08Ef<  Ef]t tEf@@<@T 08Ef<  Ef]t tEf@@<@TU Eft`AEfEfEfAEfEfEfuA.EfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfCEfEfEfAEfEfEfAEfEfEf$h EfEfEfmD EfEfEf (08@HPX`hpxp$|EfEfEfL$-EfEfEf (M$EfEfEf08@HPX`hpE$vEfEfEfx-K!EfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf!EfEfEf4!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf B!EfEfEf B!EfEfEf!EfEfEf"!EfEfEf"!EfEfEf"aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf!EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf?\!EfEfEf>\!EfEfEf=\!EfEfEf<\!EfEfEf;\!EfEfEf:\!EfEfEf9\!EfEfEf8\!EfEfEf?\!EfEfEf>\!EfEfEf=\!EfEfEf<\!EfEfEf;\!EfEfEf:\!EfEfEf9\!EfEfEf8\!EfEfEf:\!EfEfEf7\!EfEfEf6\!EfEfEf5\!EfEfEf4\!EfEfEf3\!EfEfEf2\!EfEfEf1\!EfEfEf0\!EfEfEf7\!EfEfEf6\!EfEfEf5\!EfEfEf4\!EfEfEf3\!EfEfEf2\!EfEfEf1\!EfEfEf0\!EfEfEf2\!EfEfEf/\!EfEfEf.\!EfEfEf-\!EfEfEf,\!EfEfEf+\!EfEfEf*\!EfEfEf)\!EfEfEf(\!EfEfEf/\!EfEfEf.\!EfEfEf-\!EfEfEf,\!EfEfEf+\!EfEfEf*\!EfEfEf)\!EfEfEf(\!EfEfEf*\!EfEfEf'\!EfEfEf&\!EfEfEf%\!EfEfEf$\!EfEfEf#\!EfEfEf"\!EfEfEf!\!EfEfEf \!EfEfEf'\!EfEfEf&\!EfEfEf%\!EfEfEf$\!EfEfEf#\!EfEfEf"\!EfEfEf!\!EfEfEf \!EfEfEf"\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf \!EfEfEf\!EfEfEf \!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf\!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf !EfEfEf!EfEfEf !EfEfEf!EfEfEf!EfEfEf$!EfEfEf4!EfEfEf!EfEfEf!EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf !EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEf!EfEfEfaEfEfEfaEfEfEf!EfEfEf!EfEfEf!EfEfEfaEfEfEf aEfEfEfaEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEf?\aEfEfEf>\aEfEfEf=\aEfEfEf<\aEfEfEf;\aEfEfEf:\aEfEfEf9\aEfEfEf8\aEfEfEf?\aEfEfEf>\aEfEfEf=\aEfEfEf<\aEfEfEf;\aEfEfEf:\aEfEfEf9\aEfEfEf8\aEfEfEf:\aEfEfEf7\aEfEfEf6\aEfEfEf5\aEfEfEf4\aEfEfEf3\aEfEfEf2\aEfEfEf1\aEfEfEf0\aEfEfEf7\aEfEfEf6\aEfEfEf5\aEfEfEf4\aEfEfEf3\aEfEfEf2\aEfEfEf1\aEfEfEf0\aEfEfEf2\aEfEfEf/\aEfEfEf.\aEfEfEf-\aEfEfEf,\aEfEfEf+\aEfEfEf*\aEfEfEf)\aEfEfEf(\aEfEfEf/\aEfEfEf.\aEfEfEf-\aEfEfEf,\aEfEfEf+\aEfEfEf*\aEfEfEf)\aEfEfEf(\aEfEfEf*\aEfEfEf'\aEfEfEf&\aEfEfEf%\aEfEfEf$\aEfEfEf#\aEfEfEf"\aEfEfEf!\aEfEfEf \aEfEfEf'\aEfEfEf&\aEfEfEf%\aEfEfEf$\aEfEfEf#\aEfEfEf"\aEfEfEf!\aEfEfEf \aEfEfEf"\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf \aEfEfEf\aEfEfEf \aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\aEfEfEf\ !EfEfEfi!EfEfEf!EfEfEf!EfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEf aEfEfEfaEfEfEf aEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf!EfEfEf!EfEfEfaEfEfEfaEfEfEf!EfEfEf!EfEfEf!EfEfEf B!EfEfEf B!EfEfEf!EfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEfaEfEfEf!EfEfEf!EfEfEfaEfEfEf aEfEfEfaEfEfEf aEfEfEfaEfEfEfaEfEfEfEfEfEfbpf!EfEfEf $EfEfEfv$>EfEfEf$EfEfEf$sEfEfEf$EfEfEf$EfEfEfAEfEfEfmEfEfEf$EfEfEf $EfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfAEfEfEfdAr!0 Xo;SdԠk}tKF n[)LfG 74";tx t9v#(WAoU Wf Zك?>g X ѰB(s~'x'#?͚((F(_% {eUT"|DZZueBvemEA?y9@}!]w.(J 7^j}wbk,Ws6u@6y X:W;8 cE xb>5 "X$9:€h`-[6dz9paUZ;t;juQ%ucJ8zJd#Y<TAgQYMƿm_kFГ( /=Z#RzEip-,|]G *^t . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4( 4 (JJ$$LL$$NetBSDʚ;PaX NetBSDearmv5hf3D0D 0p@-,E@-pPP@`DI t,P Ѝ`3MU@Vp@-XP8@T`@D p :'P<opQ<Pp&A-AP0$ P0 0 SQ ( $0P /h d!`P, R3HHqU``0``0001P. 00CS000 g   0,`0CS0000 (00u/U R .g8 4D 0$00 0$ &wX%P&EX&fT0 S 0SP/P/S/@-+&`p@-HAHD0040S*0! PP P0P`04 PR@ V04 ^000(  0PPU 40PE`PP 0P4  P P0C SRP40 0P  p&&t%h&X&p@-@8P0 00@0@00000pl&h&A-p@P0 &.徿< 8,4 0 R`Hv  Q0S ( ؎P .堿  @(?$00 0(0 0V0? 0"-倿D @L"`  0$ 0o@ 0$`wX%E|&P 0s@-?0 0@c! P  ) 0P 00S/S`]X8P4ŲЍppP \uP(?D8媥<ᰲL&p&տ& &T 7@-@(P +P8  y- \0X~T Ѝ08PP(P S8r8P 0"&#X%@-P4@(P 8P ;8Z080&HH @-suP(0 00<0   RX&%&@@-<P0:  R R1S7{)P P 0SWA吡S@ @@  yP<F,޽T PLL00CS0410& 0`00 SA)PT 0@@00S - P- P  P 0@0CS0\00@  Z'&|l&&%(&&wX%EX& !$p@-Pd`d@000 PPPP0P0CS0p(00 Ip&(&X&G-@0` V VHЍpPP 0崀 尐R`00`@0SoP 0S  0 h0 0 ?o2S @`sP&8d&p&`&P `00CS`0p S00 P0S X0X /Xꨵ%G-pሒB刢`0SS CpP[ U\ XLDV00 0{PZ 00CS010a U0Pd 0@Z 4+̼ : 00CS0h10=0PUPP1 ` 00CS00 P0` R0V00 P*兼 p00CS0p00 VV0  000  @00S 0S XHP&D&&X&wX%Rp&EO-`-M  R 0000100010S ر@q0`  0.0P0 0':T0J?o20SS SRO f0S  RZ@T  Z     00 10S@@  0 : 0P00CS000 Ѝ S "0P  BR l  @0S Z0 0$D&p&h&P&l&&X%iX&{A-P0`!SP@*尻 0,KpP0!S pP )啻P 0HH<00S0 $00C#X%,&l&A-Php@`T0S P)d$ һO]P&wX%O-`@ ؀0SP ĐĠİp0 T T R R 0pfP Ѝ PP P   P Pp@P&h&p&D&A-p0`!S@ PPl) 0q @'7 P0!S P O)X 0PTPD00S8$ HT@G@ЍI*#X%,&O-@bp00CS01pW PU>ءTpp0pp00>P" )壺  00CS0Hx10 t@p@P0 5 0p0CS0100 S00   X 0000  0 0@ ([ tɺF 0 `00h0 P`0W0$0T P 00 ꨵ%T&&&wX%EX&p&L&&O-pLP0 SPEUP ЍE P C0 0X0b U000壷Pp( v 00C0S.20 & 0 0CS0T200 #Z( 0 PPE CP 000S S  `V%0 V00UP !(幹| x't 00C00 0CS0D100 0e#X 0PFjP 0 0ZPF C V(崀VPP0PP00P 'wt plb 00C0m0 P0CS0<00hj00`6&D&&wX%EX&& O-P@`p )P`T !. 0PScP 0@^S00\P0S \ [ l zP @P@+0P00!|%&/%S<@-T @0H 〭P 0S( 0C00S 0C0 ЍX&ht@x%P0 R  QQP0R/@- X&`G-`PP@ X 0S@ @0S @T@@DT }pP 0S  0 0 PЍX&8G-@P tp0SW`TPUP 0 @+PP @`X&X0000D@-] 40aA R    0/$%AX&40000 0h@-> $%X&AO-R蒟@ 刀p00 pWp#s) 0`?VJV$ V 000 0S0 =D & \1@s4&0"S00 @∀ FQuHSUUU UUUlUUUUHSUHS U0UTTTTTTTTTTUUUUU0U^V^V-Vk @ 0000@^V-V00@R 4& p1@s@*&0"SR 0.V@0 @R R /Fo@P0 R00R  G@PR 000;V 00 X@} T0SxX&$%&X`@-0@00 005P 000 000 ,R;R 0S  S   0;SRpX&p@- L0PQS@@R0p`VP0C X&p@-Ph@P %:, (娷$% p 00wX%EQ 0Q\SA@-o/`@-0S* 0@ 0S! PpP PP )@P )0 S</R/    Ⴒ0 X&I*ls( Q 0@30/@-X&00@- R 0C30X&A-ppA1S0PR a  R R 8S ` ` `0S 00 R0CS .R R P000`P 00CS0"0 l W  JU0圁0CS00 pPX&%G-PA 0pR0pG0WR``0 0`01S 0100CS0H89 tP00CS0' 0S  dP 0Sp`0 0`0R0 000C00p0  $`pX&G-p0A 0RSXPB0GBpPPp`U,000P 00CS0'0  W  pP 0圑0CS00`PU*Ps`X&G- A`0P00 P 00CS0-0 o& 0FSLp I1S  0p10EP0CES0X&O-`PBp0SP UC0S0001XPPPPղPE 0Q0CS00LN P[00`F`0WP/  W P) 0100CS0G'(;P; 0堑0 S-ڐ  S   史P\# b00CS00  0堑0CS00  0PyX&|wX%EA-`AqW ڬQ1ECe R10  C0|00=PP #墴 00CS00 t 0q0CSQ00 \R `R `X&wX%EO-0D0!105P` Ѝ0S/T SPPP  P"MX T廴P800CS00  ^0Q0CS001Ѓܣܓ! P 0 S*"Rʜ0Upppp00婱P 0r0CS00 1 Q !@o!S/ %S pW U 00 0zP 0帱0CS000!000\Q00pPR# QUpp0pp00KPb 0q0CS00ik0p 1 1S 0S11a0Sڐ  S`l  P5 0a0CS00<>10P!pE S:`00  1S `qP ʼ10PE pBR   0 Pp|00ݰP 0q0CS00 X&xwX%E &$( Q 0@30/@-GX&`01S @-@0!S @P /iP /X&x7@-A00 S1 RUWʐ0\00到PBU! [00CS00- 000 @P R0 R P Ѝ00!S JP K0 Sڴ 0R0CS00000  \00sP 00X&$%wX%E?A-O0 Q .#p WU ! GYQ]YRZ~~mopHuuo{kPllmnopphqqxrrshttuDvLwz{o{H}}P0 nR pR lR 00 S P0PP1S (PHPFPP0 nR pR lR 00 S1S 0PP0PPPP0 nR pR lR 00 S1S  P0 S00ЍP0PP!R "RP  R4 00@ `P P0 nR* pR# lR$ 00 SvP TP PP0S!S 0S 1Skd YP0PPP^` ,+0100+0 R00@ 9PJ 0!S 5 P0 nR pR lR 00 S&0S  `FJwP0PPQUX )PG@oG`GoobPVWP 0 nR pR lR 00 S101P0PP0SOP0 nR pR lR 00 SX)0S) LL A%P0PP0S/P0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Sr1S P xP0PP  P  P 0 nR pR lR 00 SMXP0PPYPN 0nQ pQ lQ 00 S - PP8 0  7P,P pP'0Sh `Vk0VhVPPPVPU0 p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SP0 nR pR lR 00 S2S040S402P0PP0S 0 l0C0S30 Sx1SP 2SqWPP00@ 0S0 0c`Pt P0 nR- pR& lR' 00 ST1Se1S0!S ` 0S1S 8c PL 0S0 1P0PPPr`0 gRG  R: 0 B R `[@p?~0"S;bpR1 rR1 Up020 R 0 S$ 0U0b0 ' `P$00CS00 P00 S2SP00PP2P02 P P ;0b200CS00UN !2R00W0#220# 020 nRL pRA lRE PP0 nRE pR> lR? 00 S1S"$%X&%% \&wX%`;P_,8d8& &I*}&x%XD 4 Pr" 0"0" " P0PPePZp PPU0S- `V0V PPp0 nR pR lR 00 S*1S;23P0PP0SP0 nR pR lR 00 S P0PP QR000P0P0@k `P 00 00 P0 nR, pR% lR& 00 S1S0!S t @0S1Sp bWW 0 P0S0P0PP1S 2SqX<0S 0 l0C0S30 SL P0010CS 0nQ( pQ! lQ" 00 S3 00SK` S`屔@p0"SZ`u 0  P0 nR pR lR 00 SN0xS -P0PP0SPLP0 nR pR lR 00 S,P PFⷩ2S|$P0PP -P"  t -@-0 0y ЍЍ/'\&-0^S0]S0]S S]S[S .0A0S>30   \  R]\0G-`ᘁPp0 SS'PG(!RJppU``0``0,0Q@P.嶬0 ,$(00CS010 [S@ \S@0 S @@Pp 0(a0CS,A0p00,A AP0  0pS  0G&\&&wX%EX&ԇp&!p@-0 PJ@p P@01S?0A0S S n@P P0P 00S0``0 0嚵P0A l0X 0Q0圪0aNP`0, (匬$&8\&D&H&'wX%EO-bB0  %R R 0R0P   BR  t   R ( Qp B  RʼqU``0``00_P@ 0A0CS0p10H0 P \RI0P 0 S 010S P/ 00P S)  R [ U   0P僫 n00CS0L00} T0`00 p<P P&&d&X&&&%wX%EA-@`@0@P X0@ p>P" 0 R00R000 1BQ@` @s@p0"S,@gR000&&XO-cSp圳圣M@00 0GS T`SXsTP0PP00唨Pa( $g 00C0-0&SM0 L\  DQ<Y 0C0@p \  0g 0P2ʪl h8d00C0S @Ѝ,20   AQ  \S9 1B\400 BR0ˆr L\ DRW B @ \   P AQ 0 T Tp p pp  P p BR   @e0 P0CS0,000  r&&X&wX%EO-M0@ T0P0ߍT40S  0 G0 000(0 pPPd@ p0 S pSx 00 0(00Y1 Y   $ 倧$PL R|  B Rd30    BR  300S 00  ~0 (@P#Qb 0bppG XxlY 00 0)P\厩, ($y00CS00 Y(1 Y    1P n ܩY1  B  BR p100S 0   @ Q 0 00"2 00 (0&P1 0 0CS000SUW#00 X00S 0 G @  0Sp&&&wX%EX&|O-- *0AQ0C Mp`01 00C S00`Pt :  P Ѝ5 &P!` 00000`P00CS000  [  r0S00CS0x00` P  P`&l&&d&8&X&O-MRB000bsp 0s`Ѝܑ܁0S1  ,0 0 0P@ 0##੟ɐ Y Gt10S 0000000p0CS0D41<  \$ \  00#0L\ 0C000@000000 0C LN h&%l&7&&&&X&A- `P0 0Cs 0p 0l0 d  0C B R0@pT o;@&l&%h&G-p@P0 `R0  Pz(S%u0  d P 0 , (&wX%E@-0 㢥GX%O-GMeM0PS@p$Q403/P GݍЍ0: S00W +  P8:?0ᱛP0: S 0SᙛP0: S 0S 0S 0/S&ᇛP7ጛ00ppP- uSP #0v┦ PvO+t 0P ]@#P倦]OP o/(/P(P e0P,I [)H Z& U9..0 0(PT:..0 0P@D!0Q\ PT1RP  oR00S$ 0ST 0: SPPPO 3  0dG=00 04K XG=00J0SP/ HqaXG< X00CS0p Pp  pYW PX0 X p00CS0 0 ꦚ0S nPP l0$ R;c 00n&dT &=%M%X%Zh\\0\\X X0p@-@P@@DDT` U H H0Rp@\\ppX 0Xp@-@P@@DDT` U HH Q\p@\qppX X0p@-0P0@44T` U 8 80Rp@\\WppX 0Xp@-0P0@44T` U 88 Q\p@\<ppX X0p@-PPP@TTT` U X X0Rp@\\"ppX 0Xp@-PPP@TTT` U XX Q\p@\ppX0@-t pX0pt0\@ ^0@\\X @-0ptX pt \@ ^ \@\5S %R R S R SSh -^L^S R 0/0/0000&O-Q-MTv u@ 0 `0 0L0 @@@@@ @D@H@$@(@<@@@4@8@,@0@5 SS$\ Trs0 !00`V0SE 000L0刐S{ ,0000D0400800$0S00( $0(B?T$pSp,0S  @?C0000D00H0X$0p;pg 0<$ Dp2p^$0S00<00@00#p"pN,0S  @?C 00 0S 000 # 0p p5|#0pp-0 \ C@QC003/040 0S آYT RS0 00 R0!0L0S XP$0x |S(0D 0$ 0(PHH050D5[<1p0tQ@<0 @ Q (8.Z,.X , , 0  0 4 04080080 0Sf QA 0! X⒣X0:Q= 0! d∣d0:   0S0  0  R 0  P @P0@ 0S00P0 0P00 PP.