EfEfEf%\!EfEfEf$\!EfEfEf#\!EfEfEf"\!EfEfEf!\!EfEfEf \!EfEfEf"\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf\!EfEfEf \!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf!EfEfEf !EfEfEf!EfEfEf!EfEfEf$!EfEfEf4!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEfaEfEfEfaEfEfEf!EfEfEf!EfEfEf!EfEfEfaEfEfEf aEfEfEfaEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEf?\aEfEfEf>\aEfEfEf=\aEfEfEf<\aEfEfEf;\aEfEfEf:\aEfEfEf9\aEfEfEf8\aEfEfEf?\aEfEfEf>\aEfEfEf=\aEfEfEf<\aEfEfEf;\aEfEfEf:\aEfEfEf9\aEfEfEf8\aEfEfEf:\aEfEfEf7\aEfEfEf6\aEfEfEf5\aEfEfEf4\aEfEfEf3\aEfEfEf2\aEfEfEf1\aEfEfEf0\aEfEfEf7\aEfEfEf6\aEfEfEf5\aEfEfEf4\aEfEfEf3\aEfEfEf2\aEfEfEf1\aEfEfEf0\aEfEfEf2\aEfEfEf/\aEfEfEf.\aEfEfEf-\aEfEfEf,\aEfEfEf+\aEfEfEf*\aEfEfEf)\aEfEfEf(\aEfEfEf/\aEfEfEf.\aEfEfEf-\aEfEfEf,\aEfEfEf+\aEfEfEf*\aEfEfEf)\aEfEfEf(\aEfEfEf*\aEfEfEf'\aEfEfEf&\aEfEfEf%\aEfEfEf$\aEfEfEf#\aEfEfEf"\aEfEfEf!\aEfEfEf \aEfEfEf'\aEfEfEf&\aEfEfEf%\aEfEfEf$\aEfEfEf#\aEfEfEf"\aEfEfEf!\aEfEfEf \aEfEfEf"\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf\aEfEfEf \aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\ !EfEfEfi!EfEfEf!EfEfEf!EfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf!EfEfEf!EfEfEfaEfEfEfaEfEfEf!EfEfEf!EfEfEf!EfEfEf B!EfEfEf B!EfEfEf!EfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf!EfEfEf!EfEfEfaEfEfEf aEfEfEfaEfEfEf aEfEfEfaEfEfEfaEfEfEfEfEfEfbpf!EfEfEf $EfEfEff$>EfEfEf$EfEfEf$sEfEfEf$EfEfEf$EfEfEfAEfEfEfmEfEfEf$EfEfEf $EfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEf AEfEfEf AEfEfEf AEfEfEf AEfEfEf dAr!0 Xo;SdԠk}tKF n[)LfG 74";tx t9v#(WAoU Wf Zك?>g X ѰB(s~'x'#?͚((F(_% {eUT"|DZZueBvemEA?y9@}!]w.(J 7^j}wbk,Ws6u@6y X:W;8 cE xb>5 "X$9:€h`-[6dz9paUZ;t;juQ%ucJ8zJd#Y<TAgQYMƿm_kFГ( /=Z#RzEip-,|]G *^t . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4 4 (ʩʩ$$lLL$$NetBSDʚ;PaX NetBSDearmv6hf4H H D0P/!p@-@P`C`F&a03/T@p##A-`0`` 0PpU(pGpG@Pq`P03/T@0US b#`@-lPQMK \!\1 P` 0 R: 8 0S  /S 0SP `00S5 0pp WI2I0@3)1*03/ T@py0pWH2H0@3(1*03/X@ b_L0d 0 P0 0#|h0#H# 8$@-t ttPl@dphP LX0&0`POU NP t@4?%|lP@-@aH0`  BR` pRp RX Xp/0%%O-pP  b 00CS0wEp@ [E0S TX 0S7 0T0 R0S p "|16@' 0@ LA`"000`00<16@0D 0S 16@ 0S $p @ T T 0S ^p Ip0S TMxp -tp @000 ^jp T?@0 @ꔝ%%%0%wO-@Pp`0ĀĠ00S 00P  0Q @P p姬0 P00S Ѝ @0 P0=T0`00 L0%%PA-1Mfv1 Ap$0v`S(0S[P0 S(0( QP$夔$0S;(00$0( $嶶PP  \V00ЍD}$ 0PPU0%%%wO-PTqTa@P1tLLLMt@00SC 00P0@tt@)  R v@Ppჶ0: S | A0 P00SЍY@P0 P0g0s s0T _T0%%P@-0 y$% 000/ġ%pC-؀-`P p0M@   A '  A{{z(`P Ѝp Y@ġ%%@- M @00@0  P ᑫ Ѝ/@-` x1V0zP 0 6@P@TV 0PF $$q W@V4  Ѝ 20S@ ^@0;0P W 0pW2Vp p10-S T`=@@p ,P@0S W $F<ء%PO-5M R ˶ 幵@P| Ѝ np P@D5Xp0S 45 0500P 5PPUP0S50S+ D$`D00CS0@Ȥ Pp  @YT L@0 @00CS0 0 U,0 ~p8幪,00gp  p`300 壪80: SK +p`  pP* R@tU0@@ 0, 043(P$05u00000 R00SQ 0 0 ( pE  p@ 0T 1(#E0 喴 0P# ||S@ P XJ@R0S P $\=ᰴTA᬴! ,+," 0R@D 0Z0TT$@ Xp00 R0S pp0PS  0 9(\ Pl PTH@T c@P@0 ?oR20S 0  0 0R0⿵P ש@IP llϩ@0S L"P@ P0Rt00!sP %$ȡ%С%ԡ%̡%%%\0%\%ܡ%kġ%%%%0@-MM@P  p  ;0U$C d=P TT凩ۍЍ08 P ,(0P X$ܡ%Q@-@ TP DDd,P $ 0P@$ܡ%Q@-@ XP HHE0"\P $ 0P@$ܡ%@-L0 %0$/Ȳ&0$/&@-@@-;@-6@-1,@-1   0R 0 Ѝ&@-1   0C 0 Ѝ &@-1   04 0 ЍȲ&@-0   0% 0 Ѝ$&@-0   000 Ѝl&Ȳ&@-0  $ 0 P/ Ѝ;$@-1  (0 00 ЍF&<00/@-0   00 ЍX&R&<00/@-0   00 ЍX&dȲ&,0A-PA!q!ᘁ M`V0 |! R0B=00 B  T剐0L!D!7 Q<A 84100 Ѝ P [= P 0`00S 0  p0P      0 3/Q ! 7000@0@0L&D0&X&Ȳ&P#=&8u7T0p@-|@PtP00 R 0p800 p0  B0Sqs &Ȳ&&0 0 0 /Ȳ&&@- b@-@- `@-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/qp9.0S 00m8@@- PЍ ⬾P Ѝp@-(`Vp80@  03/PP8003/(Pp@-@P`P ㋱80 (0(3/@- P ~-PЍp&O-3 PMP`(P,`B  0SP0 0K S X0\ 0X0\Y0 P % pHp 81/qp4 D+ 4?P p 04 -0S4 p0 0 0 0 "0 0 0p0 t 0 %0 0 VU0 5"SR* x0| 0 x0| ! R(P0,`R!*0 A{ 000+1 xpt| v0( ЍOϰp0t 0 p0t x0| 0 YXx0| 00 0S04D0嵎004 0X IЍ&&VR/ R 0 0 /P0PL 0L B0R/S/  AA  AA  A A  A A  AA  AA  AA 0S AA@-tBM 0  \X 0  @Q ⵱? `(c$P}%B@Ba cHDP}%?L3c`?`RP0!!!! d 4 !`P4(4 " Bhh `!d4پ4n(4  " B !d4ƾ4[(4 # B  d4⳾4H(4 8p<@ !0|/0(0 /(dX p@4Ⓘ4'(4 įЍ&Mbh&?YS@-PGG- A `00P4 2#&`8` (01/qp $ 㬀夐pUЍ80 $0(3/P 0 `V`PE0S0C0<_0  Z $0Ȳ&X&$3@-XAM P0 401#"8 P0(5/qp$ <P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080 p0h( 3/pLp #U0* 0P/`RP `&m@-@L M 0Q   0   Ѝ &zO-M0@S M. 8S+ #='0|⤽0S( 000| " ! !x0|0# #|0 \& P%ݍ Ѝ'|`# 0 Y0 S 0E0WS06  S  S $0S0 600000S60 060 00 6R& R0r0C0C00Q0 0S, ,B< 4X06,m劽P`p0V 0(0$0,0PUp 00(0$00,0 0S $[# 5%'(0S%0 %00   0 |5|[,0S l5l%0 0dQ\ZWXH5%DY; ?Y07* .' 0 @&` $'0 7&0 '0 -&P(0, 0 00(0 0@"<00@ 0@ P|T ' &됶Yj& ?Y0: 0Y300$0吣* ?Y0:W%00S. ,0S#$`V  !40S ؼ\ ?\0 * &0 % 0Lż &%7# { |0ⶼ$`[㐒3 0 !{0 $ ! s  !m(0, 0 00(0@0 <"ap匼1,0S 04a Q0X$8_0V00, ?V0(*`& 0  r%4V&0 i%M&0 _%0000004 00 pJ7&9V㐺+40 ?V0:*& 0V㐣$0吓) ?V0:&5!@<$ 0 0$ P `9 &s {M$]i]4&KU2V9# 8"(?k3MyeQ@-p'PP`@@ Q&P Ѝ`3MU@p@-XP8@T`@D p ?!P<opQ<Pp &A-AP0P$ 0 0 SQ ( $08P (!h d)`P, R3HHqU``0``000基P( x00CS000 f   0,`0CS0000 (00|/U R (ռ8 4ݻD 0$00 0$ p&i%p&R)&T0 S 0SP/P/S/@- "p&kp@-HAHD0040S*0! PPP P`04 0PR@ V04 ^000( P 0PU 4`0PEP P 0P4  P  P0CSRP40P 0  pp&p&$&&p@-P0:  R R1S7X#P P 0SWA吡S@ @@  P<&LT PTL00CS0410& 0`00 S#PT 0@@00S , P* P   P 0@0CS0\00@  Th&&x&0%&p&i%R)&zp@-Pd`d@000 PPPPT0P0CS0p(00 Hpp&&&G-@0` V V?ЍpPP 0崀 尐R`00@`0SoP 0S 0 h0  0m?o2S @`sPh&&&&P `00CS`0p S00 P0S X0X /X0%G-p`ㄒB儢0SS CpP[ U\ XLDV00 0PZ 00CS010a U0Pd 0@Z %: B 00CS0h10=uPU 0PL1` 00CS0 0 P0` R0V00厶P$ g00CS0p00 UV 0 00 0 @00S 0S XHط&̴&p&&i%&R)O-- RM `0000100010S @0бq`  0.0P0 0':0J?oT20SS SRO b0S  RZ@T  Z     00 10S@@  0 :P 000CS000 Ѝ S 0P  BR l  @0S Z0 0$̴&&&ط&&p&%&A-0P!S`2P@# 0%4KpP0!S P # 0HH H<00S ,$00C%&,&A-P@dp`T0S P#ҷ$ ڶF誅ط&i%1O-`@ ؀P0S p0 T T R R 0pfP Ѝ PP P   P Pp@ط&&&̴&A-p0`!S@PPE#r 0y @'4凶 P0!S (P (#U 0PP\PD00S 4 PT@G@Ѝ %C[&,O-@pb00CS01:pW PU>ءTpp0pp00嬴P""  00CS0Hx10 s@p@P0 5 0p0CS010x0 S0 0  X 000 0 0 0@ "ɶ tѵ= 0`00h0 P`0W0$0T P 00 0%ܷ&x&p&i%R)&&Է&h&tO-PpP0 SPEUP ЍE P 0C0 X0 Ub000PI"v ~ 00C0S.20 & 0 0CS0T200  Z0 P CPEP 000S S  `V% V000óP !'| x/t 00C00 0CS0D100 0X 0PFiP 0Z0 CPF V(崀VPP0PP00倳P !t plY 00C0m0 P0CS0<00hj00`6h&̴&p&i%R)&x&zO-P@`p 0P`T !. 0PS*_P 0@^S00\P0S \ [ hP @P@+0P00$%@-T @0D dP 0S( 0C00S 0C0 Ѝ&ht@$L0 R QQP0R/@- &kG-P`P@ X 0S@ @0S @T@@DT ~pP 0S 0 0 PЍ&G-@P tp0SX`UPUP 0 @,P @Pk&X0000@-@U 40aA R    0/ᬜ%&40000 0h@-6 謜%&O-R蒟@ 刀p0 pWp0#s) 㼢0`?VJV$ V0 00 0S0 =D c  i1@s4Y 0"S00 @∀ FQu$SUUUTlUUHUUUU$SlU$ST UTTTTTTTTTTUlUUUU U^V^V-Vk @ 0s000@^V-V00@R   p 1@s@ 0"SR 0.V@0 @R J /Fo@P0 R00R  G@PR 00;V0 00 X@} T0Sx&%h&k0@-@00 005P 000 0 00 ,R;R 0S  S   0;SRp& p@-PD0QS@@R0p`VP 0C&p@-Pׯ@P |婳, (屲$ p 00i%R)Q 0Q\S@-Ao/`@-0S*  0@0S! PpP &PP ☯@P 0 S</R/    9 0 & ( Q 0@30/@-&00@- R 0C30&A-plA1S0PR a  R R S0` ` `0S 00 R0CS .R R P000`P 00CS0"0 l W  KU0圁0CS00 pP&0%G-AP pRpGWR0`0`0` 001S 0100CS0H89 kP00CS0' 0S  [P 0Sp`0 0`0R00 00C0p00  %`p&G-p0A 0RSXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*Pu`&G-A 0`0P0 P 00CS0-0 p& 0FSNp K1S 0p10EP0CES0&O-PB`0pS!P UB0S0001XPPPPEPD 0Q0CS00KM!1  P[00`F`0ZP/  O P) 0100CS0G'(>P; 0堑0 S- S   P8e m00CS00  0堑0CS00  0Pz&i%R)A-A`qW ڬQ1ECe R1 0 C0|00宮PP 00CS00 v 0q0CSQ00 \R `R `&i%R)0O-D0!108P` Ѝ0S/T SPPP  YP徰X TƯP200CS00 ! `0Q0CS00! P1ȃԣԓ 0 S*"Rʜ0Upppp00P 0r0CS00  1Q !@o!S/ %S pW U 00 0P 0帱0CS000!000\Q00pPR# QUpp0pp00弭Pb 0q0CS00ik0p 1 1S 0S11a0S S`l   叭P5 0a0CS00<>10P!pE S:`00  1S `qP ʼ10PE pBR    Pp|000NP 0q0CS00 &i%R)&( Q 0@30/@-I&`01S @-0@!S @vP /x P /& 7@-A00 S1 RUWʐ0\00PB1^ f00CS00- 000 @P R0 R P Ѝ00!S JP G0 Sڴ 0R0CS00000  \00sP 00&%i%R)%?A-O0 Q .#p WO ! GrYQWYRT~H~xmpopuupo{k$ll\mnpo8p0qq lR? 00 S1S"\(P꬜%&7Na$${&i%k\?,&&o h&$&" 0"0" " P0PPmP_p PPZ0S- `V0V PPp0 nR pR lR 00 S/1S888P0PP0SP0 nR pR lR 00 SP0PP QR000P0P0@m `P 00 00  P0 nR+ pR$ lR% 00 S1S0!S dM0S1Sr bWW P0S0P0PP1S 2SqX=0S 0l0Cs0S 30 S0 P0010CS 0nQ( pQ! lQ" 00 S3 00SL` `ǏS@p0"SZ`{ 0  P0 nR pR lR 00 ST0\S =P0PP0SPRP0 nR pR lR 00 S2P 'Bv2SP0PP 6P(  X-@- 00剧 ЍЍ/'&-0^S0]S0]S S]S[S .0As0S>30   \  R]\0G-霁`Pp0 SS'PG(!RJppU``0``0,0Ȧ@P.-0 ,5(00CS010 [S@ \S@0 S @@Pp 0(a0CS,A0p00,A   L0 0pS G 0h&&p&i%R)&aDk&p@-!0 PJ@p P@01S?0A0S S n@P P0P 00S`0`00 P0A l0X 000aŤP`0h啨, (坧$h&&x̷&з&'i%R)O-bB0  %R R 0R0P   BR  t   R ( Qp B  RʼqU``0``00֥P@ 0A0CS0p10H 0P \RI0P 0 S 010S P/ 00P S)  R [ U   喥P0 n00CS0L00} \0`00Pp8 Ph&&p&&t&x&0%i%R)A-@`@0@P X0@ p>P" 0 R00R000 1BQ@ @X刍@pv0"S,@gR000h&&O-@cMpS唳唣00 0GS T`SXsTP0PP00 PCp( $x 00C0-0&SM0 L\  DQ<Y0 0C@p \  0ޤP 0Al hId00C0S @Ѝ,20   AQ  \S9 1B\400 BR0ˆr L\ DRW  B@ \  兤P AQ 0 T Tp p pp  bP p BR   @e0 P0CS0,00 0 r&p&&i%R)O-M!@^0P0ߍP40S 0 Q0 000(0SpP@Pd p0 S pSx 00 0(0Y01 Y  $ P$/\ |dx  B R`30    BR 300S 0 0   0(@P#Qb 0bppG XxhY 00 0塣P\( $ z00C0S0 Y( Y 1  僣P1  Z1  B  BR l100S 0  V  @ Q 000 "2 0 0(0‾P1 0 0CS000SUW#00 T00S 0 Q  @ 0 0S&&p&i%R)&O--p *ᬡA0Q0C` M01 00C S00`Pt :  P Ѝ5 /P!` 00000`P00CS000  [  }0S00CS0x00` P  P&&p&&&&O-RB0M00bsp 0sbЍܑ0ԁS 1 7  000P@ 0.#⩟ɐ Y Gt10S 0p0000000CS0D41< $ \$ \ 0 0#0L\ 0C000@000000 0C LN (&$&,&p&|&t&&A- `P0 0Cs 0p 0 h0 d   B 0CR0@pT yᴢ@,&&$&G-@p0 PR` 0 P(S%0  d  P 0 ,(倢,&i%R)@-80 㷠%O-eGM0PS@pM$Q403/P GݍЍ0: S00W + P8:?0⠔P0: S 0S∔P0: S 0S 0S 0/S&vP7{0p0p P- pP 0#v⦡ PvO+0P ]<#P⒡]>P 先/$P/z$P M 0P,I [)H Z& U9.0. 0PT:.0. 0 P@D!0Q\ PT1RP o R00S$ 0ST 0: SPIPO 3  0G=00 04K G=00J0SP/ HqxXG 8X00CS0p Pp  pYW iLX0 X p00CS0 0 ꕓ0S gPP 0 d6 R;c 00g8&qf!%0%%\\ 0\\ X X0p@-@P@@DDT` U H H0Rp@\\t ppX 0Xp@-@P@@DDT` U HH Qp@\\Y ppX X0p@-0P0@44T` U 8 80Rp@\\? ppX 0Xp@-0P0@44T` U 88 Qp@\\$ ppX X0p@-PPP@TTT` U X X0Rp@\\ ppX 0Xp@-PPP@TTT` U XX Qp@\\ ppX0@-t pX0pt0\@ ^0@\\ X @-0ptX pt \@ ^ @\\ 5S %R R S R SSh -^L^S R 0/0/0000`&O--QMTu @ `u @ 0 @0L0@@@ @D@H@$@(@<@@@4@8@,@0@5 SS$|\ Tn0 !00`V0SE 00刐0L0S{ ,0D0000400800$0S00( $0(B?$pfp,0S 4 @?C000d$0D0p0H05X0 s0X00 00dt |  ` `R`S Y ( ?R004(0'R S S Sp4 L0Sd4 T0SX4 0SL4P0S@4@4Z  000Ѝ1@GPꌪP\,h`x|0tīЫ 8DTl@0PPL0 P 0PPH0LP PTPGX0s0X0 0PPLPTPHP=0 00PPLPTPHPX040LPP00PPT0LP P0`P\0&0\P`0"0d0``0<0080 `000DPh0lP0DPhPl0 004@p*l0 h000  L00S   ]%f!jȹ&̹&&$0\ 0S й&f!0L0S/0 000/@-0M0S 0 00!pxpۛЍd0d@ `0R@X0 0B?B 0Ѝ@ěl&p&&&o|&P `00CS`0p S00 P0S X0X /X⺜0%: S@-  S  S/ I* S  S%|@=A-x1`@pTXPM !X{@P10S D10S- 010'[p / `@0 000) 0@0S00S 0: S@Ѝ0圀 h0R0x |B?= 00T00S h&p&&ȹ&̹&Ĺ&Թ&&&&s@- ږP@@P `QU00S @HT DЍp0t  Q \0 \0@.T )P@%U&&p@-P@Tp0 0C0  ,B @G-@0Mi,3(30S`V0Ѝ0 0C0| 0XPS !,多0S 20Sn  4 "; $pW x √0 0 pL20S 88w ((s$20S  $k0 : SL( 1r"6000 0@0<01"$0W10S10S41 100H 10S|10S : S0: S t`w818q 0Rp(1 B?( 0 'Q p{ 4 pP^ 400S &&h&p&&&&B&&ȹ&̹&Ĺ&Թ&&&&1O-0S,0@010S 10S40 001q 1000PS ЍO\a0TQ ɘ0P 0 D`0SEpAQPPU& Ѝ  B 10` |0  ,R4   V 0S[     h&p&&Ĺ& $Թ&$&010G-S,0@010S 10S40 000 0000PUG`p2눠PUG m0 0C0 W dp0S,4  `YpP T`h&p&&Ĺ&Թ& $0G-@0T,@0@SP 00S40 00@p0`0夀S㤐@VG -0 0C0 W ,$p0 00 S p0S,4  Fp` h&p&&Ĺ& $@- M @ Cp ЍT P 0@  QQ  00NT ᵙP S  ꈕ%0p@-0PS``@P P PLA4@P4D Pypp̹&C-CM@ `s oPĐT *F 0ԘpPPCߍw ? P@Qw0S ?@ዘP?oP@<%@- 庘g% 000/&@-ֱ0 娘U%@- M0P ! 00A00P!0 0a~h gp~  Ѝ "$  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx̉0P @000 h0h< FpX   DHf"$  (0f&jod` wO--\e@PQM ݈pPp 0St  =~p߉P 0S ؉P -~ t00CS02p1pЍ0S ḉP PPᯉpPX )<$ Q840l0p~0 ! 0 X Г00CS0 p YX 0 P 0S  x0P≉P X0: S ՈP<Pz P  eX0: S PX pP}`0S 㞛 ሲ  P= 坔P} 幇 R (w}&P p}0 ¯S ,!0 0 A '! A{{ z0 HpJ}὇00@0 P @8}p lP 0S +}X0;X0X߇P  }ڇP 0-S  }ᆇPVὈPtpW  HdMp Y@&\%0%  k&:Gs@-@ `P%P0P U ?=ЍpU \@1/0 `P4@ $@-Q~M0pSM 0`  0 `xP H`! p~,P =8!>1@~܍Ѝ00 `ZP+ ~,ņ@P" ~,⼆P0`  0 `<P W ` 2Q  X00 00%P 0$ 0 $m 5_00CS0 㟖0 /O-D`LMp 000tTt$tt000 0000Sp@V04`0p Q 0SI\#NP0#0V 0030p Q  #1P0 00d#0V00<30 #Pp0#p030002P冇PZ0"Z00 0LЍp(0: S |/ S%l fP000`P3)0-V'V|ЩVrX2PUT  ?0M1PP S0 0 002qp 0S0 0V00R V 0V 0d1\!00X!00@@D!S9PPDP~<0V 10S0C ^:ˠˠ\:PV0 ~,0 e~\P0 P ;  0 r\U0Y 00V T0< $&&p$,$4$=$Lf'8&:Lm8@&&L$}D00S/@-4@~M0S~, .P~܍& $0@-p@$0l00S Ѝ0 000Q r, s/P $&}L0@- R8 /P 0 0 .&4g'&A-p`P@ 0PPEU`@T@A-p`P@ ᮄ0PPEU`@T@p@-P@T0` Q@P 0 Q @;;S p袄@P00T@ (0( .( . $&& .s@-R@T` V0a@$00 ?00S 0CS1P10 S7@v.@ЍpPڀ;;S! 0 000Q P?7P@@00" 0S @@0ES TT 0$00S0S 0S 0S $0STڄ00Q ᦬Q`$.T( H.k(00 k.$ $&Oyg'.`!0SN@-PQM0SB @100CS4:Q000SS60S0@pT0S 0pLTQo 0 T0pIQSQ00 t 0BP00 0S L-Ѝ00/ -& $p$9mhG-P0 P Ѝp@PڬAQQ` 0Q P 0@@Q< -P 0S $&@-pAPMP \1`0S0 SU0<900U0p 0pQ -Ѝ P0S(0S 0Q}  Pڌ0U 0? 0 d-0 P 0ᎄP_ 0, _- $&+X}&mO-rM4M R0`RX0@FPx0 0S 0  F00 S(0S l  \"qX2p00 08"d>00 "#]Tq " #>F܍4ЍT 聟0S =! !E!0`#?## q0S1p1 000@!&>0H!041 04q 000`$1尐(00C0   0( 0 ,0$ e$ 0 x  000 0 0 `##~# Tp$%&g'&4g'& &b & $. C-LRLb0HBS0000 Ѝ(( 00 0S  2 r0S |1 囑  0S 偃pP (0: S)0D p10S10S PP S 00 0S q4; 1 00 0S000p000 S(00(000 P@0S !000S x0P 0+0t0P 0X, $&&g'`g'g' g'4g'_ 8&p$|g' g' && A-MM4 ^P #+H RP"+bR$0@S 0@̂0S24+pP| Pw 0 t S( -x +t+p2Tr0h0CS``++P+L+H +D+P4P0@0@* 2 ލЍ*0S  R  sS SS YS~P*yS*0q儁*x*H*P8^P 0SD @UP4 (1P *0S *@(*CPP 2P0@0@**g'   $&g'4g' 4$,$ 6 p$    A  Vd g'[ | r    5 E  a      00@-@Rp]p`l$O-ql L|0S'P6@PXXLP&PV,L0 R4T0S  Z*@ET  A0d#0V`@P@UP=*PT0S d0*Pꓢ" <2/PL0!ᓢ#, 0?`$T$&p$ & g'O-騁0@`PpM∱ @FaQ PPPU3PP)-PT,010S( $)P@!0$0 3/0P% 0 R T @ A; 80 3/P{0Pp00St l) Q < 002/P0 " "Ѝg'&&& p$L o &  @-AMP/M+@PAލЍp`p P/0P0 UX0X )L0_"/0P0 0@ 0 `)& & 00CS0 i0 /0O-c$M00P[ P$ЍP0,03/P000 0t`30S LCL P PPP 00 30S[ P U P!P r4 CSR zpPtt h" ~PzG;8@";)0/S8P  A?W O 10S b P0S !S 0!202 03/pP X- \ d1  0S HQ0S 01;00 Ph0D0 3/P 0S 0 R 0pU0403/ R~C00S .'P0h0CP0PPg'g'&g'xg'&b&&@g' g'&g'g'g'&@-@@P( (n&|@-=p @@ (@-@ps0 s(@p@-MPgp@c0S  0C0[ `Qp 0: S P`S NS Ѝp@C-MpPЍa0H03/P0 03/PsphA]P@ 0AS0@0 a3/PE0 0P)3P/P 3P0/SP A0 00l06@ p '0(03/ Tk}\U Pg'&&&%0%g'O-MPЍhe0H03/P0 03/PfPs,5p0S 5}P %'40SD]7P 0(03/ }P 0AS0@0 a3/Ph4C00+D^P 44 CP40S  d~P 00  Y~P 0R S "`Qd 03p Qt 0pP\eP HSP3` Qd 30/S-P  A4 00  ~P0SU 0S "`Qd 02p Qt 00S "SB 0Hm 4S P X20SlH20S Po4S S/ 0CS)0S%  Y K0S$ 0S 100`"Qd P  t1 ,4 T RP (1J0 M Iq @ 9/0S 0S 0S 000Y\0C00(4S 0S 0g'Pf'l$g'&g'&&g'&xg'pg'`&P&&Xg'Tg'g' g' 0P! 0p 0P0U00pPF0P0 000/`F p 00`00Q Q P0 S  PF&L$!$g'g'p@-0@0PpP E0Pp@|&L$A-`PlplU@@DTj@P U@0 n00`PE&L$G-P`ကpU0 @@BTG@PğU 0@0 90@UP0 `&L$G-M =@p P`1`10S wPc:8,!b ((U00" J(  90 0CS0P`ލ/U 0 uP0PUoYwPJ,8\ @D 0RP J(@ J8,  `dg':&L$dS0@- M@ wPl0PUP $ 0 Q ^ 040Q\Ѝ0Pg'0@-MP @vPЍ000S0: SxP!vPU 0D vP 0b0 g'V g'0@-M@, 0000S# Q0S 10S vP'0S% X0 "?A3c000S&!h0 "?A3c0 uP s0NS o0X oЍ0g0< g0S up$|$Mb( @-@ vP  Ѝ0uP $0?0 ? g'S@-!@uP 0+0@ * g'qO-@0P/S`p/M/9P8 0 0vP  p /00 uP%  P 0S  uP uP0 K pw  ЍHg'G-@P 00/S (QP q00Q  G]t ZP0 0`0S 뤀夐p0 P0S@$<iP@D05 40 @!De' Pg' g'A-M`P@pruP5(10S Ѝ 0RP  0RP 0: SgP tPB0 B1uPW tP . P W0 @$g'V4E0@-:(4@: SM=!R \000[ P0 up 0: S ,Ѝ000  u_:P/  0 gA-`QFZDT@sP0@!81P @$<pP10SP+(0 000 =  "4S `sP`0 t80p 40Ѝ(tS|(tHPs s00 Hg'Lg'$|$e'O-Z#Q30`@ (tKMMp 40CS񟗩l3lrP\30S Qt0P0 0$#: SQ ZPX3P @$<쒟 ?o2P0S(4S2?P tPtP{0p"0 + 0S820S{ 4m0C?o2 000! "Fmrp0!ZY- Y10S- 0 !K>0@4@~z=0 C)szr 4j6 rv PF@$<P>4S(4R0(4p l$hR\00 X0S 0(4} 00H 0KލЍ0q4g' hg'Hg'Lg'$ I|$Pg'#/O-p@M W 0DP 0S08 0<000SPP0C080pG0S 0`S * 0R 08 0 x x/  P8 7@0 X2@ @?NQ*(@0 (0嘰 R P` dЍTT a~ 4 ` `@ag'g'qg'g'R/s@-@ 0@`PQ0@ Ѝp@ $_qP0 Ѝpf'0@-@MPPq00800S =J"Ѝ0g'G-z@M`Q M Y #P DqP 0P 0P=! SR J(=ݍ ЍrPJ8| = $ HL0RP J(DP 0PQȄJe8 :G- AP 000qPU+`00CS0ᆪpU 0 0S U 0 P 0 SP P0SP 0S0 0 S 5P f'f'$0% 0 0 S00@-@R000x00S0@000S XN}P DP,0Phg'lg' f'\g' g'p@-PP 0Sp `'}@Pd @P0/S0080f R P@@@@p-H f'h0 RX R  H R/< R/ $R/Q/  f'|g'dg'g'l0A-0S X0XP@0P`PpT R S* 0@g' f'i%oG--c@ 0(MS 0SzB0@(Ѝ0 0P50C S=P$$d$$#|$$$$$p20S 0X0 00!P 0 ! " PPP  0!$!$! 0!㓭 X (4 : SB  S<  S)  S08 0T! (0 J ,!$1$@P@ 0 S  S0  S04=! 0400S -ЁЂ ;Ѓ" 040+04 VoP0H 00  f'g' 4g' p@-8M@  HPgy0`P`dU0$ $ @ 0P8Ѝp *A-t1hM0@S T~hЍA!`Z(z="(<p@01WpP0 0000p084 ~40CSH$0r"60"$~0( {~4 CR+x r~hЍB>'Pi~S+<  4Mg'i6HaZS@-@XM="p:(2z0 XЍb7@-@PppHP Q Ѝ0 0v ( Ѝ0@(0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//Qq0@-C0S&P*00 ,  SΌ!0W0@0BS0B0b 0K 0 00Ό0@0 P*/ P@-*0S0@P0 ? SR@G:@  SR < Q R 0\ 0 Br^00 Cr@ T A Cr@T   \a0Cs R  @-0C\@0# S#:0CBPBb 0 ^ 02W"!0C S*040@-@T@@  tg'kA-P0q0`Q VA-QQ@@TQ S A}A:TP0 dd|?@ 0:S@ 0S000 @\?,0f'$%%/s@- ` P0PQ!0*0S @mR$ bR kR% + 0*S xS SЍpwR! /Q0@P0$+* &#P00PG- 0SO`P y0P  p T@R 00T0pT0S ,6@Pp=1PP {8f's@-@PP0@l C300Ѝp0  R R00`?y@P 0 `F 008f'@-  &y%*0 Rr @-/p$@-00z&$(w& t& q&y%^5/O-pဠ倰 @ 0P0 3p`0, Y/   `PO-@-/lM`봯PDPP 0p p|/||_00 `?`/pP?L?A0s 8/S XB\    CRX 0F>4yzP񟗳d86836\866666868t8|88666686666666666666666666666666668 866,8886D8P866666666683H76666d7l776666876683l767676866666665566 66H66T6d6l6t66|66666767$7,76<7?<P p,PM>J=0 -R,Q0 000;l= =p, 4hP5PPU @ ,P@g tYy`P jP "PiX PcpPX\  P \50S  o P  P@5嘵00Kp:% 0yp B;X%04 L50pzR񟗺TFAAAAAAAAAAAALF@FAAdFpFAAAAAAAAAAAAAAAAAAAAAAAAAAAAA@AAAAAAAAAAAAAAAADDADDAHEdEAAAxEEEEEAAAEEEAFF,FAAAAAA@$@X@l@A@AA@@@@A@@AAAAB(B(0 0CP;TC 0S0TP* R00;T 0S Y 0 0tYpi Y 0 0S ddt0S X 0 }0Q0 ( tKf' S!m!!%!C-`PMM RP s\SP RW P0S #  P0S᜼s\SP R1 PgQ PQ' SQ GQ ᇼs 0 0@pQ sQ00000Q0 R @@@ۍЍ00 P Xsst%q@P p V~P ; i{0 $iZs!H"#"f'!!A-`P 0StVpp@PP P`Pz80 PP p@ @@ @f"{"f'X0A-@0LPL`LpT  S& s0@f'i%"L1p@- RE jDTA ,PU; P8 \Q Q 0T + r04#^P  0S/  00P0S/  0P0  @0/S000 0DPpR0 f'|g'g'""0A-j40@TPp 00S 00S0 00/S @Tt0oPL0D0S sP040 f'|g'g'x2A-0@SP' 0`.S0.S0S/S 0Z;P 0 Q CR S.R  S.R0S/S S 10S410S 6P:4 CSR ! xQ`V 0/S0S.00 p] 00C0V00 `V._ XP:$0BRSR;  IP C 0C0 0B 0 B "0꬜%A-Q@pW :@ bdpPaV 0 R 0Sn0PP1 i g'=$:$Z$A-@P PU `0SoP- #U \U0#S@e`P@  @  =@K`dpPaV 0 R 0Sm0PP1  g'=}$$$A-`P 0S4 |/PP00p0 X+m@P U 0S800V0S KP 000WS 0SP <P7 ` /0H PW,Xp C !.XQ  PE R cR CR MR000mR000 o0    P00 \ oD0 R @ @@ @$8%%%%%a%%g'0G-@T pPaV@ U@ m@P La @T SR0p 0`@g'=&@-<@0S $nP= g' 3&O-1MX@ $PR4 84S00 {040 < 0`[ @ 0SY $P ^ 0@0T l@P qP  0000Anx Ѝ d  k$0R  0CS $00 0nng' ^& 0A-@T:8$R4 CSR [xc4!AT0WV0 $P ^  @S0nAng' X0A-@T`D'L@PU pPnnUTg'p@-@0S&>mPz @px x0 S0\P0P0p@04  `@g'G|&,g'&(g'$&@-<@ 0S $mP B g'&@-<@0S $lP- g'= '  @-o`O-aM0Sq K0p40S W00 $p p0PP0 0+ P UY   0Q  zPPD 0 ZY00W00S kP5 0 " 00 RQ3 0S0 Q0P QP GP `0 ckP 0 `0 $`040,  Ѝ "g'='x'@-<@0S $QlPg'='C-d`M0S PHp0@T " !(@PUЍg'O-`0-X@D%   pPZ 0 Q PQP (0S0j@P  P p `(A(mO0g'='A-0@T `pP1AT  RQ( QP (0@ 00llg'=/@-`0M0PSpM 0/S nPP ۍЍ(j@P  pT ۍЍ@l@P 0$`0$!#!0 00 @ Hf'(/(g'A-P`@p娀TЍ000S$0S  00 0 00! !B<00S yll@g'Lg'$|$x$7@-@@Q@0A@P!!0\S q  10@ Ѝ0 @G-鴑M@T- `P!ApT |0S! @T i@PO 0L0 0QB [P4]" 0`! Aލ00!!QP z { %P m   P] $ 0\0 YD ZkQ(  g'G$`(x((((1G- `V@0P XpY  i@P) FP! @P AZ 6@P`0P k(P< kk@g'()9)d0A- @T`pH PATP @g'Qqp@-@@,C\P \0@@ \ @0@@0@ 000@@@S:Q0^ACBSB 3b 30`0pp P <  - R0 R:00R:/A-0A Rh1\pP.@0MTaMQ 0  C0/S' 0 ! j .P3ڍЍ *\0@C ?\0@C ಀ 0pC00C 0 0 j P 0` Tj P 04 $wj ꬜%`) h)s))p@-`0Sp@e\ 1e #F@ BPj000p 0@-) [00S  /g'0-p00@^SQ 0Q00Pg' Qp@-!0PS   pPd @t Lm @@T@p00@ $)@-P`p@P  P 0|Eh0` l@ Ѝ0 0P 0AQ$ 0 )9p$)%*S*g'A-`PPЍ8":0J840K0CS 2  `40 01 +  d] (lV <tQ @ |qp}  A=/ 0$  4 -BL2P " 1P* 0(5P/S00*040(84K0@SKP 0 040q;;00004(4 :(40/S04084(49(p k$g' g'C-j@EM0@S(yyzdzHz(z8zHzHz30S EߍJ(eJ(J(J(!L 0\ ` @ 3 30IQJ(t S7000-00 s++  10>L  Rp0<x P J;p0@ P J01  = 0tpP Jx<刲@TYE   vaXM  oa} 0 OpP J} ^P yP$PP P IP 0$p pt s0cR `^Pg'-,,(-0- ZT8-A-J-Th-Xf'l-r-0@-PMM@ ` =X X 0P  U+@0  $ $ ,  ݍЍ0$ g'p@-@ PP hp@*y-A-0p-S0S) ePP%f 0NЍ0` S0 BP$@P,0U ᄏP` -0%--@-0@P   wЍ@Ѝ/g'p@-@ATp@0 R P3P ` `zP`pg'-P@- 00|0 x0 t000 h@0S XK400L0L <oe ,Uw$ =4 Ѝ@ Ѝ/$g'`g'g'g'%4g'p@-xU@PlEhPP X>P p U000S  p- g'g'- -P7@- 000@ 0 000 P0S x300l0l he XvTfD 8 e0 3 Ѝ0@Ѝ/$g'`g'g'g'%4g'%؊@-#~ db-%@-M@P" 0/SJ-P|E-P Vp \Vp 0RP 0RP @ލ<- #V 000/g'@-} dbb-%@-q`@,MT xxdpAPD00CS0@៎@@a Pp= @Y@DOoB0S@,Ѝ0P: S 2VP C0S b` Q 2! P000n@ 0At@ T]d0 @00CS0T0 g'$.%0%2. i.O-PQAMR @ <R =R @ |R@ 0&S@ 0=S@y  0+S'@p 0-S(@i )e&c#a@ ^꬜%h'j4h'h'm;h';0@- h';0s@-0P`0V0`0@S P 0R@P@b  P@Z0S00S R0ST P000 R  Ѝph't'`$<+j4<@-L ^Pt<hxРxTL @@~$ \1#P?  B 0b0?  b0 0RQQQP0R0R0P0QPQP !7<C<T<O-`ps딀P @%RA &R X*5! 1[00   PP@@ Ѝh'a<p@- 8M@ T` 0  P@8Ѝp @P R 0 0 0PS@V P @0 F1P@$ P@^ PTh'p@-@P0)Sph'O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP   !,Ѝ'0DSYA `@V@@P'0ISV'Y  ` `D A^ S! wz! q0  0@@P! d0  @P[VR'T  `@P, @ ^  h'<o<}<O-p`M8P젟찟8!@ 40 X@0DS '00S^^* PU @ 0 U 0DS00SY Ѝ` pUU h'.C-`p  0BS00@SP! @ 00 TQP@@ Ѝh'G-`dP0@S! p0 000PP@h'@-@$MP 1`PLF0P  IR NRpp 70PPEP@@0@S ( &1$Ѝh'<PG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 Pw1u1Sp0@p0PH0P@ 0,O0^1P$X$o't'@P/- 0/SSS00h'@-@PMލ0/S XOp Op 0RP 0RPVp@-`\0@sP 0D0p@I0H0f0"SP Vp_^qh'<p@-T` RpH0@Q 8 PP /pp@h'$<O-pW,S 0S)P \ C000000000CS020S @T  R RS/Xh2hb0d00@/SpG/pHHDPR0S 0/p0CS0p@0@ppW000000pA0P00 t\00l/ Q tQ00CS0P10S 00CS00W0@0 pR0S/S0@D00K0@0W0 P  R*0000t/S0S  P 00CS0p@(0@pK0S 00CS000@0@00h'i'h'<<P$o'X$ VA-`p00@0MP 00CS000S @ 0P0CS0X00S 1X @06 R0S U$0$pN%i'h'`$h'iG-p2B`Mr6&0@T":R@P$ 0SM .S00.S0 00/SSC10  PPB| ePpZ% ``VT$PP@ ` .` E0EWW@`0-S0S0@T@@QP.MP0: SVP >PЍ`$<q'<0=h'<<V=@-5$0Q @ yP @h'<$=p@-L@Q50P000S LTPP 0S{s@@L 101M00CS00 L 0 L0p@m\Rq'O=h'c=l$=G-pPp@R` V101 BPp ;Pp `R\TQ @0Ti \0DsQS񟗀Dضضضض@ضضضضضضضضضضضضضȶ@00CS00 EL 0@ 0 @T0S 00CS00 .L 0 0SX00CS00 L 0 K 1% 01 @0Q  0BPA0@D@@@ @ @ @ @ @\@l$a=A-@ ` PR 0R 0S SKp0S0 R 9L0S  2LU  LT'L|[ x!Ls Td@00CS00 K 0 AKT$h'@i'p$h$ @-0Sq ᆣh'@-@(0Q Lh'@-x0@T   @@@@ @J@00S 4060S ÷Ѝh'o'`$-$0@- R    Hi'-@-   0p@-Hi'-@-0@0 H@-@  =@-@-   3@-@--@-00 " ЍЍ/@-@ Ѝ@-@-  ЍЍ/ L 0S0 @-4 4fK,S0 / /=i'0/i'p@-@JPPPP  Jp` J`P Ip` J`ps@-P30P d0d`6 N |0X0@T PuLD0 0@ M@Ѝpq'`$B i' 0    /i'@-@TЍ0Ѝ0CS4@  000 P 0 3@ 00 0@-@M PU PP 0Yp $+P   PPP 0Jp 8 0  Ѝ0 X0 0i'$Q$@-@P 0S0S {3P 00 0 ЍPP D *Vx0$`W U ^0S W 2P 0`S)Ѝt'D$`$i'P8PG-P* `0@00 0R0Cp0W S `S0p 00 PA*?*S p0@:)PD0(00$.* 0$ 0$/P$X$o'i'A-P`@耟0p00}^0S 0S 0S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R SR 0$`S Si'`$O-P࡟$M^`AV $`")pWS0嬱p0p0✁0WY 0S, |1c2GlG G00CS00 oG 0= H00CS00 ]G 0 ?G  J ^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 ($Ѝ`$i't'h$v'AC-@$M p䀟( 0 0`@T+ 0S0 PU@ 000cP 0t 0 SP0 0U$0 @ R^PU $0($ЍP0t'i'`$G-P$Eo@p0婒S' 0S$ 1a11"G GZ/GUG00CS00 F 0 FtaU000 N&PE U04q$0! @#$  A BPP00CS000S .@00CS000S U0S0S<0<0>1FDFG0 p:%0P 000S D<D0 p000CS0(00S ''$Ѝ`$i'v?h'C-@?mM0$08@P0?_0 0x?0,@0X@ &d@`PჀ 0D0h0 0@Th0p@ 0o lP 0p@T 00.P0p ,00d0S,_&d0(S( 0L0>60S t>0S,0S(00L0, (01C(0L>0S,0S pl@,nT@(|X P07S 7S6 =0S7 00SB -0 008 04000$0 0t00P t=&0S(7S% 00S 0 0SL= @  =, Dp@ P 8 = gJ@ = <, R , W4 0 Q$P$00$0<<0S V0 0`@G=.P  @J, 0 , R(0T@= < |;J/DlPUdPkUH 0k PUX00CS00 ND 0 ;/DCT 00CS00 8D 0@@`P ~E00CS00  D 0@kE @PT 00CS00 D 0@UE @P `?P @P078:0P ᬷPP@PP: RX00X0, (0P0S `-V`-V P0E0R9pPP, \ B, ( 1(0 P,0SX0077S 0Cs0S0)SS ?70s0S@P$0 Q AqQ0(0S000$0S  8 @  000000H0800<0,8D0800T0`@P8 7P 00Rl 00 =,0SX0077WSlG(0'000(000 7 0'0'0$0,(07( 10103/$8 $7 DP7P' 7H' BT0S H@ 6 6 H RM < 0 $ H $B믾&00CS0 R60S P 60S&,0CS6p6$6` l8 I54,00 $0$00$0E400 U"0E$000SJ4}$ x5 50S R@5,0S tBx90%0850S @ 0 @$0 ?PLE\`<0 0<0,0 0C0(000D0004 @`N00CS0p40S qP% 40S$)\0S`N+H@ 48 3  3 3f4D )0093 8 0S '0R\#CX#0LClH00S0ڨZM$0 #0C0000eNG@ 3TC  2 2 (08 02 \0S"00CS0 l2 R   $0L2L0S#mߍi9H20S 08"SS2 @0@ T0P@H020H0H0S 1 H0S2 1$ H0S  t1H0s1 R#$0S1   B H0S H0S7SH!D 0 10S 29@,0S 0  T;,0Sl@Q sC0,0(0P 0D@T00St0 x0@40 0)L3Eq ER~   0wDi'@- P@MRq\01p000 Q`!pWZU x@?U `?T?U<@ 04AS 00CS00 w? 0* 00CS00 g? 0 ЍU ??U P000oJ00CS0L00S <??0,P00š0 z0S v0S r000y#   P@ P @cP< R R R 0S 0   # R00 m P B0000S - Q p" R[0 RL"00p@0  Pp[ X 2@z 0=0p0ЍQ 0S/Q0S[q "P  P x"PӸ R ϸ R ˸ (=P0 Q<Q 7 噴0@D[ P Q  pP@0000S R  p  BR 9D R5 w3 s00G 00CS000S WЍ0i'`$h'@-aP 0SGO-`-pP@pM$P0cS    @TpP` vPP VP@ G RrYcS" :U;ܢ[FP VP  R񟗆 0R PU`D;%U 4; P& ;;[ 00S A00CS00 ;; 0 0@ T Ѝ;/PVd!     [ZU!Z;;;PUy;U~JU U UU<;0 f@000@@@q'i@AX1#A8AFAl$VA0@ Ѝi'@-Qp@0` 0S*00DP@`哰P@0`SP Ѝ `P0@P0`S@0S0O-@p [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR3@P0P/P 0S xpPS@ R0B$x r RP R  \$Ѝ$6PX:$P 0U0/Sl 00EpP $0S/00E0S``0` xqQP /000S вV/00D x0s0SR00Q: 0 R @?(0P . B/o.Q" R  0P V 0 ?$i'VPh'0 q Q0@-0 @QC\0CC/x~^ࠑQ@ Q 0 A-@QaT0S 0@ @@?S*S  [S R 0 p00$0S٬ P $$$C0$000CS0L00S 0S 0P 0i'i'h'p@-@ PTp 0@ @@i'G-p @0s0 ST@D0P ̀`V b`RxpP VP V V@ S`` S =RR QU  =0P @j40G-p@ Mo oF0P \8a000e U00SW-00E@`PIPE@T Ѝ00CS0@o'O- R@@0`-SPM S! C R444444x44d?So @Sy 00C Sh)0 0 .*`!0S\ 00S=SWV70 Rڬ7 RN0aF1@ 000U00S pgpWpG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P6솟p覟ԖW@A0S 0f0CS00  P6FBЍx6P6l6_0000Q00S 6 pR&V(0S 0 0S/0e0CS00 w 00CS00 v 0S 0|e0CS0]0 00w0000v00e: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000v3г 030`3 R L 0ppUppW~|0m R  R9 V} WHs 83 BR  BR j ~  B Rs `2 BR  BR  ~  BR   f ~ `   0S q QAQAQ   Q50  ' ~ AQUd Ra 4q B R `V~paQ 00S T 0s0 S00CS0 0 p00CS0 0 00 00~00O 0  00400p 0  00q'q'n6o'i'00`$o'4i'L$Pv'$O--$M000 06 0=``-dVdp0  P600`G6 @ V 0@P 00@S0(00 60P@   R@@0% T A*% R *R@R Z  JRG xA@TZ   + V? [7 0  BR & [0CSV0F V``f` Z74 00BC0A000000S1 0@80,  [0  0+ Z R CR 0S0[0F0[0 0@S30S 0@0 00J S񟗸"p!(!`"`"|!|!|!|!!`3 BR  BR  ~  BR  ~  K R  BR ~0 0  BR ~0 0 ,Rw[B0 mT@ 000ST @Z$ЍT TL aQ00CS0)0 儁000I0 : P 0C A 000 1 1 0AN0000T0 0:LP 0 00@[@R p R0 Rp Rp B\T   R0Sj4i'o'u'X$`$Aq'n6O-0M  P0 4400̴̔0@ 0~Q  0 pd匤0@Q Q#:Q =Q Q Q     BR  HP AA  p A P񟗁d'$'''$$&|%%X 0S@ЍQ Q@Q =R 0p(0  BR  pw w p    BR  u  q u  BR   ` ( R  0BQRQ B  X  BR  v p}< v 0Sq Q AQ~@AQ  RX ~     ?@@ M  7@P)  ~R&=Q0S! 00   @Pv'$i'X$o't'G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S000`0`0CS0!0 0@p   0   0  R 0r00j 0p `$i'X$o'P$t'i' @-0l@TX$O-XAX`0$M`F:0PEPE000PCP$Ѝ0000i'X$o't'O- aXP q0@ 0 R    0X00P X 20P E00C0 Ѝ0S L H.$008  @D0000D Ri'\$o'X$p$iA0AO-@ 쒟rP0  DR40:0 R`| R    0T0d2P`8 T_ T@-@FT+: fPR0CZU * TR Q  S0D2@ LP80Z0Y0S@@T: Ѝ@FT: 6P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C0`FT000@ D00C0CS0 000000C00000000\$i'o'X$C-PpM@`᠐ 0嘀00000p000CS00 p0@ @5Ѝ00pi'X$o'P$A-Pp@-A00CS00 V- 0 ` V-00CS00 ?- 0 ` V笤`-00CS00 "- 0` l$o@-A@-A00S/ R$T0QH0 0Scq o/P0//i'$0    B /i'A-P夀0@000p `R$  0 `0T @ `  0 0C  S000SAFi'$i'h'0A-P` @0p0W0 "P 0X S S0 000 00 0h0 $P   00T :00CS0 00SA $i'D$i'h'A-4b4B0 Qcr 0S U,S,r0S@0PP0/+P2b000r0Sc00CS00  ާ0S 0X֧0#S +P  y+P, 0 00P0 P   PERP S   BR 00E0CS0000`0L00S R,80+`Q$i'T$p$B`$h$@-L@00CS00  [p00CS0@Ri'@-T T@08     00000 0$00i'$A-P`@000# *V |`0Pږ#p0PS  D0  0000CS0 00SAi'@2$i'h'@-4ap00MP0*@P 1,P(0: S$0  0  *P  pP*0 000 *d#T*L00CS0,00S Ѝi'5BCBHBeBBh'A-h@Q0P0`0 PHpP唢<0`00CS000SAi'i'$h'p@-`P@00P0"P 39 0S00,90X 0000CS0p$00Spp@h$$i'i'h'0/$p@-@,`,P0SpSTpu$j'Bp@-P@0Sp$j'p@-@Pp P0Ppإ"0@p$ 0 R/$ @-@0@1^ P   U`p W Q Q 00 r B"Q q A,PU 0  0 Dn'5rO$A-R0S20SP`AR p N")pp/PpW* 1N )p !""3P ) 0P x&&&) qP )p9  3p,9 ) P )p9  w3p9 !00g&d&a&`Dn'o'$-B`$;o'BC0S/p@-@PP1PDHAsP0a 0(00R 0S"0D@]05#0s  0C?o2^0SPxp3P ^9CP p0S *00CS0p\00Spp@ Ao PQPDn'(C5rOi'hCOCh'p@-@\P0P00 7@00CS0p00Spp@i'h'O-@`TM R0 TЍO)ؐY. PPY   p0 SPs   0S0P0S PP PQ 00SЀ0S@TЍ0S{22 F!0R+  p  !R -  "z)jp 00X" n) ^p0 sR ,*30Rp) 00CS0(0p W )e Z 00CS0(0 00CS0(0 | 00CS0(0  Ѐ YZ}(000w ) #40  ) )P S#4sH8  0 0p@ gp  (Jzp0㓉(ЀHp0&Dn'$5rOCCC-CCCC@- 0 SS0C 0.^\Q0 p@  C/o "P R pO-PP10 0%SX P 0@S"!Q@ C$0S 0S  R-S +S %S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  P T"@` F Po P I \0@00SJ R Q !" R @$CCDn'CCG-$a$|0S Qq0l0@S/ @ 'А㼠0Sʰ00CS00 b' 0 (0 R  0 S !'Dn'q'5rODD2DCl$A-pP`A$P00Sʄ10P 0S hjPp pPP gP`W@ P$1@@A'PV QPU, 00SJ s'0 l'`00CS0 &0S 0 0 00S0 S 0 0`$p$:D>Dq'fDDn'5rOD& l$40@-@T  nP@@dDn'C8 P  /Q 0SZ//Dn'G-Qp0SPS@00SoZaP000M: 0@C$ @p U0Q000CS0\10S Da000<>,10S0000000W@00CS000S 0S @`VZ00萠i@ ᘚ0 Zp4@Ꙃ! P00B R @Dn'i'h'`$@-`!@S1p@!P \$Tx1@WV2 h1N0SP U 0S0&%V $1w/p5!j"g"060S% `"]"Z"Vo$l$U 0S P %`%P PPnWT  0  ЍVo'h'n'Dn'`$$C5B08 N R S  0S  P L`$O-pR0M|B0P p` 0S0S ЍP$$0P000@0 0#T):U 0S0 10S  160S  0UGE RE C100CS0l10S 0S 0 2"  \ P 0Q R0 @|. \ ~ Lo ^ \ Q  P 000 QPW@~ Lo ^ \ 0dt'i'Dn'o'`$h$h' G-pPJ@P DP1N0St `].@%T @%J.p]4 n`㜠@0S0S 0S0S<`@Y 0 X 000 F`$$jCDn'A-@Py P PT0Q 0S aUlP@ pP@ ZP@TU|06 R0S@@Q`` 0pG  0 0 SkDq'`$l$O-@Sc$M2 PT  %P )P lnQ pQT P@<X Y(300S P P$Ѝ0PQZ`pP00S XP p㴲jY  \   0`P 0S00Y 0STP i'$260Sh0`00\  \ 0?o2? TW E'\0#Q 0 !X R6  p"P0S 0S00 0 RZP S  R 040TpP/o" R 0 S0C0 N1 p0SYX X YPPVDr'DDDDn'q' `$p@-@"``Q000 R 0S <1,p ՞3!0S 0 00D1  S  Bo00P0R p` R\ p`` R00 㶏0S00CS0000S pi'$DCDn'5rOh'D1@-Q80@S U#P`q0SP00CS00 " 0 $0@,p T2.e!+#PpP000T00CS0@00S ' ЍDn'DDCl$$Ci'h'@-w @ 00q'@-@ l @p@-`@0 0 p 0Qp\ PU"00pDn'DO- 0@LbLPDDDr0U0S  U"0PE0P ЍS S =S\ 'S " C 0CS8^^]X_^^^^^$0!PU0 R$ \S0 \0 0S0 @ P   0@ P0#P"0!0 P  0  @}00 S$0)0 !"0T 0@ 1 }SP0  :0@"00  Dn'EDD $EDbM EGEA-@dcdsdMTZ 0SW0S`ba``Pa``paaaa bccxbbbD`bbbbbbb`` R0S  "%#00CS 0S2h"!\@H<80@P bU0SЍ0S PЍA 0S  ztp|xt hdT0La8 Pd Pa P^ P[ PX PU @,Dn'  EPeE#E(E-E0EI?wG4E8E@EHETEMEA#ZE}WdE`EhEmEEE.OEExE(@p@-@P@`TpUPU 0S G@ p@-Pt`t0PP6 R@N0S@2@@0S. @D0    p 0 pDn'`$A-0P@`Tp R@ 0N@T P 0S@@H W\0HU 000000V0@ o'`$$@-@ Ap P0  Ѝ@ԛ00Ѝ~EO-P 0qM00S 1a б100 0000 S  @PЍ0SG 0 RS/Q  C P 0(ͱ0Q0000X00S) R@ PP0S:SU@!00S-@p*+ @00CS00  0 ( `0SH0 @ 00hn'u'pn'0u'Di'EP$o'Eh$X$A-M`&P8q8A0S S60V0C?o20S 1Uk0^0! 0P!1U00V0S^0SP60S .0S PP PЍP ^X8 0P0C?o20dt'`$h$p$D$EXn'0S/p@-P000w@P00CS000S TpP@T` `@V0`0T0@0u0S V00T00p@i'h'`$p@-l@0P00<P E00CS0 Rp@00S ti'5Bh'p@-P@cPUrhp@-*PE@-+,PyE@-?@)ЍA-@0PS`~Up~0000 p 000CS0h00S )0p00000PC0P0CS000S P$i'h'P @-(f 00C00/FP$00  0 00   /P$o'p@-@tPt`0000S0 000D0 00CS0p,00Spp@00~,i'P$o'h'@-D@ 00040 00CS000S@i'o'h'G-qA0@0000I?o2 V0SPkPP) 00=0 000E000PS V 00CS0l00SG} E P 0(` ?0`PPi'P$o'h'T 000@0A00CS0/00S/Ni'P$h'p@-PPP`@ P T @D{@p00C0C0pP$o'p@-(P(`@@Dw00C0pP$o'( A00C 00 0C0/P$o'-A-@P(MHp@`DpPVP u (T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@'0 P Ɣp FO--@ 0,M t T@0*`P3P0S pV@ rV00 dV000T P x!3P  l#llC p CP w0\Q"\Sr 0S!4Pi R Q X BR (  "p JQO Q   嗇P h咇P W p P|X  BR    lP  BR 0@! P R   0 00 l1  `TApW    p AqJ0 0Z*0S   @P+,Ѝ  P oXPJ Wp X <  BR 5  0)Fr'q'/FQP$X$o'0A-PB`Pk̂000p00CS020S 20@T[UU  r0@0w 00 C@@x 00 C@0@0  0Dr000w  B0x  B0 00 Cr0P 0w 00 CPx 00 CP0P0t0E 0J`A01 H#`ЍP(8 1 000 0 0A^Z0@ 0QS$ 000{MPP Mp)00CS0H00S UXH+ <,G@ i'h'q'jFl$FzF%FFFO-f@ PTsMP`P=@s0SB030@TCUP3Y   0 貟@ ytfX   X 0SB01 x`ЍSVP aV HVP@ 0S,Y0S UPP;  p 0/S9S W:r)00CpßS 㠇P 0 y' : pt*L 0 ዇ @0(FqpT0  p SpPN{*0S{v0vSp pw{ti 0 P 0P _F0q':GGl$GGF +GGVGPGoGn'G BR00/0S0/@0S/ R /0@-00@00C S f RR R1\0* ЍHH000C S0S//QX0 0@- ^ @P U@R000/`$p@-`@`P6N0Spv@Tp~@ P p@ `$n'D+l1HG-pP@R`Q7 @O`r0S 0 d `V@A00CS00  0 @aq匁 Q  R  A@TPP,aHqH0 R R +@TP@00CS00  0 Q MP @1@ST@Q@`Q :PGB`V0 8%`$5HHMHnl$HYTH^HH{HeHmH 00\#P0@-`$HH0S/p@-@PPEPp@''A-@1Sc`p@DPU 0@P00` P_q'G-@P0LaL00 Rp-Q Q8 -Q R8 P+Q, 00P T00T 0P 0T0cP0 oP0S TPT40@@T0SGq'q'HH`$A-P B00`0QՖ 0S 00S0S006X pW㈇P ᄇP6p60S0S60F N0 B/oS60"N00S R 0 0-S0F0 1 Q0CSRC0SQ 0S! P0   000S 0 0^0 PA. R   R0 0q'`$H@i'PG- @@P0S`p0C 0 XZ0OA0C R 0 0CS0@00S 0S D&Hq'Hi'h'P0 @-\@000D00S 00CS000S oi'q'h'000C S/ @-z P 0 q'G-0p RP 0S6Q 0S!0@ C?`B10 !7,h``@ ``0i `` -R \ -Q0S 0`@T0:SE 0R@/T/:Y  @`/@T0:S   @` @? `0 :\00Y00  T@0 CB!0 4$@ Ѝ IHHHp$P@-HD0P  Q 000CH ЍIq'q'!@-$0S Q,0S-\\ -\\ P0 ^:P0S0\HP^0@:T($q'RI?Ip@-H@HP080Sp0u`0CS0` 800C80D$o' 0R @-@T $0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @D$ 0S/xqQS  0s0 S/00 00 0S/00/j404 00 0=S0/S 00j40 0@-0D$Jp@-`R`@PP t0 0Ppd0 Pp0-S0S0 0pV ($00080@pn'n'&JD$O-RM0p0p R pl"l2lb @d 0SXy XR00CS0`2`@@20@0@Ѝ\Y7R @@ P*  BR @@000p 0 S B Ry @@ Y000p  B Y Y  YR  Q P Pp P  Q  R P000<00 { h Km$0P$X$o'D$0-0@ P RLM00庌 P0l l "ⱌU0L 0T<0< A 001 0 D$4JLJuJ0JgJ@-@$M 0T 0P0Sp`@T*vpPT @TW"PLP @0 LP $Ѝ@P$X$r'JJl000S p@-XP@T T D0T@p8040@p 0/D$X,UP0>P0 |P000P$@: 0ЍP0 ,  0P% 0&P00 0<P_ >P &P000p0p0((0 @ -P 0(0  p 00 HD$$p7o'P$i'i'&KKIK`KxKKKKn'n'X$%r'j4K1X$Kr8n6l5 {P B@ < } p l {S  D  B p/#P0p*}P0$  @@   ? }P0 O0 p 0H$  @ Ip0H! , s@ BR #@kx!0  = BR@ Ĥ0S@0Wj%S` :S/ #S0[ 0 p?0C Q s@ BR @;W0 0 @ R*  B 0)0;F"p0ᜲ wP H02!R1S p0HS2@p0 pXp| !0X2 ` !p,!!k00S Go}S㫲[| p'P023Q w0 00"0 `!a$0 0 @ B "  0$2  `!G-`̠̀0@T@@0PU @ 0S 0 0  B/o"M`0p 0S 0 X 0 0 0,D$p7@-0P0@-2_M0$ 0 K< 100100e1x0000dPI@1x 1Q @<00 dq 0S $Q. 4QG Q (0  400,8  (\000 0 0 0 0 0 S00_ߍ0  p0 `0 H0 D0 H00ScS,0 0h'`$h'D$p7X$h'L G-Vp0 00 P" 000P600ظ0000000l0$00p@]P 0 R 0`     z0@0S 0 00' P0, RPZ 000@ 00 00 R, R弃P4 C00300 0000    BR   00p` P 0000 CR Sn 0 P P`  ``zs 0 0008 @0C 0 H00;`0 SpeP \0 R   L000`0S0 R Ӻ0 0P 0 R000& 0  qP 0@S P 000d `@` 0P00`O P0 000000S$ T 0S ~0@000@00S0P0S0S 000@Ѝ0$00pXD$.LH$`$A-Q@`Q` @ p0 P0 0X@p 0P R$@@`.R ( W% R"pm0 `4 mP +/t`P 0 08 00C0%04`Ѝ Q  0Sg0 00 00 @ 0D$$DLcL A-P@0 P. 000`P p@``@@{P 0`0 U000 PPe``0SU +PD$`$uLp@-@|PP 0 @OP P 00000Sp ppD$L P/0S/80 P/0S Q/0Lr'p@-@ `P>00`Pp@-`1 P巽} PP  NЍp @PCYuVuSuPu Mu   v? 0P/Lr'RQ%mPp@-@ P P X` fpdMA-P`@XpT@Q00C0V P@Lr'p@-X@X`0P000000CS0p00Spp@i'Lr'h'p@-PH0@TpU@`V P`Lr'@-@h 0 S000C T DP ,03O@dA T @0@@P$gfffLr'p@-`@0 Sڌ S  |PPT p0S 0 S hP곃0S Lr'n'p@-P @80Pp @  0pLr'@0@-@ P  Q 5@K0Lr' 0 P/ R/Lr'C-@sP0 U00000@0CMS񟗧 P` @P @2@[ּ  kV  Uh20S T h`H"H@P(2V0S' `p@" Qp%P!P 1 嗼 0: S00`x!`h!x `V'qP4P % 04 V U0S00  vP ނ  000CS000S Ѝ @{ tT  NP`o 0Xi'Hi'-`$ M }Mh'Mp@-@PPP U0p  x壻;p`U 0pU y 005MMpO-`PppW@p  40Ù`ȐȠȰ0S UT  "O   0@  U   T 0S@@ `U l$c1]q]UNp@-P  @pp R  pp pp pp   ppLr'$Np@-@PpD0 0RPPp03/PpLr'O-@M0 @ 000Pp`@A _`2@ 儲|U  0Sp"p2 0Sd2X" Ѝ@0SD2 R@00CS 0SP P  峺KPmP pT E0SR PMt0000 S|L1 0R  p)j B R$ c `  P T0S  P  E0SP 00CS0X00S $T0 0 0P_Lr'n'$l$h$n'sMi'vMh'O-`0@D#DSM@@s` `00 fp 0V 0@D<TRG 0p0sS vS  V`p0+S -S  P| ሢQx PR: xP    PT 0 K@0SA0cЍVW p p01      r  %5S <p $ 0.p0x 剹Y0 !pW hP00S0S=|P0ST00ShjT00 D T?,$%xN\?,]n'n'LN}N1Ol$NNNOA-PQU 00CSQHq1QL R@ 0r`0CS00 `01L00<S0S  0qL0S 0CS>S0SSxd R 00CS0K0 - 1  'Op@-@0TP R R R& 1S# 0 PpR!Q QT " "D0600S0T0S 00S0\r'i'h'`$@-0P00 4P0   ЍjO ht'QA-@ 00CS00 P `ppp C?U U P@U00CS00 `A-@`ptPt@0000S 00S p`V@40`00CS000SA$i'`r'\r'h'L0P  A?Q Q R:///\r'@- b@0pSM10S 0SPP10S WUT T TP160SPPP0SP1N0SPPTP `16 R4T! R00SPP0Q7 op0 0S" UEoop$ W`RU30@D>T000 0~00 7 Pt0N R  DTR 60SЍQ Q2 1 @D@\r'o'`$q'PO-P@p {P `{P {P 0PEpSUpUX@@&` PPx{`Ppl44j{PPEpU]X P$d$t$ 0E0 10ST@ T@P@UT @Pcs1 R 00ST|y@ TL@P@UT ,@,s,Q0S 00S iX@@T`X `Ȣ娲pGY P& P?U*X? X, 0Sl <20S pP@@0-S0S@UpP PP '2PP1 ~` a0S\  0E T0 S R0T00 #@1 R  U@ ^00CS010S _Pz`PP@ᘀPq0S 000T 700CS0t00S 8@@T00` oOjOl$\r'lOPPei'i>Qh$PPh'G-PP ?p0@`吐 D0S 00S Eo0D0@000CS00S pW@UG\r'dr'i'h'p@-H@P02`S@20CSpmV02p\r',0T0SP/0S//\r'C-p@`1010r!Q0@S10C1 ЍqXPU X2ؿTP᷸S˿P 0S ο\r'4i'@ 0P/!!R /\r'p@-8P\2Sp@xur\Bp\r'0-MM 01`"R !R X"R   1 1d"1!d2S 0XPh10 0XP L!0000XP(10  P @T0dd`0P0 U @T 0S \P<00CS0 !!nl0 0$0(0,00D>S |00  K"!031\r'4i'h'i' 0@-`"d{\r'p@-L@ݧ'Pk PPp0B/U00pp2p@-T@TP0 0P0 0 0000CS0p00Spp@ƴi'T$h'A-p`@PU F0PPEU` XD{0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S esDP`0000 0C0t'i'h'p@-@P@0SH00Spp@00CS00  T$0T$0T$@-@PE Ѝ3P-@-   Ѝ Ѝ/-@- 0  ЍЍ/T$ -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`jP$ 0S! h6t0S00CS0>0 "  u00CS0/0 " 0S 圦pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU SPP 00CS00 ^Pp2T$0RT$@-@@T$@-0rSIcPP0G-@0 p0R(0帀P0=00Ci=`?i`F@V@p@DR000 S=S B`` R`ť` @G{PX$o'P$0@- 4@ 00C00 0 0- Ѝt'P0P P PR /0@-PP@^ ^ R0L00/j4A-鸀' 0S RV'p`@PU pWp0 \ 0S 0S   3/P@P00t'0SeA-@rP]uU p`pp0S'SSP@DAL'hPP(  EA PPPP A-P0`Sp@    3/@PP@X "W p0@=SPUP00 00CS00  0 00CS00 w 0 T h:l$]O-A0Sp 00P̀ 0`V S 0:d@PU* ЍY   R Q ʁ l <0aP`0 lt't'(u'@ 0R S=R/=R/A-Pp0S=SRpGp'uh0h`!0aU@`T 0S  APU``@t't'@-1`0@S @  PPV 0 `  K d倱  `C Ѝ@ @q   R <0 2/0`  0R , R  c0a00 0000@!L @UP U0 c00CS0\00S  ЍY0#L 00P P `$Pi't'h'@-@P= `&P pTpP spp0  BR = T  `\ Ѝ00@0P-\0GM000 0(TP00$0 0  Gߍh'p@-X@P0`Y @0U<# 0U`00 0p@t'QP+lD1H!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ]$Ѝq' Qq'@i'`$n'p@-@`TP000T 00CS0p,00Spp@A@i'h'7@-P@T@ PP0 P00p Ѝ0 xP 0 @?#00000 00P2t'QA-Pp` 0   0 @TPUA@ 0@00`t' @-:@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =e@@i'O-p@`0QrSP W 100S V'>nP pPW`0I?o2V0S Dp`VD10@T0  ЍOe @0P=S7 P( PW0 00 0  ¯`U 0 X  ЍU0 00 U 00S ,W DP,FPPPPq'Q>Q@-` pj@P@ Ѝ0  R@ PR000 00S x0000    0 @@DT@00S ֮i'0h'A-`pĀ@TP0U0  n ol0 R R   0 02/0 T00 0000t'@$`$A-p`P@P 0`0PPEPvT` eTp` fTxTp`X #@V Y@TQq'PP@- 刮 aYQC-ԑp000P0`-S㬁@TQ n@ 0@00`0CS0`10S 7 Ѝ @P=^dP 0 @0 0  0 00 000000  RP 00 00=S l0T 10=S010C0 PPPi't'@$`$h'  u'p@-@PTpw@p@-P@`P \NP@ xP@ IP@"P(P0 P pXQyQq'00@/ 0S0@/s@-@t0 0P`t0S t0"S U1r0!l%*0S`0T姭000 @0C?o2R0SЍpR%R@-M@ oP ލgP@D0 SQH0PP0@-M@ NP ލFP@D 0RPH0PP0@-M@ -P ލ%P0RP 0RPA-@`JP13@ 0SC PUA PPPpPJ! 0RA@- 0-RS# 0S0 00t Ѝ0SX0 0P0S00 040,pP$`34P4&RX30@-0P!S@M0SPЍ0P{ 0SxPUo U U fPo U P? PPEUR4DL,Tl|,,,,,  O  P  P  P  P  P  P P p0St00@hT @0(S0)S 00qop@-@`P(P} 0Sz00CStP ` p      ( < X     , pooppP ppP/`@+TV$@` VT`@V0`@ P0`@P0`@V0(Eb0S0!SPpp(S0)S0S pp@-@PoPPEoP.U)  L ` l  0op=Pp0 \0!S0P p(S0)S0S XpP)R3R@-妫0[hRh$@-$0$0 00 M@i'h$R@- @l R1P\0* UЍ SO-P@,MU0pE `-R lRF 8R -R| Ph&@P 2 000J @P &pe pGW` nPpW ````F %RX gPPx81pW3sR RP3pUP`/  RpE@@W1 000 ~PPP@U\|&p &P hԪdl㲪X1Dn@P %@P0S0Sp@oq  k Y0Q ͪ RP!