\0.S}0S 0!w0P: h0P: 0  R P0%P000Ѝ&VUUU-4*lO-@a!80S  PP" RbpW  ЍO<0Sp|xxx@P @@0SJ @50CS꼦\q$[\ q00L0S \0.S0S @0S40S   <0Q?o20S X  040 Ѝ&~ _ G-pAEP0L0  㐗P0S%00D0H0v㈅` PP00  ϥpZ\5T H0J0P 0 <P YB5X0 s0X00 00dt |  ` `R`S Y ,( ?R004(0x |0R S S Sp4 L0Sd4 T0SX4 0SL4P0S@4@4Z 4 00Ѝ1@GPԫLh̬Ыȫ8$8\\tجl0L0PP P 0H0PPLP PTPFX0s0X0 0PPLPTPHP<0 00PPLPTPHPX030P0LP0T0PPLP P0\0`P%0`0\P!0d0``0<0080 `000DPh0lP 0DPhPl000pK 0帡ލЍ 00 徠>04@pl0 h000  L00S   T X%=@&D&&$0\ 0S  H&=T 0L0S/0 000/0@-M0S 0 00!bp|:pǠЍd0d@ `0R@X0 0B?* 0Ѝ@谠&&&,(& &P `00CS`0p S00 P0S X0X /X⥡ꨵ%: S@-  S  S/ I* S  S%|@=1A-`@XPTMp !\g@T10S H10S. 00 00,10'p K@0 000) 0@0S00S 0: S@Ѝ0圀 h0R0x |B?  0T00S &:&&,=@&D&<&L&&2&&s@- ớ@P@P `PU00S @GT CЍp0t  Q \0 \0@-T (P@$UAX&`&p@-P@Tp0 0C0 ,A @G-@0MP,3(30S`V0Ѝ0 0C0| 0XPS !,叟0S 20Sn 4 "; $p x s=00  pjL20S 88b ((^$20S  $V0 : SL( 1"6000 0@001<"$0B10S10S41 100H 10S|10S : S0: S s`w818q 0Rp(1 B? 0 'Q p{ 4 pP^4 00S `&&&&Z:&,=0&c&3j8&4&@&D&<&L&&2&&1O-@0S,0010S 10S40 001q 1000PS ЍO\a0TQ M0P  0+0`SpQPPU& Ѝ  B 1`0 |0  ,R4   V 0S[     &&&<&%L&%`&010G-S,0@010S 10S40 000 0000PUG`먠p0PUG l0 0C0 W cp0,S4  `YpP S`&&&<&L&%0G-P@0T,@0@S 00S40 00@0`0娀S㨐@pVG ,0 0C0 W ,#p0 00 S p0,S4  Ep` &&&<&%@- M @ ǜp ЍT P 0@  QQ 80 7T 9P S  %0p@-P0S``M@P PX A⸙@P8 -PdpD&7 xT C-CM@' 萟P`   T *F0 XpPPCߍw ? @Pj w0S ?@P?oP@괺%@-鴶 夝OX% 000/l&@-飶0 咝=X%@- M0P ! A00P00!0 1 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx|u pr  Ѝ "$ ϐ0P @000 l0l pX   DHGk"$  (0@kl&<,T _[2O-@Xe-MQP pPp  0St  #pP 0S P  t00CS02p1pЍ0S ŐP PΐPἐpPX )8$ Q440l0xp0 ! Μ0 X ̓00CS0 p YX 0 P 0S  tPᖐP X0: S ؏P<Pᇐ P rX0: SPX  pPᇂ`0S ㈲   P=  Pl 弎 R $]3P V0 ¯S , ! 00< A '8! 0  A {{z1<p000@0 P @p lP  0S X0;X0XP ݎP 0-S ቎PVʏPtpW  DNLpY@l&H1g X%%=,q)T   s@-@ `P)P0P UCAЍpU \@530 P4@P %_ I n L @-~MQM0pS  0` 0 `冏 Pa `! p~,P V 8!C1@~܍Ѝ00 `hPD  ~,ɍ@P;  ~,P 0` 0 `J PW `  Q \00 003P  0( 0%m }   !H!00CS0 ㉛0 /O-`DLMp T0|$|t00000 0000SLLDV04`0p Q 0SI\#RP#00V 0030p Q  #5P0 0l#00V00<30(#P#0u030002P唎Ps0"_00 0LЍp(0: S / S%l tP000`P3)0-V'V|VЩrX2PUT  ? O0M1PP S0 00 0qp$0S0 0V00R V 0V 0d1\!00X!00@@D!S9~<0V 10S0C ^:ˠˠ\:PV0 0~, e~\P0 P ;  0 \U0Y 00V T0<%&`&%%u!%!!%Ć'&!!m8@@'<'%}D00S/@-~M0@0S~, 2P~܍&%@-0p@$0l00S Ѝ0 000Q , x/P%& "L0@- R</P 0 0 /&-"'@'_"A-p`P@ 0PPEU`@T@A-p`P@ ᲋0PPEU`@T@p@-P@Tڬ` 0Q@Pڄ0  Q @;;S p見@P00T@ (0, .( .%&@'""s@-R@T` Va0@$00 ?00S 0CS1P10 S7@{.@ЍpPڀ;;S! 000 0Q P?P@@00" 0S @@0ES TT 0$00S0S 0S 0S $0STڄ00Q rQd).T( L".(04 p.$%&" # 'a#">##`!0SN@-MLQ0SB @100CS4:Q000SS6@0S0T0pS 0pLAQo 0\p T06QSQ00 t 0PP00 0S L-Ѝ00/ -&%%#m#($G-PP0  Ѝp@PڬAQQ` 0Q P 0@@Q< -P 0S%&\$@-PlAMP \1`0S0 SU0<900U0p 0pQ -Ѝ P0S(0S 0Q  Pڌ0U 0?0 d-0 P 0ᜋPx 00 d-%&$$$ %@'!m.%O-Mr4M R0`RX0@FPz}0 0S ᘒ0 0 F0 S(0S l  \"\pT20 0Q@"0O>("00#HTq "  #>0܍4ЍT 聟0S =! !0!0#`*#V# u0S1p1 00H!0>0H!041 0 00,q(10`(00C0   ᰐ  00(  ,0$ $ 0   0000 0# `Օ## T%%& 'X'S%0^%u%'h&%`&$%H'%%C-LRLb0HBS0000 Ѝ(( 00 0S  2 r0S |1 兖 0S 及pP (0: S)0R p10S10S PP  00 0S q4M@ 1 00 0S00p0000 S(00(000 P@0S !000S x04P 0+P0p0' 0X%`&&|'؇'x'''%&%'& '&&X'H'+&A-MM8 bP #+H VP"+bR$0@S 0@̂0S29+pP| Pw 0 t S( -x%+t#+p2Tr0h0CS``++P+L+H+D+P4P0@0@+ 2 ލЍ*0S  R  sS SS YS~P*yS*0q儁*x*H*P8sP 0SD @jP4 (1P *0S *@(*CPP >P0@0@**ꌇ'8&R&%&D''p&%%&&%['|6'''' Ds'x'& '(!(?((((( )a((1)K)00@-@Rp]p`%O-Lq l0S'P6@``TPP&PV,L0 R4T0S _*@ET  A0d#0V`@P@UPB*PT0S h5*Tꓢ"D 2/L0P! 咣#, 0A%%`&%)a&f) 'O-@㤁0報`MFPp @cQ PPPU3PP)-PT,010S( $)P@!0$0 3/0P% 0 R T  A@ 80 3/P{0Pp00St p) Q < 002/0P " "Ѝ '`&h&)%))a&%*K*@-AMMP/F@PAލЍp`pP/00P U`0` )L0_"/0P0 0$ 00`)l&y*`&*00CS0 S0 /O-0c$M00P[ P$ЍP0,03/P000 0y`30S LCLPPPP 00 30S[ P U P!P r4 CSR pPtv h' zGPT8D"@)0/S<P AW Q 10S e P0S !S 0!202 03/pP X/ \h1  0S HQ0S 01;00 Ph0D0 3/P 0S 0 R 0pU0403/ VC00S 2'P0h0CP0PP ''h&|''h'*l&m&''`&x'''('@-<@P( (`& +@-Ap @@ ()+@-@p 0x(@=+p@-MPup@|0S  0C0t `_p 0: S i`S NS Ѝp@C-MpPЍa0H03/P0 03/PhxpA]pP@ 0AS0 @0a3/PE0 0P)3P/P 8P0/S P] A00 0p06@ p '0(03/X o\Z P 'h&l&m&%%R+'O-MPЍhe0H03/P0 03/PfPw,50Sp 5娄P %'40SD]7P 0(03/ " P 0AS0@0 a3/Ph4C00-DcP 44 CP40S  rP 00  gP 0R S "`Qd 03p Qt 0pP`jP HSP3` Qd 30/S1P  A  00  'P0SU 0S "`Qd 02p Qt 00S "SBP 0q 4S P X20SlH20S Po4S S/ 0CS)0S%  Y K0S$ 0S 100"`Qd P x1 ,6 T RP (100 O Iv @ 9/0 S0S 0S 000Y\0C00*4S 0S 0 'Ȇ'%f+'h''h&(''l&''''m&Ї'̇'|'''%x'G-Q@zP@ЍT  T 0 %H03/P0 03/P0SB0 Y Phhq 009XaMP P: 0 P0(03/"P 00 @0S 0 00PP@ |iP0 l0\0 0S "PY WP '{+'|'؇'h&x''&''+T0@-0SePP 00H03/P@' 'O-MMDp0$0 PPP0 S3 R P T$ \ 0`40d P0R P$0T :P  Phh 00#X0S L20 @2 8"202(20S/ P.0Sy 0Su 1!00oP0S1 R P$ T\ 0`40d P0T P$0T T4S S 0CS P& @HP8 $ P} Z0S `0S L0 갇' ++,'h&'''l&=,'Ї'̇'|''x'`&'h'*@-@000S0000 ~ R~<ʂ;;S t<#`0 X0\P 0! 00 PP8'p' '^,,%&@-@0000S R ~ R~<ʂ;;S l<#X0*P  000 00"P8'p'%,,&0  ~,  /8'p'%1O-ZcA嘑 PR00oPQ0`0CPÏƿ 0 &1!Rp0` p P8 0`R pV0 0 0 P&00P:0@P0 `0`000 0$0S 00$!P00 Ѝ,#꜇'-8'%%M-pC-`0S 00S#pPP0@P1P 0000 0$ 0$ 0p R PR<"_PPP%%-8'- 00C0 8'=O-` 刄YM⢋$  0 0@0pP  0(P 20S  9P:8!#0-PYP,1 1 P?ڠ10S 00$ $ PP\!0"(00,0p$ ZP:p !8"0 S 00 ( R M0Q0Yߍ= 00 SR *(0M"0 ̀P:8X "pt0 !RP *($0܇'!%8'-.'.N.`.G-@(0SP唐`pHPP 0000 0$ 0/ 0$  0S0(0xPb0 P 8'% ''0C- 0 Ѝ(q 00CϠP 0P  0 _0 Z`Q% P @&P 0YP$`@0 0$ V0 00CS /R0 S  00`V@08'G-ptP`V   BRl PPEUPR@@  O`Fp8'O-钽M0PQ0p0@` 0(P(X0 㤑 0$0T0#U R 00Q0 T0*D1@PTP;Ѝ! 0!  BR P ?T0 0 0$0 PʐU 0 0 R  SQ0@T0  4S  ! 8''-.M-`A#RP㘁pL0S5  Up 0)  000SPER0 < 0!P0 p 0P0U00pPF0P0 000/`F p k00`00Q ޣQ P0 S  PF8'%.' 'p@-0@0PpP E0Pp@|8'%A-`pppPU@@DTj@P 0U@ $`PE008'%G-Pᄀp`U0 @@BTG@PğU 00@ P0@UP `08'%G-M =@p  P``10S ~Pz:84!e ((U00" J(  90 0CS0P`ލ/U 0 |P0PUoe~PJC8\ @D 0RP J(@ J28,  `܇'!8'%./.0@- M@ ~Pl0PUP $ 0 Q ^ 040Q\Ѝ0P'A/0@-MP @}PЍ000S0: S|P#}PU H 0}P 0F 0'Dsp/'/0@-M@, 0000S# Q0S 10S }P'0S% X0 ?A3c000S&!h0 ?A3c0 |P 0NS ` 0rЍ0~D 0j0S |p%%Mb//@-@ } P Ѝ2|P $0V 0Bꄇ'/@-!@!|P 0B0 @-ꄇ'0O-@0(/S$MP`p//P8 0 0}P  p /00 }P%  P 0S  |P |P0 K pw  Ѝ'G-@P 00/S (QP t00Q G _{⏄ZP0 0`0S g$뤀夐p0 ͇P0S@$<iPH0@48 @壆Dp'0 t00ȇ''0A-M`P@p~|P5(10S Ѝ 0RP  0RP 0: SzP {PY 0E=|PW {P E P W$ 0@''0Ds00:(40@-: SM@=!R \000[ P0 |p 0: S0 Ѝ000 u0:P/  0 gA-`QFZDT@zPH!081P @$<p1P0SP+(0 000 =  "4S `zP` 0{庅t 040Ѝ(tS|(tHPz z00 1'ć'%%A1p'O-Z#3(tQKM0M`p@ 40CS񟗩4tdL<l3lP\30S ]{0P0 0$#: SQ ZPX3P @$<쒟 ?o2P0S(4S2RP {P){P{+x"00 + 0S820S{ 4m0C?o2 000! "Fmyp!0ZY- Y10S- !0 K>0@4@~z=0 C+zzy8 m6 yv PF@$<P>4S(40R(4p l$hR\00 X0S 0(4} 00H 0KލЍ0q'<''ć'%&&1%X1ȇ'011/O-Mp@ W 0DP 0S8 00<000SPP0C080pG0S `0S * 0R 8 00 x x/  P8 N@0 X2@ ?@9Q*?@0 +0嘰 R ^P` hЍTT   ` `@21P'L'2X'T'R/s@-@ 0@`PQD 0Ѝp@, axP 0Ѝp'2'20@-@MPPx00<00S =  J" Ѝ0耇'G-zM@`Q M Y #P ExP P 00P=! SR J(?ݍ ЍyPJ8| = $ HL0RP J(DP 0PxQȄJ{8 >2!S2t2G- AP 000qPU+`00CS0HpU 0 0S U 0   4P 0 SP P0SP 00S 0 S 1P ꄆ''l%% 0 0 S@-0@0R000x00S0@000S X΀P HP,0P'''ԇ' 2'p@-PP 0Sp `ᧀ@Pd )@P0/S00<0 fR P@@@@p22'h0 RX R  H R/< R/ $R/Q/ ꄆ''܇''l0A-0S X0XPX`Xp@0T R S+ ᘄ0@ꀇ''wX%2G-@c- 0(MS 0SzB1@(Ѝ0 0P50C S>$%$%4$$%%$$p20S X00 00!P 0 000! " 5PPP  0!$!$! 0!ꓭ  X(4 : SB  S<  S)  S08 0P! 0'TOS+<  Q|'w,33H~33+@-=XM"@p:(j~0 XЍ307@-s@ P*P Q Ѝ00  - Ѝ0@-0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//Qq/@-0CP0%S*0 ,  ^Ό!0W0CBPBb 0_  0ΌC S*/ P@-*0S0@P0 ? SR@G:@  SR < Q R 0\ 0 B^00 C@ T A C@T   \a0C R  0C@-0S0" ^":00NB\Bb 0  \@ 02W"!N ^*040@-@T@@  '3A-P4q4`Q VA-QQ@@TQ S AA>:TP h0dʁ?@ 0:S@ 0S00 0@_,'%64X%M4/s@- `d P0PQ!0*0S @mR$ bR kR% + 0*S xS SЍpwR! /Q0@P0$+* & #P00PG- 0S`P }0P  p T@R 00T0\p0S ,=@PpPP 'f4z4'4s@-@PP0p C30@0Ѝp0  R R00`|@P$0  `F T00갆'@-*~X%40 Rr @-/%@-00*$(* * *~X%A5567O-pᄠ儰  @k0 P0.p`4 0Y/   `Vm8O-@-lM/`봯PHPP p/刯_0 p00 h?h/~pP?L?A0s 8/S XB\    CRX 0F>~zP񟗳873787777787988877779777777777777777777777777777887788788777777777377777778877779D877377T87\87t87777777$6`67l6x6767666676$7X7`7h77`777777><P p,PM>J=0 -R,Q0 000;l= =p, 4h~`P jP !PiX PcpPX\ P ᪧ\50S  o P  P@꘵500K:p% 0~p B;04P% L50pzR񟗺F|A|A|A|A|A|A|A|A|A|A|A|AFF|A|AFF|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|@|A|A|A|A|A|A|A|A|A|A|A|A|A|A|A|ADE|APEdE|AEE|A|A|AEEEFF|A|A|A$F@F\F|ApFFF|A|A|A|A|A|A@@@@|A@|A|AAA(A%4%*% %% %'%i9l'98D9G9p9l9p%/a:%n''%9'' /99%4[L'h'99'::'>:X&'؇'ԇ'Ї'̇'%'_,&MD' G:  X%% 0. ' %%:'% HE&0#@dC|L#t?||8&$0  0 W Ì1P0 ( 08,W7H1 V 2(1\ $VP00' P"x12PU1 U 1 T 1 1S1_PS2PR82 R H2 Q X2 Q h2 p x222 22"2+S002p007 {Bbr0e0?o S c00CS0 !|# R003XR0 B{Sv008300R {0 d0S3# S*SSʤS|0Vy PK000Sm30VK3`F}PLP20000S@4 P0P  /ᰆ'l0P/`0p@-0T L@LPP@0@2P' {3밆' ':;X%'<A-` @PA?\. \ *\1  Q R+ ![\SPQU  !\@@]^1!Lo \P0/P0SP PS QR S0*S S 0PS 0 P0^ p-W p]WW UU @U '0p@-@0 /SN00N P`(pPQP`Q*LC T0 0300Q*pQc< 1@-M MP Aaq:P/tP 0P0Sۍ Ѝ.S@T|`l @ @5꬇'<<=7= @= b====O-cM M33 "p@3]P`W,0 00S 000 0ₒP{ 00 ;R SY 0 0 @;T* R  DY<5 cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 s 0@&P\P   H >(0 0CP;TC 0S0TP* R00;T 0S Y 0 0tYpi Y 0 0Shh uy0S X 8 e0Q00 dyKh' == >X%6>C-`PMM RP s\SP RW P0S #  P0S6w\SP R1 PgQ PQ' SQ GQ !w(0 0@pQ sQ00000Q0 R @@@ۍЍ00彑 P տvtt@P p ہP ; ,0 iv@>>>h'Y>>A-`P 0StVpxt@PP P`P80Pp P @ @@ @> ?h'X0A-TPT`Tp@0T  S& x0@h'wX%8?L1p@- RE jDTA ,PU; P8 \Q Q 0T + hv04#%P  0S/  00P0S/  P00 @0/S000 0DPpR0 h'''b??A-0j40@TPp 00S 00S0 00/S @Tt0oPL0D0S sP040 h'''x2A-@0PS' 0`.S0.S0S/S 4?P 0 Q CR S.R  S.R0S/S S 10S410S 6P:4 CSR ! xQ`V 0/S0S.00 p `00C0V00 `V._ XP:$0BRSR;  IP C 0C0 0B 0 B "0$%A-@QpW :DC-M``0S PPp0@T " !(@PUЍ 'O-`0-@XD%   pPZ 0 Q PQP (0S0un@P  }P p `(Ap O5 '=tDA-0@T `pP1AT  RQ( QP (0@ 00|pzp '=/@-`0M0MSPp 0/S PP ۍЍ(n@P x T ۍЍ@Lp P 00$$`!#!0 00  @'DD 'A-P`@p娀TЍ000S$0S  00 0 00! !D<00S { p p@ 'ć'%%%@QC-@0A`@PP!@p WT  0q ! 10@0` Ѝ 50p`G-MⰑ@T- `!PApT |0S! @T wm@PO P00 0QB UP4]"` 0! Aލ00!!QP  z P    sP] $ 0\0 lD Ysod( $ 'G%DE E@E_E1G- `V@0P RpY  m@P)  P! P AZ E@P`?P .oP< $o"o@ 'EEEd0A- @T`pH P ATP @ 'p@-Qq@@,C\P \0@@ \ @0@@0@ 000@@@S:Q0^ACBSbB 3 30s0pp P <  - R0 R:00R:/0AA-M pa Rh1MP0\p.@Q 0  C0/S' $!$ 0o -P3ڍЍ *\0@C ?\0@C ಀ0 pC00 C0  0so P d X 0ho P 8 ( 0\o $%E EFFp@-`0Se\p@ 1e #-@ )P.n000p 0 @-F W00S  /@'x000@-^SQ 0Q00P@' Qp@-!0PS   ph P@t Ll @@T@p00@<%FF@-P`p@P   P 0|Dh0` l? Ѝ0 0 P0AQ$ 0  }F8%FFF@'A-`PPЍ@"-:J0840K0CS 2  `40 01  +  d] } (lT <tO @|qp  A=L / $  04 -B2P" 1P* 0(5P/S00*040(84K0@SKP 0 040q;;00004(4 :(40/S04084(49(p k$L' T'C-j@EM0@S(Tzlzzzzzzzz30S EߍJ(dJ(J(J(!L 0\ ` @ 3 30]QJ(t S7000-00 s++  10>L  Rp0<x P J<p0@ P J11  = 0upP Jx<d@卶Y   EeXM  e} 0 PpP J} [P vP$PP P F 0$p pPt s0cR `[P@'IWIxIII<pcIIIiqIІ'I,J0@-MM@Ph  =X X 0P U+@0  $ $ ,  ݍЍ0$ ; @'p@-@ PP hp@+ JA-p0-S0S) jPP%Rj 0NЍ0` S0 BP@P,0U EP`J%2J-@-0@P   n|Ѝ@Ѝ/h'p@-@ATp@0 R P8P ` `[P`ph'-P@-000  x0 t000 h@0S \ 800L0L <Tj ,.|$ 8 Ѝ@ Ѝ/ᜇ'؇'|'x'X%'Qp@-x\@PlhPP \P p͓\000S  pSJI*h''\J -P7@-000  0@ 000 P0S | 800l0l hi X{TiD 8i0 ~8 Ѝ0@Ѝ/ᜇ'؇'|'x'%'QX%h@- igxJX%@-Mi@P" 0/S1P1P ]p \]p 0RP 0RP @ލmYJ?Ds 000/p'@-骂 iEgJX%@-`q,M@T xxipAPD00CS0@`@Da Pp= @Y@DOoB0S@,Ѝ0P: S ;]P W0S d Q Y7! P000@ t0x @ATBi0 @00CS00 p'JX%%J=,JO-PQAMptY0FZ[Po0 q0pptfW0KZ[pn\ Y0 pz  ZPQpY  Y0 pz  ZPApY  Y0 pz  ZP1pY  Y0 pz  ZP! NPpY P㧨P U W0P  ZPPWp p'T @-% hedKX% 0p@-P@T 0Q00S0P0T`00000eee00CS000S px't'A-ph@h`0P000SP'U`00CS0$00SAx''t'p@-@H`P0S@'T`p QPꘈ'G-0a000P050@ R'QS \!0 00CS000S X0 딀唠`D pYG:50=T0U00CS00 S 0px''Wt'W%@-0P2 R'b 0ꘈ'A-pP`V@ J@P*Pp@-XPi<@P hDP0P 000@aT8@ph'A-ppP000`4@40 040000CS@000SAx't'p@-P`@T PV 0@p@@-PPG-0%P=P" P SPY SU00CS00 R 0 0 0p`@PWW%%C-3Sc0@  Ft30 0" 0  0080 Bk 3p 3 00`G3蒟 0p Ѝ/RAR R7 F%1 B&PꐛܝxTȞ0=S @ "?R 9R:BP8|R' ~R$ ^R  h; @ =R= >R @ <R =R @ |R@ 0&S@ 0=S@y  0+S@'p 0-S@(i )e&c#a@ ^$%T'PP'H'W<'BX0 @-8'rX0s@-P0`0V0`0S@ P 0R@P@w  =P@o0S00S g0ST P000 R  Ѝp8'`'%XwHPX@-L ^ءl@T0`$\T @@~, \8 31#P?0 C c0à?00à cΌ SQŒQQP0R0R0P0QPQP !XXXO-`ps딀 %RP@? &R X(3! /[00  @ PP@ Ѝ8'X p@-8M@ T 0`  P@8Ѝp @P R 0 0 0SP@V P@ 0 F/P@( P@c YT8'p@-@P0)Sp8'O-@,,Mp`TP TS T( T) #T! @$TO "T 0#S@P   !,Ѝ'0DSYA `@V@@P'0ISV'Y  ` `D &c S! uz!P n0 0@@! b0 @PYVP'T  `@P,  @b 8'(YX YO-M8Pp`6! @20 X@0DS '00S^^* PU@  0 S 0DS00SY Ѝ` pUU 8'KC-`p  0BS00@SP! @00P TQ@@ Ѝ8'G-`d0SP@! p000 0PP@8'@-$M@` P1PL&0P  IR NRpp 0PPEP@@0S@ (} )1$Ѝ8':YPG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 Pz1x1Sp0@s0PH0P@ 0,O0a1,%%L'`'K @P/- 0/SSS00X'@-@PMލ0/S\ Vp Vp 0RP 0RPDsp@-`\ 0@P 0D0p@L0K0y0"SP Vpr bqX'VYp@-T` RpH0@Q 8 PP /pp@X'H%mYO-pW,S 0S)P P` C000000000CS020S @T  R RSe|b|/\h2@000/SpGLL/pDPR0S 0/p0CS0p@0@ppW000000pA0P00 _00o/ Qx Q00CS0P10S 00CS00W0@0 pR0S/S0@D00N00W@0 P  R*0000t/S0S  P 00CS0p@+0@pK0S 00CS000@00@0X'x't'jYmYL'%%DsA-p`0@00TP 00CS000S @ 00CS0PX00S 1X @06 R0S U$0$pN%x't'%X'w 2G-p`BMx6&0@T"BR@P$ 0SM .S00.S0 00/SSC10  PPB ePpZ% ``VT')PP@ ?` <. E`N0E[-@ \`0-S0S0@T@@QP.TP0: SVP >PЍ%qYh'stY4MYX'YYDsY@-5$0Q @ P@X'mYYp@-L@Q50P000S LTPP 0S{@@L 101 M00CS00 L 0 L0pS_RLh'YX'Y%ZG-PRp p@1`0V1 QPp JPp `R\TQ @0Ti \0DQS񟗀괵HHHHTHHHHHHHH HHH(H0H8@00CS00 NL 0@ 0 @T0S 00CS00 7L 0 0SX00CS00 "L 0 L 1% 01 0@Q  0BPA0@D@@@ @ @ @ @ @\@%ZA-@ ` PR 0R 0S SKp0S0 R BL0S  ;LU  %LT0L^ x*Lrx Td@00CS00 K 0 AK%d''Q% 4T % @-0S d'40@-@Q Ld'@-x0@T   @@@@ @Q@00S 4060S 㣽Ѝd'H'%-$0@- R    '-@-  0@-'-@@-00 H@-@  =-@@-  3@-@--@-00 " ЍЍ/@-@ Ѝ@-@-  ЍЍ/ L 0S0< < @-oK,S0 / K+Z|'0/ሉ'p@-@QPPPP Qp` Q`P Pp` Q`ps@-|P30P h0 6 N 0X0X`@T P~LD0 0 @ M@Ѝph'%'B 's@-P`@0S'W<0`@&k Pg{{'jfk[[.]06S 00S\  ЍpM @0t0S0T.S N@'[0    /ሉ'@-@TЍ0Ѝ0CSPPPPPpp 000 P 0 3@ 00 0@-M@ PU 0 PP0p '+P   0HPP!p 0   Ѝ0 [0 0ꈉ'L%1nT%@-@P 0S0S 3P 000  Ѝ贖'0G-`S q0P00#h@T0PQS$@^&$00CS010S .Ѝ00S P UO:\9  R 9)P00CS00S U@0SO@ UOPO@x't''[C-@PsM^P`( UPG*릐) Q\ Hp(L  p          U2$PP^0S2 0S@*T ^0S2$ 00 *|20S G0S X2$PPPU H^0S 2 R$0S20S 4E@ P10S %E10S Eo^0St1 R$ R @T$@L10S E(10S D10S D00S D  @06 $0?o2$0-x0$@T $ fd00S D 4H0cH Ѝ%'ܔ'Ԓ'[%G-MPp@)0 1뤀夐夠`>PP H*Vx0$`W U ^0S W 6P 0`S)Ѝ`'%%'P8PG-P* @0䀟0 `0 0R0Cp0W S `Sp00 0 PF*D*S p0@?)PD0(00$3*0 $ 0$/%%L''A-P@쀟0`0p0}^0S 0S 0S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R SR 0$`S Sꈉ'%O-$M࡟A^`PV $`()pWS0嬱p0p堁00WY 0S, |1k2GlG G00CS00 zG 0= H00CS00 hG 0 JG  J ^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 ($Ѝ%'`'%'C-$M@쀟 p( 0 0`@T+ 0S0 PU@ 000gP x0 0 SP00U$0 @ R^PU $0($ЍP0`''%G-@$Pp0ESoᩒ' 0S$ 1a11-G+GZ/&GU"G00CS00 F 0 FtaU000 S&PE U8q0$0! E#$  A BPP00CS000S 9@00CS000S U0S0S<0<0F1FDF0GGFUp%'%`'[[[x''t'[,2p@-FM000000 10S 00S 1Q11 `FF0@TF1F∡PP% t1 1@=0S @T D1凡 rA@gF4eF1E0S 1 $ FߍpA 0 000 0?P00CS0 0@ 0 00t0 J=00CS0 0S 2Fl0FD0EX00S M@00S Gl'%'%`'[[p'['x'[t'0@-`0000 00o^0SP$M4P @''000P? p>%0P 000S K<K000 p0CS0(00S +'$Ѝ%x'\t'?C-@0mM0$8@P0?_00? 0,@0X@ & 0d00 0d@@`PჀhTh0,o@ 0p 0l@PpT 00.Pp 00,0d0S,c&d0(S( 0L0>60S >0S,0S(00L0, (01C(0X>0S,0S l@ 0 @$0 ?PLE\g< 00<0,0 0C0(000D0004@ `N00CS0p40S P% 40S()\0S`N1H4@ 3 3 384D)0093 8 0S '0R\#CX#0LClH00S0ڨaM$0 #0C0000lNG3@ 2 HC 2  (0028 \0S"00CS0 l2 R   $0L2L0S#mߍp9H20S 08"SS2 @0@ T0P@H020H0H0S1  H0S2 1$ H0S x1 H0s1 R#$0S1   B H0S H0S7SHD0 10S 09@,0S 0  [;,0Sl@Q zC0,000(P D@T00S t00xG 40 0L):Eq괖'd''`'`'%|LԒ'x'\H'l't''%L`H%h't'_,%%%%\p''!P' )\B o0/ሉ'0 /ሉ' 0/ᔉ'0/ᔉ' 0  /ሉ'P@-@&P<80PP cR   H\' 0S0/ሉ'00@-/0M0@0奱P HP 0: Sp  Sd PЍ0HP0 : Sb" PP괖'wQKZ\p@-Px@x`M$P)00S ["0`H000``0"!`"$Ѝp舉'h'@-P\@$M&0S0S 0C0BS00 000舉'//A-PM)@s @ (`0p8D@HPL pPP  0@PЍ,p\%A-@P`FpWU PK! 00'pp''O-pWC R``%` P0S:S22EԐ @0S,W@  @;0T/S/00N 000S00P R:R0:SPPP@DOP!S!%%'P@-@/` 喰P*  0 PU0 "U# "`VZ0S  0 o0S 0S PN! ~pP@P> ER~    0u뼉' @-PM@RqP|1p000 Q`!pWZU x@?U `?T?U<@ 04AS 00CS00 ~? 0* 00CS00 n? 0 ЍU ??U P000vJ00CS0L00S <??0,봖'\\\T %\x't'\\\p@-P@@Pp 0S%SpP @Vp@-P8@Pp 0RҽPp@VP0P- 0S RP P\ 0x%ĉ'G-`@嘀0唐0P0p 0S0 S0S00PPP|U00CS0$00SGQpx'ĉ'x%t'0G-@0`0Pp Q :RQ :QR``R %Ru 3$PPP0T:Sp0<@ 0 /PSu`P贖''\x%A-`P倀000p 0Sp00J,P@T`|V00CS000SAx'ĉ't'0A-PSp R+j`a@T"W p0009m0 @0 0 L00CS0H00S `P `@꼉'x't'p@-P$@Pp0@P0V@-L@000@00 O00CS000S@x''t'O-PM/`@ 0匮P @@@ (EP00š0 0S 0S 000y#   P@ P @cP< R R R 0S  0  # R00 m P B0000S - Q p" R[0 RL"00Hp0  pP[ X 2@x 0=00pЍQ 0S/Q0S[q "P  P x"P R  R ܾ( DP0 Q<Q 7 0@D\ P Q  qP@0000S R p  BR 9D R5 u3 s괖'\x%x''%#\\%\t'O-@ 3M`p%2PP*0S*[ "0 00 `0p0Rz0#| 0Z8 RhB<01 P =PЍbPEUp  `@Q @hV  00X!W QPYXV E1 0 0 W0S& 0s1TP P*W 00SY0 [  P 0S\XT 0s  P aw=T ]h'ĉ'%]@''x%p@-P|`0000S S@:H000 00 00000CS0p00Spp@tx't'0@-Ml@ 0P0000P0>00G 00CS000S UЍ0x'%t'@-aP 0SGO-`-|MpP@$P0cS    @RpP` vPP VP@ E RsYcS" 8U;ܢ[BP VP  R񟗆\0@P 0R 'PU`D;%U 4; P& ;;[ 00S A00CS00 B; 0 0@ T Ѝ;/PVd!     [ZU!Z;;BPU;U~:NU U UUC;0 f@000e]i]{]h'wB],]M]]]%]'P]]] ^^;^O-$M,,R pC0b@  @T- TT:T"  T /T" 00CS0@  @0D S H F$Ѝ0S R 4a@T00000@0S?@P#A>P@ @ $T аp~X =W 0 0CS00 S00CS0 0 00CS0 0 y00t00%D'L'%sRA-(A0S 0PS0 0aqP0S00 P000K00CS00S P 0SRh`hp0P RP000K000CS00S gD'x't'H's@-0!S1Ѝp*S@SP``00P Q0C RP00C S@\ `/4@U0S00S=STT00 D0 R 0AD1U0 0S 0S%P'p'A-``pP0@S  R R00PH @D'O-Ms@0S0000 0000,`آ<000000000C <` 00@0000$00CS$0C0S00CS0(20S  PY?P(0Z00(Pi? P J(P 1X0 DC{0@0CS0t10S Ѝ袺0SJP$ 00[. [`+ V , R:@ 0 C\A/@`F 0SX  BR  R  B ~   B `FAQV  R@ @D'%x'%t''L'R1O-p0PSp0 Ѝ1嘱 @` 00Y :[V0S @ xQB `P V' Q`:00Q @ @% Y0S" SP P@بP PӨQ DoP @@` D'Ȗ'H'%#nA-XPX@X`P0p00I0p0CS00S D'x't'@-D@oF?0 @ ЍD'Q@-p@0` 0S*00DP`@堶P@0`SP Ѝ `P0@P0`S@0S0O- [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR3@P0P/P 0S xPS@ RB0$x RP  R \$Ѝ$=PX:$P 0U0/Sl 00EQpP $0S/00E0S``0` xQP  0/00S <V/00D x00SR00Q: 0  R@?ᓼ0P . B.Q/o" R  0P V 0  D$D'DsVmt'0  Q0@-0 @QC\0CC/x^ࠑQ@ Q 0 A-@QaT0S 0@ @@?S*S  [S R 0 p00$0SS P $$$ G0$000CS0L00S 0S 0P 0D'x't'p@-@ PTp 0@ @@D'G-p @00 ST@D؀0P `V s`RxP VP V V@ S`` S =RR QU  N0P @PG- M⨀0`@GP0 aa(q000e U00SV-00ED`PIPE@T Ѝ00CS0@L' RO-@@0M-S`P S! C RtlD?So @Sy 00C Sh:0 0 /`20S\ 00S=SWV70 Rڬ7 RN0aF1@ 000U00S pgpWpG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 6p즟ؖPW@A0S 0f0CS00  P6FBЍx6P6l6`0000Q00S 6 pR &V(0 0S 0S/0e0CS00 w 00CS00 v 0S 0|e0CS0]0 !00w0000v00e: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000v3г 030`3 RL 0ppUppWㄣ~0m R  R9 V} WHs 83 BR  BR j ~  BR s `2 BR  BR  ~  BR   g ~ a   0S  QAQAQ   Q61  ( ~ AQUd Ra 4q BR  `VaQ~p 00S T 00 S00CS0 0 p00CS0 0 00 00~00O 0  00400p 0  00p'P'RL'D'8M0PEPE000PCP$Ѝ0000D'%L'`'O-aX P0@ 0p R    000XP X 20 E0P0C0 Ѝ0S LL ."008  @D0000D D'%L'%%wc^4Ml^O-@ r  DPR0400 ` R}먂 R    00h2TP`8 T_ T@-@FT+: fPR0CZU * TR Q  S0D2@ LP80Z0Y0S@@T: Ѝ@FT: 6P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C`F0T000@ D00C0CS0 000000C00000000%D'L'%C-M@Pᬐ`! 00000吀0p0p00CS00 p0@ @6Ѝ00pD'%%L'A-Pp@-A00CS00 ]- 0 ` V-00CS00 F- 0 ` V&`-00CS00 )- 0`*%@-^@-^00S/ R|%T0QH0 0Scq o/P0//p'|%0    B /p'A-@P堀0p000` R$ 0 `0T    0 0C@ S000SADx'|%p't'0A-P` @0p0W0 ᜩP 0X S S0 000 00 0h0    0 0$PT B>00CS0 00SA |%x'%p't'A-4b4B0 Qcr 0S \,Z,r0S@0PP0/2P2b000r0Sc00CS00  0S 0X0#S }2P  u2P,0  00P0 P   PER SP   BR 00E0CS0000`0L00S Y,80+`Q|%p'%%^%%@-L@00CS00  [p00CS0@Rp'@-8P@P 0     00000 0$00|%p'A-P@`000# 1V |`0Pڝ#p0PS H0  0000CS0 00SAx'2|%p't'@-p0a0M0P01@P73P(0: S$0 0 1P  tP100 00 1h#T1L00CS0,00S Ѝx'^^^^_t'A-Qd@P0`00 PHpP<0`00CS000SAx'p'|%t'p@-`P@00P0"P < 0S00<0X 0000CS0p$00Spp@f$|%x'p't'0/|%p@-@,`,P0SpSTps|%|''_p@-P@0Sp|%|'p@-@Pp P0Ppج"0@p|% 0 R/% @-@0@1^ P   U`p W Q Q 00 r B"Q q A,PU 0  0輎'5rO%A-R0S20SPA`R p U"0ppPpW*1 N 0p ")"7P 0 0P |&&&0 qP 0p«Z=  7p,N= 0 P 0p?