|0*QPPq Rpu`  噪TT{w%` Pa_S>S$Sil$+RmnSS0@-DMo0   0@@DPU#@0 a    >P x, pp LdDЍ0=`P "kj'Dj'$, S$YID+l1HSTDp@-00S 0x 0t 0{l0l l@0   PU L@L0L D0D P pa Pph'i'j'r'D$Lr'$l$T$h$p$p@-@0@凶N 0 0@0PU@000k@0\ PB0S00CS0400S wp@j@C4i'L$Ln'`$i'tt'h'P/p@-@PTp000@p@-@PTdv'#T@-@P`qP \P@0 cS 0<0 Ѝ0S@00 #10#7Q00A\ @5/MS0-S@5/^S   4@^S@0?S0꬜%dv'0 0@i'Th$A-pjP@UP@H嗧0P0`E ,8Sj0`00@0dv'Txv'@- @R Q<<y 40 n"P0 lTTdv'l s@-0@T 00`m `SPUMЍpdv'T@-p0PU@` Ѝ 0'R"R0@@ `@0 0S @*00m @#h@`dv'T0O--tdP0`4P @1,M01%\P#p3PEAULPE@0鋟 s 00P@`V0 S 0S\V $SxS@00CS00  0$ P%V0%S@S00CS00  0`0*S>`0.S0@*S4@YH唦<`$@0xY0WY BYR +%Yv AY* X0I S%        p!$,%%p!p!p! %     %   % %  %E0IS0Q[  $0'S"S!Z 0S 900吪{[v& t  iTP W hP T! ^d\s00v t 0 | $% UU/UT%v'l$=dv'EU\\0LS $$##$##\#\#\#\#\#\#\#\#\#\#\#\#\##'\ \\ "\ 0 \M 0\? \-@ÕÅe0\fnrtvabXP \X P  \  uP\  xk!s v  t 0 0 嫘p{ X0 , 0v < L囘t  l哘0 R0 0D@000  B+ 1H 01 +t v0 t  tk0$@0$ [ 0t 0wNVBT,Ѝ3 h0C- 0`qMP` Pp @P 0 0p@PC 0p W ) PuY <YxhP0P( 0ES ZP G 00S00H l^YPH0?S0 -S00H0,Ѝ&TU8VZZZZZ[ P@-  99^[y[@-0@0 0 \XPX`Q < 7 0Ѝp@00  P[TU[[O-Mp: ZP0ԑԡԁ0 @P1 0S. =YPP00  Ec[pgP 00 \a8i[LgP 00 4gP D 0$00SЍl[gP 0 0o[gP 00 gP D 0(0 `Q 0 SgP00CS D0 0 0ShV[ [TUo[[[0K00M00P0D0 0C0D080;800,0/(#Q00<00,,8 8 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@Lg0@-0$ 0d8 Ѝ@-@4000@-@4000@-@(0(S00 040,0Ѝ`t p@-@PPJzyjz8hz<fz@dzHPD\``zU\z\Zz`, 8`V0,0pL@-@4妜80,0@-@4圜80,0&j @-8@bʻ( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8@0<<@00,0@-$ P 8 Ѝt[@-P7nt [@-P7ot \p@-0MP`0@-S00(00P0 0  P0P  (Q\   R4 0F03/Ѝp$,lV\ZA-Pp`@Q`-VPQGfP 000 0 `:fP-V 000p0p@- P@@0P ,pT 80$P< D0TP$ <0<PptWhX YZp@-$@P0S H00Ppv'7@-l@PU X{ Ѝ0dHP0p(mi0v'}lQ+ 00CS0@-  M0| 0-0 0BQq0^@Q ^ 40 ? 0 C  / / v'v'ZO-M`pA  Q TP XP tPW ` PU  PDoT<†pS Z Y X W@  U PCT<p S @[  Z Y XW   PT7pP  X W P T;%S( < S. &S)  S$ 6 CTy"  W(  * /49>T`P($F$V0S:ЍhJS@ThZTcYT^XTY5CTT5CTOTLp5CTGX5@CTB@5 CT=(5 CT8U@T44CT/4CT*4CT%4CxT 4 Cq$ B 0hT 0S`\`TP4@CYT84CRT[KT 4 CDTZ=TY6T1TW*T3C#T3CTx3CTXPL T@3CTW$ TW@T W@S@ S2 CTWT2 CTx2 CT`2CTH2CT02C  0 d 0 @PpЁ0SU #t!T   Q  0녑0t  P UtP p?^_^u^^^^^]^\]^TU^P^\\\\\\\\]]]]"]+]6]>]F]N]V]b]\k]s]r]z]]]]]]]]]]]]]]]]]]]]]]]]\\\^^^^^&^/^7^^@-b 5^%@-,0, P 0 0 %v'Sm?_%X_s@-@`e000 #S@APe0S  0A400S 0 14Ѝp_0S/#Sp@-@,P$p~0P 00pv'Smb@-PRP@ p` p 0R" Ѝe0"S0SO 00SS  00@O꬜%p@-d@P0S 0S 0SS 888 U   S$Ppv'Bqhg @-@Qx3 lbP  X0    P      Ѝ@ @Ѝ`gv'0@-@PPM 0SLD00Ѝ000 0qP0 0 gw'gO-Pp`llM 0S ;$ , P 0S 6ߍP/1 Q 0S b@s?0   P P@ P@0ST WpU: 0S  P= 09/PV/` 0 `v'ggUh%h@-d0S S S8 4 ЍS$ ЍhhEhi0/7@-lP$ R\2;@ H$0S p (2 2 Ѝ0v'Ni|'tiip@-@P 0S D]0PS 0P0 - 0R0pi@-PD@D D`DpD0S#00m cii%@-TWPL0 p@d0"S2Ѝiv'i@-TWPL0 qp@d0"Sp2Ѝjv'*j@-@PPM 0Sk00*`/`0 6P$ /Qp0` `0 0&PT 0`2# 0 0P!00 00Ѝ gw'v'IjC-@0M  R2!<#( xd, lT0 `D8 T44 H$#4R0" ,$"4S "4S !4S !4S !P0S t!T0S XpLal匑P8W0 ]$ЍCS0S? a r 0 w 0 r0US- !S 13 e0U SS0C SHHHHHHHHHHHS 0U  F0 lApPfj%`kjjjjjajjjjjjjjjjkkO-(Q ,@Q 0Qx^P Ѝ4QPTTPQ@N80S,00 80<0S#<0P@=PP@6P1 QB"=,`p㼑弡弱8W0aSq R  <0R P)0< S P0pS:`(_Q (_Q @P0S0 BS `a 0ph R R* \*a  `0(S0<k+k0  P," R,7 P 0 <`8#>0 /r Q* R 0`'jM P R 0 `!Rw j(  41S jD f/jAZ01P P%Di |'v''mNmVEW}}mWEVvmmm nx'%A-P@`,Pp5S$ Pv $0f0Q h/%R 0R00000( v'|'*nw'p@-0@P  P$p@P 0@- 0S, Pv'@-P  w'O-@-: PkCM M00 p*8P 8KP008Ȍ800SP : PP  \@00t 富0hS ]P,X <(X(0 0 $ P P:HHἂY9 0  $0P$0S $02 ]P,唙唩$ [ 0S$00 $ P$00  P$00  P$00$0 @ ]P丟$& $ :P($0S  S;ƑZ0;s 00 0P$ 1\  d@  Y= 0SX8 0 S(0(0 0G]P _) =]P  4] P00 $0fP$0S ++RP0  0$ t] P 00 $0KP$0T0 8 ] P 00 $0;P$0`0 \ P 00 $0+P$0X0 \ P 00 $0P$0\0 \P t\P 0 0$0 P$0d0 4\P  50 $0P$07 \ P 50 $0P$07 \ P @50 $0P$07 r |\ P 50 $0P$07o b @\ P 00 $0P$0x0_ R r\ P 00 $0P$0|0O B80 aHy0S0S _0Y: Y0 l*2 0TPSH )H 2 0S0> 0 0S @pCލ Ѝ30"0 00 00S D 0Z  RQ<0 (P04\  BB! Z 0S 0 0SO 0Cs RS,[Q,[QQ[Q,[QQ[QQQQ,[ 嗊 0 0 R0 00S 0 J0  d2000"0$0 0 0 $0P |@$0!S  0$0$ 2 N 0S P E 0$S  [v: 0 S Pl 0 0$S Z& 0S[y 0 Sq PP  0$Sh ZE v'[nigsTc_n.~~~nnw'nnniw' ~(w'nn oo+o;oIoVoZoeooo|ooooow'gc%o&ps@-`0PU V  PX@P h{Ѝp`PD!V 008I0@♊VcUp@>$00S @-]00$p@-@5S4 0PSP p@WPp 0S 5S 1S ,|Pp5S T \Pp< HPp(( Pp,v'w'PpedArdAps@- 1 AP(000( ;ge V( 4 5S Pn]0S j]0S 005S  P?0PF(5S `ЍpT TkPH`0bPWEVv'fdpmdp$P`w'gdp@-@P f/U@w' 0 D$|'md0P:/ 0#-3@-P P 啾P 0S S@@ ?rP@Ѝ0@ Ѝ/0%p@-4@4PQ~ p@`  @$;wBw@-t@t0MQh  `P0cS CS SS 4|sS00ۍ0'awqw@-\@\0MQP  HP 0nS yS0 $Y00ۍ'~ ww0@-MM@` PP 00YSP ,;ۍЍ0OPwww 0 l|'%@-@M0 XP ۍxW@-$ $0 ЍKx'%|'c@-YMM@p ip\YލЍ<0< S <f%Pژ10YS<0<0rdAx-xYx@-*0gj zgzz'z'&z'z{zgzzz { ]Ѝ5px7@-P0@ 0$S0S ╷0S7 TQ,BQQ, Q.10S 8@0 W0000! Ѝ0C0ASeeeefeeeeefeeeeee(fc0As Rtopmzg{{' Q{ zg{{{ { { @'xxP `00CS`0p S00 P0S X0X /XP0%G-` 0pP0V@P )'pGYWT@Y @ 0@FH$PFWpဠ 0  Q V 6WPU PP pXЍxc%O-@M MP`%u倅倕0S0#!pO P AXP4 0,P(p0 p3 P B dtT(p  P 0 85P Z⸍Pde08Hd8tDT( p P 0 5P q0(0csS, p P 0 4P Y0,0cxsS0 p P 0 4P A000@csz`zzzzz {+{K{n{{{{{O--M@ M@a88p P$T Q:0S0`S-P`P8apEbWWnF `F`0E8ġ0 0S0A"S0#1` |dp P* A`VP0P#" DDDU QP0S *3/ PA0 b P-0ĢĂRx%.A  'p P" 4SP4`SM4`PH2a0C" 20< S :A,0"SA x5|%.A  pV P1 <x%0 AAqpA0  R x%< \0AA 0Q<0PAx| !P  000S P0`p(V R s S 0 0)0`P\Lލ Ѝ||'|$e#|e:|y|||V||} }%'0} - BR0 R 8A-P@ R1! 00 X0 X0 p X0 \ Z( H, <}0 0y8 $u4 q< m$i$e$a$]P YT UΕl 0SQ*\`p`PQ BUl幕AHo~|f]v~~~~~~~~~~~ +4DSe +O--픀MYR S@`paW 8QT ,[Q T T  `T0@"  8 T,  T  JTX@0P"  @0 !R$2$!`  0S 0Cs RoSlx\xx\x\xHx\xx\x\x$x\x\x\x\xx0 0 01 0 0208QL Th <0P+8TQ* 80A0S  @2<0P+8jTQ *ЍO0 0 020 020xd l_@ \ ЍO*Ѝ|f<I"4A-@Pp(D<<嵔`8SAG 0 `O_0/p/0p@-  R( R((,,004488<<DDPPTTX\@X\Pp Rp@PUt @ 0T0p  Q CQCQ}Cw'@-@t40Pt08Ef/OWEV0H @-P \PY@ PWEVw'80@-0@S K08f/Nx'0 \ P0//@-L0 DQ<<ʓ8@8P(` R 0Bꨀ%߀T$8P7@-@ P 0PPP 0p 0 ,`$(SP0 Ѝ0'vd0@?o2P0Ss@- `P@RP RP0 RP0 |RP00U`RP080DPD p0 $$Ѝp `='ud0@-PM wdP@` p D# 0 4-00+ +%Ѝ0'zd@s@-@ p #0  0 0`P   0   0  h0  P0  8Ѝp'td@GTkBȁC( p@-@PM`PT Ep  ( TV V dPЍp (3MH( *p 0l# 0'}d(@q~d(0@-PM @ MP 8H#4P 0p0 C#Ѝ0裂'{dЀC-P0@p!a嘁,M00 p0S@dd@@  p  <#eP qP pP $0Q `0S*U@P "@`QU)W fU 0? R00t` 0S,Ѝ00* *  P@T?,$%΂'|dт<|]S/@O--PMM )@aQP3040}=xSxs$0(,0$ `p L.4@,`@8V "0(000SڍЍ!# С!! (@`F(QP B0p r"Q@PdR8ppV @0: S \"\\%040}=$0$0(@,@0@0  p ,4p`V1(000(S70P:*  0P3@@fp  ]눁刑刡T ! x Q`!R0$@(P(p " (G`F@ @p  0Q` 4 ;$Kqp 0`p , P \ D'wdg{xd ʃ%7f%3Q hA-PM ' @qKP D iKP $!1S  z0`0PS #S0"S U1r0%*VS  -0p0S S 0"Rspm!PdPd `尀p#p0 8d!0Ѝx҄6'ydPC-p` PM Q@! OP 03/ЍC}@@ R; p &!T$j' 0@- !'P7@- P@TOP DOP804 p Ѝ0~ 'wdP7@- a4P@, p Ѝ0'd@~@-(0   I>%O-,M00@Q`pP0000 0$0X,Ѝ xJP  np $ P  _p $0 S TP@㰐尠$0S"  0 00SW   ~0 S 0 @0D~ h:p@-@PP1P' 0P, 8>0P r M 0P 0P2 0Pp@~p@ 0xp@djp@`jU@@k~Pptcidyara9rbmngntsaS2P0 P-  #B%B$14!8<'p@-π8Q a@Vp&a  …?/.01 \ @0`0 P#3pa  …?/.3P01 24P5 ̎ @'0"!#/P/'A-PT0p(,`MN@IN,0T@@DA??@@@'?0@-<@< (20,20LP0  P*0 002'> 0R//G-`0(,Bp  PL E N@PPW ,20CS(20CS G}0'E@p@-@`42SM%^ l E@ 82<"e 0 (2,"^Ѝp@YW`}<"82El@J`S},"(2H0?X"\4Ѝp@9'%IR{ڎEYs@-P`P  0SЍp00S@oP0"S1Ds@-,M$BL00 $ 0 0=%A-`0x @TʴP Ϡ#p 0d  ? YHqp  RЍAL`0S`@D@,H Ѝ%|'@-`  ppPp@0hK Ѝ!$LR@ @dQRQ r@<<U'͒p@-4@P0S( O0B1p'O--ʇߍ@ hQS/2SrW#, p` 0 ಟ00  0`p6W0 002Rp`" p p< T"QP20H"oJ 0(g 1 RS Q0S!Q10!R Op12S  ?01P' !Qt10p8!9?l0412S02S 0 0S>0)S !Z0)S  "Q  R  Q !P00 0D0<   0S<('s•ѕ%FtzUޖ.QbM!@-tM4rW@Pp@lЍ@P(0P`  B1 @  $SЍ@ 1 1 0P(1 11< 01 1 ?011< 0`1 Pz1 @?0Ѝ@r'Η):LO--蒓Y`:X& "!R &/ .0 1  Y 32 $4(5, Y \   Q R ` H2,0L2000&0S, 1S) D, W000P0  00SW0!14!8!<!14!8!<W0,p0`\T (`0 S( 21S$ / .0040 81 <W , S  PW 32 $4(5, W0\,0000P`$p 0 0$000P ,tS 0 S00$000P P LWT $0P0 G 0S pc 0S 0s X2 0 RS  $0@DoO@((0 F 4 0 8 0%4 0%80 %< 00p P0 @2S` RU 0`BPX 0 1<Ap 0PP,2`0C 00PPM(2p? 00`PP pp0`Fa ??`1`<A` 0PP,2`0C 00PP(200PP? `Fa?`?`` 0S\ 2S@X @TVJ041S ']~@'R'И'7CC-LBp42MgS40sP,r,b42S 0PCU42S 0S sPԁԑ 42RSgP:s42S^1!$1(1,ЍC0S dSp t04rdW2S 0`~p 0kP"R S0SЍCr@D\ 0ЍCSP 0Ѝ'Qc'bޙ™#@-0@M0@ pp`Ppߍ\ >0  0P \ uEt02S 0S " ` PDZ!SR 0PD<2K'T0@-Xa0 0LAP d2S8 P(Ҿ!p! 2SP0U  $pt"嶾 Rp\EU$p娾0 00P d2SP P@嘾 Ѝ0P0!!1 %'mdp'ƚh'A-@T2 @PQBP LBP GBP@ `p@T 00S p`V@2BPD00S @@%B@PQ<%h'0%A-Pp`A @  000 0@@@@-@`TP @p@ U 0@$ @ Ѝ@jJO-MM p4 P@T\D AP @ <AP44 00(04QT(0 ,04@ 0#0@,0S @@((@`@,0s0000CP匃0SP@PP0 l!41P430 (3Q,#  $ s4T0> p@: PE ,0S ,<(00S<(00@1 $a:P函'0FSʆ`P0S -S@= O3P00 @@Pe,0S ,܍ЍA0 .P %A8800  0 R00S' ,10PAPQPa400C0 1CC0S0SC0S0S C 0S C  CC$0#p t PS<(0  P-h'l4 ](+l{;A4%f!|00/\'0/\'0/\'-@-$@   ㎥f%G-P`pvC@0S  0S X  _U `Y 0S 0S  /Ѝ\'؊-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @Pݍ Ѝl!rp@P=0LLD@rOP,0: S0RP0 00 PPP81: S`P% S  R  rPPp PPPU rPP @P\'Pl'(F@- P 000, ,$Ѝ  cl'r0@-4S 3/ \'@-wB0 @( 0$@3kB@\'@-eB@=3303[B@@-p PL`@@0 7/P0 S Ѝ =00'O--:M6M@  @  @ P0 0R PH @ `PMF 0S=f vY 0R R0 p 0 0X@ORpT 0S" P%5 2uP吅eU \ 0P P0HHa@ލЍ03/0P0  4PP@p h 0S0SW SW hP0:0O.: ; p` H pO s= 40@0Z0C @ `V)` 0  0 0!000`0`00 Z!   00 +0 0t9P0 0S `b>P¢ Z @P ZH Yp Z\埢0S< e So Sl pWp 0S 0S@  @W 000 !00S# 0S,aQ000CS0"@ T 00CS0!z P @YT Y@DOoB 0Q   @OoB` 0 @0  0 0 SNT'9G0%%~ ?0@-M 03s0|c00@Sd 0SPP RPP d 00Uh `Ѝ0S ?0S 9@  .0S\0Sql\  0/.@ m\0Sp 0@u0 @>kp 0S0SEl @\0S:l  @"  @0Sh(l @D <P@ @0 @ `0x P|"%   T    P  @@``; 0 @` G H D'''QMWg´ mLѵG-0@  06P 0S< 0  Q*p  hPPxi   0`P Tu !URQ ,T l >0 p H0 0W40p P > u 0Q40   040 04$00 00$0 400X 4 0048<(0! 04"8#<,0pP  P 0SD00D0D`` % $0+4& 8' <"X0(0R* 0H0`|-0, 3$.0 (/0,8 001 42 00$4 `0600 QP  `Ѝ   0P ]P yW`P1S1S1US1S 3S3S3US3S, L D`P0`$ `03 0(3 1 31300`01600 QP    ~ 0P`00S !14!8!<<0!14!8!<@040  0640  QP , q 0PA0O A0  P 45 ࡟ 0R  , eYWUSXpW P0E@: 07#;;S`TXD $ R,0T T0,0T0 RC!:D0P 2L0#1\0\0Q 0P 0L0 0#00P 0L0Pdd@q*TnȶͶҶ8RRaArrAaU ,`ط9@-p@`P P00 P0O5 00QP  Ѝ 0P< !@ !0 P015 00QP 4 0Pq7@-@P L0 R0!0!0%^l00l0 ~p00p0 Ѝ0^ P ^3# ~\ L ~H00L 4H ,PP000FCsG-XP p`  P 3 Ѝ00$H 04QP D" :X0 1X0 P궸ոO-@,M0p@l@$0`P P " pP  $Ph <$0 LR0- \)̌ PPP;p P ^^^^ \\\ \P PŸ Pu p/  P@P L0!$@S@ s@@P0S$0p 0 0,Ѝ8(y L0 Q$2 q(@,"  P "  @P*"*  P0P S "!"0  0P@P $3 *{hQ P r0 r// /ჹXCO-`P@M䱟䡟0P0S Ѝ p W 0G s 0C0A s 0 0 q s w qpp d\P0P@ 0 `P 0 00 P 0 00` P0A s0 ` P pP0 0 P` P ޺b8¹R0/0@- PBU02S0P^0A-p`|Pz@P  PpP P0R*"R0R0]O-0p` P\PPX Ѝ$P  qQ 0 0Q\@T(2 R@0 PQ SC0 BTX t0D s   0 TX Q  0 0 n x P [ P J BPTQ2P PEx&]O-X`0pM@PP`Ѝ 90Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/BP 2  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 )"0# 010 QP 0 #P궸eO-@`Pp㤡失P0S00S <q.p@q8WO$0S  0S 0S,0 ( 0  P0S P  MPpl Q P l0p<0P0Q*l0S 2Sp  lXP0P  RQ@0 P 0y8T@-?`XP\@#@3P@T@TpW @@T`L 'O-P@H@M18 00TP0S<0T D0S Ѝ1@ 00 `p0Ds#p w0 0 00 QP sP 0X:0 0 00 QP PLH  :P<0T 0B '*O-M@L0Sp<`@DH SP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:Dhʽ '@- @/px0%B?kP0S :40FS `C 1p@@0T Ѝ?  C0 '0 PK %/ 'O--` 1aMV  0. SP0 S@0P`(0<@@0$0 00@,D0$ R! X0p1#r380#8  ,0*080, QP r0P@0`(0<`@0$0 00` p0C##   刻PW  q240pGDD04 SD00S   408 2400 0,0/80, QP (100  RR R0(100@0D0 p0D0G >\ "T*P2  (1 0(11 J    0 0B0 @0Paߍ0@ S100S  S:I@(1  0I0@;+ ҕ P(10(10@0 00 0Sa 0@ J /o<0(0"s R`$ 00P `, 060(0 0$00 0<0S<0! 0C<0 0< 㓲#P0P 0 P P :P R:x U 0`$00`P1Sh L U50$00`P^(<\Q U`V  $   P`$ PK/T6 `0p!P0hgQ P P0S*0`Q`  0' U$0 0 `H0i P H0 00  P@`  Q . A0  L L  @G?LL0CS \Q*V L0!st!0<80t10Vx1 , m.000(00UTX0$ V0 0  T$0H 0$00L0 00  @Vt 0 S1S IpQx1PPt!hR T80P PPL0sPPt!30It1@tQUP0U*0" 00 0p x1S TP@ 0I 0000@x1d`63PP 1t!R1 8$PP 1@A03 s0Ps (0RZ U 0`$00`PR1 SR` 3P0S 0S Tw[R P0S02S 0S0S 02ST] TXt! ;pQP @PP 00I@P sT B t1HH 8P$P PPPPPPL0Is0PP@x1K@I$`2P=PU `t1VS P@ ta``L0Is``@P !SP `PPO 0 1t10t1#40L0s]?000w10PP4@ K/T.PP05P1U U0@Ih00h0tP0U*0RPd0x1ST0x!(P %4xQP0%8%\0 P0PEd0U03:T(y P Pt!dx1Zb" :0 0t12P0P`, 4 \40PI!2S0P0 S0 U 0 P$0[00$000  @ D00S8 0 ,0,80, QP40 R80 PI 5P0e '*ѽ  '(@i<{VX ۾ʽ6ZC-P0@2SdaPX pP, ЍP K/3D00 8QP0Q:" 0PS00  Q puxPh`P 80"8 R 00 05 !${ 't6 dp@-@5%SQ% 5 %SPR UUQQp  0Q Q0 'A-lP`5p@ @ 0% Ņ~@ŕ\ 'O-POMp0P> b5S5夢05ET0  0P05 ET `T 5d 05 !dP 0Oߍ RR+ @ST$5" R$%P0S`0d B2" 0}+ JQP d d0P Eh0K/0h0 20 @!,qr0d  01(+  j 2  2,10,1#40L0sK?000/1001001#40>000310 00 000T0 C++(%,5QP Hd d0P{  'P'@-@ P 0 5 '0/P'0/P'0/P'-@-$@   ݔ%G-P`p2@0S d 0S X[ U `PY 0S 0S  ?~ЍP'؊-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  MC-@M Mq` @SPݍ Ѝl!rp@P=0LLD@rO:P,0: S0RP0 00=PPP81: S`P% S  R  rQPPpPPPU rcPP @PP'P`'(F@-XP 000, ,)$Ѝ  c`'r0@-4S 3/ P'@-10 @(C 0$"1@蘳P'@-1@ -""1@O-PMM`@pP壶P0 P: S3/FP 0rS 100P 0#0@0@g@ U  .P  jP PU j100@23MP@ S @V``帰张O`P60: S)^0"P@PThP V+ S R"P-P U "T@\ SƴP@`-\徴P@ `UPXp%t!0#PU00`00 D ✴@P  P00Sᤴ`X PPth0 PLPP nW80% ܍Ѝ  FF F@0/p/p@-P@5 $( $(0XRX0X00\00`0ddhhllppttpp@-@ P DD@@HHLLPPTTXX\~`\`0p Qp` (P0@ S p@-0@"!Rc0p@-@PpA-0@PJ04S->C->C?X~9>:>Cy?n:>CFt 0? AC>k}C>GfmFbEnF^E~GZX J.X R  $$((,S>,:}S>G5mF1HHLLPPTTXX\\O-@  $$((,,0P04 40TQȑ\5 S L5sT 0K TTXXp\\``ddh~h`lzlpwptttxqx1[ hepb`0 `$Q*\5 S   0S&P%@ PSزK 0CA0Q R, 2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P@ `$P`P600@AO-HMQM $#0@2`0F/ Ϡ _ 0%Q%P(,PDr 04P,`P `(0, 0S_(0,PۍЍ10S&  1pVW03?00?s0?0P 0 0(0, 0S_S(0,P0```00@@Q"R0  P 0 00 @Є0 03/`)  0 0 0 0  000 0C 0|* 0h0k40S %0 0tx'<'''''''@-P@p`AMM(0$L 0 P@ 73U0:t0 R0*d $@>0P 40  P,, #AލЍh:`'i7@-0 Ѝ0@-\M`PpX @ (0H0T0 `'!D0DP Rp9RLt4Pm\Ѝ0'PA-`:L`p`P#3RP3R#\@A`'O-M`@ ) P0E: 0 0@40P$? 0 362Ԓ2Q p{ q Br sQ0<30<420S0 sH2pQ 04  0R  @P-( 0 1ȱ r0 4 Y: 10S0<00D0`+2 `0Ѝ 0 1 020S 20S 0J` `$110010S p1p1000 ppmT<''@%x'''O-@PGMM X `'pS:0 5 R"0tSb 0S! 000S_DT00 1000u 0{5 H0\00`0Q4p0Qdth " 8"0S/ | L000 0Pt HP% 4$0000S gT0  0O.P3GލЍ.P3 09"0K 0 ; @p  0 0S s$  P1 $" i.P Ѐ䢟 L000[0 H  t 00`02  0J0  0004r00STP2r0"0H000H0H 0p 0 S 0 RC 3#004 S 0040P!Si 0.  0( 00  c  0 0000C00 S J8   0 0001   ps0000 l0 s!0vs  0g 00S i0'''@%TS''=НH`'i G-P`E@pXpAZ x10S l10S 00 0L P4ЍG!@PEU< 1 RP0H 0  P !`' H0S"00S U 㴸 0S R0S GprpЍGVX3-P H0 ЍU8'0'D''@%i'0/p@-LP@088200@ 00 %/0@0 %p<'00S/p/' 00S/' 00S/'P000R0S /O-`@$"P0 SMf0SD S0_졟ď080T C/ S ! R 0C00 0@eἰ? 0e!p\5`!S 0 00Ϯ0 ?@U '  ϬR 7 R  05 \5S0 0/070/0 0 Ѝ P L R  H00 0400h'<'4'TBZzPO-0`P:1 R0* 0됑吡0 pP3Qx 0 V0A:0 L@/<#\%@ 1R  0 ?>#‚ @ 0/` @ 0`<0@0S   0 .0x@0 1!0x 0 000(00S`''<'T''O-hCM0 R S ! R0* 0(Y 0:3 `0   p/<#\\%p2R  0 ?>#‚ Ppx 0`0 C c00d0Ppc C c a$5bSQ,040(0ÿ 08I,10SC 180X @p0!X (u! RKK/W08:‰ W2p P| XG 08p,80<00<0S<00<0ЍGGGG`G W  R0 K R R'<'T''''''G-1P 0p` 0  070@ 0S 0 0 80PS `P` 8UH0ZP000PS[ `4 Q$,$ (,`(PdP8<''' @-@8P B080'G-P`0pS100 B?: P@P 0@8׳@Pt1 ?`10pA0 G   000 0 0 Z` `1 `#"p(,0(pV Zp`0PQ(d0S\1@@ 0XP\   0^P0d000 A'<''''''GP0p@- P?@2800P 0 _!SRp''fp@-X`0SpL0LP@1D@A0S呵叵000p䉵''' 00 /'O-H0MSP` M 003/ ލ Ѝ40 pP䣟00 +0H00@0 t0 /  S 0V 00X0t3!0S& d30SfS t0  " 0  0励00Z0 02\+ 2R720t0S22 Q o   Zh"$⡴$+PH"42 R{! {  ! t R1 +졟W000e1 Q5 10000S1H  B/oQ" RK h!B0   +BLD)P: !P R, P N 10S0Q 10S 03/     0P  0p`V0 +<''''m}''0O-S0P0 0㘄RM`#V@M(, : SH \p(5R<R  P  RSV !0 ,A0 PB?0`s0 0S0 0000 0Ze 85w @5D0LT 0 b32 RP U`P80 00S 00`PPƯ RF 0 0G  0 #30t ?:#b 0PU p0Y0Ph0SM  iV a08001(P Y 03/ RލЍ}0 1TP+U000H R00S 0 0G n*GM'PR0@S P\MM T0  P'<''''@@-@{!SP80< S0 80<  D +p@-@@PU Dz P XP$0 Q0: pp`'@0@-P@80\U< S0 80< 00p@-P@ 0ղU0p81 R0p8@Dz0P0S 0Sp랤P0Sp 尲嫲00S Lt売0S 0T嚲0S(-p@,史`'''h: 0' @-p@`MWP 1  P  sp`V' rL 00S0H0S 0 0 $,00Stt, c?)00Ѝ@L&P0S 00`Ѝia0'P'''')'0@-@PM \" ޱ)Q Q0 $0ASЍ000/>O-P5,Mp0 /@P`0 T00: SR) 0Ḱ0 f倡 R09:` V `3 V `!ᜰP@P(0S @P(0`S @P0!0)0 0S:R 0娱30  `(`\Ő 0\"  ? 夣 ? '0刳 0Sp30m Sm `3 R #R Dr83 R R( 3  R0\ 0㵯 0 " 00C 0L40S$40 0C$0嘂*2c)l20S  0 : S( S,  Sg000 00r ( +2p ZL *|0M0`S 1 00l10800S0X0 ⧗Z0Tˏ @ 0`; K F!000S00S 0C&  ,ЍJ*)P( d q 0 Tˏ @ 0`; 뫴 h'`'<''UT'''U '''P''O-2@ 0lMp`0P#\P  ? 嘒 ? &0 p2p0S0 S 0T"S 3S <o@X r$20p`c2 RpR\tR`Xd   X 1 R, Y3'00X0S  0 0 %*L!00ST06 0 !S0\ 0㵿 0 " 00 04$0L4R0@ 0$*0l0(0S <P88 P& PlЍSr  m<''T'''U Н'''P'''O-`|2t2PU@"0U0 ZPp0 0 Ѝb0 Ϡ˿S g4G@ WVLQ TVgU A 0 &00100 @0  @T`T0p HT Q 0@`J @Q `  T 0D0 0!닁 0 %P 0 m0 c`0@S 0 000h000 %[P00U0<''O-P-,,Mp$WWhs`p0 00`?00S iA3@30000]T Wk L @00: @TT00T S @@S  T 0  0 01 *0PV pP 2 000`?0p20SA 뉑 0 04 Y@ ;  10> Pq 1 000`?010S) 0A0 0000 p 0@0S 0Ylh# W *$p 0 0000000 $phQ0 0 0WCq 00oq00`P h0H 0HB0C0 T04 ]P  ,Ѝ'<'@- 妮S<%s@-@P `j0S 0S 0 ЍpO-EM` MP0S 0S PpP P 0SPލ Ѝ000S  wP b0S 0S 0S A0Sb 0Sxp 0SdW0SP0S 0S0 0$d sS80!"70  0 " " 0D@!8!? 0 0y 0vd!! 0o0 hpP`0SR "04 0 R0  0"> 0, ß0S9)(0, 40A8?S%#pR [0" |&0S l!hbPUt ڬ@0S HDb@PUn Ϭ, 0SP@PPDP\H0S  `姓Cn* lhxl%|0S l9l60p00S0P0(% 0,0UA:ج000S 0S P H1 H0S 0S,0S nP  P   000(iPP 0S|P ᥬP ᠬPP P0'9Wz!<^8'ѵOPloO-H0@Sp`M W0R0: 0P 0 H"p`6<"0 S0 X20SW YFЍP 䱟䑟  BR 0S#/  !.V  R.. P x!`T  R0 H  yP  @@" 8 < P8 <`㭩P0H P 0 2$. RP `  ^ V UV U Q'a0'{|'t'TX''@'00S/p/'00S/0/' 00S/'O-M,Mp% @"<:$Z 0 0`SCZ ` pP# 0`VP!00 0؍,Ѝ0 (P  X0`VPh0S  0` [\ P  _0S, 44o $; [+Z054%00! ?0S S00:00/0S 0 S00 :0V00#03  R00S :0S;  0p 6h: 0S RT gP 0@4[< S04`?0: :R00n0 B?k QP%90S  0  0 0 T 0/P0 90S, @P$0  ZP00 0 S_8Q<80S8 0 V0;R02*h0S/ 8((d0 #0 (P K`80S (00 0(00h 0`厪  @((70S 0h0!7'(5SZ/V U:'<V  3 #P  RISQ; !0D 8 U0$000(p g0 U(7PP0}X 0Z~uP] 8'000w0pPP6'~Pk"gh0S0P%Q_!1Q 0PQ^100 U0 EPP P00t @?1#R 10S0B0 P  Z$0S 10000S l50S $0S 00 P0|ϩt ?y$Q  40S $0S  崩 Qc 04 0 S0 0 0 0000 0L$000 0 #600S,40S P4 PP  z@ p t 3RpRLtRPXd00H00SS1 0S l30S* \P00  0(+$P 2 +2 0\00Q&&:0 @000S428P040Qd/<05#fP8`P`U`00S 00p@30PpL\$\5S0Q%0# PD ?0  $40S40E SE 4 `V0`@0x@S b d0, 0 @0030SC 30S? 0 S( 3 S? T!. 0 / s\@T`  Ϡ5  0S  Fs0 S\000 T @T`VT0? @`1020兑A0^ 1QS  0\J 0P0 8@ㆥ O0 00Y 0?* 0  000VT !pW ` @p \W@ V00!03S%Q@1:0Q@0a p0  00  P F0 TS YQ! 00  `P Q00*  B `'<'T|'mX'P''''''p'%0'D'U ''O-` @ 0Mp̰̐ 0 0  BRЍ PP U QP g` {{@ pQ RP Q @p't'T0/O-plMX y0P`X0D1D0@1@ <1 0,0SlЍ0S d0,@A0 @ۦ00@԰ 0D Rp`T0!:<P 0 AQpR Q\tR ` R @P괄<'@'p''0%'' 0000@/00S/p/'00S/0/' 00S/'O-9M`PV`@@M90S 0P )S0*`00#0.倉Y xApP 0 WP H)D P<9p`0S 0S )P00 8 #R0밸p0,S00000 8 001?1#0"v    0P@plrhja00C0Z k100S 0y P 0sQ0 S$ 0S x'L0X0PL7|`z:0,S00000  7 001?1&p)0pp00ppP*0S  `Pg 0 1u`_pTP[ @p` xpb [80< 0 80< 0@0C0ş 0 00R.*0S  P  0" RVލЍ0S 80< 080H5 0< S 4>0 00$001 aP 0S 80< 0804 0< S >0 00$S! Br ` yp qP 80< 0 80< e00C0@(80P<.\SP# .P #PXPP3P`080<C@3 Q035;:,pW P0Sp\\/&0AS񟗮hllS3 0020S04000aP x2 J#R0 200MP028 0 05#R0mQ" 0S0S@ 0/Pp  : S000 !0 #R0 Q   0lFQF?\!\  ,10 S$ D=#R0 š!ʡ0S  0R 1 0 0U0p0P``000C0WPpv ! ''`''V' 'jY2?x4'fu0'D'2 O-MM@0AS񟗀꜒,<В,h3 dP T7 tp@& <}P $7 00n@0  6hP 60S 60̆V6 X  0h06`$00嘦100V3:6 Rpttt0S.`@aViPVoݍЍ( &P"P   5m 0S a @ FL1 0Y0 @<00@(0S Shhu`%p (P* 4 0  B, ! _50SW 00(000_/0q 0S ~<p(0G^ 0(SF jpQ(Ag,xfd4p0(S9@0W78U,0 S1 #0 R( S000000W!"!#4Wl/ px3  (  _/& $ ,0 S1 #0 R S)R ) *V { { x0 S( R , "2 pR)@ W(,`0@' aV!W#Wl p d aV @0 (0S $ 0 s00Q P0S"0`10S x10!a!00C0!U P0 }00000C0!" pm0S@0 0 0C0 00@'?'Y=>'''Xćp'0'' p%'x'D'b'4'0/O-ؒ؂PԢ1EPMQ@Tߍ0S  d`@EDAF@D0 pp`婡00@   B 0    S$"[ "[ "[S[ P0:000S 1a  1R R@0 S 00"P P100C84P X   X !  Q ph0RbT0 jQ\tR c` 8h00!P^ p00& }000''p'6%0'8'D't''XR''SO-0p(4弰 ` @$M?h P \P  ? ̳ ? 0 b30S30W SW 0 S 3 S p9@ 002 P00 00CSFTY! P 80R0L003030 000? ` a2! Q,S Q0B*n2x20S =P9 PDB P$ЍS   APw?00 1>!W 00S>>0Q#b ! RQ 3 T0 0 S`0?000 ?S  R.. 0" !00S0H0S 0 04040c/0 $" 80QT $0 0$0404 L3 0  ^\ {0{< 0\Pp1<''T'''U ''|'@'X'00S/0/'O-plMX Q t2t0pB0,0SlЍXR0S  d0,` 0  `废000P㸀@ᇡ 0D RpT07:`1 ARpR\tR`Xd00X00@SHԣԣԤ`V %P 10S  0ޞ@PZP 00S  00S  RQ {{00嵞 x40R! 0 P  H 08TНp'<'p'%''4'DPXO--oMM@P00  0t2|?0SX0S $5SX0SYLPZX0S $XnS X Rg ?`0V\2 PT20! X" \" B] 1\"T000B`X$dPڀ0A^000h21`l2\B1d2>V2d20C:=SLq QT20B  0S 0 L$5T> *|4>%(>0S KH0 0S0$5  B11  !`0P00B1- 00 S$ $|0S$  봀 -0⃀Ḁ$1BP`R!B@ L؜PP  f| 8PN 08S  <P| *堀<<0S 0 0/X0bA?:d<5A?T0 =80T0.H0  ;0VHQ RX0`0@ <0y 8 84<ϡP b8{ S X,0 Sh?^ <PC <;0S < A>+<B<  C:P:"  <0\ 0 0009J*|:7p:0S ]Z0 0؍ߍ0800~8``!.Q  R  `0" ti0S @d,p  0@ @@ pr00 ,y+1#\Q  0 T ?䘟 0lhS90x Sx 80S 0(S 3S |0S 0 080S 8 0S<(0 00( 0X $8D80/˃2#\%R  `  0 ?d h pB2 `b7"<6+?D "@ D @ 08L<PLRP$ͱ 7`V=S؈<0D 2L0VpC p,00C S=SxɵzS   +1#\Q  0分h ?gY `680S <jP#50h x(60S K0%\Q\u5P50 S5550/˃2#\%R  `  0 ?d h pB2 `b7"<6nv@ S>p@d0 \\L5SVPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//'O-4`@MT 唴qy+|] :ltl0_ 0 @P @Ѝp\ZP 0S0 40S40S  ?X: s0P0t Pp \2P3#0S #S7| P p0S d-0 CS kD*0S `0\%R##\%\5"0C?o"20Lph0 S 0X24/R%Pd (2 ? :010SA, A!,Ÿ0#\ P  0 R ? 0SR0S 0ȡh %0S 0|\%Rt!\%P l10S%\|XQ% L!0 0@! 0 * 0S 0 0 0@0@ .PhpJp0p 0 0U* 0R Ac'`''''0''''D<'8 'T'[%8''4'u''''O-@9*@0MM08x`倆P 尕 &ލЍ80S :Pm嚕 p 0: S T XP@888X04HSP 0)00S  00 7 7 8    8@ ەp8 Օ[WppTpPpT7WL /P 7@T ᮄP  Iz᥄H8P 00坓 86F R>0 0p 0<&00P @X7@0@$60@w>0 H0p(hp2S )P )P ).U4PZN-`Y 4[ 0S0;<관X| V.+0S  & 0,P %Q$ f Q춝C ?#jP`u 2S<4$040404X02P#W20AT2@02 r0G  0l H  ?p0l3& 8 S20#"20#205P` 2Sd#0P\@Q=S00P 5@ ) 2RT0 S @x0S !C 5*< 53 30S 0 0@20S 0w|3 0 S@ T 10Sd"d2QXe 0D_3 @ 夂=C2t,00000 @DO#ʁ0N$0 @@S葟0S0S0=S0S p)80009 p 0L%000P%X30,q  *v 10S FC0 0'''%'0''8Hx'''a5BZ''l 6]TDb1T4'mM Cd)J'+T}''n;'''''',8'Qyh'|'''`''''''''<''''=S%0S& <0 p0P%<<00*X300 00S 0 00S5 0 >0S XPLq 5*N> 0:#: 5p1h $10S 0 000S(4P0q0*1H 10S nk0 00<cQdkP 0`r<0*p2( $20S NK0 00S0L%r0L%r0H00q" P 000cH00SP8P$s*N4320S 0`# 0 00L40q"  400cL00SPs*&330S 0$ 0 0t4pW. 4E ^  \pWR 0SPt*4T40S 0$ 0 0t0Q,%R0%45S R! lg004E0S|PP*`5l50S 0% 0 00(0Si xQ$ >0Sx < 0(%0S^,P*6@50S fc0<& 0 08%<5HSR$  H00850<S6SP*i6|60S 850& 0 0@%D5LSR$ t L00@50DS%Pp*;7470S  0' 0 0 7 70Sa0S0SZ0L5sV0SN PT(00070L50P5?T5V>X50-00$ő0!00B\A`0PPPB 1@500L 0H000*880S 0) 0 0T PYd P4TQڨ0QXڌ U 0 0S Py*9Z\90S }0) 0 00S3 6 6)0S0QQ*P #0 0Sl iP`z*p:($:0S NK0* 0 0 )0S )0S  (0S0+ Q^ NQ L (0SQLd (0S{v<Q (0S (0S (0SH  8%L < @%D;0,5S0SO  ,000;0,5<0(5H04E0/85L0LL0<%/@5D%0*p<$<0S 0, 0 0<0S <0S(L*<<0S 0 ]h < < PRL PM\= 0S@ TPL \ ` Lpd娭@PUWʸ- 0 ?001>0/.P6  ',Pی0>P<) 3D^ S;L.00 0 S 05|>> >廌>p嵌WP>ppY@>@$00PEUP8HLd  BL 0b03",P P Y) T?0S   p?8 H4L0d P B b"30 E?0S   0`00p] P?ы 嗏\6PP ^0D& 5000460S 1S  P  6 6 @Q U @ 0`P @@ 048 ,5P l50S p>lP 0 0 B ``0  0 04 8 P 씟 $0S_mP`0 4?s0 S 0Sc\Pd0 4?s0S `p0SfDKPg0 4?s0V:QQ  /Q R 0Sd0Pe000N 4000 Py c0ScPd0 0 0ip&0S 00 0 0 00$  &0S 0 0 000  0&0S 0  0000 0  0l&0S ``v0`#40  0  0`ql&0S 0@000  0 1 1Q1Q,+ 0S CA 5< 0 !00|!@0t!0 pCSq #0p R0 !40Bs00WP `@f؊0PҊUP0Qo R E/ !0!Y pG  ]'D''''''LBAL)0'H}b4'x'1''H''R~x00S q: S  S :C / S : S 0P/@-岋'4'1A-0`S lh@ ^T L10S@10S0咋(1 10ST00S 偋p@z}00CS0pP U 00CS0 P PYU YU0 P0  0 0 SNU0'''8''G0%%@-HP  $* PlЍ0'O-p,1 p$1p 100 %P0 ppP 0P  ppPPP(㩈 @ PT`00 WT V ߊp pXP @@ 00''<'''`'O-@-1$M0P Ϡ,"4`H   0射 P p 0 @v ,尊P$ U i 0 mpP$Ѝ?0 0 ?   凄 P 03 00?QR0 0#Ϡ?0 8pp0P!h''MO-- M0P8`А:Pp/2#V >[ 0 Ѝ 0|?@[ ЍO ?   !P  ? '0@p'x'A[A-P`U@ ,1 UP0 PP0 0T3`p+0 L@D0T@S    8HĒL d  B 0b<3l@"z0 S  0P00`0@TЍ''<''' 0S/A-@p d`V F0 fP2Qf00 SR P00@00 0` PЍ<'<'''@-0P0@T@T5d pL `l0p `̠V W @00 0 0 0P00@@000 Ѝ<'`'p@-`P@XMX  a `P @XЍp0@-S xxH0@S  BT00S HA#0044,P000'p@-<`0S f ?># $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT"4'I''\%0R/=S/ 5004 030304040 5 5L5sP%P% s,,,TPC-<40S 0$0,DP$440S0 40S, T0SB 3`3 30S@=S= 7S*330S 0P 0W`dSTSgPsaPUU00Q A P 0S ??@XB@P`"hR0"00S7 lr002Pb0S) x50S) 0R0E>0*X4 2920S _\0 00S!YP10S  ! 1XQ d1*d\1 P10S 300 0P10S D  01P 0*C000S 0 000S d0$ _0 岆k (0w ЍCw Ѝ'''''''0'<'''''''`'''m'''4'<',O-PPMp80S#C \/ " / Q @aV``  [ΑYP d \P  ?8 , ? ~0 T2r0S0` S` 0!S 3S  0妟? 0!0! !0!S`0 0 0` U\/0ϬL3 80S30Ð0C03` 0S300CÀQ"0 0P*X00S (`$ ` `Ѝ kS  $0 0C$040S 4 $ P@ P V<'h'|'T''''U X'''A-Pph0``ATR Q@P<L0S @ 1p0A'L80 0 1S/ 0S/'\0 5< ÒH0\ Ò3S\ Ò3S\///<'^FPO-0(P,0@4p8`. P P0P` 0S 0 S   000 00 00S 0 S L0 w0    p pH'<''Q/0/O-@8`堠 眰P8Q ЍP p Q0p8pQቐሀ@`0S| ` < ( P/100s P000sB00s @-h`0S    o/0! 2/B1   P"/ @-h`0S  p d 00/1000/0B10B1/101/ @-h`0S@$ 00/1000/0B10B1/101/ @-bhG-p$Q  l$Ph!Rr lR`Π|S p  $@Z!T P*B\  @@Q ! L@Q% LX R @T @ pW   PP AO-RMPhb  ̿@P D刿@4 TPpߍP(  3vpp0S Cj<08 (00,0 000040!04 04$0D0(0 P dVph dop 0  DNU 8U ,|U  xU tU up up ) f up 8p?pq8SPr 0  *0*0@0ϵ  0* *d@edAzd@A-PCMMPp`;8 ᴺp@P  P0;P tU 0 2 "0 CލЍO-PMM`@pPRuP0 P: S3/P 0rS <00P 0#0@0@z@ U  CP  uP PU 00@23MP@ S @V``帰张t`P60: S)^0"BIP@PTuP V+ S R"sP-P U tTs@\ SusP@`-\msP@ `UPXp%t!0#=PU00`00  Ks@P  tP0SSs`X ⮛PPtth0 tPLtPP W80% ܍Ѝ  FF F@00S/p/'00S/0/'O-pl1`d10P0ɯ 0n X 03#ˠ121@ R` 0`0P As 00lRQà00S! % 0%p3sp(0 RXl000R X0 0pp<P00'<'P'S0''i' 00S/}'O--pM 0`P@ᐱ0V000Ѝ000/U0p00 0 000P00S l00 ?h000 0 P00T0SpP8P{p<'^F0'R/bG-P `$ 0p@V` 0@`` V`@&!D( `G-@P 4`SX Y00000pquP0Y T0T! ## @P?Ѝ_uP :F^^F: p@-@P`    pp@-`P@ ((UX0 3?X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W040P/ Q\/O-@Pp02#U 1!sH `R ` J U c9# S!V Q V3  P! I P` 0 c9# S V!Q V3  P 0 P$` U P `` Ѝ,2 40A-1àQ`P |0| ||$H0@Sp࠱ P$` p@QL ࠁ PQ <e 4p@-@P0080P 4 PR*SpL0L LS@04 <<G0C800S   0!|hO R 4,0S/`0@-0@  L!, |0,0080S 0  G0@{T'hc 4,0@-S ,0, ,,G@TP {@{v 4O--LMPpU`@( %88S0@ @84@D2@D1@DS@D50  0 00P{ U0#03?[[[UWdy@D `0P 045Q ,{O0 0 {;D 0XR @[z"!L0<p$08p$0 0H(0 0 `,0`4  0 4$4GHP 0 zPL40  $00 0DPc{, 005RSUSP3S` 4$`UQyV  0W 00 ,040`F000C3: 4`C#,0PQ(0 $ *,80f@P,Ph3Q 0Q+ 0CQ؃ 0P`S $T$PP@ {T@P P0xTp@W !!zP` !T@0`P`0p?: 0T @ u8< @D0RP Pv`0 S2$0$0S@p :0 P  S Z 1!A 8 B`40bx40 040 00Q80080p0ȯ0T`0 S2$0$0S@p 0 0 P 80S0 0C800S   0iz`kzO@  D e @ LЍ0 0T'LBAW |4U NBAWi R {G-0,0S0 EP@w`00qW40S*#zЍ!  0W@P   l@Pp$ 4A-`0@c,0Sl0l llEPpဓQ L0< H 0P@DT@> 4? C-`0(Pc,0S0 Ep@SQ |0l x@PEU  0P !  0 P P ЍO 4Q X0sC-Ђ0@ P@` 0 00 0y 0P4ЍpT''X0sC-Ђ0@ P@` 0 00 0y 0PЍpT''A-0PQ q@`p0P R   T0! ]y@P 8N4Pw+'X'3T'h@-,@P,0S ;00X'@-,P ,\  D ЍX'p@-P@&h0h 0 SX0d0R 3?5 @006.4 Q#3SRpp''<'27@-0S S+,Ô2 R0 ELh `Q tp>PC)waQ* Q( H<1P 4,B 5*< 50d30a3>210S   0 00@ @7.Bp#x3 Ŝ & 0P xXPA 5*< 50d3 01$10S ص0 0@ d3S+ CQ+aQ# 0AS"tP y0@a3d3*|0p00S ᫵0 0@S Ѝ044'T'<''''X')AO--0p M"##0@@P 0$0 4 0S {p`s0S 劮0P- # 00"$ qpP)$x;lV tV bV0GpP`+$N 4 `80 (  0S (00,0 p0#+C$00H0P P W0 ЍWl G  P-P p  Di0 P0 pP W:P0W 0S00$$0P+S7 PPA 0P +S) PP @ P 0 S 0 00$ 0S(00 S,  $ 8~#p H P 0S 0 00$ 0S(00 S,  $ 8Ypl 0T U  < 0 `\$%% ?]x G-p@P` 0P V  0  0  G 00`000O-0` mM$0P@䄟004080 0 zpp40S+ mߍbW AW LW x8v4vcW iW0p8 4@0 0@4: S@ @0(0D08`,0000400P  P 0! OT| ip 0Q= $ 0! $∡匱@P 0V$0 0/S <<Y* `cv`0"<]P0<0$ t`P QgP%< l y \gw <?vVD <"$Z6v 0#$0@0P!S@ `VHhp 0 n?C0 n?< n/ g0Pp < 0S `0S   B/oQ" R 0S! m0$H 8HhP`0F$0p0I $ pC op:0S ,( PQ S RPQ \T  B$%%Lzd@jf!Wh+HO-`-Pp,MP$`` Oyp@($0S0$020S'$00 P W 00 PSk0  0"#fT AT PT tX@pT$hp@,Ѝp00` 0pP ,Q ? 0o 000 00 p p@0 00`&qp p V@p@` $%%UG-Pp`l xp@<P10S<  p o0< 9X $$ ip@- `&W00S $$ Xp@ Y``V @fT rT GX`$$  ;p@$V$%)Fb% @- oA-@P`pP 4D\ XuT  @@u 0U  Au AC% @- R0ЍpP`@ CP0 0S 0SS0S $$1!BS0S ▲P \?, (P/00#s01"$#`O-`@V p?\ `@^P6 UP@ @ @7 TQ @T*  V00 Q *@T*!Ê?@T*, ? ! 0O-P((@p[`@ S Rᷠ000S0 0S0 0S0 @S" ?@0S^ :@T*.@A6 7@RQ0BR 3O !00G-(p$ P@7q`P 0㙥T$0 0Q P rs`Ѝ hdPC-p$4 咓`pQ%@ 0Q P Ѝ -dP404-@-0  Ѝ Ѝ/-@-00@t 0 Ѝ@ Ѝ/-@-P 4((s {x rЍ Ѝ/O-MPp`@PЍ |P P 4S  0DrT0P$ nQ$YP 0S 4S $ X0P4 S $rSG0!!p`000 0 0  @ 0P 000 00 0 0 P 01 T0哇* P$(` ,`$`V$R ڀ 0`  O0 @0  "SPb 00pP0Sp K /DO-,MXPp\@Po 2R 4S  0;r,Ѝ 0@Q Q0 '  PS[  "S 0X000 00 @ 0Pr4S 0S6  00 000 @0 0P 0 oO0@$00SS `ᾠ(`` (ἠ#3 # 3 1  #  0,$0@S4S 0$R  @0 RS 00 0 000000PV P0P 00000 0  P1p>pU|G-`pMMPEp@PXЍTC^t# E@0$4$ 00; p+p ibNq@cpP @4$$: S R B., cp $4S ($,40(B. cp E0dR04<($$4,40 K>؀C$$0 0E j00`d$t؀E0  P0`P 0$4S   0p 0)p 0p p}p p 0pp{ P P 0"Q Rp5M*pIg Z0"4@d@Lcd@z@-@P 4B BRP 'cp 8\4  fЍ@aЍd@ p@-@PP PP \.p~z4PS4 PPP}A- @pP0TP ` Xp@0 p@@$$ - Q EAQ0 "(  0T 02 /$4 0T1 / $4 0T1 /O--`P@p M7`: sPЀPP `00000p똰 V:Ѝ 1*00 0P0mp`P1 0 0cpP UP*% bC$$0A@-P@- t`R@`kЍpP P 4 R 0 V\?,;KO-Pp_o!R0`@|MR(0S00S "R0oU |ЍP {P`U 0SIQF (0QSB!RS R9"R S R0A +00S00P0#  7/p  7/p 40  m0$80P P ქP [s@-`@P0zPЍp 5/p 4 5/p 4 kC-(00pS4`  Ѝ$T@ 0 0 0`P 00  0 PW0uO-0 0`P%kp@ᜀ圐吠T Ѝ0  0P 0 0S Cp k@ 0 \?,]`A-P@ ` p0 vn@T`O-`p lP`@`T吐  00  Q  x t@ T`nO-M Q@8`< 0 0 PЍ P P0S*B PP  00040  0004 pp `040p` 04p   /Nj0s@-SX`@ P;?o 2R0S  Ѝp\?,;@- iR sR aR p` V~7@-@P ,PP  _ Ѝ0\?,p@-@T 40`PPVpp\?,iR@-. 0 aR bR LR) BsR& tRP 0P0S00 T(p` Ѝ(h0 \?,p@-@ M\P`:P0 0͵0,@m0S :m lЍp ؊A-Q@P M Q   ЍA~␀ p$!k!`P h`B~ `PP l<.DMO-$M@P`HP 4P`$ЍpP 0 0 0 $0Y1,"P0*HQ  p0 0?Y S0SXp Y0 p G04 pW 0pp $ ckP 000 00 lP l4   \ $  0U,S( 0 P$`4 80Xpz $Ĕ{'!#, RP P { T P R*L0Sf 0p] L004 0 000 0PK 4$$  P $ 0$$>p5 hK000S 0@-@C^M E$lE$$0  0 PЍ0 @tq !k"`#XT 80  @kP8k$%%Wbs 0$ 8O-PLM@p4 1嬑嬱D0 jop  0S$ ! R p!LЍfR lRJ  I@1` 0S   P :lP  I{ k蠟 1iP؀ 8 rkZ ̕ 0k @  %Z  ṕ ` 0 ` P` p%IP$%Tp\?,W%0%3A-p`(P@jP0 p!`P @00 0$0@-@P$0S k@kO-p`$MHLPPDT   V  \ D@=x` @SR00 Q ^00S P UP 4 0 T0P 0X0$0sP UP000 P1!!U111y@^P 0yPPJ QPT0 0X0$0 00 @R P TP0 \ 0 0@;0 0ZS @R PP0 V00IP  0 0   0R00 0P0@SP@<*4$$Ѝ2NjO-4MFT`0X\,! 0 T0  0M` ` 0 C0 0 <1 ,0tWL 0Si     R ` A  [  [00[$000(00$ 0S 0(00 0 S0F 0S0B0 T0  0  0 1%4 0 0$ ( 00 000 0,00p4ЍT0$(` 0"0 00 1!00P$000ppO-M<p` 8EJ@PJV 0S 0 0 0  0@P@000Spd- 0  J) 0PUT@ P T0 @ 0,@P 0T@0 0 00 S0 00 Ѝ f0  0 _ J)P T%V@ Q  R0P Va0 0S 00 0 0 RV Q T0Px  P0 T@ 0000Sp@{j D P/0S//P/0S/C- `P @ pR Q  0X0 RU@-@,MP@p`rP<o,Ѝ ( p`JhP0  4j@-ZXPLLL0 H'i@@@8P8`@}Tf*/ L  %i ~R R R @-@'R R/////  Rp@-0@P! R8~~~ R~~~~~~~~~~~~~pp B R"S@d dg\0 T pppppp 1 pp \' tO- M0`}@PPЍ0!S R g8P0p (P\4S 0L0$$8P(((8S gQ QP0 4S ڠ0"S1 @`g0  <03/p 8 H0 0($P  0P 0 0 $ P (, Pp2 WEVF f q t \'O--0P`p,M⌃$0  1kp@d30S$` vP 0"   pT AT fT N@,ЍsT0 0$Xp00 0*0:@Dqp 4 `0}p0ᴐ00004S 00Q-$2!0  R8 +R.R+4 R@d!df\1R R8 0S4 0S$1 +10` 0`[ppr pn 0oO@@ *:Lp@@[|qW 8 H0 0 8 Y$ (, ` $% 4%t  ' }} A-@ĔQp Mp  A^PP`|t`WP \&PЍpP ,0 /PD< / K G-@`"pP& V4 t" Anⴐ崀 ` $$ _0 P ! p" $ppP  H00p$Bn 0 PD<j  G-`-@"Mip ЍG20SP=`pPx $R  4SЍ4S_P R 0a $ RQ  vSMP 4S P P 0UpL0 08  0 P ,!?o  0V0 00 apP:GRP P  V0p 4S 4S  0L%$%   # UV @-P `00CS`0p S00 P0S X0X /X?b0%C-PYMM 0"0 a,"  a %'@rTYލЍ   a a Q] `   `0!0x! \P XiL`D`0!0(`$` $ !P0#ⶈP$ !0#` ym0 $8 ``# 6@P``  G VRx~, s!Iu>G-0p P`@M!` P &dpD20S!qP$q@1 9lP`Pa@ P |```````uP :@ЍPP Fp}PP0S00: P 0S0S \^ 0 Q t `  `pᴀ崐崠W _ _ Q _   p _$%%Rx~.A-HM@Pp4   0`\0`D0 kcp T$  P 00S0 TR lRxlHЍTpT8}p$%~%0 Q /0@-$M` 0 0@P!!dq cp$0S00m P 0SC0S@ \^; 0T 00S!  0*a@ P ̢ԢԢԢԢԢԢԢԢ,TtopT eT  " $Ѝa$%%~00000000 0 0 0 S /-0,M$00 0 00 00 00 00 0 00000000 ^,ЍC-` M @ P   000sS̀p 2P0㓗' Cp0lS|p` P0㓆& /p ЍpW `VpG-pP8M(@ 0S   vP8Ѝ70 060050040030020 0100000.00 ,0 P #00R R 0S T `PP0h# AXPp@-PP@M `8@ @ ?`  5/V@@ЍpA-`P @ p!'^PU@p@-@P(`$ Up p@,A-PP` 4  04000 00:#:900 @0<<@0 Np@p Ѝ N PXN@@ W*0,pWNL)CY@-  P$E/  ]@P* *]|00CS񟗆HDhDDDHHPl P4 0Pe o_P0Sa HpPX x//PQ  d/PK  P/PE  </P?  (/P9  /P3  /P-  /P'  /P!  /P  /P  /P  /P X;SP ~5P= HS=[PX 0P @W 0P pG Pn/PU p="80xx 0P P R2"( /P  pRP eGPU  p $ 02#W: ,0PE  QGPP? [2" t.P4 0!xWxx /P) !0xLx /P "/P "t/P #`/P m0$ 80S SP <   /PpP0T I[00ЍPY\?,$%D%\r% Wy, )3 <Aph}p R/O--@`pZȚȪM b_p :0S ЍO0FS iSPpC>؀C$dP W <>ЍPP W00 9PJpP HGP0$$XBPQ<6GPP 2GP (0tBP\=<H0 &-P 0$/ Q 004 0.P 4P0P 4 P[  'P00 00 0 00[000000S$000(0FP XF0P: RPP <<<W=`P&W= 0$YPP 0`eqp R$4< "#Uqp$0`A4 L.Pb 4`5P `3P @ ,PQ @H ,PK @0 SD00H0$ RL0( 0X} {K$4P `$$pK$4P` VjF`P! fFP L&t\FP QP+8,0 <`P <<&?  0`qpt"p B,P4po  L,P   E,P  >,P   7,P  $ 0,P  X ),P q@ ",P  ( ,P q/   ,P r ,P 01S 0r/S㲰, s? Ѱ  +P s/ +Pz$$J$4P PPУ| A<`PA<$$ 0 `0 SqpS p0t< H-Pi <p1P < 8r < 8-PY <!P +PN  +PH H +PB 4< -P $ <8 u+P2 8 Y* 0=c$ Bp $ VJ P$4 "`#qpt$ AJX$ m0<"\U8008$0 0(0$0 00(0 40P0,` 0$00P00 T0 X0$$`宾qpY$$J$4P0 00H00L0`$+`0#厾qp9$$I$4P` P\?,$%\% h3p<}RY/B)Uy, K4S0@-@M P    0 0Sgp< <w 4,Kp$o0Ѝ0-'i$-@-SM@P, 0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`pv rD Sߍi@4-i@-!iL-@-@  ` k0Ѝ1p@-0MS1`0`SMj@ A. H01P A!⸽Ax,XP 0`0?oS cP 05P PP(X0 0A. 00`0P A ⋽AWuW0 0A. 00`l0P AX XlA\W000D 08WލЍp'_'X-%a-h-u---s@-?PP 劓#P 僓 O`@TqЍpP  00STV + YW@-D<0 R !O--M@Pp:p#J`P"    ICP+ dIBCP8=CpP XIp6CP QIt (0P0&h 0R0 0 p "( (Px 0SuhQr @ Ipgl $I 0 00  R R R[  0PW t [ `ΒX (oDŒW 0f0S, @ hxIP@ `rIpd HQ L 40R !801Sp0S 3/p\ R 8 XSIp \ 0S 0@ `EIp Ѝ--3--S-%.- .;.@-`A@P@ Ѝ*BPU 8P DpB P 7@8T ABP@- )P Ѝ A-MP p(@P00#p`ЍpP l ⪇0 Hp !0  )-i@-@p @A-P`BpP00&HP@?0(H E F2A-P`ApPt00HP@:k?0 H ' F@-( 'PU00 Ѝp@-8M@ (P'P1!! AP# G0 Q0s0S00nGPP"  B@6$p`8Ѝpl s  SG8 PA`6VB.FK..i0@-@BM M  Lp 0S 7  /  0(ʈP(@0S700$0/ 0h (⻈dP(@0S Bލ Ѝ0nU᤾@fU᜾@i...0@-MP4A@P EGP Vl0l l!FG 0 0S ,pЍ0..K.i/@-@M  4  p@oЍi@-M @&P0  x p 0!Q0s0S08 1p`ЍB/Fx.I/iis@-`Pp@ @@&P0  Q@Ph囐lF P@ L㒐@AP 4 TЍp/FoI///-/7@- P@0p\ \rT@ PH08 DDW 0<80@ p` Ѝ0-//I/-7@- P@pd dI0P<HQ@ P80$ 4(  @ p` Ѝ0---/I/p@-M`7@P0P0ЍpAFP@UxQ@Pd0 Dp<8 P@ PP *T 8/00i40@-$Mp@Py00$Ѝ F`Q@Pp 0 XpLЏP@ P`@ p$ʏS{5A0V0io0@-BS Ѝ]S|00p@-M 000  P]Fp `Q@P㚏 `@LFpt P 0 d`R00S ySSQU pSSPxi 0000@-M@PP  p  adQ0p@-Pp@`@@d?PD0D D;zEQ PAnSp3/I//@-v0@-M T@1%P@0@ @04 0 p 9ЍbFI/i'1@-M T@%PD0D DD08 0 p$9ЍdFI/i510-M $00 P  Ѝi40@-@8> P,0, ,,$E? p`//I/-00@ S/a0@SW@/A0@S=@/@-D00@- M@ 0( 0 p墎 Ѝio0p@-` MP@>P D Ѝp Xq    QD( P>@3$p`4vi 0@-,M@ Pl$P0 P p,Ѝ0 0R0 s0S 0   0$ DPP  0>@c3$p`@1FdI/4@-PM \@@LzV {G 4 4 PRЍ  S?]SF1R1n@-\ @ $P0@0Ѝ  p@@  8W1-$Mk@'=PP m哮`P00L0勮P  0  Rt0@`Vm`{`PT0 0XX@ @@@@R2/P03/`l1%`1f11%/2////0 0LL/%0 0TT/%0 0\\/%0 0DD/%  d00d0/%p@-@p!P 00p00D S 0A0CS0$Pɺ>P 0@p%@-p0' 0`P/ R/%0 O- 4M@@!2T0*  D`Cpď+ P(0$!pSڰp D@T PoS@ڀAP`@ p00L\pP` R  P Q R/6 0TS $P\(P  1/P B@0S  :Cp "SR(0 SdČ\0 2/P W0 [  .O'3ɚ;6eD<3O-MMPp  Y p`$㛌 pP$ 100$0 ч-P | 7CplL7 P *Cp Q 4P ]P8 p# Q P$S賟X@Tx ҁX00@0 0BPwP@S 0 0庁 l,0@4@Bp 0N0PH0h 04 40,@Bp ^ 4PPGP H0S=I0S:Y`@T 0 3/@: " s렢M0S:00 % p"fpM0S  PR@ PJ@03/@~ JSI1PJ/BpNI!1Q㽋a`"%J` 1 0 d1 |tp 1 `T!1 DO`<#%J^!1 @ t1 x!|1  jOP@Tc 03/@ 03/ݍЍ-33Y4if4~i44w4%i=5iQ5k55'4505ii3/:h55n=5555O-M@pP  p 2T k:@i:PT!: `P l P``U T1O0S O5030 }MW   媹P /Z   塹P & "P! K0S 0 L0S 0M0S 0 N0SO0`S  PPV N 05D< '%@-,MP@fpP :P`(  p00S h㞊 HW P00< <咊0 $儊,Ѝ-8'8i(9`$9-9@-@ g| 0 @p?9C-@:PP0 X`@ Xppp@@ gP |pPL zNH@@@@ ЍW9ds$2a9'Bgs@-@zE:@P00ЍpZ@PM@g@P <` |PHNu 9'[s@-@P:@P|0| |1@P$@g@P T` |PNu( hЍp:d$a9'[A-@!9`P0 P@@p?TgP i|p8 =400@@Ѝ}d$a9'9@-@ \PP0P PPL 0 S@@00 >00Ѝ9F$a9'%90@-M@9P9P 9Pp9P d0P P P P夺 4PIp YЍ0}:9W9'7i:s@-@Q{h~M w{P LvMHPH`{ P! ,kMЍpfM@:U]:O-M`@PK OppP"(  T  ~ ?p% (F( px" <@T t8P,Ml2P\%M UR T'Ѝ0 PK@PՈ $@?p zLt 0R Lk)L LP ``Ltqttt` R#Q\L LmMP8ЍOLP\ 0P   Q1   L0! RSez LL" eL0P R ` V 0P `\p\\-x%-8i(i+:;:$E:L:q9`: v%nUs$::l:Pp@-P`@~7P V  8`P ]-`Z-뽹 00pj7TpO-p@-MPP00Ѝ`0 00p0@ 0 P =0P 0 p 0 `P0G-@(P~00p(  P1r0`*0PU!V0"R0 a"0^0"SЍ/0PR 0 , vp 0 @0@-@P ,@ O-`@pP,(0V0S 8IP$P$P 40S 04S 0S(0p(`8P0S$0(PKO-M00q W$000Ѝ`Q Q 00 [PP0P XⒸU 0dP p,,,`4@[T / @P00 Dt0800@00X5}8 "10#Z0 00q 8 _@ 0YPpG@T 0CS0 0r xC0X0^ :T 0CS00xC0 xRaDPW@DADP7@Dt@S q00@Dt@ TSS0Z`<@qJTh l= 6P^+U8 @ 0 0 0`0]+:&://A-X Pp@`ᄳP00$0P 0 p 0 `P0O-P`,Mp@ P 00Y: P X 0  0P` 000   0>%]>0@-0Mx @pd d~S0PP  041p ~0ЍB(>>Q>ie> %u>A-@BM`(  XpP 0 P P PP  8 ! ll pz l R~BlmU#0P 6qp 6S30S |B0`P 6_p 6SP@30S <B 0P 6Mp 3Q? BI0P 6?p 2Q8B8 ≯ /p 0S0 1B8 $pu p p p 0@ TxPpD2Q <SBBߍ10S KB10S DBAB0  `0000p-BPU0``0` Rڬx1000 0:S R H^P8 B`p$PQ BV pWP ,A:AH0S LA A~ARRA`0Q A A8i(i$?N?iU?X'_?h?r?) }??i8iii(????%=???Y??0@-@P@-@M  ᢮  HpX}Ѝie>@-MT @P@0@ @@5 8 -p$=}ЍBF(Ne=i?A-`@dPaAᗪ``V``<A@pP`0FSQAU>A A- AO-`MM@ 4J0P4 lPgE7EP|7U'S 0`@ 0 @`F( 0RtPx['Vʀ9 0x9 0p9p 0l90h90d90`9 A(@ !!0P pQ  ?B0CSU 0     -B$ B8##!``F 0^k 8EIcCP S@BA`pP80P0 a, @!0@"0$0$0S= n@0 P0B'S 0؍Ѝ 7R  0CR.B B7R  ǟ#110BS00 2")B B,#!% `7R.B<7.B3"" N-B B00Q0w*S SS@$$$$2SK S` 0S- R< )StS0C'S񟗐$$#,$4$$$$$$$$$$<$$$$$$$$$$$$$$$$D$L$T$\$d$l$t$|$$$0S 0 t t0@0$ 0 B$ @^ R `%Sp@눅刕pW>? lR0 0 ?`L0S< ?0S `p000 ?5H3娀XP0  @ ?p` ?0S V70$S1L?0S p?`?pLY&!1wp`Fv0`(,04Y"( 1p, sgqwpW?V'0Si  d (( x?3IP  #P|# xßx Pt# Td?`L 3I@#S0S <V?0S8   O?3SI?0S+ C?rp쒟 `0V V"  " 0/?V))?0S 4#?$?p Y1᳐! 0F `(0Z1`( p'' 1u (( >1I!P  $P! P! h>``J  ^S| x!Stlhd`\XTPLHD@<0i@@IA@Aw@o>5A' A $X'4A:A??.OCAI=]JAWA`AtAjA{APAAA@@@AAUP@P#=AAA(A"@A@@@'@5@:@E@P@Z@b@j@r@|@@@@@,@p@-P M@` pQP0 aPp@@$ ЍpiB@-< @P$0$ $  ЍBF(e=@-< @P$0$ $  Ѝi?F)e=0@-MP "Mc0@PۍЍ0@$ P+ /P@$ۍЍ0@/0S0S1iSB1B0@-M TPp@@$Ѝ01 y@i@BTB@-T @P@0@ @@ I \p yЍ?F)Ae=~B@-T @zPM<0< <j   >pryЍ^F)e=B 0 / %/-@-@ M,00(000 P  Ѝ@Ѝ/P00  @@@@0-@-  ?? ЍЍ/@-@>/(C 0S/@-4'-@-  >> ЍЍ/-@-  >> ЍЍ/@-h0M0S@ 0  0000 0 Dp@@Ѝ4'9C@-@O.H..p0/jpC^CpC@-|MPP2P0S 0@P 0 000 0`p PiP@H 00@4P8PS`!031 0@-Mt 03@P \w 9LPP @ (@@ 0 P 020Ѝ0 %<'q@-U4@ 0<  <.:%EFF\P@-d0 !X|!T@0 6p0\ (0000/EEEPh0h@-` |!TD0 6p0\ ,00 00/EEEP-4s00#q^0<\ 0000/EEEP 4qs00#\,s0Q00/00EEEPL- 0:# ^4 0Q$0000/EEEPL- 09# ^4 0Q$0000/EEEP 4 <# \,4Q00/00EEEP@- 0:# ^ 0Q0P@d|0:0# TDD#^<s0\ ,00$00EEGGE@- 0 00l9P Ѝ/ %A-Pop`@WЍ <P 63MP@ p7@-P@U0  (l: Ѝ0)lhJA-0@nS0oSp@ plP``7P:0nS0oS;PP;PP']@-7T0 ;8nJ%O-MM<(0<,00 0D@00 l0C(p0S SH ٣8 00,00 8r45 RRRSp@-@PPp@(0/Sp7p@3PPQ@-P 64EP%O-p0000@P`᠐ (,嘰00 9p0@DTq oP\0 teP<qee9 O4$%T?,SY\?,jP@-M@A>0 0D@00 l0'pW0S SH P}7 00,00 q*4lRRRSp@-@PfPp@(w0/Spp@PPQ@-  4%VO-`0@P(,p娐娠娰0 i9p00@DT oP0 dPPmqd  3A+OY\?,U$%jP@-MM0An H 0P0 $@3'p Aq3DVp@-@PPp@(0/Sp<p@8PPQ@-O 53W%O-P@M P0P`r"8p+x2 0S00)0x0& 0 x`1p0 +00*`&0`k e'pY puPfPMP9 9P$ GP g@P,LKKKKL@LKhLKKKKLLUP|0 0|00|0|00|00|00pt`x0 dPpd|Pw[,0p0Z00t0X 0;;0x0UO/$00|00|000Ѝ\?,_X$%}TVjP-MMJNP0 @P:00 |0<&p0 `Ip0 0N/0 4 k000 0@(i42|PWqX7@-@P 0Lo S? 0 p Ѝ0X@-@m$0P@Sm@-@%0P@@-@ 0S 00S0?  