=  7p4= !00n&k&h&`輎'H'%SJ>_%\<D'l__0S/p@-@PP1PDHAq8a 000P0R 0S"0D@[05#0s  0C?o2^0SP{pDP <A xP0S *00CS0p\00Spp@   PAoQP꼎'_5rOx'__t'p@-@\P0P00 ;@00CS0p00Spp@x't'O-@TM` R0 TЍO)ؐY. PPY  x 0 SPs   0S0P0S PP PQ 00SЀ0S@TЍ0S|22 F! R0+  p  !R -  ")p 0`"0 t) ץp0 sR0 K70˥ p)00CS0(0p W )e Z 00CS0(0 00CS0(0 | 00CS0(0Ѐ YZ(000v ) #40  )  )P S#4;  0 `0p@ gp  (Jzp0㓉(ЀH4p'%5rO`#`(`0`9`>`M`0 @- SS0C 0.^\Q0  @( CP/o" R O-PP10 0%SX P 0@S"!Q@ C$0S 0S  R-S +S %S D1@@YZT X@1 r9 002#00S 0S 0p?Sp  P T"@` I Pr P L `0@00SJ R Q !" R @%S`r`'b``G-$a$0S Qq0l0@S, @ 'ĠА0Sʰ00CS00 h' 0 (0 R  0 S !'꼎',h'5rO```M`%A-pAP`'P00Sʄ10P 0S hjPp pPP gP`W@ P(1@@A'PV QPU, 00SJ y'0 r'`00CS0 &0 S 0 000S0 S 0 0(p(```h'`'5rOa1%40@-@T  kP@@d輎'r`8 P  /Q 0SZ//Ἆ'G-pQ0SPS@00SoZaP000M:0@ C$ @p U0Q000CS0\10S Da000<>,10S0000000W@00CS000S 0S @`VZ00萠i @G0 Z7@Ꙃ! P00B R @꼎'x't'%@-@S`!1pP@! [$Tx1@WV2 h1N0SP U 0S0-,V $13p39!p"m"060S% f"c"`"Vu$r$U 0S P ,`+P PPkWT$0   ЍVH'l'D''%%_~^08 N R S  0S  P %O-pRBM0P0 p` .0S0S ЍP$$0 000P@00 !T):U 0S0 10S  160S  0UGE RE C100CS0l10S 0S 02   \ P 0Q R0 @|. \ ~  ^Lo \ Q  P 000 QWP@~  ^Lo \ 0ܔ'x''H'%%t' G-pPJ@P DP1N0St `o2@,T @,\2pm8 k㠠`@0S0S 0S0S;`@Y 0 X 000 E%%j_'A-@P| P PT0Q 0S XlP@ pP@ ZP@X|06 R0S@@Q`` 0pG  0 0 Skah'T %%O-@Sc$M5 PT  %P )P pnQ pQT P@<X Y(300S P P$Ѝ0PQZ`pP00S XP pjY  \   0`P 0S00Y 0STP  o'$260Sg0`00\  \ 0?o2? TW K'\0#Q 0 !X R5  p"P0S 0S00 0 RZP S  R 040Tp/o" RP 0 S0C0 06 p0SYX X YPPV;ax'?aUaa'h'*%p@-@)dQ000` R 0S <10p }6!0S 0 00D1  S ~0 0P0RB o` R\ `` R00 㔕0S00CS0000S ~px'%D_'5rOt'D1@-Q80@S [#qP`0SP00CS00 " 0 $0R0p d5.b!P0#pP000T00CS0@00S $ Ѝ輎'``T M`%%_x't'@-z 0@0,h'@-@ o @,p@-`@00  p 0Qp\ PU"00p輎'aaO-TbTPLLLr 0@0U0S  U"0PE0P ЍS S =S\ 'S " C 0CS^(_`^_H_`_l_x_|^!$0PU0 R$ \S0 \00 S0 @ P   0@ P0#P!"00 P  0  @}00 S$0 )0!"0T 0@ 1 }SP0  :0@4 "0 꼎'ayaa%aaiaϸaA-@dcdsdMTZ 0SW0S0acaxaxaaHaXaa0bXb`bbccb cdc`@cXc(c4cLcxcxcpahaR 0S  "%#00CS 0S2l""\@H<80@P bU0SЍ0S PЍA 0S  ztp|xt hdT0La8P dP aP ^P [P X PU @,꼎'*alaaaaa[ϸaaaa.a a*a taaaaaakaab\p@-@D`PTpUPU 0S G@=p@-Pt`t0PP6 R@N0S@2@@0S@D. 0    p0 p輎'%A-0P@`Tp R@ 0N@T P 0S@@C'W\0HU 000000V0@ H'%%@-@ p P 0 Ѝ@|30ЍbO-Pq 0M00S 1a Ա100ȡ 0000 S  @PЍ0SG 0 RS/Q P C'P 0(ͱ0Q0000X00S) R@ PP0S:SU@!00S-@.1 @00CS00  0 ( `0SH0@ ẜ00' ''4M ''b%L'-b%%A-M`&#P w0\Q"\Sr 0S!/#Pi R Q X BR (  "p JQO Q   tP ho PW p P|X  BR    x P BR 0@! P R   0 00 h1 " `PApW    pAqJ0 0Z*0S    @P+,Ѝ P XoPJ Wp X <  BR 5  0bx'h'bD#n%L'%4MA-PB`Pk̂000"p"00CS020S 20@T[UU  r0@000w @ C@00x @ C0 @0 0Dr000  w0B  x0B00  Cr0P 000w P C00x P C0P00Ep 0 P`A01 H)`ЍP,> 1 000 0 0A^W0@ 0QS$ 000QPP PpG-00CS0H00S UX+. <)B"%x't'h'b%ic c$%c/cOcO-hsMf@PS`P>Ls0SC<30@TDUP3X "0  @ @ythX   X 0SB01 `ЍSVP aV HVP@ 0S8X0S UPʙP= p 0/S9S W:00C⒋+pÿS  | P 0 ( :"p.L 0 f @0(IT0 S !P[-0Sy|0tS xztg 0 + 0P]{cLh'cV5c%#d?dc ccccc@'dK  BR00/00S/@0S/ R /0@-@0000C S ͕ RR R1\0*Ѝdd000C S0S//QX0 0@-^ @P U@R000/%p@-`@`P6N0Spv@Tp   v @   p@P %8'adG-pPR@`Q7 S`r@0S 0 g `V@A00CS00  0aq唁 @ Q  R  D@TPP,aHqH0 R R .@TP@00CS00  0 Q VP @1@ST@Q@`Q CPGB`V0@ %d 4ed%Wvdd$e edd80 \#P0@-%ee0S/p@-@PPEPp@**A-@1S`@D`pPU 0@P00` P\P'G-@PPaP000 Rp-Q Q8 -Q R8 P+Q, 00P T00T 0P 0T0cP0 oP0S TPT40@@T0SGP'l'e*e%A-P R B0– 0`0Ճ0S 00S0S006X pWdP `P6p60S0S60N0F S60N00 BS/o" R 0 0-S0F0 1  QR00SQ 0S!0P   000S  00^0 PA. R   R0 0%P'>e'PG- @@P0Sp` 0C  0XZO0A0C  R0 0CS0@00S 0S )LeP']ex't'P0 @-X@000D00S 00CS000S ix'P't'000C S/ @-TP 0  P'G-0p PR 0S6Q 0S!0 CB10@?`! :,k`` `@c0i `` -R \ -Q0S `0@T0:SE 0R@/T/:Y  @`2@T0:S   @`#@? `0 :\00Y00 X @0 CB!08( @ Ѝ*eeseze%,P@-HD0P  Q 000CH ЍeP'`'!@-$0S Q,0S-\\ -\\ P0 ^:P0S0\HP^0@:T($P'eep@-H@HP080Sp0u`0CS0` 800C80%L' 0R @-@T ]( 0 B   B /@-@0S@p@-@P0S0ڈ00@0B2 ! ! !!  !!p@-@    @% 0S/xQS  00 S/00 00 0S/00/P04 00 0=S0/S 00P0 0 0@-%fp@-`R`@PP t00P pd0 Pp0-S0S0 0pV ($00080@p@'<'f%O-MRp00 p R pl2l"lb@h  0SXy XR00CS0` 2`@@20@0@Ѝ\Y7R @@ P*  BR @@000p 0 S B R @@ Y000p  B Y Y  YR  Q P Pp P  Q  R P000<00 { d Ki%TM%%L'%0-@0LM P R0000 Pl l "'UT 00T<0< A 001 0 %ffgTMgf@-$M@ 0Q 00SPp@`T*vpPT @T%PLP @0 P $Ѝ@%%|'*g8gl000S p@-XP@T T D0T@p8040@p 0/%',Lg4'%'0@-@괊'p@-d@dP\Pp P 00008  P8  p@%%-G-DR0@T @ B 0S 0 @0r 8 0 00CS00 `)V*V V v va G ` 0F S``4``L` V0@000 @\V. |V ;V&P0 @ ;P0 @ E@0L Pp=x&P0@ 6@0o|P0@ -@00@0@.p P  00P000K0  %%p't'UG-pc00@ T T+P,0S)㰀" PP @ϐ n@@`P  0RP @FDA@@T 0  %Mp@-`0$P P e 0R$, (@R   RP8Pj    Q  00000S@p 0 BRp@ U080@ p%dg@-y0 000%@-@oPp@- @fP P @0 000p` P 0`@`%O- 㰑`P0  P㜱@APp0 CR00S00 p0@X ',10S @%X U \@P@W W- V- L0@PpGWPV VoP 0000 V p0S 000%TMG-JM0 5@0 000$04 00400D0(,n`P $0S $o$ 4 0  |4 (nt$0000$`SH4 `$婏,4( ($00CS0! 0S$@PU3 0RPPS p10PS Pv '30S l3p@p3ppL000 0S 0 s`PPA P5 \P p'200pd PP0000 0 0 21 B#20#"U0"P R \00\0@0 $P00CS0 P`@0000 V@ "00CS0L001@@PsF n@m1000S 1 0 A0 SGl!|V@0  0 @00C0,000#0$000CS010S S0 0 0 0 02 P B1 0R @z0PEu`0PUZJߍ6{00CS0`R {00%l'%x'%t'%L'gO-؟د0ϟM0 Q002202280?_@? 00`0"00/20S@0Sʴ@ 2P @8\<(0/Q00S .00CS0.0.Q00S 00C00000Pa210S0xPVTP"P_ SPMpMxU0@#SG      @    4أ <H       P   X `h | p00@ Sr0pG A0@Sr7pGa0@SQrWpG[Lp0 S00C0t00" P *'P 0p@W00@S p p p p p pq0pG00@Sq0pG`0@? @?o2;R0Sp ( \\P\Pp ?PpXWX 6;G S 5:0 S@ W*00C0?0'3?pp000 S0 0C0~00ĕ0 0C@0pW'*00C00'60'3?00  R ~ B   ĕ?pAp000 S00C0~00•00C@0W$*00C00'90'6?00  R  B ~  ĕ  B 0'3?00  R ~ B   w$00C00'<0'9?00  R ~ B   ĕA0'6?00 Q~A•W?p00C00'?0'X,UP/>P0 |P000P$@90 ЍP0 ,  0P$0 &P00 0_<P >P &P000p0p0 ((0 @0(0-P   p 00 H%%TL'%p't'g#hggh?hLhgh@'<'%$%|'PshEN%hURQ {P B@ < }  h p {S D  B p/#P0p*0}P$  @@   ? 0 }PJ0 p 0C$  @ Dp0H! , @ BR #@jx! 0 = BR@ Ĥ0O0@Wj%S` :S/ #S0[ 0 p;0C Q @ BR @:W0 0 @ R&  B 0(0:E!p0ᜲ j}P H02!R1S p0HS2@p0 pXp{  X0`2  !o,!!j00S }S Go᫲[| p'P023Q w0 00`"0 !`$0 0 @ B "  $0`2  !G-`ԀԠ0@T@@0PU 0@S 0 0   B/o"K`0 0pS 0 R 0 0 0&%T@-.P20@-_M0$ 0 E1< 00100p1x0000ugPI1x 1@Q  @<00 do 0S $Q. 4QG Q 40 1(0  ,8  (V0000 0 0 0 0 S00_ߍ0 t0 `0 H0 D0 H00S%gS,0 0l'%d'%T%p',hG- Vp0 00 P" 000P6pppppppppp|h,,x<0$00p@ [P 0 R 0`     u00S 0 00@% P0, RPU 000@ 00 00 R, RÉP4 >00300 0000    BR   00n` P 0000 CR Sm0  P P` ~ ``xs 00008 @0C 0 F009`0 SplP \0 R   L000`0S0 R Ӻ0 0P 0 R000$0  oP 0@S P 000b `@` 00P0`M P0 000000S$ T 0S y0@00000S0P0S@0S 000@Ѝ0$00pV%h^:%%A-QQ@`` p @00 P 0X@p 0P R$@@`,R ( W% R"pk0` 4 kP %/gz`P 08 000C0%04`Ѝ Q  0Se0 00 00 @ 0%%hhA- @0P P/ 000`P 000p0@``@@xP 0`0 U000 PPe``0SU (P%%ip@-PP @0 @LP P 00000Sp pp%i P/0S/80 P/0S Q/0Ē'p@-@ `P800`Pp@-`&P宽 PP  CЍp @P80{-{*{'{ ${  \ 0P/Ē'RQ%bPp@-@ P P b` ]piA-P@\p`T@Q00C0V PI@Ē'p@-T@T`0P0000600CS0p00Spp@x'Ē't'P0p@-P@TpU@`V P`Ē'p @-@0 S000C T DP ,0O@dA0 T @@@%gfffĒ'p@-@`0 Sڌ S qPPT tpˉ0S 0 S ]P꽉0S Ē'@'p@-P @20Pp 0  0pĒ'@0@-@ P  Q @@0Ē' 0 P/ R/Ē'C-@S0SS|h R 00CS0K0 - LN*kp@-@܅0T PR R R& 1S#0 DžPpR!Q QT " "D0600S0T0S 00S0Ԓ'x't'%0P@-00 80P   Ѝk*'QA-@ 00CS00 xpxP ` C?U U P@U00CS00 `T |A-@`xPx@0p000S 00S Yp`V@40`00CS000SAx'ؒ'Ԓ't'L0P  A?Q Q R:///Ԓ'@-@bM0pS10S 0SPP10S WUT T TP160SPPP0SP1N0SPPTP `16 R4T! R00SPP0Q7 up0 0S" UEopup$ W`RUO7@D0>T000 000 ,  Pt0N R  DTR 60SЍQ Q2 1 @D@Ԓ'H'%d'(PO-P@p 墁P `ᜁP ᗁP 0PEpSUpUX@@&` PP~`Ppl44pPPEpU]X (d(t(P 0E0 10ST@ T@P@UT @csP1 R 00ST|y@ TL@P@UT ,0s0@Q0S 00S iX@@T`X ̢嬲pG`Y P& P?U*X? X, 0Sl <20S pP@@0-S0S@UpP  ;PP 5PP1 ~` a0S\  0E T0 S R0T00 @1 R  U@ ^00CS010S VP刀`PPP@q0S 000lT 700CS0t00S /@@T00<dYk.k%Ԓ'4|lllTx'wm%llt'G-PP@0`嘐 ?pD 0S 00S 0DE0@o000CS00S pW@UGܒ'Ԓ'x't'p@-PD@`02S@20CSpsV02pԒ',0T0SP/0S//Ԓ'C-p@`1010r!Q0@S10C1 ЍqXPU X2ѿNPᬸĿP 0S ǿԒ''$0@P/!!R /Ԓ'p@-8P\2Sp@xur\BpԒ'0-MM 01`"R !R X"R   1 1d"1!d2S 04\Ph10 0,\P L!0000$\P(10  I @T0dc`0P0 U @T 0S SP100CS0 !!cr0 0$0(0,00D>S *00  J"!031Ԓ''l'x'0@- `"d{Ԓ'p@-@H'Pp PPp0B/U00pOp@-T@TP0 0P0 0 0000CS0p00Spp@轴x'%t'A-p`@PU ;0PPEU` XD辁0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000 00 00CS0h00S \sDP`00000C0 <'x't'p@-@P@0SH00Spp@00CS00  %0%0%@-@ԫP<AЍl-@-  Ѝ Ѝ/-$0@-  ЍЍ/% -p@-Ml0, @P(0 0`0CS0a0`1@00DЍp@Ѝ/G-@'`oP$ 0S! ly0S00CS0>0 " u00CS0/0 " 0S ᯪpW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU SPP 00CS00 lO%0R%@-@@%@-0rS@lm0G-@0 p0R(0帀P0=00o=`o`F@V@p@DR000 S=S B`` R`ť` @G7P%L'%0@- 4@ 00C000 0 ЍL'8m0P P PR /0@-@LP^ ^ R0L00/PA-' 㴀0S RP'p`@PU pWp0 \ 0S 0S   3/P@P00h'0SeA-@9xPzU p`pp0S'SSP@HAL'cnPP,  EAl@m[mXmT <A-P0@S`p    3/@P@PX "W p0@=SPU0P0 00CS00  0 00CS00 w 0 T V%TzO-@0Sp 00ЀP0 `V S0  j@PU* ЍY   R Q ʁ f @0aP`0 lL'h''@ 0R S=R/=R/A-Pp0S=SRpGp'{h0h`U!0@a`T 0S  YFPU``@L'h'1@-`0@S @ PPV 0 ` K dw  `C Ѝ@x@q   R <0 2/0`d 0R , R  c0a0 00000@!L @UP U0 ]00CS0\00S ЍY0#L 00P P %bmx'L't'@-@P= `&P pTpP Lypp0  BR = T   `\ Ѝ00@0um\0-GM0000WP00$0 0  Gߍl'p@-X@0`P @0U<(0 `00$0U p@L'mmad-!0$MP00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ^$ЍP'md''%8'p@-@XP`000T 00CS0p,00Spp@9@x't'7@-P@T@ PP0 P00p Ѝ0 yP 0 @'00000 00PHOL'mA-Pp` 0  ! 0 @TPUA@ 0@00`h' @-;@P 0S   3/P 000A-P@`T PP 0    R   2/P @@@ pP =k@@ꌉ'O-p@Q0`rSP W 100S V'>nP pPW`0I?o2V0S Ep`VD10@T0  ЍOf 0P=S@7 P( PW0 00 0  ắ`U 0 X  ЍU0 00 U 00S -W BP0>PPPPh'mm@-` pk@P@ Ѝ0  R@ PR000 00S |0000    0   @@DT@00S ήx'4Mt'A-`pĀ@TP0U0  =w  0 R R   0 02/0  00 0000L'%%A-pP`@P 00`PPEPvT` eTp` fTxTp`X @V Y@mh'PP@- 倮 bmC-pԑ0P000币-S`@TQ v@ 000@0CS`0d10S / Ѝ @P=6jP 0 @0 0 0  0 00 000000  RP 00 00=S l0T 10=S100C0 PPPx'L'%%t'  L'p@-@PTpv@p@-PdP@ \NP@ xP@ IP@P(P0 P pWn nh'00@/0 S0@/s@-@z0 0P`z0S z0"S U1r0p%!*0S`0Xឭ000 @0C?o2R0SЍpn$%n@-M@ nP ލfP@D0 SQH0PP0@-M@ MP ލEP@D 0RPH0PP0@-M@ ,P ލ$P0RP 0RPA-@`IP13@ 0SC PUA PPPpPJ! 0RA @- 0-RS# 0S00 0  Ѝ0SX00T0 S00080 ,vP$|OPPnO0@-P0M!S@0SPЍ0P{ 0SxPUo U U lPo U P? PPEUR 0@`p| O  P  P  P  P  P  P P p0St00@gT @0(S0)S 00qop@-@`P(P} 0Sz00CSt             D p   voopvPv vP/`@+TV$@` VT`@V0`@ P0`@P0`@V0(EbO0S0!SPpp(S0)S0S pp@-@PuPPEuP.U)x x     0op=Pp0\0!S0P p(S0)S0S Opw6mnn@-坫0Rn%(0@-0 00 D븉'%o@- @q R1P\0* LЍoO-PM@(w U0pE `-R lRF 8R -R| P)@P 2 000J @P K*pe pGW` tPpW `dd`F %RX aPPx8(pW3sR RP3pUP`/ RpE@@W1 000 ~PPP@U\*p *Pp ˪dl㩪X1Ht@P |)@P0S0Sp@yw  >q Y0Q Ī RP!|0*QPZw Rpu`  ᐪTT{w,$%<GmH~ooow%wHoo0@-DMh0   0@@DPU# @0 =    = P xtt, Ph DЍ0=eP "k|''-*~p%Deadpp|ap@-00S | 00t 0tl l0l@0   PU L@L0L D0D P p Ppp'p'x'%'Ē'%%%%%p@-ޠ0@@倶G0 0@0PU@000kd @0PB0S00CS0400S np@i@Cꬉ'%Ď'%x''t'P/p@-@PTp000@p@-@@aPTp0   SC   @p@ q00  vq00@ pW0@ P  /7@-@P4 0 P  S'@Lx0 0 000@0 Ѝ0O0 0  0 000  00 2  0 000  W0@-@PM  0  %  0 00P0 0v@Ѝ0@-@`PT@ Ѝ0000p`@PP000/0P/  R /qP/n 000/ܖ' 0P00/ܖ'A-@pP 0` V  V @00CS00  0@ 000CS00  0`ܖ'%A-p@`xT [TP 'T` *TT "T[ RLhH\0DS````8``D`````````` `(`0`L7T /T@Pp+ 000C R&AET@ 0@P 0 \ pR 0  R0 p \@@aC\BW0CAC\70C00C@@ @ @ @ @ @@p$%pܖ'p@-@qP`P \P@0 cS 0<0 Ѝ0S@00 #10#7Q00A\ @5/MS0-S@5/^S   4@^S@0?S0$%ܖ'0 0급'q%A-poX@P@ULᏧP00`E ,X`j00@00ܖ'3q'@-@ R Q@@q80  t"P dKqfqܖ'l s@-0@T 00s` `PUEЍpܖ'q@-p0PU@` Ѝ 0'R"R@@0 @`0 0S D"00s @m@`ܖ'fqO-0xd-0d4P ,M1P0@1%bP#p3PEAULPE@ꋟ0s  00P@`V0 S 0S\V $SxS@00CS00  0$ P%V0%S@S00CS00  0`/0*S>`0.S0@*S4@YLጦ<`(@0xY0WY BYR +%Yw AY* X0I SX&T!T!T!T!T!T!T!T!"$%X&"""T!X&T!T!T!T!T!X&T!T!T!4&T!X&T!T!X&E0IS0Q[  $0'S"S"Z 0S 100吪{[v' t  iTP  n~P T" l^\s00v t 0 },%qq;1qfq$% \T 4'%Zܖ'q\\0LS$$$|$$t$$#############X$'\ \\ "\ 0 \ M0\? \@-ÕÅe0\fnrtvabXP E\ PX ? \  P\  xq 0vs  t 00 p{ X0,  0u @ P尜t  p娜0 R0 0C0@00  B+ 1H 01 *t v0 t  tq0$0$  [ 0t 0wNVBT,Ѝ3 פn0C-M`q 0P` Pp @P 04 p@PC 0p W  ) PuY <Y~nPP0( 0ES 1P aHژ 00S00H pQ^YPH0?S0 -S00H0,Ѝ`'qrw6wT`P($F$V0S:ЍCJS@ThZTcYT^XTY5CTT5CTOTLp5CTGX5@CTB@5 CT=(5 CT8U@T44CT/4CT*4CT%4CxT 4 Cq$ B 0hT 0S`\`TP4@CYT84CRT[KT 4 CDTZ=TY6T1TW*T3C#T3CTx3CTXPL T@3CTW$ TW@T W@S@ S2 CTWT2 CTx2 CT`2CTH2CT02C  0 0 d @pԁP0SU 7t5T   Q  0녑 P0t y UtP pzz{{{%{,{[z3{Fyz:{qA{zoywyvy}y|yyyyyyyyyyyyyyyynyyzz zzzzz%z$z,z+z4z=zȑȡȱ`p8W0aS R  <0R P 00< S P0pS:`(eQ (eQ @P0S0 BS `a 0rh R R* \*a ` `0(SD0꬇̇߇P`': `#dʈO-;$M `*R 0P$S 7ߍS '밲@pĠ$ˌp@0 0뉔ᨛሄW YX( 8$ f Pf/jVc,"R 0Q RR !,"!R !` !`!Q Q @p 0ꨑ!P#.   P," Rx `,a! $a$"#. !$$("(Q* R `j 0S 0P R ` 0 0! 0Ro j+ 00 @1S jF f/jb01T T%Hb X'`'މVEW}}WEV,@o,'%A-P@`!pP5S$ Pv $0f0Qp &3%R 0R00000( `'X''p@-@, P  P$p@LQ 0@- 0S, P`'@-P  舗'O-@- CMk M:P p00*8 P 8QPP008̐800S : UP  @00t 崐l0S cP,X@ (^(0 0 ( P 1:PHHἂY90 $0  P$0S $02 cP,唙唩$ [ 0S$00  P$00  P$00  P$00$0 s@ zcP丟$& $ >P($0S  S;ƑZZ0;s 00 0P$ 1\  hH@  Y= 0SX8 0(S(0 (0 0?cP  Z) 5cP   ,c P00 $0YP$0S ++RP0 0  $x c P 00 $0>P$0T0 < c P 00 $0.P$0`0  b P 00 $0P$0X0  b P 00 $0P$0\0  bP x bP 0 0 $0P$0d0 8 bP 5 0 $0P$07  b P 50 $0P$07  b P @50 $0P$07 r b P 50 $0P$07o bD zb P 00 $0P$0x0_ R jb P 00 $0P$0|0O B80 aH0 S0S  D_0Y: Yx0 *$ 0TPSH H 2 00S> 0 0S @pCލ Ѝ30"0 000 0 SD 09`  RQ<0 ,0P4\  BB! $` 0S 0 0SO 0C RS[Q[QQ\Q[QQh\QQQQ[ 圎 0 0 R0 00S 0 <0  d2000"0$0 00$0 P @$0!S 0$0$ 2 B 0S P 9 0S$ av. 0 S Pl $ 0S$ ` 0S[y 0 Sq PP  0S$h `E `'cEJ1<A-'O^7''{:ˋً +Ff|'-D$%0s@-`PU V  P]@P hЍp`PD!M_<0 N0@⠎VD>$00S @-c00<%p@-@5S4 0PSP p@WPp 0S 5S 1S /Pp5S X `Pp@ LPpK(( Ppu/`''xQedArdA-s@-PA1( (000;ge( V 4 5S Pjc0S fc0S 005S  P0P(5S `ЍpX XkPH`4bP`'WEVfd>mdO<%a'gd`@-@P f/^@ꈗ' 0 D<%T'md0P:/ 0#-3@-PX P 0S S@@ 0(0csS, p P 0 _8P &0,0cxsS0 p P 0 G8P 000@csxd /DDZX%}Ǡ%PA-M & @?QPH  7QP( %+Y  00S `PY0"S U1r0%*VY  F00S pY0 "Rsp$PdPd `尀pp0 <$0bЍ0bzơ`'ydC-p PM` Q$ UP 03/ЍCb@@ R;  R p $%`'T  0 @-$`'P7@- P@TUP HUP804 p Ѝ0*`'wdP7@- `4P@, p Ѝ0`'d@@-}(0   g΢X%O-,M0@Q0P`p0000 0$0X,Ѝ FPP ]p"$$ P  Np $0 S T㸐帠P@$0S" ) 0 00SW   ǂ0 S 0 @0D8=Vp@-@PP.1P' 0P, 8>0P   #0P 0P 0Pp@臂Wp@ 0x<O@d6p@U@@phPptcidyaraɣrbmngnts*~2pK T £P0 P-  #B%B$14!8<h'p@-π8Q a@Vp&a  …?/.01 \ @0`0 P#3pa  …?/.3P01 24P5 ̎ @h' 0"!#/P/'A-PT0p(,`BT@>T,0T@@DA?@?@@h'@-?0<@< (20,20RP0  P*0 002h'> 0R//G-0`p(,BP Q ET@PPWW ,20CS(20CS GH0h'ժЪp@-M@`42S%^ 7 E@ 82<"0 0 (2,")Ѝp@$"d<"82El@`W,"(2H0 X"\4Ѝp@h' %٪ 2@JjիAs@-P`yV  L0SЍp00S@hV0"S1Ds@-,Mt$Q0$ 0 0 0Z,X%yA-`0~ @Tʴ "Ϡ<,pP 0d  ? &Nqp  RЍAL`0S`@D@,zQ Ѝ % "h'@-`  ppP0p@l Ѝ!$LR@ @dQRQ$ @2Y?Uh']p@-P0@0S( UB01ph'O--ʇߍ@ hwQS/2SrW#,g `p 0 ಟ00 S 0p`#W0 002Rp`"; p qp <T"QP20H"(PD 0( 1 RS Q0S!Q10!  p12S  ?01DP& |!Qp10l4!?h02S02S 0 0S>0)S $Z0)S  "Q  R Q ! P-00 0G0@  A 0S<(h'I(R,a %~ֲ& <($,LUni@-M4rW@Pp@YЍP(0P@`  B1 @PP$SDЍ@k8 g1 48<\ ČȌ P!N1 I11< 0@1 ;1 ?0511< 0`,1 P'1 ?0<Ѝ@h',.>M^rʴܴO-p-蒓Y`:X& "!R &/ .0 1  Y 32 $4(5, Y \   Q R ` H2,0L2000&0S- 1S* &, W000P0  00SW0!14!8!<!14!8!<W0,p0,0`\T (`0 S( 21S$ / .0040 81 <W , S  PW 32 $4(5, W0\,0000P`$p 00$00 0PxS 0S00$00 0P P HWT $0P0 L 0S pD 0S 0s X2 0 RS $0 @DkoO@((0 F 4 0 8 0%4 0%80 %< 00p P0 @2S` RU 0`%PX 0 1<Ap 0PP,2 0C0P0PO`x(2? 00PPpTpp0`Fa ?`1<A 0?``PP,2 0C0P0P`(20? 0PP`Fa?`?`` 0S\ 2S@X @TVJ041Sh',';1AT -'`ǵӵC-pHBM42gS4w0r0bP42S 0P7U42S 0S v؁ؑP 42RSgP:v42S^1!$1(1,ЍC0S dStpdt 04rW2S 0``p 0LPo"R Se0SЍCv@D> 0ЍCSPM 0Ѝh''06=nR@-0@M0@ pp`Phpߍ\  G0  0^P \ PKt02S 0S " ` PD!SR l0PԱ2Y¶۶h'@-0Xa0 0LAP d2S8 P({$!p! 2SP0U  $tp"_ Rp\EU$pQ0 00P d2SP RP@A Ѝ0P0!!1 %h'mdU'V'AA-@T2 @P(HP #HP HP@ `p@T 00S p`V@ HPD00S @@G@PX' %A-Pp`{ @X U 000 0@@@@-`@PT FpF  , 0@@ Ѝ1 @fO-MM0t4 P@ T\D GP @ <GP44 00(04QT(0 ,0) 4@# 00@,0S @@((,0@`00P0s唃0C@0ẨP@P0 !0P1P83l0 (3Q,# (  s4T0> tp@: PE ,0S ,<:<(00S<(00@1 $=P/'0FSʆ` P0S -S@= 8P00@ @P ,0S ,܍ЍA0 $2P F8800  T0 R00S' ,10PAPQPa40C 00CI0S0SI0S0S C 0S C CC$0# t PS<(0 - P咩',c12&4  %= L0/'0/'0/',@-@-  E X%G-P`pPI@0S  0S X QU `Y 0S e0S = Ѝ'QAhO-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @Pݍ Ѝp!r`ddPp=0D@@rOP,0: S0RP00 0#PPP81: S`P% S  R  r7PPtPPPU rMPP @P'Vm'T @-P 004 0,$Ѝ  }'0@-4S 3/ c'@-QH00 @ 0 $8EH@'@-?H@@885H@@-p PL`@@0 7/0P S Ѝ @00l'O-@-M:6M  @  @ P0 0PH H'`PMF 0S= f vY 0R R p0 0 0X@OpT  0S" P%5 uP嘅eU \ 0XP0PPƧ@ލЍ03/0P0 mP⸿P@p  0S0SW SWt P0:0O.: ;p` P pᰠ B,40@0Z0C @ `V*` 0  0 00000 `0`00 Z!   00 *0 0!?P0 0S `7DP& Z G@P ZG Yp Z`0S< f Sp Sm pWp 0S 0S @W 000 !0>0S# 0S,aQ600CS0" @ T 00CS0! P @YT Y@DOoB 0Q  } @OoB` 0 @0  0 0 SNT'%%*@-0M 03sc000@SdM0 S\PP RTPP u 00Uy `Ѝ0S 0S @ F 0S\0STp\ 0/2@ 0\0Sp0 "@u 0@kp 0S0S(p @\0Sp # @"  @0Sh p @D @P@ @0 @ `0x P|"%   T    P  @@``L 0@` G H D'''0RtFaG-0@  0P 0S< 0  Q* PPz  V 0P` d !URQ <e l jD0 p H0 0W40p P O u 0Q40   040 04$00 00$0 400X 4 0048<(0! 04"8#<,0HpP AP 0SD00D0D`` % $0+4& 8' <"X0(0R* 0H0`-0, 3$.0 (/0,8 001 42 00$4 `0,<00 QP  `Ѝ   0P  P y `P1S1S1US1S 3S3S3US3S, \ X`P0`$ D30@31<313 00` 0`;00 QP    A 0P`00S !14!8!<<0!14!8!<@040  0;40  QP <  4 0PA0O  A0] P 4F 0R  = eYXpW P0E@ 07#;;S`dXX $ R,0T ,0T0T0 R(C?D0P 2L0#1\0\0P 0P 0L0000P 0L000h00Pdl0d@2<X]b1RRaArrAaU7Oh@-p@`P 00 P0P: 00QP  Ѝ z0P< !@ !0 P0: 00QP 4 C0P2<7@-@P L0 R0!0!0%^l00l0 ~p00p0 Ѝ0^ P ^3# ~\ L ~H00L 4U 0LP000Bc2=G-PXp ` H P@ Ѝ0:!0㑘0 0j:Q P D/ yX0 X0 PFeO-@,M0p@$0l@`P P "  pP $PPhA$0 LR0- \)̌ PPP;p P ^^^^ \\\ \P PŸ Pu p/  P@P L0!$@S@ s@@P0S$0p  00,Ѝ4( L0 Q$2 q(@,"  P "  @P*"*  P0 SP "!"0  0@PP  @ x  P r0 r// /2O-`MP@0P0S Ѝ p W 0G s 0C0A s 0 0 q s w qpp h`P0P@  `0P 0 00 P 0 00` P0A s `0 Pt P0 0X ` P n1R#R0/0@- PBU02S0P^0A-p`|Pv@P  PlP P0R*"R0R0=PO-0p` \PPX Ѝ$P  qQ 0 Q0\@T(2 R0@ PQ SC0 BTX t0D s   0 TX Q  0 0 n | P [ P J BPTQ2P PEBO-X`0Mp@PPdЍ ?0Yl0L 02 R0 r00 P葟P#ر 0 STR rH 0/BP ,;  0L˜ Z,$ z ,(  \l  ,΂0l\ll 0\l lP 00Ql"! CClX0!  0z70 QP = PFO-ḡ帱@`PpP0S00S <q.p@q8WO$0S  0S 0S,0(  0  P0S P  MPpl Q P l0p<0P0Q*l0S 2Sp  l\PP 0 RQ@0 P 0 >D1v7@-XP?`\@#@3P@T@TpW @@T`L'O-@HHM8p1pP0 0TP0S<0T D0S Ѝ1@ 00`0 D2"0㒡0 06 Q P 2P 0W:00 06 Q P PLU  P<0T 0qB'O-M@L0S<`@DHp S$!P PJ V_oR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:,Z'0@- %B?@kP/p0S w90FS `C 9p@@0T Ѝ?  C0'0 PK %/'O-`-aM 1V  0. SP0 S@0P`(0<@@0$0 00@`D0$ R! X0p1#r#88  ,0580, QP r0P@0`(0<`@0$0 00` p0C##   GPW  q2pG40DD04 SD00S   408 24000 ,0580, QP (100  RR R0(10@00D0 p0D0G > /&P2 (1 0(11  J   0 0B0 @0 Paߍ0@ S100S  S:I@(1  0I@0;+ 3 P(10(10@0 00 0Sb 0@ K <0(0/os" R$ 00 ,` 0<0(0 0$00 0<0P `S<0! 0C<0< 0㓲" P 0P  P P :P R: U 0`$00`P0 4g | U?0$00`P](<\Q U`V  $   P`$ PK/T< `0p!Pg0hQ P P0S*0`Q`  01 U$0 0 `H0h H0 P  0 0 P @`  Q .0 A  L L G?L @0CLS \Q*V 0 $L0t!s0<80t1 0V4 8  b5S5夢05ET0  w6P05 ET dT 5d 05 !d P 0Oߍ RR+ @ST$5" R$%P0S`0d B2" 01 JQP d ᢽd0P Eh0K/0h0 80D! ",qr0d 01( \4 j  8  8,10,1#40L0sK?000/1001001#40>000310 00 000T0 C0(%,5QP Hd 1d0P{ %'b'/CS4k@-@ P 0 5'0/'0/'0/',@-@-   0KX%G-P`p8@0S  0S X U `Y 0S 0S y Ѝ'QAhO-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @Pݍ Ѝp!r᜼ddPp=0D@@rOP,0: S0RP00 0_PPٽP81: S`P% S  R  rsPPtBPPPU rPP @P'Vm'T @-P 004 0,$Ѝ  '0@-4S 3/ 㟽'@-700 @ 0 $#(7@('@-{7@40((q7@O-MMP@`pP_P0 P: S3/JP 0rS T700P 0#0@0@d@ U  W4P  &P PU 1700@23MP@ S @X帰张 P60: S)^0 ",3PP@T$P X+ S R"ᢻP-P U ޼Tᔻ@\ SxP@`-pP @UPXp!t0#PU000 0 N@P ټP60SVW yPPxļl0 ῼPPẼPP V80% ܍Ѝ FF F@ 0`( "4`#/ p@-"440 @"440 P"440 "440( $0 $(1 XX1ddhhllppttp p@-"440 P"440@ NKHDDB@@<HH6L`LPPTTX~X\{ \`^1p` pZ1 p@U1p@-`"Q@Upf@p@-@P pA-P@M4Q->C->?n}C@X=X\:\79>9>:>C:>CF 0? AC>C>mGFE~EnFG 0X J~ pXW}m  $$((,S>,S>GFHHLLPPTTXX\\O-P@4pT` !"441!"441  $$((,,004Vܑ\5 S L5sTԀp0,$ $Q p W wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUx0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P 1 RP1H X0  P=!`3 Hs0S$00S U '!0S V0S G 1@ЍG_Xs-P L0 ЍU'''K`' %gQ_v,' 0`( "4`#/p@-@HP08v200@ 00 b/00 @Z+p'00S 4 /$' 00S/$' 00S/ $'P000R0S /O-@("`0 SMPf0SD S0_졟ď080T C/ S ! R 0C00 0@Ѽἰ? 0f&\5h!Sp 0 0Ϯ00 ?