oЍXp@-@PᢃPp@(0/Spp@PPQ@-od\@-M40 0,0,0(0(0$00 0442\\\\%5]\@-  @HP 0 R\  oЍe]p@-@ PX0 נ0(p9MPP(o P1p@3('\NO-@H `p巠H 4™000V S7p60`FVQp 2@FPR\R,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,QR,QRS,Q,Q,Q,QLS,Q,QP,Q,Q,QV,Q0V,QpVV,Q,QV,Q,Q,Q,Q,Q,Q,Q,QRRRS,Q,Q(S,QhS,Q,QtS,Q,QS$V\RHVdV|VV,QVV40S = 4 40S 4 0<007aE08:d$0000000D30@90;g)04 0I 0(80@008 0JbPn0@B (Q  Q@       a20  xa0$000 Ta0 000 0a0$800 a0<:00 |a08:00 ra0@900 ha0,000 |^a00000 0a0909Rg01ra0$000 0 0tT0,0wM0 0xF00007000+0嫗40 F Ѝ %]h %\?,$%T'L'X'XjP~P'/]]]]]]]l %A-RMMI>0PC@P@(0L BH`q刁( `L0#pD0KSh0  R< (Lh00 T01$0 m( h0^/P  0hPP ` p,@.`0T@ KP 0\ $00X 00P00\0|00x00t0 0p00l00d01RݍЍL'^|Px[]]p@-@PPp@(0/SpVp@RPPQ R R @-0m/_0@-@MP`p 0p"000 #PPЍ0P0 0 0n#0 P"0P Js@-`/P0@00 '"P0 9Ѝp0/0@-M@P r0 0P0h RP P @T@R 000Ѝ0'>\$_(002P0/0@-PCMQ* @41010 0000000 0P !N2< 80H00Cߍ0Cߍ0@o꠆F\O-M`p8@@PpЍpϿ| D<姝0D< Dn4<408 h0e,bD0(00x0 @E0h@0Kp P˝H00@JPF PD d0'[YR\D_O-- M* P@`pP0FT0<0p0Ѝ 0 3/X0p 0PP 0@ `I P* 00 PH D@03/pphPp0PTP@`P꠆[\T_0/A-PMM`p/# P@1L# 4ND0@@ 0@00 0@p'ߍPڀ@T ߍA8Hꥆ'O-`[ 4MP3@$@P :>@P`v4Ѝp p⟜ 00` 0 t@P X @_@00 p0p0000S X0Sp00000 xp  dP@0 Ryq D0D00X00000I00@ 000<0'q__'@-H /k-a%--0M 00H0 @P (jn zg 'oЍmazaO-P@M$ 0䰝 0p 0@"b0"@0@@ " 2p2 0BPa g@PHdccccc`dxddcccdce0p00@0mp j! 0 ^Pzj] $P   彝 0 S Q [j lUjMz e!! @P   囝 0 S Q /z ' lp 00k+   p x 0S0<S0@pS(@p @Ѝ?BT?,\?,$%ba_jPaaa bb@bsbb@-MMCN@800 0@(00 0p i 0 .".! .(0P( l.,O0P , T-0L-ލЍ4-(-bbbbbc!cbc7@-@P B0Lo S? 0 i Ѝ0X@-@0P@Sm@-@w0P@@-@ 0S 00S0?  jiЍXp@-@P%}Pp@(60/Spmp@iPPQ0/p/p@-P@[{ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P {{{DD {@@{HHzLLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@PzzzzpA-0@PJ04S->Cz->C?Xz9>:>Cz?n:>CFz 0? AC>z}C>GzmFzEnFzE~GzX J.X R  $$((,S>,`z}S>G[zmFWzHHLLPPTTXX\\O-@  $$((,,0P04 40TQȑ\5 S L5sT 0K TTXXp\\``ddh~h`lzlpwptttxqxy1[ hepb`0 `$Q*\5 S   0S&P%@ PSزK 0CA0Q R,/~2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P#‚ @x 0 `0 C c00 d@ @@ 0`B:C0 0 0P!\Qpx 0&0sS ( (X0xSX d`qVhl  00 ЍO e0tS ppЀ"v XА`vVhP,E'l'U ooTTPdH, 00/1000/0B10B1/101/ (o%O-  dϠ 0@ `Ì0 150S  0d R\[PU[Lp Ѝ$ş P` ` b5B?0L RW@QWbR3؀P/R4Dp\ D "r P D!!D!$ "r P "! ( 080P0 U PPpأ  0$5S?00 1>lV0@@TNN@D@` @00C030S30 0C0 0#0030 3#00020SQd 0@ `?5=0"ST0T00  B 0|"PSX000X0*d 0@ `5?먐ɿ 0! 1#" 0. ?0 00C000 xS p10S   dϠ 0@ `Ì0 1&! ! RZ'N40Aj]80 C 00 080$0C $$  $ a40 040 @08@T@d`T`@O@?00`1>Q@00S 00` 30'l'U oo p)p%p %Spp@-Pl`0@S     ⎌@00Sp0?00Sp0?0pp %l't0p@-0@SlkP aL00S000000B0F0p'p %O--MMȵp,> 51N_R0ePS yqሢ儒 ?D 0S\\/~D? 0?D4P p؍ߍ51  2@ŒD 0L 04;20d04 0@0  00@4T@:T @:T @9T @ 9T @8T @8T@@04s0p0N4`0S7w 0죟00 00p 0 0 `  0S X 00S ``a  ,⏒ 0#\0Q ?,040<090(08? $0mP@Z  0@Dő$ L00 /4;0v 0d0@ 0o 07 0r `W5 p^|S< yq/0/~D22220OD0? 0 04!0hl 0@DE0 L 0/4d;00 0@$ @` 04 <01?\0X0`0d09{0?,0{{{{(0 " @őDL  0?$+4#b 0 d 0@ `Ì0( 1up %d'' %%Ao'l'TO--M M: c>0?0 0 0D0Dp0S3 80`V/,0P0  0 "d'x'p'''u0@P`P 84m P@   4mpT 3T@  |&CP` *u q&P S(k0S0,5 S<0x0(5002 0,%S0022Q04B$N 0Q:$Fb" 0 04 0A ,$8 040A d#$/ 0 4QD$& 00 Q*$$ 00Q($ 004 Q# 1 0 S0 C' \1\cXZY1X0S|# 0X RR $%0 bH4aLBϠ8A<Ń@ϠPDŃPT\TR`8\PR001# `4UZ0 P c 2# S Q,Qd0Q38$Q<4R):$ ''t %x %qpp''pp qNqyqq'h'qq'VrTr'rp %8rT'| %''''Do#{  P\0`\5?>C00#!3x000844$0<0t D0`@`Y0|00`XcL5P5 P4`F   ?I8@pD ?B ?YYt00唀 ! o  A   >08$ 05<44R #11 p84<00x0 08SoPR @P0@? @P:aPP0* : @PP(5#R0:ƌP@$0Z`- 0000 a`8! 0/  !.1 >0Z`  b0 R[ Q[" Ϡ  ! 0 0S  BB00 P`*02#$ 0 ?V`1V`#T0`10F 0xI  :r B@TP 0ἐր됈  00B1  BZ`0 Y3  B0 S B!I0B ?H0 `ᲀ됈 0 BZ` S2 B Q 0S p ",Xu @P`x1 F084<ĔCP`0S84<$-0BPQ,`QɑRB1ȁ@L0 0 0000H60S|0` ?L4 0H4 0 06)kp>'/\#R2\3PPT``0 S  u],7\5?>C00!#4t x0WP7 (1#T a2!, A3 31 0  P 04 P ᔎ 0H$4  R$ (  B, @%LV.  R*h ( < ( X ( \ (( E.?.XT+BA.B,-0 HU Pat8 @40K PW0 ,p B8d i A YZQ!WZ 0X RA{ pW $4?.t{ 4 R?D400P@$04 0H4( 0Āp@2 R 5#< 5$23dr0S+`됺z z'xz {' 000d0 CSQ c6Rc+S`P  @ z犸 z'(Ȋ0 (08qW+S,h  0  R0:1P000\hP2#00@Q@0 0jp00 R00娺&A0 壍0S_` R  PP0 t`y6 K  WZ⋰>'^FrsHs'csd'{s*0%ht@%s'sTh'U  Tt p'd't'p %5tl't'8 x' `00Sb 0 #  V 0+V. K|00S  L 0=S,,0S &0S0 0! , 0 BϠ2\ ( ^  0 d0/ A! a,3 1 !0 1@ pppPP0 4R00 S  B S0 8:0,0 lj0P0B 0,0SP} p开8ȿ 0ᘥ+" < Q \%l"R!0@$00 @DU`@4AMV2( @R,0 `0```0T0,垹(s 0 嗌` pH3$([0`0 I9pQ004 帀 P0x0 0Sx0x0t\0\ 0⨁  B`[d HQ   h ` lS2  B±dd 0R@W%X U0   $0 C00 0 0 R R` ` 0$5S  l01` p00040S2d0$%ST0T00! !0H%SP5bX0`P5`S$0ds먰 o  i$0و00080` _8Q U+@0@  ,P+@֋ oU@0-ᴐR㰑 ,  BU (0;8(000T0 10X0岁0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4400CS T00C@Xw 0`4 8 0 RT:  $5SʠG $`$`(0V70S ,4 ` d,04  0,4 $T 00`  VjZ@80S   0帀0 X#` x0Hx 0X\%Ϡ  R   d@ 0DĠ dÌ!1^ @L9\%R XI0SP-pi\`/ `ƌ$  $ l0)`S`0 0$5S  l01` 00090S/dῇ08*ST0T00! !0\*PSX0b``[d0먠 ,   &00080@% 0C400400T$* Q`?0@$00$0l0`0@hppT:S $S0p0S $S00pW`@R]l倐H*]P00@S8p`0x 15pZ90JY!@@]l00 @ T: @ᔵA$\Q  @080 $0  $0d O@ LL lB;  _ p0S8=0S0 000S.08C =R= 5,\%R   0 d0/ @ `.3,00  0000P0S$> 0,@0P0 L>0S `0S vx>0S  VS j00|:x*0cP>0ScN C>`>0S3030404004 spCVW*0EXV.噂PHoV.GV℉0S  p?0 PS?\5=S,p??^ E?f0 0S 04 [ dLĒH 0@ `Ì014 ,$0S0S 04 C d ,04 0 04}ލ Ѝv $0Etep@wSaZO-RMPhb  X@P DW@4 PpߍP(  qppA0S <08 (00,0 000040!04 04$0D0(0 P Vph p 0 ͈ D 8 ,    +p %p gW ᤈ  p 8p?pq8SVTPr 0  *0*0@0 N  0* *d@edAzd@A-PCMMPp`;8 Rp@P  P0;P^ U 0 2 "0 CލЍp@-@PjPp@(0/Spp@PPQR/ iG-P `$ 0py@V` 0y@`` V`@&!D( `G-@P 4`S Y00000pquP0Y T0T! ## @P?Ѝ_uP :F^^F: p@-@P`    pp@-`P@ ((UX0 3?X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W0O-4MX0p0\00``Pȇ0 0,, 0S% P 0 "VmS aSMSASB0C0b0C S@8888088888SS@U@@sS@ @ @U00 0DT dS$ 09R 假"P T 0U8$UQUDT P 0  @@@ X 00 l PU0S00 0 000 00P4Ѝdde'eWe@-3,@ (x%wePt0@- @    O-@0p |͆Ph`G0 00000B_I0V W `BF ᴐ('l'P0  /PPP\!1cQ\ P/p@-TPL`(FV@ d0 P 6V0@ \0<@p('0P  C @- (Uco`/w4xs@-PL@` 000BV @ UЍp'('wOxs@-PX00S@H0`ă5#0404!V @ TЍp''('wnxX10 PS/C-DQ@8MPM`f8a1p P05 0 T:86S, <6ۍЍC+ 0  Q 0ˍ14 ^ 3?0\ P;0T‚ 0+ۍЍ'(''''wO-LBvM`jPP$"$yT 0F 050( %w,6倢" R 0 !cT0 :0C 0 !QT00,6&0A,6 0  B 00C0( 6V0:@!$`V0 v,v$&p? vp @ 0`7p0 &$& ?v00S&L0S% `~0: S(0( d X0d &ЍO,S('lwxxxx%@-`a,F0S@&R:p PP 0  @1AT@T  Ѝ P @C1@1 S  S R21,6&0,6   B ! ! 00C 00@('qwyO--@PGM X ?4F@0VD ?`0F  qS|?0V 1p5: T*; \dS T8 DT 0 0,/P(/U㰠Z 0 @ / @& d &F0K N TӔ> R`$`S k2+ [S!Qq 0BG 0?(:0 S 0008cS05=0:*0ᐊ 0%0UC 0 $P 0$   BQ 00   0pF0L000 60 6<g 0(0Q0L d01D0 0S ,0S eP 0S 00S40  0U0l0( XC<000`01$0pp @X80R<(0 x0S 0Sp֯0S00 0  0C##@(0\,8P $pp6 PPpuR0 SpG SP@8:`0S $sL0S d0 P# 0<4#S 0+ 0E{&,"{ @&! B  `!(`H q60CT 00C0CS\: B \XW:Ȗ刁XS: ,66(㫱 |? H :TㄢB ` ,6 0<6&$)(6XS:0TSL0S d0 iP UHP50S `V=@_ S!PSȌ01 210@! !0 ST40##0lU0d$6$[:,6 0&4.hF 0V4#000040 (`P0SMVPEPUI 30SA V \3PUCL0S \08`0 1K PP1 P# x⎁h37 6|0X0000096 30EPp`<d%P KP `W xa27X0000if & 01/6," Q *dh"P P 0 |0;PPP$"u v`Pw!k P  6!b!PU:< U*!:0U:0 0 xp.L0S]_Upp0S N<08 (00,0 000040!04 04$0D0(0 P Vph op 0  DY 8 ,    p p 4N q p 8p?pq8S#KPr 0  *0*0@0D w 0* *d@edAzd@A-PCMMPp`;8 Ip@P  P0;P+U 0 2 "0 CލЍ@-`^  @PV R ?0 \#  R  MS\F\GL \ xXh<gL| RDKTЍpE%KUJ%FZO%A_ p{@-u+P LHDDP<@ 00ZP@00 !$003 $ q W 45v:$ R% G  (!r h h$  k Xa XabV1h 0A0 yvZ$ 0@S%0P0Gmv 0h j0@P!01ZH5C: X0 !X00Qj*!?oR 20 P  X0 X00 (Axp~ÄhۄҰh%t~n o$1BхW}6Zۆ *3/?Yq%\]Sql(%gfffwUljRRaArrAa#+3<DZctq-{Q03!PE0QR0Q  1 00S 0S000 X01 00S03 15 1p5 X40 0 X1 d0_ ?80"2`c PP zG8?C"Z$ @02#D0i X00D 0080001l0$4s0P0<0#4s0T0,0#4s0X0@0$0 Q  *X" *  H\  0d0|2Q0Hh080 S r0S d08Ru800 0 00(0S( X0q"W030#W0 W00S  pR:*`pp0c0S  `+pY T   3x0S X1 t C/oS" R P0 X 00 @ 000$00<00T00,00X00L00p01t01x01 0040 0 1$00(01,0F?03G?03)0 01 01100 04"/@!b$ 04v 08 0#$ #(#< 0 04%^ \?h R(0S00d0H 0o0 00 ST p%?   yp T]   R 0 Q  !R R S 0S 60$610110D @QS*@ CtQL000l R X  R   0D0 00B?oQ20S (0 00 25 010P C0024 01000pX40ST0 $00 @0l) <0S # 0S,0  0L0 ?Zp0  <0!t0A?0x0 0 40S  Z!  x h XQ 0 Q  80S Q@F,0S1   k B*{@-S-I A 8 /eA@00@- 44@4P\P 0B"" p(-@=B')0/p/@-\# /  %G-`@ P pv!>0P U0 0  gP@ Gnv0P\0[ 0L.E R 0'E U   p(`?,Ŋފ0@-xP@ 0M  \ 0XXPЍ0 ,P 0 0 0 p((@-0 $0$04}S     Ѝ@-@p$M0 0S ` P1 00P 0! 0))1 lS\NL@DpQUVPE:$ЍFamg:0@-4M@ 0P0S ,Q 0  R0  7  0$4Ѝ0@R  (  0$R 0S 0S 0  ( 4Ѝ0@t4Ѝ0p(ȋ݋ @-Jp.D(H@- 0 R* 0s# p@0)P `00CS`0p S00 P0S X0X /XL 0%p@-`u@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hfdf`0buPp <10C <1$0 810S81p( %%%(0@--@4MT A`dhQ `"R d2RK d2SA = hk0:{PPS['ΞkHk?[E{7<1 = > * + (+S  PPP 0 @@@ ! zj{ k{[+S[4Ѝ00B:k{{'*k{h+S ?@@-C6?Y@(p(%>Te %((ӌo@-ei0d2SÚp(@0@-0S0@d2Sve`2"R2 %p(@-@ 8!<qH 8!Y{  { ,00X@ 㚙?333333?p( %O--pdDdd`2Ms=pl"PT1^RP3 20460 \86. @'*t* %<%b/t8*͠ p1G-0S ``咨@`TqT T0 :D1000@T0S ̦@p㼀 T0:ۍЍ`PP@p0 8 Y 0  000PU$ *%y*0A-0S 否P`|p| U0({@TP`0  RF000S @*%*A-p`P@P pPpDorP 0L0 0C?oR20S  P ¢%ܢp@-/0@PY 0Pp SRp\*@-8oh0S$0$ 0 0Lk`*)L%$0?S/ @-WP\*N%A-0@0/0000 SPnڨ/0>+b!T0 L< WP0? 4  CM00?\*T4*N%0@-@0 0>`0@0Ѝs@-@P`P @TZ TTC?0 00?#`+"+R  + Ѝp蚣%p@-<p@ P(@@P0P0pN% G-1@`pVBMu Qp@0DWBߍ`TV B/ {g 0R ?s0 0c b@PQ 0 ?2/ 0(10S 0S Q0000 (hX:0000R%*0S =0 0S 40 000R*Q l\0S Dz`W0`S l*(.*;*%ң*O-l3P0_MS XXTsTC L0D#D0+b! L<UP L A0?0H @L #PPD f P #P&P|u_ߍ*%*`*x*3N%T4*@ u\*N%TP  *֤0Ux3t5$*%N %@- @ 00: S *G-@qaP U+ P00S 0 S00P R GRڀ00S |pZP Y X3cP Y 0:0S $B*t*%%>PbO-AM M` 0opP@0 @ Aލ ЍO/9/P( 0`!`'aPQ D D @P ,bPD }@T bPD s@D `టT Aލ Ѝ  A>00C 0  R + x D M@D s`0 YP  0 D r)T4*V %եC-M Mp-p0 /R @`㬐嬀 G;PP 0S P@ۍ Ѝ00 D ?4a`D @P 0V l]P`PT4*p@-0@ @P EP @p@-@@O-3tM0 S ppעl300RS\3 P3P#0L\DC0#S8 44tЍO辢$U P d, 4 00p`00@Тв?` _0@ %哢W6 ! h`V5VW p$@P p0 ?0@!  qnW ?0@ ]Z!tЍpI\1P0xSiS?P 00@ 000 0C0T10S 0`S#Y \` Xh0SS   80S d00X00%E0P!Nd0 8d\*%x**`*N%%/\*Yd|**~˦ܦ* -F@-AMMP 0pP0 pPd!d@P TTKLT d:< 0BAލЍ QD D<`PpU U + p 0P c  t0SRp T0TP 8 c8 [E[%gT4*|* *ڬ@-+P@-L@0#S 0;4#S 02@N%N%0A-@P` 0 P0: 0tpp ?T0@$aH00S$` T` R 7eD0&F$ ЀP 0P  %AR(*p@-@`PP0S @ 0P0 @/vPx]I^0P 0 0s00paO-2lM0`S ||6x2XGhP uaP LDi `  @(rP 0/*P Q 0?*A Rg@ !!!0 80` 0 08ak ps2 3lЍ  P U@   / 0lP P @TP$ %F    0 ($  R ,  R (  R 0 $ R 4  ?P@ 0!R   3P*%r|* Y%*(***h*ƩC-20MS 倞Y܂r 0Q+P0 00:000Ѝ PPP `` \ T8P `0   @0@D`P "P `  s/1RQ rQR $ 1 RP P0dI0 P T1 @1D1@10S0"(  0 AD@(C@\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", tP  *%*(*VZ%)KUwx**۪ **d*@-@MQ 0 3/00؍/ P [ G W꼊꫊0@-P  *%0@-Q 0@T0 R ||倝0AS@ ЍH0 DP_( H%* .*%BP %mlp/0/@-x 0 RS T0R H0P88Ѝ S  .*I *}%A-D@p 0 0SP(m ` PD P .*L0@-  Q0 0P ,0? ЍW .* *%@-0xP 00S@%*S` P@` 40P , $  0hЍp .* *%@-0 0MS 0 @B4/ t00S@\@0WqpH0PP`_3 0((P8Ѝp* .*|* *3%p@-hPh@4S 0SP LLH0H P0000$R0p4 .* *g*2*@-0@0 S 40B3/ l00SX0:pH0P`@^ 0((`Ѝpp* .*|* *%p@-P,@P@pP @lp@-X0XP0SpH`@P $P  1b@ph*P % .*%A-@ 1 a051q0S :pMPP 00@)P@&=n[PPG^t 0|{hpP9^fP 0Dm000A(h* .**d*0%P- 3*C-`aM! L HO F 08! } (A(C08!Q  0"P5/1X, , _ & F 0`  S 8#`Rp00"0Ft F d儛00@ L:,ЍH *6% *G+X%*j5F *WvO-鸳@0EMSP8a  0 @|00T*0 ?o2Q03S L30S @3 T<#<  0S 咿Eߍ0S3 00p0"0S 0"p! 0 V V V-    0 B B B  0h"p+ @20S L0@   0 B B B  0"   0 B B B  0!0S  0;ZP 0 5ZP. 0S xƚV V V     S8!཯!p0S      b V V V|     + x p z     =L *%t*6;P %DƭYխi| 0P/00S &^P % .*P0O-dEM940`SM P < 850SppލЍ90 Z i400RSp 40SppT)9S140404$04렴堤 M B00  4 S BPLZ0 S 0 ᔩB)R)  0B.d B Y 0pp pTh͙S PLHL B♽ P PhB"YP u $ R B  WU $SR [ Pu  !P_t2 005P 20S )8偙00A,0 S x l#R QPSÝ\U  $   )a#0)90S 3) 0S 810S.0S 3 #W3P) RYPER00PES @!U<1<0 PUJBJBGPEU 0S 1 4S 04X3P UB-PE .**3*x* *%{9®[*3cnدP %Bh*t*R%s**ư߰1]S*2*O-hChs5 SW0 R_`P44)0SW  0PS9S00P0S 0S 埘09Q ?oV20SKUNU5E Q5 IY`Vq``傘\2 RE R; R< 4<w820S?,P; %+?909909 ЍŁ01 @+"+R ! R  tEUY0+5`LlP d8X $`e +Z0S ? PmZ 00 ?Rqp V00S x 0S 905 ;#;S T%=K+X R? .*h*t*%L% **^P %*iձ*7*@-7M0@SM&6PP pP P `ۍЍV0S60S 巗00ZP x60Sf PMJ G DA>;5h]f:hc:0-04*48'8<$<H!HLLN:K:H: xx||0:9^E,:E)::^E%:ET0ASqqpqqp i Pl 4PE PehT0S\40S PP"00 ((,,TTXX\\``+X0 # #1 0002#22 02 0 (0#(0/,0, H0T0/X0X0\ `0/`0d 0,dQ20m000%60"d20=S" " \" R `LrVCDS@"@ <#3 ( !0!x30=00 1R 00# |# #X0/80\ /`0d 0 %0L0<040h0T! AQrr0U(0 "S j#r0(CA#͡ 5/0(0#R00 #0Q0У dZ0 (0S  F(C#5/0(0,0S3,0P0?0!#0,0@'  P Aۍ<ЍP(0S #r(0AC#͡5/0(0#r0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  B 0S 8#R00SR 00S \0l 9P tlx3  P8P0S*T .*l *P %ڳ *Zt* %& 0  *0U@-@0SS* O-@M00< 04000 0 8 0@bPb  0@ @ H0LP Dp`P* ` R  R  R;  R 0 PL RM  R"  R`60S  PPL60S C868PU)-$P"?Vl 050S  lP% R #P 0 t% R  ddR PЍ0HU00L%HHX0S50S  $540S   PP 0 0 8: 7   W0 0040S 0 d $ R  8#PU# R  :  0? P U 0x  W 0 0 8\30Sc X \T 0 hI+0#P0 0020S  2PU-20S P8PSU 0 X XW 0 0 820S 0 $"P|0 00o 310S 403/  !PPZW00 0KX10S00S 0 0 800S 0 4\p 03/PU 4   00pP  *r%*%*|* .*cD%XUVTW˴<.** ?Y0U1B^p*@2*TXY_A-1( 0  S !@ 1 1R 4S8 !4|q04@0t\a00S/ P0S  R+* RS-EP- !0 010000 QP 0PT 0$M @P ЍPB+0P;C0P|80S050 000 @ 0@0 0* *T .**ڳ@-cM0S ppɑlClS0S Yu0ST00#0,,7 R0 2r  0500K Pr5"0C590C990C9000Ph|n x0S \2d"`2Q090 9BލpC*-ϺA-P@`"K<0 pKW AC*Ϻp@-MG BP ? 0SP  <P|0(PP 0@ 0*>PS ! 0C R: p  d!  `V$@1@a0 T0 0d Do Ѝ0C*@-@T T  0Hy ,q(Ѝ@r>[ Ͽ%ݿP 7P P / //-M M? [Uۍ Ѝ䈕%4`00CS`0 XPX0 X /0%O-pQDMDЍO/>@x'`pP W200 RR00u0PS00C00@@ Rp@T+ W-Y* U U    L  FP0.|    L  E.0 ↹ p W8ꈕ%*ԻC*l3<0S/@-@QPM PЍ@ p31Q``X00CSУУУУУ У        ̡  X "2PЍ@M }!0S S/   md0AS& $4`,xhH^ <840T 0SPЍ@Vy G C ?0VE1hS fS501 0400030020+j0CS PЍ@=01 (0<00$0;0d 0:0090080070060 0500400300201jS$ $Q Q !( xVPЍC*7Իbhq  _owh O-@`pRF%O-連`0S000d#00P0P0 0@S ꐩP% P@ @00GpP0H0p XL0 0L00 Ѝ@@ @@[8 "[: `J `0PE0Nqp W aNQWNANQ7N^\ ĪЪ "V  0C0pY/90H?o P20 Sp L0 S 5vp O  ЍOIB&p/00puP XL0S PeP0X pv#&pnP PԴP 00 7/ C*"%eHp@-P(@P +GPp@t %0S $  R R0@- :HG*@- (0 0 0 0 0ЍhP P P v@-(M0@ #\S@3@#:@ `(Ѝ T7@-P  Q,XAP Ѝ0 *@P .8PP FPeHHG*HH*0@-@QPM @4OT 0d@Oo@5_0 ! "U  R P Q ,AЍ0T%< @|%(Tr d T%Tq < (uP"  @HG*eH%" Q0@-.Pd0 @X!P@QR00 00HG*THI*0s@- @R`  pP.$8P ,*A0S ,#A|Ѝp l0!PU U 0< 4(Ѝp@)Ѝp@("%HH*eHHG*+@-@T T 0( (  ЍЍ@5Ѝ@3HG*p@-@"1Q0P Tp@@P  p@F0 p@@BO-@"P\MA@ (p @@0$@,0@?2PP PP  @@0,2P``uU]\Ѝ`P0  FX y RAx   <y0P  nyY  4\100 0 S00C00  Q4P p0 <r 08pl0Y x`00CS`0 X0@T:\ЍOX0 X @=UP0%("%d@-00= Ѝ@-0  5 ЍO-@p P4 aTAD -QP  P PPP@D`FRPP00SP Ѝm@-@0 0 0 Ѝ?@-  8%@-v@-aAMp@0WP M0`qT1T!TL0P 0$1 ,Aލ Ѝ`00 ! !01 ?t0 !R  0G6L@P'8 L8<T0 <<@D0 H0X0X v0 DD8J* TO*\]S /Q@-*TO*0@-6S 8J*q@-777x7m/l`@P" X}Ti w <s4B, m@qp~HK*+TK*@-C y%0@-h@  0@ 0\0CS @C꬜%p@-@Pp00Sp8PU``p840#U:I0X 00rX0X40P80 >0X0p`P -7@- 0@P00P R*00B0 Ѝ0@Ѝ/O-dM@pP )FP@DU 0 S sdЍ` |0 J0]0 0 ^`!0  0 `00$C0  .0`  V0BrP EP%A-@`Pp尀@"!023 U 0 rpp p rP@T0S0#P   Ѝo-,MZ 808"40!00!,0 (0 $0$"@T]gq%-7@->`P @XT@ R 0@  000 Ѝ0@Ѝ/8"%P*p@-PP@ E0S 0CSx 3 0pEp@ PP 0 E, ,Up0Sp{P*P*A- `M0p  0 @/p Ѝ P  @P   PP0'/pЍAt01Sh0 `0X2TpT0`0S ` FP `P*8"%UnC-q@1MS0`n1SP1SdV1 묁XV ЍCVR 1S  @1ЍC[4V,p0S) S S =X    =X  VЍC   = X `x TTs ЍC-VЍP*8"%U%q- j*4 0Q 000/ P*8"%A-|AJM1MSh=`p30 `PBD c40`0 ".p0S JލЍ;X P0$DA7J.H0 0A1$HpL  $`0P0p0 P.pWD Ls0S8l!10 P*"GdG-`Qp1 `S1S@1SHV$1$ 1SV GV1S G 0_3VS0  夠D@d0SVG1S Q 1S  < GKVP*8"%U%}j;C-a0$MSP@D pTp/ @P 1! C   0S T0S0SC0S@ @0 ]-po$ЍpT 1S!0T0  rq 00 CT !10!sr 000 20 0( *00 0 "P*GO-lb0MSP@ἐ upTp> ,pFC,0  ,p[Ѝh { 0a[ J0S T  MC0S@ 0 ,poMpT 1S!1T p 0  T 1!0 00 0 0  $ ( 0! 0 d ,"0 ,   0$0(0!00d00 , 0  , P*C-0P80圐 ,MR/ !!~1P`,ЍC`@ @];(0`0$0F P8"%P*P*PdR*O-\M`c>P@谟Q% 0rS P @0  0000 0 0^0P    RQ  \ЍS @0  0P@dR*A-8Q夁X@`!1  0AO!pRS5V0 1SV AVS A 0Z1VtTPDP@\`XU HA ^VP*8"%U%'0@-P@0$M00PP0 +p$Ѝ0 R  h9d0 0 1S0e0 000 0\;P*UG-pq` M 8@0D @CT Ѝ0YЍG7S" !10  @@0 H+p Y PP   @@07+p !R Z tt00CSxllll4{( P*P*60@-P@04M0@PP0 *pz4Ѝ0P  "!  0 Q T0 0 8Q((;P*8"%Zp@-`@0M 0(`` 0 *p5Ѝp R  V|P10 01SL0 D1S**P m!s;P*8"%UgO-DMhpXP2 0S 0 000 (XCP (0((  `@PDЍ0(0(0 0$``(0s(  ``$0 N*pDЍO((P 0u(  0C$ S  u'P`㨡娱唑( r00R0S X 0H0 0,,`!10< 0( (0(Ps ( @ (U((0$ 00 0 00 0 000  00 0$P 0 0$ 1SD"!!!! P*o;p"%CAwC-M⬀p`` (8W000 0BP !  Ѝ0000P:@P! PP  PP 0)pЍCn 0R  (10W400(00 P(| 0SQP k0 Pp0!00(aP0Stpt1S`7\p\`D0S U * &Po;P*p"%CAn0@-P@0,M08PP0 &)p,Ѝ0 R   0 01SL zZ{e[jKZfke[KK{K+S;P*O-MMpdb9D00PS@ LTO :P" J@ > 0䱟Y:0@@0 (p/o>ٍЍ>0 0 \p  Y  \T  > "QPR !$%*1 "! 0T 1S!1T0 0*~T !10 0*r}p: 0kG o@: 0  \8P*]O- JM M`@pPf:3 <`:0@0 0C?oZ20 `4  Sc/b8 TK'1X0 0 04@XTTT4S <U08+080;<00U0 +;40@:@#TRT 1S  GR:1 W00   @ 0p3p0,D(,`(T ,@ (,80 ($倀  , (,  (  , (, (ĩ  , (, (딩  , (,p (d  ,P (,\@ (4  , (,0 (  ,}(,y(Ԩ  ,q(,m(뤨 ,e(,a(tX 0 (, LT(,@P( 0(\-HQ L((D% W 7  0D# /34@pS pR,d&(,F\7$R [[ 0WSW XQ;X PD0<4EH0 1HL00 1`00D0 &p)L0X 10@sX夆4 0#R0X00Cs 1SLhX0@siW 0 0D30; R 0Q(0Q VP  54岰 8eWP Z-  0 0 0P:/00DJލ ЍW@ Z H0&p00DH0S  0 @3SSH0GS*t`X  "80S0$RY 0 00@0P0@3A4/ 0 @3S`$1$04S# 403001P  0"&p Z [<0 S0!,sP40S0$ 00    $ $ 0``00040 0 0 S 8pz'0S 0R 00C0 0( 0R RX,( _P ,( 4H0 %p0 6yH0 %p0 l i;㨀H0 H0%pp;0 SpH%pP  H0%p 0 0H0W< V:pH0pp Hi%p0pH@P0P !p ppH0R%p 0H KP*x"%V3cUp"%P*(@ )4]xT*GPXbjtmx dBh=S*8"%O-`ĿqM=P`{*@Pp Up#*p0T?SpDp00p>&P.0`0\/809` R  1PS0R @`  :00 14@:0 ,&@@<@%@D*P0@0 p @0XW!3X0 S7 JRED="*@P 8   <8@8@8P T ,*P  8P+Y =y-  0S%T : 8480T  0S:0S @7PY@(7P,T 7P 7P0p40 7P0p40 7P 7P0p40 7P   7 PT  r: 8 ؚ804T 8 0Sa:0S x7 P"T  T: 8 ᝛8 T  k RB: R!P 0:{xP7P:TZ 8@80 Ro aBQ* p  `080ikklgj   | p5p3p19 8 1 8X ( 0S 90S 1P00: <00140k0!S0< 2  x 0G0ux9Wh)  9 8  8X X 0S 90S R0* 0%0%00140k0!S0404@Tk0d54`5T* u9 8 8X l0Sd90S `   40k0!S0 S01W40Sv  kW01Sk4@T 0G?oT20S0G?oT20S0G?oT20W0S| \NWPJ 0sWp0;p00$0P.&9008`d `@AaFNP8 B+1804@U08080S@00 @ c/4 4 6@ @"5p8 80 @ @0Y @  1=0 ! `0400<0@0,"p8 !105 "\04qߍ 1PS co p0 X8dtD`5p`H 9"pH0SX Z@8H-0A1 Nd! `0 D00@0`q9"pv8 !10`100CS|$$1" ='@P qߍOdoob4S 804(4 (04c0(00000(4, p!p;W,Y RT=00D@ N0`P0=S "8 R  t@0P 0=Sf "8 R b  @20P 0=S t"8 R  qߍO ( T V0@40,@p_VD@90S  1S%X'  PPP `V-p P 0D 0(0 0,003Ap06/00 HX8d8<800( ,p0,S(` T'&7 Xqp 70"S 7 L0 SX0T R  00Sb SV S0F&$0Cs=" P* #8"%$=TnEgz](9.hJ%k (@'x"%5<E[}S*P*0P T0LP0PT0p pWfp&000&00' T0&P0.T0hP70S\@@T T TT0P 000@L F0' 0 0 & 0.0080h 00؂2`@PV\-PP P\0p p WqߍOa60S0 0\0w0 00 p0000s@-@P   x l ` T H < ,b% Ijx t0p@-@PT`3 P  p@0埯p@ U*;-M M P $P!ۍ Ѝp@-IMM @`PkIލЍp P0 噗0 l哗hP 0S 0S0 0S  0PZU*@-M @ QPD-ۍ00 R   PU*H-p3MM@@vPPXY %P0  42P00S` = 2P  AP``V - 7Pt2  ` -`P_ H2P @2P ,$PP0 0U,00P`0SW J1!P J fPP ޖJ1!@ P\10S P 0h20z 0\b2PPPUqWP P 0 V_$PiP`ZZE_oR0 W$P  4S J P t剖60 `P:< U*wqea-%RrO-@M M`;@j/p" P@@@ p p0Wp0Y:d0S @Pm rލ Ѝ0Wq@P @p10P 0Z 0 p 0V9 H1Z ]P Z.$ 2pZP Z. 20Sa000Z0 00V9 0Z 0P Z.p @)0T:Z_P Z. p$|dҰUedAU*R@-0`0 06PP 0@PT 6P Ѝp@0@(PP 28Ѝp O--\M, (@$0=PPʴ`\ЍBT0P0  *Ppc U  XlT] T` Tc;88T8000 /<0$ 0S0R0S p 0 @ p0`@TW*303# 0303P0<0d 0`ZG*$0S 0[S0dOt  㜃 0H8pz 4; @.pp @ H6-6R801肟R800S8<ȂP0؂R80P/Wp1Bn,0S 0( S5@F000 0S, Z竸J0相S%8 ?/ <0D8 ϠĠ?4 00.@4 00. {{'0 {0Bnv 0 1 0@0pt, t?H4  $;p  @D0?4 $;Pp @0 0<0 {{'0{0P H8 ?$ 0.@$ 0.0 pK Y@q#ir{Q9X#]0SP0剴kფ0S? 00 @C%  pTP 0pP@<p~ ?4 ;H2pt ?4$;P(pj P0H @8 ?  0.. P0 (.` 0.0 P[ڐ竸z0^Ë4: 0相S?ቤ 02 @ `LQ@*0 @`Pp& ?4H `@;p 0 0CP$`;@ p {{'{<0  {{'8 AϠĠ?{ 0-? 0 - 0 -<0 Y@W]w@-\ /%G-䐟`DTp  P&TD PEE$U@X .P00@.P 0-40 $P @ ,3MDPE@DU*h  @-@Q0 0  .P  @0S `#P L)0D 0@ 0Ѝ R$v#"%*;\*(***3@-3400S (0 0 pp S0**Y*@-@L0@3@00S',0, 0S00'8@**4*t*Z*C-pQ@AP@pM0a00 M0 q!+ 0<P @0 @0`ۍ Ѝ0 000nS% ?S aS@ 0@IpS qS @ l0h n@<0 P@0 @0@N*\0%H*m%8*}T* $00S 00S/T*8*A-X`0S L00S 08P8@p0Pp00H*0*T*8*@-RP@tM  d P RQ ğE R@S% h4` R0Pt@D\ <8    Q(P   CR @ 0S $ L0 3\ P000ßx^;0S@tЍ R Q$P \P! P 00^`\ 1Np$$ l \ VpH 0P P0 P p00$0[^ ! \^ $^``` 0QD p1A$\% lH` CQw A0Q  $QTO 0Q D R QH ]QK p`1A$`VR lH` CR B0 pp\^ $^'! 0QD p1A$\ lH` CQ A0Q^,^ ]^Lpp ^0Mm?\QQ Qpp,Q ]Q %%8*I*8*8**|PA-@@P@T W-@ P`p0Slm d0 @ P,0< 8(0@A"% *U0E ?\**A-@P@p0S0P0`|0 R d R 0L 0S @!P@`T !*ĉ*h*"%*(3P@-, 0 S\*P@-, 0 G\*bP@-, 0 ;\*P@-(@ ,000 \***P@-(@ ,000 \***P@-(@ ,000 \***'P0p@-AM 00@0 0@S, ,1 AލpS> 0S0!C:P 0S0=PP 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&04 CS:P\*gMp*RWd*`*\G-MP3, ,4 ލP 0$C4:P @3@/ PY30S CSc G5PP / 3@cs0S0S PU~T30S4 0 P. H30 0,30E> 3 3Q0RQ300?o2?&Q20S  2 0P0002@0 0R R00 R P (2<"0P00  22\Q100?o2% Qy10Su 1pP0001ph, $@- $0PQ$0S0L$4PU Q 0S 0S 0P 0 000 00QQ000?o2%Qx00S  `0 0ZP00080\*sH* Y**4*d*P*`*p*RWT*0*h*PG-0JMM 00`0 0`S+ @1 JލЍS2 0S! 8P 0S0G<PP V0  t1t p1 R0 0S0Q)Zp% 41 @T (1(j! 8PʱZ@#P0͡ ,0S @$00 R   R 0D L'l0P04qp %R0@;\*\h*`*d*`**g*0 0 0 0\*o0 0 0 0R* C-KM MP\* x2 Kލ ЍP0\"C\8P @<2@82000(r)P 2 0S@2j- +P0 caQq0S 0S 00 Q3@P -`1@0S p[5PH1 \S0-P 818!00,1 0K0S P+ 00 000T   /o" &l0Q00S 0@0P0 00`0@\\*H**`** Y**4*T*`*h*d* T*0*@-PAMM ) 0 AލЍ@PP0 ܾ` pF x#t0p 0hphp0+@7P0S 0 `X\** *  0P/HYP@-0@W)000 坾0\**'0;Pp@-@PoU p pQl0l0 ၾpP `@SP00 LP )pY*HK0@- 0S<*\*P@- ) $0 00S/0h\*h**]0@- 0ԉ*\*Pp@-Q !0?o20@0`Q  -0S 0 %h0S P (00p`@tP T0 HP80 4P400 0\*x*Y*H*l*0@- R 0h*\*0@- H 0*\*@-(@(0 = 00S 0 l*\*x*0@- - 0T*\*P00P0SA-$a e(00Ѝ AP0q?oѣ2 PP%|P00\ Q 0S h000dP ,x"7`0T0 0R0D00$\(  ,m\*p**H*5Y[*L*.l0@- 0P*\*0@- 0d*\*P00P0SA-@ '00PP.p`P 0 `0 S   S  $0S00dPL03P < 0?o20\**Hĉ**YP00P0@-S ' 0 ЍP  5P 0Pd00}S`00S T0TRg0HP 40 0, 0( 0\*$h**#|*T*P*0p@-PP00008@Ppp d嵢p@P p@T'Z2@ 0S80 0嚼00g\**+T**<UP00P0@-S 2' L0 ЍP 4 45P 0 )P 0\*gz|*@-M P' D1 ЍP0! 5P @1@*P0P`p )0@P*0@!0 S0 0S P P l0 Q0S  L0@ 0P000$0@\*H* Y*z0*|*T*@-P& 0 ЍP 0S t 4P 0S0TP0@P ,0 $ 4P\*|*G-@PpHoᩒ @%P510S1ЍG2fZ0a1b& t1 Ѝp.ZP+L%@PA 0|S@= 7@P 1 T ЍGlP*Z h% 0P`0`ZZpʤP0 Z pXQ(PPP 0RP$z5|0@0 V P0 0080"7`**\*PDX A- MP% 2 ЍPO0S!3P 0 1C %P 00|S .7P P 0t$@h1d@) PP!@4Q  @-u0\*P@-^ x0 p`P \00}ST00S H0H`@PP 00 0( 0$ 0\*Th**Y|*T*P*P00P0Ss@- + 0 Ѝp0` 0S P@P y0Q R   L[ 0Ѝp@_$Ѝp@N\*`***Pp@- $0 p0@P0Pp\*h*C-P D2m@r0S424_P80S20S 1_@0 唀 0ܑS C"! !    㒃#A P0 U0CQ00CS0F PI00CS0J PA P!-PS0 p` 0O_0` Ѝ0 `v` V` 0咃" QP 000 UQ00h0PEP00P0 0 Sp(0L{0 0 S\***T*1***0%&mP@-00P0S`  100ЍpPl  4-P 0)qpP@ 0 $0$cU000\*g*P00P00@-SM@  00Ѝ0P  -P 03)qp P0P0  媮) 0,,0S0000\*g*P@- 0 P\*@- (0@P0 @ *P00P0@-SMp  00ЍP  ,P 0/`P PPP 0RP{@x   -@  DR  N ኰ00" \*\X PG-00P0S  Y 0 ЍP  [,P x @P@ 0R@6`-|0P 0}0p@ppp`0000 0D0 @?0Ҳ\*gX*x*h*PA-p 00`@P-P (P #P@*p0 ` S P:@@ @000 (-0\*] *؉*܉*0A-p`P@Pd0 A\P x00A-400SU0 A*[h*q A-PP   R ЍAP  R  @0S00Ѝ@`p\*8#%*0A-p`P0 AzP@PLp @A農P !00 崲00\**[Pp@-Z H0 p@00Sp@000]0$@$P0OPp\*`**h*0@Sp@-: `0 pX00Sp@H0H\0<@PP0,-Pp(\*`**h* @Rp@- h0 p` Rp@P0P\ D@P0P ,Pp \*`**h*;C - BR0 R  P R 䫲O-M$M PQ  x3 ڍ$ЍP 0\#C*P HS@p@3`X ,3 ( PP@* 0`t' P0S 20P @B 0S0B*00pK\"lI\<"0SP$S \S0P0$ 0""  0 P##00C   BR 0 D*b0 0B@0SPiR 0PS 0 D *b0 .@P$18[ 1 R ! R0 R Ȱ[ & V  尰2/ R 0S `0* P@0 0000wX& 0`SM!\*&***L*%(*4*h*,*<*@-@P 00P 00P00 -d0lM {T00S 4D 0d P,00ppD@*0**\*-lM\P00S @ 0d P(00pp% 0**\*@-@xPp `0 0Cs0S03  |,P0 S 0Cs0SP03P  0 0Cs0S03  ЍPs@- P@: P , 0S1PS !|,tЍp@,*`(P %c P00 0,ׯS!0Rh\np@-@P ů00PU  Pp00pP/0S/0@-@\0%\#0S P   R   0W7 0C20s0W70 0C0꬜%s@-`P0@P<w0*.o0St 0l R00@~Ѝp  R  B0 0Cs0S03 ̉*C-pPM0P @ +PP0P   +P 0 00P10S&" hv+P0P 0 U ))) 0 01P1 }9oЍ/ P @)`@w P 0PS 1` P):`h P P)*P &:Z PP000S`U'  |0S 00S0 @Rđ.0 }@  a) `? 0S 00 0 v) 0S S St0 PUt 0`Sd)H0PU [),P>FMU*eH*PD* - BR0 R  P R 䄯O-0@!M M P<@8@4@@0D@@@*P4` 0p 0S 0S 40S 0S }@4k!ݍ Ѝ<P0S ;0@P D嘯P 4哯P $厯P| |0040S 0S 0St0 /.P&tt&P>t0S t00S1S0( 0N 0  A+=0S ^t[P' 1Sb=- R)0S N7)tP$+d=XM 0 ()00 ]Q@ )<=0S'0= R* ,t0 RtCP=0 t00|S PtR0S<0vt Q\M @\< =  {p4hL,$X<@0S  1RS4  S( ;,p 0S 00S C? 尐0P{ 0Sx <&P`x@P@ 0S :.PTV :F'@PU M`@`0S1S `0S\ : 0 PG$P @%P  00!I/1,1(1$100p 010$1S 0S ,AT# 0S lP \ yIt0 0x0S 00S P @0,10%,XI000!R pp@Q000090t10.x109`P V&S0 @ yP\P\0S! yg9PW`@yTu  0^0P0/=/PX80S PP.5@ | h00S L L>/70S00?o 2$PᅛP0 P70S P 0S%%P 0S%7Gp匇VP@3l*h)`70X7P 400@T l <P %00@T ] -P 00PP 8N`FTP<\n'(P<50S"P`@T$!4&`e&& 0( FT & k@60 d5@T C?0T0%0V@!&t50S hP  PT5T%Tx& `D%D5Qo&,k&pp0S``4TUPX 40S l5 @ Q&V 30S ,5 @ A&T <&&p p gd30S 4LoT[000p00d000h 00 000N/P P Po C!0SG20@ @1DQ0008<1spP20 00 Q 00S$ 820S0d03!THAL~t@RQ t 0Dt媩0S 30tCtX1L Rʄ2"t1R P ֨81@~#2l2pT0ǟs T0T0@hPU &Pwb0 0l2l PR 0"0C?o2?v "0"l0Ap:E\*yx***|*|*h*܉*P% 1<]*\*h^R\_P*8X*** 2L*(*,*^ ̉*~uQ`lȉ*'0H[n B!<VkoW x] #5*Zx*@Bg\nl****x*0l0l0 R ;R LlP |e0l0l0 R RU 0S;0S 0?" $0"+h0S ?0+U0+͡P!͡!++R0l 0"R0+͡0|%`P-%PPh0Sh0Sp10S%@P u!4000+R0(,0"+ 0xx< 8哘p8< D @ @PD #P V tX Rp20S l20Sp2lP "h0S PEU0S bę0 0S PZ0S= S0 F#(3 (3pŸh U00R0SI PuPs %PRPUe g30Sg3 Q b# Q03 W4#M2 ,4R+sr ^a+!0hA3/@t垘p4@$ ឧ4 R04L P TXm$0S,$5t 0R.HF 0S Ѧ00p0S pʦ0p0x0S xæ0x0|0S |弦0|0deލЍ0S 03/t0S t媦0t0s@- P@"P  "P0P Ѝpo`P  "P 0x FLU 0S S TP 0S  ("0PP Ѝp@>MQF^O--`AM M0B=H@p` 0 4@P< P Aݍ Ѝ ,D4姍,0` R 4000@  PH@  P8Z 0@P 04Dt\4Q400S Z Z  P? P 00*S0 tQ,0-S 0tQ P0,00000 /R0 *R0 ,DtQ,000000S03 0$t7P 00,  0 0P 0 00SF0|iP 0q Ps`P [P twtflSP\otBB=00B-0 00S(@P ;PI P t00 = ?,P9V V XT ?tK/FR02 U 0S p41 0` X= E:H! 2S 4tX0 ! 1V0S 1 ťB= 00A-0A=80< 0  0 bB=0S 0 嫥B=  0esU ꬜%* *APZm\*G1h**gz0@-Mh 00&P P10S 0S00 0 Ѝ. qQa @T0 S 00S 0s 0 :/P 0 S000 B@ T dP 0|S ᒤ00 0S00 0000*4* P \**x*P@-P$M`@  0000000:p 0P/S:S T @^    Hz`& 4 p0/0&@P/:&`P s@;P 7$Ѝ@/000`0 ?@PV@`00l0@@DcT@@00@0CcS1S@ P \*PP00/@-S (0@  000H@@*^*@-B p0@ `00S T0 0Lpp<0000S %@@*0**^*@-@\00S P0 0Hpp8 10 10S @0**^* d0@- T00S H0 0@ppl00 101000@*0**^*H* -X0lM@ xd @80 00ssG @**_*@-0lM@[0 0 00 0rS sS ld dd XfP0 00ss,d $@*H*^*|*"*_*@-PP`@ @0@ss00V 0ss0000@? P UV 0A0T00Ѝp00CS0 Sp0 S 0 /O-- LM|0xp0?W0 d "?p0pW (-P`PV0W B8 8 (0,0R< @ 0PZ0S= S0DX0Y 0   夓@P*0S 0#S |0pS L1 R 0@@0`P5 p`5刵P< 00CS00 S(P50S5U <% 00e 0We S00G00S,+ 0S 0 S Z000S800CS0}PP00CS0r0h `g0 @P00CS0 Y00 0 s`83 ap0SS 00   00BލЍ@d3@<30S VW@@ c030!30 V S$ " R 5U Q Q$Q V RV"d 00H"0M0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 01U 0   0ZR@0 RX P 8/ 1X YS P 9/0E60Sd00S 3/^*؏ p \*̉**h*Љ****cA*Qt*\*%*-A-` @T o 0 ЍAЍ/0p0$ P xK h0h  oB0@S |P 5/*q\*^*؏ \n*O-@sFM M`  @s  o  0k 0$0p30(0$ 0,@\ 0h0$<` ((0d $r 0( 3?$r / &<7R 30 R0S R3(0s0?008'PP3Xm97S JލЍ000 00r0S   0ipڄN8']PX20 0 0@0R 0 0  Qpl 087PL屄97Y] Ś 0S [Q0sN0010S ;7='0:7<0?70>7<P0S ,0< 1, r"P!1 R  L 0 0ZP 0S 0097S0 L0S [[ZX  ST000 00̏K^*\*t**d***4**ĉ*h*.\**3Zv*i2`*=`*_d*Ku@-2Bp`WLM LЍ@ vpPk  ope 0001ᝏ1 0S<0 ?!tq(␏ ( 0R0 0SZ=9Q ='/?@#b!"/p8 0S 0#S 0(60 8?pp } 0S y 0#S 広, pp 90S0 00 0 0/LЍP4k00\*t*̉*MbI^*, 0A-Pr@L0 @2T` R ] B P2  Q  ,W00EE?AA?1 R$!$! 1 (!(! 1 ,!,! x1 0!0! h1 4!4! X1 8!8! H1 0 S 僓0*DD P p p( $8S 80pP U 0S ,8S = (8S JM0p 08? 8$ 0p3/48S 0S 3 D0R <4 Ѝ}*h:L*0% P P/ @- P,L P D Ѝ@-<@0s(00pp0Co*%*p4p$0 00/O--TtKM☄0 P 0 0SZP=9 =:k{- A8`Y0 P@  A{ Q3P@0I03 3# ( `#0‘{p`Yڐ T ᘫ<#Z030(0 0f$#媑`  ᄫZ (f 0"噑`< +0S*00 010 Ѝ**@-9L0@0 <pp\{pP0 0SP0 0'@Ѝ*ht@*P  P @-Px0000Q/`0000/0S <S0C00S/ S/0Cꌅ** **@-0 000& o R Q 0S0000S b0Cs R S @ @ @ @ @ @ @ @  Ѝ ꬜%%@-(A`0S0 0 0 0!0zp 0S:S50P0S0 0 000 gzp0S:S5000h `0PPzpTn00, 0 Dzp(nЍp܉*$ ؉*D d  G-@\〠pA`^ P \T1:00"^ ^ N~ W\^ \ @2O-p@t`A0S00 Ѝ%S V@0PcU9 &/U -U4%U V% 0V @PMU0S2 2"0S00C R mU.R T* @mU nU0Sl2`200C R T* @0S 4cU.U   0' 20S0S /R 0R0P 1@X0@LP'*S/@oP0\  R  JR.UTr*PP?* RP?*@P0C Ro Vb @0CS/XP0CTT*/ P *< \ R*9Q*+ @ T =*>@R *0@V1@P9@,@*@(@&4*P\*L*P*T*/A-p`P @UP0  T  `00T  0@ R   `FVx`00CS0 _ PpTL000`000 0 ST00  0% A-pP `@0尀T 1, 00@*ax 0 @P`0 \kL00D P 0 ЍL**  0%  ,*(*O-MMP @ 04`0  T3@`T P 8#8T $ 30S- p Q pWp gxp@0P00E.002 P E"EPtlލЍ &wpp0@@T l@ wp@ Tl010PS  =x 0$ 0/ 0$ wp@OE0$S*F>C0S  !xX$ (0Q`$0SZ=9Q =)/?@#b!"/0 0vp70S 0#S [0AS  T0 0000 0wp 0S 0 0 vp@@q0T4T /lkP<00* `=% R ̉*Mb8/@-@Ѝ@wnvp@-P`L@P@ 00P@ 0S kpY+ @-P  Ѝ @-\PP @-sPp  Ѝ P@-륞P B 0@-PlMQ@00 00 T  40S P 00 P 0 0u 0 sPIcsPI 30S )@&@@` n X P ӄ`(!P@ 0S  @P@    P@ TN T S 2 @0 S7 x7@P l0@P/T2 P) 02 P 00 PU   P z0 0PU  P klЍ/m0S }@P@$ c0S @P@ UT 11@T  0P 0p`VPP*000m0 0 0@Q XbP@꼉*gU**p*LDLW \*l 0%x { nxL**4*** 2L*(*,*T*P*7@-P1 1 Ѝ0Q0S 1 1qP !(0 CRtA R hS0R L1P 0S0傿,S 0CP 0S 10S 0 0:@ @*0 @0@"0 @0 @0 @ 0 00S 0P\*4*\* *Usp*L** D*h* b*** ** **_**P**X*00S@-@0M, ] 0бP0S8R @0Ѝ0@P*-A-0000S 00,S 00 S00S 0  P 103/P lH0Q  F  000000P*L*t*,* l*n +L-%d*`*%@ h**Q{?Q ' i0,*@- 0  $*@-" 08(*t*P `00CS`0p S00 P0S X0X /XԀ0%C-Pp@  l1s0S `l媾 p㤾0S { 0`V   Ѝ,*L-%$* t*@- ;p( P@ P ЍX0/LAP 00i*,#c*  L-%%\n  0@-0@ Mp1Ps0S 0S p  p H p@0 "p0nS %Ѝ0*L-%@ ** -\MP \g P L00SD0\ \ЍpP  *L-%  @-@80oT ~7 *} *  D0@-|AT 0S  0 oL-%,*@-< LA/f P  0 &ЍL-% @-@0S S S 0\ \ \P \ @P0PA-`@ ?  嘀?p  ?Pt @~P@T*\ЍA01 !QTUQ s00 h~*%  G-AMMP`PxB  d2d `2 'oT2 P@o 0 04R 0 0 3o 0R  0 S!KyV`dPp@D✡0S1 o1 0S000SR&@@T  nT @ <1<1s0S d P0]!  1 nnAލЍP0S S  S00<1s0S }p 0圠0CZ nZ < 0 @,*(******t* L-%** 0@-EM,P oPU@PEߍ0 ,PP n n nn x0 <  TPQon" v{(8N[ L-%|O-pT3MP@ `<</n8p}(#h3 ?nUPE*pcR00CS00ͧp00 R0S^P1s0S2 Pp1 Ps0S 0 0 ^%\PP2D2l1s0S  nzx0 PVS,1s0S : 0 S 1s0S <1s0S p|l1s0S 0〱0ݻh1 m RHP1P) ϻ X $11s0S V`F'icP` <1s0S0 m ЍS R   R\P0 U0q0QLLD*,* ***L-%,* $****p@-BM,\@P3L1 DCm$!{1 RmPPa`0<1s0S b P00 m \ifBߍp b@`ӜUPp0nۺPMN<|\z(****NL-%**,*p@-BM6,hX@P3X1 Pl(%0!(1 $lPP`1<1s0S b P0G0 l Bߍp tb@`iUP|@mmn<{y(****NL-%**,*0@-Pp@4MW\ 0PP <<0000<<0  4Ѝ0,*H*0@-@DP4M40 0P88 04Ѝ0,*H@-M, ,PF A e 0 001 +l1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍L-%*I=HY$*@-(@ $m @m,*{t zt @-@HTmk@;p@-@PPpP p0@-AM MPAލ Ѝ0lPra0!pzlPPl1LAd1T@kk!lkk0!P0&muNakkk+k@k AU 0S S 000 %T,a   T l{t  10D0 S B/o" R  0C~ZL-%au*%oi t*@-MP Pppp pSkl@PL\܍@Mz, HP l܍,0 < **0*<[L-%0@-MP MP%@i0@SۍЍ0@*P551d dkPPTۍЍ0@z@ 5y , ۍЍ0*Rt*Z<s@-#P xxE P ``zP DLЍ@y@@Ll1s0S(0Ѝ@HuЍ**L-%,*p@-P MP(P0@Sۍp@5P5p`]z@P\ۍp@yP l! r R< < 5Ey ,=ۍp*t*L-%@-  $w%O-P4M p858p=0~0`P@p0p 5% zp0G$t `V V Q 0 P0$404``{xur 0p$pxh6P`k pXh T~TD T<<u44 U! R ! R-$ ^wtS)`S FSJ (9S /S 00C7'pa0CS< ; < ; = ; ; = ; ; ; < ; = = < ; ; (= = P{ES 0SvePS43@[P{ VPe Q@Pb 2 P㓴00T2 PBPW  <PS d0PPA d2!00:P2 2 0030SD$2/ $ $ P %!,00!0 0 ȡ0,P   1 T T@0!0!!00PP@ 0  R 0 " l <r> 0Ϻ4Ѝ0*L-%@-`0S@ eP0S 0000q20\ @2[*xG7@-0Pl000p@h R R  l R  R4st03/ Ѝ0Q PL-%*%*p@-,AP1$aS 0SP PtȍAP00pPP0P P0 P P0 t pth.0T@T  "  \ p0L-%* ^O<M% ,%1*,0@-1s0S 0P X@rL-%8*(0@- d@0 d***p@-`BM Pd@0 S0`01s0ST01y0 {t0Pn00x0 dBߍpB/ BR 0d00P y0001*L-%o8** 0?o2 0/L-%H-AM M r 00000P00챟a1 dPھ0  sdP 0SS WS BSr1 +`d P  lUr0S R ^1P0 S0Y d1s0S Ԡ0S  Q@ |PY 0@^ST00CS00  S00 P0S)t*\O ,**L-%*8*p@-PH@P@puP P nP @L-%10/@-ido/A-@PP" p00CS"LT T T T T T T T `V ?PPr5P0 P00TA  0S P0000 !0S0R 00 Sb< `00CS`0p SX0X /Xs0%7@-`AP00C!S0000CS/V U XV DV XV XV XV |V 0 "S 0S!cr`r0 0P0 0 dMr0"S0P0 Ѝ0@O 4Br0 0P0 p Ѝ0<*T;o0@- R RR \R ^R^@N  @0 Nr@T 0N~@T!0N~\!n0( ^00@ 00S@wG-@gP2 pqp =`P`bPP2 00PF 0P  V @P 7@0S@0S 00@-PP?*P PPP P  0!SPq><*L-%A-@MPP\1 "q &r@P `p崀  Z@Pțu00u0ۍ0 P 0@ 0000S Yq  P00 ZL-%*p@-`@:PP 0 gTp$PJ@ps@-@P`@T%qЍp a c R c xc(R( da0PP O<zP K(uP ,*f@xt yt @*0@-@M@0(@,0 0 *@P Ѝ00,ԯx0 aͯPPPP0S p00@SP\ @*L-%,*@-p (, @*@-@ &cP  ckkP Dk ga0P3P xptp2h c XTa(k baЍ,*xt yt f@'0@-4MP3P4Ѝ01<1s0S UpAW  0 9 0ck Da<P4N0 a,0E Rj a a9P 51PP wk0(0S"=Rp00ESh_ _ |_ _ _ _ ppdp`\XT HoLL-%-,*%9?D@*QJUdq@-0 `@3,*-@-zX0 R   ЍЍ/l*-@-jXn-@- ?0 R   ЍЍ/l*A-ARp`P@1T }`pPF `@DO-- \MP@BmP80d" >PI T 0S e pe `e he xe e e De 0 0(R00S @` P!X0 (r  #5    P  0@0o 0[ +!P8,00SX 4 P 0C S  R$0PS P0C [$0 X 00   (c"_plJ@` UX  l*$>Y`v4ZO-- lM$ k`kPVPP,8@ 00Ÿ   0<0d2d@0`2 @0P 00E2@P 8@pP x4pP@0S( P @p mm $0lЍHp<`@40S(  ^ Pt  ( G4( 0PŸ4 0-P,0,P<  B, ( p( ,0RQ@(pS<`@ 01P%<0%8s00%4s00u0 0(<0(8s00(4s0\ 0x0l  P$@pt/%YnGoiC-ap0MS@0P pC0 00qp   ^?sp G@0  m00`9 Ϡ pppppW0@0 @ A@Op`6t00 }>?@d l00 S @. @ C< vm0ЍCl0t/%%ep@-MO_P! 0: S0 0 S P@` 000vЍp ]p P @TPT0dHS 8$    l*%6O-0]M-SP M0S 4P ]ލ ЍOv/u]ލ Ѝ@p㤄^P$ 00S0W0S 0S\` jpP@ v r@pu0: S  SГ0S =]PP _u I]W ]ލ ЍO)l^P <]xK0v: S+S( `P@`Ph  ]P p  0060 00m 0S0S`-\P`D]`\vH`0S 0 0\P V \P z{ R^yRw\pPT %^Px!1Z[ h 0\]Z]U\p`4 0S!P0!0v0k P: v?b  0S -vh\pPv底*P-Rm\ 0S h\p<vl*t/%qVew <Uv0%0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T000TP@-@P@@0a0S 0S Gnl5B@i*@-iP=6p@-P*@fp 000/*@-@sP 0S`P f 1g dBPЍpPU P R0P0M*M"@-@P @ 00S@*@-@P$00SЍ@Ѝ*A- `pP@P000 PP0 0@-@P P0P00S@*0 R *I A-`0QS@X0S@ p8P8 p$ p0S@*s p@-B0M 0SB 0PPdb$0 (0S ,0(0eKPj >P^ ,KPX #P1 2P 1 0X00\00`00G?000x000020"00Z  P0ЍpnP X1 KP4 P. P ,1 P 1 K P1 K P+ 0P$ P 0 P 0 P! 0P 0 P 0  0 0 t0 h0 \0 P0 D0 80 ,0,*#+6,7@- \PP@0PS0 P xP0S00UdPPP dd0SP0d0(Pd Ѝ0ht@*M#Uu0@-@ ShS0CSz z z { { { { ${ (S 0h i0 hЍ\XTPLHD@{P0ih0(*MMNNN N NNN<*@-MM0DP 0WP00P00m5~{x u0P000tS ä0000000P4PT L4000)P44 , "P004P00430S 30S 4ST4STP 0S0P0 0S P 0S0P0HP 0S00$34P 0S00Tb400PP 0 00404 0000404 000( 04t04p0$0`PPTTPd D25<P`Q0`S P,dPT!tPpPQ0pS   BPdP6ta \UP`L eOPP`4`H0PSe 50S 0 ލЍ04,.P 0S J*sN NNX +*6,cex+*Nv +*"NтAQF`\\%N\}] ,u*@-T@5SH00S< 000S 05*4+I 8+ 0  *I 0 *I 0 *I 0 *I 0p@-0x@Sp d00SP H00SP 1P0S05p8+*I 4++/@-0 @ *I 0 R/ *I 00S1+ 0 *I 0 *I @-x@5 h 5 L 5 0 5  05*I 00@`//%p@-@`P X j @ d ( ^  XEp*I D0@-0S K00ET@YKU@+*@-@05 0@*@- Bo 0 $*I A-P/o"`bp2qp -@P UA1p PU||PHXU`X8/pL V@ P@T*U A Q )N=NTNkN< l N 0 0A.0 00S/*pp@-@ P 0s  x1@p/%NO-@`嬐0娠T$0P ?990 VYvT00S[   S1 RP V@*N/%P 0S  R $ ,0/8<//*O-騔M`VЍ0(tS,  RQ0$R00:?002P?00" 2Sh@V !sr% 0S 4 30S $SjdP 4 0 40@!0`000 00 @ ` 0 0 PP00p @@0,t(dvyf`p|V0 Z$4SRA 4? 0 qp0dt2 0Dx RQ&0$0@R*0S 0 0 0@0@ 002  @@04 S*0MPf1 qM   10S 1[0?0S  U0$ $  [ 8dCB/*A-Ā`pMPP#@a 0 DBC.B $-0DBt P 404'0$rdA{**p@-`PUp4 @ P@ D4p ST 04p 0 bb0@p@** 0P/*p@- @@0S p@P BbS .S 00CsP U2"cS T- P:40BS **OOp@-PP`@ 01S E"0S *Sn0S 0Sn0*S x0sR  dR  kR  0C^S0SP@uR  @@p*/%0S- B 00P!P* C\/p@-@P& P`PpQ P @tPQV`n-PPN0Sp Ppp/%0%.O@-lccdPP0P 0S .40!0`,@$!$Z3VcP@P{@Pw@P@0 0  @P0*P*P x*Ph*P LsP COOOOO*OO*[ObOkO%*OpOvO|OO 0p/*@- p 01SP0|  Qpp]h ЍR @0!0P0< 0aQ 0! C*O*Op0 R R R R 0S//////0S! @-@PPQ0 0 `" br Q Q S R0/@-@@P@ X x ?? q? ??  ??? ?? ??<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P p!lq? `P`ĕ ?`ll@@`@@*0A-`@PP QT4@TT@DQpW E@T0t0S ;@* 1% 06% Q p0/*P@-44N\,P@P @ $P r0 _0! KP0!T0@T0  T03:T03:T03:T030# S,,A #c!4,!0St ,1 ,!?   $CO(*O* HD%00P0bA @SP//D%A-RPp @8` TЍ`lP 0T0 0fPL 1P TP00T0 0H*s@-3 @P 0S PPЍppP Ѝp@T @P 0S  `(00 0P_.TP;Tf!p@-@pP Pd0 S P @<` Rp_@~0P  DTQTP P / k}H*0@-PM@ s  0 BRЍ0@-P , @` 0P FBЍpH*@-`@ (8R808Ѝ 8 0 CS  8 0C 8nH*P*p@-@ M8S/ 0  0S R(0 (SP8`000 0C?UR B( 0 8 80C 80 CS Ѝp 0P*H*8*s@-P@`8 R8 R8SЍp 0b 80 S08W) 8 0 8 0P0S08H)H*8*p@-p@XU 8PE`V` D0 p8SopppH*D%p@-P@M8`0 0 0 00C?UR  0 R 00C8.Ѝp 0P00S0 0H*8*@-@8 R 0 0 ( 00R0 8 80 8(80S Ѝ0CR80S  0Sʿ(08H*8*(080S @-n/H*p@-P`@$p Q0(0p0CR0R: $0 p00H*D%s@-@@`P@T  :A@P Ѝpp@-D@0S PX 8P 0 ppH*D% $0 ((( ( 80 /H*D% 0( ( ( 0 /H*D%C-@ĀPp0S Ѝ @`0S 0S  80 8808'P oPgP (8 (0*H*7@-D@P@@00S Ѝ0 PH*0P$/H*0S/p@-@PP` P "@(0 00P@@00p@- @$P $8 H*O--474G0pPS`M(X/ Q008(X 8# 0S0S  P0S08 Q00((XʜP  PЍ0 80 8XU080H?oP20SЍO$Q 5Q) PpP0@SL \ X t @  D D L 8 l eP 048048TPP0480488080 SA?0488S0S S 8S0S S ec0488A04880S} 048x0480480P48k0488S 0S S8S`0S S]8SW0S SS048(04880 S 80 S C80=08:0$48X3X3` @R( B WH`X  tP`WH80S 48PS8P [088  80 Zt2"8Q WD 0`48 wD(<8RqDPp4@P 0480 QZ`Z ` 1弁 0 0 0 K Z@p@w$p***TTA-%P Ah0qp  H00S 8P8@Sp` u p`**+*G-@, eCT00P  00`p|| 00ST V0 000S T82 X**#+0PP/*@-0 0$ ЍDP%Tp@-P(0S 0(0gPp@b0v%P 0S S S p,P `@,`X?o2(0pgp*@-@0@, , ( *p@-P@@@Tp8T0O--e`㋋0B0r0,2,0$M0?00V0 S -10 S G&,0S4-$!P J P x2Px10S V P g1P @0Ss80 S% K"80SeVaP䰟ZeV0Sk Si SX S S U UQw'*P t"Y 0S:x" "/S 7S***#+*t+ *T#V%E*U*U*djD+,+ oM@UVU*P`U*{U*UUUTUU@+UV*VVV,**0**(+8**00E.U S)dP{0SP0 P/ OP, 00`P V 0FcS 4 0 p < l ` 0 D 0 X  $ p P $   @ < L X   l Խ 0SP0@ _U0 0Si U U00L Z# 20U 20U 20U DP+U U !UR00-UR000@0#Px 0 a0CS00 0S P 70 0 0P 0Sa0@S @PX 00Z"M 00@0S" aEQ0p$>P40U \40U h40U 0S P0P 0 /8PxUUt0E Sp < ` ` ` ` P ` ` ` ` ` : 0#0%*U @U !UW<50SQ07SN < 60SH07SE ;07S0? ?P 0#0CS>P;50 9e`0 S &0!R0?0m60S  F e`0 S '0!R0?0R | !R00 !ıFp70S!R0 !R0 0!ı3 !R00 !ı*70S!R0!R0 0!ı !R0`?0 X80S `M0 S 080Sy 0 S 0  D&mx!R0 0!ı/n!SeR0d 0!0<0<]P0TV0S`9 nMJ$  C@90S0S ~ @ 9 <P- 00!R0 0!ı=0p:0<0!R0 0!ıw?`0000!R0 0!ıe-``000<&:`S:4  `@ 0S X \+ drh;0S `D; eP  ;0S  + `+0 l#;"i,P m!R0 0!ıP P P v !R0D<D<T 0QH,Pl L!R0 0!ıP !R0<< 09!R0 0!ı+P . <Pq+qpm < z i!R0 0!ı+P$ !R0 0!ınPT Q Mh=` PDEP h? =000 0g000  0SG- o0% @>P0S >0S $>0S P P 0 d(ih>P0S x>0S >0S P P [0S  % M>P0S >0S >0S P P.P0P/% $$Pg0  b!R0H? 0SX?0գ?0/0 p/0 S00C0 ? !R0? 0S?0գ?0/0 /000S 0 (00S080? p+00S/*p@-@P/!pO-pSP@`MPᾼP80 `0@0 Y:X  80#1  X RH W0H 0Ѝ 0S  R  P R  AR  QQQQ R  X180 R    80 SP cTZZKI  P R:p@-P\ HPV@^^'P gP dP fPpdpT ^gP PP0  0S0A0p0   /O-PR p QPP @䠟PU4PP0p0 Ѝ S@0p0`P`@0 0S ``F0 S0S P B0㬿 0R R@0.V @-P@*0V @-P@*PV 0 P* 0 J*@-d@ CP 劳P  0S 2P Ѝ*G-,2@T @Ѝ`>CP7RU P0pEC@P`P 0@墷qpR C-C?Y W R0 R MR +R GR  SR 0SSk SER SnR0SdSPX0EP` 0 @vT cT eT @ Vx@T@ @ ?   @P**uVP7@-@P KP P@ `P (@Q Ѝ0U*V@-H@qq (  @  E%VVVVWC-P1M0PS; 00S7 00S@/ `p P@P  0@Sd@ 0DSd@ Td@ 0DSd@dT P PEUЍ@,**0*@-  srlP :X@-`V - pQ000 00 !Ѝp**O-@I`PCPPPpᤠ夰0F R ЍWpV R  0n0Pp@ U  PPUP@QpP RpPD%D%p@-@QP  0S R SppQ0 QA QR P/@ PRP/@-@P *P/@- p@0@-M@ 2_ @AP A10S@"PaP! DP OP AP dP cPoP qPTi0|00SZPЍ0 YA0LP 00ϵqpbA00@* WBW/%WG-lM0S @0PS _0`S  HP3PT{#(0  0`pP 0S 债PO200U p2PW0dR0@p P D2  0B,2P 0S H2BP"!! 