@U '  ϬR 7 R  0塼 \5S0 00/70/0 0 ጼЍ P L R  H0z0 0000s'''T #PO-0P@:1 R0* 0딑唡0 `P3Qx 0 U0B: 0:0Ï|!1\%pR 0 0/.p 0`0 C c00p0S   0 J.0x`0 zƃ1!0x 0p000(00S'Hh''TT''O-tCM0 RS !R0*< 0D`X 0:3 p 0  <:0ï\!2\%PR 0 0/. Px 0`0 C c00d0 PS CQ c$ :R, Q,040(p0p`ßp08`,10SC 180Y@`0!X (e! R<`?0 XXK&o[H PEp1 Q R>KI/V08:‰ V/ PlYFp8 0,80<00<0S<00<0ЍF `FFF F  V   R0K Q  Qh'h'T'''@''' 1G- 0pP `k0  0^0@ 0S 0 0 80PS `P` 8UH0ZP000PS%`4s&Q$,$ (,`(PeP8)'h''@-@8P C080h'G-`P0pS100 B?7$ P@P 0@8ض@Pt1 ?`10pA G 0  000 Z`0 0 p0 `1 `#(p"(,V Zp`0PQ(d0S\1@@ 0XP\   0^P0d000 A''<'H'8'4'D'P0p@-P @?800P( 0!SRp<'H'p@-X`0SpL0LP@1D@A0S咸吸000p䊸H'4'D' 0 0 /T'O-H0MS MP` 003/ ލ Ѝ40 pP죟00 ,0H000 t /0 @ S 0V 0+0X0x3!0S' h3QgQk  0   0励0>0Z0 02+ 2R720t0S2ڤ2 Q o   Zh"$$+<2PD" R{!  { ! t R1W+졟W000d1 Q5 10000S1H Q B/o" RK h!B0   ,BLD>)P: ! RP, P OR 10S0Q 10S 03/     0P  0p`V0-'''',p ,'.R`('0O-S㰄0`P0 V0RM#@M(, : SL \p(5R,<R  P  RSV !0 ,u"|0 sB?P0`0  0S0 00 000Z_ 85x @5D0LT 032 b< RP1QZH 0j 0q0SY "00  G1+Gf(P0S00Q )yQ2 <P U`P80 00S0` 0ƯPPQG 0 0H  0 !40t ?:#b 0PU p0Y0Nh0SK  !gV _08001(P Y 03/ RލЍb0 1TP+U0H 00R00S 00  G*Gq'PK0S@ PXPT0 P''@','.R`('@@-@u!SP80< S0 80<  D ^!p@-@@PU D #P RP 0 R0:pp'@0@-P@80\U< S0 80< 00p@- P0@<U0p81 R0p8P@-00S 0Sp똧P0Sp00S rt 0S 0T0S(Sp@,''\'VJ('Q@-@M`p{WP 1!  P p`V( P 00S0H0S 0 0 P0L (-00Stt,  u)00Ѝ@L&P0S 00`Ѝ衅gH~'''h'h','0@-MP `"@? DK)Q Q0 $0ASЍ000d5O-,Mp0 /@PD` T00: SR) 0Ḱ0 倡 R09:` V `3 V `!ᛳP@P(0S @P(0`S @P0!0y 0 0S:R 0姴40  `(`!\Ő\  ? 崣 ? (0嘳 0S30m Sm p3 R #R XH3 R ,(03  R0\ 0㵯 ?0 " 00C 0L40S$40 0C$0娂* 2)|20S S 0: S ( S,  Sg000 00r@( %2Zp N *v0M0`S 1 00|10800 0ˏ I0X0 Q0T @ 0`; C >!000O00S 0C&  ,Ѝ*!P( 0ˏ d Λ 0 T @ 0`; 뫴 hL'''0'T''$'U ' ''''O-lM2@ 0p`mP!\P  ? 堒 ? &0 t2t0S0 S 0X"S 3S D@X #(20p`Y2QpQ\tQ`Xd   X 1 R, e'00X0S 0 0 `0\ *L!00ST06 0 !S0\ 0㵿 0 " 00 04$0L4R0@ 0$*00G(0S WP8 P& PlЍSq tl'L'T''$'U 2Ƞ'h'h''' 'O-`2|2PU@PpU00 Z0 0 Ѝb0 Ϡ˿S 4G g@ WVLQVg TU A0 ;&00100 @0  @T` T0pIT Q 0@`L @Q 0 `  T 0E0 0@닁 0 &P 0 b0 W`0@S 0 000l000 %[P00U0 ''TO-P0-p,MWtWhfp`0 00`?00S \A3@30000PT Jb ? @00:h @TT00T S @@S  T 0  0 01 0PV pP 2 000`?0p20SA 뉑  0 04 Y@ ;  10> Pq 1 000`?010S) 0A0 0000 p 0@0S 0YlhA W *%p 0 0000000 $phQ0 0 0WCq 00oq00`P h0H 0HB0C0 T04 OP  ,Ѝ''o@- 㯰X%s@-@P `ę0S 0S 0 Ѝp>O-M|E M`P0S 0S P pP P 0SPލ Ѝ000S  P i0S 0S 0S M0Sx 0Sx 0Sdw0SP(0S 0S0 08Sd s/2#' 00 " " 0D@!1!? 0 0n 0kd!! 0d0 pPd0SS "04 0 R0  0"? 0 ,¯ R( 圠*,4ï0A80/R%'<0P 8` V Y0" |共0S l倱hbPUt 9@0S HuDb@PUn .,l0SP@PPDPSH0S  `Cn* lxlB%|0S llR0p00S00Y%P 0,0UA:Я000S 0S PL1 H0S 0S,0S P  P   000(PP 0SP P PP P'U_x .Lm8Mt{$(aVm2O-@H0pS`M W0R0: 0P 0 H"p`/<"0 S0 v20SW IЍ 챟쑟P  BR 0S#/  !.V  R.. P x!`T  R0  D lP  @@" 8 < P`8 <㥬P0v P0  b$㊮ RP `  ^ V UV U '' '' ',':'00S 4 /$'00S0`( "4`#/$' 00S/$'O-M,Mp `@"Z:$ 0 0S`CZ ` p)P# #0`VP!0 00؍,Ѝ0 (P  X 0`VPh0S t  0uh P  N0SHH, 4; ([(+Z054%00! ?0S S00:00/0S 0 S00 :0V0 0#03 R00S :0S; 0  y6t: 0S R` P 0[@4< S0 4`?0: :R00a0 B?QP%90S 0  A  0 0` 0YP0  90S00, 3P$0  ZP00 0 S_8Q<90S8 0 V0;R02*h0S/ 8((d0 #0 (P el80S (00 0(00x 0` ~ (@(:70S 0h0!7'(5S[/V V:'<V  3 #P  RJSQ< !0E D U0$000(p i0 U87PP0X 0ZP] D'000s0@P֪P6@P"㾬h0S0P%Q_!1Q 0PQ^100 U0 EPP P00t ?@1#R 10S0@P0  H Z$0S 10000S p50S $0S 00 P0 (t ?w$Q  40S $0S    Qa 04 0 S 00 0 0000 0=$000 0 #600S040S T4P P g@pt3QpQSLtQPXd00H00S1 0S p30S* \P00 4 0C(P2 2 0Q\00&& :000@{0S828040/<0a0#QP8` QP`U`00S 00p@3P0p<`$\5SQ%Ϡ<# TD ?=0 (40S 40E SE 4`V0x@@0`S y0,  d(0 嗬0030SC 30S? 0 S( 3 S? T!. 0 / s\@T` 0 Ń># 0S 0 S\00T0  @T`0VT? @`1020兑A0^ 1QS  0`a 0P0@ W۩ 000 Y 0?* 0  000VT pW  `@ @p \WV00!03SR @1:0R@4a p0  00  P C0 TS YQ! 00  0`P Q00* B  a`L''T',p'''''$'''X%''U @0'Yo'O-`pܐܰ 0M @ 0 0  BRЍ P PU QP X` {{@ pQ RP Q @p'' 0`( "4`#/O-lMX 0X0X10T1p LL1LP` 0,0SlЍ0S 0,@ d0 @-00ట@ 0D R`pT0#:#P 0 ARpQ R\tQ `; R  @P\''''X%$'' 0000@/00S 4 /$'00S0`( "4`#/$' 00S/$':O-M`@@VMP`90S 0P )S0*`00#0.吉Y pP 0 WP X)T ,PL9p`0S 0S ) P00 8 #R0p0,S00000e8 00!"441#0"q    0P@ fbf}00C0U 100 0Sz A 0PtM0$S 0S '00`PX7}`{60,S00,0007 00!"44'1p0pp00ppP*0S  zPe 0 1`]xnPY `@   80< 0 80< @00C0 şr0 00 R.*0S  2P  0" RVލЍ0S 80< 080P5 0< S <:B0 00$001 E` P 0S 80< 0804 0< S B0 00`S $`!  B("(p   ᴁP 80< 0 80< 00C0@'80P<.\SP# .P #P*PP3P`080< =D3 Q035;:,pW P0Sp\\(?0AS񟗮HLLS3 0020S04000yP |2 H#R02 00eP026 0 03#R0mQ" 0S0S@0 xGPp  : S000 !0 #R0 Q  x 0 FQF?\!\  ,10 S$ D.A#R0 š!ʡ0S  0R 10 0 %00lPd0`00C0WPpo ) ''''DsG,'`$'w'&''<51)OwO-MMY0AS񟗀| h h; dPX7 㶥@. <P j$7 00>@0  6P 60S 60̆V6 X  0h06`$00嘦嘶100V3:6 Rpttt0S.`@aViPVohݍЍ( >P:P   u 0S i @ FL10u0 @儧00@(0S Shhu`%sp(P* 4 0  B, ! _50SW 00(000_/0y 0S @p(0G0S(F GQp(Ac,xd4p0(S9@0W78Q,0 S1 #0 R( S000000!W"!#-W l'px3  (  _/.   ,0 S1 #0 R S)R ) *V { { x 0 S( R , o"2 pR)@ W(,`0@'a V!W#W lp Fa V @0 (0S $ 0 s00Q P0S"0`10S x10!1!00C0!% P0 00000C0!" Up0S@0 0 0C0 00@,''4'D''''5X%''X'l$'' 0`( "4`#/O-Mܒ܂Pآ1EPQ@Tߍ0S `@EDAF@D d0 |`t00@   B 0    S,"[ "[ "[S[ P0:000S1 a 1 R R@0 S 00"P X100CD<(P X 8 X ! ! Rph0QbT0 e R\tQ ]` h00!P\ t00f 0004'D''X%''''`'OTU'$'(VO-`0p(4弰 @$M? @$P\P  ? Գ ? 0 r30S30W SW 0 S 3 S x;@ 002 P00 00CSFTY! P 80R0L003030 000? ` a Q2!,S Q0B*2+|20S P9 PHB P$ЍS U Px?00 1>!W 00S>>0Q#c ! RR 3 T0 0 S`0?000 ? S  R.. 0" !00S0H0S 0 04040c/0 P0L 50 8 QT $  $ $ $  L30  ^\ {0{< 07Pp0'L'T''$'U 7' ''''00S0`( "4`#/$'O-lMX ℒ`|20xB0,0SlЍ`R0S 0,p d0 ,p$000pP1@ 0 0D R`T07:!AXpX\tX`Xd  X  @RH$ȧX %P 10S  0@PhP 00S  0M0S  RQ {{00勡|  0X! 0T  L  <0P'Ƞ''ZX%0'''KO--oMM@P00 0t2l?0SX0S $5SH0SY<PZX0S $XnS X Rg>`0V\2 PT20! X" \" B1\"T000B`X$dPp0A^000h21`l2\B1d2>2d2V0C:=SLq QT20B   0S 0@$5H> *$>3>0S B0 0pS0  B$511  !`0P00B1- 00 S $|䌟0S$ 봀 -⎀Ḁ$1BP`R!B@ LᮟPP p bl 8PN 08S <P| *堀:<t<0S 0 0/X0bA?:T<5A?T0 =80T0.H0; 0VHQ RX0`0@ <08 84<ϡP b0{ S Q,0 Sa?^< P< ,;0S < A>+<B<  CwP: <@ T 000:J*:L|:0S [0 0؍ߍ08008``!.Q  R  `0" i0S ,p@dF  0@ PpH 嵡008y+\0#Q  0 ` ?옟  0thS 90y Sy 80S 0)S 3S  0S 0 0 80S 8 0SD(0 08( 0Y (8H8o;\Ş&"\ ` 0 0Ϣd h  pBnj `b"36'+?D "@ D @ 08L<PLRPP07L `V=S؈<0D 2L0VpC p,00C S=Sy{S +\0#Q  0分h ?xY d 6J0S <jP#50h (60S 0%\Q\u5P50 S555;o\Ş&"\ ` 0 0Ϣd h  pBnj `b"36~@&  S>p@z0 \\L5SVPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//'4O-P@-TM t圴圔pqx-[?ldp:0  0@ @P @Ѝ`\VP0S/ 40S40S  ?,:0 0 P`\/P3#0S #S5| P p0S d,0CS Ds*0S 0\%R#\\5 0C"?o20K`h0 0 S`2 0 ᑣ#0d 4: 2  ? :010S?,A!Ϡ\<# P  0b  ? 0SQ0S 0ġh N0S 0x\%R\P l10S%`yXQ5 L!0 0@! 0 *% 0S p 0 0 00@@ 1`h0̰00J00V* 0R A ᣘD'('''5''HT'g<'$''8 T'''P'' 'H'L' 'BX9O-@*@M0M08x`P 剘 fލЍ80S q:Ps pP 0: S X gP@888X04HSP )000S 1008 78   忘 㺘8@ 㴘8p 㮘[WppTp\7PpWL P 7@T P ~H8P 00ݗ 86F R>0 0p 0<&00P @X7@0@$60@w>0 H0p,gp2S )FP )AP ).T4PZM-`Y 4[ 0S0:<관X V.+0`  0 ,P %Q$ f Q춝C ?yPu` 2S<404040$4FX02P#W20AT2@02 Jr0GE ? 0 lH ? 0pl3& 8 S20#"20#202P` 2S d#0\P@Q=S00 5P@ ) 2RT0 S @x0S IC 5*< 5(3 30S q0 0@20S 0巖|3 0 S@ T 10Sd"d2Q`d 0D^3" @=؀C2,0刂0000t @DO.0 @7'p0 @S葟0S0S0=S0S p(8000J p 0L%000X30P%,q  *1 10S @0 0 '4'8'tT''(''`'P'^$'('2CLwTCb(TJr'i:Qt@'| 2P' '`.%'W''D'' 'w' ''!0'E@''<'4'8'D'H'l''''$','=S%0S& <0p 0P%<<00X30*0 00S [0 00S5 0 >0S WPLq 5*N> 0:#: 5p1y $10S 20 000S(3Pq00*1Y 10S h0 00<cQdzP\r 0<0*p29 $20S H0 00S0L%r0L%r0H00q" P 000cH00SPGP$s*x43 20S \#0 0 00L40q"  400cL00SPs*P330S #0 0 0t4pW.4E  ^  \pWR 0SPt*4T40S f$0 0 0t0Q,%R0%45S R! lf004E0S|PP*`5}50S 6%0 0 00(0Si xQ$ =0S0x < (%0S^,P*6Q50S  `8&0 0 08%<5HSR$  H00850<S6bP*6#|60S 2&0 0 0@%D5LSR$ t L00@50DS4Pp*e7470S '0 0 07 70Sa0S0SZ0L5sV0SN PT(00070L50P5?T5V>X50-00$ő0!00B\A`0PPPB 1@500L 0H000*880S W)0 0 0T PYd P4TQڨ0QXڌ T0 0S Py*9k\90S $z)0 0 00S3 6 ,0S0QQ*P "0 0Sl xP`z*p:9$:0S H*0 0 0 ,0S z,0S  t,0S0+ Q^ NQ L b,0SQLd \,0S{v<Q T,0S N,0S H,0SH  8%L < @%D;0,5S0SO  ,000;0,5<0(5H04E0/85L0LL0<%/@5D%0*)p<$<0S r,0 0 0<0S <0S(L* <<0S T0 ]h < < PRL PM\= 0S@ -PL \  `\堭p@PUWʸ- 0 ?001>0.P6  ,Pᴏ0>P<) 3D^ SH.;00 0 S 05t>|> > 唏>p厏>PWppY>@@5008PEUPHLd  BL 0b03",P P Y) T?0S   p?8 H4L0d P B b"30 T?0S   q0`00p] P? p6P k0x& 5000h60S 1S P TPD6  <6@ Q$ !V @ 0`P@@  04 8 <%c#!$c4"%S 50S :P 0 0  ``Z0  0 0 0 05a(!"4a#Q  0SgwPh0 $"448#8 S  0SidPj0 $"448#8S t0SjXQPk0 $"448#8V:QQ  /Q R 0Sf4Pg000 4000 Pz c0SdPe 0 40#40ht2*0S 00 0 0 00  $*0S 0 0 000  0 *0S 0  09000 0  0p)0S ``&d``0000  0`p)0S @000u0  01 1Q1Q,+ 0S wA 5< 0 !00!@0|!0pCS #0p R0 !0B88#80WP M`@fᤍ0Pឍ0UPQb R E/ !0!Y pG PL''8'C@'('`''LBAL'I +A^4%''.'0'',',||00S!4!: S  S :C / S : S 0P/@-$''51A-`0S lhr@ ㏏T L10S@10S4Ï,1 10ST00S ᲏p@᫏00CS0P U 00CS0  P PYU PYU0 P0  0 0 SNU'HT''g'U'p%%@-@P &$ P㜍Ѝ'zO-p,1 p$1p 100 P1 ppP 0P  ppPPP(u @ ͏PT`00 WT ᯍV ᫍp pXP @@ 00X'T'''`''O-1P0- Ϡ,"ʼn$MP   p P 0L x 4`,@T 㛎 0`P$Ѝ?0 0 ?     P 08 00?QR0 0# Ϡ?G0 8墎`0@p 0噎('$'tO-p- M0P8؀:0PϠ,"  `᠇Z0 Ѝ 0|o@Z ЍO& ?   僇P  ? W0@`(''tA-`P@U ,1  U0P PP0 0T3p䀟`+0 L@D0T@S    8HĒL d  B 0b<3l@"y0 S  0P00`0@TЍ(',"''$'' 0S/A-@p d`V F0P f02Qf0 SR P00@00 0` PЍ'(''@-0P0@T@T$d pL `l0̠p `V W @00 0 0 000P@0@00 Ѝ''Hp@-XM`P@X  `P @XЍp0@-S H0@S  T00S H&004#,~P00'_T ksp@-@8`8P0 /$00Sp p@m'L'$'0 /'\@-^* 0<80@400 01Q0'0''!%O-\MPpSR E00 00S` tp@ [00CSD \ЍO}`T `'0XYH`o`00E0 0PE00?0+0F`F B\ЍO*000D0P p`  x00PpD@T  0F  0/ `@V @:P pVm(vUTU\%2R/C-@=MS}QPH 0SV؈PV.10S %10S0 L5as0|pS净  T0S   0 0"W0S  :0S  # $ $0 \# 0$$ 48$( <@$ D?>L H$C0 5L5s0P500ߍT''$'\%0R/=S/ 5004 030304040 5 5L5sP%P% s,,ETPC-<40S 0$0,DP$440S0 40S, T0SB 3`3 30S@=S= 9S*330S Y0P 0VhSXS0Ts*P`UU00Q AP 0S ?@? `P"hR0"00S7 lr002Pb0S) x#0S) 00RE>0X4* 2920S H0 00S}$WP10S q$1 TQd1*}\1 P10S 0 0P10S DP$41 P0*\000S 0 000S 0d$ a 0 (0~ ЍC~ Ѝ','''' 'D'''('' '$'`'''L1X'T'FcH''L''(O-PPMp80S# \/ "C / Q @aV``  [ΑYP d \P  ?88  ? }0 P2r0S0` S` 0!S 3S  0嶣? 0!0! !!0S`0 0 0 `U\/0ϬL3 80S30Ð0C03` 0S300CQ"À 00P*q00S ` ` `Ѝ kS  *$0 0C$040S 4 $ P@ P V'''TL'''$'U 7'' 't0A-P`p`ATR @P<:0S @ 1p0A,'80 0 1S/ 0S/,'\0 5< ÒH0\ Ò3S\ Ò3S\///'^FPO-0(P,0@4p8`E P P0P` 0S 0 S   000 00 00S 0 S L0 w0    p p'(0'Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS lp Q 00p( 08pQቐሀ@Pt`0SP/100 P000B00   @-`0St`@0o/0! 