1P NQOp:000S Yt 1W10Sڐ`O t+P00 X#P00 >P OW  O<OOTtЍ@P00S rP|P ``  YP y@**P*******+WoMH+WP @- 0@*00@-P ( @*WPA-P`XpVPU@JTP0#+ 0 * 0 * 0 * 0 *p@-P@@P Pp@pp@-@K`PPpVU Pp PpC-M@pἐ@PXЍ`PPPNY04Pt0SE*@- 00S T Ѝ*@-(@0SP00*XX@-@%0P 0sS@ @G-`did@p00CS0 xp PP 000 P U 0D IS  GPJ:Nwp@P@- 0P*XA-@g-0 0pR`@0S00 R0S@00G`P0S U  ဳP@00D%D%O-Mp.G`@ P1!Q[ Z@P[@P* 00p00 0uMЍPP P : APT0T VP/6P  IP00pWpD%D%9X@-@9`P 0S PP Ѝ@,tζ@˶@@pH0H 0P0'M}M t@wM ЍTe@-p`P@ Ѝ0S PាPP%L@P T0P 0p0L#PP>PHM@EM\>PG-p@`P@ 0S :P@0S0# CV* UR@ R %S #SP Q@# C V* WR   R %S #S 0P I1@**p@-MPPލp@ 0@`qp `,= `P|` 0S:T  K0S 0S   A 0S*PlP@L+C-Mp|1P0S ~s \1RPLЍ44@P,A 1R@еp͵pʵp``0000 0p00!L wL밐@@ᱵ`V J4`fLV @s0SZL 54SLQLP*PIX@XD%D%RXiXZ@-  R@}@BP0P K@p᪶`P*L@'L%L Ѝ*qX1G-0S" 10S`p|P 0 |R@C0 -R D}P P$D@0 3P0PP0 K AP KU T!  xx<P .sT@@P@T 000d0@ЍP4S@s0S +*UPuXW00S/RC-p r:`P% 'Pڔ ЍCԴPѴδ PP@P0 +K@~KT  ЍCr Ѝ*XX0@-MD P=P@@JIDOoBdKЍ00@-M2@P0SP ᓴY@bGG =Pb@@KЍ0@T@0: S r*8@AGH+G%G%@-M@=P͡0 00㛰Ѝ/@-@QP P0@/R00S+h00S /pp@-qp CqpP@ TUpp*@-P/P03#0 R/ *O-4`p@P08V `20ST20 S/ R 0200CS$0S 200CS ʵQP 9+QP -`V1 `Z`Px0Z0KJY)Y @ PVL1L H100 ut 010S1 10000 0000Sqp@PX PPAP qp Z / 00 ЍO. `V *`++G%**++XH00S <0P/000S $0@///*d++*'G-$@p`P *P@T 0@T@@XJ0ZsP`X G cTlr T 00Sm*+G-p`P P @P  qp@PV00SЍG0AcP0 00@ЍiP@P 0qp@P **A-p`qpP@VЍAm0  0@cЍ0P  P/G%0P  P/G%@-P@p@-@PplPU 0S 0 0@S8 00C08Ip@5I  B 0*G%*0/*A-pP`@T0'@-0 "0UP00 00(@0@000 傳P @   0S 000G%*P// / /00//0// / /O-@P,Mut@PЍ30Su200 ?QhPp0p P^T`V0TG p@ P P``0t TV 0@SPm!! g0P@_ P10S 0 P00P *1t10S``V P PH p ЍO(100pW r 0`P `V˯[:r T` P0PPڔ0[00S0O Ppy@PT0r@P_@z0 7#+ +(**<+*$+l+t+O--@p $MT0  $Ѝ@ p20S2T0T0 002000T:0 :~PP20S 43P U U P PB p &0 P=P`]P R p 00 00000000 P000P+H1 D100%+ X#*0 S0˯0 zpP` P0 .P00S00S 0 0 00S00 PXH00SO 00*:PE *B#+ +(*$+l+<+*t+qpp@-@P Pppp 0 P P @0@`@@PP60@p@P/%H/%O-PM@`P!@@T H0000 00 `F:@P 0@20S1 ЍOkpP ЍO  0s00U 0SqD Wo 0t!`F0l!0\!H0 0@0Ѝ00Z 00S 1 0000@0@ 0qpP@ pqpP@ P 0` 000CS( d00S\`H0`0 0`0@W,+X***+@-p`qp P@P 00S h0 Ѝ@5W0 8@P80 +, Ѝ@z p`u Ѝ,+@+XY@-  Ѝp@-6P p@d^ pP@ qp@`  Bp@@PQPpp@%Y*p@-P@`P- P pKP@000S  p@M,+A-`pqp\_qp@PA40 P0T0A @Y[Y@+@-04 ,    00*|**x*@-04 ,    00***t*$1Pp@-0` S@pP@SP@P%pP`P @@R 00SP 0S@uP R @@P_00SP * *G-` 傀 C@CPTPpp P $ET  E   ; 6 E E  @Ѝ *@-xt@P 0S\00XP 0S<00   ;0uY *CYYP/ 804   $ ( , 0  R 4 / *$+O-ap0PS$M1A0S 0!A   W  R ! W @  000000S ׭PPP  0$m,`P 㚱04 `0 `04 4 Z `J P0p0PWP1 P#P3*0  Z0 0 Z Z`S ``$Ѝ d  `0X+$+ */%/%P 0@-P/ *P @-@P$0尠P/ *O- P0  V1PU(0S 00011CPH(PꘑQ 0 (Q20H0@` 0P `2R <10?Q 0`@U 0S H0S0S u0(R0SH0 Q0H @`ʈPpP "E E"ETP0(0E7PH00C10H00PP(0 *+p***8*`*@-(@(0S&>C0(0 *G-tAp0P 0P0W0S %> 0`S@U `0PS mP 0QR00 0R 00S W 00S0S 0  00 0   0P00SX 0  00 *L+Y8*d*h*0 0@ / *d0, R X00S P@0~0/0P 0/ 0 / *0+ 0,  / *qp/G-`P@Pcp p倐x X 0 F 0V 0U@00CSʝP 6P 0A@ *#+PG-P0P`sPp̀@ 0@D P V 000U00C@C@p T aP0 0C J0 Q@ @D 0@DRC *#+80P/ R/0 0S 0 /* 0 R  X+Y*p@-L@ 0Sp0dS 0p`$P `r PUp 0*YT0 0Q 0<0< (., 00/**+A-APU  ^%(`P, `(,, RP0`VU, ,0 0 P ^PQ p0࠱ P 0*1G-P0sUPP@PP0Ap`@`V R0 XWA V$ 0 0W PS 0)pP ` AY0 0 v W0@TP0  0` &qp .@PGP tA ` W0 0M0  0`qp @TPX+*#+P0G-dpPU !R00 RS@ U W0S Q0*P @P P`@V0 0 0 /0 00r  0@P`Pl`@W 00 H0 00r  0@P`V@*#+G-`P P@pl0Vs 0SP@`= P@tu TUP*00CS0 Sp0 S>0 p/O-0P-SP }y&$L/p.X.P /D=P0S0@ 0S 0S%@T :=...^X @>  0 ЍOu`P ᧦@ᤦ@ h@E 0A ( =V=-TY*eG-@` $PP( cpPP| W@yz  0Z`p@od C `0 n(p Tt pp@ pY HK*C-`qp p6 qp@@PP. .Y T0 0 Ѝqp 0 p 0a0@S , /A0@S'0@@- +Z.Pp@-1 $P 'P6 Pp srpp^P@P<@050O00pPp\0,\ O  B%@ $,P M $0ON0@4pp'Z+*%Y*+0 05S /+@-o0@-M@P P&  000Ѝ0*@-x @ sr NΎ004Ѝ+*7@-~P! 00N.P ēO.|~@P@BT  $ @P Ѝ0@  P Ѝ0*+@+@-SP ,0 0R H*4Z0@-5 @P00QAC R0+@-0@Q"P P P0@Ѝ00St T00Ѝ@D00S<Ѝ@0,00*MZ*oZ/%ZZZ 0 *000S/$  " ?A9c0/O%*C@+@-P M# @0.S 00S Ѝ 0S 00 0 R000l<#⚤P0@  0R 000@0,0ZO%ZZ@+Z[ [000S/$  " ?A9c0/O%8*C(+@-P M# @0.S (00S Ѝ /0S 00 0 R000Hl"5P0@  0R 000@0,0DO%2[J[(+`[[|[@-@PP  @ЍVP P/00S xt0/p@-`ZP p@qpP@  0p@ *[+@+P0@- S S00 Ѝ^0 0 0@P%[P/ (0@- 00S @++PP7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@PR:a Ѝ04@P,0  0 10P%O%"+P%+0/0P+P/ @-@P @DT@h X0X PLHD@<840*[DP%v[[[\V\\\C-PPM* 0&@@P 4@T@U 4 ЍP |\+*i@-@P |00o/C-MD@ 804S S S0U0@S  0 [Q0C0S 0 C Q ? 0   ^R000 QR S$R 0C000S0`0000\R000008P%#+O-pQpPpWCM Cߍ@tcPSTp`3`#`C \\Hs  PZ PUA (3T oQpP 0S @DT2 P=@ :7 @@ 0 X ) P@ )T@"0S 000P @B?1P SQ@ P1 Pp 0Q 1T QP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0S 0S P? ^0p0000-#+8P%Nj0%#+%Sj0Mbj0@-@ἓP嵓P |尓P l嫓P \妓P )P;8P%mjsjzjjP@-@P DP P P(@MjjjO-P1M0SM A0 ЍOy` 100; 0p `wx@PЍ0S  0 |00 0 07P 0S0S S @P@P#+X+#+j0@- PPPP^0S @T 0 @ #+8P%0@- PPPP^0S @T 0 L@ #+8P%0/#+0/#+00S /#+@-TP 0 -#+/@-H@ p P*0S00PЍ#+FP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-P`p?P@P$ ?0P0T0S@ s@-0P00`a0C@SH 0 0 8 0 l 0 0 0 0 0 0 0 t  0 0 | 0 0 0 @  P  000@@0Ѝp 0 0 0 0 0\/\\G-1!0 sc \ [@Q`V1!0 bc[0F?o[\20S7 @`^V`00]QQ! ]Q0[Qp.GqQ 5 p`0W]Y0`QV0 0 #c\Vp0[W` W nW \W`Rp0 V0L5+D5+jk;k7@-0P| @R RP L L D D   Ѝ0@y @꬜%L5+D5+]kG-1`MQ@P㈡``0pW0 p1PK P1 H1 000 (b\W R T R 00P@0  p0 [R .BqQ  [TS[Q@]R  00000T[@T[T@  ST  SR(0 R Ѝ$5+D5+L5+zk=+00@-00M/SP M $S, +S00, 0 0 9S$\S @P0 0 5b0IS0@S0 W00ۍ Ѝ00@00 S00@L5+D5+kkO-@ MTЍ0tS bS rS aS @{S000`Vp F` 0S0QU 0W0 0匐P 0 PUP @0@ `0 0a2pP%#+=+L5+D5+kO--`?M @}Q ;Q <,0 ` \ @\\ `<`,0 t@T @@ (<(,0 @\\\ \0\ AP@000J S  4P <40 @ R @XT;0S008+8p  z`  R @   R @` @ R @S 0R @ Rt AT- 1p @ 9)0 4" X 0َP00)9 0:@@\QQd9d)0 f$ K@P$9$)0 pV,1S0 K$0,4 @00T@S0 8 0@090>: 009 Q00A0 0C S0 00, 4 P8(0 t\QG THP R,4 R $H, 4 00P@0) 00A  0哾0+ 00 0 00)Rm0I gRu b9RZ0RR R 6&0 PT   9R/RRA@ &R- 0P0 @  y\R0)0\ P0 Ar R(6(&0 [Q 50)0 0)0\ Q5%0 (~0;Rv IRpR wR9 iR0 R @ 0S <5<%0 \000) 0)rS00 0 0 @ᄐ0"S T4$0 ,=09@0C09@0I0)0S 00@<40 0)0  0) QQ L4@S 4$0 h<$4 0S$p5 0I,1pS0 KT% 0S @;S>B0110@\SS434#0 ~ P3#0 x4 @P 0S 00@0   p7#pp_^p2p"0 0$ $%#p W 020"0 20S$000 S 0Q 0Sz @;S> }S Sp 1!0 0w$ 0 0$ (0 0[ Wp"p000p WH 0S  "p U] $ "ppXP  0$ 0     呻!1 !  0+0 $p$(# $ p$p|! %+%%+L5+D5+k-lHP%_plllloUp,5+ Hp&p ~#+lm-mvm-+mnmm.ngnnn&oToo<%o-pL5+D5+Gl0 0 (\<0< 0 L}]00܍<ЍG-@`@Zp圀P䘐U@T00S Jl0h0CX0 0S0 0 ^{! P#+L5+D5+p=+=+=+=+p@-P @%000P @pQ%@-@ 0  @0Q%0p@-P`PUp!@P 00CS0Kp ᫂Kp0 K5+G-p`dBd 0S2 SQ S$PUVP(00S S  !P$0, \0000 00! PQ $00P0T00, PP (00S(0 #R nR0V ,0020#00$0,0$01K P( T0R #R nR   PH \T000(0V0(00PP P 0\$T 0\$w 0(0V0(00 000TPr5+;P5+}q@-@X0  0S 0S00CS0Kp X0 o5+G-(DMX0`SpM00S 0S \3#X0X0\030 `00d0XSXP 00CS0Jp X姁X %pP0 p[0 X PލЍP2 {Jp0S m0[P 0JP p4S \M0p0p4S \PP YJP 00\0+P|p0`0d0S00d0000S 00Sf >P00 2 02[00S +U+w P0 [+0GJ+0B] ?Jg^ 0p!L P*\PP I@G P\c 0 p,p\0pp! 0`PS(00- PX5000.|0\`0P l000S S0P@ 0 P00 00 lC(00(045+q0%w9+5+5+qqqqqq @-P [ ЍqP@- ЍTP Z Ѝ r@-P0 Z Ѝr0@-\P@MP  0'0  'Ѝ0=+@-`MQqM0S000@03 0@L0S Gt  0Z 0 0S S ` 0{l}@P *0  P!I 0k{00ڍЍ=+x5+|5+@-@P   0S|qZ`p0 R `   80P S t VZЍЀ=+'rkG-Ap0吁0`PU , R:(,50(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0   p 0 =+%A-@P p0R`*W00 up 0P P 0O-/MO00PЍ080?PU 0PH0\\e R7 0Sd?0 C0R 0i Pi PS4 0 PS>0@oP 0 R >0R*0 0HP0S40P 0 R D>0R4>0 0S> 0RR0S0S4 0 S=0@oP 0=0C>S񟗐t X X X X X X  X X x X X X X X P X X X X X X X X X X X X X X X X X  t 8 X X ` Ĭ X X ج X X T X X  X L0 R: L `0pB0080S < < 800 [04 0y<0S RH0STP80S4PU 0`  Ee{P080 A E4 ;o0T P$ 0  004 0 0  0:40z 0 :0RḚ <00s }0P 0S 0S 0h( P2S 0 H⏉` 0S0`V: $ 00@ 9@‰0S  0#X  H0$P x0 H$0\$ [P9`0V:D R$ ` 00C 0 0P0 B8 0R:6`8  0x `[ p xx8P0  R:d`dd8K \`((1 S:` 0   07!R7 800 g04 0x<0S AdiP0800 D0$YP80S g04 0`x<0S  80S0p4  H8z`P <000F400<0吆04 Ax<0S V 0400<0H6 800 0V04 0)x<0S uL0 R: L / `0pZ00pY R  Q l5 50W4000  P 04`Z Z 0Z 000 G 000 00 V ,Z0 0RP  0 0 0 PQ@ `VpX 0  `G0P  ßH`pL(L<Hp(L<(0000S c04 0w<0S =` P/ 000Q00 0  0`Vp P\   `VXp0  `Pa 80S0s " p0 \V04 0e 40P0 0] P 0S 00P80S0s$"$m p 4 0@ 40P 9 P P R0x5\0`pL<0p<s80Sp4Xm P!p 0`R@l0#0Va*00000S(0!0  (0Z0  0;H0  0 1 RyP0P& 0 01D5+=+=+%+x5+45+=+%Q%Uht@|5+jnrArErL5+Kr=+ <%=+,=+$ (1 0X`4H`pL(<Hp(<x0h0<0 0R0((Q 0{Q  %+=+p@-@P`Tp0wS {S sS 0p P 0 D^U0`@p P `G-`P2p(PW00+vr}rp@-P0@0`T P oP# 0S  ػ 0 < $ 00C?o2S Pp0S000S000V0V@>+6, 0@-MMP @P  PT  p4T+   P ۍЍ0rH0  BR Rp R p/0%%@00CS0 S0 / 0%@-,A 0#<000p00007< <0 0B15s?0 0@Q^?+0-01S ^00oS^ P0\ S0S Q0S R P0S0S00QR ;,?+0@-  `Ğ\ @ T\    %R    ?+;,A-\A0 5S <0S 300,!<[P a q 0U&%0 ! R8  (P  F0  ,P  =0  4PP uAF00\P JP @ !00, PS;,ؼ t?+%+p?+p@-@0` T  thud lDP`PT p sP000STX @0%%r>+rs@-P hxP8@P-0?S0S@P` ⤭p Ѝp/㻙P@\HP 0S S @^0SZ00R Jsrr@-0 3s%@-0@<TQ T00 r0001S R0Slp@TX` T@0$ @H4VT(8  @,M?+QsXs%;,_skstsss@-i0 <@t%7@-@P  s0S 0@T 00 Ѝ00"S p`@-@P  p 7RЍtp@-X+ e@-6&+ e@-.+ @-  &贋+ A@-+ @-  貍+  @- 0u+ x+ B@-贠+ @-  豎+ @-  ԏ+ @-  v+$0Qa A@-x+@-@D>~P d 0C: 0@-0 |1E+ p@-+A-@PP 0S u`/P  ./`1S0cP /P 0p RV /`@-@PI P { l0 0jl000A-@`\@*T<0p " RG\<0d$N R 2Q%@-@K@-@@-@M@-  k %p@-@PUP,HGPP( H`aP 2 㛐#Pmp`muluG@ PP , 0@ S< 00p?+46,Q%O--,M@0P0 T; R~0ATz 011!0 S01  R01;bP ,0S  R3/00S 3/[1P PP n0P 0 0S_`: p` 0 011S`@S0` $02hP$0pt$0P``PpU$PeUP$0S000 CL R RڰDPCPE_ C B R@ R@b 1  pdP\  0 `p0C0CS0V`0Z `1Z0Zb 0 000 0  0 "P P |tV`x 0CÀ  S CUPPEPE_P0 3zP a 0 00@0 PEҍP N3m1 0 z  Q 7:z90#?@0CS T ` `!0 R$IP0g0w0[PP70006ᓇRQ0!R0c !ġ1S 0C" !s0R11$`V0 ,Vsps0 yP v-y+e&`P0PSY ' G 5m0 m q4ddU[ Pd50xPd#~VjyGV S0S 400C`$a~H1Sb !0C B/!?1!1NSRPNQ0^ B0жs0xP00S11 ;zP`PxP@a@1S0020+ (P%J @@P8T 4  0@S%4 , l , , \ , T , , , , ,  , , , , < P h3P?P <P >P PP P$ZvP P1QF P x}1S(ʰ1 F P xq}P 00P1 RF40S 3/Pi PP i P,Ѝ0R0 J` 0SpW 0~ 3/px P 0`F P x ci `+}^i0010A^90 b"P K 00P000xPdP <P >P qP uP P ʰ0P <@0CSV <000C`FqP Y$P P 00P?+ %g86,RS%46,ي% 001/?+P0 R0//?+O-p`*@PP [ ! 0P @ Ѝ0u00 0\"<P 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @?+P/D0 R/0@-A1 P h@< u?+O-Bp0 W Mk0p 000B Ѝ`$Z 0S qP Z00010P@P 0S 00@ Z 00 wqP Z0S Z0 00` Z0S ^qP Z Z 0 0 00U0 P0HS0SPPAq 00Dq0S ?q+C P ZPU m0X!0Cs0S 43 000 PEZ?+VUUU% @O--$MPZSQ0T @ 0 $T`B <0X0 0S 0h Hmjp@p pp0P@0@ 00t0000. 0DSDU 0 E 0U00ө?0U0 CR C 0ER 0 0jpY 2 j0  By<_X Pp} PC ! PZ P P#0STkpD EYPE@ @"jj,j@P00 2P? P AP7 0JSI1000 C 0 E0Y0@pP1Pp1 W 0p00@0p00@pW E@DYPE]{pGT@D¹0 X@P l5pP@U@§[0S 0 B0lY0S 00 0 0al$ЍO0XS ?+P%%A-lP`Pp `o@o@0T a`P@ P P?+@-P@Mp 0`T` P@@Ѝ0 00l 0 0`p @OPu ,p@P ⓦ dh%?+'Pp@-@*TP0Ps D` R :~P 0S@@A@pdh%?+@-@dC?+0m?+0m?+-@-0 06 Ѝ Ѝ/-@-00 ' Ѝ Ѝ/-@-  ~ ЍЍ/@- Ѝ@-@p@-P@`M ,0 0(0 00`Ѝp@- ЍO--0M P` HpLonUs\0 0`X 0RYPc 0S` T00S\ n@PPT00PXP@ 0sHਏȀ0 0W 6p bPUWpV`JЦo`0 S 0`J0 0sPF 0 00`>P\0 0X~0 0T00P0X BZ  t ]e&yXeVeЍ@00Y00S 0S nT00P@#@3@py"tP 0 nt뜰IHHgKg OB 0 E0GsXP`IH`,g/g?+86,@-,, ($ Ѝ@-P@`$0 0  0 00`Ѝp@- Ѝp@-P@`M ,0 0p(0 00`Ѝp@- Ѝ-@-00Y  (Ѝ Ѝ/p@-Pm@mp?+@-7@- K@eB$O^[PU x% $b.00h@PU h%T b.00000S$$僯 Ѝ0謋+T+f?+%}O-pCM@`P \\\ BP.Cߍ@ &@ C{0P0 `P@Q nm :0P0Y pW    X 0 =RPOP j0 0 i@i[ni%t1@-\0O-MM 0p@t`P2 yPP* P Y:P 0S0 0  < 9 4PnPFnP 0 Q0 0PkrۍЍ0P 0 &0  0  P,00S/ 0P C@-++@-TdP uP <qAA(O"P@PC-@$M  @p0S0d;%P-   upG0S$ |P 90Sm Y0] )Pf :BPaD' D* 2B^($ЍP@RF@2P@ 9A`P'='P'\20S hAp0$A P@ X $P 0)AT 'P P  AP  pPP0 +Q !Xp 07'WpT+pAT3 x@p 0T3:X#  4APQ  R@4Q p0Q  R@ AP`Vp003/P,00  h0S  R l 10!@T+++0@-M M+@(h+(ZB+(gB+Z(8@PP B3@PP 0 ` @@@@@ @@@@'Pލ Ѝ0B( ?!o-MM+ g+L XZ+ g+0PZ ?P  >ۍЍ!0@-@M *o1@@ #P @  pP A0$*!PRU)QW&Ѝ0RL00S 3/P 0$003/0$*@P3$P/\P+X@P'@P# 0P~ ͈>~  0S 0_ Z'P @P0o,m&)r*00T++86,46,@-@M n0@@?a#P* *@s  pmP 00*!R00$Q )*@P  T0S 0` 'P%(,*ЍT++O-`M!0[#*0S ` 0B00 SS@@@jp @(0 S0 0`0@nj 0 S:fPP@ B 0p00Q %Sg0S iSD %S* dS $$0T !PsS$200P 0 倠ಠ@Z4!@ P %Q0@ 0S0 aR7 cR 03/P Ѝ R R P10 R @ 0QR\P0S  S 00@Q0 @R$R0PPR@ $]$ Tl 00S  0! S 0 @S$SS0P @U:U 0 f꬜%7@-@ PU R! o^*00 Ѝ0llP X| :!L v W^m( 0$[+f 4U7@-@QP T40400 S  0  Ѝ0@D9++7@-@ PU  ^l*00 Ѝ0PP | ^d00S RmL 0H[Imv0 ,~+묋+To@Q+ZUe%s@-8Q`@<lqZ|k bgdbg` bf8gvbq9|h 0 An@Pxx巪8[P CBCaa ᕆX|Ѝp46,+%O--* {M`Pp <`0  p@(6 F 0S  P R / 0S  댵P I]|P D]Op@T PcJH @/ U>0B? 08E,P  j)@P  a)00ziPuiPe; P  h`; $;0S ;RP ; 0W00{4$"0{ߍ6Us3 ,k0z"!׋؋ 031,0p0,0L,0   L 0P60 0p0z?"!!03  PW 1p WU l @2 0S l2P  ;:k0S$P0  HT 0  <SR sq1P _\ 1 W @U$2 @lPU k Pz?0WC(0P 0[0 R0SQ 4)\0S=P 0`z{0SP @u l 00TP@@ $2 @@ +$r%ptbtf@++iv++oi! \n0@-0,MP0 00 0\PPP@P DDƨ@0Q ,,Ѝ0@ (r%%E+ -O-iMs?!0,YP 00iߍOЍ/Lx0`P81P ,!,0$`P z[p P@P)PY-'U0P 00GSW030#[0S G00pcP@ Pp00$+Pwd{-O--p(MT@X  pp`V 0 @Q'U` YPPIfP'@P 8H E0PU 0'SP0U*S!/ P0 0mX/0 0P f0@: 0H: qP10Z xkp`PUQ V D2S022SP0220C2   S`` ᫃ny0000 0PDU  @0 0 PA eer 0`R  u_U 0 0C?oV20S ,_c)_`cefyU @ v 0P| e@8_Ry(00CS0000&UP a0P >\0S  \9V1i2y.`PW(UU S k 0%S @S, B* B+i& 0.R> 0*0aP6 00Zp %@P  0A0* 0! P9hVx00F  ASz c~^5ctV P^xd(ЍO Ѝ/; ht@46,0%0@-CMlPP 0S .Q6X@P 4Q Хͥj@Pcdd0S cV:=80$d 0w-B$0B. La 5A Da0`Q>d0 `@400c0 ,_P40,   TljTr0@W R?0 2p0/^jp x#|3 R0:P$P oP @0a X_ z_@P  t_P@; 1sS1lSD;"00`&a`P RP@;Td@P,]_*0x*0wrH B0C   5PT  f8T@Y jW0X649 @p A\)0p 0HASip H0S[, ,)A0$$  @P @0 H0@H0A:ip AA`LVp@fv 5f! H1fH p |)P p0 *\6S 0 >88@P 55( #  [7S   9#l7 P~L7'AtA\@P G@P 7T'TP\804'8\8P$G 87^8 &UP0&08P 8H%^8 4UP00 60&S\880\8P 8 ^8|0S X&8P 8]8m TP000S\80\8)P0S\80\8@|n08E010 ~fbP bP |bP lbP bP HbP 8bP0:4X:4SU 0 PM 0$AtP  @674SP  0@?S @P ] 0{BQ0:$R##ßRl#p$Rt#W%0RT# U>N /N B0C   [0S1 rpP 2@T [΢WxH_Hp#0l0S T 0S `"8U!3S3 V\ #C?00N?C0C Y`0  0@F0@`r4HP;A?p@`x080C4r@,0,P$pM0S `Y0X6W5S  !JoXIUXF0S@0 <Y4!S< " 0 t0 Vo i+%#%Hr%;M?++ oP@+C+D+E+>+<C+C+sOlXwA+U'~iF+oo#&+@#/ E+*eH .9Du l}A+H+&u6[0X6S/?+P 0/XwA-鿏P@,Mp$aP3S0 `0 0` :00 0`@0`00Fo/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ ߍ:@-p`CM|@`PlP#d0RXPP @ W<0080 `0(PCߍ:++ +@-@ @x+@-0  0 P @0@ L280 /P $  Ѝ䰠+F ++f!0@-0@XMP70  0@ P x x0xP t0E@ 20/Q   LL 2 0/R@, ,@}Ѝ0?+F ++x++f!+@-MMP<`@P  I[ E[ލ0 00S@\0\ \y@P L0 (0< B0, =ԏ++++++ؠ+2@-bCMX6S KP \8lP'XT20S H,2\6S 8'2020" (b2PPr 10 :4S / wt\@aU |10 i:4!SO *00 0 B^x[||/2@P) c1l Q\NTKDH0S 4!4A,!,=0S  5  1d,P/\6S *'U NRCߍ 0 B?+V;>+loA+H A+Y%y&C+ko@+C+h:iE+ * 0@-P@ T\ ! 0C @TR 0\  @B_TQ  S"#0  @ S! 0  @ S 0  @ S0S000S\RQ @  Q  G-p@PhM 0S'phЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/0 \ P0//!01000/ 00#0//O-`$MPA@T W] pYP00 0S 0S0S$Ѝ@-@MP Mp! *0 `p Wd5\\ SS=S 8 d3R 0 ,0 ڍ ЍTT  G-Pp0@0Mw'wPP ]`ĐĠ0 R PЍ 0L03/P  0 \놁0 \  Hs,0S P HK HK`P+ p@-P`40@0S 0 p@,p@-0MQ!0`L0 3/P< 0t@T 4/@0 0 b\ 0]\ 0H,0S HgK,0 HbKT `H\K HXKHo\0S0CH ,<$H F,ЍpP+   P P00 S ]S, R ,0S R : 8 80R:P#3///@-M`p@ PPЍ2PP \]PTP0 pP@$U@@T @ @d0 @P. l<  0S/p@-P@ 0000p@O-p@P|M YfP+`P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p`5`P 100,`00S.0 0P1<00 m0`pP <@D<,@0S `P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0,0 0 ,0Q N @-[ P 0P 0Pc PQ\ QTaPQD "P 8040P/(/$//tw`fp@-8@Q 0@P@DPp *Pppr%p@-P@P  FW I00ppo@-  pr%@- } pr%G-`PzM@PN/^ W0  p0S1 0S@zߍX'P# a-P@l0 1h0$1d0(1`0,1>1S$ FoP j?l%0`J?^0S ^0SAT FP r[P @`9p̠( >p<$  e $0O.Y x4 P 3SR L ^ ^0p0? p0_P 0S0)#0C?o27 #3RR  0R67\ 'Sz?0C'Q0 zpR0ЀG(Sz?0C0(\F 0C Q@ 0@ P P /P  ,0!4!PŸF0#pY2P  @000@0"/@0@N?@@T@0S z?0 C,0!4!P刀0#]0!p J k]T Ie]00I? 0011F10100 d84p1P8( s1S%4p ∠0!n 0Ai 0d ,0!!0#P 0  ,0!!P0#0h puH lWŇч}DI+QNEFXS %] k 'Q`w @-@M`p @@ 0FpЍ PP  l@@ 0FpD=<@P 7/P.x @-0 0P ЍdX @-0 0PЍX O-aM,MQ0=@PᄸP6 Y`P - |YPP- Vl"dT+"GLb+bG`XP@``VQ aV+"~G+byG,-P P&0 Q%3`VK0$P 00S 3/p0$aHbb>0Ep0 S aݍ,Ѝ\QQ0GoG`FYP 0000!!9`P 00S 3/p003/NaV $P 00S 3/p $aV P p0 PP pxb.;9/ 0 PPpxP;".5/0 #X R1   F KT0 0qP`lqllV b +PPY  DsvPQy+"Fb+?"PPiYP# YP XP XP XP XP UxT F  FP (9q`E Px#+Ұ+ ]%Q<< Q 00C-$0pP M`A@P00 P > C 0 1/PP0@0 @P@00003/Ѝ003/$Qg O-PUMM.tx`@4P[.z[Q_4Hj$;/WpWp$[ Z T   70.07 00P00@\#Pz∗40([Z4S =U?h400C287\4=1 W = 7h400C26\4=1 0 00  000000pp  [0440m40s -14s[w0 00 00000 0zpp 0440K40s -1tPw003 E "R5@ UݍЍP =2 (XL=1຀P0Nc ⺀ h \  pw00$?00[000ӧ?&N?`/'#T4`(04@ TL40S N?/$$T4pWH4 0}10  A |R "wR sR04 1p$ ,01(.8,40001A  B6`$1 (11S)104 $q,0(8,4q0$1Sy 00 t  P0o^m ,Ԓ@p1# 0H$100$4;B|2P p>{`{ $10 ,$! ,0: 0G80C0(1}1S 0}1$1S!> ,! 6$40`040T+46,0% Rr%++Џ+X++ YPP  (00/0@o//BO-@P MMAE0*!Rp0)Q`U0 $0 b  P  Pp ,* (0$0 H$(pP l4\,] ܍Ѝp @46D40Spp0 @0 4p0SW00y , Rv  000x;8,9/Pc 0  x08,;`0S !z84X0Sl! hSd! `80ĄL0PQ@(1P\0S ` R !8Y8 ⮄Q⨄P{⢄Pu✄PoX 0Q⑄PdbpQWppg  b+ l P'B S aT+  <    XY s   K v Q  Y  % c 1  ) j 5 O-eM0M*Q8U"U&K'@&u m X w&0 h0T 0Q @F@$R )qWe4p} nP9 FP-' *P ; @P) @ pH0X 804p~T#Pp< P U \@D`@ P p PU    T0S/   0S # 0P000P FYP #p40 80 P 00 ,0ST0 S00 P0 40040804 0SS 04  0x; 8:/0PST0rԢr S S x z y y y y y z <{ z Sb  SU 0|tr t<0SP<0PLpLL"@ @ 4,RP Ÿ ,0$ 0 ( Pe 1Pp SP0 0ꜱ5S0+^Nx1 pH u0 S\ rT0= j@t%< 00 014s10 5@*) b%`%^%0S Y%W% LFލЍ+  x+     b4 &+  9[D6 Q(@P? D L S \ c o w  vl; R  l   h&O-@BMTM\p P`P  @P`T$$ { P```^PP@BލЍ؃ГCг @3 (4@$80DP@<@T@ \  J P  ` B 443 0 4 5 3 $0( 48@YĒ " P   똢嬂   x2 08@h2@DDAT T2T"TT۳#P @2 <%PI02 ( ' 20)ATp !0   P& !1%0 Z|#P@0SW K0S0@4 000@0x;8 8/P6  %P !c%P 0  ~ @$$0 K@pW: p@x Ұl o 0@o/b 0 11/ O+10/Pp@-@4P0 `K1111p O+O-P@p`АРа0* C  !0  P~R0+S   +S 0P,SR0B `p@P X 00,0` 00000 Ѝ O+l X 0@-P@M*.LR1( 00 0d0@00 0T0@@@81 0 000@.P(wߍ0褌 O+O-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+ { 0 Q{ 0S  bJ0 0P  P 0 0H  R,  4@T  8X $ T\ ( p` , d A- +R 0  P0:CoЍ@-| 0S lP \0 T0T 0PP0oL004 80<h( Ѝ Ѝ&+ ؠ+ԏ+f!+<++@-t@Mhl900 0X00. B00 08h $0l !Ѝ O+|x@-H0@,$ Pa@v+PE.-?@-P @ V{ R ,50$@3\Ѝ0@ Ѝ/Bc@-0  05 P L0L L@ 0< <@x0 $@Ѝ谠+ +f!++-3M M TW9P0  4KP Ko3ݍ ЍPNN-3M M 99P3ݍ ЍP00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PD@00( (0P,X+ܠ+ؠ++ԏ+<+++@-0  0 P <08 0440i000 0 bЍԏ+++++0$ 0S/ /,P+0$ 0 S/ /,P+00 0 S$0 10 1/.P+ O+11<0@ Q !@-0 " !/ O+0 10 1/ O+@-7M`*.sM( 0l0d 060 P0008 0X@()7ލTt% O+0D D *Q/QQ Q/ O+Tt%@-@0@ 0 0"PPЍ@- @0S00ؠ+0@-lAMbd@ E P@P@00 0p9,/r<Aߍ0 O+d+@-P@ c0P  \Ѝ+-@-   Ѝ Ѝ/-@-\0X0@P D   Ѝ@Ѝ/o&-@-\0X0@P D   Ѝ@Ѝ/o*&J@-4P P Pqz@-@HP@ o@-0@IP$0  P000+ԏ++@-0@IP$0  P000+++QA-@@1@#PP1P#Ttpt` aP t uc""KAHA99[A[46,+@-@P  lL  Ѝ%0@-EM P@ D r;P0000U ($$0p:@ Eߍ0d+ O+}p@-\M2TA _D H41Cp 0!i s%<<0 00 000H0 0 0 PP`\R0\2<Up:` J5X (D((Jߍp O+d+U|  Pt% @-@P !0`RpzHP PP at 1P`pZ T %01N@0\PP@T 8[ Ѝ O+Pt%@-@<=0@- 0 Ѝ0@- 0  Ѝ@-0@M00  0Ѝp@-P<@0*SpQ {HPp@Tt%@- 0P谏++O-$M@p`P 0 P( 0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ$Ѝ!+U+$ؠ++BEO--,M`F$:@pq[@pPe $:P@cdT10S@ FPPEUN T1T!TT-$0 0  @\$0 VSS00R00S F 0 C HC$90$    0:$ 0VRR  P # 2R @D RC@ Q?hF `P$ 9@,ЍmxA-`pP@P!+C fPP 6/ApO-@ M$z9`P0 Ѝp0P0 `0VSS00T00S$X9-@- 00Ѝ Ѝ/\ -@- 00Ѝ Ѝ/ A-`@PMMP\ `P`ep<@ F43T0(3T$$c3T& x 0So 0CS+PDS0)  0f 0S9 0S r0S 0S QN@P% 0 `D0 P@oH2@P 000C?o2|70 &n0`9(D,0SލЍ!|7SFP{1Q! @F?@F9oh!H1PX0 H 0M('  0S 0S| q0Sx 0Su QN@P  00 @P_F? Q. QFNjikh+X+ܠ+9f!gF+Pt%g+: f++M%`-MM P  P  ۍЍ-MM P  P  mۍЍs@-jP' `PeP G%`k0S ܱ x p @LP &Ds@TT=ЍpVx0t+R/ @-dt+\0X~T0PzL0HvD0@r<08n40 O+@+l+D+h+*`+p+P@- ) 0 ЍW+p@-@M L(@H@/H0 #,0@@,0H 0/2Lhf@Pp0: S (H@P @ @܍p,H 8HA @@PP@Dڸa <UPP?8 1!啦8<DQi \1 08808@TT OoBQP@10S nt < R t00 00000 00l0pP@ m(ht(0@C!ԏ+A+++Z+ x &+ؠ+ O-0EMSP8q @ a 0!@)0`SPW!000 @97@3/@P EߍW! 000Z 0SX 0 @T W  00 0  0S h00S X  L0W0 ! ! 000갠++H+?+c O+@-Q@0  R < 60 000]Ѝ-S iPsO-DPUM<04Q $Ȅ F $ ğ0*S^P3s0胟C0`*V`5# 0SPEBU@c A@ |ZPp{HP XOTLHI@1 U$?  P P $ 0RP P #^ 0 10S 0S< 0 1S800 000S MP+0pG00 0%2F3U!0a  0! 0 0R R` 10 1000pYR `0,S RB  0 P a+S  *SPR Uߍ` 1 00000000 /UR U@P@T Tt z<+xH+Tt% O+&<XPqv86,46,+A-Ph`hp@TUSU 3P  IP`{%O-@MMp\@ @P hrPP6P ^ ("@ڍЍ MrP ErP PVPP PZ`P5E* cq0aA =P0=S@  < PigT >P 9@P  Pꤠ刐P@ &@P K@9 5w-  i*0p@-4 P@D0 Pp@@-G-`P4 D@T$ `V! p0F&04 p0RSP pgPp Pp40Su p =Pp@V/0 R/@-`p0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ PYDP  p@)@-@ 9(7@4A-P@p`p0S 0pp R$A!05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-0pЍP@`=p ѷ/p ȷ · 0`ặV0 t@孷T  \0<PLP <P X@WŇч}D0"@-@M M`p;@ (p  P pC`C`ۍ ЍA-@P ~CpP` P  0Q~PV|d zd@@-@M Mp;@ ` p P0 @R`QVC`ۍ Ѝ edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP<00/00/4\80S0 S001/\80S  00@-\\@!SR0(SS QU S!0$0S\  0x1p@-S@!0a408,08 S0040803/P,000403/,, H0 , 4 T 8 X $Q  0|P!SR:pSS P Q408S Q0  0x40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 Br Rt0! 408 00803/P,000403/,, H0 , 4 T 8 X x000/O-0@p 4MPPp`*04ЍO$0 L03/P Ѐ0 P p!D@ Z[H * R T Rp  ;8``pp 0S0P 004Ѝ, [ 0ꤟ+O-P@4` Q 1SQ " 01 r " 0SQVLLSS<SQ R0!S,0S p0 p002#000000S SPH P00P0  R R00R0S \ S 00 0S0 0 K`03/P D  8 $ O--0t(0M000PS`@p0(0p00 ' 80s$(3 0@=(h,@l|Q@3p, (0d@B ` H3`R0000ЍV0V*8q 8 0L03/P 2HR b0 ( 0 0 0080<,02  ,04 <D@0  4 <0p` ,04 0<P23W 4f0( 0P0,000SOH0 L L00SH0SP000i h0,0 |0 E0 000(000  i0 90 00000PY (08O09/<0 PhQPQ Q*:p ` Ylh ,0a P0S h^ 0$0h0 0  :*<p `r 8 0a+P+a+":C-F`0pSPtM^hu<0SLm<0 S0e<0S_^<0SW<0SGP<0SHI<0SIB<0SJ;<0St4<0S\-<0SD&<0S000$ R$000 "0& W40SV4 QQ00Q00Q00S 4 tЍC ( U;0SWBW?  \ P Q< Q44<0 $b4004 0;0  tЍ3003 0;0300 0$3 0|;0 0tS 0(` 0 0 x (SH 0P` 0SH 0P` 0SH0\000 SH0`000S$H0d0S  0pP 00  D"   nP0 ' z R>0  H0L0  H0L0  H0L0  H0L0  H0L0 p H0L0  X H0L0@ @ H0L0= (tЍC !SH00000P pG d 9/ 000(0B0a+yz{}~D  \b+P+k$ 8 y   C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``B0 0pp07/@-M0@ 03/P 0 00000 #003/ލ@-`,MHP 6@0 0 0PP@00 RS THP pW u;P00P00P0,Ѝ @T@0/W/0  0k6H P00P0꬜%P0@-$M@D0X u 0P 00 00a0PLH0Dd$Ѝ0O-%,M}@PU \NXq pPIpDEP`88 ,pVV !R "2 V pP P`!V$Ub$U p 0 50 00 00 0% 0MsPP CZ,Ѝp xLy C-40PS,M80S,ЍS S S !S S @P `p䐟`$`X 0 000 00| 000 0 00 0 0M `PT4y0  O-P@0p(AMP U   唂  `1#0 !(p0#UP 4]P H500 P SP '0K0P0F[@@0 ` @0AB4A0  0|!4C* @p0  T!*- P0  ,! DP`8P@!@3@8T -`s<T@D@`0@@< 0 0K-e<0 0@`0P ت.l 00@` PHAߍ #"0P0RPP+a+ D+O--\5M0 04`A00 00```B0S8@P 0P40 0H03/0pSP,0` p p0C@ 0DP000P`ꋟ@0 StpP pv0,01v0(pp1P !r B B%2":!  R B *; ;0 R80pPw0 R#,500y6000ЍQd2  0@0D  V 0$ p0pC 0@D @00ZD 0S , S00000@3<0X ≡0L0 3/ 00X08I`P !@ B" )8T0 01`0(`10q0000W 0S/ LP0 5/P 8 <0 @ L0 :P00P:4p Q:  BZ:Aߍ L`0 6/Pd 8 <0` @]0`4000V 00 V0  R U 00 U 00  RA 0 , 30,  3Pp@ $0P0(0 p @0`1 0 $ 30$ `@3pPvP` P p`@0` O--@AMP++pO-Pp4M0`\03/0 @T @@T@   ( P(R 0$ß( X0Y0 200120 01T 0 0 0C0CCR 2"ȕ€0E0 0t2@0l2J00`00T@@@P,((@4Ѝ<1@1pp0,00Ž0Ph 0@ S[00S2[ ZJP P400S/ 3/+嗓)08q P , (0&4P(0, ZH D00;0(70( mP P@ (0,(00T,000(0( X@ b+kP |  o `zj$ ra+P@-@P03P/KP0S0PO-pMCxb:TUtX4{ 00 rs ,b0  * 0" P  00@0 B )R RP 0Q R Q 0TR000US0a0Ѝ0S@0  llqPT00U00@0 \%41R7 (R3 !R/ R-R I 0` ` 0R 0R`[YoFT00U00V 2 @2P0 /S`Sp`` [YuT00U0,`0xzc+Wc+c+T8 Tc+ 8Tg++PG--0MS@p`ЍP X0p`60@ R 0GS \ 0{1@@MS\ 0CS\SS\0X0+R0S 00000S O--OM M#0 P$00$(00 0@0P(0P0@D00P,0  0H03/80 0<000!6 0R 0  0,3/ 0Ps`` r S04 X&40L&XU\40a`0s0v000 0 &bp`0 :,`pWX0h05R0lp0zh 9 `pV Sqh 0`U Tih (PUch "VU 00 08PTa4P0dP`080S<00O>0=C0H04 00$x;U 0S  T0Pa0 000H0P0 F0yPT0S xx1P 0S4 `Q00Q0S 0L0 aA3/P Ȑ 0&003/f0F0P ! E  0 Q01( $0Y(00$0 S(0 0R0$(@0D 000@ RD 0S8X4#a`v 0"0(&000!ꀒ   00x 0 dޮ0  00 00Ѯ 0/Ȑ 0 Ǯ0l010h t0hp?++   [`*pV 0 T`U 00 0dT`0 <T`T0P0%0 Q030#Q0S ,0 A, 2Ffp 0$&(?0 0PL 3/0!L P`Q.V#P S(0 0K$0 Y(00B8 C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a+$0pQ@-4喻~ #"T R0//@-(@T@Ѝ0 0 0003/@PgO/@-|M#PP@" @a1!@p@P  *0@T@pT 0 @p|ЍT0| dp0p pwP P D  갠+P$+ +&/@-z :@7M///@-0@Q0T@o?0 \ 0P000@-@4M0  -P0PU*0 00U0 00  074Ѝ0$+//A-pP@`|VT0S0S &+PH0P$1U*0U0 00X0`p@$+0SR00/p@-@P)<0P4`" 6D0# A0$!pP++A-<`P@*Pp( % A(+@-0@-AM k-0 hu0S XPP0P@0,U 88 0 $Aߍ0]^Ԡ+W~1G-1`P!M@PM/1|!1x  pqpq{l`PdLt s-H0 [ܹ!ލ @P :) y%@P 0=S.)!>A@ >⎿@AT@  P 0 hnP L e<  R3DiU+1s@-1P@,PM/1\`\ 1  L L P D : 00'eЍp謋+3-p@-0M0-000`00P0^@P @T 1X 1T1D 1 S4P1 1 Ѝp0@56 0@- P F+C-`CM P@ `[,P pܐ܀0 `0`0S1 1 Cߍ5S  |rp pP\ ``X0S  @810 1ԑ+^Ӑ+6s+G5Qp@-P@1 1  pd+17@-@P剸@典 0 Ѝ0@ p@-P@ҸP P.1 1 p2p@-P@1⤲1(1 P.11 p$@-㨸@G-@M,p+T+R@`r夒T5 TH To20$0@TPp"pp0`pDBpP0Sh Sb  @+ 0` 0P@MP 2 SPP ލP ^;P !080 0*P |!0t1X 0 , }', 0PҾ0 u' 3X,1,1L0d,b,0!0P PM?00P0@: E3: 0 0 0F& 000 p @ڱRP|%P+6d+Ӑ+ԑ+s+T+/@~+27386,46,# Ex# A-P$p4儾@P a-@T ) a#gP( 0  P  0J P -#@᧽oЍW\\h P3< 0  +"T}h//O-0:{4pn@T Ѝ@T@T' ^% L U [Y  [ XY P{ UPE P P$@ @$0"/t+O-4Mp(tZ,@fP @ P %R!0ͱV0 0 &0 V0 &1!PP0@P@0 0 000 0 T000 Q0#02S4Ѝ;0 0Z   R% S   0 @    0@ PV0V0 %1!PP0@P@ RN RK RH  R ࠡ࠳ $,( [Q$[4TT [ 0Z0@PV0V0 %1!PP0@@P 0 T00T Q Q 0   ~+0@-4MP!! 0  P PP@4Ѝ0@/@-@ @@p@-P@/>P `@ H!0P P `Ra BQQ pQQ 0@S:p @-H⫷0RH #@-!0@-P@04MS!1P4Ѝ0 P*   P +0R0#@"*S Q 0R|+0p@-@ ^T00PUPU' \$ST ^Vp 2@Q.^U@P@ @$ $ 0 00C 0p0 p@-,@P(0P ;pA-@H`HPpF{T00ԗ@"T01 PS4{X+ 00S@- /X+Ї+C-麋XP(p,`0@( 0 XWaV|V T0    ЍАYĐY R  U:0V @  @T0  ɺ16@-@P 0  Ն@;Q{G0@-0@S~0d Ts0"S  @0<00R( T40 X+t+x+G-錑P0`Sp@Q 0Q02@1;1':X 4kpB 2 SBpPTPRTP  R T R0S0T0S @0000(Q $$p Q 0S T v  0@1 00 00T"1|+up@-P@mP000p1O-0@Sp`P 0 PQQQS SK0UȰС0r 0 $R 0 0"60(Q $2$p0, 1QX#  E vQ 00  R [ R @R H0H Hԅ R# Ѝ 0W1Q:P X+`{Gp@-P@P0Ss!U E p(0"E0P4 305050 0(2#pX+t+x+40@-0@SYDP0@ЕX+zA-Q`0@SG!V V p0耟 ST  4V(Ѝ0ոPP P4p00 0@0&`p0T EL p: P04 `;0'p(0,0P(X+x+t+m|1A-0`Sp@P0 PQQD R<0 |& 2r 0 !Rv?000 RU  (0$0X3,000 1Q\RP 0 00  W1Q:P0X+K@- @00S T $崲@Ѝ7@nO-X0MSM2"忄\0@S2"`0Sb2"d0S2p"h0Sx2T"tH k0SL8 80R[ , I0pQSPPSPU @⠠@m`P- @ \00`0d .0h X 똱;S/ʌ|!|@0hP@_oRݍЍ RQ8 R 0:S 000a 1 0 0 0 0C0 ;0CS||zPp~{G7QZ l{z& ި%p@-\P@0S Q0 >q   R@Cp|+O--BM MpX\0ն@P 0` ;`( pP\0 ~P @Bލ ЍQ  0 0d!V`v0 00!$0`4X00 $00 0v0; S٨ P|呺P +RQ 0P \Q S0Rʧ0S R6 S 1 S S"0S000000 0000004P 0S   0 R$ ? ! 0$ S0S 0$ ` edA O-$6#Sp 0 G P` ;+[0< p0 d00\ `0h0|0 0X00 P$`P`l0 (04H⨲000 00 00p;{Q@-`X0Sg0 市\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP U &0W Ѝ|G7{O- 0TM,00P(00$00 40 0{{p{{@00@vP40ZZTЍ@`DP S S H0!401R < 8080< 1#0@4 PD0 0LR0HL0H0L ,[` `@D,\  0 pS `Sq0SKp+R ʘ10R02p1;1':Z x(00PCQWQSWQ 0S0W0S0G?o2P0S p2Ȱ`(,0,0(Q $ p$0 S  0S G $v00p1 0$ 0 0 0S  0"ıU0S 0$ P0G"1|+uO-M00D@TЍpP`Ра@D0SW@ 0   0 0 `1/Y  S      Q R  0@0 00Q0 0`p1/P ꄮ+{A-Pp@`0S  R 8p0 S7/P 0403/P 0D03/P0403/A- P@`p1S 3/P P`VUd0PT0P0S@000S4000S(0000A<|++{(p@-@4`4P0Sp@,10S 3/@ꄮ++0 @\ \ P0000S/000 0#0/0@0/p@-P8@q 0X0S 3/0P  P  01 00080sp `^4Q Q0 0`40$ Rp `083/< 0 2 P   `‚ 0S0P000(b 00//00/00/00/10/Q@-@@L 0A0003/Pg@. @ C-B`0pSPGM;00S0 S 0Sh0SP0S_0S0S00$ R"000< R&0pG d8 9/ 00 (0` ŭ0 tA)( 纭X0SW@O hO O O P Q 00000 0 0 Gߍ0000 0000 00 0Sl0 00 Q0 +yz{bP+P+kG-Pp 0MS 1ߍ0L08 3/P H0 8 L00S4A 0S:0 0 0 0000P@T 4/@@1 0 ` 0 0`hA0 R Z/0 00T h0:/P h00S0V0S ZZ?V F 3 `  ?0!CZ? fh0 010@0`z+P+/ O-PMά0@ʬ0` P8 ì`(b0 E00 0"p!ᵲ0@0 0!ᩲ00p@囬 Z@F.@x匬 0 `!卲fレ @p0 8!僲4y(!(p 0z`P0 R   P Ѝ 0p!X0i `Z ` OT0 0-p @ Y NT R ` @+P+qB +c j a+y| +A-@0P\03/ p`W@@P@AP80BW  \W[0 V  0  !   0 00$ 1 x    l   C`  0SJCT L0L LL}0<D@+k_ W oL |y `c s@-P,`@ 01Ѝp+p@-00M0P,03/ , հ0@ , S:000 00 00 0p` ӥ0A0I0Ѝp0b L O--@M4(P PЍ P 0   <  `@V0H03/0`SPpHPpA0 0, kPP 0t, S n?2I0C 00A`0000p0400` 啨fި}0S \(00 L0P 3/P XPPTpP\p0 S8*P[ 80 S (- 0( S001x40P ≡0L0 3/00 P0 00006`0p0`0 0厦p`x@YѦp0S @, 0H03/p,U@9@0 0S001Ѝ}%+P+dM XK 0@-@80q  003/P4 04ЍP2 @-0GM0@00@3/PP$0SP `p0 000 `p00S 00@03/PPPGߍ/A-@xM`D 40Pl00$pp0Ph廭@P3 P p 0d$0\ \+T „P 0X*0L08 3/> 016 0100 0 00ХpPẮ& 0☢ᯮp0S 0h 0Q*08 @,04/P,qP 0q00 0S001xЍ}%[ ~%dM XK O--@0lM0$3/0H03/2P0`PqTW0pZwU ``A0pP 0(3/P\ Lj"##$ 0H00 40R! H 3/0L8 03/p@ 0L08 3/PP9 0 R6  #1//L"P#0X 80T3/L0 083/p 0倰$0Y 00㓩.8$  pP `(;/P PlЍ +O-5P0MS J?0SVU 0SL5L%LLy`VI <%@T dO@Fu5 0 5 0500d @@qѤp`廭X0pT,Q0N` 㐤80$4@`!0 `40 0,0000 (00厧0$10$0\$10`\0@ pd000S< p0e PÁx ,p3 000000 000 0 0<0pZp` J 3d,0%ᝤl0S= S@: SN@`$P H3/P 0p0072 |000L0p 3/P '0 00S 00CS@` 0ST 8@P$2Q XЍ@P00SZ 3/@@OoBS l0&00c10@!R|!@!x|pPpt岠t0S|0X*@J@P TQ 0!@x 0T:x0S@ 堬t@OoB~@|0xT:@+ | T++xP RR 08+L L +L o L + !>O--hS 0UM8 :P40@pD .P )`PZ Uߍ0P,0 P UJH,30 00S 0RD 80S:(1SK1400J ,!LH!0."\0A 4<#H@; $幥<嶥< 0@PP11@T "2B ,04 P0S 3/P|20 SU@0%0cD0ps `2R僥\1Y N {Zx ,H!!LPH@0#pPpT@dP #p @ 000@ @040g @§    0 巧 0 ⮧ᘫ40P1: 1 !  Nw, @0 000000 0000 00㌢pp D[D0S#, 5Q7[T Y fdb,`w ỢYf++j?!L iJ!| G-p/0JMM`@ 0 pp@PP+jP) g0S% c0l"`Ϊ!`\ p/-0P T 0CT *0C/Q 00Pi@m+ P:^?0  ^P+0: S `VO>00 PJ>00C0/S04!倪+c S ᷜP+ W P*#P 0/S`0oo`bS p & 0 PV+t P*+ P*ᲜP@ᰛ@]᫛JލЍVf!UPI@-P˨@-M @֜P(0 : y@P n P  ꂛ0#((R 3? sQSЍ O--M pP@P` WP`m0PЍ R  0P:0*  0DpPϐ P W`0    "f!]!qG-|Mo `P`P PP<^+^@P@R 0 Ŭ@ F<@P +JjJ.0㨬+J[ J.0T㙬TX 㒬PP~D4 ቬPPu$ +J;0J.yPPe+J+ J;` bPPN+Jtpll40 0J>P 0 .CP UT 1ލ⸛P@Y+JJⷛPPp0J.@+ P h lJ> PR l!u!!!!!m!!!!! !""D~%f!%{!!!!/00/00/00/00/0@-0@4M#|0$P 0 P\ ឨP0T0760 P厢 M@P u4Ѝ0P+*++O-AAd2M(0!0PB(0 0000m 80sS0`p(00$00 0?00$0 s 0$W `5 0T%P500@%`N0,0W,5 #=5P00 0`000 00嶢W D`4D 0S_ @X%SYeP X:000` @@`S@0S 80< 03/P0p80<P NЍpv'80s @0D 0 0Q:8`0S}0L0` $3/P$ & [P Tp|Gork 0$ Wt 83H3 y0 D Q%0C?o2000;00H03/W0@0 a& 0X  0  1!`00;000Q!{  (P R`p,2;0H082Lp0,!<1H0A``OP R0$ 00 00S >P V[0꒘ 401P* 40Sp t, Sp ,008q ^ Q  Q0 0 0 p0, 哒)000;0, 00^00 `00 (0 0 R 0 0!00S {`(0`UppP+"+U%n+sPG-QM{0`Swpp0 0 0 P  "  A" զ 0@T0P S"TPu@&x"P@0Ħ@@,0ST嵠X@0(@"左@!#㫠,"P@&0⬦ 001 0 !00' XP(!0┦P@0p00+0@080s 0=0 | 0 T ӦXЍPU PP@@P $c0!X@(d 0 h00X@0S0 400t0S00ᣴ00P0 00;X@(0l <@l1 @8q 3/PP+y"a"q""""0@-)M@j0p \*3 + ,P 0 XI*X B- 0 F  .0 0Ѝ0!0P8q0 S+P ,̟P X J++|"X+A-@  "(0M)( 0P`Q2X1200500@1081$ 001@`,01000 1800 P$p 0PUp 0S0p\'Pp,P(FAߜ(F@0Ѝ0`0 PCp0 L03/P 00P 0p0 PUp0{ |܌ P O-P`pp400W(ZWp "!¤pPP p 0  0 @p0Q 0S   00,0 $0T0 0X00@G$, R+R P Q  P 8qT00PR0  R RP  P Z0000 ЍpO-l2M04p@$fP`PP 0 Szn?2@|1 01Ax00 00@llfx0ST( PPM p(P01ᑙ!P0P(0A x 0`R b ",0Wx  BP   0 008僢P0h lƾ(0, 040x0?o21000Ѝ0ᒾ᏾m+ o4 O-p@᠁堑堡,M0 S0 0000 /00㌟0S,Ѝ/S  /00`pPU/(ᜣ`P p呈!PP PP%0(` 1`x t0 400`% ,08`0100/ P 0 0 P/;`T+QvO-pP@\M4 `儰<0 SpU  0  Q $0S  0 0$ pӢP8\ЍO*. M P0:0pQ ",^T ^ 08 %0`0000Y (0S`e ` 0 R{H03/p`0 [ 80s P\0!0000 SPU0"U00[P 0RP  0 p0 P  !€ P 0$U$p0p[P0P0[yp P 0PQp0[t?[00S& !P0 :p0 00 0RP\  0 1!2 S  P0p X 0S'  0R 07 0  !0SP0 0PU pСZ050Z0* Z%Q Qp  0S S00 0Q0000 00000000 \Ѝp0 0 ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P 0 0 , 0R 0S 1 `R ($  P` $  P 0 Q0``T R T  R X `( 0S0L0( 3/P <00S D0SS000(( } L0( 3/P 80<00S (0, S004 Q00 `( ~[0\vAQv0[[r8qnP U c`p8|Yʜ0 :0 L[p㜀, SS 8q 0PUp0pu R 0S  0 p 0  ! 0 ꤟ+0}+H+PsO--`M,p@4 00PVY pwpPT Pp0Z:`PU`J6ERUA 6&Vm00#h R 0  80s0`F`pHU p h0S 00  80spHY pPp h0l0 0L03/, 00Y:pPpVp00P80p5ЍO;p0H03/,0$ 08RPP0$P(<00WX:< R/*pp,0PP UP`0$0$ PS(0& (0$ 1! 0 Sk@DS d0S 0 `p8P0V]:40S00004000,0(X{$0( 0c2#$ + 08`@ <00< R:pp8`Fp0< p 00<<( `8q ,0,( 0L03/0 00 0`VV0$0$ S(0 (0$ 1!P p0h  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0Pu0H03/pq0@08P0D00[s*p0 0 `<080s^00[ <0 0RU4p0 @ RD0 0 H3/PA $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00  000 0W 08   1!7400000Pm۶#]7#+0 04 Q000p <0P80s}00z } h0Sz l Yv* 0L03/Pg !0 儐X09/P] 40000$0$00(0 0 0 R( 0  0H3/P. X$ 003/p3 0 L03/  $0( 0S "(0$ 1!24000040000@0$00(0 0 0 0  0H3/P<00`0<0w 0R40$( $ R( 0  0H3/P* $ %P 0 0X 0T80,3/00T00X S \ $ ` ( d , ,0S P0 P  R0P0y40000@0$00(0 0 0 0  0H3/P P80sa 00^ Q Y 0 SV 0 R80X T,3/00T00X0 0\0 $0`0(0d0,00S 8/ L0 3/P @D0 RP RP{ 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQ>Pp`,0 0U=:8傞  0 0S$ p0p0$  SUp:`P p P0j"RTp YT Ye:PpW00 U0#Sw Pp`Ѝ #"08,00,L0 3/P p开8 Q 08y\ X W 8P@DH P0   8 rp08Hp0!8p 40X 00 0S 0P*p ` 80s0 L0 3/P 08400H0, 00,0+$0T00X0pPx 00 80sh p Pop@-@P(M(0S↜(`,`0P00 0F0  0(PP`PⴔP,(垝(P(Ѝp000{,(咝0,`(P46,4 R+O-hpM)1$AS TP T(!0 "PPPЍ0 @0> C 0 1/@P0$A Q 0 > 1/P@P 0U:0@!RP C$ 00S H @3/Xz$HLP`U X["1/"P, (07, (0;P0L0 3/P 00S 0SPX003/PX0PH03/ 0! P5/P%$%$)@0 Q0pLYI@/Q P, (01/(0, Q 2"gX$Є  02PP  0' Hp0  @D@0 ᄐY80Y> PPmՕe,0S K0P p@H H 8LP (08/P `  ` @(08P 4/00@D@H,p\ 0,QQTQ  @DPT QQ0p p@08L0P 3/P `00`00P80P 5/00P  P 0000000 0P 000 +T+p408+{ { ,{ +<{ { o Pr#7# 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PWV`4Ѝ R00S 0 //O-X`P@ < b"0800 c#  p 002   0 S R( 0S% p  q' R Q0 2T 0 < k+800 c"p0p00S    $0!0R!/S01/X+!0 /X+$1p@-S@ x1SP $003/p@螚x1盚P$1 0SO-@0`PKMM0((0DpH0S >I @0 0<0o- %#{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,jppK܍Ѝ(5᭑(0S*< o #80a&@@ o'O-`0@PMMhh,00p 0S ( 0R> 9 H9 00 0 <0.%#@~40kP`0V,p0U 0000000 0 0000000 00p`ލЍ,܍T,0S*< #0,0A#X0S000C0C0000S0 0,0A$PX+ o@-@-0  !<$10(10,1P001.@-@0 0! 0O-4M`@(0T`X\d0hpP 5"\ @ @,0;/,0P R7P \Pp2CF p W 2  0 " ( 00 0{`LĐc(04ЍO/P%4ЍU5p@-@Q-L h Ժ P 0 Pߒ40 Ppْ <0dp@UPВ80 P<ʒ,0 P(Ē00 p!#"##%&p@-PMV`@Გ  Vx Ȼ  P м  8 ` P囒 0P咒 ލp`凒P00S 0`y40PlPs80 S80 Vk 0X0S(!i@^ 0PV\0 `0S S@`Ed0Ph0S C@l0S 9@tp0S@ /@PL`!t0P3##567_9##:; =>?@-PAMV`@  V( t ľ 0D`qK0 @0S  t  p8`V@ 0 Pܑ 0YAߍ(0S l ֗@d,0S D ̗@00S $ —@ )#* +#-0@-AMP@0Q*| $ 囑   q0`N 0S (0S    ,`V HAߍ8w  b q0`N 0S (0S    ,`VP W $0PN 0 PH0 PtB0 P<0 PH60 P40 0  #60S O-@MU M,Pm 00x R# R0p]娥娅qt8`  0@0S D` P& `  PC  Dj  dpW00(0S%ږ$BT00,0S$͖$BG0000S$$B:0+ 0 p0B/ߙPp᭠ C"U0S1 ` ` }똣0p⇞ 0S  E  A`,pYV "n$ D|`嬎 k0`0"  !2ލ@噎 0   0S  "| `PV 儎 0  "1 S ! t 0N0S @0S"@` 2ލG<0040!00"Y@0n$ 0DL03/00 Dp p q r0S |!0 ?LD` 0S " "p8`Y0a x 0QW 8 <0RN  0  0@ ".+@ 0  c R0Uh 0"  $P$vG% $$$w$ @-x @D+0 @0p0[d㳭 @|$@-D @1000(0,0000Fd㞭 @{ꐯ$p@-|A`0PsJMd!   01SB  ͇Jߍp@0P 0 0PP@Վ`(PVU@@ 0 (s0 0(0 00@0Ἆ(3P(3#n,P0`0PP`x~%o./ 10p@-aPM,0$0Ps@!   0(❊$1 SP| \ h t P$1P$\PЍp 1 ,R,0S$01`@VTPP 0 00 000 00P0I0z3P0v3X`@P`@o@<` @`@x~%oX+     O-P`08  , L  , P 0 00 P0 PP? 0/S  !0ߑt@@ 0/S  ލp1?o21QUx1N0p,!@<1(0@`1?o21P 1?o2 1 1S 1SoIOVTPP 0 ➑0 00 00P02P2 1S 1Sp`JO 1S 1SP`KO 1S 1S0`N 7+ O-4MbPp@ǍX  IJLXZY  H t  h 4  l bP 30 @ L@4Ѝ<Pp&1`SPe# "1S "N ! @ b 0PPp1`SPe 0 l1S  1S0P! @ b< 1S 1S$1!ߐ @ b 1S 1S(1 ΐ @ b 1S 1S,1 彐  b@ 1S 1S01D 嬐 @ b< X+PUP+* 0O-@PQWM0u1 $0` 0VŢ40Sq 4000S4l`V$P |X003/$}1S}alx \400:"+Q:  Q 5 $$0XNY/X({0.}1{.{ K#)1 0 &,1I1P/S <(ω0(0 00_V0SvU `P  ( 0S `P $ 0 SX2vU Z xY $1 0V!7 x0  0X!p׌H1@!Q$91S  0Q p $ 'p 00!15:% p ֏P p Q 0, ($!p p $ P] 00 8a4Q101S/l+++Pf!T&!%2&0S@0@-S@00 0S/Ḿ+0O-P̲EM 02@T PP0 2P  ?|1S# $P| 003/P \2PX @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 8pPP2@0S- $P* 0 x0D 0SPD++q'l+%w+m @+!+~'A-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R(p1@l1@T@0SP.H1D1^0P@@T  @T7 @pW4dpW1V 82# @ R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0D++@++h+x+\0p@-T00P DPPp0AS@  1SAЏ+++0@-P$4M0@L0 3/P T0  P   R4Ѝ0 ^@ ^T  RR""ꈮ+l0\ Q0/\P ^U Q0000@-ꈮ+0O-`GMM40X2@TL2V 00 0 0000000@@@@ ~0hIp@c<  D G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 t0@W 47 `4|,4 VH0 <0G, ,,Lꠟ+o X+0@-PDM@T P08 @\ 0@  Dd  )0 0DЍ00SX+0@-@DMP/ P0, P\ 0P  0T   R X  0S0000000 0DЍ000SX+p@-@Q`P@M< @P   T0 0SP@Ѝp@?0 @00 D0U@ЍpX+17@-@SW p  Ѝ0!|P4PP<<0P0<0P0<0P0<04PxP<0 S, 0<0mP<0 S@  0"{080#{0,0${000̈Ԉ܈@-@PD x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍp̈@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P 0 $妯<  <Uၺ ,0$hP 0|! *|Ѝ0+[@-80@SP`4Mc00 0P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0 L'0p@-PQ0M0@$ 0x`0 6/8 ܉`Px1x1a1S0C€10Ѝp'p@-@P 0uP  Pp0S@}p bP 安Pp0S 4! B! MP  噉Pp0S h=P R 0L ㅉ 4倉Ppp'%w'!'''O-uM Mp, Z-H0cS_ C+0SSzB0S KPBԒ0SzIJB0Sz2 P     P x2@    PP2 HD     PX0x0001 @@K @P @ PHPP< ,=h@ ,D@31K 01R010|100P Pd0!}p@  P yb} 0S10$1S10 0Suݍ Ѝ㹄PaH㲄Pk嫄Pj1S |!R |㛧P x~%X+@++l++D++h+x+Ծ+++|++ t ++Z@-O(00S P  Ѝ| Ѝp+(@-@PЍp$QU 0 `P PP> C 0 1/0P $1$00 HL Q>+80S @-0 1Q/Stm &(G-`@Pጐ匠X0r2%S80S00 00 S80S0|1 P S$1S00 0OJp@-8M`@8  HT P $QB.$00S U 0 |1 08Ѝp$P ᐭP P Q ? ᬺ P | ĭ CP X+A-M|P8 U`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 `pXM@0 803/PDG 0`a'!!` 0 3/P"#"#00 03/p 0` L03/ -Jp` 0SXpH 0!|1 01!0P0<0S P L3/0L00 3/P @0D t0Rv`p0L00 3/P @0D t0R 4 d00`RP  w00p 0Sw`X+S &(O-RMPhb  (@P D@4 "UPpߍP(  vpp_0S j<08 (00,0 000040!04 04$0D0(0 P dVph op 0  DU 8U ,U  U U Ivp Cvp 兿  vp 8p?pq8StPr 0  *0*0@0+  0* *d@edAzd@A-PCMMPp`;8 p@P  P0;P|tU 0 2 "0 CލЍ /O-T  0 J 1!P 0 ࠱ \0-0  \࠱X pͱ0000 @00R00000 \ 000(R0#02S<Ѝ^ 00$00 S00) 0R $X' S   P 0  `0 T0T  0  1!P 0 ࠱0 0S0 84p< P ,40 WR,[7\ \ [" 0 S000T0T  0  1!P 0 ࠱0\ 00\ RpR0؀0@-4MP!! 0  P PP@4Ѝ000P/S 0/D0S D/0- 0S^ 0@0P00@0$^ (( P@  @ \/A-`4P7 #P.0'% D0S(0 D (Ud0{S  0 ( 0 0{ :@00#@#000@4(0 0 0{"d@R)Y)j)"*)))))I)p@-@P} # #0S S .|妕00 00$00(00,00p@-`00MOQЍ S 00W@0u #0$P (0Vp  P0W D @0W  kW0S U0ąA-P@\^ 0  `04pX T au0p04 4`X \^  R  0  `04pX ^S@-`lM8PpV0 00! ! 0 ( 'PV$8 80R:V  u@#RD$ͱ,z@PV008PU{0 00$00sP 0   080 0 0$ <0S $ 0$ lЍ00000S S   0uD*A-`0Pp@ TR:?o2R0S%0   @ T000P0 04 Q\* yPW000 0 0004P 08000 <0S $0R 0$ A 8< Q\00ꤟ+ \/0p@-@0PS\ UR00p0PU 0P0000 04P 080C 0 0<$ 0 0$ pz*@-@ 0S PO--UM M00 5%7F50S5%  P=}PP Uލ Ѝ5 :0|%@|PHy@P T@v0 $08<0(40PP vPD 0 ` pX0,DbGP 000  0SXPD0(00040(0<00a@08`0S XU 0 D  x0U0Q0SpPX X X0S X X x` x0P,0 XYP(00W80400<0tXMP0 000$0,0S <XEPcXxPP @y 0S$00)yI` D;00pp<00008``#004S``V P0pp`00S00PP 0P0 0C5 0 0! 00$0080V/ 0<0`$0500D0;p0PUH HPLPkP 0P`wPHL`-Wynj0S 4 R 000 0#0P 0S ߯뼀8 0<$ 0S P 0$ 08000S`H kP`T0S0P 040 Q\8<0 Q\   P`*ƒj(`+**h+*i Ճ|d@-鎝 0P 0P`+p+-0,M$00 0 00 00 00 00 0 00000000 sx,ЍC-` M @ P   000sS̀p !P0㓗' 2p0lS|p`  P0㓆& p ЍpW `VpG-pP8M@(P2 0S (00202000010 020 0008Ѝ70 0600500400300100000.00  ,0 P #00R R 0S H `P0h#Xp@-PP@M `8@ @ 8`  5/V@@ЍpO-0p8SGW*QN PQUaBP@4`PTB S`#`3S`#V2 P%  A^6*q6 0ABT+ PQ1 `QV^.b4 R$ aX` Q!S#3S#X FQ*0S*@D\!U^\ S*A\!PUB 00 Ѝ 0RS /S 0 $ 0( 0 ,04 8<R#3//0C-0S 04@0 0 $ ]P"R" \^0 RSœ\RS 00  \!  0 $`Qp Q0"^ 0R/ PD0/(+P" P! @ P PB0C0CB0CB0C0C0C0CBB0CB/@P3#/P////C-P@ 0}oM`"R Q 4 ‚oόP4/ЍR^8" 0S^"R }pX ^ XY Q2o?000P00P"/ /0 U00SP/Qo/0 hD@-00 0 0ЍWp@-O@@TA @ `Q\PPP?AP P P  0$b0 3c0S00pPAL@@@?A@ @ P @ @ @DPH AppC-P`@(M  ax 0P @8`PT\0(Ѝp!SQ0P ؁1/T 00gR+O-DM 000 00 0 uPXDЍ 004 0S/004 800,00  (0$ \P,8<\`/! (04 0@_%tP$ p _5#$<0_.8̅ R0PPPPUW P0PSu g"? <1 0@LH0 R p ? 0 G$7@ T S`@`000 00  0 P R02# !"8 0/RSrY<0 V`0 0P0peYl^+/C-P4`M P}p 2S XS^ @B@BY^ \Q0SQ00 000 +PЍO-4MXPpU\0PP㰒hl0$ p Y(0,0t0R00` 0!Y000$U0#02S: 0` ( 0, 4P0(,T 0 00T 0  1!P 0@[ 0(C,,`"Q"`0 `P0 Q04Ѝ $ \ 00@-@P4MA@P  A 0 P4Ѝ0/000C R /@- $0 0Ѝ^@-0 0 0Ѝ4Y@- 0 |ЍL/@-0 0 0nЍY0@-0MMs@P M  @ fMލ Ѝ000; p {dЀ4╳G-0Pp4@ )0R@10PTP04@`2S$ ^ SR!  "0 8"0 \PW B1<<10}/ Q 0S G`VBTW HnDϕP0mݕP2!,,!+O-4@pPM` - P' V \ P\ PU2Ƒ0ʱPP BP0L 0Ѝ`VBTUPO-Pp `D@  40Gs 0^@0s+0Y0 @@0@PX(+|+0p@-0PS@U$ U# U p0UpT 0D SRQQRQRQQQQRRQR @D 04 ppp|++(++ +@-@0S|+C-DP4@0 | rtl pp0(\ @r0p @ 0 @Q%@@ Ѝ(+m|+80@-0@S_D04  R@|+(+A-@p`P0     `B 04 8 <00 00S00  SR000O-0@Poo`#0S Zp`0BT ЍZ  R  SR S0"P0S R00Y0 0 0 [YA-Pp`(@$@0" 0 $ 0( 0,2Q 2R0 002S R02S0(2M 00SM )S"S=  CR9VVVVVVVVVVVVVVVVVVVVVVVPVVVVVVB0C0#S S0 SS S S0 S , r RЍS  0S0000@P (WHW0W8WHW@W @- 0  =S+p@-0@P@0Suk00S00ӵ0Ĵ00p|+p@-@`PQ Q pP  rm0P00E0, vq0Q  T@-0@0S  ?PP  00S T <Kk@ЍD @@$0S[@|+(+S@- 0ЍpW  (P \P/ ‚!S Q /  ( 04 Q S 00PS//p@-@Pp_oQqUp@LqQ`00 Q@-@0@ @<Q€+q @  "2/>++@-1 Q`0@d1@Q`q4Ѝ*+(>p@-xP@0S0S DLR00T0SRD0  p"@ p|+(+08S^/(+ + p@-@ 0(  P0R0PS 00Si ppC-@NMMP`< Ѐu=@ @@0 ` `o@;@ ⷧPPD bp'a$a NލЍ(ydG-xM` @pᜠ堐0P@J!0@P 0S PU 0 R<\1\!\\;00S 00" !PP0 0S0L0H 3/P HL 0RPPT $0RP 00  x@ 04/@xЍZ Z Yd   )ZY < 9o @ 3oA-P2uSvw_10000“b\œ@FҁL@$H @A- P@ \T@@ 8ž\ @Tvg `Č `Ȍ `̌b` ` p PČpȌ` "0q1aPaa m00`T08)BLP080}@ T\ 0Sp`82S @4008 q2aq0R @Q2T0S X 22 040TP 2SX+O-P`\M(@4000PS}1 0\  \^T 0SQppQpW X@\ЍTfb(0,F0 1!P00 P PQTP Q8b0 RX3 0pP W P\ T 0pWbV0V0N21 SR 00(040,082S`00!$02( 2S01  $ 0 PBE X2p ̓Q R @QT aB`@ V````Z R2@TP@@ 0S1!b02#38( R,00XL v fI 00 (0$0oS4  00"0(4,Ʊ@P4 80  02 S02@0S SP Cl@廅D0S 1H0Sp10S 1 S  o00( ,04p\P`` 0ST0` ``72 P B!X,0<,,SGT@7l+O-`M40P@p0V00P484(447PV 83ЍP  0} "UR\P R^"4  0S 0Z000[ 00S 0PSVT7 00" 00000 S00 0$0 0$ 0(00S0( 0 0<0 0< @000,0@ 0000, $0S(00 08BV6u? v?( R BT@2r/40q?0840800s (8  R    T R,08 S000e0D0jPD07V50Xo_P0"Ph0S SP $kh圄 8 @U 0 o?0 R S2 RQ  0^&/ o_S㴒!P% 0 8 ,0 S0000IY0X0\04024 0PZh0S PS jhMB I )! R0 2<0C00$@" ^(P0T0^X0\0P&h0S SP jh0T2S2Z 00[iP3R"? 01@22]UV 0w?20"S0 L    0 HL H0SP LY0H0PS B 0D  ]1!P0 P0XT \ YY X\ 04"o0Ph0S A<SP 'jh埃<PR#3P8H0 01H2S 02#38S0Ro_PPUPo/ @T \ `TV R \ Qwτ0 8\ 0$00(0|, R0 V000,W+,+U@O-dM∐@Y`p 0P 40 PP<Y dЍ003/00S 0( 8"V0 P20 4  0 P YP "#"#0 0D00 P 00SY0 0 #1/P0(@#R 0P 0"P25/  # @1/0 +{O--:0aM M Q@ 00/;`PPaލ Ѝ [p *H6P:0@ <r,FW 2S 1S<2<"<<40u   &      0S!?⧻t  0  d T 9 bPTRUYL&HRQ  0WS 1Z!*??  @D@0Y!)??  0dfpP  b?XT D , bh?X T Pd@Sd+Us@-RU0 =4@p`d0T `Š"; P0H0w`04 oЍp(-n +<-s@-@P04P00  4o0S  `VRUp SY0P 003/8_o.hV*hЍp@&h\(k +p@-@0AMP 003/00; ⲟpP   f`P  XhYAލpO-p0\M0SQ `sa8Q P0g P0c0@>S@ P0g P0b0@SP0 0HL R   ?  ?/Z[\ P `@10d ἐ 09/0P@\Ѝ +G-` p0@PHLR0418S ^ @Z R  0\ X0?Pࠡ࠱000^ 0 G/+>0@-@0M 410810!'a0 P0T0T ,a0 J0PU ! 5/GЍ0+@- dHY@ 6X@- g0 gge.%@-<@0shX(00pp`b0Co~%D,-$M ?0 0 X$Ѝ0-4M 00 000tP4ЍO--pMMU#Y " @Y4 Ѐ0 p0 pW(0 0CSpW"R 0pxğpD0S 0s T0SMߍ0S P 0b40S` #1:f`#S006 v拟 A0'o A{{JOdTd@00#ff3` h3R - BP   BRڔD3DC"B 8#0 f$#2e` 0 ß RSPS0B 10"000fe 0`S$0 (00SZP=9 =:k{,2 A \090   A { Q 0 \SQFA00 0A ;f#;Z0S;#;0@d^4#.P0%U[?;#; 0 #5;B%0 PX!e,1@P0'00 RPldP !"%+0An,Šˌ0B%W5 [e@0S00d Re@0 00ppVY@.AX,P,8,h,@,P0,(,H,Q-D,@~7} P P!j0  Ad A k{I{7{z\0W 0P   e`~P< 00<@~|f0 d@ d@-@[@QRG-PP @ R700pP:<`X:00X 0dPV@-P@`pP0S -S :S S  000`  0 Z0P0 ЍU0SN00T  PLP꬜%p@-P`Up@  UPUV@/70@0pp@-P 4`Up@  UPU@p@-M@  Wp$ ЍA-`p@T/  7PP *1P. @P0 @ R R0 RR00#R0;R0S Q \Q  "Q0# #Q S 0Ѝ0pC B 0 @-3M M 厼p 3ݍ ЍPp@-P@@VpPppA-@Pp p` j N0W0 t0WpX U`0\0P P  0h0@ cЍU0 0  2P}GGGV@-`0tM0F?oP2p@ @pSV &VpUIV@tЍ]Up p2S Vp D0V4 - hiVp"@Up0p@- @  pz0 S " 0PUPUp@c0 S  0 0S cc0S   0 0S ccH0@-@0  d T@0@-PM 0@     UTp||)Ѝ00 S   000 00P0 PS0 / p GU0C-p@PM$MU `0S@PE8  0P00ۍЍXڏ700S @ Q@BPE@C0 00p s0S o0#S u@UX f0GGG@-M@ 4 S0S\ۍ p@-@$`P`Pp0 @ `P0 002 0pj0p@-pMP` 0Sp@& Sp!  Sp Sp  Sp  0P < l p(WpЍpSt Stw0  p@->@P`ypp0D I  ,0lp 0 < p$p@-P"R q@ : |S01p@@@dq * lS02p@px0@-tM0 p@ z MSpPKS@tЍ0C-QM Mچ700ۍ Ѝ]  Y08 @`V R@pP`A-`Ra00Pp@0ST`@PT  Q*R@00 S   0 0S0 S *`P `aa ``0000`0 @ 0@ H@-@s @ 0@-p0M0@M0$+pU Ѝ . 0 Hp@-P@ `$ 08 l, ?U\F( 0 0 008 , @1pp@ 5H \-Hp@-`D1P:D11S0p0@Tp 0S  00:00T1p@-S@\1S#l1S.RU9tRUpxbV:t2atbp1C-aT10CT1T1XS%a0X11Ca\10C\1\1`Sa0`11Cal10Cl1l1pS a0p1}2,P0C2bV`bpx2,P0Cx27@-@0 JPP! P1 0L1vD8@ @@   (   )    ,  Ѝ0@ Ѝ0@-b@ QP p 00dk @ 1S 70`]^P 010@ c 00@1/@-@`V'L0S  P 080H0S S@ >'VHLHM@-x!@RM Q|0 x) Ѝox1S^H0@-80@@? P@-@ IQP p 004 @ Q 0 @0`-MM+ 0*Qp06S , ۍЍ;04@ / 0%ap@- B@ Qp  P8Qp@r P 11P p1@ R  &lQPEUQ T`00CS`0 X`0( p@X0 X 0%0%`@-@T 0S h@C-`P-H0$ :0 0 0100 & 00 0 sD00#4S4& 0>P&0 Pp0P W  g080P040 Ѝ3? 0S %/%p0p@-8P` J4  :0 G0 P@p@P@  @Tp@p@-@QDA$:01`%p4*0 qGPTJ4*0 `V$: I0 ppps@-@ @1`  l!1P D1R$ L Ѝp@}%P P 1 p Ѝp@ PU%P P0pPЍp@o 0 -@1)#90 -1S nQ s_ 040Op\ @1 9@144O041 ЍpH0fHjHH%Gp@-@du @11P`PUp@ 0Sf%P4@1p@u3-H@-p0@SPLM 0$M0@(p> 00 p0 `P  LЍUtP @ t L GU`  P10L1\1HH@-@MPP` p` 0R  p x0 0 VU  Ѝ@;ЍHI0P!LA-`@x0 P ЍA , 00  ` 0  01PU 0! 0SHP ЍADT 0S 80 YP P ЍI1I=IA-(M@`O P,H`p$G PD 0Sr PuPUn 0 8PU,P E Dp(ЍAj$d9 `e$T;080SI $0P   % p0S > U6 A(ЍA U. 0S V  L0S p`MP V,p RۓP 0S H: 0S )8$(ЍA&(ЍhIIILHIq1IIM 0@-@ 0PHH0S$ `@R H0p@-S@P` 08PU $00P  x @1 08006? $0080S  p, A\ p p@1@-@^@O-pP`@టT(  cP 0S!W 0 8Ќ# } 0o? X(00U0X0S @iGX   `I@-@1M@Da 9PP` q`0 P  4 MphhPЍP& P P' P, 4MP5 P!!P@1 0 P Pp iL!d10B0P1]t tLHQp\ 㾿Pʦ1GXJ)J2JIIIJJJ>i"J:JHJPJ @-@4)Mp X00D1 ЍP 0\1JA-` 0S0 00@p;eAaPP8 0S,p`p`[P1A-q`@  @P900Ѝ 0S  O60 S   0` 0 pPdo`w @P 0`0P@[ g PP 0S $0$0> > >0S **V q 0S S`0 S   0001  @  0S LBP0 S   0JJ1JJ0C-MM000@!0Mp00Pȁ+ >LP`pQv07S 0 S W X00d!h1`P1 ލЍP  P " R؀ؐPU [  0 S   0  pP 0 P1p  P  0S 0 P1J KNK`@-@x+p&07S@d0 S 0VS@m1A-`R@p@M PP U 700 @ЍAUP"R 0S 0 )r>XU$  *P 0S <0 *? p \ <05 <V>P  *@ЍA@Ѝ2cKKKO-@PMpP  P 08 ЍO<P `4001p@Tx KP1D@T@11@1Ѝ@P000 @V@T W@P`@` D  ᏿0 00V`l`J@YD3L#`H3``U[p#3b @11@1kQ NQ@ 6Q`4Q`UQpQ xQ nQ 0S0 0 @| 0 +P  X S  p 0 0S@i0 0 X S  p@11@1w 0 P `` 00d : 0( @10S 0@8P 0S 08  * 0000ST 00S j0P 0S 0000S600 00C00)KKKK$%KLL@3>0S p@-0?R02@?P00?8003?00> *0>0Cp/ြp@-x1PSM@`("%@P+ T0x14!V@1t1%0 0`0 p 0%S EP ;0@X@ 0S T`kiVPHd|A|ЍpxA>0S$ N01@T t1S D ~@>0S@ 7`t1S  m0 @=P 0  @  B.(0%p(4t1S ST T8Tt2]TTTT 0 R/ 1/,0@-@T0\@@^0S\P*\@0\PZ 0Sk R0@-`pMP@SJ (0p``FSЍ Rp5 p5 : B\ *R B  0L ʚ;G-P p$qL1L!L#W@14!<41Z`P(@ 1!0S0S0\,0 0 @T0@TU@P0\400 (P p`P,00@,@0S  0 S0 0@@T}2T%Uʚ;6U/G-@PЂ@1@!@@L#p0`,1!(qP000S3 \L0Q  H|PPL0H0L0 \ 0 S   00S000@0`PP0P0 TPV`XT2ITOUJ@- Ѝ@- 0 ЍP@-0 "q@0{00Q 0Sp0@0 R    R 0700@R @ 0@00T2T@-@^I00 Ѝ ^   ʚ;@-0 Ѝ@-@P`pO, 0B0 0p"# ЍMb@Bp@-P(`0 s"PUPUR PU PTP,PP@4P`P4\pQ@ T2#TP@-0 I"0TP0/T27T0P0/P@- 0  6"#08D0T2JTA-(MP` w1U0@0$00 "0p@000 0<0S 3Gp(Ѝ8010C>S@( ( 03(00@000 0<0S80 ⭴p @T2nTp@-XT@P HHpPV@p0P@ P00(P,000P400T0p@-@Pp0080<0P  P(P0PUHUHPLPp0 S   0U0 S   0U0 S ,  0U0 S 4  0U@-@@UC-@PM `rP0SY 00C01@0S D3/D2D"DD^!(PU0ST2k0S R,0 S ,  003/40`0P4P!0  P0HS 0 hOp/0S `ЍH 00S0`   R 0q   QRq  `  PP U 0S 0 SIr 0S Yp P0S 3/0s0S 0S 3/,T3T@-4 0g$@ o$p t@Ѝ%@-`0$AMrPpM (}G 0Tp@ E@AލЍF U ڠ# "U  RU@@ C  4,0@0$   cV~%%-@-   Ѝ Ѝ/p@-MMP@ ` 0;T-V 0 `ۍЍp-@-   Ѝ Ѝ/-@-  ЍЍ/-@-   ЍЍ/-@-  ЍЍ/-@-  i ЍЍ/-@-  ЍЍ/-@-  S ЍЍ/-@-  ЍЍ/-@-  = ЍЍ/0/~%0/~%p@-MM p #Ep@ P;00 dSV w0@0ۍЍp P0 4Qd~%0/~%0@U~%p@-@PPN; @嬛m UT GV00pp~%%U@-@P=:?o@S@-@p Dp D1S6"@SHF@-@M    B0 8Fp1$0Ѝip@-PM@`   )0 TFp 1@ R! 0 p`Ѝpii$00 H0s P/0 #  ///A->PXMUV0P0XЍU700p@ `R0 PU B0>000 <0  ,> !PP> *SsU@-@T@>@@-@T>@0Q/ R0 /RG-@P(Md0'0S  匸P P 典P:t`P $0!00 0   $08S0 ;$00(Ѝ080 a00S # `p$P `P ۳0 P 0iS.S  `P˳4$P 040:S꬜%O--[M `F/@P 0娿9`0GPpP$C Pp:Rp[ߍ0S00:Y 0S 0S_0PP0 $ ߼P PU0SB 0$ӼP 0PSP0SPP@\1S<@d1Sh1 $WP=d1 S S RP@T1SX1 $EP-T1@COoSB@$TP!P" `$ _0s 0$卼PD1P `1 $P@\1SPö@@00STATl p1$h0P0; @T$ P p$[0P0P@PD  ` $] 0[$0E  PT h0 S 9`001P d0?Dp `0 D000S0 35S S  CR0UX LPS y r R 02 > 0*ॷ@1 U48#88 S R p 'S 0 S U  R P| 0?D0C p 0L0D0}>D0 P 000H0@@@3D<UUiVU0@-@PDM QP@T 00p@DЍ0U  ❻P @0SA-p`P@MT@Ѝ 0S P 0S0Q   <@P @-H000Q/P1P/$0/0@-@PM   YUP 0 0pЍ00 BCi~i@- ` R@0$Mp0 PR  RU U 1 # ⽶0PP  R@T!@T00$Ѝ R @B@-@p !p !p`A-88 Q  q8A Ō8   "  0Q5ã0ã0A-`Pi@P─@Ѝ 2P\PPP0 q?P ipP n 3O-P@>0p"S0W"SpGP Y 0@s` PF700 ЍY\ T00W YT X0#0%: T X3#: 0\Sf0`xSmS0SD bS S\ Tn C R$4DT0 PT 0 0T 0T 00 0    00 `` 0S& T  60P`0 NRU`0S  6T P00T0` ꬜%P /0 S S /S/P0/S 0 S S/0/@-`RpP$M 0S0U00/ᥫ@P 0 00 0  20S h$ЍU 6PP, T/00DU 6(V9VO-p dhPPx ЍO=e`P TT ЍON@@ Y3NGhPP  וP9 0QA0 Ѝ N@ `@p M0P! 0 @ ƴ0p00@[   P 0S h@P?'3PVA-@P,p N` 0e SP,pwN$` PP(0e S$nN0(0$0PPO-P! .RP50R77P0.U  0 pP HRPU H0yH1SvtfHP H0P00U 4gP0HP0 40 00 0 L40SO  PU 40!00 0 40 S9  ~PU D1/r8`&d6"PP"`P`xP`p@"@oP   QPUY D1r8`&d6pP"UP"``KP` 0@H0P:0|H ,P Ps0P<0mUH# 0S /Ѩ`P /̨`P00  V /0P0 P0P0<0F000H0P60<U 40 00 0 L40HS  P%h7 0 apP Pw 73pP@H08SP7SP U ,r`P 0S@ PUA 0 9p PH0P580 x050408$ 00 0 ۬,004PX |uP ,8d EP `fV70084, 0A;; 84p@AK0:9PP880A ;p PPH0U4 0 P 4P 4P*0 06S 06S0P90|U1 40 00 0 RK40HS PeU H0 XUPXXH0P;00QH0P90KU ` pPC`,ᬧpPd H`PP00&J A KP$H0Q7;0UtQP |P0Pt1 tPPtQ  mP0Pt1 P` xJ0PPx1P|H0P00U10HP2EP0HP2;P 0HP21P ,PHP xiPH0P00H0P200hU3 ( 00pP@0S;7P0H0P20H0P60H0P;0H0P80U5 D1`r8`&d6`"2P"0`)PPP@U D1`r8`&0d6`"P"`U =ᬦPxP9l ᡯPH0 SP P'0P<00! ኯP   ၯP Po  tP  nP  hP  |bPP`P  p0,p 00 4p 00pP ,( 0% H48!   P  PYfV~%VVVVV WW9;WEW_WWA[W\WzWWWWWW XX&XMXFX 5P0Pp2p2SS%PxH0P00rH0P70lU! `P 00 `įP@ 彯P 帯PPSPSpVPp 媯P t奯PqPpP8H0P402H0P30,H, 4P,%H0P20U  0pHP9PH0P00H0P00PV 0U0F] `  PU d0@T$(@@$P[+[0[::[X{YO-pЃ`P@8 P 5P PgUD1L ЍOmB$0SX0 ,08 ЍO9 Ѝ 3 WZA-p_CPPFH,3&7,0 06T06eD1@!0`00 0:00309:O-`S0$M; @ 0QpP  80:0D10  0H 0Ep0 0000 000P0 U  * 00$Ѝ$%LL@3\?,A-PQH1`Sp51Sp:1pS> P D@DTD`fd6S?`Dhfl6S@hCpft6SApC|f6SB|Cf6SCCXCACC1pPCC1pPCX  ቨP T0 ST9d6,`0Cd62l6,`0Cl6+t6,`0Ct6C6`0C66,`0C6O-MDM` 0P@ E 00% 5p 4 +8 0 X 0 00 +0,0 P#Z1HD1E,0BP0`d60((@P4: ؍DЍp@0D,0@04CP0/@,`6hv2d62`dl6t SM@,h4Cpvt6t SGp-C0&h6l6p6t6t"&x"6688@ p458! 0@0P 00 R @0<   C 0 0  5 8 @0 R R R P\R p@b@_@@000SS @3@ P4400  C 8?o@20@0<@8@,0@p00P }00 R*': 1PR0PM Z8 (pPp@@04CP000#Q00Su t0 0;$ ̫$ @0 R R R P\R @* @l p @Ph"0pAlq[Pplq @ H٬P 0S 0P  ̬P 0S 0P ¬pP@y@0 #0S  R 岬P W@0<   C 0 0  ]z0S 0$: 0000,@9;`[iVE|[0Q//Q :///G-p0@0P `P Y 0 0 `R:SC3@"X HGU( HGA-TpW0 T`@V0 H0HS @sP X X| |00 S DD0P 0RS ]9] ^p@-P E@PpcA@-@P apL_:]P@-,0, ,,_ Q 0 T_:]]p@-@P,0, ,,I PP p]$:]P@-(0( ((5 T0Sp@iⱤ_+:]A-PQP0  iU0x ` @T  Vp 0S 90S"@L_3:3]^5p@-@Pp PPpT0 p@1@-0@dT y0@0T0S@-0   ^A:]A-PQD2D"DD T0@ pR008@10 2T T'֣@Pp t0 t0 x x0R`5PP P PT T0R88wP `(|0 |0T T0RfPt05 t02 88[`Px x0R p,0S Pp0S Ep0S l:PV `(P`P_N:]^^_"_1_A-`P Pe_@T T0pS3@p@-Q M0  T0S0| PUx0d tPe_`@P  0 < >  Ѝp_U:]^@_X_O-Pp@4M   @1 0A@1u'P  4Ѝ B ᮣ@ᔣ唳T}   ᥣT0 RD1 0800/ P T8ep 0SS 90SSⲢPT0e᪢`P| 7 |0T T0R   P  @88UPY0Sx x0R{ vբT 00 @ XX4P  jP T T0R88#P gPpū0VS teo @XXTP8q @PS /ᎢT P 0SS,90SS(PT00S@!D18,*:SR  S p t0S p0S @`:9p:g_u__y:P@-;000 0 0S T/00_:_P@-Q000 0 0S ?/00_:_P@-}H0H H 0S So$/00_:_0P@-D0D Dv PPp/00_:_0P@-H0H H\ PP,0@o/00_:_p@-@Q0 @ RP0 0`S0@ SQ0` =p@p0 p@Y0 p@ _:m__np@-@P0  QP0 0S 0S 0P 0R !P BR #p@sLP HP p@p_:__p@-PP M0 0S0S 3?@c@Ood@T $S W0@0 ЍpP/0@d`Q 0000P 0 _:_,_'A-0S(0@0`TPPQp_ ѩ0 0t' d Qp!/ƩPU00PP L0L Le/00 t 0bR 0c30, `:_P@-808 88IQ,0 (!>000_;_&`p@-@PQpv<;3`G-`PM@ P `%bp, 0 Lb ````[b1pW`0쀟pW% Fb룩 @ 0 -@ bT  @PЍ00C>S`"P!@03@000C>S|`"P!@03@0p2L2h2l2-3@- P Np @p p@Ѝ0@ Ѝ/R A-@P8p`B0S p/;`A-0Pp`@S:0SS 0  RT R0 `V1S* ˂P a 0@DpR: Q `D;A`U`O-A 0MTP` 0 {@@PA<I@ 0@1 0S  tp 00PĀ P P P P ߥP ڥP xեpPp 0S \ @p L61@ R 86p 0@1#?H00 &&'p H0S% S% p D p L p $ p < pw L0S p0$0M0p H pe t0S@0@!מ01Z9;p M ⠟P= F p@ `OPG0 \dT$kPx$x p+ P-` p.#p_<t p 0S P Q [Z T  .;p  #%;pP^ PY PT PO P PH X00S 2"Q`` Lp  Fp %P /%P01`30  2p X00S1XppW@0h1SP,rS9Ểp@Qa a! p%P`V%P ps0S   ph !tpap0S   D pT 08! pKpPE 1 R 0S  P7 Ѝ 0Sp pol;``VHMLHI`J-H`;``SasIaaa-a8aAa`:Va=```Ka gapaa{aa!Mkp@-P@pp p@RRA-P`@@pH0s  S  U@ p@@@dW0S  R H R U@ p@LHM`Q/p@-P0U@ST` 00p ˞P@Vၢ@T:paA-P`1pSMBT  p@Ѝ h壞PЍA!R @04  @ @p@ @bpV 0 !p@`P  cpD0S t|0 0 0#40  DPH SP   d: 0$u;aa;awaa @- @0P PT00Q  DPp@- 0S @0\`0S4 SP U \ @ Υ00p.S0.S0_S-S,  00  ?Rڭ"0T0 00p謜%P `00CS`0p S00 P0S X0X /XM90%p@-h1@SPQPPE @p B⬝0.SSPP X吢P H勢P 4匝P 0  .ᄔPP.y;bp@-@P'U^ 0 p70 `70 P70  @704,,)$&#  @       70  70  70 70 x7p@ P NPFbtYx*MbTbZbbbibqbxbb+bbbbbbbbb 0(ƒ -\ tx Q^ ,\ ,@-QMM@pPXp000 6QލЍA. !. d0h 6p`0SPE@Ep 0S:0@0DKQbbO--4Ml"Ph2 P끋` ( (B@P74Ѝ0S  剜P@ 僜g 0P@,p,$0,PGY \P,p0[.6I00 P,p, R XP 6, R, R0S p R $60 8P p6,0S0S ,P!  pr @P !!! nbb P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-`P@MpVU:U 0U00E0S00T@D@@V00ЍPW"0$?S 0[ `W R``V?Rx0U  Pn70 -.0 IP0 0IV:D X\0 0 @UR  ES`O-@`0p 1! Y*QP T W6700 Ѝ%P@pG`  "00T W 00  'P     \Eo p  ' U/U$\U0 T WPPT W\%0P00PPpG@`T W PpG`꬜%;C-QM MP<p`8p; @<p] <5p V=p ;L 5pT=    0 Ep P1 Ep E/   =Qލ Ѝ      0@E $ @pP0P @T*ep0S4 Zp`@ᘑT*T 0 t5p @ Bp L 8 /r ^5p} @ /r   2/L5pk @@ 2/ G    .0E/RPS E/.5pM 0S @00S@%45p=009 Y nbA- @pTPM ЍR` R ¡00L0S 0 -0 0p0#0M0 d$ 0V 0  03b cO--4M`@`d00 0ShplP (0S;0  `pp30"4ЍO 0  ,   p0,0 ,0SDT ,LEp 0"00,34ЍP U0 000!0  Y 0 ,`op000\!p p PE, 0 S(0SU $0$00 (000 $ 0S *=iP @TP@@P@`/0p@-` (M00>0@SP  '0x Bnp0 ᥟ0t0 0 y0S00 0 0S0S|0@0|0 0  Xc00Qx0 zTT0S (Ѝp0 8P 0T0S 0 PT A-`儂VPPFPP2X@p`EV1P 刂"20 JV0  32PRp@- P`_$p@ F? $P!#@p@-`@MpP!  (  (ₗX( 8px$PU@ TD700@ Ѝi///@-!M@ 0  ~/PЍ00 3"9p 000)00#pxxb000@ 0T0#p@DT 0 0" 0#pIc*Eccp@-Q@p "101p@~1p@->`FMV ֞0P0Fߍp@PF/ 9  0T01 0 ` 0@P 0*> u  6 ii@-@M:P4@ $⼛P P@Ѝ U 134  4R2$ @0 DЍ0Ui@i%0@-@QM P tPp 2 0"2!Ѝ0@-]MMPl#H p@ P@P -R 00@]ލЍ0S0S Sz SS wR@T Hopz@V@T@S  CRPS @@ @p`P -$0 Bp 80Sr S~ S00,0S  R000@0S  R00@ H ` 0 Hh!>50H \0[!pY,0S (01S XXz0S0 0 000 0 0pwPq>S Se  @gPa@PU b NPK 0H H=O@!Tw?0SG H⡔M P N0<00S6i@vEd@-40 000 0}ЍE2S/2S00/@-@@媛V002S00/@-@@四V0002S d/EA-@MP`p @@5@,@P= Pp  p X0S p .@!  p x { p 6/PL p p +P Ѝ@?dqB@HdlBpBfB@G-@p`0 M00PU  0S9P 0 0 P  RP弡 RV 1!e P    帓P0 PPP0PU:000y Ѝ@-    ЍgBp@-0M2S`P@x (⊓VP@0 \(걚00ލp@ EB-$M^ *Ѝ! $Ѝ@-@8 -@-@-@pp p`~B p@-A^ TY00p``0@D^I"000œ\p@Tp0,p/0/R00@- \!Q0s# R0p@0QRO-M@@0 0@0Ѝ`1Q V00Pp0 , Q :@QpSH ᯒB\= \ lP lP U  Z4\[X\T p Q*S0C!+P 0 r0 s 0 @S2T0@cSc@-@ 000~P 0S00Ѝ@-@ 000kP 0S00Ѝ@-@ 000XP 0S3Ѝ@-@\0S \0\0@-@`q0 `0`0@-@08TG@0p@-80@P >0S0&0T0jlT01 RpR 0S TT0Q  080 >0S  p@rdp@-`PK@t*Pp00,000S00 /0KpcScO-ᴀĐEM@ pp ;00KCH*P`PN d0S  GRW ( Q  R H)Qh 0 00> 0200BS* vWW 00 RS00Tm K4 $`B\` D RW Wd^ h 0 \ FQ 48?$000 FR@( p$ R D RW0S <0S @FT60000<0 @0W0FS 800007 S0@0WW00W  R 8$R  FR0+  8$A 88$0 @W& S2 W0=0S< p p?01Sn  FaP0l%*p_ 08    FR2   0@08 R  FRv3    0FSk70 @000"0, 0Q `6 ,0d&RE "(0,q0 PW:@QT; 0, 00,S P T(, "r  PW: ART  ,0  00D0C00s W0 0FS900000@Cp8D73S Y 0 FSM007# !730@(1S 0 F0S=00(  (100@ 0S W02S 0 FS<0 0" 20@W0@1 0 Z00 FR P0@ "0R_ P 00 FRQ S "   S   W 0  ^0 0FSqt0p0p95SF 0 FSe^009%  9E@@6S _pp0FSQ|0000x|6S# @000DKP::Eߍ P !) 勒F P. 0   `  @  0FR000S *)   E0 000p0, dcSc25dd79dd@-PR1!`0@ 0p\ 0? R1 0R00  0M 30 0 0P0 0:0 00P00;0 00P0060 00P00 ЍP 0000t |0 00pd0 00tp0 000eXFe;e0@-`0i0 MSPp$M 1!pp~p@ڕ0S i +`*i@ 0 P` "@1Q50 00pP&P4 j ۍ$ЍFe0%$]ebFsep@-`\@T  PP\0S \0\08  p88 0 pk؂%emF@- 0080QPP@ `V@ @T %@P  00ЍpO-IM PpgPHLL `PR %@P0IߍO'0,0'600 0400` 0 {p00,0 PS2 V30a2@0 0 ,0T:`0 P :A@PFIߍ@90 Px VT` 0X`0T90 4`9PezF@eeeO-@pP`Q`,R尰,P2,ES#P㔀U`,@ ,N'HPG', Q 0S, :' 4`,P0FeeRO-00"`p@PT:p ЍT  X ⢱00U *c"0 np0R0   @_90 'p U9  |'p^l@-RM M600`@PBT Tp@ %00 0ap | p ۍ Ѝ0D9 E'p UPU p@- 80SsQ S   00 0PЍ 0SЍO-04MS@ h@@ p0 0_0P; 0o0  00 0`P37 0T0 @ 0P0 00 0`P 0 $ ( XpP 0$,0(,8 P@ 00 y0j`P2 0 0S0@0L Zr000!P*g"0 0rP 0$00S0(0  $ 0 j (`0$ ,0S  S S0t0(0s $F(C,8@ P@0S 0h0 0h0 l ;0304Ѝ 00 !0`PX @ TZS0`$00S,0  P@,0$S  S S0t0P4 1S 2S0 0h0p( $(,8 RP@0eeO-P0M@040`0`p 0 ''p'X; X8l0S,0S,0匒0嚘 2S,08`0嚘 8d6S,0t0嚘 x"R㌂0,80,0H00`2 S0d6S y7 0Lpߍ0 0 0(p (  0p 0 0 0,p (0P7 0p (D7 0p(,77 0Tp'0z0,,04l0 40pl'0k@0!04,0 40p],])d&k,0 !P !,d ,hS  R0  P 0  ! 0  0$, }R0 RP 0  B0 0  0 !P !0  P 00 0H0 0 0, ff:f(fOfgf@vf`kp@-PUp@,0L0pp@- P# Mp@ 0` 0 ` 0<p"@ Ѝp ` 0.p )X` 0&p  00; U100pG-`@p 0崀SP$H` #000 0 0 `00`0! 0 `  $-6 Q 0 tL000h4H0@1v XHpЍG<0 $6 30004@0S4H000s$80405  S /00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!5 00,*S:kG{{'{*z8 S zkg{{'{* z$5 00H0S0SZ h W 0R<0S 0ST2P2H000s8040 P024 ;P28 5P20 /#00@0S0i y0.0 0p 0h`  H  P0dh0Ѝ0S4141y PD1 _@1(0000S  0R`V dp`^ЍGf0x ЍGe??ff`fffffggTgng@Ԝhgg hggHFA-@PT R0A 0p80  l R 0i0P 0S <0S $4  r 4`0  `A" ``="0Hp00` 00`8 0  ,"00 0$008 % d0h0hO-RPp`@\M@P; 800 #3P 0 RT0y00 ^pp h@@L p 0  0 @P 0{, !X P0 \ЍL0S0 0@S@0L0L } cI00=P 800 |"x2P 0 Rzgjzzz{HT0!d0S  $i P $[ <Y, y ! +!C,p! $@(@ A,  0  04  <  @ , D  H  <8pL@P@T@Zp` xv ⁇0wp 0010 p{ zE00b@00pj jP00 0 \`3!vT 닎04S1SK0@1X0 ]<7S: zD7hF=hhZhChDChh H@-@`P 0 ;h0X T6S @`0 ,    Q3  ,tЍp@40  ohzk7hh 0p@-PUp00CSp@0@ $)3  (6000L0p@@ i Ĝ7@-P@ xK800  B`000H 0<0L008 % Ѝ0@$iHi0 dpA-P`@ v 0h 0R0;P3 0@1HA"p` 'P0@1( AP      Pd0d dd 0d 0 ~PK $Aaiii;eF1 e C-`@ PR0  R $ RP608 pp2  i@ R PP  P0 ' lH@!D1$?'((700A Ѝ@ 0iIX0@-@4M@14(0P 0S 0 0}P 0 0P0   000 0 0 4Ѝ00 w1  4Ѝ0@i0p@-8 PR@  E0P   0,Hp@-Ppp@aiiG-`Mh0p P@@1D!8 8C02s )pЍG0t&0 2s 3p PUP 0P`00P 05iH00P0 0봀0  ( 0(10K#R/   P(] t 0 + 70G (PD  0㫹 , gPFL  0 ? ЍGQ   0|P() (1 (1  0(|!x>xmP( "(1* (> >Q  0*c  T ЍGO  ЍG80   0S 0 0Q ß Q 040 PH*000s  ipPqp 00 P R   V0 00$0C40 040800 8ꬂ0S0&PU 0S 0`0h0L 60 PH ЍGp0I|0 $0  0Sm 0Sj 0Sk$|0  )0  d0S  0R/.0/IO-0M 00PS㴐 @eT0`Sp 0 eЍ> R*SP 0S D6S<ƚ Hƚ[  S/  @!  Q 0 S:500 0 p0 0 0  r 0 S 0 0Cs0dd0S0 @S0L00 !p 0 3 {00 0 P0 [ 0S?60@ 600 0~p0 l0 \ `P < ?0 S\ 0@1i8@5P P0S0 0<S<0P0B!0 0 3 {00 0 (P 0S6[[0 0S40S:0 0Z ;PP   Cl00 0 !P0SS 0KSK?3 05 0$0 /[ pi0 W84 @2SS  00Cs00Cs0 > $P 0 0  0S  0   T3@ 0 R@ S$ D :0<0@1=0: P0 P3 000 000 0[P00S* YP )   p彁 @ 0^600 0<]P0  0S * |0P *?  p叁@1 f000H 0 000 00 \ 0000@! 0S  0 $ 0S S0 vS 0 F0Sq0 00 P0hPc0 <[ - l sljk5kQkakskkekkXkkIkkBllG`Hl!l2lOlRA-P@`\- 0l A`0RQ- 0 D0BSpb 0 Al$lO-`Pp 0䘠1@T ЍT 0S R T0 S> R *QP  !0 S@lC-,M@P`6P P0 ,ЍCIPE lURp0@SN 0SKUG:p1SC U@: P7U4:! R1!C R.   $   zP` 0QU q `q`g`  aU ,  D,ЍP 0 ! @ B)*Gm/m@-P` M\@p0M000 6p 0S LL  ۍЍ 0]`V \@T$6Gp@- P@3 P<p@0S0p@\0Sp0p@CG@-0p ;M4MP@ p`@ `0چ0<000C$00(00$0C,00U000`$0 @`c0 p bݍ4ЍPGp@-@PoT  (@1S pRq W 02p 02v02p0S 0Sp 7@-PX0B @P 0S0>8 Q'Q'+ " B r R "'    ,30 Ѝ0@}|Z zgjzzP+S, @ 0M Ѝ0zDLmp@-@P0( VUph0Spp@O-@`PU Q Pd0S  0  0 d0nP0.Q 0S 0P L+  Y080 | U봀8 R0 , 00C0 F080<0  P`00 0 00S $0 pW ! 03   0P C @R 00pwpWL0H0eH>0ppmImf0/@- 0Sr 0 @Rp@-00p0`PQPE@ `_ @d@DLd@p0P @-P01S 0 P04/P/P/Q 0\R/ 0\/0S 0< S8/@-P 0S1@-@T P@10S/ R0 " /P10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScO-`1 @\MT. 0S pW$   [{ .|PP@0Sh0S d0S4$ A{d0 0S PP\Ѝ|0d 0|0  0 0d0  0 0090" {P p8MPYP ?}s 0|0 {PP$0 00 rPP 0  0l id8edXaS {PPl {|0d 0|0XxI{U V0S P 8pP   M U`  jP < $R R0 0#  Q  f{P h % <   d?pP? t0<0t0008dxQY X 3{P Q{ UUP "{P @{ĠZ 0$8 0  h % <   <}`:n]G*ninAnp@-P p`01S 0S 0S }0S  0 @T 0Q0 PSP 0U d0S0h0d0p@nmG0d\/ (0 /00 0S/ p@-@T PP@0pzGG-Pp`Px@Ѝ0H @P00 4d@P 0P000000 000 (00 =$0 00  0' 0 p݂0S t/00@ s6P  0@R 0 0000@@G^-nns@-@T`Ѝp`PV08,*:SR h0S L#H$` P (0R ,0R   `P 800000( ,0APi0S  0h dd0S  $0R 0h0d`0SHŵnn0S/0S/   O-MPD0R8<`@H0!R,00ЍpP P 0 U@ UP R R R0 2P!4Y@PЍOS p    @@0 0&  0 ,0S SY000000000Cs a@UЍOeG^0S/C-P@$M T 0p `! 00 0@00 @d@$ЍP/@-@TP@30S   0,p@-@PPP "p\}Pt 00p0000S0p@00:S 0S @\S000@:S @,%P/:P@-^@S :RS:SP:P@A0 ^S:RS0@S0/% @-@A0S :^|^  ^ R S \0L:\\ |\ O--CMM`d4!SP I SLEpWH `0P0B@ 7P܀ 00p@@; 040S0 00,0:= zpP 0 R0 :R00Hd400 0p0PP u0S a FCލЍ P ; 000P2PV%0 00xp0PP@0S!+ 0P R $0,$0SG m@ i@P  `P00 P000 SWB p@DW:SZ @\Sp S Spp0 0T:C P @D 0SS Pp0 0@0` Z@S 0#SS `P@?0U u:00h00>P0 0Q :Q0, C B  RpG:R:   H J B[$0 0 PC P[P$0 @D pG H  0S 0y @p P D$0d$0 d0e @E 0S u D0A0 0T*vP 0P:SZv,% @-0  0 Ѝ@-(@ P <0 0,0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ s0Pv Ps @ ]< Q0P ލЍ s0P P 0@PB<0 PP U LP   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0S@Z\R    B{:R|R  ,%r@-@DЍ@MG-p= @P@ d'Pv~ 00@^S0S:S^ `00A\S`0S:SQ 0C^ 0@0LT1 0L\TS`ASBC\ 0(bC|^0 0 0 0 R@Ad:PPd @0:SS0AR0@A P Pd : A-p= `P@ dPPd0`FA~ 00@0S @AdPPd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P 6P,~G-Q0S`pԑʯ ^PV00c `a  lP00CS0: Pp0 0 S  }W00S(@ zP  o , kP P00SW  X\00S 0 47σ,P R   S@T P R  ` ЍR ,W,,@0@-0S tP [P, ,@-@RP08G,p@-P@PPp5:Pp,@-<P  J(0@87STЍ, ,p@-@ PS P@p p@-P #(0@87STЍ, ,O-pWP`@P @ Ѝ0S K P 0yP0T  RT1@ S //////0@-4@0P P , ~O-T@00SPp4b  4#PU00~ P|  kP00CS09 Pp0 0 S0 &| >W00 S yP 1 -P P00SW00 Y00S P P00S  P P P  P  P  P$| :8kPwP Ѝ ,WdjX0@-0S ;@@0@00DVP0DЍ;P ,8 ,@-@`0P0`Sp 0`;P P Ѝ P ,@-@P08D ,p@-P@PPp8Pp ,A- P@`pP 0 `00P84SUP@Ѝ ,@-$ 000B;P Ѝ8 ,A- P@`pP 0 `00P84SUP@Ѝ ,@-$ 000B;P Ѝ8 ,@    /0A-P<<`0@ '0p0D0& SQO-@P DwpDpG``b0Y:0z  Z# 0@@ Dw 0DA\0:Z: [=0 S: p` Ѝ `p<,A-@`Ppv v yv svA l0p@-Q@T 0 do `n2 0$pAT doP n $!0p0Rp0@-`pTM00`< @PVp0TЍTT0 pz@ T,0@&$0$ 4/00S %~<,A-P@ 0s P0#p`ppGWp0P ```pT @@P <,p@-@P?0 ?@0R:@@pP p<,0S 0S/0S R P/0R //p@-QM$0Sy A1` 6/`1!6/&%!Q10P! \`6/*)!(Q'10P! \^`t 6/ ,` 1 !P6/ 0`0 06/ `|0 6/ 4`s0 6/ 8`j|0| 6/ `aX0 6/ PX40 5/ 0@ 4/Ѝp<,%H~i~Zo=~eu~Y s-E~IB~6v?~~~~~~~~~0<P, < /<, @-@ 0 0A11D ^Q  $ $    <,O-lQpD0H0L0$`PD @@ @$D T:d 0jHT:d @DL0 0R:P0a Ѝ030@4   $0@0 80@4 0$ (0@k% 0  4/0S O<,%O-EBMT`MV`x0 0000, ``bp0,0tY0@ 00`o`,,U@Y Y +ip B>04@tH R|Yx 00$0S  ğ0 R 0 >80H@`@C^3A40LC32 0h  2l 3 p  !dC 2ttt 00C0'0DS 0 000@PxP| P,0 & 9 % 4 @ P B, * R' \  B\ !\  $   R B @ @P R B @ @P '  (  )  *   0 0 $0  3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00l Ѝ0S/1>3 !/0S 000/,0S/A-0p @RP:``S * ADP`A 0 PQ0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-@0SP`(0aL T  $ T $ Q0@ 1pC !OO0`0sA-0p0@P`MⰂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SQ u P0( R, R)\\&|\#00 |R 0S |0 3/000Q R R0SR|\0 Q QQ Rt0S 0S   B 0  BЍ 0S 0 c >0000  B 0B B00 "0 00 0T,A-`@0PS<0R"0!31<0S 0R0PP0S! !x000S!!!,p (B0PA , (0 ,P<%%%A-`0 R*S\ ]\ tpPB@T Um 8aPdPpL% R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00, 8 0 s000/`Q'Q!//ᬜ%A-PRp 0@S` * `BP 0!ca PPA-@P`p0 SV1 V00W W0St038383834444443X444444444P 0 B 0  B  B " A A`0 F  B  B " A{  k`PpG  B0  BZ`FPpG|S`FPvA]p@-P@,`eP@tp Tp}Q 00//},1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0P`<%%%O-P 0R@M _ P&  _ P 000Ѝ 0@  ,AP ЍO 0P  S @ g 0 00<00S*^Q000800R ]R00-R f0 S*]Q -QR\T0]Sh- 0 Sw:0S0086000S8^ 00000 50Sl`0rPr_S ,0Sd40Sa$0S^<0S[(0xW b 0(`c0@`F `@ fUi 00C0d-Q [QR:Q =Q 0pS: U !0R00`S0`000-S]S0`S0`0h4 R*000pBW R:0`S0`00 S<*R9 :R6 ]R300B  K_0p pBxP 0w S<0R$ %@P    sP  p$0  0$ 峠0S00`` 0R00`S0`000-S]S0`S0`0=  R:0`S0`00 S*R =R ]R 0S0 -RD QA]Q> -Z00  W3 0S- W0`S 0`00S<0W00Z0S Z4 0?P  pgwp400!0pᲠ40 P0`S 0`0{  P  P @ [m 0]S Q^0s0  0  EB#ЍO<%,%p@- 0@0(M! 0 0  |  p 0Q 0`0]00000P0`P(Ѝp (Ѝp@꬜%%%A- @00P`\UC S:0S004000 p4\U R[U*U .Uy 0S0 S xlP JU @0p W1@p(` 0 S *R \R0)S ) \ W 1L  l0 S *R \R )R00J 0S00300B3Ud !0CUU0Gqt0S^  Ct % : 0D #OU &02U ! 0  4 000p0^0 0 0 0]0000p0S* *Q2  0  BN  B   B0B  Bu  0S> 0S 001006PX\QV {RS00<0PS<* ,R9 Q 7 810000 'U0 R     0 S *R\Q}Q00 0RR \P 0}S 0<0S 00,000$EoЍ[Uy`,)>{%A-0@pp`?Q $0As R SG,E,E,E`ELFGG,E,EH^QO [Q \Q PUOO{Q |Q720W:0S00500 @0P U1@P(` )0 S*0)S  ) U 1L  0 S:0S00500P 0)SP  0  $  $ RK*0?S{S*C\Q@{SP L$ "!,Q  R  $  U   R  #  ?S m*S +S 0S* *B?RP {R  Q  3000 Ѝ  0  (  (  0PP 0000^0 0 0P 0]0P0 ~o0W:0S002000 <Q >Q qx9PP iS &[N L]{S0 PSp* ,Rm  1000< U0 R  !   50 S*}Q00f 0RL}QF \ 0  B_  B   B0S  BC   B0F  B 0  B;  B  B " A 0000S 00000,%0S G- `M† PQPE<^PL@P 6U: pPp P P$ @pxpa0  pt0^ 6up|0pp P   $ ( , 0P4 8 < @ D z000Q R:0S005000 S=:  c 0A0;P  N00Xo p0 P>3S, 9S $S S <0R pQ00< 00u04|04040 -  Sc S<0RxQ< s00 p0QiS S S>SUSQP>3S S/ "S 00 0\ S:0_0P 08 BB0U0 RB@ Q U B!U 1 EU, ^ 0C\!1LX0RU!U! 0>Q% Q% QS 00 080Se 0S  0H 0@0 @0x00 0  0S =<Ѝ0R 10C/TUUD,H?4+*Ee,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0cP`<%%%0p@-0PSQ@ʡ@8QD@ p<0S P pL0@0t@@P(00Ppp@<%%%O--P@pMLP0H #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T 4P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R xVR Ra R >c D2"H0 00 P0 0 9>c pr0 pRd[* A T0$  'P0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D0/H0 0 0 7P0  R'꬜%wO-P`p4@Q{ V Ѝ>3S% *S" SY SH SR `P SX SX 0 P =S[ S SG S03S S S6 "SY SF S 0H S &Sx.S$ *S S0s0S80 S xpPr80 0@r0s0Sx[X00>@4@505 P`F`FV0@0>@>0> ^0C0>@01>3 Sw 0O-4M\0@0(0X000 001( 0  |000_V_U0^00 0,e,v_V0;0  R" ( ZP $0 00`,G0P,vu00_PU0PSPU R  S0 04Ѝ謜%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0800 0 X7  IS~ S F S 0>#0DϠ2@ 0u800 0 lX I0  0bP  0p @0P  0PTP 0PP@ pP@0<800p 0 3X G 0 PE >#P   0#W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--P@pMLP0H #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R xVR Ra R >c D2"H0 00 P0 0 9>c pr0 pRd[* A T0$  ]#P0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D0/H0 0 0 7P0  R'꬜%wO-pP4@0s0 W Ѝ>Q. 0Q`$ Qh QS Qa pP Qn QY  0WP0 @Qs Q Q[ Q6Q QF Q@ "Qy Qf QQ g Q &Qy!.Q0 *Q QqQ8Q y p Pr8 /rqQy SY> EQ\QpGpGPu > j  > >c V >  > QMO--,M , *4 d0*0 0* (0 @ X  0 `  0R   Q0 Ra  R [ PZ   R    ``R  0!P0 00 0 UC D V pP p r _U RQ v     _V RpuZ P# r   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  ` pdX0w u r R ` pS0!u  vR q   _V_U P  ` 30v0_V` P R  R5   0$ !0PZ& 0$  P0 S 0 P0`  :` 0Pvu _PU PRPU0S 000S00,Ѝ謜%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0z800 0 qX7  IS~ S F S 0>#0DϠ2@ 0T800 0 KX I0  0AP  0p @0P  0/TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--,M , *4 d0*0 0* (0 @ V  0 `  0R   O0 Ra  R [ PZ   R    ``R  0P0 00 0 UC D V pP p r _U RQ v     _V RpuZ P# r   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  ` pHX0w u r R ` p70!u  vR q   _V_U P  ` 0v0_V` P R  R5   0$ 0PZ& 0$  N0 S 0 N0`  :` 0Pvu _PU PRPU0S 000S00,Ѝ謜%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0z800 0 qX7  IS~ S F S 0>#0DϠ2@ 0T800 0 KX I0  0AP  0p @0P  0/TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--P@pMLP0H #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R xVR Ra R >c D2"H0 00 P0 0 9>c pr0 pRd[* A T0$  P0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D0/H0 0 0 7P0  R'꬜%wO--lM $PQ0W @$QR ``O     Q 0R S g  Z2,Q~ 4 Ry 80S0u P0 0 0/ /0 0 0 0 0/////0P P@- T /ዃ,P P/ /O-$MPpLWH^ `d@P1!$/@ @ T0030#`W00SP 0?Z0*9# 0  0  ?Wp  p $Ѝ 0?d 0? 0?p@P] `p0H P 0@ $Ѝ`d@Pꙙ\(\@-PQM@(p,` U00 V Sp0`sЍpw`S0p`Ee-00Ѝ00 r0`0EX00 r0p`0P0O-M@0hwh[ PA  8YAZKW  8 8X%  8 8V<  8 8 h 8X 8ЍVY PZ, P 8 8Z  8 8Ѝ P 8[  8W PX PV P PЍO|L\4 |TTO-@Q00R0`P00M 04堄堤0 p 0aP R nR a BRrMT1   oRl JPM Ѝ  JPY U000T000 nJP[Y U070T070P ]JPY U000T000 LJPYU000T000 ;JPYT000U000{ *JPYN U080T080j r@ JPY9   JP  JP  JP_YK U080T080@ IPp  IP  IPJY8 U000T000$T080U080T000U000T070U070 T000U000 ЍT080U080T000U000l IP T IP ,P$\  C-@PdM0H`>SHPA@@@$P(P,PPP PPP9p "`!@03@0 p@& 0 a=p@ K=p@   p@`&L0  PJ=LPL0 PLPdЍL00O-1MM @`DX!D "( p C.  P pV@D;@8 (0Sp p p̱̑ 00Q$ P %0!pyp@ t0!0 P P {0S RK0@01ݍЍK0S PEPU R} PEp 0T8D<4! @ P0 0C0 R 0I$0h,R @P1ݍЍhL1ݍЍFtH`gt0@-P@M 0  PLp@ .p@ P 0 0 Ѝ0 Ѝ0A-@@`v0 oPP0P! 0pp p%p0`p0$K0`Vp K``pp0`p0 K 00(ip@-@PCM3 /$:P5 8p@% ` PJ000u5 09{C.P F {@4EP @F>0@S VS 00 SCލp@@0S,@l0l 0P@0  P@1:J?0@0@J0@0 @lgp@-QMP4@SMZ TE /9PB QP0s+ GP QaP 0`pP @ 0@BqpG H p@ ۍЍp%0si/ 1p0" +B@0 P@0  P@1:HJ?0@02p04@:J0#S.p@ 1J00-JP*J@Pf|fHf%@ e@-pP`O-$(pY,PS@`1U+00ï  0 ;W0 0 0; 0R0*V&G 00p&C{p@tp4 2x 2 BppwkP@r`Up@-@M@ P, 0`0#L` QCP/ FaS 0L@U/1 0S2 0 "#@Ѝpꫪ*O-((60 @`$M00@=+@ I\b-0@?o2S00/ 0 P 00d 0 uQS 0 0000S 0 PW!#ό000 0NY [ȏJ0-0@?o\2  y 4YP$Ѝ0 0sx 0 P$Ѝ0@Pa (P aP (P0 )P0CS 00}P P p R4000.P0S0 0S  00000S3 R3 t 0S( hRf `#S\ DPV PM 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00 000XP#'XP(0S   R $ R`d Q  0d 000@#d 0@d 0@%0P"@XP 0dR  ^ P   Q& 0PT08<XP0 SE P\0s E`0d XP E ! 0XP E!XP  \0000 Q00SPT8< XP  RQE#XP  0 Q0x*0^q*{ r0s{P T80<s 0 XP !l '.%""""0S(0SO XP80@0 P0D: c 0  @02   S.Ό  1,ώ$0 d 0@$ Q04000 0-0XPE0'0XP0!0XP0XP P1P0 P0 :($^0<P0$ 0=R%0h00H $@DL0c 0?02   S.Ό  1,ώ$0 d 0?$ Q00 40XPt2|0 P0:P0 0<R  $0h00  0XP0  0C0  BQ $0 h00$%XP @ D0 0h$% 0S 0000000XP00|$0Sj"xXPqXP0(0m0XP(0i$QWXP 0RPM #0\ !#/1x2 L$0XP2p rp t t BXP  0 R+ P(#R# & E%- R  \Q%8< &# &0 (0 0dRV$ 0$0 h00% 0C 000 00S P 00 $0h0 CQ0 @00D h00  0  C00 00S \0  $0h0 0$$% 0%#P # 0S !#/10s ad 0>d 0}>$O--MPpB0k 0B0U`0 W  0 2c1000刀000@P/ 0v> 0`0?d000P0?T0 00#?<0;0000 000P :0\0P@ 0TP 2 dP 0P0S}ʴ Rzʠ RwʨQt005 0Sd `0?#0S/" ES}> `00d 0 RW S S|\pTlVh0SdU`0S\0 R{z  RRzl8@0>C 0C0p0t R@ix0S A0pPt`( 0( \0:PJ p'?0! P ό 01l"?! R1 R?U0v Po 0M=T7v~@ pG0/ QPpp 0==0Rl h Qh łA 0  Xqp`P  0qppA0S Z R@Q @T ^A 00 ߍ 0TA\ qp0 M 'pQ !'/q S=P9 RTP\0 P0,P0  PpJZP S 00@ A0\ ` A0S0000 W\ ZR0``o d`0\P0? T00\80? <00\@0? D00\H0?L0 ܺ0X\p0e @0SI O937'3gS:3ß0#cP,: *PIy0y@P  刀dS_h0 [ZP 1pv0ps@@(@\ P`VP ?/& Rß%0Q0vt W0$< 0" Q0P"0V#0,m`V10& Q#Ό3à\!=30S ( 8L^9 0( 0fqp2 P~q+@#00(@0SL <\| РR10"c01 2c1Zÿ sR @T00@0S$ 0?0Q 1&`P 2&>`\3à\&=3?0 0{ x0?T00Z?T00'\lP)\(\ ףvɻ @-@ Lp741T_at X00 R 0 R 0Q/  /    DQ 0@-0P S@@H  ^ 0S  Q 0#0S0 0/ᰯxhH  Q j.0 0#  Q/00Ɠ\ 0@-xPo> 0@" \ 0 0 /᤮A-@P `p@P@0%  P PPA-`@@6S `pjNP@ & P 0SP蠭A-`@@D0S `pH@P@ & P 0SP0O-P M `P9 p젟P nP P @@ %  P P0Sp A Ѝy X p V s:  #p0`0pS꘬A-pPQ `@Q P 0@DDB(000S   9@- M`pPPp) U> 0 Z0@0S I>0"S" 0p000S0 7/ Ѝ5>0"S1Ds\0pT000S @ Ѝ1Ds$  L9\8@-@ @O-p MWP  pp2SR`PL P@C \Pp G ,P P6 0nS# p= -@P00Q Q P R  \0 HB"A 0 0@00oSp\000S PN` Ѝ,  CA`h7 O--AM M@p=L0 0LP:,PP  vLPm0: Z9P PC@@0K PP 0&'p 0  00P: 0 *PP'p ` q@P! L 0dSPkPU0 Pp` fp|  (Q:P O@PP 0 PgpR ༘Q P  =00P/U` P pB<0SS  )5PAލ Ѝ 50H0PP0 &p>  'P<00 Z05l! 0 00<0D0 04w<!0 jHQ0:&<00 Z04~<00 Z04sPq<0`0  P04ezd@pD\( 0@-P@M 0 P@ &PЍ00@-P>@M 0 P@ &PЍ00@-P?@M 0 P@ %PЍ00-,M 0 >PЍ--0$ S   0/ 00̩p@-P64U@p;?( ( 0P 5/ph@p@-P&U@p;?( ( 0P 5/p@-@P 0003/괨@-@P 0003/tp@-P ?oU20S@ 0 0 03/p$|p@-P` UV00P00S@p$ P05/p货$p@-PE?oU20S@ 0 0 03/pXp@-P`6@Ppf;(@0 p@/p@-P@P p 0 0 03/p账-@-M  gp@(0(003/Ѝ@ Ѝ/XP@-gp@0003/ O-`$M ؤP @.0Sp$Ѝ;0,P@@  4/$ЍlxO-`$M ؤP @}0Sp$Ѝ:0,P@@  4/$Ѝ!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////ᠽ`4$,ܼȼtL4$Ի|hTD}O--0:p0*S0pG0 003PZ0G"` `0 U0SXU Y <00p00C0`0 Pp(V ` BPE @@R> 3P 4U * 00 0 0*0G0PPU  <32 7[`= YI Ii XR3"^P<^P `0U 4@ YFX; Q8V ` BPE @R> 3P 4U *0000*0 00G0[P & < Y` `0<S Z>03040p 0R 0<ЍPU *@ Y,PU ` * Y@@ Yp;0:,d;0:(Y 00  P4(<p A FQ ,p 0$00)Q!*AQ V S @0S Q} FQbQ0  `302 @10 0[0 X 3 "R Y 0H0PE00 @$@S 1>03P041U * 000*0 0G0, PPU`<03`2070SE 00P0=S @Z? 0  `,)Q(P 0 BPE0`$@S>03P04U *000*0 0G0VP 0`PU4 Z [PU`1401` Z``0fQg [ 0 L( ,!3 0 ` l:. @3[ X3"30Q040 N Y 0H0PE@ $@0R 1> 3P 41U * 0 0 0*0GR,0PPU`< 3`2 70S 0FS 0(0(0S00040G0 3P0 PU`0(0 ``<0,( 0B($0<PQ0$0 00PU 040FSY00,0@00S(0 P<R00S$00$0 00U 0 4 @ZR  ,*0S)P 0 BPE $@R>03P04U *`000*0 0G0XP `PU *Z  [PU *<0,0@Z7  ,*0S)P 0 BPE $@R>03P04U *`000*0 0G0XP `APU *Z [PU *[4 0S1Y 00H0PE00$@S 1>03P041U * 000*0 0G0T ,0RP`PU*=00 <0,(0PU=030400*0400G2P(0PU`0 X00S4 0X+:Y 00H0PE00$@S>03P04U * 000*0 0G0 ,0RP`PU]*#00,0( 0PU#03040, (0 0[, 0S)Y 0H0PE00$S 1>03P041U * 000*0 0G0 ,0RP`PU*=00PU0#0%=03040305,00 ` <0,0e,00(y,00uķ0-M{0{0)Ѝp@-P`M0@ 0n 4/ЍpG-PRM^  `UpP*/a@B%P T1000< pp Ѝ80S 1 000< pp50S ЍĠ 50S 0 < @0000< @ pp50S5 0 5 0 ̧,Hl@-$$@M ЍO-EM MaX@P+p `E- K0P@+T! 0 K0P@T 0 0EAP D  @ U0Eލ Ѝp5 0 Eލ Ѝh5 0 P\@-@` pMP|-P, /J 0RP  rR' rR  P   P @0CЍ0rS\ 0 @uЍ0 Ѝ@r 5 0 TDA-`@ ᮸p@ 0P/S /JJP @0 Sp  0 S -@p@-IMM@`PP ۹p 0: S p0 0rp IލЍp4@O00IލЍp@IލЍp40@0꼣p@-IMM@`PP ᪹p 0: S p0 0Ap IލЍp4@O00IލЍp@IލЍp40@0g0@-P@M 0 P@ ;PЍ080Q 0 080/p@-@PP`  PP u %P  p@_* PPp--00 M (0  ЍЍ/(--M  Ѝ Ѝ/ -- MM<P 00  0 ЍЍ/X(0-@- M@MP  Ѝ@Ѝ/O-,M `@RPP00:A!0@00Ppp0 0CS1 PY P@ 0 @cYP vM!,Ѝ4@-@0M 4& 0Ѝ0 00 t(p@-`@POMpp p@ @-80800M@ & 0Ѝ(p@-M H0H 00@` %Mp  Ѝp@kЍp(0@-4M@PMp %@ X4Ѝ0p@-@PT T  0M` @Lp % =0Ѝp(C-,M pP`PEUP0R@@t0 0:2 0U @P0 @T L#!,Ѝd4@-@0M |% 0Ѝ0 00 (p@-`@PLpp p@ @-80800M@ S% 0Ѝ8(p@-M H0H 00@` mLp  Ѝp@yЍp(0@-4M@P\Lp %%@ f4Ѝ0p@-@PT T  0M` @ALp  % K0Ѝp0( Q 80 @-l880@08 880/880 00<P 80880 p/p@-@0@00S 000 X t0PP  `00A"/L00p@&P, $ (p`O-t3M0@ 0P 0 `0Dp@ P P00U tpp0 0CY 2ATT00  RG LD@D T]:[ 2 00p0`K K0 V0 W8 P2ATT 0`Fs 0RB zK 0  0 B0SH fK@0Ѝ V0& 0  TK 0 0pHXB0SG 0 =Kv 0 B 0 B@ 0 B  B$K`FtZ  0 B  BK 0 v 0 m 0 0S J00X 00 (p@-@PJppp@ 0RS00 /p@-@<0<00P  @Jppp@ @(808 00 Q0R00 /(p@-@`PJpT T   p@pp@-@P\ \  ` @JpTT  p@pL(O-1!000, S1H0? MPD`d 000PV1!p !q1 W0C@(t  ,0@@KD Œ Č Ȍ A`| @p4  W R ? \ QQ Wt ,0 000IC11E00Q00, Ũj Ѝ0 0 00{(@-000 000 @!@P80@080@-@@P80@0800-M  Ѝ0-M  ЍO-ϟiM QP@qaԱ  PX? `K͌U P? K͌T P> F͌(1S P~> F͌(W zP}<> C͌ V hP{= JB͌8[ VPy= ̌1S CPv`= ^B͌`0=@ 0S078 H0P `P P P Pd P@ P( P P@ (P PD (PPt PHT PxP'( 4Q780L0x100C40S0 00C,0000h0000a0P06 ,0P0@`U 0e1P U.0q10 `00V0q0 `bV, 0U @ `dp少Wl` 0 Z Piߍ`0 1 S  ,00 0! 1S 0D 0| 0>p009 P ,,0$ 0 @< 8P!P H, $  B @ 0S% 00P00C1 0@S3 00 Q!1 p WQ  pW,000 p0S,000P$0U1p㔠 0 W Pp~80Sz004 0R0031800S@@X!0@< 0S00!$0P 0S@@@@T0S0 0 ,00C00P0X00Y,0 0CR0@,00`0QQT d!@YP0 p00 W0 pgW0T,00` pp少W䰍 0 X P0080S^p!f p!:|rQ R 81 R 0S ЍQ  <00 IDh0 T  ЍLD0h0  S/G-TP@pᨤMk +q(@($pT /0CS0SX%31D6P 0400/($$ ଀膃0尀:p㴀%LȈ㸀͠x胟H pp8At`l@Ãd\X(TPPLHxD@<84($  h2101:|@ R 0S 1q810S \ЍQ  x20 dCh Jh@ \@  00(PU(p0Ѝ>㐸A@<㋸^㈸vㅸ8#ジ:0'|#yJ #uH#rp-o-l`_i|focp`r]yZzW{T@|Qh}NxT- l!+!%,!-!.%0%`&i%j%k %l%m<%n#o#s%t$%u4%v,%w%x#p#rd"ye"z`"|DA-``_` p @ 0^ 0(`V(PO-pTT7 L7L00MJ]070 P0\0SZ  p p P` + pS`H\$ 0` s 00bRS 4S 600/N 0 ;0◷ $Q`B`q 0 ;0∷p n 0S,0 04 0 s 00bR44 $S `%5 0Ѝ p P`1  4` 4 0 s 00bR 444P500/1QP p lR Ĕ P $ $ 0d0\0S0 S 4$00`e pg |0`@ `00 4Q0`Q40NQ  000r0  cR$0S0I Sz= p? T0`@b p6 0 $ A` 0 s 00bR 40 ; 0ڶp P p 40 s 00bR44 $RT0`$#0 0Ѝ0 ;0ⷶp4SL 0`@  $ `004S: 0040 s 00bR $4S4!SY 0`@s  $ `004Sc  20 2"00`}` 4!4 0 s 00bR L/o 4"101!00#?ca p 02 0s440040 s 00bR44n40 s 00bR40o0 00#?c0`0040040 s 00bR44T00S \ \ t0t0! 07г ꔯDx AQT8(4_0$  0* 004 44/|O-T4P8 `0$Q@DMh v :Q{#R3Z 300S 8 0P0 @P`@-@{P% HuP 4PFP0S)[P& mR R@0R0 1BqQ;RS S0 CmSr ;S R R0 S0S PS0 C;Sr  QR0RR,YYO-0tSp@`Md`Z|P YT0ɍ <rr  00bI|"0R 3S(0$00 0pPK?T0 THP ךX 0S$$ $ 0|"4`0T 3X 0 4S0300S5 p0S2 4S, 4S 0D#Tq匑Tl"2 8PR t3l2Z& L[# `P P %|0`% #V 0H5S4S 4S0?o28p22Yt2 PV 2t22Wx2 P/ x2x2hЍ0 D p$l h $ <%$(fW _P2l2Yl WPl2<l2Zj NPl2?;~0l2Y CP1x2Z ;Px2?;~0x2T 1Px278x2W  &P<1t2Z  Pt2?;~0t2T  Pt278t2|200S0X0  rr WH|"R1S00 4S,^L%R)TZ8p2@0t2e8p2,0t2Z긠W@-\Ӣ5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@@@@ PN U  ^Q/0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@P!80-^\ , 0 B\ 0 ^O--J3dS0 dMbWSUa 3,p0CQ?8 <3 Q7SA0:pP8 , 0pT3S0h0P 0p3@ 0 00p, , 73, P 0 0 0N   0RdЍ|B0 9dЍOh/O-*,M0pP2U 0!  @Te ` @p$ $TK):0`SO p 0 GPP,Ѝ@`00S S> S0PV$0S-00 04S,ЍO>0@0S A0Q  B20RP 00C 0PV !00C 0 0PS  P@0 C`PQO-DM 4P3 S-0S*U= 000  0@ 000@ Q k@` p 埣PJ @0S 0ợPЍDጼ P 4A " 2  0ЍP0P_P0  0 /T D0D M000S :P Ѝ"Ѝ/P^H0H M00 0S :P ЍЍ/]404 000S :P /]H0H M00 0S :P ЍЍ/\]404 000S :P / ]MDD0P  P 0 ЍЍ/\@-|0| 00@T 0J#4R |B0pQ 38@-P @@h\808 000S :P o/[D0D 000SP:P4@//[000 000S :P /@[L0L 000S :P @-p @/[A-0 00pW* Z3$SP! #R`@4Sp`3@Tv A|B0tQ 7A`-Z-0    hY000 000S :P r/YA-00 0M` V$ p @0pmp   fPP 0pap@   0-@១Ѝ@HYP  P ]/p@-JP 3S P`4`瀡30PVz  0s3$ S"07P |2 $R 0X0S 0L3 |20X #$03p03ppp(p@-jP D3S @P4P:30@Sp@3A-`P\ J3S%sW" P@P033SĔ S*/W 0B@ ^0,  W0p,030!C  ! L! \0|! c0000WP3PSSpP4Stpp3PUpp@-@P PX0:|"C0T0XppG- Ѐ\-P@p  `ѡP LTL!VW R T VW  H000S4080 ἡ0 0U|O- M0@DT  =pnPP5P( ~ U9 Ѝ|P&` U$ @rP  0 d 0 gh `  @RYd ` `` Ѝ Ѝ0 F @0@0T|0@-?S0P  0pP0@X p`a p@^`  00PPR4A- Q@PP% pW# 0 0S0,000 R   R   R  P 5՟ӟ4ϟ`T `TX *P Q Sp  QW02Rp@-`P X0@:|R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S OT00SpX@ |'(@ 8Q 0@0ppp@-Xa@P`Q X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \PpP00008P@078@0pGpNT0T 000S P@ ?# Q @ $080///DM((0( 00Q0/L((0( 00Q0q/L(A-T0T0 0PRp @`?`,GHhL(T0T 00 R X@0|78@08Q0@0/L(0 00K(0 00(tK(0@-P0P0@ MT X0:|20T1S@0?;@0c@000080S@078@0u Ѝ0LK(P Q@0?30R @080///RY/R/p@-PS `0H @?DppP X @0*|"7 8@08 R 0@0/P@/'0@-P@PP M X0:|20T1S@0?;@0><000080S@078@0 Ѝ0|I0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/H0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/$H@-My @0@0Ѝ@%G(@-@Mg Ѝ@p@-l0l 00 Q@P00R ^ p@H p@F(p@-D0@@ 00P #pp0 p@F(p@-P@#pp! p@p@-P   ` @#ppT0 T ^ @ p@@E(p@-@`P#ppT T  R @ p@@Rp@-@P00S ^ p@y p@rO-`A-PUP5P`0@%@00?C,5p 00TP 5 5 0@0@0@0  00P 4 4 0@0@0@0  00P x4 t4 0@0@0@0 00LP ,4 u@ (@ $ R@0@@0 0 (P !R 3 Y0@ 0,@   8P !R t3 G0@ 0,@ T!R   P ,3 5 @0;@0  00P 2 & @0:@0  00P 2  @0:@0  00 P x2  @09@0  00P <2  @09@0  00P 2  @0;@0 004P 1  @00@0 00P 1  @00@0  00P L1  @0 0@0@ 00P 1  @0@0@0 00P 0  @00@000PL1S0  @08@000@P L0 } @00@000  ~pdt|p@-P@P0@P006Sp0 pG0 0p@O@pp@-APQ@`Q }10  R* 0  0W pp!R!  Br (00(!C R$C1Sڸ0J @Tp!Rڸ  *d2 00000S / @T *@TUpx00 QPڸ0 Pڸ  4040 K @T|  -M 0ЍC- `?PpPEIP$Y/ P@  N @DT`F࠱V HX $ P 0Cp@-A1@`P0M@00 !P Q `Ѝp ( 5x! h!l1P 00TtP1 0@00@0P5,10 R00S Ѝp@  0P 0 S0 0@00 @0 0P 00 @00@0 0@0X P@00 80L * @08@0P  ~p|tdA-@`PpxTV,1 @ 0 @A O--/? dM$ 0*#R{$/@ T<  ( ` (`RP(080@80@9 @ h?0S`$?@ ? 