2/B1   P"/   @-$`0S00/1000/0B10B1/101/   @-p4`0Sh\00/1000/0B10B1/101/   @-JAO-$5S[  l@P`hT00! t pbR$ YB,  !$  p  R !U101Q+DP 1 @PA Cό02 R&@@00Z   T   @U   @ Ѝ ^000 0S0 B0O-RMhbP   @PHO@<  WPpߍP(  x|ppS0S  an<08 (00,0 0000400!4 04$0D0(0 P gVph ar 0 p HLX <~X 0zX $vX rX  2|p ,|p   {p 8p?pq8SþPr   00**0@0}  0* *d@edA+CL]i{zd@A-CMMPPp`;8 ap@P  0P;P[zU00 ## CލЍO-MMP@`pP{P0 P: S3/P 0rS 00P 0#0@0@❆޹@ U  P  _{P PU j00@23MP@ S @X帰张D{P60: S)^0 "elPP@T]{P X+ S R"yP-P <U {Ty@\ SyP@`-yP @UOPXp!t0#;PU000 0 y@P {P0SyW ⲟPPxzl0 zPPzPP لV80% ܍Ѝ FF F@00S 4 /$'00S0`( "4`#/$'O-pt1l1`00Pɯ 0 X@ 03ˠ121#@ R` 0zA0P s00`RQq00S" 2% 0%3CC(0QXp000Q  X00 <P00.''('%,',' 00S/a$'O-p-M 0뜱`P@0V000Ѝ000/U0p00 0 Z000P00S I00 ?0X000  1@400    0P@4P@ 000/U05:00 0"000P00S  Ѝ00 ?0pp%&` $ X|yd0  a'%o0 S    'n,'$'','p6O-PhhVd6d04MCTH@ Hr` pr!0_ 0 CR(,$p$##,$,$@ 1  50S )T 1 19 1  @ a0l  1\  P 1   x(00 0x00P(0 R. A00!00  Y40SF 0a!(00 0`M00@P(0 R4 4 0 $4$4\0P 0S 0P *0S 1  ( 000juPl3 @ 4ЍjP|30S01 0? ~D30,083@,[0 S,0(,0h Pn@P,@, R)0,0, 0R0( 000 [0A(`|2 Q,, (,0!P7Pm,00,01R0 00 0Cp"3P0 ,0W7! 1 1S2K T10S# , 0R?R0(0$0 000$00?y000P$00S  [ P0,00|$0 0 d 0 0, ( 0S     `Pp@+G'.''Lx$'F^^Fr,'q'(%O-0P⼁!QPP!a`$Ma !S@r0!!1  `00 0p000P 0S @lD$pPU PU 000/ 0`P&P0[P    0S A    RP P@0$Ѝ'G.''0''6),'p@-P0 % .  @Q 0S p# #300# #:>00Tv0SpP8Pp'^F'<XmR/EG-P `$ 0p@V` 0@`` V`@&!D`( G-P`0 4J Y0000008#8#$48#8Y\dp q00! ## ?@Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- 0X$(p,P0`4@*^0 *^0 *^0*W040P/ Q\/O-@p0P2#U 1!FL ` R J` U9# c! SV Q V3  P! I P` 09# c SV!Q V3  P 0 P$` U P `` Ѝ2 0A-1àQ`P |0| ||K0@Sp࠱ P$` p@QL ࠁ PQ e p@-@P0080P 4 PR*SpL0L LS@04 <<K0C800S   0~  ,0S/`0@-@0  Lr,~0,0080S 0  K0@~( ,0@-S ,0, ,,K@TP ~@~( O-p-LMPU`@( %88S80@ @4@D2@D1@DS@D50  00 0P U0#03?[[[UW|@D `0P 045Q ,O0 0 J~;D 0 XR @ }"<p!8pL0$0$0 0H(0 0 `,0`4  0 4$KHP 0 'PL40  $00T 0P{, 005RSUSP3S` 4$`UQ{V  `F000,040000 C3 : 4`C#,0PQ(0 $,80* f@P,Ph3Q 0Q+ 0CQ 0؃SP` T$P$P@ }T@P P0m{TpW@ !}P` !T@0`P`0?: p0T @ u8< @D0RP P?v0 `S2$0$0S@p :0 P  S Z 1!A8  B`40{40 040 00Q800800pȯ0T0 `S2$0$0S@p 0; 0 P 80S0 0C800S   0}`~O@  D e @ LЍ0 0(ALBAW{|) NBAW,< N G-0,0S0 IPz@`00qW40S*|Ѝ! 0 W@P   l@Pp)`$ A-0`c,0@Sl0l llIPpyQ L0< H 0P@DT@)s> L? C-0`c,0(PS0 cIp@LQ |0l x@PEU  0P !  0 P P Ѝ)O LQ X0sC-@0Ђ D`P 004 0} 0PЍp('bX0sC-@0Ђ D`P 004 0} 0PЍp('0A-PQ H`p@0P R   T0! u}@P 8%4P{+T'(( @-,@P,0S ;00(@-,P ,\  D Ѝ(p@-@Pp0p 0 SX0d0RX c#!$c4"5 D006.8 Q#3SRpp'$''27@-0S S2+, R0 ELh `Q tp"PC;{aQ* Q( H<P 4,B 5*< 50d30a3=210S ᆵ0 00@ 7.Bp#x3@ Ŝ & 0P xtX|PA 5*< 50d301$10S Q0 0@ d3S+ CQ+aQ# 0AS"HP M@0a3d3*|0kp00S $z0 0@S Ѝ08'('E { ` ' '$'(   O-0-Mp "##@0` @ 0$00븃 =pPs0S @z0P- # 00" qp)$z:lU tU bU09pP*$@ @& 80 (P  @0S (00,00#+C `$;0P P V0d sЍV0p F  pP `  \0 p0P `P V:P0V 0S00$$0T+S+ Pl3 0 +S P<  @0 00$ 0S X(0,  $ 8yp C @pg0 00$ 0S X(0,  $ 8\p| \ @0Ph H  P0 Plx%!%F*kG- 0pP@P` V  0  0  G `00000O-0mM` $P0@004080 0 ~pp40S+ mߍbW AW LW |8y4ycW iW0p8 4@ 0 0@4: S@ @0(0D0,0000408`0P  P 0! RT| jop 0Q= $ 0! $刡匱@P 0V$0 0/S <<Y- `*y`0"<P0<0$v`P mP%< py mw <yVD @"$Ux 0#$0@0P!SL `VHnp 0 n?C0 < n?n/ Wm0Pp < 0S `0S  Q B/o" R 0S! m0H $8HP`$0F00pI $ pC rp:0S  (, PQ S RPQd T %8!%zd@=2SO-`-d,MPp$`` |p@($0S0$020S'$00 P W 00 PSk0  0"%fT AT PT xZ@pT$jp@,Ѝp00` 0pP , ? o0 000 00 p p@00 0`*qp p V@p@`N%TjP!%UG-Pxp` "|p@<P10S<  p o0 < 9X $$ Bkp@- `&W00S $$ 1Zp@ Y``V @fT rT GX`$$  =p@$Xm4%h!%+ @-oxA-@P`pP 4S\ XCyT DD =y8 U  A2yA GQX%%@- R0ЍpP`@ FP0 0S 0SS 0S $$1!BS0S eP _,, P/00#01"$# O-@`V p?\ `@^P6 UP@ @ @7 TQ @T*  V00 Q *@T*!Ê?@T*, ? ! O-088P@p[`@ S Rᷠ000S0 0S0 0S0 @S" ?@0S^ :@T*.@A6 7@RQ0BR !O 300G-`$(Pps@P 0'0 0%Q P 6v@Ѝ jPC-P$4 p咓`㓁(`@ 0Q P Ѝ  qjP404-0@-  Ѝ Ѝ/-@-00@w 0 Ѝ@ Ѝ/-@-P 4(Sw { wЍ Ѝ/QO-MPp`@PЍ zP P 4S P 0uT0P$ Q$YP 0S 4S $ X0P4 S $uSG0!!p`000  0 0  0 @P 000 00 0 0 P 01 T0哇* P$(` ,`$`V$R ڜ  0`  O0 0  @"UPb 00pP0S$p۶TxPLT O-,MX\Pp@Po 2R 4S  0t,Ѝ@ 0Q Q0 '  PS[  "S d 0000 00  0 @Pt4S 0S6  00 000 0 @0P 0 oO0@$00SS `ᾠ(`` (ἠ#3 # 3  1 # 8 0$0@S4S 0$R  @0 RS 00 0 00 0000PV P0P 00000 0  P1p>U (3FcmG-`MpMP s@P>\Ѝ#TC^t E@0$4$ 00; ᴫp+p ht@jpP @4$$: S R B., jp $4S ($,40(B. jp E0dR04<$4($,40 K>؀C$$0 0E 00`d؀E$t0  P0`P 0$4S    0p 01p 0p p}p p 0pp{ P P 0"Q Rp5M*pIg Z0"d@d@  6R@-@P 4B BRP uip <\4( fЍ@gЍd@{p@-@PP PP \.p4PS4 PP 2A-p @PP0T ` Xp4@ p@@Lb$$ - Q EAQ0 "(  0T 00 /$4 0T0 / $4 0T0 /O-`P-p M@7̍P䀟䰟`  `P0P0000t V:Ѝ 1000*0 Pt`P10 0 tP U Pz,X%fG3C$$0A@-P@-@ p`R`kЍpP ɰP 4 R 0 V_,O-p!PR0_o|M`@R(0S00S "R0oU |ЍP dPU 0SIQF (0QSB!RS R9"R S R0A +00S000P#  7/p  7/p 40   m0$80P P ၩP s@-`@P0zPЍp 5/p 4  5/p 4 C-(00pS4`  Ѝ$T@ 0 0 h 0P 00 ( 0PW0RO-0 0`Pn뤀夐嘠p@T Ѝ0  0fP 0 0S Cp n@ 0 _, A-P$`$p@0 r@T O-`p lP`@`T吐  00  Q   @ T, O-M Q8`<@  00PЍ  P P0S*B PP  00040  0004 pp `040p` 04p 0s@-SX`@ P? ?o2R0S Ѝp_,@- iR sR aR p` T~ 7@-@P ,P9P _ Ѝ0_,C p@-@T 40`PPVpp_,^ iR@-. 0 aR bR LR) BsR& tRP 0P0S00 T(p` Ѝ(h0  _,p p@-M `@P` P00͵00kq0S eq "qЍp, hQA-@ MP Q   ЍA~☀ p$0 n 0`Pp `B~ `PP  o 2Y Ա O-$MH@P`P 0P`$ЍpP 0 0 0 $ Y># P0*Q  p0 0?Y S0STp Y0 p G00 pW 0np $ %nP 0000 0 lP Go4  $\ P  0U,S( 0$`84 0sp{ $Ĕ'{!#,  RP P{ T P R*L0Sg 0p^ L004 0 000 0PL 4$$  G $ 0$$?0p6  (!C!a!{!!۶!00S 0@-C^M E@$2p$$E0 0l  Pe Ѝ0 @x("(!p"`#XT 80  @ pP8pꌯ%!%""##*#A#_#s#*##0$ 8O-LM@Pp4 ⴑ崱  1D0 rp  0S$ ! R t!LЍfR lRJ  I@1` 0S  _P bpP   Gy Bn蠟 k܀P 6 4nZ Й  0o@   #Z  Ὑ 0`` P` p#l#%s_,!%%^ #A-p`(P@lP 0p`P @00! 0$0@-@P$0S m@mO-$MHLPPDp`T   V  \ D@=x` @SR00 Q ^00S P UP 4 0 T0 0X0P$0sP UP000 P1!!U111w@^P 0yPPJ T0 0X0$0QP 00  R@P TP0 \ 0 0@;0 0ZS  R@PP0 V00IP  0 0   0R00 0P0@SP@@(4($Ѝi$$P$$$Z$O-4MFpT0X\,! 0 0  0  ᒴ1 p 0 0  0 ᒄ1 ,0dVL 0Sk     R b A  [  ]00[$000(00$ 0S 0(0 0 0S 0H 0S0D 0  T0  0 0 1%4 00$ ( 00 000 0,00`4ЍT0$(p 0(00$ 0 01!$00R$000``O-M<Pp 8EJ@`LU 0S 0 0 0  0@`@ `000Spa. 0 P 0 J)`VT `@ T0 0 P'@` 0T0 0@ ` 00 S0 00 Ѝ  0  0  J)` T'U@ ` Q  R0P  UpP0 0S 00 0 0 RU Q T0P|  P0 T@ 0000Sp@ ` %&%J%k%$%%%P/0S//P/0S/C- `P R Q  0X0 RU@-@,MP@p`lP<g,Ѝ, p`mlP0  4$ @-_XXPX`@[L0 PDDDFm<<?@uTjfG$&&&X%&R R R D@-R R/////c' Rp@-0@P! R8 |||||T|\ R  dl       tpp B R"Sh h@k\0X pppppp 1 pp'('O- M0`u@PPЍ0!S R j8P(P0p \4S\ 00$$88P44 8S jQ QP0 4S ڠ0"S1 @k0  <03/p 8 H0 0($ P 0P 0 0 $ P (, Pp'WEV''('(O-0-,MP`p$0  np@d30S$` vP 0" $ pT AT fT E@,ЍsT0 0$Op00 00*:@=qp 4 `0}p0ᴐ00004S 0 0Q-$2!0  R8 +R.R+갇<\\<\<<\\\<<\<\\<\\<\<<\\\<<< Rh!h@j\1R R8 0S8 0S$1 +10` 0`[ppr pn 0oO@@ *:|Cp@@[hW 8 H00 8 Y$ (, ` (%&(!%@('(Y(tu(A-@ĔQM pp A^PP`|t`QPd PЍpP4 $0 'PԱ2Y(((G-@`pP& V4 t" An⸐帀 ` $$ O0 P ! p" $ppP P 00p$Bn  0 PԱ2Y()G-`-M"@,mp ЍG20SP5`pPx $R  4SЍ4S_P R 0a $ RQ  nSMP 4S P P 0UpL0 08  0P ,!?o  0N0 00 [ pP2?RP P  V0p 4S 4S  0!%%7)N)))jU)@-y 4040P (, \   X \ (Q,6(VV,,(X Q&ZH!V0p` 0p4  V   0 P\"V_ QY QV Z 0 0 ` 4p ` 4\ "$p0 0S 004  $ 0$ R40H Lp 001S0 S 00 sr/0±0¡($qpP4t 4$$  ZzZ~w+%"%+4+p++++x+,\,~,@,,,C-P$M0@ p` P!! ip*0S00 P 0SP0SM \^H 0T' 10S#!Q `2.NP. a@ P P 8h@@@@@@@@TXpT T ],$ЍP`,%0"%$@-MQ a@P^$\<DLTԚDЍ@[f0 |Wfxtplh 0 @HfPFf q/@ 0Ƞ0 0#30 \S0 P p,f $m0 8 "fЍ0 0 ppf1S1S|pЍ@f2\PL  PЍ@e0-7-fA-P-_-m-{---w-*z&--,1p@-M(@,`6#,P X0h P00͵00e0S e eЍp,-hp@-M ` @T $:D0S@ Pe $$0 $$0 0 0 0P ,e 0 tem0 $8XweTue#H  ݍp--."T *-..&/-P `00CS`0p S00 P0S X0X /X]fꨵ%C-YMM P0"0?e,"  ;e }$r@TYލЍ )e  %e Q] e   `!0!0 P\ LdDd0!0(d$d$ ! @<#vP$ !<#d ym0 $8x dd# * @Pdd   F V1.. .(.T *..Y..., ./-G-0|MpP `@ P! gpD20S!nP$@1 9lP`Pa@ P , <uP .@ЍPP :pqPP0S007 P 0S0S \^ 0 Q t .d *dl븀帐帠pW d  d Q d   p c3/%K`PX $$Rt5t%p,lc2P ;@T^NPP A P$E/  a@P* *_|00CS񟗆KPl P4 3Pe o_P0Sa JpPX | 2PQ h2PK  T2PE  @2P?  ,2P9  2P3  2P-  2P'  2P! 2P 2P 2P 2P X*VP y8P@L =@[PX  3P @W 3P p|J P_2PU g@"80xx 2P P R2"(1P t UP SJPU p $ 02#W:4 3PE  ?JPP? [2" e1P4 !0xQ|x 2P) !0xFx 2P "~2P "xx2P #dr2P m0 $80S VP ?  2Pp P0T 9^00Ѝl2_,%"%233%I*Q 0)343A3P3Y3d3q33333f33*333 4441t!O-@-ZܚܪM`p bp :0S ЍO~0FS iSPpC>؀C$dP W D(ЍPzP W00 *9PLpP 8JP$$0CEPH?&JPP "JP (0_EPd4?T0 0P 0$n 4 Q 0 0 01P 4P0P 4 P]  P00 00 0 00[000000S$000(0IP `I0P: TPP DDDN@`P'N@ 0$e\PP  0`|qp R$4=,, 0kqp$0`Ay4 <1Pa 4`9P `P @ }/PP HH w/PJ @0 SD00H0$ RL0( 0A| Q$4P `$$Q$4P` VYI`P UIP lO&|KIP pTP+8,0 ?`P ?@&?  0`qpt p 2/P3po  Ѝ~2J7KiM@-MX @(PD0D DD"0< 0 p$=Ѝ%2V7KiM-M0( 00 P 㡑ЍiL@-@8A P,0, ,,"(7B `kLuL_7KXJ00@ S/a0@SW@/A0@S=@/@-00@- M@ 30, 0 p^ ЍiLp@-` MP@AP G Ѝp` v   >G( PA@6$`!Qvi 0@-,M@ P_'P0 "" p,Ѝ0 0R0 s0S 0   0$ GPP 8 A@\6$`M2l7dK!QP@-M `@ @}=Z {< <G  gVЍ  S?,oMM@- X@&P@00Ѝ  p@@  <Mv7T -$Mo@@PP 㡐m女`0LP00坳 0P   Vt0@`Vm`即`X0 @ @@@@P0DDV5CT03/`7M@#%,MMNX%N//// 0L0L/@#% 0T0T/@#% 0\0\/@#% 0D0D/@#% d0 0d0/@#%p@-@p3P >00p00D S 0A0CS20$Pw>P* 0@p@#%@-p0( 0`P/ R/@#%O-04M@@ !T10* D`Iďp P(0$!pSڰp D@T PoS@ڀAP`@ p00L\pP` R  P Q R/6 0TS $P\(P  1/ P BH@0S mIp "SR(0 Sh』\0 2/P W0 [  BS(7Pɚ;6eXEPO-MMPp  Y p`$W pP$ 1000$ s-T ⬄ qIpl_; ⟄T dIp Q 4T tT8 p# Q T$S賟X@Tx xX00@0 09IPTZ 0 @0` p,0@4@"Ip 0P0PH0h 04 40,@Ip ^ 4gTR H0S=I0S:Y`@T 0 3/@: " 렢M0S:00%  p" pM0S  3T@ +T@03/@~ JI1PJ/HNpI!1Qya`"%J` 1 0 d1 |tp 1 `T!1 DS@`#%J^!1 @ t1 x!|1  SP@Tc 03/@0 3/ݍЍ7I[PiPPiP~iQQQ@#%iQiQQR((QQQiiOPV0!R*RVZ4R?RWRbRO-M@pP  p T [=@Y=PT!ڍ= `P p׍ PddU T1O0S S.3,3 XQW    P/Z    P& %P! K0S 0 L0S 0M0S 0 N0SO0`S  PPV R pM7lRX(%@-,MP@lpP =`P( 1 pu0S hZP J#P00@ @N0, @,ЍNJU (8i(U@UU@-@  0 @ ,UC-@s=PP0 *`@ Xppp}CpC kP pPP H@@'Q@@ ЍUA2U (҃s@-@z7=@P00ЍpHCP;Ck@P <` PPu 2V (xs@-@P =@P0 CPC}k@P T` [PPu( hЍpHWAU (xA-@!