0D000D0 RP (@AD000h0S80@0800 0S4$ >0(0 R, 00s0S^4 0"( @ t@T,0Q0@t@T<0(00S,0S (  R( , HL ,T,S(0 040,100 180<00,0 10 0=$ 0p0H |0D00H00`p 0H SL0HP1<08 0,0000O,08 0Y0Y 00S0`S0F0Q<08 0,00 1 1 01IY0Cڸ P0oD00 L RQ 0YP@r00PPP 00P P p, 0 R S R  0\ ɟ`V0JZ 0Z jp   0R A VdP  P  `p P V  0Rt  `@:$00SID QC 0C00 S40( 0S(00040 0 S(00 R4 000:3s L  RL   000Q00 0\,0(0s0,Q0,8P 1 11RY@ڶ  R7 8 r  b q$0`V 0\S0JZ @  @NN Œ Č Ȍ N LL\o00ɟ`V>:p80PT 0P TD0D0 R 0 R PP! YR *Y $R  0E0| xp0  0E n D000P $ 6  ZD0@00!R 7tq <000V! B0C 0H$0P=X 0*1d"0p,<6$  y 0@P`< 0P8, Tp P$T000 @0p4 1`11QUo 00S400 <0pD0 P|pV0A0 0C0 R d1SYdЍ꜄ 1P U00V0S 0    z4$$ R 00S0 ?CQ`FP@` 0?3T 1HX1QEP `?0D000L00@ 0@0@00 XX0-yP0L0c^\ 0S @(080 z <00  $20 p`dЍ80 00SH2$ 0D000h0S(00S;<0+00@ 0Cb (0 Y0<080 @0 80R00C\0Rʙ @t' =,1$ 0, QUp! <,\`@VP  V@P P0,p, PQP1J q <@,T`V@  777|.-D%$l$### epV@ P0 , PA,\,PY AIa,@IpE ! W   P  X,00,0Q00 , BCR4 R0<084 00C, 00S<,04 00@0@0 0,00400 00 S` @` P 0, !Yp, 1@  Y@p oP0000 00S000 00 0S 040C04 R00CQ8(0 00, PEu1 PAj0, \, p(@0<00  {X 0*1d"0p<0V @ p30S  `3$  D0@0 0Qb R_ dP\  Y R d1S $ 3 A 0PU@`W0Vm0Sj 8Q004CQ{0各V0F0<00DP `P | <0`0PL W H D|pY uPp:U U` p ,`FV EPEElUP0 0 : ,0R<00,P 0 apC0Y 0C040 % 0%: 0:5,080@40 HY 0X00X0S1!0a~0S00Y0SvW{W&0 S 0PU0@8  K , @DHTH K0E @0PE0PEQ! 00 00C,0X<00,,0100 0R0B<0`0,P,,PT 0E0p0 0E  .D000P8, 080(000 Q0,0 00000X@Wt 0 CD0X0 <000P`P4 pQ S4S Yô4SQJ H5S4L  9$p@ 0 pPD 00p0 pC00Pb  0D 00 B0 y0p p&0 0pl0 p \oSJ 0 00D000r$ :@ H0 pC0p   D000ȔY  Y 20 oSP+4PM D00  X sPP p0SM 4S 4S Y00ôQ0S9 L5S<  ;$ @ 0   D0 00p0  D000Pc  0D 00 B0  K00Q0@000 :0gD000P  T P $ 4=@ 0    KD000P) =$  0 V R- X =$ @D0 00vXDp 0 0Lj1S X 8>$ Dp@0 0XL5S 0 0R{X >$ @D0 00L@0P0PU 0 U @"P @0pD0 0HpX @0 P: 0}P    p?$ D@0 0pX000 D000H%RQ    p40$ D@0 0HpXpp@-P0P`@0M R    80x t00 0 000P80  D000! B/ 0C?0 0 Ѝp 0 00(C-M048&lp\h@`Pp\P  Ѝ|80 800 0 pCB`Po_`PЍ @-@P @TG-1!00`0DSHp0?sppS-, P !Q@QT:!80|0Zp@U0 S00? P R!R0 S   0 00( 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP0 @ @T $U0` V P`,Vp`0P 0@PUpT` @T @pp  ! !@-@P@T R/A-p0,SP` @T @T0`SP R0Q/ C0A "" Q/@-pQ*P`@ 0A "" T0 "" Q^ 0N "" \^PW`@@-@@@0S P$0C$<O--:z0*Mp$P( , pPx l00^b Ss @@lRXapH\ 004@Y @A@0 @TI Q@@[@TAP i``FF\W0^0  | aR\ p`Q'`Q"  @CP(@ ,4QT SI@0S EP$00C$0xX0C,4Q~ @CP ^a S_ʔ80,40SoʀHh@` 0 0, $P,04CS (` R 0 KR 8 80 p pP] `' 0(@Z =q @@lR@A'@T 00P0SZ  P$00C$04' / 00Q4 70,0' 4(0P0K0 覟F @&  $P)0Sl600S00l0S$ 0 S! & ,40Q$0 lP,0S  P$0CP$60 RЍ 50( $0(0\CEe@` % (00 S5$%P0C (00xP0S  HP$0C$@8% 0( 0,@0(@Q |4000XV 0Q[Q $ { 0$0C ,0(@ 0 K[ZP pD40,0<$ , 1 10yD4@000P ^$ $@$#` P(`h0 Ru ,,Uq  P+ x# * l# (`$@ ?#R WH( , #\ $6 (`  P 0(`$ R  P $`B lP " 20,,40 SO   H20$ ؀0B@0S eP$00C$0$؀ 00P0 ! ı 00(@S7a` 10(@0 T0!0@Dx P(@0S  /P$00C$0`,0( a`0S P$00C$0 l`,0,HXl`4< ,h\@ t@$O-PsP3pLC@00 S 4004c`(,P Zg34@2`0T5"0C S402P00S00h0S000S200ʐ  0@DS(00S 00lP 0S D2 4204@,P0T0hPr RP0 @P 0( 0CS xP1 P1040 ,( ϴ@P,P  ᤗ@1(`0 R&T !P @T 0 R 0 P'  00 lP @T00,P 00( 0  04@S]CPE@DSP4@,L04Pl b00SL004PLlxpxt@- ,(4 00  @-  ,(4 00| O-\1\!0 T *⤒Y|20 1 W0!Q:|20t0`1=}Q,00S|20l`0 80!Q:|20hRl0 *s0!Q j0!Q ع p/p@-x0x 000@00CS0 S p0 S P00eprzPp00p@-0CS@0 S p0 S P00GpTzPp0p@-,0, 000Py@3pp@-Py@)p@-|0| 00@0J0Q P R, !Q0000舶(0JP\@-\,AP /0S/ p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0PQ`@ ypP 0 0C S{sp ,0A10A1S!000A CR  (  \ 01A K" R T 0 0 0J T0K0 00Y?3 0Pq uPP| 0Y0 00 W0(@p ڼ T D H0W D@ 0 ( 0C P8b$Ѝ00$ЍNT0 S80 E 10@ፑ @D  BT zp`$ЍHȏ$Ѝ 00C! [z @ D0 |0p H0K002 [ @T @wT @ @\q 0 00 (p@-@Pppp@p@-@80800P  @ppp@İ(O-X6dM0Pp$0x`P @=u0P0 X0P400Y000@p0@SUJ6+QP`0PZ0p@00@D@TX0 000SR 4 M  @ CpDR2C.-40T R8 7 040 Mx$ 40p0[H0`00000S00U0E6xP`F1xPJ`*xP0p0C0 D S    @R4,00 !R0!!۱,(@Q 40 0R!1 AAaA"AR[ 0 0 0`F[0A40Z00 00, @ pp`4 84,0@,@ 0 <8'@T 0 p4 00C 0 Sj , 0 (0C0S00 SRs 0  3 w R $10`0  0p K0000 00 00Se @p0 000S00U0EpwP0J S 0p0Cʯ 0I!a@Qp``P@ 0H00001@DT D0|0p -vdЍ#`@ 0\40T `R0@40 pxP`; `v~dЍ`|`vxP /0 0[(M,P   00ЍMЍ/ܩ(0@-\0@X 00 MP p T  Ѝ0@0 Ѝ0蔩(p@-@\ \  M` Pp T  Ѝp@Ѝp(p@-P@ppT p@ pp@-`P@ppT  p@p0Q /0Q /p@-00 0`@P0 0@\1000C1.T 0*\ /\p0R000p00p00 0L 00O--MS LPP` 0Z p H 0@TK !  5/  @T8 $T0<SP1 0000#10#.R00S0>~P0  H 0 v00 P00 Kr R0S0?@P5/@T YЍ H\00r R0S@0刀0o@P5/@Thc a Q" @-@ RM !R "R pPĜ\  00@XЍ/0Q " @-  MS S PpP$R (@/Ѝ/T-4M0 Ѝ @-P000M, PЍ 8@0@- 0\SY ^S9 %@@ ,S'Sv{cScXÁ0@4Ÿ^C110N0000q0}00%@000@0>Á{C0q)@@PA 00@S801pP00A 0@@100CT00C0q S\S:S '000L0d%{tQO-M  /q\PP 0p p00047 000R0pp ` @ 0,R6Ti \ 0@ 0  @ 0 0 Rg  QS%R +0@GSSQPNMLpoIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! > 0 SrC 0P0Ѝ% 0iP 0@  `fv`00 0 "!.Q *Q0 0 0RZ@0 S\%p 00 @ 0% 0dP 0@  d 0 @0 S 00  00000 0 C@030 S`  00    0 0 C@00 Sm\ %p 00 0%@@c 00 a 0 SH\%p 00  0 % @ @@+c0 00 0   / 0  0 000  0  C00 <   0 @@0D0 00T0 S\R$ W 0`C0@ T$<0  0 Um/> 0000   0 0S0\S 0 S0 \ \ Y p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp)0ꄘXDdA-@0MS0H0D!0@p0S? ` 01Q!1!1"b2cP0A @ 0L0L  00210BP 0 pW$P@WP 0fSPЍЍ 0 0Ѝ脗N@T gA-@0MS0H0D!0@p0S> `- 0?1 ‚0  @P0P0A 01! 0120BGP 0 pW$P@TP 0nS4PЍЍ0"0ЍkLR >C-@0MS00! 0p0S2 P 0`1H $@0!b4!b H1c$a1c0@` 00  0#3c`10BP pЍ 0<0qW X $`0sSP p`VWT 0S NlPpuPPЍ舔-?L$Q *S0 O-LM bl mPG $0$ 0*0 : 03 @PP: , @P 0S  R 0[ M #[ =[ =y`P` s000`0xxtp`P-  [Vp p  RR nP X,     PkV k0PSo H0 1$ @ 0d#ds112cp0@0L!112c0A0L0 30`b1a`@0Pa `0```@$@b`Hp, `V @Tp@zk=0 P@@0ok`VP00LЍ` 0!q0ƒ0p0@ 0200A0!1 120BPH 0`0@4`^ 0pL1N $@0!b4!b N1cq1cp0@χ 00  0#3c`10BmP 0tS0cS0S``d0@0` 0 0< `0SnzN vNM g(ukLLL >-?LlK *S|6 O-@Pp`0\ %\0pS sS lS@ 0\TT1DW 01 CR0@CUPO-ϟqM pQ P`P? 00S040H $  l0H }[0   RU0P Gk@T %0%T 400 R,B*Ph p 4 @@TP, 40,qߍ@P%T =,0,p:T TI 0DSECB@?>=<;:98543210/.-,+p(mP" 400p,1S 0C11ऀ R 3400@ R,*P 0 mp 40P4qߍ00f0\!0D]SAA t~x|{|x!00D R`@0A?S@:T = r@P pPu< <0 Q4 Q 0 0S, P b LЍ# NPP3 @ p@t , R 0S00 R 0S TR   `$0pW %S$  a$ PV $p @ @R^ /p@tP 0Qv Sq 0R 0Sx @Q 0p Q( 0Po )\QPaY'%pWp^QpWq p`W  P( 0 P'0HS3u  0Pg ?b LЍ0AyPEA/P{yxwvutsrqponmlkjihgfedcba`_\[zXWVUTjRhPONp~z`Q@ Q, @  @`, p` 5 p6 D;ID P R P PX0 T RC t0 U000 00Pn0}p``_$ 4 80p80p `pp pp pp p ( 8080pppsSt 0 S00 P!`ß0 AR ,   0 80T80剑T0IY【`B 000 0 0s0 _PWP p@t p@t? ,0 Se Q0S ^ Q; 0 c4k0 0P+|zP0 0 0 0 f0 P P p@t  < 00RO0 R0K Q| 0?WpMp@ 0 00 0S00 Pj  0P0 0 < 00 00P= p 8PD_tR DR L J I I |H H @H G P/$P00//XH @-M@0 0!1l!1"b2c N0L 0 0@@0#@B!A@C0PЍ赁NG g P0`0K?//pG @-M@]0 o0L B0  N\00L 0"2<@0#AB@C1dKwPЍkLF >$0P00?//F @-M@!0 30L@N $@L0B!b4!b N|1c1c0L?AA 0 0P0@$$C!d!b8A@C1.PЍ-?Le *SE p@-0P0M`2d@P 0Ѝp0[00  R 0S"0Ѝp[ G- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00L=<;:9876543210/.-,+*)('&%$#"!  " k{UF{{V!00 (Ѝp0P0 P 30 0U f {kUka>!00 0P0 ~P L30 0U 0"P  0cP0J30{kUk 0 yP  0cP0G20U 05{kF{{dPr  0cP0t20U 0x 0"RP=  0cP0x0 0U"  @P?  0cP0|10mU ! 0a"1"YJ)P2  p0cP0%ژ 0U"  R b0cP0$d10U 0"P1" P  P0cP0$10U 0"1"P   >0cP0@00U 01"0"P@  ,0cP0@ڜ00U 0 0"P  G??MHW XW PU T T HT T GS `S S R R 0R 0cP000{kF{U{ 0% P  0cP0uڠ30{kUk 0 Pd  0cP0\30{kUk 05 }P  0cP0n30U 0_"3"kPH  0cP0L20U 0="2"YPS  0cP0ڔ20U 0"t2"GP  0cP0EP20U 06"\2"5P9  |0cP0 20x{U{ 0 $P  k0cP010g{U{ 0 PF  Z0cP0ڌ10U 0"\1"P  H0cP0H10uU 0 PE  70cP0k10U 0\"1"Pa  %0cP0&00U 0"0"P  0cP0ڀ00U 0"p0"P   Q tQ P DŽP 0P O HO N O O @O 4N M $M GM TM M 0cP0(,00U 0"@0"P  0cP0l00 00U"/ |P  0cP0ڰ00 00U" jP  0cP000*{kRF{U{ 0 UPr  0cP0`30U 0q"3"CPf  0cP030U 0"83"1P  x0cP020U 0"2"P  f0cP0Wڔ20U 0H"2" P4  T0cP0HT20 00U" P  B0cP020 00U" P  00cP010fk{U{ 0{ P  0cP0ڈ10U 0"`1"PP  0cP 0<10@U 0' Pe  0cP0Z00U 0K"0"P  0cP0ڸ 0U" 7 P  0cP0qt00 00U" |P  L K K K GK J J 4J I XJ 0I H \H H H 0cP0_(00U 0P"<0"TP  0cP0h00 00U" BP  <P  00{kF{U{"00 t3030vx30 3U""00 aH30@30 3U""00 Q30 X3U""00 D20{kUk!00 72020 2U"$"00 'x20p20c 2U"o!00 @20} p2U"b"00 2020 H2U"R!00 1010$ 2U"pB!00 10b1010 1U"G/!00 `109X10k d1U"!00 (10 01U""00 0000 1U"B!00 00400g 0U""00 00 G H G HG F G F XG F 20 0d20 0@20 020 0y10 0p1t0 0g 1T0 0^I140 0U!00 X10 0HQ410 0?h10 0670 000 0(I0p0 0 ?h= ,= < ; : : : ; ; L; 9 P; D: 9 9 9 : 9 9 7 7 7 9 8 8 T8 `8 7 `7 6 7 p7 5 5 0P0 040p0 0.X00 0ܲ|00 0Ӳ\0 0003 0Ųn0 000% 0ෲ180 0லo41X0 0ॲ&X1 000 0hF!00 10 010 010 0w@2 0008 0iH2 000l 0[ 20 0R20 0I" /+SH0@-C @AQOQPPP 00 QȠ\ 0 +CA{ 7G 00+C03Q Q 00A@@1 0^XnA!0k+C{6F{7+S 0+C06 X6 /P 0S $0S 0S P? @4@P//A-Pp8`Q) , R0( 4", 0R40BV@1@! G-V @D 8&,0400G0, 0 40@( 0 (3/P840, 0S004R000@-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0$ R(400  0@=0U 0PE@T$0S0  0@4=0U 0PE@T$0Sx  ($  0  88 (90,K  @Uv 0PE@T$0DS, 0 D0@+@<0U] 0PE@T<($(<,00@000;00SB Pt<00 00CS:0S ;008@ Q;0(0 S0(0@080t0 8904;0U 0PE@Tx0S  :00;0,@:0000 pC0 0,0S P<@@B0S 0*S3 W 0PC000000 00 0 0#1<0 S@0@0R0 RR<,0 0PUS0S00)9 0 <0 30DЍ  R S R  BP>0 P 0pBS 00 0 C0 S 040U 0PE@T00  BR00S  \ 0S0($<,(<0$(0 R x80090 00 80B4 R,5@0 000DQ1  P !ADL B \000D0S707 UR00t0 0P <@@b0(S0 ʆ  P<@@ ;TU 0PE@00 S  SP S> 7威@D00@T80PE@TULQ60 Q H0 @S0 0CR*ʆ+R h6006000LQ`D0ʆ;460\0T 00T :0PE00@SUld h ^X0Pt00001p0T :0PE01p@W0U Q 0SU 0PE@Tz 0Sw 400d50Uu 0PE@T:0ʆD+1 0D0@D8+Ua 0PE@T:ʆH ;0 H @D;8^Dp840WR Up1 0Wp!WC 0 0C 00 00D0PE0CD00*Dpl `R*$0ATU% 0PE@0 0Rl @Dᨁ:R (0,00C 8 P0l00X0S>0p0P0?0X00 p0tP 200L30 R=0 U 0PE@T20H?o20$0S0G $d2r ($B0#22cR<0S 420020 0L$Q   R D Up1p!W(R0 D ! $ R D ! $ R$!  $ R40,0000 100HU  PE@T  ' !X$ 100T100+000;8D@Dt00 R  B0 D  0P00!<2 ,2 / 6?7?8?=?>?N?O?5?P, P?(M?\+ H?A?L?) J?' C?$ BH# 9?:?;?0@\4 @Dʆ+8_,4威@D0F D0B(8<#0#xpW" h400,40:Q  ;8D@D _ 0;=04HL0  : 40040 0@S4Dp0I Z0PE@ZU8tgx|p@p ⨃ ^':l0wp 0:00pZl.  0S50P0;T050- @D{5威005@D0 :@z 60050@ 00l(4890 (8(8:0;t600T606l 0XZk0PE@ZeUx 0C00Sd  0 7 0pe41q岠pT*US 0`4`UU PE1q岠@pW0`8@DQ{8D@D,8tgx|p@p㨁U7L0R0 PpC% 8(890@+Z\8@D 0w@D(38l0R0 0 0P00<0@@50 0`pC( (0R@D0+S(0,80080 0X0S>0p0P00tpXp040P40. \9008 (892 fSR: @3 0@0L9@0l900900 pC \ p dT 0  \ h P H:000 00威@DpCx:00:0 0S:0=0 pCwp@-@PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B-4 08@'V000PA-@`PpP 0R| S  P00S  . +0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000Pi@Pp`W2@ R2Q <00 0 0S!B <@0 Q00cS R#2^ S3#Q0S1 R[ @ <00 R<0@ l0pWPV H R 00cS  Q # 2R S3# R0S  l0pS0pCp)x0 00 0P,04F0p0 p0 0 0 30 Ѝl0Sl0@@@LeS???P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pPWPw@ 0!(`3/PPp 8XG  ( 0(3/P00@d  Q 0  `!ƱP S>0Rp:oRS B P T  B T p X0Bp  (08#ᨱ8Pp 0BS.  p 00@ Q 0  ` ᆱP S>0Rp*p 0BS.  p ($03/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?00@C/O-PM@ @㬰(0ӷU 0C0 0$SP $Cp`0 sRpW-(0p p0Ѝ0` Q`V00p<J\S 0W0T0S20b60s0P0U 0 CP0S 0SCU\! V ! 10T2 0 T 0SЍЍ0D?o 240%R00S020,0@0000,004@0D?o280(00<000 0 0 0C$0 0S03p@05 :^`033N , %0! '05 %0 %!0(P<90C1P RP@00F3 0S C 0 $Q Br R$AVG  ` V$  \ F Y( V F(*Q BR  BR^ : 8 Q  Rc4 %Q  R]<  BB!   S @1@ <01( 00 040$0$ 0 08@, 00T  O-DMX03 0\0300 C  2 000ӗ1х1&=  tx l0J B0x t HH^Hl0:8HpXT`!Dp4`ᶐH@ᰐ00Rx0 Pl h`0 \0S8 B0l0\000S\ tDP`ux0l h Rl R010#P60 6SC \0P8 B\l0\00PЍl8  Ƒ R0Ƒ0Ƒ !  h0\0P8 B/l0\0|00SЍxO-T $M t44Yl08H XT "D 4@@QH 0 , CA/B BP`&P]pƈ0Cs00&#ĠƘ@ph# 0C s0!I.S8# 30җ1Ӆ1&=  `tQI Y 6R06t0l0080EV` l H 0U#@H@0 Sl \P8 B0 l0\000S$Ѝ8ƈ6&6 &!9096tl I Qtl 1Y` +t1QZ 0S Q. Ql0mR ,l0`h@A p400D`H0` l @5!0 PH0 ` 0 ll R1#:\ 6S \0P8 B %l0\0r0P$Ѝ\0P8 B l0\0`00S$ЍO- ,0 IY!0 M@pܴ0UWZ0c&P* U! Ep:\l`T`F Z PUP!Y /ooW"Z  [ZW  0u0 #4 B %B B  0BV V`!0\ 8  ᕩ\  0C  PEU``\  &Z  BP 0 P  `QP ,8\t06 Ai,0l06\0 `QPl0&R65UP    R\ S#P Ѝ<``FV*\,\8 CLl \<6&S06l0R, ` 6V`!VX\, Q* 65@ 0CP!P 1RW G/o"S W  R  PR#P`1`!WH80  D\00\0_Pl<N^ Al 0&lR &&0R8  0C ި6,AQ  l00l0&l8 q, l0BP0l0\P`1`!W 80 \00\0c  PR#P" 0S $0S 0S P0X*SES[SgSqSS9 C0//O-PM@`?o2P0S{@0S0v S t0Sq0,0S$ RgL0Dp 0CpB L*,0lp\p v`FP0*SUtpWR 0s ,00VpE*0*  00 P  t0S!ԥl8P pLpD@4H0P  ;. 0`RH0`0t0l t0Sl  l \  60 `h  00Ѝ* ЍA-@P 0S $0S `PlpP l0t,@0S@1VTU@80C ԧpp@-@P$ 0S! $0S H`PP`0 S0c``,0S`  *00 00(0p`p 900,p@-P@P pP,0L D0<00 B@C |0\ 0 1 0|0:l@\@t@Fh@H@x ` php@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P( 0S% $0S" PpPU0&0R:`k6 @cU@ĠL Â0 6PUWtPPA-@P P 0S $0S p`P0p`P|0A-PQb!Tc@pTeAP0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`䯟0P 0 X  0@S P X 0S\\ \((PX\ L\  RL/Sv0S[Q gQ 0St0S 0Sx RH R .0 103/0@S0S>0 X0S S000 00#400 03 0  0#400  0 w0S0c0?o20 Ѝ0So = 000>Sq *S/0Sq00 0 0&S+B{l0S=  B0#2 2c0# 0l0Sm q00010S9QI Q0t0 0 0  R 0,0S0Q0Q0$ s0Q0s0R 0s000 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E00Q P p K 0S  0PESp p W *PG &0 ,0 SR0 B0Ztp 6l8&`6&6 &!909&tpl0pG0Qtpl0` Wt0SX$ :Xvy 6S \0S8l  B0 l0\070P0S P{X: X(0S0(0 Ѝ0S 0=0 0 0 0 0 0 S0 S00ӈ R01q 00 0SEQ0X P7 R #0SS@ }S  y 00#  #800#"0 w0 0H ,0 QR 0 0I000S'  0 0S0   0S,0SQ9: RY,0S  R0 0[00$0S,00  0$ 0S0   0S,0SQ@:T R+0 B0o00,0S!  Rg  S 0 Q10S 000#40H0q000SE 0 B0:0#  #800#"0 IQ"V\ R8 C0 l0\000Sjp\tZ(l 8`pR B 0 ^L 6ƅp6ƅp6ƅ!9096&tRl0A0tl0 Qt QX Q Ql 8`p0  X 0Sq0 B000 B000,0I ^ ^<00 Y Y Y Y Y Y Y Io^ᩒ#Y0C0KS`00`S&ƅ&p0Cs0 ƅ0 01I>  0001&=  &6tR` l0A0`ptl0r\ R8 C0 l0\000S500 090[(B:XF 6S \0S0,000A  l0 0000 B 0<L0DC0C dt0S*l0\06\0S8l  B0s l0\000S(10 \0SSQOMKIGA-@`pPStPB T00V0SI0S: (0sT Q 1@0@!A00000 |0 `jp( 0S*t l00\ R$6S S L D0 BC 060@D0 0!1 0Rppp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pSz $0Sr wpViV`F0HSr0FSRnZ WkFoY㫲[dV @!( `4/@Pk * @ 22)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOv `fx00$0h(0 ~ Ѝ@ @0  000'P-M 0 AЍA-P@APUPq 0`0@ 0S  00 0x!(3/@PX `!@Ǡ 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/80S. @ R+ D PR% , 8 ᙠ, @@ ᔠL DD Ꮰ 勠0 0C006& 0&;> 0$0;/H O-Q$M R0  \ "r !#4"  Pp Dß` + @0 *'@$0z t %q q{0~ 1Q`!;~`0#:~)4~P(>6"r ~!p'P% ` R ` ! 8Ÿ0# s !P#4" Ÿ " " r01P"$#00# " r01P"$# 00#0# s !P#4" P% 0# s R#4 PUS@h RR.~0R$D. pR$.0#s0A0R.$ pAR.D$0#s00R$D. pR$.0#s0APE.4$ pAU#D$ 0 @  P   "r !Q#4"$Ѝ\ "" R !L /Ppq < X , C-`R! p `  0 D^00# PL  "`@18P\0 C @$!8 C-`R! p `  0 D^00# PL  "`@18P\0 C @$!` @-@Plp`hPp@` 0!đQ0 0#B   @-@Plp`hPp@` 0!đQ0 0#B   0@-1@4P\0 C @$!0 RG- ph Q R@O(sR$cW-mPVMD0@D\\\ \ 0\  \ 0\\00 0\\0\00 0\\ 0\0\0\ 0 00 R8΃7` cVV- 2T0HN0 T"R @0Q1X1H.7cHN1P @@1^NNTUD0 P P, R0R0R R0R0R0R0R0R0R0R0R0R0R0R0R00U0 l@D B @0 QD0'7b"c2HNVME1@Dq%R&-7c20Bp c!qÂ'b "0C0 Q H A R,A B8P C(0@P @@ /qR&-7c20Bp c!qÂ'b "0C0 Q H A R,A B8P C(0@P @@ /q/ U/ 0`0/x4D7ς 1O- p:PTU$1` Q U @ σ1\KU`0 ẠZ 1 @1: 0V: Q- ^ pQ Q Z @00O- |ş pjDMWP@TĆP4Q @Q- NP0P4 \ˀB XS-ʨ&σ pPpp Q-Yp& B&^ ScB C 00 p&P4 À fXQP4 !\˒0C`K P4`ˀXT$`; BXKT$T;!P P PQ͌Q- 1^ 2r6w|&A `{6P4pST.0J`@T41\0 Ѐ0 00P 00 p0q !Z㲰_Q=0ⵯ00 PQ !  W Y ^PA ׼V БR"S & &  R[P- Y> 0 Ό KK0RPKPG 0 QR0C Y> 00 B 0[0000C01 KR  00N 0 @ 00T00s P\ R @02^02N00 R0P\DЍWP 0 [Q / !@LY0S F0GC#6pQ@Z p J  =A-P@^1RPA@D0+}n@R- R1>000^ ^P0T0 S ^ SΌP^00 P0P0 S0Ѵ000°0Ѵ0O-pMWPP00RF@ʀ+m!k `  Rp: W1 R5 Q^pp`0`0p#406 R`c^@F v0`h7W@Hs`s0p R`vpWk @P0 [ЍZ㼆`f Zv` !.0@ cR(r C0` P`P`0P`#4`0f`fTfἆv`0Pc^h0v6v`@``@`.0C0nU6~ BSr Y3@s0P0P00@#4PP06cR.0C 6W W~  @[P0U R: 0@P0dS8`s0000`#406@D@0cUSFuP TcN0~ Dt@P@P@ 0@#4PP06 c^ 0C606 @0P@cTh0v@6v```@@`$D@F0C0@dUD6t@ S1 Nr 3@s0P0P00@#4PP06cR. 0C 6| @[P0`ἆ 6 Br T@PFgX@uPF Br C0@6[O-ʀ6k^pS㼖Mw 4004@0030 0300300"10` cy Rwwppp p .0CnV~pp~漖6S&00wp @4  `! Ḁpb W zp&z帠 B pp't pv pgXw&wpaY taN~bpiW vp&v``` Ipp`&d`v pg^w&wp0CS㎀aޕbޅಐaᶀir^wwp` pp p"$ InX~pp~漖 `#R~ `d0Cs0yb ^wwp@`pp`p. BnS>sps6pS἖_0 c Q~P~"`kNPP!``0C0aR! 6Ѝp἖8p἖p἖0k. 06Ѝ 6@-S k>@@0 #400k.06S0k. 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&蔃ʀA-@k`P s0! Qrr  pp "$pp &bS1 B0&u 0  u0#Ġ  <##4U0 0 u   *60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-*k΂6 Sq@q;0PP@0@#4PP06c^ 0C6 S0Ҽ60k@PP@0@#4PP 06 0C6S S00k@@6 0C6006k>@PP@@!PPƂ0O-p0@S M,0S ─&]P+ (+%0 N. 0r?010S@P j600&6 0!R1Q  S030#Z0Sk0 r Y9s00 00#40编0iR# I⼖r0(+ ,Kr Y9s0k0 00#40编0iR# I⼖r0 Yڴ 9s0kΆ000#40编0iR3 I⼖s0 Y @r 9s0k0 00#40编iR! Ir漖D Mk> ! PaR, A   / ! YqqP἖   00`" P0Q ;S ;S <SE S 0R  , &] Pj0S  Z R, 00G. 0R0 0xS0   0LSI>W&&&& Ѝ ЍO0 &k0p R2 ʸ006N.V l s000 0#406 cP 0C6s0漖@q9s漖9 9s0漖s0漖 l  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF 6@o0ƓAƃDQ  !I.!ѕ"х&  p@-@P`d0P \0PV  E@T @4 00@p)(@ yaratcid@-M @PoЍ:@oЍ@-M @PЍ+@)@Ѝ@-M @PoЍ@oЍ@-M @PЍ @ @Ѝ@-MpP` @P @Ѝ "p /Ѝ0@/T 0p@-S P@0 C`'0@!T @p˜ 0 p0A-S Pp@0PC`'0@!T @诜00嬜0p@-S P@0 C`0@!T @p蓜 0 p0A-S Pp@0PC`0@z!T @w00t@- MP !p 0S @p0@Ct'`[!V ` ЍW0 0 ЍP Ѝ@- MP t!p 0S @p0@Cf`6!V ` Ѝ20 0 Ѝ+ ЍA-Mp@P `P E!p . 0S P0 C5@ !T@ Ѝ`Ѝ0`0Ѝ0@.T` Ѝp@-@mPt0PPptcidp@-@aPh$0P p!00ploobp@-P`!@P   @[p@-@?@@-@9@@-@3@ @-@-@*@-@'@H@-@!@W@-@@u@-@@@-@@@-@ @@-@@@-@@@-@@@-@@@-@@8@-@@L@-@@e@-@@}@-@@@-@@p@-P`@P   @pp@-P`@P    @pp@-P`u@P   @pp@-P`c@P   @pp@-` PP@P   @pp@-P`>@P   @vpp@-P`,@P   @dpp@-P`@P   @Rpp@-P`@P   @@pp@-` P@P  { @-pp@-P`@P  i @pp@-P`@P  W @ pp@-P`@P  E @ pp@-P`@P  3 @ pp@-` P@P    @ pp@-P`@P   @ pp@-P`@P   @ pp@-P`|@P   @ pp@-P`j@P   @ pp@-` PW@P   @w pp@-P[@b(0P p'0P 0pgntsp@-P`@P   @T pp@-P`@P   @C pp@-`P&@-HP p;P U *00ppatadp@-P`@P  d @ pp@-P`@P  R @ pp@-MP@ d0P @Ѝp  )`P  @P`+Ѝpgntsp@-P@ (0P p0P 0pgntsp@-P`)@P    @ pp@-P`@P   @ p@-@R  @ p@-@"P $0P p!00ploobp@-P`@P  # @ pp@-P@P @#@s p@-@"@@-@"@ @-@"@$@-@"@B@-@"@`@-@"@o@-@"@@-@"@@-@"@@-@"@@-@"@@-@"@@-@{"@@-@u"@7@-@o"@P@-@i"@d@-@c"@}@-@]"@@-@W"@@-@Q"@p@-P`@P  l" @ pp@-P@P "@ pp@-P`@P  J" @ pp@-P~@P "@ pp@-P`m@P  (" @ pp@-P\@P b"@ pp@-P`K@P  " @ pp@-P:@P @"@s pp@-` P(@P  ! @` pp@- P@P "@O pp@-P`@P  ! @= pp@-P @P !@- pp@-P` @P  ! @ pp@-P @P !@ pp@-P` @P  |! @ pp@-P @P !@ pp@-P` @P  Z! @ pp@-P @P !@ pp@-` P| @P  7! @ pp@- Pj @P p!@ pp@-P`q @P  ! @ p p@-P_ @P M!@ pp@-P`N @P   @n p p@-P< @P *!@] pp@-P`+ @P   @K p p@-P @P !@: pp@-P` @P   @( p p@-P @P  @ pp@-` P @P   @ pp@- P @P  @ pp@-P` @P  d @ p p@-P @P  @ pp@-P` @P  A @ p p@-P @P z @ pp@-P`{ @P   @ p p@-Pi @P W @ pp@-P`X @P   @x p p@-PF @P 4 @g pp@-` P4 @P   @T pp@- P" @P  @C pp@-P@. (0P p0P 0pgntsp@-P`@P   @ pp@-Pz@P @ pp@-P`o@P   @ pp@-P_@P @pp@-`P@@ HP pP U 00ppatadp@-P`z@P  G @pp@-P`@P  5 @pp@-PW@P o@pp@-Ph@P _@pp@-MP@| d0P @Ѝp4  9%`P  J@P`x'Ѝpgntsp@-P@[ (0P p 0P 0pgntsp@-P`@P   @Mpp@-P@P  @>pp@-P`@P   @-pp@-P@P @p@-@Q @@-@R  @ p@-@0 P ''p@PP!0S !pӋ !0,@-$@@ ʊطQP&PQ PphPPQ PpJp@-@<PEPp/>P Q 7P Q>/P p@ ) 0p@-SP` @ 0S P@p<P QQ P/P >P p@ p@-\@<@P(@Q Pp$pP p@ L , $@-@P@ p@- @P   PP 0, 0pC"@@"p@-PQ@` x0 S S   CQ R 0 S S CQ\<S0S !S0-S0F?o 2-R0S0S -S 0-S >R/S `(` 0 S S  /S  >S   C\  R `Sr 0 S S  /S  >S   C\  R0FU0 P[ AXPV0/S_ 0$00>Sc Sj 0SI S S   0CS R` 0 S S   CQ RS3 `0 S S  =S   CQ  R  S! 0 S S=S CPQ`B`0"S0S  0"R. "R+ Rp`FV0S 0(0k(0S0$00>S`0``000 0pL L0L H0 0`tC  >R00p褔 ԓ , P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /@- EWoO--l1KM0 ` 0p0:[ 04A @ Q, [ !WPP 0P3/P 0吊0  @04/P 00 0 PiPPKߍP@ 0@;/ 0 @QPKߍ̑ @TG-@,PPD aq`p@@0 S S   CQ R@<S,  ΅P   ȅP   …P0 S -S@0-S>Q@@0 >SS @S@! P@< @ L  A-PRMePp`0 @T- K0@0W   W[ 0 /R C 0CW /RW  CW0  B/Q !@C@T@!  ;@04D.0 0  R0 *( 0 0|]p@  U 0@0@ۍ? 0 ۍ  0 ۍ S0p /P-Dp p@$ C-`MvmP6@P5 ,~p`H pB pEe0R:p#0 `h00up*  S00 0hp" 0PPЍ0 `h00Rp  0ЍG@+Ѝ$@@-@ u@@-L_P 0 0 뜋  $ O-IM  @T V 6/ p0  PS @Tv 0 R 2/0P`%_a P0 p 03/V@ 6/T _T T @T@. 0S2 03/P V 6/^0S @0 R 2/0P`^ P V 6/X3 003/Iߍ 0 0C/O 0 0C/F 0 0C/= 0 0 4 0 |0 +l l0l B0C/"밉 8 8  $  h D Ј ̇ E ; p@-P@PP  P $0SP  R P2pdTP P VPP , `PPꘇ h  P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0bP 0 $ \00 Mߍ R00 0 0K/c  0/0/@-@@P 00#0 0 P 0S S R/P/ R0/@-f@ |p@-!@ (M  P l  ```RP(Ѝp<  P h(Ѝp ȅ $@-@,(@-$@@/`-p@-M`Pt@0 @0Ps0*0 00 Ѝp]0"Sp@-M@`SP0 Phqp 0 00 Ѝp>0"S 00 S 0 P:\03#/S 0 P\0///A-P``ᕀ@P (RpP  |@P sƀW@(0( (0 4 @+ ̂ 00 S 0 P:\03#/S 0 P\0///0@- @PM @ Ѝ00@- @PM @ zЍ00@- @PM  @ lЍ00@- @PM  @ ^Ѝ0@-@P ,0 00R) /P/0 00R / 0  Q0 R* R0:/- ^ : P *0 S0*/@@/ / (P $0 00R //'P $0 00R //'P $0 00R //l'P $0 00R //4'MP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/&P/l0 00R / 00 0  S *0/ ɒ\* /L&P/|0 00R / 00 0 S *0/-  ^: %P/|0 00R / 00 0 S *0/-  ^: <%P/@0 00R / 0 0 S /$P/|0 00R / 00 0 S *0/-  ^: X$P/l0 00R / 00 0 S *0/  \* /#P/l0 00R / 00 0  S *0/ ɒ\* /H#P/|0 00R / 00 0 S *0/-  ^: "P/@0 00R / 0 0 S /8"P/d0 00R / 00 0  S *0/  R* /!P/d0 00R / 00 0 S *0/ R* /l!P/h0 00R / 00 0S00/ \: / P/h0 00R / 00 0S00/ \: /x P/T0 00R / 00 R /! /P/h0 00R / 00 0S00/ \: /P/d0 00R / 00 0  S *0/  R* /P/d0 00R / 00 0 S *0/ R* /P/h0 00R / 00 0S00/ \: /(P/T0 00R / 00 R /! /- P M /o<0"00^ R Ѝ R Ѝg0P/L\ /  JQ\/P/L\ /  JQ\/P/P\ / Q/S/Q\/ P/P\ / Q/S/Q\/p@-M0 P000 00S Ѝp$0@S `0-S 0S0xS hP T <P ЍpwPRPTq Ao/A-PP@@Pp t0,p0P4080<0P`p @@PB@|W}@-0@ L 4T}@-(@@3  |4}ᗂ│@-@@O-4@T `,@@D¤@`T PpQㅑ uPZ P PZ  0 0 p `s p z @-R 0P< P 4Q ,  D D0D @0 ~0 000 0 upr Xp $p cr p p p@-@M4 00R<SP,0 S R( 1`V9 P` 0 01P 40, 0C40P0 `ЍpS 0 0D 8Ѝpr nЍpR t t0t 0D \ \0\ X0D H H0H a0D q o o aXq Po n 4q o n qq o dn A-@`,pPP W 0 !R},P0`,,P0`G-@P MpP  0`0Ѝ!0 /`P (0S0 젟0 $P (0S$`V00  0P 0S  `P  P X `0 vP ( (0( $0\ xk T pn m Hl I 0  @-0 vn 8l l  0  @-0 h|n 8m k 0p@-S `  Q P@30@-p 0  0 Gm |k Hk {p@-0S h`@`P}Pp7P p@ 0  0 "@ `m `l j 40@-S , 0C!40R @J@ @0@ <0B/, ,0, (0B/l l Lj l pk (j p@-@PP0S ,  Q <0 0 p@`O-`p@40Sa HP@ P 2P0UP 1001000`SZ 0<0S 0  R 圑 # 00R&P P [H P P P 0  03/P PP 0 S NO 00CS 0 0PS Px@` `0` \0J/LL L0L H0R/Cg P f e j 4i \g i (i 8g D@-@Mz0,S<SSbHrPG-J `P0pUIU@* 404 SS= G000,0 100,0$ 100,0, P  ?o 0 2\0S PP*    0SuPPPPD D0D }0., ,0, (0. g Hg 8e g Lg e G-PP& 0 0R!p4z`P 4 R @, 儡ᄑ! ,04 儑@ 0T:80#b` 0P 0  Q@-P80080/ p@-@PF80080p@?p@-@P 80 0R@ pP14@.p p@-@P \0 0R@ pP`00S@#:p5@4 A-@` T |0p0W.PP X000L000A0@S 0< p p A-`P 0 0R4 p40S @40S,0 PP@ pp A-@P 0`0VpP0S P @T @ @0@ <0R/@@h c c a A-PP /o0`0"Q@@T 00R pu @P @T j@ 0  0R/b b 0` O-@PM 3` 0R PЍ4 00R80p > PP @`P /ЍSP rwP3 i 004Q\ a4[_ P,10Q1 0}P0ZUPE Pm 0P !e 0 ,0傁1`4 <0 04 <0h |,XG<XIXKPUF ء0 H L  wP"  D 0,S<SSLPP ,0P`<04 0<0v100 IwU.  ,P<PP_! ge,04 `<0 0P4 <0P 0 |0^/l l0l h0^/!T T0T U0c/xjliP_ H] \ ,_ h\ \ _ ^ X\ G-@S ` VP p P  000 Gr 0 0i/L^ ] \[ -0P M ?o@2 ^0S Ѝ00 S Ѝ@-PP M @1 0R Ѝ`@ 80  Ѝ AP 40 Sp@ R(*,P  C!d400C40<00<0/-h h0h d0s/T T0T P0s/@ @0@ <0s/\ [ Y F\\ 8\ Y H8\ \ Y G P/?o0 2 R0S/00 S/ 0P -?o82 ^0S 0 SF/P/0 000R/P/0 000R/X P -/o<0"000^ R  R/ p@-P[@P 0P 0 03/P AP @]p@VpA-`P @P%pP $P p90P  pAVs*,U p@-P@PP z PPP ep~0@^~@p@-@P 0@,T @-@0P B@P 0R R@-P0S /Go/808 80 $0$ $0 xZ [ HZ Z Z (Z O- 0S7 @` P. X0tqPpqP 0 kP  eP X0UUUB!#1<00@.B,? SP@HPOX% XP0@#r 1 D A-@`,p PP W 0 !q,P0` ,P0`p@-00P4Q8 @Q 4 <0,04Q<0pPp 0 &0P D C XC @-` MV& @Pp yP00 Ѝx 0 P (0S @P 0 @@P  Ѝ$ $0$ 0` Rd9 C pC xB B 0  Z@-0 BC A 8B 40S 0C40/ 0  @-0 /XC B A 0p@-S `  Q P@s0@p 0  0 0B A hA Zp@-@P t0`0VP0S R <0 0 p@$ $0$ ]0 0B @ @ A-@`PM40SO P@Ѝ P d10XpP @10041000@SB <0 0 00S 0/0 03/@P P? 00CS 0 @ 0@S BP`hЍA #L@8 808 0,m6 05 5 L@ 9 > G-S &X@ PU 0` 0R 00p "P U v G 0  0F//T? ? = NMA-PP 0 0R4@pP 40S @,0a8, 40a@T:8 408 p$@-P80080p@-@P 80 0R@ pP0@php@-@P 80 0R@ pP4@pp@-@P \0 0R@ pP`00S@#:p@A-@`T |0p0WPP X000L0000@S 0< p pj?DLp@-@P_80080p@Xp@-@PS8@@@Npp@-@P 0 0RP`@40S ,0AT 7p@p@ 0  0O/LH; 4 `: RA-@P 0P 0R@ p`8040S !,0X Q<0, 0Q<0\@@g@D D0D @0S/0 000 0S/: : h9 : |: D9 p@-@P H0 0R@ pP`9@pxA-PP0 0R@p4\ 80,0!aV! \ ,0\ <0L04<0AAD D0D @0W/0 000 ,0W/H9 9 7 $9 1 7 0P -?o82 ^0S 0 S'/p@-Pi@P >P 0 03/P OP @kp@dpp@-`P pP@P $0S p@A, p@-P@PP p gPP |pt0@ut@p@-@P 0@CX, 011/A-\@`pP \"1S 0 €  P 10P !`p P 1@0@ @B0 ,0, ,A0 8 d8 7 7 D8 7 @-\@ ^ \)QRS  T00 QL R S "  T € 00 0 Z0 <7 7 6 0@-@R00QP,M! P! 0       H0T?o20S00,Ѝ00 6 6 0QQQ S/  0    P / <ϿϿϿ 0  Q/ 2/ / /   0  \ /p@-@PP`(M/ 0S, R00o$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0M P0V00(Ѝp@ R 0S V004 0Q000 00/@-@1p00T000"@-@$T @-@T000 000S/@-^dt000 000S/@-Ndt000 000S/@->dlt000 000S/@-.d,t000 000S/@-dt000 000S/@-dt000 000S/@-clt000 000S/@-c,t000 000S/@-ct000 000S/@-ct @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^  \#211 0 01/41001/10 01/00S@-@1/00/@-d0d0 0@0MSP Ѝ[cP 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ q P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pl80 0 @ 0 048# /UUUU3333  T-: S0@- d S V Sb00Z r - w-!= S @^ >S-00 @Sx00: r-w- 0 SPD !S-00 Sx00r-w-0T! P8 P2 P8 Px 0    0Ss00 P! Ss00 @ Sp00  Sc00 ?00 S&  Sw00 Sl00 S00S00t 0 T 0 - 0 A00a0-00{d00xs00uG-dapP`8 eP3  dpP$ 0A0d`@@T ChP0=S AP`0AT CU !oedAp 0 C-dd"d2dM 0 P%L\Xm P`` 㔐嘐圐堐夐 Pap@Z xp  `p@e 7,P  $(0Qp@] `0<S0<0x0@S<00<0@DH(<R(T(0;("e<1<0 00L0000e(X %o0S ep@ ` `  @ЍbOoBЍ@no00 ` ` `& & & hX% $ O-p`M@ jP-TPm +T@`0 0Tj W p p?  0M`0 F` P p  ! @00Ds \a0DSW0DA0DS70DURY :Q P   S  R n "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0@0`00XS00 C R @0 p` 0 A BRW p pꙙp@-BR"^< p@000O@Pn0T0Pp\p@-BR"^p@<@Pn0T0PpO-p`M@ iP-TPm +T@`0 0Tj W p p?  0_0 y_ P p  ! @00Ds \a0DSW0DA0DS70DURY :Q P   S  R +n "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0@0`00XS00 C R @0 p` 0 A BRW p pꙙp@-BR"^< p@000O@Pm0T0Pp(p@-BR"^p@<@Pm0T0PpO-MHP@QD0@U P0 `8 P0"0 @<`$Ѝ 4Rl"00lP`!0 #$ЍX0 00T0 0P000uP00S<6#0P P` U03[0<0P 0$ЍP`!0 $Ѝ?/%1R5%%;R:*%6R1!%?RP`PP` `0 `PP4 `0 `y ` p   @- M|d"{@{ @0S D <0 0 |0 30Ѝ :/4` -M{(,{ Ѝ 0 0 9/jmNA00/jG-ApB`@>Q" P9Q JX5UQP 0 0V B  P1YPPO-H,M@|@0p8@0 S00L8`p0S 0( $($$ _P@0+0C< W Pp  q 00 AB0 0 S 00PU-0 0XF0-SPULa_P0-S 0!000 ,Ѝ ,Ѝ60p p -U0 ̦` :U`< + B R 0ZP00 WU E :Ro 0S000X6X0L60`u0v`  $60  ,Ѝ60Pu `0 0PEPCP0 S000500S 0:S 5 ?0P;R0S00BX0?X5 00<500S 0:S ,50{W 50 0+ C :R :S?k:i  0S`0  :R 0X0! $ 00Ox40l4 0$  RH$  = Y0P0{ C000Z p p@P`@p`W  bPuf P 2R z PP  0pQW`0S p @Az `T 0RZ0S" 2 00S 0:S  X0 S2 00+ Cea0JS0S:  00 S P0S`,Ѝ p @ f1 00S 0:S  < 1?0 1 00S 0:S  Z 0 10S$000<1 00S 0:S L z00C 00S0 0 00+ C0 0 0 00S 0:S U t00P0+ C10L$,diTiLi(D X i hglgHB Tg(gg 8,A H |eX@ \eLe@    D a<  O-2ؒ0 \p`" P@T60堢 R01-[@tP-T@PA T"TRPP XP -@X0P  :R7 20 0S! 000PP@:T0S! 000100SI 0:SF  0?@w0Sd1 0@ 0HP 810P01000 0:S"  W  00:R@ 0S m 0?@;?@0000|0| 0 @ @(`p`D`: _|_h_ 9 ^ ^9 ^^T9 D L<^8 a@-k@-Q Q Q  Q 10 0 0 0 S 0 0 SϠ @ ND^0   0Sh 0 hT 0 T \ , A-P @`0#03v0a 0Vp BT@! 'a 0R ! 0 pP   Fh0 p `QPA-``M! PpP@ P& 0`0p `` 00`0 @P YЍh@00Ѝh0P@hP h0Ph@P|0 0 X Ꜽ-0   X% hQ0  GP  $\Pt WPo$Uf ,NPf(~,|!GP $tU ,p Y "2 0 d4 30Fލ Ѝ` 0P0@ `P`P8 / xP @@U  <V; VE !0  d1 0 |Pllq0$0SH / x4!P  0  51 1 ! 0 )10  0 1 rdk]d||U'ܬh  x D T (  X @ $ @-M `@$$10pP 000bT T' b/0@0 0 0 0 30+Ѝ0U000 @@P@00vP 0?s000U0Pb0Pbb@P\ O--Ɵ GMMlčĝ* ĝ: ş$ P`9P@ @D`H`L`@0pJ@> 5匵(000 0(ph t@P!  PsXb00S/ Tb0=S0`S0`V`X`V `ሀ]PAb0#S PU @$4 0 l4 30GލЍ(00C(0\b@h 0 POyPb@ OPh 0 P4Ol!`m `"t fa\`&:p, `(9PPeQ| PTpxp2/͌7aQ&+ .* PP%`P썈5_l @$)p'paq,p`aq'p` 6oh, "   *a}:` @$@ @%hQ  P hQ%P 2/g @ @.h,]a>8 @gA!+*`&@ "$gA$,  ͌g!@pe! 7  +o&(```)) 6/`*`&* ``. &.`0*$M*l*8e, (e.ࠠ( ` (d,:+eQ ! & `_+P P&_%(`4  $&,` _&o%8 p'_+'_'(`` p p Po&o&`&na ,`  d`& ` dQ **PdQ%P*]@an!O n,mpeq! pfaσeA&n@σp'eA$ 0@菠Ϡ?/( @/"/"$@0,4)(@(p(( @,,@e1,,`Q&PʟP%0n_`A.`P@$=_`aA.m@$`c1_aA#@$O$'0 O$O$O$ fQ#@OP%a@_)0% @$+@_%+@'_%_%` PfA _@$0_0fanA (P=@$an!`O(_O%_%O$_% O$,_%m$Pc!_(n돠_(_%_% (fa((ꯌ c&(ꯌc1`&0(nꯌ0`.(`0`ꯠ*((***<=돌(a.*` 믠*($*( m*c1*,⏌a#* 鏌f#୊a.`돌f 0 !돠/(0/"?"00$(,0(/(4 ?j! fa "? #(`))<`?#?#0`?#ono80j1.j`0#-揌a1. 0#b! a1"0#όa?Ϡ#'o'p`4,++(@?#8?#?#0,0,,,Dp p୊`" ,jƟ`1j? nፈj1 naa $?`n1aa`?j?/#0@ `/"4@?#?#蝉O#/" @! "0%q0 ?p0%0?SP@@g 9Nr0gS@pG"# ` *h0S@@:`F A Np@- ! 1 0M0 00 P@R00 113R0 0~? S `` 0~? S U PE0"0 1<3R08 (0 0 0 30Ѝpr q0@- 0 0$MPQ000 @0  @" 0S0(0T H0 0 0 30 $Ѝ0)6PP p XpG-p QM稐  P 0E4eeP<0G 0S08C;t0' T DMPP!  T0@To0T0@VT@  0 0 5 30"Qލ+T0@?TU@ 0P PLQ/@p p@``Zoo 0- M Ѝ0@-P@tMt p0 00l00 :0 (0 0 l0 30tЍ0,nm {-0 00000{   #EgܺvT2O-tM0@ @P 0\@ 00 '` 0 ,40ʆh'0 !80ag+, 0 " (<0h+l[!h;P%PD@0eZg[a "g; D0 l l˃b;% +0# 0HcpmvmzNS.00@0i;h!@kd00@ +NDCDGDl˄@ dD@ `` @*mČƌ͌3kˌf+"d n , Th++KꭠᕳKgK0᫷K)e;#hˌg 0뺠cP1d{荠fa" a,fk`Hhekb( b,e[P@]a[h& h,aa4bf% f)b+ L@+IᕓI@嫗I d <*h+@h`i+@@de! p@d  p'e,pg|nlɠ\pfˌa "p a kfk`8iK+@@@nh *ꩠn@ @$@fi @lekb{,pe[b{'pg}0Pa{@lK&@alK$@DPdIbKf'f!b+ b-`l+g$lˁg. 8fd"fkd(hd`gb.P b,g[PdsXpa{``p[d[gzk{Tekj ,``!n(dˌn!h@  kˌ `g4m+K╳Kik૷Ki  ` k aLbhK%@b+hK$@X,MnKe! he,n0hhX0f+d@0 n;0a;$0a;#0cC3C7C`;0n;,0#dKl;%0# 0Lc:nne;$0#0<;+Al;AAld.`( he8PPh[PUjPj[ " b)g+,P(Pdˌb˅aP,b[Pn[#P% P]dK\UPg[pb[c+( "jn隠hfn+ih{$p' pHg}c{c;0 ,gH P+K╳K⫷Kfk`fl`kd.,P% P0dc<]ha[<0*ad hn;'0# 09dKg(,` nh $ T0 \$ g{ g+id+.g " (h d;h n+' " 빠dKg{(p'0ph$dKP:nPnP( fkꪉa` tЍG-`p 1?@10@Pd00U0T?WP@0P\@0W*U@(PU(pG  G2F  .F C0dW*0@-P@!1 0 M0 000" " " ? @ aR a# #0#4 B0 T  0E,̠S,ĠD 80 0 0 30` Ѝ0@L (RĤ LQQk) 00 Rv) xB@-d @4  R  *4 8/8 t0 S@- du@ 4 *8 R РS /,%zxBM Ѝ/+S$# /0/--M  Ѝ Ѝ/0 5 0c  qp@bH ^H`(00UH0@@QP#@IH EH`(00R0 00//H@-M Pp @<`P`W0D>S 0!31000 ;Ѝ>SH 0!31000J00J00LH/-p@-MP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( lG |: =Q-C #XA\#\ !  +A qR   R  +S -S =S000@Rh-+@"      000000 0@-A @0RuS#WSRX0CSH6 ,0!0R \PSPQP\     0 T 0+S -S0I@O-`VLM 0`8@ (P(0,00040.p & `I @ -DI@T2h7 `000000$  0pa0HSvctsrqp<nmlkjih/fedcb,fI00cI0@^I`@LЍS!  "=X  R"   P:0$`HI @ $C@I R$ "@`0 偡   Y 0 S:$`&I@ $CI0S$ 0"0C`ኡ0W X  0 0X ,X +X@ 0-S=X000$00 0|P @X B R񏐕~|{d]hvc`S  Z0$`H P YCH RV$ "@`0 偡   , =Xx +0H?oY20S ZrW 00 X00 Z$`HP %CH0S"$0 ""@` 傡 0T 000 ~W  z ;xI?vI0t0rW  n |0S 0 S3*-P"+  @ LЍp'}C~p=X   00$`+HP B#H0S $0""@ `Ⴁvq$`H P $B H0S" B`01DsP{G00LЍXp+P-@ 0 +0B XR R  +0B 0+R XR  -R  X@PPQpxC @-0@ M  @b1p`ЍP 0 @-KG/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`q6P+m6U PU  0  tP@P PPrq\P \000p@400G0PGP  p@-0P@`T @T0rS Ppp@P0+Spp@qo,p@-@PrQ` 0  P<0P0 `@p0  PD0@-hA M@0 @c0P0 <100S'<@p@( P << 00 00S3000 ЍQ0 0 @/F@<d0 00S d3,*nF00@ Ѝ(#7t ؀ ܀ 8@-@ `0 0$0 0,001#‚0! 0`1R101R"?01> P0(00"P!40:,10`0d0(00P40/d0(00 rP40&)@00Z0P%Q5A0$0A``0@E0,0 `0@p  0 q`M`M`K2@tx P GzGL  l P  SQ Ā O-0@PMQ:Uf ` V# V* V U 0T STЍU` V V V ^?@ T @P00P`岀pX```` `& `X `p0 Up`0岀X 0 SU:0S#pP0Q P 0관` X?[*!]-gE@-0 M0M040K0s0S0 0@ $03/P H0 0 4 30 ۍЍoPT**G-`P``a V00 "5E@P5 pPI 0SH 0p R0CÐP0P1 U  |\   1`V*o`CqnpP Y  !B C 0   1  O--``ş MMMčDş尠 UEp` 0BT/*0U@@ R R0 0C?o2 000TU$00 S0E0 %0S}0000Sl`0+(0:(0 @(0 2/Z(0 0@ 40000:0F,0 03/P   0S00*  0.S 0 S R V: R R   (0P8 (0* R $ (0TP(0 , CQ/ 31 C10 0 0 P000$0 000S  0P80: S 0p" $2 MލЍ Rv 0 r R u P jEZ(0w@T  r R c0B 04/P 0 000c$0 00 P05 k 0.Sh0SS 0.SbO Rh  0@ 0)  2/0S  00.S8 G (0Ps (0 C 0 &P% 0 0A 0RtC0$ `YA / 0 (h(*p %G-llŸ KMMč\`pؔܤ1 //\P  @P\/\   W!1 0 4 30mKލЍR8/\3^*`PW0/\ \@ @PP 0   R  = V/R * R( R 0 0 00`  0P&K r R @ (03/P 0: SW/0 0Ɓ Ɓ TA/0 P0P#p"O-@ğM $M; ~R0`PM 0 pR  ᘤ嘴*R1 r 0 @ R ?R! [R!^ 0S0 R@000WS 0GZ 0< S L@V 0, @Ⲡ \< 0 0\S 0Ჰ@ 0  p G0 R/R00B0 4[S 0G*0; P4S 0 0CPJR*0S0;R{ W @G 0Gz +@PV t"; 0 2 ۍ$Ѝ@P 0Dj Sq 0]S2!^020 ]R0  r -R0]S` s0010 ]R0 @, ! ;   LXn \Rk0LXh 0\Se0@* 0Q 0A  001A0 ;+Q Y;P\@0  p30Pd0G*0 ;;PU 00 [0!^0 0@0SJT@ax ?**[!-]l O-MMQ@`P8x9  @ ^80S @}\ \ [\ {\^! N\]\@ \  ~ލЍ @ ]RRR @ Q+[S0 S]S*S [0 {S &,S^Z ' B0S00 &0[ 00ލЍ0]SS 0]SS }S^NZ  J B   7  A- 0` PpM 0 S +{\ @ \ {\@0 pGP  Ѝ Ѝ0}S0S ЍA> 0 @-M Mp      `KP ^    ލ Ѝ`\ [ \T@T@I\@L @Tލ Ѝ\@p@-`Pp@0T1@D 0CP@DP t000p0S. *S9 ?0Cs R#S 1  \0S /Q0 S 00 /@-0SD @#S@7 S S$ S" 00S "S0. ^ \S 0000S\  00"S 00 CR S 000   0@-QM M 0P 0 0@050 0'p @EO0  0P0 p \0 0 5 30 Qލ Ѝ0D04 P 0Lh hg j spi |sG-pepM` p #S$%=0 P@$ 0S %P @ 0Sf=0SЍt `p+0@S 00 40   0Sy ltlpp0fS0fS 000#3R0 $ 0000@SX 0oS 0oS0nS 000#3R0 # 000 25P 000#3R0 \# 000H 5P 000#3R0 # 000 5P( 000#3R05 " 000 0#S RP@0 S00+P0@@0Ѝ0 S SD 4P 000#3R0 " 0@00o 4P  4P0 000#3R0' ! 0 00RŵЍ 000#3R0 P! 000<< 0@S 0 4@  4P =Qz+0P0 o4P=Q 0 @0 0 ྜྷ ]+0P04sxrDrf e qXqq`d pd Tp,pXc oc b ob nb Hna na a m0A-0 `R % <PpPpr@P 9P $P 0S 0P@ p0'@0000@'@ g0 UT@=' R P@ᐺ$]:00 '0'T:Z0ST 0 H:00  9V   Pᐺ0S @1:00'0'P*:P0@W0 0X H30 0@0@ ' 3 0 00  " @'@2 0 00  " @'@0'0ap84M 0000Pil b0S 900'0咽'@9@ )Pw {i K@' `*y9000`00T 0SCP @@ H/x0@' 0@0@<  !@' 600PP800P40@,@A0 9Y0 P @ᐺ0K P@ᐺF0S0  ' `00C0  '  P㐺@( P㐺@# P㐺@H@{  P^ hY L^ ` X @ W V V 0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpFpP xP ЍpbaA-@@0`S&@@Q)pPpPS @TP  ᕽp @BAQA3M0@0 Ⴝp zp ahaLaHap@-p`pP`P@T T0T0 R@@}p#P00r괝t`X`A-P@P`@pd0S |@@4 R"@`VW1@P0080@C(__@-ɼ 00 0_C-`\MPE,@P- 0S|00V $"$ UpЍ `0P  $ R%pȁYTǙ  0N|㠁0໙ෙ|xxౙ0R1 0QG Br&Q&R-.4 p0ሀ Wtq{\ SzڙHvR v R ^^4P200xS0xS0Sc 0P" $2 Aލ ЍdR @P\ Pk 0S 8200#SB \ P 0S 2R0P\ PV 0S 100xS0xS0S 10 0sS(0wS%0S"x! t1tQ0P \ 0P 0S i@10\ 0P 0S ui!0 ! 00P00 $0 000 00r3PP X\P P\[t[O 8[O ZZZ|Z YM DYYXM XX( dXL ,XWK WWK K WW p@-hPP0S P@L@@p@`@` 4P@VVJ HL X A-P@P0 $S Zppp@3P Q0Pp<`<`ePpR(VVI K A-P@P0 $S -ppp3P $0Pp<`<`8Pp%tUTU8I J 0p@-dPP 4P pD`D`P@ ppTH `J l @-@@P00DTO-ş,MS 0 w ph5@0`\5000000000T 0PA  0|0?S SQ *S T 00  *Q .Y Q /Q0S $pP [S7 \S0 Sp 0T ≐  R?\{ \ *\ p[\ \\0 SpQ 0 0sY,ЍYj /Y T lP^\!\00 $0 00P /S \S U T0  0SC -R X0 T ᱰ0]SZ$0PS * pe fT ⊠Ằ Q]Q \Q A X XY /Y( .Y)0S& 0W 0S 0W/S,Ѝ/Y00  0S9 0W 0S3 0W/S00Sp0ST q UT  ᲠQ p*P [Yp Q ;0C 0T 00Y 0 P+/Y[ & 0# /o#PT@0P@-@ P ;4 0 Q 4QFoaB B p@-@`P;1P L51PT00pT00p 4 0 pHB 8B O--0 Ÿ M opb @T ` !1 0 2 30]ߍ2PW 0  NpL  &`P: 0S;p 0 0P`P* @@0  9p@ 0  P0PpW*P<  ?0 "C 0 p@003`-0P0000`q0 `0HO--0 Ÿ M pb @T ` !1 0 2 30]ߍPW 0  ῷpL  `P: 0S;p 0 0P`P* @@0  ᪷p@ 0  P0PpW*P< 1 ?0 "C 0 ቷp@003`-0P0000`0 `0|O--0 Ÿ M Qpb @T `t r!1 0 2 30]ߍPW 0  0pL  `P: 0S;p 0 0Pk`P* @@0  p@ 0  P0PpW*P<  ?0 "C 0 p@00u2`-0P0000`Y0 `0Lp@-T@0`P@ P0P0S StP pL; p@-T@0`P@ 0P0S S[P p: p@-T@0`P@ 60P0S SBP p: 0 00 ŵ-H- M0S000 0 00  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/<-H- M0S000 0 00  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/P -- M0 0'--M  --M  %A-`ppQpP @Q IPD@0 0000@A4d0P R   0//O-- ǟ 7 p*`3C00 2#8"0x3@00 2#(`3& 00a#(2H3* 00@#(203. 00p#(332 00: `,  R D= 0sq[@D   1-)%!p     p  ( p    R   $p ,pD 0 p  D PNDr 0@1q00p`H2#8Ẉ"0\p  !@p0@0t@5T0dAd1@ 00PL!x0 0 40 30<Ѝ p  1!0 ,PX00X0~FpFFh6 T6 X 6 6 xE0 8E< 5 Dd5 DD5 (D4 XD@Du D4 Cd4 C<4 C4 `C3 4C$2 C3 Bl3 T3 B83 3 3 2 x1 @\@WEV\?P0 p@-@PA 0S, /+@T :T7 0R/Q T&*0CT$ /R0C0C/QT :0 BPU0P!T0l0p`@@PX; 808@/S@0@@(@@@??0 ?l A-M`P*XA0P@D L!0C p0 00   $! 0b0C S1;/.-,2*)(4&.p.0 0@S` 0S 0S.0"S D(Ѝ T1r0:. 0 Ѝ Sp@-PP7 0S0 {*@U3 0U.  /Q0C U!@# *0P/S@ B=>@T@!|P;P 00pUP0 B@T@!8@,@0@/SAL < @i 0{-DM  {000嗲p 800S DЍp@-`Pp@ P Mqp V U ph ˱p` ᧲ᤲᡲVѱ@@l, h Q?o?o 0C-@c^?c%^& ^ `pCc&Pc268270EG2&1H01. "0;:(0C0 /0 @- /? P!Q/o/o G-@b^?b'^( ^ @pBb&`b4')4(0VX4G1Y 1. "1;:( B0 /0 @- /k{  0 +C 0/A0C0C [k{ 0{+C{7 Q/A0C0C J@ @-p A J@ @-p Jm@ @-jp Jb@ @-_pP `ݰ@-/-00?0/R//R/?0S/R/P/R/p@-PMP`V r@T 00%Ѝp{ : { p@`($ g h?4?' 00 R yѱ>,@--00 0S@_|h> /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  `Q0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`K(@ \;P PXY  P @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍ賹PP @@ @t0(@$0庹4O-鰏DMP`00 0P0? 000 00S 4 T/ @p%S{ @0@ R0`S 00S S 00(4/!/#b!!"AK/ "bQ3:bQ#3P . ! P0 00 0 0 #>1?3c112AK? .## .cR 3:.cR # 3 00 0010!00C0 0 0@ 0R PR0<R0@@mWjp%0KUSd,ba`_^]\[ZYXWVUTSRQPONMLKJIHqTy-;(>=<:87 -,+*)(Q4ih".{s(b 00 000; 0`0P `DЍ0@@0@000@0(p,P8 h0$ @PCp& 9P @ T$0S* $ 0(p0,P$00@PCp& 9P @T$0S $ 0 `0 00 0V$/z[0@$ 000 GR +Rk -R 0400``PW:S 2a2c2SOR0c$000` 0(050 4`0tU0[04000000 @Wd0`nW`pW\ 0, 0 09 0I`0 844 40W0C`00B 00 0c0 4`0@0@0W%S0NW-|=0 `0r WD;0  0 p0p S00W0 0` 0 0 0U0 ^`0 0 0 0000 M`0 00 07c0 4@0`S0G 0X4 ?2c111400 00 0000 404c0#0`S400111v>C 0C40 &!/"b!!!A0400 0@@0@000000C S0`0`0W0= 0@h% @y8P ^%@  o8P` 0 0` Rv40W010 oWm 0 0` S0pYWW_ 0`0N00J50 4`0  044 400C`00> 00 0440 4440v>C 0C`00+ 00 0x40 40\$/A!b!b0C`00* W 0  0 0  RM 0s 0 0@0 0 0vP@ @ P)` @aJaj B  B0 UR ZRU R   @K 04# @ ( 0$04`L(p,P@ `W0` (p,P@ `W0` "!/#b!!"A0K/ XX"TbQ:L2bS0#03 p"10 !A 0  40DSd040ռ0 MR[ 0@^  @Q 0 "#^  z K/o "0P8 0`0000C/< 800A Q`A`0PQ0N#όF0 0  D[ 0 80< 0A Q 8P 00`0 0@z[3 0@P 0 TR RO ` @D0 CR :ȵP)\(\ ף4# |" Qt n  l'$IX ] QA ALA|r` \V6JQu8 @ 00 (0b$0 00\00C4PN00P01?2c 1A;S40`2ca12B @0@000@V@ A\N A R$ M a@000"b"b"$ (0(p,P$`(p,P$`40 @' R$ @  R 00@ `p40 `$ 0P$ @0004 0C$0(`0 0`$0P$  @000 4 0C$00!0(0~ ` 0 P 40@! 020( 000c$0i 0 0 0<갹p@-1 00M0,00`P @  P00Q Q Q ' 0 |t  , 2 0Ѝp H30 4-0  '0됹t,t,t,0@P/ P @/G-X# `p"V@P0PES  R  D 0PEV R  SS0@0D@R@- 0BAs@ @Q 0CR _&@O-` MVP0 A @P;  PpP< n"0p01S Y Ѝ0$0P P 0 0P 0 0 &=00 W& 0  RQ0@- M@@  PP TU =&0P Ѝ0 Ѝ03& 0 Ѝ0G- MMōhh P N`p Pɩp> @P<@ X0^00pAtA嶲0O00 TAXA\A6 q$@P0,  (@ @'@P P t `0 0 5 30ݍЍ@%0@0%0@0X040   ꬳ--M  Ѝ Ѝ/ -- M0 0| ЍЍ/O-,R @p` M R00?y00P @ P )00 P! !  :1XP<   VP WE V[X0 SPpp` `2(!(1 00w Ѝ`᩵pP2 PPSPpp`000XP C0PP00 O Ѝ `f` }pP V vpP `0\@-@ M"(0S2 0 `0( `1/qpPp0  0 0 PUR <0PU ЍPPTp 0S  0CPP$0p0@-P M(0S< F0 #p0( p1/qp@`03  0 0 @ToR <0@To1`VP ЍP@T` 0S  0C@o$T 0 $ 0 0 R/p@- @Tp0 Rp0 0R0  P 0S P0 c ( 0P0 0 S,P 4P 8P p@eEp@-@$PPQp@K@- @@Q@hKp@-,PPٰ R@Ұp4KA-M 1!00P00S   0 XR  0S= `@@p@ X8 CR78!0A0 S0Q\-*L\)\ ' 0 r SX   "Q \ #R.Sa A  00C "\ #R Ѝ`0@ج4  R  *4 8/ 0X\S 040:8 R РS /PxB@-@`PLpL0ppD尀 ᧶T   sK뀪 - MP@ X# 0Dp@-H @| PPPp P pq`PP4xo FqeT00p00 u00p70000   70Fs0 00Fs0 20p# \QP%Ao&Ao=Ao#4`p 0 0   & 0W0Cs0;V 60000l 0!00C0``p0?Q00p Ve =V_ Va 0`0p00 G 00Fs00W0Cs0 0p V VK 50000 . , 00F70Fs00p,̰D P501 0@S;V cQ00e`sdQ 1\ 01 0SS10 0S0U4000p00FQ00100C0p00FS*0100C0p-Q ^Q00p 0AnS~|{zyxwvutsrqponmlkjihgfedtba`_^]\[ZYXba`_^]\[ONMLKJIHGFEDCWA@?