<`P0 P@BpBKkP p< =400@@ЍAU (=V@-@d "PP0P PPbL 0 S@@00 >00ЍEV2%AU (_X%OV0@-M@<P}<P x<Pts<P d0P P P P< PNp$Ѝ0HW2VU (7iVs@-@}hQ ~P LQHPH`,~ P! ,QЍp}Q@T V5VO-M`@PK Up pP"Ӌ(  ᙿ  8 Ep% (⋿( px" <@T t8PCQl2P\X5{8 "10#Z0 b00o 8 ]@pG 0YP@T 0CS0 0 xC0X0^ :T 0CS00xC 0xRaDPW@DADP7@D@S 00@D@ TSS0Z`?@MTh l 9PU.U8 @ 0 0 0`0wHWCW9LSLA-X Pp@`0P00'0Pڼ 0 p 0 `P0O-,Mp`@ PP 0tY: P X 0  P 0` 000   0 ?p@@pP@@)%H (O-0PU` 00Sp1 000xSP PLD1p@ Q Y 周1P @ `GR BG`U     @ Ѝ W:UUp@G  @ TA̠WL ΠL̠ 0 B W B,B,  G %$%XXXQA-@Pʰ00QQ00S AJ00Sp0 000xSXJTp`VJ`   @0$%X=X % p@-` MP@ ƸU U( P00 Ѝp00 0TPTT@ !᪸!0P!!`FPP  @H 0 `A-p`Pp@ @P(㺄 $z A>INJp@-M@P` q `ЍpO-MMpPP!㕄p`p!t pX!` F/ N  ⚰<1W@4444TݍЍ᝵0P0  R P 8س)0  !4  >0pxy0@0 "' R R00000O/ 0P<1S O/,IPDJJIXqi (XXp@-`M@Sp 40+SЍpP  ۷  zy R #D 9>p 01S 0/S  0n iX 00S/@-@xI(YA-P@`Tp P @ 0SP X%YA-P@p ㉷`P h ƯPX0 000 @ p`W㚃lY$%:iBY@- M @ph h㏃` P00 Ѝ00 1pwhDeYqY9iyY@-(M @p f KPt00(Ѝ p00S L P02 0 p@pDIYqY9iyY@-M@ lp 0QS S  HЍYY/ 04 8 <` S $S HHH S/< S 4$0 ,/(/$/PPvYPPYYYY 04 8 p 3Q? FI0P 60p 2Q8F8 ⺴  p 0S0 4F8 pu p t  p 0@\ |PpD2Q <VFBߍ10S NF10S GFDF 0  `0000p0FPU0``0` Rڬx1000 0:S RL P<F`(PpQ FV pWP ,E+EH0S LE E~EUE`0Q E E8i(i[[i[([[\) \\i8iiikES\\$\+\$%Z3\7\C\Wv]\g\0@-E- ET O-MM`@ 4{P04 lP7EgEP|7U 0'S`@0 `F@( 0R tPy['V:0:0: 0:0 :0:0 :  E(@!0! P T0 /C BRV  0  00=C$0Cɟ"!``F 0^l d9EIcCP S@BA`p80P0 p` D!0@"0$0$0S= pD0 P0B'S 0؍Ѝ h(S   BS>C0CH(S  $ȟ "!! CR  ##9C0C"!% 'S>Cǟ>C"" N=C0C00Q0g*S SS"<# "# " " "#2SK Sp 0SC R< )SS0C'S񟗶0)()(((()()()()()()()()()(()()()()()()()()()()()()()()()((((()))) )0S 0 tht0 `D0$ 0 B@$ ^ R 4&S0p( D$$$p`W>C 0R 0 C`0S C0S 000 C00C!圥娀`pXP0  @ Cp` C0S 8WD 04 8 <%S8C0S 0CC ` 0dY)1 pG(  `0,0t4判pY$( 1p, sgqpW!ևӅ|HCyW-0S\ ,  W ((I kC3 $( P  #P# ß P# SCpl3I#S0S EC0S%  l>C ST8C0S @2Cp {Ѝd{2EY*_0 /,%/-@- M,00@(000 P  Ѝ@Ѝ/P00  @@@@0ՠ-@-  AA ЍЍ/@-@rAㄨ5_ 0S/@- (-@-  iAeAn ЍЍ/-@-  [AWA ЍЍ/l0@-M0S@ 0  0000 0p@@Ѝ (_@-@D4H4 4p05mp__`@-|MPڸ2P0PS 0P@ 0 000 0`Иp TiP@H 00@4P8PS`!0310@- Mx 0 @P \cz 9<LPP @ , 0@@P 020Ѝ0,%a (@-uY4@4 c@ \ \@>X%[bbMcbP@-d0 !X !T@0 60\ (0000/b+b@bPh0@-d`  !TD0 60\ ,00 00/b+b@bP-P040#^4<\$0000/b+b@bPD0 40#\00Q 00/00b+b@bPL- 0:# ^4 0Q$0000/b+b@bPL- 09# ^4 0Q$0000/b+b@bP 4 <# \,4Q00/00b+b@bP@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00b+bYdmd@b$0@- 00F=P Ѝ|4,%A-Pq@p`WЍ @P :3M@P p7@-0P@U , )o= Ѝ0nfA-@0nS0oS@p pnhP`9:P<0nS0oSf>PPa>PP'@-W0 ><fX%O-MM<(0<,0>p0PEU!+ e@ PFFFFFGFFFFGFF@G00000000 hPpuh00P0<490000000p0 Ѝ茯%m_,_,jl-BMM]@0 P@t00dx  0.pL0 Rux0 0/ "  0sp" 9u mlp@-@PP,p@_!0/SpS  p@O jmmm@-TT D;8lX%O-`@ Pp(,娐ݨ뤰0 0000 =p0@DTq oP\0 ahP@tRh9 O4ꌯ%m_,2_,l@-M@A> 0@0D00 p03.p0S SH ިv: 00,0 0t8'ko 0@0D00 p0-pY0S SH R9 00,0 0(t72ko0PC@(0L P@Bq吁H`( L0`)pF0KSh0  R<( Lh03T0 5% 0 p( h0^/P  03kPP 00,@ 0.0T0 @IP 0$00 00000|00x00t0 0p00l00\ d0XP,k5RݍЍh (.{ mx~zzp@-@PyP,p@0/Sp p@jmmm R R @-o/{@-@M0P`p 0\(000 )PPЍ0P0 0 0])0 <(0P Ns@-`000/@P (P0 <Ѝp 0`( "4`#/0@-MP@ o0 0P@h00SP P @Q@O 04@Ѝ0 (x{(002P0/p@-BM`Q+ @P41010 0000000 0P 4< 84H00BߍpBߍp@o꠆xO-M8@@P`ppЍ8#<ă Ƞ,Ƞ D<塢4$03 00<D e4408< _0\,YD0 0(0@Ep000K@`p PâH00@AP= PD .4 (_^x{O--M * @P`pP0FT0p<00Ѝ 0  3/X0p 0PP 0@ `oM P* 03H D@0 P3/pp`P{0pPTP@`P꠆x{C-MM`p/ ᆝP  P@1L#d8$#4d4# N@41@㑝D0 0@000 @pߍPHڀ@Td$ d 4$ (O-[ 4M`P@@P :9@P`4Ѝp p☡ 00x 0 |@P `@ P0D 0800 00S X0S00000 tpp cP@0Sp!0!D0D00X 000 0  L0b"!4b4#@0@@ 000<0h (|h.|$ (@-L 3-1}X%-0-M 00H 0@eP ,Lmq zg qЍ} ~O-PM$ 0䰝 @00@"b0"p0@@@" 5p2 0BPa g@P8ihhhhhPihiihhhihj00p00@~op l!  0R`PlC` P    0 S Q l tl@zNz d!!L ȘP    0 S Q  0z @z'  #op 00i+姘   &p|  0S0<S0@pS(@p @Ѝ?B_,_,%#~T|l>~C~n~~~~*@-MMCN@80 0@ 0(00 0%p Ll 0 1"1!1(C"0P( l1, 0P , T10L1ލЍ41(1;GTdu7@-P @0Lo S? 0 k Ѝ0=u@-@C 0P @@-@!0P @G@- @0S 00S0?  kЍOup@-@PP,p@0/Sp p@jmmm 0`( "4`#/ p@-"440 @"440 P"440 "440( $0 $( XXddhhllppttp p@-"440 P"440@ DD@@HHL`LPPTTX~X\{ \`⮚p` p⪚ p@襚p@-`"Q@Upf@p@-@PYVSPpA-P@M4Q->CA->?n}C@X=X\:\79>.9>:>C):>CF% 0? AC>C>mGFE~EnFG  0X J~ pXW}m  $$((,S>,~S>G~F~HHLLPPTTXX\\O-P@4pT` !"441!"441  $$((,,004Vܑ\5 S L5sTԀp0,$ $Q p W !wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUxM~0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 PlV0@@TNN@D@` @00C030S30 0C0 0#0030 3#00030SUd  0@ `?5>0"ST0T00  B "0PSX000Y0.d  0@ `5?먠ʿ 0Ϡ:,0 0:1#  0 0! ?0 00C000 xS p10S  ' dϠ 0@Ì `0 1! ! N*J40A`80 C 00 080$0C $$  $ a40 040 @08@T@d`T`@O@?00`1>Q@00S 00` 30<((U vX%,%O--MM̵p, 51N_R0ePS yqሢ儒 ?D 0Sdd/~D ?0?D4OP p؍ߍ51] 2@ŒD 0L 04;20d04 0[0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#8p 04`0S7x 000 0p0 0 0`  60S 0X 0 0`S`a ,e 0#\0Q ?,040<09(080? $0P@X  0@Dő$ L00 /4;0: 0 d0@0o 0P 0r ₱`W3 p"{S< yq0//~D22220OD0? 0 04\0hl 0@DE 0L /0d4;00 0@$ @` 4 <001T?{\0X0`0d090?,0{({{{$0 "@őDL  0?$+4#- 0( d 0@Ì `01u,% (<(@.%P0%Ao((TO--M M: c>0?0 0 0D0Dp0S3 80`V/,0P0 0 & ((( (4(y 0@P`P84_r P@ 4 UrpZ 3T@  (CP` *K (P S(A0S0,5 S<0x0(5002 0,%S0022Q04'G 0Q'?b" 0 04 0A '1 040A `'( 0 4Q@' 00 Q$*' 00Q(' 004 Q'1 0 S0 C' \1\cX^Y1X0S|' 0X RR $%0 bH4aLBϠ8A<Ń@ϠPDŃPT\TR`8\PR001[' `4]0 P c 2# SQ,Qd0Q38$Q<4R(:#4(,(,%,%((([ލ 4((o (T(E,%ȎT (,%(((<(D'u PT0\5 ?>C00`#!3x00084$0<0D04t `@`y]000`XcL5P5| P4`F   ?ᇐ8@pD ? ?X]U]t0o1&"  A00@&"n@0  4%8$05<4R@&11 p84000 0<SoPx8S @⸑P0@? @P:PP0* : %@PP(5#R0:㙑P@0$- 000Z0 a``8 !0/  !.1 >0Z `  b0 R[ Q[" Ϡ  ! 0   B0SB00㮅P`0*2"0$ 0 ?ᚅV`1V`#T0`10F 0ⵏI : ௏ 0B@TPἐz 嘀 00B1  BZ!0`0Y3B 11 0S B!I0B? 兏0 `V똀 0 BZ` S2 B Q 0Sp %%\u @P`x1ِ 0F<Ĕ84CP0S`84<$-0BPQQɑ,`RB1ȁ@L0 0 0000L60S|0` ?L4 40H 00 6op>'/\#R2\3PPT``0 S  _(7\5?>C00!#4t x0VT7(T0#2! a, A3 31  0 ؎P 04 P j 0H$4  $ (  B, @%LV.  R*h ( < (R X $( \ ,( E.?.XT+BA.B,-0 HUPfx8 @40 PKo[ ,p8d A YZQ T[Z 0{X RA pW $4?.t{ 4 R?D4P00@$04 0H4( 0Āp@2 R 5#< 5$23dr0S+c됺 zz000d0S CQ c6Rc`P z'z {'+S}$ @ z0犸 08z'(ZȊ (+Sl,k$ 0  R0:1P000\hP2#00Q@@00 ~np00 R00刽&A0 x0S_` R4$ PP0 t`y6 K  ZZ⋰>(^Fc؏ (@(( -%ht@%7,(T(U =,T( (<(,%Ő((8 ( `00Se  0 # ZZ 0+ V.㿍|00S  - 0=S,0S 0S0 0" ,0 0CÁ!$!\^   0 0 0/d! A, a3 1 !0<# 1@ p 8 P4P0R00 S  B S0 8:0,0 0P0B 0,0SXp p开8嘥ȿ+" < Q \%p0R@.$00 @DU`@,( 4AY2( R,0@ `0```0T08{(s 0 i` pT3$0[`0@ I9pQ004 帀 P0x0 0Sx0x0t\00\ ⨁  B`[d HQ   h ` lS2  B±dd 0RL4%M,U0   $0 C00 0 0 R R` ` @ 0$5S  l01` p00040S2dҍ00%ST0T00! !P%0SP5bX0`P5`S$0dA먰 =  7$0姍00080` ;Q X@0+@  P+@⨐ X@0-ᴐR㰑 ,  BU (0;(000T0 10X0岁0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4040CS T0C0@dw 0`4 8 0 RT:  $5SʬG $`$`(0V70S ,4 > d,04  0,4 $& 00`  VjˋL80S   0帀0 Xx0#`Hx X\># P 0d? @ Œ `0 1r @\9\%R hI0SP+i\`/ `ƌ$  $ k0)`S`0 0$5S  l01` 00090S/dጌ0H*ST0T00! !h*0PSX0b``[d먠    d00080@$0C40 0400T#*0 Q`?0@$00$0l0h`0@ppT:S $S0p0S $S00pW`@Pb뀐 H)a 00@iW8p`0x1 pZ90J@Y!@a0@0  T: 呵@$\ Q  @080$0 ڋ $0d O@L LB l; p  r0SH=0S0 000S.\ 08C =R= 0ł."\5S 00 0 d 0/ @. `3,0 0 u 0000P0S8> 0,@0P0 `>0S t^ 0S  >0S  V 00|:x*0[P>0SNc C>`>0S3030404040p3pGVW*DZV.P\oV.GVT0S q?0 PS?\5=S,@??^ E?ᝉ0 0S 04 7 dLĒH 0@Ì `04 1,$0S0S 04  d ,04 0G 04Bލ Ѝ;00 Eip@qSaZO-RMhbP  QZ @PH Z@<  PpߍP(  6pp0S  <08 (00,0 0000400!4 04$0D0(0 P DVph   0 pᝍ H  << 08 $4 0  p p Y t p 8p?pq8SځVPr   00**0@0;P ⤅ 0* *d@edA+CL]i{zd@A-CMMPPp`;8 Up@P  0P;PU00 ## CލЍp@-@PlP,p@p0/Spd p@`jmmmR/smG-P `$ 0p/~@V` 0(~@`` V`@&!D`( G-P`0 4Jь Y0000008#8#$48#8Y\dp q00! ## ?@Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- 0X$(p,P0`4@*^0 *^0 *^0*W0O-4MX00\0p0`P`ᔌ0 ,0h, 0S% P 0 eXmS aSMSASB0C0b0C S̼ĻĻĻĻĻĻĻļĻ4SSU@@@sS@ @ @U00T 0DS d9R$ 0 M"P T 8 0U$UQUDT P 0 @@@ X 0t0  P X0S00 000 000 P4ЍTs@-&7,@,  X%.@-0 @   V O-@0p 㚋tP`G0 00000B_I0V W `B@ ᴐ((P0  /PPP\!1cQ\ P/p@-TPL`(FV@ d0 P 6V0@ \0<@p(0P  C @-kWco`/ᘓĔs@-PL@` 000V  @VWЍpx((ߔs@-PX00SL0@`ă5#0004V @7WЍpt(x((d10 PS/C-@LQM8MP`f8 a‡ 1 P0p8 0 T:86S/⯇ <6ۍЍC+ 0 P \ ;0 S a8!#4a4# 0^ ;0PTᇇ 0+ۍЍt((x((|(O- R`$(aU2+ k [S!Qq 0BG 0콟0 S 0008cS05=0:0ᓊ 00UC 0 $ 0$P   BQ 00х  ͅp0Fƅ0L  00060 6巅< 0 p$p0,(@ (X20740x<080@0h U,<0DHLP\P`PdP' 0T0((V(np(͗؏t(-%ht@%=,AJȘ.lƙ|4%l2%A5%'((x(0Q:BS! f0 E6Psd  00 P S %%* 呐 0p1Pn1  !9P0 `U&81XH `60U/0 x xL0S `0 1 #'$/%17 dX0000| &09020 |P  & 8&0`Pp2& 0x>00i/p4 ݍ ЍL0@ S40@0z P x&t 0 @zahF@P!Dp bP  Y80S 14L : SRQP7  yPPPj VPrPE_oR0: b=p 0yP0U p  ~P  ~@DP$ 3m`Tb:*0 P0*0 :y:*QP *:s@ K,0SPD`Ap0 S1|0S1t0S0x0S 11011h0 01,0Sp0| RSt 00R0x R0S /ᮔ; P0@S 00 T @#P U,  ;,d~PD;P0 101000&BT 0`S`Sʈ0S 1S 0S 1S 1S4L04 0@w?0 0 lp^ p`P`C0S\*Lp` p1S?V?`#0*@pT a1S *6pJ Q 1S A0 { 1C0 S Z000 Z00 000: RS3#*:Q 00S+ PY@00T Q!oP@ T0 k" p d "B?;;@0DKP?`|0 QZ# Z Z  G ZD0S t5,0S D0SX0\ 0D0 @0D00 (+\0S &X0S    T*,,00S0 Z0S000S"  0C 0T 0#S|0S0T0S SL t 0S 0C( 00T00D0S0h0 l0Sl000S1\0S1X0S1(0S /n(0P: &*0P:  p`b 0P!* RaQ zV000S(dR00S00ZY` 1P00V`5U0A $ M|$pY㤢 0< g'JB|U0u<08|<00S:Y,|$  &|U e ?|0 S:1SL5 R 1S *(0: 0`000 Z P011$S3#SQPPQOU Q1S 3 #S RP RM Z {P3UP1P Z 0S<00C<0{`VZ0D  {*10$00A00 @00,0d0p 10PUWP1 Zd0; S9:Q0C?o20S P PR*> Z  2Z$ 02#{@ d0 Zp0#d" Z΃6#0\0:Pp> 00@0Pd0S!0$0$03 qW 5q:$ *R" P    G$  o Zpa ZdabV10A0 3{d0S$ 0@R"0PP0G%{1 d00uo0 @P!d01SW*;Ѡ?S*T kb5$%q{ҡa5r ƢkBã/?pEo,O)X%>gfffUWRRaArrAaḁ̊ԥJ4  Z0 Z00Q* 0R P ?o20 Z0 Z00 iQPE0! (1,QR0TLj1 00S 0S000 Z01 00S03 15p5 1 Z40 d00 Z01 h0_ ?"802 ` PP I8?C"- Y$ @0T2#D0Jn Z00D 0080001l0$40P0<0#40T0,0#40X0@0$0   Q*" *  H\  0d03Q0Hh080 S (s0S 0d8z800T0 `p00(0S( Z0q@#W030#W 0W00S  pR:`*p?u0V0S ` pL T  ~ |0S Z1 S C/o" R P0 00 000$00<00T00,00X00L00p01t01x01 00 Z40 @ 0 1$00(01,0F?03G?03 )001 01100 04L"/@!b$ 04v 08 0#$ #(#< 0  0% \?h R(0S00d00H o00 0 ST x&?   p T]  H R 0 Q  !R R S 0S60610110D @QS*@ CyQL000l R Z  R   0D0 00BQ?o20S (0 00 25 010P C0024 01000pZ40S $00 @0 <0S  0,0S  0,L0 ?Yp0 L  <0t0A?0x0! 0x 40S  Y!~ | xhXQt r Qm