>=<;c9876543210/.-,O*('E?$#"m `WQKD>#V 00 @@000p2000N 0`0p00`F`0p00p00p00p00p\00p00p00p 00p 00p 00p 00p 00p 00pcQPdQ00ppdQ 00pp0<00p 00p00pp00p @00p00p 00p T O-`pMWP 2 @ P@ 0  DR6 \L 00pW @U 00  0 Ѝ 0S S Q  0E   0 S0\ 0 0L0  0 0  00  AL A-q@pP`Ui !4"#12b! DqW7 0S$ RP QP0S! 1003/P P $@00W L!P0 $@ ϲ0V0 P100S) 3/000PP0S 000S) 3/000(㺰p000p3/P WPVSP 000SL峱P0P000p/>3X=t <L <\<=A-q@p P`Uh !4#3b!b DqW7 0S$ RP QP0S! 10 03/P P $@900W L!P0 $@ D0V0 P100S) 3/000PP0S 000S) 3/000(/p00 0p3/P WPVSP 000S(P0P 000@  ,;H : h:0:A-PP} @`Py qpPg  00Rc<!"#b!0CaqV- pW PWV $00dqp0ST100S004 ,1003/P0 0$0 00``0S 000S+ 3/000(㢯P`0003/P 003/0000S P困P0000 />3l 88487=A-PP| @`Px qp Pf  00Rc<!#b!b0CaqV- pW PWV $00dqp0ST100S004 ,1003/P0 0$0 00``0S 000S+ 3/000(P`0003/P 003/000$0S  P 0$0004|6L655SR: G-P0`00Sp 3/0Y @IOP  T 00 00 Y @IOP  T P00 D0D 0 p`P/4xD4<4SR; G-P0`00Sp 3/00 Y @IP ΰ T 00 00  Y @IP T P00 D0D 0 p` P$/3\$3A-@P QP P@`p\Pᰯ0`P ሢPpW 0"S ~@00@`O-PM M Q0` 0 Q /Q P.00F PPەۅPp/Q/ Qp @0/SS.Q6 0E00 0C S"/0  D0[0 I  0疢p  0: S+  S/ A/o" R_/Q Py?0V0/0000 ލ Ѝ DR .QRV  u/R0W03ʨ !0Pu5 0-0 Q)0 (/QPpPVP/0000ލ Ѝ ㆭ`P `c(00$>00 00?0000 A-Da@P`: 00QP0XP= 0p0W& 10pp:W@^ 0 \S 0@ S @ 0:Sp@:W W0 0T0P i <00 0 0Ԑ0P/:P-0 S\ S:RS0@S0 S S@\ :R \:\0P:P 000/,0@-A@\  \:^|^00^0S R B|S0 0:SS O--ǟMM t<č!^pĝ  ^ TG@`V 0P0(  ㍬@P 00S < [ & n0 00 P@ 0彟Pv00 ` R0Pp`0 S Wp :S \Sp S Spp p0Ui*R0+  Ꮯ P 0`0 SWZpP 0#SS  ]P 500S0 005@0:,0:= pP 0:R@h @R0t400 0p4WP/ pP* p):00d00Z  0S m900i:SZ P0U:H KP PE @P4 0:R` ` R,0 F C 00SpG:S:0D 0 I0HZ 0 E0v r04 P@C00DpTpPETgH PEpG@DP Pp@@0S $ E0AU0: 0@#2 0 <4 30ݍЍ0 0 09جP@P c@P} Ὡ|2P00PS0-0`S噭`0SRM 0@卭@00 ᝞  噞 :Py  4p,@00  `6/p P0003/004`X80,`0C0000 p @P  03/P$0p0H?o20 0@m 0 @3@c03/ 0  0Z%0S 4 m0Sv 00 , ) T* P'@-@M0 Ѝ@-4@@ P Q0 000 O-ß3 M0 MȍC\@ 0夓S p` S P@T 0S l @P 00 C R 830000#30:Q0#Q0S(  0R\Sz 2@0T  P P 0 0P0 :P  20   >0S00S\S00 R{AP8 0S7\S5 00S1 :S000 0 Sc4S\ A 00S :S|S@0@ A@L0S't!D1 0 8 30H ލ Ѝ  (@P 00 C 10 Y P @P { @@PP P r @ 00   0ඬP 50 0Pm S @j=븅tT0 8$h 0@-TP@P 0 MS 00 0 00   Ѝ0@TG-`= iPP dq@P 0:SS   d: p \SP0* Q@ 0:SS ^S 0S:S 0Q0P@ @B d⴪P 0:SSd@ 0Q BPA0n0S:S 0Cp\6BC2PBYU?PK<;:9876?432802.-,+*)('&%$#"950+000Cs^/000Cs\P& P0 0 P0} Ppz 0 P0v 0 P0r Po Pl0 P0h @2P P PP P P|Z 0P0wA-P= `P7 d㦨pP9 0S:S@@c0%0:SS   \0@AdP pdA\ @Ap`pP@`@@ᶪ@ 0@0p@-P# UP 0Q @0XS@@<,00As ^a ARA0AW0AS70ATppO- AM Mhßh3 00(0 00SK @`p0/04 PPO P8T   w00CS4%210/.x,+*)'&%$#"    4$` 0:S 84St0S00"2 0 (0 30s KL P( BKI8T 0:SSa0㼡44 440$0<4 0 S BKJ;4$ |/ 44$0C 0$C0$ <4$0C 0$CPu04BK I8  S:S1 R5 0B44 R0  0R!0100M P@@ ՚0:S084   00ULPhH000044 (|,  z| \- h + 0 00 x-H-M0S000 0 0 0@  00^100M 0 @R0    R L00 x@ 00 0 0 30KH Ѝ/Tx 0 3 30 ߍ P0 P 0 0C 0 S 0 B `0 zR0ePLKJi\~}|{yxgvutsr0p,+*geI`\[Yu``YBR000`0C0 KPB 0S 00 0@@00S0  @DT>< 1P0 <P 00CS0000@ 0D S*v0L0 S00D0 0`I @ 0L` H4  BPR '+[ 0vpC0Z M:PWp! 0jPP P`p + @MR^V\TZYBNMNMLKJIH654321A@?>=<;:9876543213/.-,+*)(!  XM P 00CS0!000pWP0 NS XR    0 $ 0$        00 0P0 0C0000 S000@XT @0 RP0@ S0 B0 0 R 1P00S000000S0N >. #RR 0@00T0C0 0 >. #RR 0000C T0 S P Y 0 00+ E  P BR  X *@PNU 0U0P0CS00X 00R*@P XR P@P9R*P  P0@@40 o P<D0U0S00CE SP00[ *@@ @P0ESH 40SH  P  0@0CSPH00 4000T0y: `8 <@DV*T /T0`0 @Vj 0$0P0  P m$00 p400S P0Su 0$P0 00000S @0P0CS00T 00*@P+ E P BR  X =* @P  P @0P0CS0 0IU0P0CS00X 00*@PW(  R H  R~WW  BRp P n 0@@N 刀WiU nU0P0CS0z0X 00*@P RP. ARJp P BR @ p; P:W8*@0P(U P BR  @p$ PW*@0P NRp P BR  @p 00@<00 0E@ @@HꈀX     SL00@900 0( 00  $  0$  㰀   +  00 p Xo h D X< ( 0 G P 0 0C 0 S )P `00@00   >00@<000 0P0^U@@00P080800,H0`U 0$40A4 >>0@<@pD#C8`0-S ]Sn Sb P4 >>08`#C * 00000@ 000 0@ 0   +   +    )     00@90 0 0q *  + 000@ 0b0 0@0\ @40S@@@XL  M PL @PS40bS9 > P 0@0CSPH00 00 0P0CS00R-*P00 bP P0  P1 0P0CS00[ *P 4X v P 40@04X j P  P00CS00R*PdSꋢ?L00v0D0@` PT* 0 P@@0P0CS00T *P009 PT*0PXp`pT$0TPP$0`5000  00S0P0S(@T 0@0 0$@P >. #RR  PR  B   P 00@ P0>>03SS 0PU0C0000P000- 0S P PYT Q 0$@0 0000C P0LP00@0 4 P4 R*0P }PX*0 @PK o  oP R*0P00Yi_SP00[ * @P$@`PPP0 _ P 0C0P0P `V  0S ;P 0$@0 0P0 P0PC ,PT*0@PS$0lxPp$00400pTPX` % P 0  B0>>@I  vq0 ֡p P p0S P0SYx4Y 0S0 00 0 ἡp 巡>>3PS 0S0P0C040p0400S PkXi*0P0@0 0 ? ᾡP; 0 @0>>` BF vo  0 op0# P p R`80<@pD00@ 00=<@pD`P 40uP40 S@ 0@00! iPyXw*0@PX _PoXm*@0P$00 Pi$00 HPX*0P@o =P[*0P 800C0800]S0  ,0 uP  0PP80p0H`80v`Yp w PP0 0 P400P PT*0P003 PXZ: `8 >@p G * 0 v⏟pD P)YPE* 0pS,U PU RP0 T P@DP UbH0@P0C 0P Wp YPE`0pS zP W P  0@-@P M 0*0 .0@* Ѝ00@-@ M@P  0P0@ Ѝ0L2pA-0P7 !@00S5 0`1S010g C000PuP! pW@0PA ም`PS 0 00 @ C PC0000  Q  Q*RQ) <00@8 BP0P00`0s0 ڛP + B ?#A 0#@ # B0 P\Lp@-@Pw {0@xp@- $ M0@4/@PЍD @Ѝ@-X0 T0M0$@ 4/@PЍ* @ЍI@-0M$̓0 $@ 4/@P Ѝ @ Ѝ@-@0\ \  M $, $@4/@P Ѝ @ ЍH@-0M$̓0 (@ 4/@P Ѝ @ Ѝ@-@0\ \  M $, (@4/@P Ѝ @ ЍG@-0M$̓0 4@ 4/@P Ѝ @ Ѝ@-@0\ \  M $, 4@4/@P Ѝ @ ЍGO-M@DX@P`p# 0SP 0$,  ;/0$ 0H@ 4/@PЍT @Ѝ$ @-$$@M ЍE@- $ M08@4/@PЍ- @Ѝ@-X0 T0M0$8@ 4/@PЍ @Ѝ@E@-@`pPktt0l尀 8T  @0 @$ %ҚD P 0fO-,M`PP pE0P@0 p00EPs00D5ʿ000 0   @0 0! B b190Bp   U\ @ 04B@3A0S0 vTvtsrqpogfedcba`_^]\[ZYXWVTSR]PONMLKJIHGFQDCBA@?>=<;:9876543210/.-,+*)4'&%$#"! #       0 Dr R R Q  R \00t0!#300@ 00@00 @0`PUF*,Ѝ R\ 0M$ 0ԛ$ P 0` S^?0@00 0  ӛP 0J ZS 0  0J ZS 0-00d10000 ,Ѝ0\r  `0\s  `0\a  `0\ S00 0 0``0\b  `0\t  `0\n  `0\v  `0\f  `} @qP 0` [0\  @`p DA- Q@Pp`! {P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0 P0 Af` A-@P`Pp$T0 pAQ_T !T '0DS%(0$"0@ !1 0 O--TTǟ UML<ǟS 0Ppခ儡<  s@n0P(0 b`f0P,0 0S0080o 9P40 H  T. (`000P@Tp` U T 1 # 00P?0S0d PjP P5%0 f(0@FDA T @! D`0P$0 0 :[40S V D0$ 0C BP$0  ? *H500R  ` '$50$0R` 00` 00` 00 `"00@`\00000 tpT0 (`,$@T+ 0 7/PQ0@0$,(8$$3 0 L1 30Uߍ<0SP=<;:9V@DS3/.-+)(5h[$zxD B)Q [n (-= 0 |0 30zЍBϠl4 @0 P $08, ##,cR:,c2S <  @@ 00CL``C@ @r  ^^A!/3b112A0<  ̟# cPp<5: cP` ;0!3b112A0  K0 S 0! [ K 0P Qd; Q00dP  = [ 0 S  R  |;  B2:Q/0A!b0dP   [ 0 S  R   0  ``: Q00dP   [ 0[  R   0  `m 9 Q00dP  Ї [~ 0 Sy  R sd)d9!/ b !Q Q00dP  ᱇ [_ 0[Z  R T8 Q00dP  ᙇ [G 0 SB  R < 0   ` 00 S00C  B8Q2@80/A!b0dP  j [ 0 S  R   1 '(0 dP0  P [ 0 S  R  1 p'0 dP0  7 [ 0 S  R  [ 00[006 Q0 0dP   [ 0 S  R 0 01?2c 1 R11Aãd0Sâ/d0CS0c0(6dP 0 [ 0 S  R  08  8   `W80S0 R05s0dP0|5 0ຆ [h 0 Sc  R ] 0 0  `.Q0dPS004 0 [D 0 S?  R 9 [7 00[^0  0  `$ 0S!8 ɂqp   4qp 0P 0# S! -R? S30 [ K  S Q X1 "`aa!B! #<0 dP0    0[ 0 S  R   0  `4   0  `z`0  0S0  PƀP u [ 0 S  R mPw0` 4m0 S  1h [e K 0P^ QX0S 1 [P K 0RI QCUP 1 00 dP!/ b !Q    | [* 02Q8lP)\(\ ףmY Y J X LJ W *`W W LV U tU T ] xZ R Y DR TQ P B B N dM L n: : 4: (: $IS I HI $I S  R  1 h 0 dP0  3 [ 0 S  R  8  0L08008<00dP@0 0D00H00L0 0X0s!  [ 0 S  R  0l0 S0Cڜ [ K 0R Q0S  [ 0 S  R UPUP 4B28" @ $08VS_ gS 0 `^ " " N"N Ϡ$0B!l0 8 <40c1?2c!1!1!L1A0#/"b!!P1C  ã/ d0 S  à/d0CS0c0h3dP 0m [ 0[  R oIP 3Q00dP  O [ 0 S  R (4`0?Н<.<$+d $0< 1|$<0 0  d#A- M`@P00p<0@0008 0@pPP T p0E Ѝ" 0 ЍT 0 @-$$@M ЍA-p`P\@\@M ~@0@0  0 @~Ѝx8A-@P`\p\pM ~~@0( 0  0 `@~Ѝ4x8X0P @-DQ4h  ೝG h0P@-X  S H@ @J0( (@ THT8TF Tl0R0 @-\@0@PQ 0 0 0R B/ t000S 0 00 9/`-  0  ^^$  00~HmNA~0 0 A-`pAQq@"0F P啀0Ch@12c` P@RH00p`PPUTp`~~_ N~p@-HP@P 5}0S,000@ p@ )}}}|G- p P@`} `FR00C0A10 0USU 10p   t |?U0T!P 000<10 j100 C0B100UU$0 P 0000 0 P 00000@ ` |0h P 00?0P00, |T}D|||{||\|t{|<{{{zp{G-@0`萟&䀟 P #Qp| PFR00C0A10  00 0UPQ@pG@P H06&```8800A @T|Xzz,A zzyPP 0 (07,00S 3/DЍ Ds00,00(3/  PP 0S /A-M $P@0P ـ00 `pP {Ѝ00pO-lhyM(p`z4PP  s@Pp 2 z20 RG z0!$@ !  00r0 4L  00 0. $(p,`; PR 80 03/0`0`6P"  !0 0 1 303yߍ         f=P 97Pf-P``free<9 p9 H9 09 9 9 P00/ wp@- 0VM 0PP0T10ƙp" 0P1r@r ` r0P`` S 0!< ,0 0 T1 30Vߍp&<vp@-MP@]`P`Ѝp o_P ]P  ]P 00 0  PPO-p`@(,]PP pW0SP[5 WP) @ :/@PWP0S 'S[ WPPW :~P@@ f Pb00P WPH6 6 G-`R p@P8/PP @VG-!1 0M@Q000`PR UH U .0P0!1 0 0 30\Ѝ 0p ) P00S00 0@qPP  05qPP ,q0PSYUp$0T  )qPLp0 Pp0ꀀp qpP 0 @P~0 00pP,/ B/0  Q B  /0S 3 %0C  0% %//Q0 / 0R  B 1 // 0R  B  2/ // 0R  B 1  // 0R  B  2/ //0S :p@-@P0C0 P Pp/0p@-S@ :P0C0  P Ppp0$00$00  /00Ꜷ|p@-P@%]P 0S S pp@]\P p@[p@-P@ ]Pp> (]P  \P 0S S[P p@[p0p@/p@-P@\Pp >p@] \0@- MP@[P Ѝ0\P 0S00 O]0 00 S /p@-P@[Pp\P [P  [P p@[0S S  /0S0/ R R 0 /0 0 /0  0/ CR  0  0/ 00/ 00/ 00/0 / @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030p< VP7 -YP uP (! 1 0 3 30?ߍ(3@ R. R  0 o| p0S 0% p 0 | 0 W|  RP R , + O-DIM@4MI͍,,J͍@Pp P0`S S  p4,$I= ,0 2 Iݍ4Ѝ RJ- RW# " "  J= 00岠p} #Kz0 { J=00PkJ=  00SO S UVW J= 00p,:03 00'$000J0 40RP @'0Sk0S  0S0s S0S UVJ= 0 % J= 00pfYY O < UP^ /P xo03?"R<UVJ= 0 p`p^pZ<0K8 J- 0% $ 0Po J=00P00J= 0>0oS Sp#< lJ͍ 0 pp p 00SVL2Sp S SJ= 00Y0  /UP pJ͍ kPp꺔hd* * )  8' O-ğ MQdH4@0P0CS,p6)('&%$#"! 9 QVW00 R04 0S SQj#3 0 0 30Ѝ#3 0 0 300 HDp@`ЍOoVW7 0 L#? s0z`P#T!0SN0S ? /r "s0 DzPT QVW00RTD`XT 00" 0 jz W* FP00Sz "0 RzT@@? 00!D DzPT`!0 7ziT 1i #Qc0|||Pp`P 0X! 0 zP030#?Vp@D `0V0 0 zP030#?p@D0Q0 p0ĠĐp `pP0 W 0`@Dm    yT00? \  y|먿t$ p$ # # 0# # |4 " ; " 3 ! : ! G-p 0 FM& P@`p 'P  RW  tP Wr`ov` ,0@Sp0 0 0 1 303Fߍ000 00ϿJ 00  0P Y: /r RX 0S 'P 0 D눺0@-P@ M 0 z 0P  Ѝ0W Ѝ0p@-MP`P@@P@T 0S  R0S P4@PЍpP,PЍpp@-@pPpPp0. AASq0C .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0R00@-d!$M""00(  AS0 0S  R lQ  hQR 0S0\000$Ѝ0\ 0S S!0S.  R  R R R0 S 0/0S S S S S00@-/ 0  00S S00/ 000S00/00S 0@-P M@Pz0 PE@r0S0S 0S Ѝ0/O--0BM4M@ 0ȍ,ŸP @,p$01 0`(0000` ``   P:1000 0fP@ 1[ 1#V 01  8 SP 0 00 000 08~ P X0 08,01'؍4Ѝ 0?sQ s0 0PU 0S $0S S S xX0 0 0$0걐nX0 0iX0 0dX$0 0 @xA- `AM č@pVP zPPU( 0@` v & 0 0 4 30Aލh0 RP P@ .R@ A>PdEX 0 UT ̮A-x!x1 0 M0000S@> S0  0` V" p PQ 0S @ T S   0S QRp`V| t0 0 0 30 Ѝ P0 0 0`V     @-`QM @QPp Q Ѝ RR _PP)p0U R R  P0R  Ѝ  R RD0 P 0  t=< G-`@ puPP   @ @ !UO--l lM4M`-,, @ &\8  $PP40'&< 00ZY!SP< &< 00S &< 00S 80 0*0?s0SP_ : _n0 0F 0_VpP00  03/P &< 00 SS00&, R0S00j  P0<040uPUpE [P㐪7,@0D0>@PH0(P$`0 Z PE 0  P V@P_00  03/PV @V 0`0VVX00S V- &< 00SVVV !VT V <s!P0S(0S <JV80C$0XD00S S80 C, 0 0SP, @0(PS$`C @T ؕ@ pPlp 9uT5 @0 0%|%x% %%  0000 00u[P ,0q0q R R 0   PR, uTU LE0S{ V00S @$= ,0 2 ݍ4ЍU0@0&< 00SS  F'VR1!pW: X:40 0 <r!PR0`S`V0  0$(%$50 5s (0S9 J80C?$0hRC.@t&< 0P@,#40%P@ av@00SB@tU00<:4Q 0< y u$0DRC.@%<0H  0 2 30ߍ0 0|0 S0$00 `P$$`H>00@,0(z `\ l6<2 L;20\0 |0 S   S  Q  RQPP  XPppWS|0R0Q0S P0^㄀Sg : P|Q ,0z 0S Q0zS %0P40 pᧉP8x 4 0 B pW0P00_X\ 40 4<@D@P@`XH 0S0pS 0S S 00S 3 `PT0  =`K R R R`0S0S;0S`V ;6`S0$00|0 P4<@@`D8o00SzXz\t0zS0SB x``=@H*H: 0 @*0 4 4*80` Y?,$@@ <0V 0 f362 F;2P |0SM0 S F SRCQ Q : \Q^3?oR20S Q`P0 `P04 00<080Pe?0001Z@P񏐑0S Y`V `tV`Y(@ Z 01P @0P0@TPU m0P0 h帠`nP 0 @@ P@ TPPnt0S 0S n t0 `0 |0/aP)_: =P| R (0z0S Rx0z0e  tP : !0P00z0S z`p,@$P00v`V0 $P,@P@@p 000 Pv`V  R R R`VR $@@`P }n{nV$@E 00Swr0 0`~`| 00 P 00 :0P00 z0`@P KnInXa`_ 0 0Q P  400V  R  A/o"\  P  R9 R T p`0 P 0 R   L" l1, 0S 8 008zm` kP  0 @@P`H`ZPkP HJH HT0 V@0T* m3z0:0$Pzt` P@ X`@o `Q輐0Y|0D Y0  00 : А _P ^P40D  L L0_P00D) 0|0 p0T SR S  ^  Q 003 Sኡ*0 S :0 SJ f^@$P1 0z0 "t0R005mPP @0T 0@+m@0T@$mt0+`zp,@$PDHh0 |, ! XyvL dIi . > w <_P1x00x0 l9P@0T00T0@lP z0`O-xxqLM @ p KPP0 0PF ``0S S S T@ P `0S `(0( (`P00 U `V`V 00 `V0S 00SU$@LЍT8 4 G-`M @ PtP p ` @v00 0 ~P <0S0- `ЍoPEl0 aP 4l@@DNP <`P,M 0 0 O--ttŸM  ! "4P ğ* $! ğa @#, P@dğD 0"0#P 0Hğc>  !,$P,$ʃ  $ "0P$a @ # " `!`&@ `ßj "! @ ßa  # ",@ ß$ 0&0# 0pßc> `!,`jD@LSPP"P%P8CeX@ @#@$@#D 0 ,l̈́ 0 !蒟$ `ab``P P%P"`X @ 00#@E0`ጒ`& `xŸfm   "0X"a 0P 0#PX0 ,, @(BŅ@` @@$@!D`dM 0 0#0a `̑`& P`VP0p: O0hV@Hp` E0S@@:p`F Ap@-@P0M0` 0 00 !? 7R8 bx b  D 80 0 0 30X Ѝp@~김p pG-L"L2 0M000424"00 P00 `p4 0R @  0XS@@ rY<0s000L T $. 0NrY)T  aA 0s00C 80BS,!1 0 0 30>Ѝ.R ^V* 00RP 0FS0 S S Q >Y00@^*0^0 48 <^*0 8<oon- M`P Ѝ@-L!L1@ 0,MT0$00 `pVP ?o2T0S9/o"T R @ 0 0 $0 30*,Ѝ @`!(0r @$0RV$B R T0 R ( $Q C ml A-@0`, rMX0P^ppAtA^`0O`00TAXA\A 0cP" 0 kpP 0@Ue0P 0d X0 0 1 30 rߍP f00z 0P0fkBj0   dj -- M0 0 ЍЍ/--, M0$ 0 Ѝ Ѝ/jp@- M@( Pt00h` 0`0 `P@@X@I0@KT  Ѝp@ i@-LL1 0M` !000Xp @P  : 1Xp V@ 0 0 0 30(ЍVP@pW @@T PU 0SP@DT?0@0~0iihp@-@P0fe(0Pce(P,P_e 0p0PP 0P 00 0p`00eP 00 0p$ ܽ   / 0@-@ 0 0u 0 0 0 ~ 0 00@- 0 MP @0e 00P 0 A?o20c Ѝ04 00 0 0p@-@P0 0U0 0pp@-@Pd0PPd(0Pd(P,PpG-`0PX p&PQ 0@00 S S0 S S dPP@ 00pZp P7 @P 0P00S S S@ 0AS A@PP 0S00 00cP  @cP0@@H O-@ 0`p M,0(S{: w(T_TppW 00SS 0QM@D@T0PH 00SD000@D@D0P0S- T0Y  0!0J@0PI 00S$0AS00l0  d0S000 Z  S0S& O0p@c0ppc(0pc(p,p>@ ЍbP  (,@(|0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0uP Ѝ04p 0$  $ 0 . Ѝ0O- @\ULMP$0  @@0塺P0F$03apPA  0@@咺P6$PPU 0`Q QB QR Q% 0U 00S{ aPb  `0 @ 0Vp R  R/ RY R 0 @Up+c 0J[I0 0 LЍ   @QA@  0U` (⼐p 0  ,  p0p 04`W G`@ @U@ 0 @bLЍ@ 0@bLЍ `^ P@Q  QA@ PU ^ QP @ p, 0S QARQ  R  P@ P@  A X% X X9 p X) T( QX X X0` `t`  `{ ` t  `Q@ @  P@U`9b 4bTO-P<`_ p$0[@(0` $pL0W,0N0-0(`` P `QJ`0c#UU`0* 0U'PS$Y:W' 0WV #((RP P54PE2PE1PE`S0PEg `PE:`uP4;P6 0 @a[030#W,0W030#-051-0%!0Y" #((RP P54PE2PE1PE`S0PEi 'PE8`uP09P P:04  P800 0@-MRp/ @Tp6 P0u0(04{ {@ߪ0@Rt 'U 0P  9P Ѝ000SЍ0uR 0 Ѝ0lR A-'Qp@D P`ᷗP0 A00 / @-\ ,@\ \ Q :\ :Ao 0 i 0 C-P$0@SME 0( P04 :C1I;p1 B$`00>1B- 0CIR0  R0000809L>01  00LЍ0 0 0@-S@ 3/@`p@-W Q4S @A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U  B N B ^ '" ^ q N $P@@DF$E@  BB, D B,&" @A!L@  B B!"AA!@@ pQ Q@#` P `N@F$PEPET% B B&"@D@D"F$PEPEX% B B""@D@DA$PEPEU% B L B \'"\  \ \ , ($P@\ \. \* \, P@^ ^ N@N P@\ \ \ \ @w< 0PPU R800 0\`1S   ;`1S0 0  0PL0  0P9P  PP&0  0P0  0zP0  0nP0  0bP0 0WP`1Sy40S{ < P0ppW  0R 0 \pW 0pW  0R| ,0[pWg 0pWb  0R4 00[pWHpWE 0 PS 0 [`1S   0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P  0001p 0001p 0~001p 0swt1p 0iZ.[\L b[tЍ tЍ 0 i/0 b0 [ 0 T0 M 0F0 ?x0 8$CL@ /(  -\  Ь +l @  ĩ L d D $  ĩ @-@`0 0AMM0 400p00 :PP0S hD 80 0 4 30AލЍ.$s;h;0,@-@ M pp P:`PlP 0S <0000 Ѝ00S.S 0S Ѝp@-|0|AMPt 0  ` $ 0 @P 8 00 0 4 30AލpCsd:$:p@-P@Q`  @Q XPV 00pV00p@-@ M`p9PU 0PU  0\W 00 Ѝ_00P0 `JW00 ЍT p@-@MP`0S 0 @S 0S@V00ЍpO00@0 P"V00Ѝp贤 0@- MP0@0 @x0@T U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0% < ԣ p@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@$8 h$0@- MP0@0 @?@T U Ѝ0p0 0PU:L@@ Ѝ0<00@00 0P Ѝ0<$ ̣ d 0@-@ MV T ' T2T7 0DS3m~0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@;T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP\ $ D h 4 L ܡ < d \ 0@- MP@O@ P Ѝ0 0( 0P Ѝ0訙 0@- MPl0l@0A> @0@T U Ѝ0O,0@ 0P Ѝ0L  Mp@-@ML 0 Q0P0<00P@ ` 0. 0T @D S000T H0 0 <0 30 @Ѝp@Ѝ/.0 T1q$2H 1O-PM`@P P = p 90 Q  ЍSv RSPP -\00 +\00 3P0 0  R0N1011.\ 0 @T@  R㞀( 00 S #3@  R\ Z 0S#30 "#T$P+<0+80+40'<0'4 0(< 0(400'( ((P p 0R0p ` 0T00@0 P   0R00#3@0 PS \  R#3 000#3TP 00 T @ P P 00 S #3@  PR \ 0S#30 "#T~ {00H 000J00  0L   30O--Q0 \M R 2?"1>Q1|" TSSNxB0c<$CdbBdAAC22c1Ab^f,RnjaLWEP0>%S8_2eRlQqQNDB<">"br!LgLH @p qNo o o[H LP0H Z J Y L (D $T@ 8 < $, 0*0Pp4 >[ 'VZ #VY V\Ѝ  BTꠀR(i  0 0\ЍTZ DY  4igܤ MbQl И d~ P~ D~ @-@"P0D .R S0*SQA@0T.S 0@-MP20@0P(Q 0v. 0 0 ,O =Ѝ0踗 C-@P@ `p MPOP @U SP@Wt Ѝ @Pt0 0000 0 P>#@0S0Toᨂ#P (< C-@P@ `p MPx@P @U SP@Wt Ѝ @Pt0 0000 0 P"@0S0Toᨂ#< '0 p@-@P፵00CS0 S u P `0 PㄵpV`u00CS0p  Sp R 0/V@-M@$0  00P00 !R !0@MЍ@-&0 S 0@Q0 R  004S 0@l@Q0R Q  R Q D%Pp@-DPD0P`@0pp 00p@,X0-P$Pp@-@ @ `@0Ppp0p@,#PA-DD p@0P`p0 A#PC- P0`pMpp@ H 0D @ <8 (@Ѝ95H#PC-tt `pP MFp@ ( 0  @ Ѝ5"P0 00/"P0 00/!P0 0!PA-TT p@P`M p 0 nЍ!P 0 0zT!P@-pp pM`P p@ ( @Ѝ44!PC-|| `pPMp@ 4 00  @Ѝ4 P0@-P@(0( M0 0 Ѝ0 Pp@-D0D 0@0pP p@q4pP  0 9P` R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-M,`(@Pp 03PE0 R# P R8@  0 0 000 CЍW R  Q.R   Q. 0 .R  P P $00p@-P0@S` ׸0 0C0p 0 pO- M$@`PP(X0*00T+:Yp) Ра@  Tp p P@ 0  P0 Pɿ000000 Ѝp00 PG Ѝ P P @-R M @0ASPAA p0`0SA0qp0@ ЍD0iP Ѝ 偿0 0P` O--OMM@͍<<͍0͍0͍=8<00M00H?P0$0=@^.M0p4PDH[ SP 0`S @0 8PP(0 0@P0:=40=H 0o`P= 00- 0C0H;0H;0 010h0 >d 0 C0 Pm*0JPdZZ 0JS񏐶Aur:ow7{`9UuUh*) ~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      VP]Y 0S .St 0Sq 0Sn00S.Sai`9ZD =<00S 0<)0C ( 0  BQP5D0Sy@  0D;pD+0S0` `【t0`SpW 0S @0D+@T 0Y4  0d  0 wP8(= <0 2 M ݍЍ词@0 (08P0 ZP`0 0P:<=<00D S)1D;d 0D;t70 0 7P( 0  BPH 40@寍@0 8P(0 0P D;0B& <Q060d  _0 PD; Rt6 00 B(0#8 ,0(00,0D+00pCW``W p@D+ x7 V@ p I 0 PTWoʬ0 PJ0 0(PBp5 00W0#80L5$ D0N 0C0 . q . 00CS W0 A0 PD;`0DkV:U`0 D PD;)|$0F ^D;ld0`d 0 00 fPD+0D  d 0 UPD D 20D+0 D+ d 0 APD+0D;`V spD;`V0D; 0d 0 00  %P(00,p`C 0  P0 P 0  P=<00SD /D; D+D `/ D; 0D;)X2Cd 0 =0 PhP:D /D;b0D;`d 0 $0 POD /D;0D;0d  0 PA?C0 Sp0 P[= 00H+#Hk~=D+ 00 `0C D+Hk00 kP= 00H+#Hk^D+= 00 L? 000#80|t: D;0B/ -0/0C ( D;0B/ "00Q0D:H 0 *P3Z 0  PD;`DkpW@ GQ9g D0 10"3/= 0;D0000;D020 20;D00030;D0#100;D0D100;D0  PdDk`Dk0S>0: 0D;D+0S0Q p〠 0pSH 0S `D+`V 0Z6 :d   0 P-= D0 10"3. 0;D0000;D020 20;D0D000D;DD=  D010!30;D0000;D0+D200+D;D+D+D=0 D @!  ;D+D;D;D;D;D;Dw D;0B- <` spPWW Ԝ `/Z 00 F=P0J 0GW 50 0P0d,0C  *`D D *D;pD *`D;`0D;<2 0i0  P` )pPWW 㸛 `/Z 00 FP{0J 0GW 0 Pm= 00H+U"HkڱD;-  0 `D; N:d 0 Hk 0 PHD; 0SD;.** ` *  D+@Jp Z0 P+ 0d  `0 PJ`p@ D;S: 0 PS 0)0C d9d 0 `0 oP0SG y`D;p0`SD;0D;; 0d 0 00  RPD  0 GPZD 0S 0 VP  D;0B( 0 -PR 0B( = 00H+!HK= 00H+(4xD;p0D;`0 P8d `0 W`0  P0 _Py0 PqD (D;`0D;0 Pd= H 0:0P\-  B H+ 0H; 01PK0 PCD (vD;p0D;`0 P4= H 0 0P,-  B H+ 0H; 0P@0 PD n(D;`0D;0 ~P= H 00P-  B H+ 0H; 0P0 ]PD @(D;``0D; 0OP=H 0`P= 00-0C 0H;0 H; 05P0 P0 %P0 P` 0 D 7P0 P(0 `CD;4t0D;p P 0 PD; R0 Pt'D;d 0D;30 70 Pa0x#0C Wd0 PQD0 PI( 40 P= g D;0B" Wy0 Pq(` pPD;WmWe ㈒ `/Z 00 FP0J 0GWM ~0 yP0`0DkV:A0 iP䑟 m0 ]P Y D;0B! : D;0B! 4Wڀ0 CP`1d 0 0 5PW$0 *P0 !P萟 *_s r r q p 4p n lo m @n Dn (m l l 8k `l l pk j i i R Pi h ph g Dg f f tf g f e le d e X 4d X d c `d d W b dW b b xb b c b tV a 8a HT _ W0 P^ D 0D D DD!D DDP,DkpW`Dk 0B$! @- @R  MAP  ,0(; Ĝ0 ЍPMM$000 1 2Ѝ/A-PSp`@ @V0 X :@Ot@PU %Pj@(00@X@D :G-0pW0:@0`?T0)0 ?0 0@T0T?0P0S0 PUT0 "$P P@@'( 0 A-QM}p$0PS@` 0! $, (0v(`Vl0Sh(0S0! , $P, (0V-ʨ100 %P\, 0 ^,0W /  , U/ ,(0T0PT(0 S70P$00Q (0, Ѝ 0FDP., (` , \(:0,0?0s0\, :$( ,00(0 S PU$P0 "ЍЍ蝱 0 ꕱ( 0 A-QM`$0PS@p 0! $, (0w(pWp0Sl(0S0! , $P, (0W0<0000'P^, 0\,0Y U/r ! , /r !,(0 Q0QQ(0 S80P$00Q (0, Ѝ 0GP/, (p , Q):0 ,0?s010Q, :!( ,00(0 S PU$P0 "ЍЍ 0 ( 0 QC-W`@ P0 <S.A&a$Œ?F(q@p`  0 <S.PA&a)Œ?@0: `Q`Q QP Q@ =Q| 2P [ W0@0@PQ 00@ =Q  PЍ`@QxZЍ`[`P W`@`_][`X`Q 00@=Q P PZ` ZQ Q 0@[W0S `QQ 00@=Q`X X X pX |X lX `X TX HX @-0 Q0SPA00XS<@ 0SQ.C+S^1- r``p 0000   0 C R0 37 #`0CVs0 X     0B ^037# B"  A-Pp<U P0 @x0W``W 0 .p H\p@^0070.200 0 S037#P00 \00/no/༧n///,p@-` @0 0DM0<000p2 00 RP=00P@0P< 00 0 <0 30DЍZP 0R O-1쑟P0ਂ0M #੒ q i C2'r0ApqB# C@$AQh!dP`3 @@C.*T6W>YFX @00 SP$Z R 0s00    00 R @ЍW 0 pPD0 fPW H0 \PY 0 M QP X : %I$ A-`pP0S.@ T$ 0D0 .R T  S\R C @D.R @0.  0T  S\R  @@( 0 0@-0M M 0 P@ 080P Ad P>o8 ,0 0 8 30ލ Ѝ0Yt  0-@- M0@R0  ?PP * Ѝ@Ѝ/ ( Ѝ@Ѝ/YPR0@- M P@  P P0 ? Ѝ0@r2 ꊭ00 Ѝ0PR0@- M P@  P P0 ? Ѝ0@N2 c00 Ѝ00@-@Q M Pt  P P0 ? Ѝ0@#2 >00 Ѝ0p@-P@2P p@ p@ p@-@P 0P   L  S g P |  p 0 pQP@- 0R R   0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!   P # T@T @p P  ꬬ 0 pp@-PP @ P   T D |00S6 \0S D0Kl@k{{6{ D0Kc@k{F{7{ {@{ \00c\0  ?A?^ {k{.\0S 3#K#K#KFD0S@046S D0S@0Sg 3#K 3#K1{k{Z l3#K{k{'{ {G{ { {k{'{ \0S{G{{ { t0S t0St0S t0S {kF{7 {  {k{7 { @ 200 0"S%$K"K@056C@0 D0K@{{({ k{{6{ @ l20X"S (0L"S,0s% 42@0 0D0 e@056@0 /0S! 0jS{pk{{{:0 0S00 0:g{{ \0S{G{{ { 0 00Bk600 D0K@{{({ k{{6{ @ T100 0S) 0R%{{:0 0:{kG{6{ \0SD0S@046S {(k{8J{%k{3{!k{,J 0V^T^R^P^    @??A5?55?5???|P9  0*^(^&^$^"^0S \0(0 0,0 k {{&{ @ |00S 0"     1S 1 0S {G{{G Kp@-@P,Tp (0":k0cSp: A p 0 0 L A-`@V Pp90S @ rP 0S V@Ep@-P@PP0 S :pSS00 0R:ppp808 8e0 $0$ $f0 x' x( ' ' X( ' A-P`L@IT,EP: AP- pPW 0P P B $$P W 0 P d d0d C0 3L L0L E0 *4 404 D0 !P' & & ,' ' l& ' & H& 0 0@-@PDQG-^8 pP@`  00+00CS&OC#<!  5\U0 S\p RXV``W`Q`VP\\T0 S@\` Q@-0-rw0-0x-00 0  0 0S wS -S rS  0S /xS  /  p@-^ PB2 p 0 pP P//0S/ S S/0S/0S/@-@ᬞ0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 /" " "  ??SS $0$ $p@-0 /X" " p" P P P`/AP/Q/Q Q/?0 H0H Hp@-0 Q/?S0?/0?/! " ! QP0 ?0/@-J 0 A- 2@P `p``; PϜ40S.0P@4(Pp@-P0@ ES`M aЍp  0Pᦜ 0S 0 p@-@PpP Q 0S P40PS4p@4A-X Pp@PEX `P@``O-p MW " @`IW   ܞPP @0SW G!Ɔ0pGp1 ЍP Ѝ  B4p - BMMRč `` T @P N P$    ,   0@- @-Ÿb M M`$ȍ@|PpM WF b"@$@ p` M0 H",2 0 $8 30ލ ЍMB^"P0 @Mp r $0 B^P.!0 5100qp0۔P0 N\A AL+\ 92( PH[LX G T \G P FT  E0 5\    t 010/C. *     A-RP`p(M @x 0 @0@0 P0 P0.N P@ 0 (Ѝ 4 h0 0 5CS A/0cS#:*'R A/0CS!023 A/@-@T  S 0\\0 0NO-PpM ` v@P-ZV +Z @00ZS U Ppa㓜`p"@ 0Jq \ aJQW JAJQ7 JUTPRQ ҟ@ 0T  R S` 0I0 0 ЍS T0 Ѝ0 0XQ0A Ppb P A@PUPpbꙙp@-BR"^8 p@,00m@Pᆟ0T0Pp p@-BR"^p@[@Pt0T0PpO-p`M@ ɚP-TP +T@`00T W Xp p 0 0  ?0X 0j 0  ܚ P @p P 6 Q P  S  R-!P 00Bs ^a0BSW0BA0BS(70BU%| X[  Q P  S  R!"00ߞ"00 0S \0F0 0 Ѝ@`p00XS00 C R@0 p`0 A BRWvp pup@-BR"^< p@0007@Pᣞ0T0Pp` p@-BR"^p@$@Pᐞ0T0Pp | 0 Q?0S @-rJ-- Mj ЍЍ/G-`P】00 !PER !@T2UpU= ᎏP- P@@D @00g  xP0 0PU00O [P@@D0 @0 0@003 X,A-P@jJH`H0``@p 71T  C A p@-@P00CS0 S u P `0 Pp1`u@-@ߐ 0`00@ސ- M ? Ѝ0 000 /O--0`MQP 0 Q`\0 0(-PL 3p0:30 :` ႈ`P @   "P0@ S0S S#Y`@T 0@ G T : @D0S Y@Dpn P   qPYp@D_ R/ 0` 0 B00ߍ S S0 S S \(P 0  0C?o 02P@  0=P 0 !W d*@SZ @0P ` 0S S S` SX W:* p``P @0S|0 0Q ǘ T:@DP࢕ 0pC Z H  嗕0@D Q ZP 婘pWy(.P G P 0  V/r(u.P b pG 0p 0P-C/`^R p@-PP L1PM0LPQ`@0  .0 P + T+ 0  0W0 6MP  /  0 x0 0 L0 30PЍpLPL @.T4H * $*4 P 0@-PpP@ T`M+ V 0 0 0  LP .  0 Ѝ` `@.T Ѝ LP @ 8)0S/ 0S/p@-0` P@ Qp0 -00 Rp` FQ`00pO-DDß OM4`(CQ@p`Pdh Q 00幛/ 0 "2 0 41 30Oߍ [.p NJP 20@ 00 T  !!.PQP\.Q M :!ᤊ!PF Tw 00:T.T@@<##4;@T0Q.S5 YT0 IR 0 M@ I [  @EP00՚ 0 I )@Y2:   0@  @  <:T 000(0,$P0 0 0H0 p0 $Pc00_ [j00 0 T<4 ⑩P`aF ̋ | D| Ј  O-ʟ UMMLōxŝ|E de SpPစ@$`, S S 0 0* : 0 L5 30lUލЍ900(+0P 0 0404^-뻚 0$ 00P ?s0 US#@`O H-0$ 05 00 `P 00 `03/P ``U:0K?o2P0[0S00S ` @_P `t@0D00 LT D00 U8054 00 0H0H8<0X0N?T0(- 00 `03/P. @ U:   `V Z 00S Y  (0 S 0I'YS:00Cs0 U `0 A6 @P8 R 0d 0<0Q P0R00SK P 0pD` pIZO[P 0 00S ! Qs /oU" R WS0Z` PX600X 80SD0 I@H 0SSQڰ\"@UP0S 00  0`4 @C0@0CS`:04P jF,D <0`0C 00CS`:@DY0$ 0(0 SYU5RO0 0 Pc 00  VIZ`0  BRXQទ`0,0`8(0 S S S 0`0*P0 0S&Y 80`@S0@-@ 0R`$L0< 0R*  `0`80<08040 0,0@03RO0 09 P 00 S  VH 40 1Q 05S*``` 0P```0 CR00X,`0  `0`m0(\0 @ \0%@ @E- P_@`Ổ`0 @ BRT`0@0`@ 03/P `4` 0(H0}*P 040C0 %`0  -y 0 T8!<10J@1sGk,`l)P `0 A @Pm 00 $  VS80S`@0@^P[@ `<`@>%@ X`0,?H 40 1Q * 0`@@ 0` P@ ND4@ 0(H0*P 040C0 0| D  X,A-0@SpM07 S20 0(PP: E`P5 80 0P廥P&`  0 #0P*;U Ѝ 00S S Ѝ0 0*#* 0 G-20BM0400 00`S0. S @ሢA~ P p0u #0G*0P @T *X< 8"02P  0 "2 0 4 30wBލ 0    ! )'@PH PPC 8 0 0@PAP 0 00 00000 00@&*T7 0 p pIP 600S 0  0pW'   0 ᆗ 0 ) 0 )v 0 o 00S Sd,Cp| x{ G-Mp0`>@P0P0 0   0 p`GP?Ѝ 0 ;PP A-M`pP@P , 0 (   P% @Ѝ0, 0ЍRQp@- MP``8@/0SE 0S 0S0sC S 04>  0 40 0 0P@LP00 ЍpR R / 00 Ѝp0S  00 Ѝp0S00  0j t\w HO--LLğ P0:YZ W@p:Q@0S  0Q:@!0.Y0$ XPʟ X$?o n n 0p@-@P  (M $  `0 &P* L @0 0 $0 30(Ѝp谓 0 ?l k O-ß tMPl 0 P / 0 P#H3 0 l0 30tЍ(#3 0 l0 30 tЍOp '0C01T0@ pP2PT0L` 0r 0S P r v\P  0S` rw v00 X0S  X``!<0@0 jT? P UW*:0VT09 J 0 `%YPI@T p V00 S 0SV:0@0Tpv `V0 S,*: 0 S&* 0CR00:@RPX X X00S0  JP ᰎ80S Ȓ 0 1v  > 0 pp@-@PPeP P 0 03/P Up@op003/P U 0< p@0/p0 p@ 0/8  -M0 3/Ѝ/0@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0 R R R //00/00/ R R R //00/00/0@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@- 0R@P M R R Ѝ00P03/P P Ѝ0003/P PP0@- 0R@P M R R Ѝ00P03/P P Ѝ0003/P PP0@-@0TP M T T Ѝ0003/P 00S00 Ѝ0 0R0 02/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0R /C-`@QpM Q) Q PЍ0 03/PP WP:UR X$ ЍC0  0003/P PW*UX  0P0U URPЍ ^Pp HH,P0PSP|  ;A-P`p@P  R 0 R 0\A/U 0A/0@-M 00@SP`p SW-   P R`V V V Ѝ W` 00 R D0SPV 00Ѝ 00Ѝ Pp \d (#p@-@PT`M T T Ѝp0 03/P 003/P 0 Ѝp0 00 0 3/P 003/Ѝpp@-@PT`M T T Ѝp0 03/P 003/P 0 Ѝp0 00 0 3/P 003/Ѝp@-M@P0.S00Ѝ@-M@p0CЍ R? ..R0) .Q -S.S AL#\0A QS' .S 0 .Q AAQ0B Q AAQ0B QS  \0A Q-R 0//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//"0 0 /M PM0  1 0Ѝ/M 0p/0/ 40/ ̠ ( 4 0/O-P M R  <4<00 \O 0S XJ@.000PC @PG X=@\RARZJ 0cZC1 00X.p0Z`ڄ P Kf[p[P[D Y@@T  R0P P*0000@ŋ( 0  ЍAS0S~!0X@\!0ARI0SP \P0" C:R:Y8W654SR10/.M,+*)('&%$#"!@; ! C]R#X`!`a##"!!!Cr b0Cs0!0@ D0DQt X 0@Xx0@,010. Z009ZP  0k3 ""pE dk+ p; 0 Q0SJ*.00?|xhQ̤O-ğ,M X0 t4tt0P`@p 0)[X> zP @Qa zP @Q㈀ yP @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] yPj  HZ$M0xSJ3  000 A P0XY /Rl ]RRP ^0/ $$ 0 ]R& PR " YXuP   Z J b"r R ZzA @Rg .R`P@S0@,Ѝ P` 0D0C  [4:D( 0 ,Ѝ= 0 ,ЍP    Z"    R  PXY  ^0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYyH 0G-aQ`=*0 S) \5 p0P0S/ @S" 0X*U  @0s00@琐@@ P 0S00BAU0S!PPQP0X( 0 C RO-P3P#RP3 M0U 0p`\ @H @R9 R R% i(00 ЍW@ Ġ[? A @ GRPR@\ 40S @[A  Y*@T*0P 0A\ R!ɑ" 40S 04 0- M ЍO-S,MP [   0S 0S@0Ps0v @P` \qTp000[000 0P0$@0C0@TW @0S @S]  0r XK*PT p@0T00S 0 Sg*`V_ ] N YZ R0O Y PB (00P0S !R* 0G S 0S 0 $p0ATgP0"1 0\0[ 00僈( 0 ,ЍATX0S"  ! 0SP14?<00 R`v``V0 SZ000R0 ABQ AAX QS R0SY 0R?0)@ *- 0 ,Ѝ !0H p@- M P0 `00p @ !p < 40 0 1 30ލp@3 = < A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ3h< < Q:/R/0S/S:00/@-\@3$* 0^ @R R R ( 0 0S0QA^ R! Q 0Q" 0 ARL @-  RQ0A  RL  s 0 Ck( 0 /C/A-@P`TP' UVT EP @TP 0p = 0 7( 0 0QSp@-`P@ PP@`V  0R p/pA-PAUQU@A`pPWڀ1AP( 0  0 ? 0 Q" @-ASRB 0@S AȆ 0 †( 0 /-- M ЍЍ/@-M@ p TЍR/0-S0 \S  R 00O-@` M P P-Yg +Y` 0Yi T @Q 2pO`Ppg2pO`P" [)SQ" K0Iq P0aIQW0IAIQ70IT| V[SQ4+)$0S \0J0 0 Ѝ  00YXP 0@ \@ AL\T@p@-BR"^8 p@,00a@P0T0Ppl4 p@-BR"^p@O@Pԅ0T0Ppp@-@P M``8  0xA|Ag8O8 TAXA\A`0PP08 @(0 0 1 30ލp13 43 0   2  -- M0 0 ЍЍ/--, M0$ 0 Ѝ Ѝ/2 QPO-M@b 00S000p!R !03  vPP E`#3?`:0P*Q30A !!!! P 4 0 } U 0C pSvBP0 0@pQ 00S  Ѝ T 0 @00Ѝ 0 0p@-@`PM x0 0@ xЍp0 0-<0 X p@-0 000St@@@pdPddPfT@P@P B0000 00 t  X @-@M嬄 Ѝ@A-@`P1ppp0php T  )<0 s  A,/ lOL@-@P0S 3/000S@莄 A-pP@`  F oi000@P p@-@PbPpp@@-@!1BMM 0`PF040@@@ @@G0qPpS p10S d!p0@ d P@A0@ P> 1 0Xo!0 0 4 302BލЍ!P @P  4/P Q Q 0 00ox0 00P 0 0 @U/- T- |,, \l O-qQpMPu Ap@f a@0` RD0 0]1PI 0SP p Z [ @@P ,0['pP "0PU :Y P``S@PP TP 0@U:W 0@@00Y@Qx00p@@ ЍPЍ<0 0n $x+ Pāl 0@-0@P$M P P0L0 0 OP $Ѝ0  G-RPL 81040SA a q@`p #)/0@S-00儑 000S 0 000 00 xw0 00 \o0 0 @g G"(00|dP̧G-쀟0S@P$0S!0po`PP @0S PU @@P -0U(00 g8@ 0@  P` `@O--dM␐PYSRßQ @!3 000Sc`0S00 0|#00x3 0  0 0tP `W@3@0 083U0 @ 0 Q  Q P0S-   3/0 0'@W$U 0 L00L9PL 0SI 0 <00@00<00)P< 0 S@Wp@ RP"00S-! 00C0T@dЍA,@@@10\U 0,0S/  R|1|0$   @$(0se@n$0@S(  ( @0dZp+ p1S `bPI 0@0C000$   @$(0FP6 @@>$0S(  ( @04@$  $(0+0& t $P4   H  @-0N~ \0N~@ T \FT 0 \< 0 0@- MP@0 P# 02c2c200:S Ѝ0;0 P 0 2c100:S<0 P0 000F̌0@-l>0F. "l@V,h @P^QhLl -R 0 P0R 0R R0 |A-$Ÿ$20#Lc\*0Sm S} 0C l l;Sàʌ͌fc\*0S[ S@a 0Ϡa^l@Ҍ 1C0o 1fcf Qq P@\ pp0T0CH` G41@?L1c1c0P0B0P0BP`N4PQ` @PS( 0S l lVàڤ0@00002c2cPÌ l làL l là@)\P ף*Qgfff$IL 0P /0S/ 0 S/0S/0S0@//O--M0 @  S 0H$(@0 48<0L T@W ~xCE 0R \ 000!10 R0sz 0 Ѝ0 S, 01P0% V 0? VPPv42P Q%3PP ΌQ V"> 0RR!:∫ RF\0h W0PC F. l V h@Y(@ pRAh \ b 0V00V 0?0P 0 K0P  V    PR/R  RPy 0ЍP0P0 0P  R V,h ( d P/R  (  l Y`Y`Į HlO-@PF"F,l Rl0l0U"RP*;<Ѝ"R 0S*0Za, 0*P;M@@` P P00C RVUV`,⸠  `PPG 00R 0R0S 0V0mW`2 z6 @S%VCD00S R ;S,S S@0\- 0 (\ 02FSPPE4@mpP>0@gpP+ @00c@049@@i@V|hlp崠hpx|…崠 ራ DntЍPs  0f [   100 0pS0S >S0C"1 0XH0:P 0,S\0:P 0S   @Dl6 ihƎp60 |ax倆0*;$吚<P,@P@ğ唄唔00p(p[pT @D bY1:HtbW 1!/ 0Pppc W p$@P(,@P0@@ @0 Q0 3#哔#cR01:#cR010! 0 cR c s S R  h3@0@j,P4@8A$0(p0P#38#!BcRl:#cR#20!WP Y c8! \ Qa ce8偡 Z , \DR/ (" !c 0@?P00cSC X>*p  1  @R -S +SDP *EX1DP D00cD0W W Y(p,P04@<0f΃g>0KpP@(,@P0$ (p,P04@00HSh0Ű17t0s1800H2r$r)\(\{ ף3Pp@-@@!0S p@2PP ,@P x0 h0@iT D00 8 1s@ꐔ Lp [H2lkG-@QPM 0SB `P_ 0 00<0STH0SB `V _ rPPUS lQ8 X1X!@0d0 T000(aM@@`F T0P0\  R@ d?@D  @D0P0T0S 00 P<P@0 0 l0 00WPࣥTD,k\,ih h`[i D`@-^ F=<;:9r7n3l10/.,+s)('%m#"k RoNMLzj TyvNK|S WW[ 0W0   0Q񏐫00@0C \$ShPe u0Ss 0Wp1!PI  u0S 0Wp1!P9  u0S 0Wp1!P)@@@1 /u0Ss 0Wp1!P   u0S p  0Wp1!P Z u0SW 0Wp1!Pg uu0SA 0Wp1!P `0*S6 0C P@00C P00C P`a`00`F0C P$S2 uE0SWp10P 5 u60S 0Wp1!Pu)0S 0Wp1!P * u0S 0Wp1!Pu 0S 0Wp1!Pt  u u0SE 0Wp1!Pc @ u0S 0Wp1!PT p <Ѝ 9 u0S p 0Wp1!P6u0SL 0Wp1!P) p l  u0SF 0Wp1!P  u0S p  0Wp1!P u0S 0Wp1!P p[ p xp0W K*0P| <Ѝ@@@@ Rp4a KpxZ DpS =pL 6pE /p> (p7v0S p * 0Wp1@~0P O pu0Sk 0Wp1!PW C u0S p 0Wp1!PBu0SB 0Wp1!P5$Sy`0P00 pu0SO 0Wp1!P)@J u0S p  0Wp1!P p p puq0S {p  0Wp1!P kpz dps  uL0S Vpf  0Wp1!Pu90S CpS  0Wp1!P00C P0@ 00K0C P$S u0S !p / Wp1@{0 S p  0 W p1@ r$S@O--ϟ oMMƍH0@00T ! R !0s0I: Xa 0S^   Rd 0$00D0>ܰ00`0>T00@匰d0<\PPU @%U PU 0T  `J 0 R 00S0U`n0S <0S <:0@0S0000PP -= 0 6 30C oލЍ eXPZ    R:0s P=*X1RRXOX.TQXQ\Qfˠ~@Q`G0D,TDT l(80    S+ 0S@q-0r0X?$  00 @TX@@RPPUm@ry(PLP,P4P0PW Pq`}r(P@L,401 S0PP00S800 0`@VwQ 0Qr0S0Q 00QG0S0Ry ( @DT L( p0 0 R *S9  EUP@@y0Y PBU0 S80000E000X0$ SH0100 H000Sx00@t0| d7| PR1|0P <x0P0CD0 #0P<0 t0$@S-0r0|0s40 p< Q00 mS60\ 0> 00  H d@8P0p0QS#\ > 00   0 R +0  S50    X 0   0 R S0|@TL< D\  6P0P00iD0 0Cp0D HXXz@``  HX{0\0SD <00NSO `Wrtʜ|p@P00L@(P,@4@*Sr0ls@\0(@Lp@ R Rmdp R 00! , 0g 0@ O 0P pO0P00 0@#:} Z $0$ 0 {@; w QH $ H puC@:? Z $0$ 0 ~L,PQӡ|(4s0@ Lz`dhP, XRӄX,  B, 0 HI0Q 0 S0 ZO0P(  PBUPU ڐ0QP0;U@@ATTj P @DT0Q0S@DT 4 0^@0O0 P00D0S0 O0P3S0yJ[(mdp!000  0g0SP00@0GpBTo `` (P0pZp` @DT0\p0S N0P000 N0P00 0v4 10R+ S0bB- C S!!z/ @.cS#/L!b0C000A0 A00s@0A^B0. ^@0\0\0X0r(0b@(0SH$01HS-0`r0͵X$  0 00Z{ $$  QH $ H @v  P o @ N0PNr@ (P0p,0 Q @ 0S0004@L0,000(00 SA. @0c 0c833:G{000@+S6LR S 0, UUGoPEEéQy?aCoc?`(?yPD? ,' P 0`P 0 < PQ4 0(0Q8C6j0 $ "P PRP@J B,Q ( P$0 5P P  @6$0( ( $0P $0( S UWQS `Q` ZR R XW R! QS 00 F 0p p( 00,` 0 `$0 P00< `U`R  0 0Q``V  0RQ KX ( 0 R:   @P W P  pP`DЍWpR0C  aS 0A0c,00 X4( $0(`P WU 00X Y 0( $0 \8  kHK, \{KP | {k&[ P {[BJk{{X Q LJ ${ A kQ;0F{5q [kDk6k+K P5['{;k&C{5{0JG[2k$000Z X44Ձ v k{{ Q L{ AG{5{Fk{LJ< PQ Q    QQ,` p P 0 [ U[ UQ Q R,` p04@P qP09S $010 D0 DЍOX00 0000Q DЍH[7 `kk(@F[  { [%^F[h Q,^@P$0( / ?@?$@@<HP$0( UWQ0( $0$0( `X00 ?001k X{k&Ƌ000100 [ Zx 0 y ( $0@P$0( _ $0P$0W  0P 000C 0E@PG 0S 0X40SPE0a 4 1@P3 00S0S0JS0PW0 W B@P P0 Z0JV  s9R   E X   cP| 0[00~@{;$# \ \K{'k[E{7@{0 quNk[3{Ck6{Z0^0SN $00W 0P 0e0 01k,K ( {{[F:N8N0CB:N@:00s001 RUW+ W 8ƋF"*  J @$@?VN 0r9S 00  upPw (Pq   ! dN 0P 0 d PJy X 4\Kk[%{{A$ Q N 0X 0U pp,`W 9S09 P $ 0000000ZX3U-Q$000^QQPQ S0 uQqQ j 0 s0R    000100D  0P 0 4 R E 4|4 Pp,`9S,` p Xʡ<`Z^ $@@ QD !460/\460//P@-@00 R@P@Rp@-@`0P0RP* 0PpP R 0 R VpP 0@!O-0@MS]@DPqp1 0.Q[1`q0&:0 @@F0 R0 W 0 *0 @0S 00CX:X@D* R @  P `00 0P W 0*!1R 0CX:X@D* R @Ѝ0-WM 4@.T0L  T 0      @E-E,m `@- @-@-Qp@-P `0@ R O@P  L00pQ ``0`0@- MPO  3@P  L Ѝ0-M Ѝp@-@ P` !LNP !@Ap- MD ЍP/D -0")2b3c1@2`M1 HЍC0 00/k 0@-P @M  0P@ C=p`Ѝ0 -- M0 05T ЍЍ/ p@-0@Q r P p0 S P1 py PP   ! L @0O-`M p A QP +5[% 80Sz SQ  @T Rs Q)Q0 <0  S" $W `W `t Ѝ @iTQDQD@ Q A[  P<0   W <0`0 <0 QCW   `V0BSTQ; ` b  <0V 6TP a PPl1 !P j P T@@k   2  _ 0  @0 a`P  0Q/ R  B / 0Rp@-@P*`0B @!R@ @B@DR@@@3 R0  `f2f`pS@ * A BP   Qpb Z PPO--p0 tM@ 0M 0dp\ h ` -R-+*)('&%$  000R 00B S 00$0P@1T00PCTЁ0Ad @00B S0\  EPJ00 dp0d00+Sh -S,0,00d000C PR0Sdd00S 1CP*0Cd0d(000C Y d00L0C Y( @Pژ(,P(`(0\S 0p\tЍd0W(XP 0\0 0( 0 B0S  S ?o200Zg{T@Xpp XGڐ7 f01k5[Xӊ 0Sy 0Sq %0hS 0pHpl00XS `d` 0R RKQd000S\00\0R  h  Y RiSa IS^ NSd@o P 0 \0000d00(S 0h 00nS 0h dp\0\u   Z% \ BdT0 0C Y d0Y ( 0; 0d0000H 0\00 0 |PH h lpHpWg  |501{'pH ` Ph; ` l BpYlp q lp`plp 0 A0S@0Q,0|GY  Rh` %r0`000$0, Sl  @00Sh,0@0000 00j 0( S? J 80 0˟۟:( DD@| PP   ! Ih0q `P h   !I`plH 0G@P00 S( 8 B p,0 G(8pS BpGpp W Y (0RpGJISGQʹ 0SZY  @P M pP 0S0S  ) 00SPX} 0 S # Z @0, S0\0 [ 0h S 0CQ 0 R00S400H00Ja00` 0# R00lS 0<0VI XT PM TQ0hSN  h Ph; 0S A ^@0, Si`0A0`   X` l0<0 Co4 婒RY )K{8Ik{Zɋ0SV \ `PT ?@?AV瞯P:00XS Q0L)AoR^& 0 0S  0c1# 00Ѝ QN0O0l1 c, 0# Q:v00Q )Q  0LI O-Mp<0` H8@P00S 0@0P 0 B@0P 0SQ^  H0PP   Q0DR0^^ 0S 0S S SK pPr@00@0 00W@ !IpT0 Pe 0SUP0 @0 0R R 0\Pb S 0CPPa R@ 0D0CSڣ0SpP[ 0[0 0 RYd*0  TDQ @J \  T @   T 0CC10BcPDP|0S0SCU 0S S S RIP@"00ЍSu 0CPP @+P~ -P% 000LP 0ࠃ:L0@^ > L@YPl #@Ѝ000 PL 0\@0Q  R  r KS S80S "0p00 0p b@0H"00@@}P  D21 2 Qn\ 0\0C 0 ^  00@Y 0Sg Sh S @0p 0ЍI  PePgx0S`H@"00Ѝ@ @QA@EzpPJ 0H0Y@HT  21@4PEB@80SjU U EP 0 00b80S80S800c8080S Tp0+  RP!@L80S L80SH00@X \y0l 00f@`  BR"@^ 1P5"@!@V+P(&@E  /A-`< RϠP@pl3 ^P 0 W`0 p0U0@PEPU 0 BP `@ pV  0 BPp0U@980@-- M@ PY@U0  C00C2S*ސ*KU Q6cZ AKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ G0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/A-^"PbA1! !0T2, lp(  T2,N10C#10R! R 0000T TN0NC1^0@- !P@M: R @ 0S R0y@ЍA-q1pP0S2 U`e@T`* 0S00 000AT !0S 0i`te@!0 0D1S  00T0S 0M7 t@ 0p@-@P0p R pPQ`00App@D `.80 0QApp@"6 t@t0  0#10/sP30s R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P@pP   ! >`~ 88S00000P0 0/@-@P0@0O-0M[ pp @ S0P0= PaU*0 F B  }E 0 X0 *0I0Cp0Y003 0[P^   p0>0 Y0 0[ PT@T 06S 0@ЍG-q0p@9$A QPiV= @ PU `  PP+ @ h10S~PP= 0S ,11PU 0C  P 00Sj`P! 00000000i0S x0d0iV0S 80 ,0R0i 2 t@ q$G-`0b@TP塢ڃ0T'P# Zp  !pD0  n.  P2)0@R0C`0P003 `MpG P `C-0P!1^$23\ *G-0@P@DT`G !1PG*32\ =:Pp @@  Q0 0S 0SQ 0 A B`Q3 3pU  0 0S3#U0 E B S 02LS @0@P`P 0!p@-@ AP`DG 0` P0R @*P56 +CpP `0PR `5<#511 +Cp `1<P0DR56 501?C-p MKU`EP ܀4%66T0@ 0X0   CHH5` Ѝ P0 `00 !30 0S  X0 C@@1` Ѝ0S0/0 R /@-H1HaP`@M@rPP3 upP-0S  Q5 p 0: ST0P  uPP @0 $ , ( ЍCO000Ѝ\PC 0 ЍC 0 + ,ip@-@600CS00 P6pP  BR  /p@-0rSM wS aSOP` IC`00pLP`0S e C+Sr/ ^R$ L0S@@p0KS0DS0ES0PS`@`P0p@-S4 @6 P00P! !& 0S 3/PP೼000P @ P 00 `{00aa5@0`` 0pmK3PB 0P000@-!@R !P 0C 0 0 S /,3p@-Q1P0@0S3 0 GN 4000S9 0"$0 3/0P:s00.p00P @ P 00< R 800pAS0PF2P00s04p  0@000 pGB  0@00pH' h-Ѝ/@-@^S S S )B 0 H0@ ,0@ `0@ 6@000 0 0000/ ?`4 ;`@p:pAB98C D`? >`Ep=pGH FI`Jp< (O KLM N匀FE`EF`GpD ŠK`DpG JpĠI H`H`IpJ KN M`OpL`0NM LpO`pC` pBD`Ap@`EFpG`ˠ ^ʠP`p A/`p^ APpM_Ām[PQ 0pePM`Q 0p ePBQ 0peP8 Q 0pdP.Q 0pdP$Q 0pdPQ 0pdPPQ 0pdP Uލލ@O@ ,!a԰Qp@-P P4ATp  @P 41S P0p@?@A-4!@k pP31S Lg @P!`4Q w0P0W0S!R PMoPP K!Rp ]BW?p?p?pp@-@P 0@+@A-@`P] VapPPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V ?0@A? @O-,M0 0 S ! (sp2/0, (Q0 P `@P@P0S$Pp LZB @PUXX 0 |`P_ @\P0HŸUJ[e`pp,Ѝ 0 iPPuA $`JiP[ 0 $ R`P5 @\P0  0P 0Q QA Q  PರZ`K@(  AbP 0 eP @PP,Ѝp  0p!iP ,Ѝ 0 dP@00,Ѝ$`  bP(@HT 1SX0$(Q $(1ն`n0 @-@ ! \ @)>,#>00,1S@-@0@ >00,1R@-@1  @0>,= ,!O-QM `y0Sp1 Pw`W@PC QP   =P 0 p=q=PQߍPm 0p '0 YW \T A/ OpP  0'l'%%ȠpP `'.h%t.\  ( (!!ȠpP"|"X `.#l(!"$ pP ` $(,p0`#0#4)̠))T(,0((4# '+/p3`+̠+P '\'(!"0&&8 +'t&d$%&()*,P- .p0102`48<@D)̠)X)$7;?C45P6 (|((4 l !Ƞ! G+(!+\+9:0<`=>@ABE 8pDPF|H`'&&&pHIJK`L0, p  A AA` P  L0 H HH岰 S+I !!!EEEE,TGPGp'''NpNNNR.FF`&&Ƞ&TCCPC`CpR'BpB z 0ASZ RVI^Rl  a6/@ PJ(P QPP p 0D A2n0a!NpW Q`0QVa```$4a$PP @xCxßxx#xcx0p 0 0! pQߍO0 Y<zU< RqP<Q  P2"8 P40D ;@ ;pW PtP0Z4U QS!3Y 4,"YYe@48pP3j` D H 0$ `\aPV<0EI<0,0(CK QdPPS ;@̠0(Z 0(084 Pp `D a;@ ~;P(P ;P`Q ڰ;PP;Y;BP;;t axt0\O-@(`10pI0X 000; Iq00& Z#Z! 0J/S   09 0P00: S 6/0 p0 R I R+/?004 <0 0 U! - ²p"/0SY `0 S00R0J Z )P/000S p pP .ppGorr t ihR Q0P:Q0Q:'@-Ѐ @-@@ᆻ ! @ 꼀 p@-@SPP R+`JP! p@訳f8 O- 0@TM0L3 pP` 0L0 D@ @ (,8p p $00`4P<@ H@P P "  p'gbȌP% 0#  P !@$d(ah  P% l` ca+b(*alb̌` & gx)c: eg` .dH(ଊďeZ,a*aȌ b, 㼋dL+d<.00 0bhc`: \&eb(* a#a` *錈g|(gȌ,igx(ǧi ,00dH+bldY̠eZ&c:. ̠dL0A0Ĺ `  )p ` 0  0p@  p hTp@@ @⚹ REЍͱRZLz 8z ,y y @-M @( 0T ЍpЍxx O-D"D2 0M Q0|00Pm@  0Tm !1 0 |0 30pЍX@p  0TU @J@@ DU01PEX %` 0?P00 02[ c  0@@0S 0000VUX= [<0  0 0 R     0%0@ B<0 00  0 0 0$[H 40 0 |0 30ЍO۸ <0\ w  w L @- M@`3)`Pp =P:000 U !) Ѝᵸu @- @] 0T@襸Du @-M@M 0T ЍЍ@蒸u O--1!0C$M0 BpPsr[㰀 0K 00@`Pr  X  BQv    Xk 0U @pPuP 0@t@S[Z 0`Uv`:00s0!0 1(0  0R 1S0"s0&1!U 0 0C01 VP05P 501>0C0.@%01 U@[* 0(b僐 X @0Bt@S~[a{zyxwPutsrqpo'X0PQ* 0UN X !    {     rT    r0P@p0uP @[t@@t@ 1[@t@@A$Ѝ0   r00 0  r0`Fv`00s0W00s0Q ` P0M XC-Mp`d@P%  _PP 0!0 000 0`r 0@@!! 0 040000 00@PЍЍA-@P` AqP00P 0p0S   L| P00  000 0KS$1  @p  P ]0  P 0 0 0%WO-MPp@Pk 0   qR1 岡-@@p^C z`P0I 10 岡 0@0 0D000#!"ᒼZP@ Ѝ S`P0 !  10 岡 08P 0  00 1@0 P@Ѝ  ЍXAA-qPQ A @pq  qQ Aq⁀``X  0!0 0E Bq0 @r0 r R  Br `` PPV0P00 0 0 00 0Q`O-- `10C0s00C 0i P0 0RpW 0 10C0s0R p W`0 R  `p` 0R ` iP ` C-@P`Qp$M 00 WW 0GS ( S񏐛ySuP0GS&00$Ѝ( ?   0=pY 0S !0!0  PH W W W(0XW p W  P- H⨀Hx弁HW$ WA,0p110C0s RBk  x1p崀P P,0p1! B r RJ  Z1p 0 P弁pP Ը0 00 P(0r00㸁(0p= `P 2 00$Ѝ0SH 0SE  0X@弁9W` w 0긁0(0弁⼁(01ḁ0C0s0xXZW( p W  7PtHxH꼁, 1 &Pd 0WS<qW0G 弁,p 1 PK 1ᴀX0C0xs0XX0H1崀ሀ!0  1{ P) pp 0Cs 0 각 0H⨀Hx0!1 p崀 T Pp@-@`PP 0 00(0`00Q(0pO-@M,0 01 pP@ Ap@D@t@T/ `@r`T PuP  PN 0Ds0P @ 00!01P0 @ 0V PFuP 0e0P0p 0Ѝ " VR ! B r R p 0 `ЍpQ AP P  ἀ@P  㼁0S0  뼁0@S\ 0H 1pP 1 X0C0s00CR  r DQ  " ZQ` P] !@ B  B  `PM m Q0S0 F@UTe \Q 0R? `0E 1pP pa P1 0p1pP01= P Y @T *p . pA p`M  p$G `:p  A1@D@@Dt@ vP@! @1 0P rP`F!@Dt@V@ `F!000/U @-@P L  0 0@ (# 0"D<O- t2 (P0Mp$@ \0` 0 @,2  p@@`P0 \ %g#" ," , 10&&e!"e+" 0 10`0 0p1@0 `` pP  0 0 0`.0A1. @Z98#$5#l  00# 0% b!00#b! @00 0 P 0P`0 `0 0p0p Ѝ;/B:iA-pP@ $Q`?PU(8 "0(0 0`0$0d0=  03? R0h " 08R(@R )P@ b"8 ")P8 b" 0A-1?`P@p @f(XR @ 0刁$0@pG0( $0p. ?WH@`G?`@`(`0@ @T 0 0$ < T 0$ ?pW (o 0$ qp0 p$0?W@`G?`@`` 0$ <@@ T 0$ S 0$ q0 0$ `R @-/ E@-@P P Ό 0 0@ (" 0"\6R @-l/{ p@-@P X00m]\`  0 P! 0$$p5O-B \M D6  0  ^,  ~?  @00 ( P0 , D0 0 H0$ 4 p( 8 H4 < 8 0P`L $A(@ P``p, D000$7)$970#%'ɂ%)' "ˠČ 0#ˠČ<0 "$0  (&Ϡ' .( 0  *  )'& 0 )0冼᧳ . 0<0  4 8 ,  ",0+#)0 0# 00 @ 0Y0$(483A00#a`8`pIF᠎   `!7p! q9ǀ #"Ǡ"97Ɍ,;(4%(0#4 `,`@ 0$P0#0p`+p ?(P)1 ` =<;:9876543210/.6P ڌ6P 0P#0Ġp 00rP0?CP 0P 0# 0 0|p dЍ0 0  +0#0 0bp P4 0 # 0# ,0#0Ġ 00P 0# 0#0Ġ0Ġ0Ġ~0Ġ hU F0# E0# D0# C0# B0# 0#f3Pl @0 00@43p0Y <0#d G0#_ P@0 0P0@4p[  ?9 *0#D )0#? (0#: &0#0Ġc 0#+ %0#&0R 048 0 0# 0# 0#  0# 0# 0# 0# 0# 0# 0# 0# 0# 0#0③P0 0# 0#0•P  0#00040 0# 0# 0#0Ġz0Ġud 0#`0ĠjP0Ġe, i+t*@**(*H(d&8&`&<&:0G-` Mp@  000 0êԩVJ QP0S ePPL W`A 0S7 YP= Tp8 T 0S: MP8 @V (! 0S01P0PW 10 T @0@0  x Ѝ WPTU U @ U U X00YY RO @K8: {l{<{9 9 |9 X9 (9 (zp@-X0@T 03/@TKdPP G00@T 03/@T\<p8H00@T 03/@T$pH8 X8 8 7 7 7 0@-\@M@P Ѝ0P  0P pЍ0xO-pPR M ഁУ@  `880 S" 0SJ: I 0 Z  0080 S 0Q>0 3 0 0 Ѝ 2  0 0 2 08 @@ @ Ѝ  P00 0 00 0 tP00 Ѝ᫭P   ꤭P  000@-0 P R@MPQ   0 13/Ѝ0s?0r? 9P100@-@P0U1!^ 0C BS \ L0D0p@-P`V@1@!T 0N B@n\pSVpG-`P @P0Sp:ؑI Y `1`! | O PU p @PpP pPO--Mq 0:P pG 0& PU  @P 0U`1`!000  0 7X0 PU0  ЍЍ0A- P@h P 0 a`F \ P@D pV: P/0@ 0A0S*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:B080pO-Ÿ2 0|M@R0t00P`\ 00S80S `h"`2 0 t0 30|Ѝ4P  ͩP8 p0\ 14p0p`0$  8 0 0 `[9 P%8pW= ` ;1!040 4PU 08  R88P@PX`0 A@8Ы 12480Q8p :#0 S 08P廫P8 kP 8 ` 0`P 8p0008P圫P8pm0`0h`e Ȃ 4* O--ɟ M @pD$\  0{ `Vu 0H"4SkSi90Vm ,0:0l`000P.  ]00\ Sx S`PI \0P 0  0CX 0 !>01H0(0 p0S(00S0!Q0:X Z c/ \@ c/<0p 0S 0 Z00 0p 0SZ0S^00H2S708 R,0:' 4P0P\ R,0(P,4`0( ᕨ@ 0  p (`V 0` 6(7(0w_V704`8X00 S  0 \ V Y P! P P X V0"2 R8\((\ :P00S 8Q 4Y. @ [`@' X`D 0SV 0 PZ【NX 0SQc/ 0 0 0SP ZB !SR@T 0S $0S  !l0 0S 0@T `4  P!SR @T n0S?00Z【 c/ \C!SRr@T R R 00i"00$3 0 2 30 ߍ  p 8Qf!SR@T )0SA00Z【 c/\p0@ _y+0 S c`aũP((\X` `0ḩR48 0\R408  \P0` @ /@!SRG@Tf `aX P2 `0 R(S VPR V`Pa `8@40p !SR0@T 0S00RP!SRf @ f@ `` 0PP ` `8@P@0@ Xv x@ @@ !SR @T W0S@ Y< 0) h' & Dz " \! 0@-Pd@$M@`@ 080040 00000_0@$Ѝ0t O-``ßp MWA5SQ`Pqx q6 @2 0@T`0  Q2@0"B   R R @ 0@"2 0 0 30ЍhTŸ <AЍOT 04S:`X ~> P Pp`     `X  TpK`PYH  rT  QX ( Q  ` T 04S`XA @p~ _X` `H`p\`@ T W`@Z~~ @-@0V@p Y ! 1E@pU VYp:q?oT20S@` Pc0j 0 ^Uu @j j t t Li Ph @- A0@ @ €1=p@-P@Q 0P ! "0 2pp@p@-@P` VP] p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/0@-@!@1 0 MR020* ^3 0 @TQ*QQ P1D"Eq0^ R QQ*QQ  Rl d0 0 2 30ߍ0D800230ߍ0@ p o o O-p0$M "!  0 00 P0@@࠰P{+ (P P`% 8/P 8/P8/PY  0@0 S00 0 @0Pc8/P`T*0 0 @T:8/PY Y| 0 SYy 00` @TP* 0 0C0C@J BS0!AQ RS Y B10V T0Sv* S:P 0pC 0 00j0SPg0Pp$U\*`c⃠@W*0 0[ @ 8/P Y Y 0 +  T [0P0U:$Ѝ  00SjY 0 0V Y0 00 0 `r 00S0 e0/R$ЍY u 0 S 0 @`YF PSc  BYYt  0R08/P8/P`P08/ PP 8/P0 PK8/0P o8/P 0 J0P 8/P S  8/P 8/ PP P S*0S : 00S  fP 0 @c P0 Y 0 R0"! RS  B#10S 8/PU 8/ P PPL8/P8/P8/Pv8/P``o8/Pu8/P``` 00S 0 0C0C @J ES0!s 0 0C0C @JS E0!hR Q0P:Q0Q:ʠ@-邾C- 4PS@ M  $3/`t  0 )QP`  4P4S  $3/000 Ѝ^ 0 A- 4dpV:@T@T 0P R 00 R 0 00 ⠣@P0`0dp@A 0A-`M p@@P"0: S{PP P\ 0 tdЍP00ЍPЍ( $$4/p@-P$0r0" @`Pp4 $ U0000C0  0R 1 00 0 p  0% 0?@d  0@-S N  0!AR 00A0 ?O-4MSw`A`ↁP@p0 T0? S-Pj $ 0  , QP R$R PVS00`000aS0@ `d 0V 0  $6/ЍS    00`S0a  R` 0 0 0  0000Ѝ # 0  0 O 0 0Q 0A00/0@-S@  R   0 坣0Sᘣp@-@PT @T 0 Xpp@T協P`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 0 3??oP//RQ3@-p0#03Q00S@PMVЍA0` 0 P` F$ `Ѝ%S T 0`@0 00G-SI 0P{  Rx p`@p) ]T B,B R  l R!1@  0 0C 0  ` BR  T0`@p`@pT  T 1+#,03/P0`0CS@D0R) T1 ! 00PXQ}R],03/PZ ` 0`0CS@D0 T0@pT`0  .P@7Pk00S *R *0 00PO @D R3,03/ PDRr* @ 0X:∡0P3  H  00 Z w0Z0C00 00VP  e00C0000@L X000=P~ 0@00 0  0 0% p@-`PV 0@0@DT`0@T` ,0 3/0Pʼ0@00pD0Spp@//0p@-@P0 `0 Pap> 0P0, @t PnpY h0@-0M 0 0000@>S@P  !02300  <P0Ѝ 00C0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ00- M ЍH-M  0Ѝ- 0 0 0 M ЍW R q P 0S/ /@-0 00@0S 0  R 0  00c0      0R0Kc0 P @P &0 0 $0s0 W @-@`p`pPM p搓P0:*C/o" R; 0  S  L 80(0P  Ѝ ; 0ЍlV @-"2 0lM0d000RP@ C 00  "2 0 d0 30lЍ 0`0S pm0Pq L"L p PR00 ppMPP0000S!$p@ >Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00 +{ {*{ 00{k 0SP ` 0j ppp  00 pH_Px U U \U $p@-@0MP000Ta7V( =0T!R O⁚0T!R/0`" 00UTX!\!R Ѝp@ \!00Ѝp@00UX\! X\!0 000S/Q tp@-0 00PUp@000TQU0` TQUP ԙpX1P0X1֚0T0`X1dQ th0h 000S/@-@0⹙0X10CSX1 @ⰙT1O 0@⩙P t0 000S/gLP t0 000S/p@-P@0␙U0 \AQ\ X10CSX1 p@’`哚0T1Oٙ0p@u$P t-X X0 04M 0,008 00 0 ,0 304Ѝ䍸xO PO  ‘t,@O-MHP@QD0@U P0 `8 `pVP0STA 0ST@!0 0 $0 305,Ѝ 7 @`1( s0@$S V $ C0S 0S ( !0$ R0 H 40 0 $0 30,Ѝ@5BP7 6 \(6 O-p`M@ P-TP +T@`00T W Xp p 0 0  ?0X 0j 0   P @p P 6 Q P  S  R-!P 00Bs ^a0BSW0BA0BS(70BU%| X[  Q P  S  R!"00"00 0S \0F0 0 Ѝ@`p00XS00 C R@0 p`0 A BRWvp pup@-BR"^< p@0007@P0T0Pp2 p@-BR"^p@$@Pm0T0PpA-@P`aUT0p  R *P @QpR JT@p@@Bp>@0 000/1 0</0 000/T1 0</0 000 /1 0< /0 000/0 0</0 000/0 0</0 000/D0 0</0 000/0 0</0 000 // 0< /0 000 /x/ 0< /0 000@/4/ 0<@/0 000/. 0</0 000 /. 0< /0 000/h. 0</0 000/,. 0</ @/ /H-M 0ЍA-`pP@(# W@@@@-@M/" R Ϡ?#0! P O, P!Ѝ  0S RP/0?c0 3??oP/G-QP` pS Wb PRSW Pi 0Ct ?oo0CS00c<@SÁW B  sS& o?oHX@@ 0h0P<SÁ0Ϡ 00 QX@P0WP@0BW00R( 0b /ob0 5?oo0CsP! X 0h0<SÁW W fo0`05@h>0Q^@<Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /x 0@-@ P  000` / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R R  // U /Q R 0 0S00/0 0/0/00/Q- S Q P 0S Q0  0P 0000@-Q @% TS$ C0 P @D^TPPU0N QP Q  00S@ 00Q0 /0 U0/Q0@- S Q0CP S  @P 0@ U00Q 0000@-Q @ TS Q@DP  ST P 0 U00Q 00S @Q U //q 0/  // R S 0Q00S0 0/0 0/0 /R  Q 0/0 U0/0 0/0/R  -/@-\00 @@0S0s R S   0 /U/0 0/0 0/R S Q0 S 00 /0 /U/S0 0/R S 0Q00S0 0/0 0/0 //q 0/-Q S Q R  0S 00R 0@-Q S B @Q R0C  SR  @ 0U00@-0 M0| @000!00囅囅00啅 ᗅ4 ,0 0 0 30ЍE , 0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$ $0 00S0/ t@-@p@-0@ ,ppPs0Pp4 ////// //O-qPp@`T4M z10 0 $(, ( 05/4Ѝ0S-    q!Sp0S S9 3S0SQ00 X00Z00q[0 0 \ 00!" R 0S@L RT\00  L00 S00htdP<///O-˟ MQ 0 x; 00$0h;0 0 0%SS``S; P0p  0GZSZXWUTSRQPMnJ~}|{zyxw?>=<;:9876@43210/.-,+)('&%#") UP.% .|x`\rIRW P 0,p,@``P@^T V Z`4 ^ \ [0ʄS0CP Z0404 R*d 0PCUPE_ [ 00ʄPU*Y00Gp00G S`   0 00Sp0-`p Hp `@T u  0P 0CUP0 `e Ep xp `700 `uG 0SU00@P @UP0Lz 0V O   0pp@ p*W 00G SPpQP00G S+`p 0 pP 0`ppV `pP ` 0,@, `7 0``0` 0u 0SU00P @UPV0LP0/, ` `u1 QU*P @3 000 0 3plWp 5p倐2 0 0u`` 0 @.10d0Q00 S000D0@@CE @B 00<y ` `( 0& 0`uS 0@ 000 !0d00CE @}d< `u ``f P00%0!P%: 0@PS0 0 i LdT0* 0P0C@C0CE @P Z  04t Zr* 0``[pʅ ^kAQAf [0ࠃʄQ*`AQAU0 [ 00ʄQ*0M` L r 0``0 0|0 Z0J0@"(2 0 0 30Ѝ  b 000?0 ) `0 `l ` `` `P0` @$00> * 0 @p` ` `4 0  @00r   0 0@ p0@@% 000 0 0 @p0F@D  0: 0pPUP 0YT0 0 tD hT$ A-`T0T 0pP@PU J0PES 8/`uX@pW x 0SS S 0R / 0R0@o/ @-*oG- @ Mp<čP`0@  0 @0 <4 30*ݍ 08p ` 0p!P t 0h pL+  87굧 (8`G-0S0 S,QU) X&p`@V 0`S  0P0 S@0S 0S0S0S  P PU@0@\  R!R  R0 R RO-- PAM_uP MUčHd 3 p ԰PE @PU*:0 ]nP @ V:oo0 @YP00S/ SB`vP⨐0pS EP4 p 0O 0P)0S1Ss/P @`TP00ST`0v_Ⲡ0Sqs`V0@  ^  0S< X @, \P Tf0<0080v?@0h0: 8 0T S<0#H 1S0 x00S S00L01< 021l0:ATX0D0Sl00h040800*SAT} H0@P| @0PpPPwz 0;4@ #P @0PAP' 8 <0 @8 @ 0 T<0@ 0P  SP  D0S*,0SU < 0 h0 S00D0#*p㐚x`tP6 0  0P4/PYt|*h: 0 6 30ݍЍ0X0 040T0 m pW5 A8@P@0Ppw !Y~@0Pp/0 = 4`0 @|P V0 t P> w<0PSP0S  P@0U  00P`F $0?kE0(0 萰 Pd1 0ူE0( &||PI [0Z  QP `1  0 80 (X0,0I&  R ,0I/0,0~$0 0 A0 SQ@0b0!0p?A9c!v|P 0S @0P 0'0@0'0  (,0P,03 Q#  #64 0 P0`1  0 70X0 ,00 0 0  ,101 0,0`1  0 60X0 ,0p0 O 00 L5xP\0,&0<  X␋Q80x00S;0L0@dD4  .fe D: TO-ß BM M`$č@pPP\@f[; 0.[@[VS5.K2o11T. d1 0T 1 #R T4 00iP 00S 1T0) [ 0 '0s"2 0 $4 30Bލ Ѝ0 Q wPN l"PH T4 00a0 D DR000& 000SG .SB T400P`0=S 1SA S5 S6 T000SB 0sK0SP0S ~e00d1  @@T>00& D DR0 0 ! 00000S0000   R00S0000< !0T40 0P]8e00W@;0eQhX @   p@-@P``vP p@Mp/G-p0xŸ`M P@`#T V l$"!3 0p!100UϿ@0T 0 `Ѝ10 *00B* 0ǃV`0 0  0 F6dP0swpdd0SUPP   B R`00 0 BdP dddd ⺐H`Ѝ0 `F 0S0 s dwd d0sd0S  0<H0 LG-@0`P p%@D T@*)rdWpld0`  ad ^d0 ?0@s0?0(;7 ܅܅G-@`P p崒Ḃ E0S@P0WU! 0d@,dP , EGp#dE<O-0P䱐 M0S5 @@d@t@`p S S0  XP&  RP0 LPI  EP00^ 0  SR 0  SRS Ѝ"Pd1 00d1 Hं"P0    P  P060 "P0 x P  P090\ `000<Yi0:0  P  P090090| P010r  P020h  0P0[^ d@ ?R? # } 0 2M$ 0P0[C @ ?R? # } 0 (32 kP+ @ cP010  YP010,DKHHJITĂXL0IÎ\/h.ԁ@-@(MWtxAt% |Ô0{ D   0  x{ 0Ctx(Ѝ ā@-AMT  s0000 00tЍ@@0@- 0 A0tMT0l00  s 0P0#0 @ 80 0 l0 30tЍ0@@ꠚ `A-@P`r 1!01n0SPpvOPp Orp0Sp@-Q@U x3s|p #01P 01000p/rcsVx(rP //SP //x~G-P`@>V%0VQ\@ 0\!R p Âp p "p O--Px+x; 0_M M050\;@0$0a0`T 00 c~01(0`,4 05@ d!A  d!. 0`11110VP  J0@ʏtz( p d10 d1s4 P- `@ |`0D@SH _j S\  S S00 Q@0S S\ 0CQS0 C0SQ00000`9`P ~/0 8 * 0}0+ 0NP 1#S;S 0(S# 8 R 0(S> 0(S 0(S 8 R 00sS1 S S 0( t8 R1 S S0S 00 S S SS@@ `0 v{_A.0P0@@ 0Q"0A'A+S? 7R1 S S00(R00S 0`0 S S00 t@`@0S S 50@ @@@@@00@00807uO 0,?*0HPd4@ R`P 04@ 0R`Z`L 0d!S 00 02d1   Aup0 |3忩1|qpA τx0`0S [ `0`SH@DH .S0S[ P`.V00K[0S 0 0\YP L% 00<%004 0 5 30+_ލ Ѝ0, SA T T0 S400: 0弔 ᐪ P$P,p T T@ TT  ;T RP@T \$ ` p ;T 0s000@@T  SP 0 0 `P  80  qh1@P! @@T;T 30 0s000@@T;T   8P 8 l! X@ P,ph3 Rw1 S Ss0S] 00 S S SS@@R `` z _AP@`0D`SH  \R?* S S00 Q`0S00000* }OP.P `Wz 1x#|#IDQ aD@`6~Q;0 SQ  P 8 -0!! 0 h13?S01S 14l1k 7h!2/R!0R$ l!^  `'M 2 r(^p6<  Qh|@|~ )domasearnamesortoption{inNerpyD7pww 0wwchsss!1 p@-P@hl(M QP T 000(Ѝpp Qx#r c/pV p 0xP005pPT $000(Ѝp̵tq0A-P RP0p `V pP0\\C\ `@`@ ꃃ `` O--40OMP}0P:  z0P 0 0@`         SpP O{PV" RP0 4 0N/!I`#Ve 0PP /{P0S V00/ R' 0 I0 @Q1 P`   0`QUI #V @Y* P !  0 |00 Oߍ ᐪ@ P` 0 0CQ*00 0 S  :C X 0 q:H00ᬠ@ @ p`R    YpG:0p` p` R@ H:T,  pX:  r0H`V  0 C| V 0 j8|} 0 v0   0 lr @-<0< 0@P @K 0 0| h0p@-0PMU# 0U#0PUP!@@``FBzP $:zP `$0!E1(`P 0Ѝp2P'' O-Ff@0`S M, 0 4 & $0( |V|FP@RB 1ȖqYT0i(1<0 BRO#)16:  50(< ܅ 1 c0Aş0 p('(p4 < P 0(0 PR hup40SgX% 1S H 40SkH6S (% 4 0Sup00S S404 RR 4 w,00,000Sğ0( 0 0X B2*3Q Pq Q^P( 0D$ Rp (40$1%40(8(LiP0440^# 0(p Ѝ! qQ 0Q*# 0$|3p040(P8p!@(%01Rx$#30<!^ ^ ഇrp S:p 0("< !0(0% P\4+|20(  l20(<  X20(<  D20(< 020(< 20(0 208(  0聟0(0( 10( 긁(0(10( Q   x1x00d10)dp (4p Ѝ:p P5p 0s^$psp_4  Z 00K {p%  gg8$flf`H,eep`e(ܧhd c|clX@(h4HlaDa`7O-41M0 X C* !1 0aQ ,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y$00 Ѝأjjii@-$0 0Vyw4 XYA-@@`V 0 CQPqwP pG PfwP 0`0H0f@-@00 R \\  $0!0D0 0@ ($ T꜡H@-@PL  0S  T0S@RxPx@MxP/0-` 00 0Q,000 P0($0 xp@-@P0`D P 0(S  1T  0"00o`pp@-`0Pu@P PuP 00p/c A- 0@S  1S p00  ( $ 8PP(p`0S 1@ ̞O-|:|*4M 0 , Rz pTT: +^ 0,0? 0,:p` :0Z  P^?^_00}O00 0 0R `^ :R ,0 00^ 0:S Ve \90 P9Py00H9HY0pP0 00H4S   !$RH S(QPOV` , Q 80( R? |800 R? l( 0S  !R L8p0p( $ p b Hc@(`P 0!4 R B  B QP70 pH'  ( |'  X 0 hG @400 p20  0H0C(01`,0ǟS0,0(0$  00$$SfS_(@CPs @T  B P$ , R  A  r,p p$ P  uP p  B RS RA 4Ѝ50PP @ `%0 0 0  % 00@T:p5 B0P\500L50 4A Tn 5000C?00 P$ ,p0 R`1j#S$0r $ P@᠔ ( p 0! P 1@ V @ P $H$ $`V $ `% @T: $ \ 030$@ \ `(0pp00>0#0 $0T` #$ 0$`1,hC@ 01$000b`,0t,0 PY `F `$0 0,P (vP 0SJ P( 01 (0uPP$ 0`,P1 0,P$`1~PLw @` P $m0b$0`( 0$`1j(,@@ P $hvP, 0` 1R(0 `;1!0<0 ^ςS0}00@ P +.000@P$! /1:^0   ^00 pp<^|8 dd$ ldhdH[ c$Ȝ`L8 `^|Tܘ\ ̖\|ZltZHZY<[,[ZP4Y@-@P200Q  P   $00<0 0@ ($ p@-l@@`VpPPpR0U1pPE1PSp ( 0$ 0ptQA-pA@PT`QV0Lr@P 0 pPP``p`(`,`0@HWA-p`@/rPP T  0 000P   W W@-@@0/8O 00(/Ḑ000/ᤐ004/ᐐ00/|00/N 00(/T000/@008/,008/A-x``PU pqW@Pt404 0 ,(0 N q#ss/-< <0  M00( $ u ЍTM x!tU@-@V0`00@Y@-@Q 00 2 ) 0 G-H`P@pM[ 0p TW 00K 0 000 00- 000 0$00ڥPP: 0 2  <R 2"  "V &= " 2I 0  0 qppn W* W+ 000@廩V dP@Ѝ00@T0-00ᐥPP 02 2 2: 2 (eP)0? 2< 2D10 04100(10 0 10 0100100100P 0 R00   0kT 0 2  13/pl0SW 2: 2l P 2 @0 2@001P,004 <@p0QC-@`pQP M '00EPEUC\A@E=2 2 X 0 R0S 2 +13/PP"?o2R03S HHPA (0$( p 2P 500 Ѝ(0 $XP ЍP00 Ѝ(0" $X000X "X00"?o213/pP  Ѝ@-@`pQP M 00U,0`V( 2S * 2 P13/PPF `P 0 p~ 2P 00 Ѝ s Ѝ0P0PC-1pPS M-:b V%*AYp pY 0 S P Ѝ 0 H P`V: ЍqP `W 2< 2 ЍO--rMWb9*0P:A̱媛p V [KDp@P+ Á @1@DT0 @ 2< 2Ѝ0 @D* @ P0pSЍ0 P ЍC-"1`S M2:rWB R"*T$* RU  R00U00SR t0  PpX U"B Ѝ 2< 2 ЍipP"! ЍG-rW" RbM"*R* 0 @0\ U@D0 { PpY  U 2< 2Ѝ"ЍЍG-邀഑@ 0`P9  Ipo1v`wV0`F1v` 0 \ 01^` |0N 0 L|\ L|0S00s060 R2N0C2p0@- M@W0P  PP   Ѝ0Pp@-P`@Q 00T T 0@0p0Q 2S@3:A@P p(0 2S $A@P$00C$0@ 2:0 2pC-P`@Q4M 00 Vu 2+ R2 13/p) 0 0! 2$  00 2 p`0 9/0P 0 9/0P   a0P 4Ѝs$  0qp 0 P 2: 24Ѝ?p`(0 0,9/0P 0 ,0S0S Q #$ 000#$ P0A 0S 0Cs0 Cr  0 Ѝ ,  0#, ##$ QA A0A̤@0@Ǥ@0@gO 0 1Sp@-@M PkaP8 \,0YP8ЍpmЍp/G-@B@M@Mȍ qŸY w@`P_ 1 R2X<0*%@R[ZZP ? B2< b5<R P0gpF YPhX!8 0 2 K؍ЍU9P`J8 8000S "! !.<L0L.8.0LL\ Z0J  CQ"$ C|࿥pp@0@0O 0 ꜆똉  ?O- P `j@P H1嫲p0q1 F JB  0000N`ⴜAO-40@S M0S0040000 P`D 0$p`B17v0C1f0V0N P V NW 0 ^V!B! 0SP|  R 0S  p`s"`fRΌ 0!2!$0 Q0A$0U @ UY  QRQ2QqpeWa 0 ᲣP 00000 pBA0 ЍVD $ U D L @ppB W PUgp1 PD D00CD0 0 10CR= 0 B Qs "00lRwp31pwpP!@ A 0$ 10C0S  0"fSPW1 +] 0 Ѝ RpP0Sʅ `P1D p W D wpPU PH D p BD 01 $1 1 X;::x:O-P@`Q M%0᳀Xp0\[@0T P> @Q 0SQ} 0P @P0S 0P%@P 0S0 0000SU 0 QP 00080080ЍO耝Ѝ 00008(8N40PЍ0000PA qC 0 0@q  0 ᳀0 00pG0 0p0@ 0kPP p@- @`t051@0JJ@0D @$ AR3@D$0@N0!PR T00t 2@@lRDAp@e2 O-0- `ş\MV@ `P(0P 0Y 0  P$ Q v`0 000 00p0S,`G80 @:`[ { J n `00K00Ჰᴠ000 R@ڴ R2 J 0 FP { 0@0<80 :y洠 0B,`s0, 0 A0 0 p000$ 000\Ѝ 0,``$04@At@Q 0$0(00`0000CSv@@ᴰ[ pW(swpQb@@QDQH ZPu   0  w000@t@Q@00 pW80S BAD  @o0 S0QDQ $0P0> 0 0 0? 000  0 6  01Q00S 00(0H00 0 00PL0S0 H0X0 P0S(0 `00n 0F40A0A,s0@TL000`( 00P(0 p`W 00wpS 0,p}(000040C(04,p00B00S$p(04000p,07 O-\\p0@S`P @L$P i xhP' Y  0z S40  0(10S0 1$10$10 0S0㍠P 0 P0S 0}P  00S 1$10$100O-@P M BXp0rQ `pV`!0 0Csp »0 p r Gp p 0LPPHq X]0p00Qd Q 1 !r[ `ರ K{ pG0㲰F0F000 Bೀ0@ര0@000  BrW. `0P1! 0{ \@x Hxe0 pWq0s00Hೀ0@0ഀ0 00000 Ѝ0@000``Fv`qQ 0 Cp Ѝ` PP 0@000 @pA-p`P@0R"  0S00 0ᛟU@ 2T8 P0X BPR RQ 0R0Ӳ00 00R00Ats0 0r0 B 0000UU800C80O- @T @P@D(0t@S(,W ௞0PPI# 4P @T @(0@Dt@T `pV T`  0 P``p@-P@ 0^\ ^ P0Q Pp\ p pG-@` 0PS 0S  0Q՞@PS#  00S p\= 0 BS5 P@ 0 \ṞP   00(!S%$! $! 1Q0 ᤞP @0弐p 0p 0 S 10 B\r ἐၞP  $10$1 !( 0 O-\0@0C@LS`Pp M P Tg fP& 0 0  _P 0z S0 హ Ѝ0 0S04P 0 0P000@- M@ P p10 Ѝ0O-M 0`p  0@DHPpB  P. X  z0ᐪ ⌰ ⻰r ^Რ N|ᾠര0 `p0`000S XЍ 0 P  Cr 0C 0@00P @G-plŸw?`0 (MR$@p_2 S?:0JS< "P| P崀2 Sk1L PU: C rX0: L|0∀1  p۸ 20  2T!L1 0 $0 30J (Ѝ P? ZP崀 Z 00C @ ஸ1x Ap# 000 p  ` 00 pP202 p VTl k A-@pPQ` M C00 2   Q a:1Q\0" B!2!0 0 VJ XGFZCBH@0PU; "R!* 2 13/pX "P* 2<00@0 PFP: 2 J0 EP VP V$P "0* "  Ѝ 0 Ѝ0PU "R:(0 $P0PUP`" !cP  w ЍdP 21 mTe@--M0 @ 0 0.Vh hP 0PSP000S 3/c VWQ,g 8 80 $0Q/ $0S/ f D <<0 0R/$ 0S/0 `f LA-@T 0Sp`/XP0P@Q0@ @@}e]P 0A/Pt4u%A-`MPs'fqA }hp01A,4QSX 0 0 0UpL|BS b0CS<S9TЍЍdtЍЍЍЍЍЍЍЍЍЍč K(00000 00 00,40000000i00)~ dЍ 0 0 0 0 0 .0寎P겞\?,%$%w%%O-@PMp`܆e3#ep#3H RPGPP/ H@ P,0@PXP f@QQ8@0!C!-\\ R0C0`20pW WT Z( Y 4土PPPXPrPT! c`P   PPc 0+0V!YqPPpUp`@ tm% B RLddddddZ V  X 彆 7/ P  R J $ d  E2 $ d  t;2YHP0S @a$\?,$%4 O-`(IwMpPׅd`` `` fp8pGW( 0RZ S 0 0 ۞vPePRP&GPzf0@S8PPDPPPPPPXP`PPPhH0@ SPPP PP$P0aP ` ` `` ` ` `$(,S4 0S000 0S000-6T0@TpG4;T` '3 P C`P/V  00010ST0S0000 C C0S S/R LTp}0Se (&tTm0: S (00/V%%00pJ`V  <PpR =PP0S6 0{P0@ /Q50CS $c 0 0`0SE 00   B R\ L Q,Q p / 0 pPpGp` 0 n Pp K/R  S/R/    C  R:  H#   30SS/Q$ 0S% +T0sX. @D!R\0PT!R\ `0X00: S  CCS0: S H1: S v : S  Sy  Sq P9 `6 Sf S0 L0S !t(0尵0 [ <H0  ['8Ÿ0 S802"-Q SP,0!SQ  HaH1: S 00[0S 80d!0CS80d1d!d<PQ X0R ,/0S !f0S !A P_W(0S0S 0 RSp!Ɯ0: S0 W ġ%!$%.c$ $  /U%6?G-@Pm\!bH&zdp@<6XP\`0K ( Q(0, PU`00 XP\`: 7v]$%x&$Ȳ&-w&&Y&$$h!&Tq~8O-MMpᮁb`G bp 0 Q 0 0m0(0G@-P񟗓꼤Ȥ      0      <         t  Ф $     H0@00$0<00D00000$0100000$000,00$0;0H00$060(00L00 00080S OPU RnR oR0P<0,`P 6]P8d7P,PPPX `x( $^\R4 , 05 `厒PQ4 1SqH0S880S5@0S2 L0SP uP4PD0S |$8<00 +`p P4D4X(D`尠UV 0PU 0040D0S ލЍP 0`@0S0H0S 0  %P L 3R㓥' F P3mY` Z HP 3 H\P ] 0br40PEP PPСP UD0: SšP4 01!еP4H  P  0  Lv,  ǡP 40h,YX 8SU # WpVJ  n00!"00 00!"00 0$0!"00 (0,0! 0 0004 0 008< 0 0 @0D 0 0 H0L 0 0 3]P g  P40SPP`S ,0ST | &\?,1%$%  W!<MYwA-0D7P000d0PTr0C?o21 `p 00C00S4 000-S/0 2R$0pP EP SP v  ]] [sP xP30202020100000C0㿨KP>кͺʺx|@P5 Thd喴0S\cT2S  D]00$CP@T "0p/S[/ |P 0 S:  (`p : P`b&$%gA-`P@MW|C3 0} LP  AK  LP  7K LP  -K KP  #KPH岺D3P0<3P P$P 3( 0P+( P3( P7( P;( ߷P?P ( P׷P( ѷP P8$@Ѝ(P (÷P0"(0S (ⴷP(0S (⪷P(0S (⠷P(0S (▷P| JxPah!p X.`PPa D1R`2PU 0E /R VPp(PU  00,0/00?00CSPdYP0$0~00S p厔0s00Pgg'%r#Pg'Xz#Vl$#E#غ&0&#A-@P@{Y`p K\p 00S VPSLP PP ``P $~ 0@V$%%0%wO-`pFMP᜖{Y` `  \p p6 HX.0S ЍfP WP! PP p `RP dP vP iP0p0 `rPxPpp0p0 p$p qKX 1S ᷸VDdeddPU gJP$0 S<500S5>2@X*/Q /P.QQ .QQ[&  Q00@  0P0SP$0`S0S@ pP PP0S r50C SWdd,dldd0$S P Y e&00 $ Y 0(C0S $ ?RR00R0SV1 $0SX  FP 0 0C0 IP 0S 0S =0S 5S 0S 0SIP 00 0 0;zX  PsKHrP k0S s0Sd o0?S` k0SNUS X %000: S R%  S/o" R 0: SHP 0S  P SH 0SIP 0S 0?S 0Sg'.$%Ў.. .A-P@KyWp` VZp 00S PA@PTpPp ?HP&=PW` /P 0S 0S0P$HP =0$%p@-PM㍴ 7 $ 0;GGPG@HUmHTD QGP00.CWfP30 0P 30S S! S  3H \3! d3 00L30S  R ,#6 R #!SR3VG 3 2 xR20S (|) 2 20S ?0S'002@T$OLP0"*@\()xB00CS00 G 0 < rG0S60016 R0S 10S<)L0PR<1)0 01 10SO 10SK((p1\1PML10S H10S d1 X1 0S '160S 0G*G@1 H0 1Q=((i.(K0S0F0S 00's0SJ0S 00='@`|P@CTon'E`$h'4i'q'Hi'i'h'0Eh$p$Et'$h'E/G-@MP wV2br@@0 S T SX "XpD 0 L1 0ɵP8| GPh;dx GPP;L8 xGP8;T< 0DS 00S8 @0xLY0QaD0@0 0Q)@0SZ L PU㙐a0@S񟗶@@@@ꀁEP `偐@@LV XP yVP XP 0@0 00 L PL P0@0 00 0 PLV|V#[D0S hx FPT ;R(%$%^^^Bt @_ht@_t@_%$_*_\?,\gt4_@-v(ERO-Mpv Un@0o0C?o`S20#3ܓ @@@Up#33 X XT 0S9 Z`7 [``3 dRPGPP u[H@ P444t4444`hP vP  fP@``k0T 0080 S1 : ZP @q[ A0S #S<D[  ᱿`PM 0p#?. \0P0 hp0`p D[Ep n0S40 080050C SCd@@@@@@@00S n@P0S/ C $Tp I"0 3/P00S 9 $T t3"p[h0X0 0S WQv'_$\?,$%_v' (O-MMM`G4Jp^,5 00 5Q5005 9p 00BP [ = PY P㴙yO }P ZPQ|㿎A@6P񟗳H$0< hp0USxP jVpQ PQH 0(<ȟS SS{ (f055050050505 P P^Z yZ : p˿0"S d8 ) p 긿0"S   p0"S P 0:pR[0050 00001 00 00m0k0i  ^@ ^  ^ QS00 00055X YaoJPU5SPP5`FV5S UU0U%0;燉pPl%5S 8fDP@0: S055PEUt@|P@V05]VMa4P$040]QdpQ82{PP Cd$iBf%hg{\D00 0$00( 0xBMPP#2 (pB CBCC峲Pc`0 z0S #P後p@Rdž0#S (IB8Cq0E?o2? (6BX<QPP7f/P]{X  aPPC`3Q600CS0 {P Pp PNU0 P00CS0{0 V`0S:00S:0d1V51`1S(1S Z[[Pdh!iBe%p2gV|QP 4i)]P,0V0< E`P(呌0`FV} 忌P  f/Ѷ0 ώT  ?L[Pu`v'pq@ddq\?,pqqqBqqq0qIq$$%x'Eqf! w'0%qpaqar%mdpqn(w'PC-ʮg 0P !@㐐`p@XPfP Pj`00CS`0 pQ@T ЍX0 X @j'0%O-P`@dMu$P(P,P0P4P P  Sp4pK[lTT1Z03rTdT00 0Ap0-t$t݋SPPP@STTTTa0@Sj3P0 0dT5 RT ST# QT040  坋pT[ S0lT[ 0 0j  $OH$ FBp8 dЍ $A$ 8Bp{ 848 +Bp( 8⬼ 8$U  H[K @M@P`p xv `[X\@T8 BpD:@:P,",#!" #"0 PV0U!  !P Q !,;0P 0[`&=Y@|@Ot=O4O,0w08hH8 pP0 @,U TS jO` V8 00P 0P:@P0 P IF@ OK$%W;B\?,~DcDp{D~|D(Ňч}D=PyaratcidZ%0O-XO-222422223220p _aM 000 pRpr>`PpG PC 42"S 200002^S R2SW10 dbV% ``L0៥p L3LpP  ``L0⒥ppd2S P@PX0: S0d2232` 3`Sd2S|}0 t=Pp0SP L #03PE/PF1@PC9P<D  X,8P0A@9Pj007000`컟 ,b,000S0?# 㥉0d204202020202 @d[dk @MTaߍ0220202;/`/P000S |jp, 00[ / `P000S jjp 00V / P000S Xjp 0 004*2j000 0B BP 000S /3 S;3Ť)00i 0 P 000SX"\2RRX2Xi/ ĩP P?PX0: S00y `P /M/ᯩP 0  &Pf>`P3V)>VK?p X:{\10 [xt*=[` H3!14@(S8=̲03%703 7Ԉpm7037 P ʴ0 S 0R& 2S# 2St 0sd =pDL3P0 P$5 f/徲H7w0L7TP'\?S@<"820,"(2 hPPO0 0  RZ$ 0JP$ `SEd2S+ >pX 3=00RX!\1 9\1X! 0 \h02T7,2P7p2%>pV%1=p` 2==`P%fiP 1k%)0%X'f1 SR Q  RQ!R!RS !14!8!04P)`CQښ. .a0C 2 0Ńh'\?,$%edAҰU%'x'0%]p'Q<%ذ'zd@8' (NwO-`@p̑́Q Kp%W㬑 0S 0S p1`VA P `0S Hޥ@`V-Z ЍyPmPPP fP xtn0@ S@l,T 0 0000000000pW 0%P .tPtP {8X\?,'$% O- 5 %$MpP 9P!!8`80DĴĄĤ00``` Jp6Y00S 0S 0S l``4pWQ* 0S00KP (F0S @<00W30S$ЍzPOPBP4 FPt P@*PT\`|$,D00009P02 2P20v00b 0 堘Fj0 0 P0 0^ d P0 0U 0c@傘PN,fI000E00B00?0 mk1 >0S 600000'000#00 00000000000000 ` `0Sh_P` 70Y0S 0 30P ,&FPpG 0J*0X27!X4'0'\?,'2$%``Q8'Bqk6Bg%O--MP0h_H e PUPEǰGvPlP*HP6 TP8 .8px@|p `,.  ^pqp@p!#0S  4 h40@Zpx t~m@ P H X P `  `("ZIp2 R Y R !$ Q P$  R  0*8|P8h -RH 00@00 00 p0@P@Ѝ0 0y ,,?0,0P 0000R0S f```0QpZ0S0S ~ 00 0@xp` @@@ @P Pn  03/p T o*t  $% a\?, _x%@-(@(-3,@?'%O-P8M -pF,8 0f`^ p p 㮀6 Rl,0 P8 /P0T 4P0\808ppHP,,F U86W`E`hC0IPHPU0 ]Hp0(5O005SO /5,* 0(0,00(00 0GP/PPP%PN~PzS `SNSM *AS> CSP 0pp0jEaC Q                pWSL4$  U$ ,4RD +K L J ~O c{05xN 0Vt 3M pH n$0%0!0 0 c '$0@S. pI (3V``R zS NkS CS BSHLS aSDcBl0CS>t          tb+b)ZimKPeH0SbI0S_O005S& L;P" T( KpH (0S  0C#P @P!#@p``Tp! P! P|! 0S1\!A3/ 0⌰p@ ?P\S/PPA<J/P010!0a5 HR #| 0 p)G5 P 0 I500 0S0 pV%'h%5%6`'(%76%$% l1\?,P6%a6@%%%r66--66I/643/i66"gui 7m@-fP ~.@H%'p@-D@DP"@( +p@1'%p@-D@DP @( p@'p % d A-|@|p `(P,0`8P@@@4,A' % G-`M?4PB)ywP<)4P0 Qp) Pp4Tq4@P D4@28ŸP8"0 0200@ 4 Hp HQ )4P ) @  p1a 00 @ p0 @ t080<0@0D00P0 0 080$@P  83 HL@P@T@X@\@HP妠 H㢠13/3-3 0400,0@@,0( 00P&pcPPUPh0PP 0/`Ѝ&E>ECPEE EUEYEpEp+ %)))$)4'O-`-Ph6MddF(`0  Ep<6X0K (V0Sv`@@0V}P 0SЍuPfPFP RPh g@PX| 000P0 DS}0#S 1P00 $($00S  $($00S e`P 0}0#S ( P $($0(0Sw P $($0(0Sk 0fP ᳫP9Aq 4Aq /A @` @epKWwQ2@23@0 RH0cS pS: bSAJJK[0 0\Z9W W, 88 0,3/8 RfV /d@z2Xi $2P?0 0C?oR20S` htZ|WJ% `|&00 0 00 00$,0 $00S WZ 0 % 0S0:10S1 0S  0P0 0  Q00s  `1000L,0 09282PX& S R 0@0@0 #  R S 1P(00s  1p&2X 1 02/G\?,$%<'8G$GFFGHGhGG%GGO-P@p'M Mfট$PP Cp6 @DT T/ TX 唶w`PK'ݍ ЍAP? a@PP񟗡t """"""""""""" " @ H \ 5P50S $%PW {e`pP%000P00` 5P L0P <+PP  P  P P( ]{- qPoPq/Y{00 000#0 00$00 0 P@i(sPPLdD?{(00P(X@SW  2 P |P( !uP( (mv@P` Tᶩ0P` 0(Ȑ⨀ qnP 00 00$0 00p@P sv@P  Bv@Pkv@P:v@P `ᆩP 偩P |P !g`LtP X  P( (`m` pP( !qn@PP WD -Pa>/pp++0S > +R /bPm`` 0V@ #r0 0/pp` `  '1P/0S` 00 000$000 e( 1p//ἧ0Pa0SJ+S'- 29S!S 1aV`@HLL$%E YLH'\?,'LQ<%dL h{LLLzd@edAp@-P@`2p@-P@`p@-P@`/@-p@-P@` p@-P@`p@* p@-P@`p@0O-nMM800䮟p4`WPI 00 >R㸎0 00>^(00㠞$000 Ap@:x>P10?0S@>D$RP$r R  $t <4tA؀ @0<4x00<$ 0/p0 yP >Pp`FB@D4TFl))))$/))`))))))))))@**)*)))0/))))))*+)8+l+++h,,))),-8-.-)@.)t..00@P d< $wPr Wtt  0< j <$$r $b@<ڧP ;$0 00 0 <L0(00 0,;0@= y \;$50 00 0 n(;(0!00 X 0 a: 0(00 ( 0*T:$0!00 0 G:(0!00 0 :X:,0(00 0 -$:0:0S  -P0 0H: 000 0  !00 0 :0!00 0 :0!00 0 (940c 00 0 (: 0!00 P 0 88괸@0S 0 kPQxk}P0@4v P@p 8(6x HPD40 ۦPD40D4Y  #0P(0O \800 1 D1 48C?  -P0 067000 [* G: P姘P/ ᢘP w0S 0T4000$0 <4 L!H\ <L:PFU [U  z0LVp0`R 4S<4[0 H$L40:.p`r@?HL480S $I?ߤI5HLY  $?Ѥ 5YHL0(4SH$L4R0 &,p`  +.p  4S@ [kP ?cwk sP `; %s`Pd%d.p X1: SD : $Rt,@P  4oP   P [Z3$R  $z?0$@0Bp!$4p = ,0ŠP,0 r0 4P ⱥP$$<03}p4p40S0X44SH0S4x2S, "20# 厥Pr 0T40S 僥Pp*0ST4S x3H#t lrP `3 `s'x2S 2H$L4P*pv0 $L4H1#"0dpL2 C  v$0+ pĮtX!  <P X 㽧L$H4#"0$R 0:0_Y :P0$$4RT SQ  Y  0_+p0 Y?S  S!0$Qh +S0$:$40 Q$ Qq*4A m`'`f/f f\?,'$%gg_fBq%dfZjVlf'llm5m%f{mfmnf %jP ggaSmAgWgi'egugghh#h6hh'Lh^hhhҰdhhhvGdlNviTioiiii5jp %yjjjKijP`f{jjHL$ Q,} Q+Q +*0$0$Q0$S\ 4S$pP 44崐S04144 0S @4S 0 0@4,4S $4R#1ѣ1,4 0 000(0 Vv *t *0S 0zpp@$ P& 0d!O9>0]KSȑP8.X Q(041$4+nT4S# : ,d00"'9+***T^+\4$H1H4L1x0<$|0@ 0%+p^¦\ۣP Z > ۞PϣPJ  <ǜp  T< : :.00 <O--0p PDMM⼓c4, <pP^3`4pGs04WY `&  "XaL 4S<44S $$4R0#)p @ `{+p : 4S P,0S x<x<D>x<x<x<l@00vbPEUU$?x<x<x<T?x<x<?x<x<x<??x<x<x<x<@x<x<D@ (P!p00( R0C0s0SK p ;t044s04@0 00 0 030(00 0,0@% l0 00 T 0 x\?,$%#h6hhiwZjVlf'lmn%fiwLhhh'vҰhhh5 }vv''Tioiiii0*00 +0 0*00 +00!00  0z0c 00 0 n10!00 8 0a,00 1hW410(40Ss;!YoP!s`8*p 4S (PP!$k0P0!   $(@P<2(0(p00S0 Z <00$p$T"x$` =0P0 r04P P"01s3m`$`4S80S4 1S !10 #4 0SDjǡP T3P#X\cUf000  $$!0#ap3   r0 $ rQpԑ 5P ` 4 t$$嗃r'4S 007?X  7 $tR $4&S 4%X0; 4 44 X  0'p0rXѠX0:S Q4S  0 ֟  '0Z00S '4 $!㦠X0⫱㟠X0+O-GM MPh ⫣똔D嘤 K:p40PEPEUa$@@5P+C@4PQDMLLLLxPLLOLLLPNpNOL8PLLLLLLLLLLLLLLLPML`MPlM|MLLML NN$NdN|NOPLOP 09 0r PP0P 00R0S Xp_ 0;8;08;X 00d1IQPn,1 P00S  ( ?+S2p PP000S0? < - 0< 0: 0 p@0 00@; 0@0 00 008;0`RMb@A?{Gz?eAЍ\?,):VǏ$%'@]{Ύ))p(X(%B)sT)|))Fp(̐)(5 %4%,(@( P[P0`00S0? Y0P 00@ 00= 09: PP0p0PS <> P3P00S0@S p0K 0!; 000"* 0! 0 000P1 P00S s  nY <01 ,)d )P 0: 0 @>!.v8`X2[ `2`2VȌ0 V00̌ ň p+< 01P< t 4o 0@ @ 2 0@TePg 0C Sd0400000,00(00$00 0000000000 000000l0 0z0` RB @@-3뤃夓VB 2s8;p 00 L0B%p8; 00 L04%p$8; 00 L0&%p`8; 00 @L0%p 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;`+  @` L0$P8q;"0#10@00 0pKpQHE  p   p 0$PLK0S `` K0$P? 0  00 6$P 2d D0 44z2868v``0 D$P`d6d&d$l㐐!2`(10kkkk,a0a4aV 0P````Аw)V<;SVq$>@ #rz{  A 7䛟:S_$@ rVz{  A 7I:`"2RifT' A({ @p30S 0 *' 1(@MHIN2 X0弅"pX00 @+X@0V0 00 D1@0`" (00S O ` 02#P$Gy82AQJq#`*okfik{{'8Nj@A@G'@8HIN;*V ({*X"P*)U8 0S4 Y)@>0x`T0T00`0p+ts"pP ֞0S D){#t;@000!R<  W0 0 ,)|C \1d2"SS 0  -C6?8~A$@@@()u%))R)%( %!G@ 1PS! 2R``@p~'V\\0!Ld0 0 d20 !  ,  `0c'0hl0^'?ph''{{7{{{3{{ {  M@ H')*3`f03 0h 0S hߝ`h2d0h220Wp |-C'@0 0H 0 0+2 0BS* (S2; , 0P;0pV*42&!00ss0S 0 0@ s0r 0 0 (1币;    0;~0 0W |B&@0 0H 0 0*p0Y 0(1 JfP@0<0SRW  (0 0RZW |B&@0 0H 0 0* 0 H0D p,0lph0Zp!0 0 ( %Ñ>)%T)s}0CS_``@c@claaaa@bhbbbbbc0 *P Q:`<`D`L`T`l`t`|`````````/ 'p`|%&/|x0 )PL X0 )PC Q,aHaPaXa/=&/0 )P$ %% y/0 )P o/0 |)Px 0 s)P Q Q @<x8v0 a)P ~0 W)P 0 N)P 0 E)P 0 <)P 0 3)Px 0 *)P T0 !)P 0 / `` %)p0Sw ESm S W |ZAI%@0 0H 0 0H)p.>Œ EYqѓ %7\j{Д/|H^ƕ֕$W6>,)MLRS<0KX0C W [B0C<0<00C <0H|. 0D0Hf%D0X0  <0K+0C;#<0 D09&D0 <0 RKX0CWD0* +X  $dPWD0 D<0h.<0 \帋|W'&t[.p 0D0H$%D0X0 D0&D0J.WE.&O-M`PG@0P-S@᪘P0 @04 $t1p$+4QP a`F0pP[N+PijQLpGK PL / itP@ X3\C d@P $hDhDhDhDhDhDhDhhhDh,hDh8hhDhDhDhDhPhDhXhDh`hL@0Sl( @HGG 0 0p* *Y `~iZ'4b`P*P`4b2 R =/ V/0 S 1/ ,/U+ 0 B/!/0!00/XMᣋ㠋㝋㚋㗋 㔋ip8 0_p0S X"` Mp0Sv딚@<0p   . 0h VpՕ`T*$% (@͖ߖ(X$aU:O-PAM Mʶ'@`-눧P |'Pt7tW00-S% *P $*Ph @ p H PZ ,`F0S0 ` @DDA@Dv {0p ,0Stb@qQ 61 Ql [*P -00 (`@Z-00  D0B5S񟗌tnpkpkpkpkpkpkpkpkoopkpkpknpkpkpkpkpkpkpkpkpkpkpkpkpkpkpknhnnpknpknnpkpkpknpkpkpkpknC 0C0 0B 0 B "00P00 C0 2#10C0 00C0P00C1# 0 00C0P00C1#0 00 C000C2#0!qp4 0P 0PQT+SaĎJZ2V w`'os`F ]P$ 0SU030#:U 5%PXqP Ha%1 0&P&T6K/r0K 3PvTS0 0R3# G@RPEKX!EK/r0KP"E0<6S"46S|" 02Q|" 42t01&ύ\)6S L$OKP W0`W 0 P0 J᳍,6S m/PP L"㜍<6S46S;P1|Q0@6D&Sl1 0 00R\!  H&PRL! $&R@! 8&R4! 0&@R$!  !Q   @   @h&@G t0P08J*\?,$%P*PTK*HK*5(@W% 0%Ifxz(HKqNQTiG-P`pIHM (p10PEU& JHP h0@ S ShxHHIIg00pa 4寉P ` 1!#a$PP _ L`$@@Ȁ`(` `C ,jP P^0S PxW cP X_0 0000 0"%\?,$%ҰUP**_yt Ct 0G-`HMp0sF C S 'p 2B1 `FS 1S 0$  !RS@$ P+PT^!PQ|u_xP`PAP MP2 Ja0@Sꈑ 00 04044041! 00101@30@3101101101101ДY 000 0RHЍP #PPp   _0S  /U0#0 +`PMPV q V U`FV R $Sa (08 ]V ZP*\?,$%8"%]P*%C-Mp`<q@PV &p-6TpF`F5 VE@T TYP DTP\Z0F,V &p6PU 5 `V V 50S aP tP0S pY500@V 0S qpG YP`V  \\2# TL.#tP9@PA0@3S,DXl̖Ԗ 4HzP0S<0S00y0S00S00S00S00S} 000]00Z00W00Sm@0000K00H0 0E B0SZ<0SU00SPP0$0-:FU 0SA 0S 0S;`V UU5eP t`P |[P& UH U U6PEU24LU( Q WP! ] U4 @U U0000  Z  U QaXPJ!0000 0 ZP  X X$0S Z X p "qp剻*x@x!T  0r"600"$0h!$P @ӋP ΋P`T!{U*$%w\?,%G < /I\lG-@PMaqM $p10S `A⼑P R ލЍRP fP74n\PP\ \X@0JpP1 JMP/0: S2  S)J U\P0 JN@~p 0 4S00p9w20S rp hJ +\PJ $\@PJ(`U*$%SC-PGM M!0L?C< <8<8X@8DXÁP<0D80l8"=`{C0X `XdXhXpXtXXXXXXXXHhLhPhThXh\hxxx8坁PP   P:?! 0&\K  刁P; <@P !PL ;T(X:@ᾊ0P`l+TX8 lX;P  0S<;4+,0Kh8S <PUD hX< UP@ ,嚊OoB ;pp* ;(8ppP `ZT`hPdh0Jp኎P0 pm!PT:T f!P 0:h(p]!P :T(X(L @XP 9h(40FDS=8 $4@@\htȢX|08(B#p`0xH 7g8 W B 0،10 ܜl  d~8\0>0X `XP0P S 0 4050X8T80<<0<<0<0<0H80L80P8g+Ä P: ?  07p堉Pt780T80X8H70<887 {P 00S~ 7 Z6 jP 00Sm 6 0t8f6pc0<`$` w|6@`屙0 ‖  ` P  @.ip4B20S 6(@0V0` 0000L85僙P'0`8d8#0eP ՠ՝ 5?Q0Gލ Ѝh5l `g50DL<<0P 0S Q SPg@P `d<S P 0S > ;(4 D8SQp03 `  }v|t t͉C\t ʼnxDt ᾉq,t ᷉j ᱉ d$嫉^#奉X 埉R 噉:)&# 0S0S2  y@h288S#@@PxsN @+~ P:$B? u  081<S|w+u P*H|0:OzP 0ԖPx@Pt>pΌ dˌ빊H=@P<4 㾌0@` r'zPP0@P``7x@+(00@0@8004`<0U00P<P8,8U0C?o20SP ,R  \0,0S L,8S= ,8S }*:KE)  JO0%%]G F$%;T\?,P%R]X?,PgLq^Uhs}Xhc d YQ* P G-P`?,E7h6 凇P03~p2S l  PXU}PH p 㘤嘄9PB/PE0@' s  p`40pEWQU D4 000` P L,SPE0S#3 4# 3aPzzzz᧤P pXvP303 ~`pl d"`}PX34L,4S 110101$1唦/-+0oz$"$2Q<lp`e Pb Q1s0S ބ`qԁԑIpl0V0C?o20S pP  \Ḧ=p`S 0 0000 lU1s0S 3S P P=?o20 P P l:1s0S 0 P `?oP20S 0P,x*H<$%%*G %@-%L-%!2** % C-@`h5dPP P1 LDqH Qp0,1QA= 1P5 00P P 0 cS 9S0S00C0VS   dS lS0 0T TT N0SQl*t/%$%LKi%G-PC0`@00p0P 0S004L婅P00{ &'pp\0W* s/R吅P0r0"2PP P밂V 0+0C0SPP y hP`F 30S %P $2  vP 0S nP 0S10dP  0S1 0$pW pV 0SPmPP}CpP`FP 10S 10 P5d!0S0PNPd`Pxqp 0000r6PP L*EMX+^@M` t+PMqpWM`MoM*|+M+@P%PM@+O-`pBPᨒ<뤂堢` p2 0 qQ p{PpGz{uP`P GP( IP) EP 3 0 Ua@P8P\|0000 fP@ CPA \`]pPB rP pUa$0 P80: S0S00ԇ`P pKP 00SpWʅW  ] `P  3 t3t C^@00PPPLs-,0@ H$P PR ՙ7#- u uuvqԓ- @P0@|UP4PP.@<00Vn4TP ,  ,8b]00G$2"C21QY ̌ba 1 Ѝ /0p040TP 0<0S0<0S0x0p oPPh P (,\/\?,$%iQ/g/r////%ht@/-0/0//900 ,s PRO0S \0 0/X0  $ P70S  $@pРr50  Q   S  R#4sp0S0ʭ r TUP@Pp` u0O-PMp0 0Ph@P\ T@PHHD呮ߍ@P/ኁ ?/x1?0$20H"2@2<211t122tknlhp00m10㘎`&$0 001 0 p.0 h>p0\0J00 JR181270 J1!1q匡0 @Pb}0, = J0R0 =+00-181BVPMP 6P^ ?PU 4P000p=` 0N@P񟗭@x@@@0=` 0f@PP񟗚 L@@0h@@@LX@@@@@@h<0x1<E-|0$0yu|<` 0q131k0$0001C` 彭0<` 0W 0 p3P 0yP 0%$P~ 墭0 JRg0 @P 0 p0\ 凭8d&`@ 0$01@p  P *100 01Sq@4(P =,P4N@rJq [m {8:$0P 61@ P ľL,*1@ tp  $p Ҿ1$@ 0S  Q0 0  P819:0  0  @0|) t pPd 妾ҼP ,4L '11X |P`0S9 (Q90(0 0+(t1 @٬U`"`v' p 8 P8 !FpL V 5XhVV`` 0S 8]X0S @V$0 RS 1S !10180X7"/0 0<! <2s7"/0 "<<2s "/ p<Y 10@` $P:ν!1 01 6 `gp-| Ͻ APVV`` ½0 $``#6800*x4p $00cS$0 Hؽ~<Q04&< պp !NP$A`0S 岽1 V0S\ZO0SV K0 SR 1011'z?p<0S h%d卽``2p/0S @%0倽@}4P q@ v' ~$Ok1S $#PO1 t #(0=pY m1S #000p VbpW P x840,A>0 (0t10T$t Lm1Su 004p10($p @k,0(t10#t 6m1S 4Np 0|4zpl1S 4:pl1S |#TTPhbp P 101<0嶼0@@00 3`P  <iO0 10 厮pY !1! !" 123pD ደ+pd岼`"0 徹!R1411KP,% 0$0!$0R0S"RA1᫱1t!狿P$0!  R !}$00$0 Q[ 0LLK"2LP]PxP~% LL@3$%PJ5J\?, J%JPPF2SSG@PPP2P}VL2PQ\YQ|QQP(QCQQ,SQQQQQQR8R0% NR\RRgR{R%lRaRRRiLsLzLRR8R SSKSeSS1Y8 61 &1pW41!( < V ?= :0w  1`@T 0S 0  @B@ 0S   ἱ 0S sጼP`p P ( RV  R   1 @X0 S   0`Va  Q/0p@-|@0Ptt@ P T0xPPep@ 0 0$010e lh@e/0@-hPMP@T Ѝ0@ 0@  0 @Xgg0ƒ S'* 0@- P@ R P@ 0\ R^H00"@ 800 0^$00"@0/~|~d~P~@-M @  ^ Ѝh  0S/ -PM00 0 p 0 S 0 0 ЍP s /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/0*/)-*/=**/'*/$*/"!*/*/*/*/*/////^ */ */*/<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ረ */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*//7*/>*/ 4T*/ */6 */*///*/@-@z@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogressM$ht4@ON4Jbt̰8 ؽCF $<<\t(\g*   &@&`&&&&&&$&/ : DvMJff/\k.\k@s7'@|&:ԜH/ȰKȰQȰ cpXp$X]Pbk(iQ 4 %6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory `\3f@hb @@k lo@@u`{?l| $@@is($@@`unblock and -DNO_CONV?xloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot close file descriptor on %sCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... = =======.=>#>E4>ZH>]>w>>#> >_>^>F><>>>?>>PATH=  gt_fqGdGGsMcGGmGGlGGr tQCpGBnGGv Gb    EOF reading here (<<) documentJLLLLLLLLLMMJ MMMM#M(M0M8M>MCMJMNMRMYM`M LLLJELL@EvEihE}-+?= E @F 0O9O?OEOKOQOXObO@ E.OEEEE-O-OabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Pv'0Qu'1Qu'1Qv'8QQj7QHDHC|S$SdjIHkHS4HvLSL\SSSS 2S02L\nt\SЉl~DI D>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalshifttrapbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:202405161232Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed0[8[ i>[B[Li\G[M[Q[ V[R  9[ .]]*[:>0,$\.+\\,t[\,0\+d+7\X,b],B\,[-Mk.]+!.[-I\.0.bP.P\|,D\+-[--.\\\\\#\3\#\3\2\3\3\#^]]^ ^@@^&^/^7^\\]]]]]k] z]@]s]]]\]] d\C$c\Ci\C$h\Cp\\\z\\] ]\+]\]]@\@"] \ \\6]>]@F]N] V]V\U\^\]\]]]]] ]@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.ttt@s@t@t@t@t@t@t@t@t@s @t@t@t@u@tt uuuu'u-uat3u:u@uGuQuYu`ugumuyu@u@uuuuuuutuuuuuuuutuuuv vssvr+r;rlr}rrrrrrss0s;s[ssvvvިww wwwwv%w)w v/w5wAcv%v/v8v?vNvUv[vsbvgvBovtv}vvvvvvvvvvvvvvssusssssssssssssssssttttt't0t9tBtMtVtatftmtrtyttttttsvvvިww wwwwv%w)w v/w5wAcv%v/v8v?vNvUv[vsbvgvBovtv}vvvvvvvvvvvvvvsvvvިww wwwwv%w)w v/w5wAcv%v/v8v?vNvUv[vsbvgvBovtv}vvvvvvvvvvvvvvchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] KՂUsage: %s device %s device command [arg [...]] Available commands: forcerw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'.J]sΠ O n   ס2E͢ 3!C#C$C&C1C2K3C4C5g6C8r9x9:;<У=@A BGCsDEFŤGŤHŤJۤLM NO P0QBRWSqTzUVW\a٥cde@fTgghgigpnqCsCtCuvCwx˦!6EWxԧ !;YkӨ888XxvqéҩCCCC$=0Tgt˪%<D\qī߫5IiլCC49-LfCyCʭBr/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.cannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]1 lv5 lcv%v/v8v?vNvUv[vsbvgvBovtv}vvvvvvvvvvvvvvreturning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctbadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-~RmtX+c        %D%%%%%%4%L%d%%%\%%%%%(%`cv%v/v8v?vNvUv[vsbvgvBovtv}vvvvvvvvvvvvvv.J]sΠ O n   ס2E͢ 3!C#C$C&C1C2K3C4C5g6C8r9x9:;<У=@A BGCsDEFŤGŤHŤJۤLM NO P0QBRWSqTzUVW\a٥cde@fTgghgigpnqCsCtCuvCwx˦!6EWxԧ !;YkӨ888XxvqéҩCCCC$=0Tgt˪%<D\qī߫5IiլCC49-LfCyCʭBrSFH0eCrSFU0eCxvHah!IdontNeedEFI(s*K>;|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+v=rGy=iG};Mt?&mWC 3KOO1<yD<#*=(GQ3Dh&[c\ M}-v-чHv-чHZIчHlIчHvIчH!2IчHS'@ )Ѹ *1@ )Ѹ-v1x )Ѹ2<backupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps!///>/setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatusprintallmaindo_setifpreferencedo_setifcaps5zi0%yiSSS%-%SS%b%d%-@%63h%/%7%{5L%8% 8%8% 8%8%08;8F8R8^8 j8v88@8888 808@888[8 88 8@Iinit_current_mediasetmediamodesetmediaoptsetmediasetmediainst:G:::]s:] :]`::@:::]:media_statusmedia_constructor::}9%9:}9%}:}:T%::::p%::9}%Bg:Bg%paddr_matcht4tt$tsettunnel;0%; %print_link_addressessetvlansetvlanif< %=< %== setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanBBBBsethidessidsetapbridgesetiffragsetifrtsB@ %B%B( %BBl%? %??$(* %X %B %B\ %B%^ %?^(* %V %=x % C'BBH&i?i?&[=[=$%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s input: multicastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %sPPQ<G Mz PJ L,M 5KLJ@MMusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o jkHkkkkKlblxllllm#mYmlmmmmn!nSnnnnno%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @vBCFILłN҂OSabc*e>fPhikmn΃o݃rsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:3@@@h pp  p p l` @  $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u%s: unknown standard format180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()'TUPULU+HUDU@U0 %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY*Cp#Cc1[UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_print>PN0Zd0pv040p0000,1Gao00000000'.0MQ0mx00000*0A0Y^000000bitmask_scan.I%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_url sendrequestrecvrequest ***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230505NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gzD%D%D%S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data]SLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i]u ++++x+w+v+ԏ+<K+X:u+a+j+t+}+&++X+lܠ+++a+a+ԑ+ Ӓ+!ғ+<GӐ+Z:є+c+l+v++++:+++collectw  :Kq cv%v/v8v?vNvUv[vsbvgvBovtv}vvvvvvvvvvvvvvNAME=5 vNN1 mount_disks>      !"      !"#$%&'() str_arg_substget_available_cdscv%v/v8v?vNvUv[vsbvgvBovtv}vvvvvvvvvvvvvv edit_fs_type_extD  $ 8   1LP _ o edit_and_check_label cv%v/v8v?vNvUv[vsbvgvBovtv}vvvvvvvvvvvvvvdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskcdt* p7 7 : |5 : 1 @. X9 X/ 1 - - H 5 `D 3 (1 ) 00 H; ? B x) p) lC 4/ / t. 3 L. disklabel_change_geom{;(outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default+++Ծ+pm_from_pepm_whole_diskgpt_freegpt_create_new('(&t&!8<";|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+v=rGy=iG};Mt?&mWC 3KOO1<yD<#*=(GQ3Dh&[c\ M}-v-чHv-чHZIчHlIчHvIчH!2IчHS'@ )Ѹ *1@ )Ѹ-v1x )Ѹ2<q C-V-n-x<}-vA- --- --mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new{@Rd]W\QdX]PMXDYDD: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.0_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.0_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.0_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.0_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.0_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.0_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICdtbgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition*************************************************************************************************************************************************************************************************************************************** usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump2dhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_geteloop_q_timeout_addeloop_event_add_rweloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option[bcd[eUf[gVhViNjk[lbm[n[o[piqcr[s[^t;Wuv[w>Qx[zy[A[B[CTD[E[F[G\HWI-J\K\L|M"\N(\O1\P>\QSTF\UP\VZ\Wd\Xn\ZH1}\4\6g\|[|~\}\\\\\\\\\\\\]] ]] Y]%]GbuY-]5]?]L]V]g]e]n]l]t]]^)^]]]]]:[][]default_configread_configrt_compare_protopprt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtHHrt_buildrt_deletePPsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init5bP bb b-VE+bscript_buftoenvg]\xn]amake_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osk?&d*d/d3d:dif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CD@DCget_leaseread_leasedhcp_openbpflog_dhcpmmmmdhcp_bindm,lmmckmf mdhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d %s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccallback != NULLnseconds <= NSEC_PER_SECread_cb != NULL || write_cb != NULL%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIASfwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated lease%s not foundNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\Bss y< \ X|       !?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%t|x}ssyX  @ ss<yXL  \/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist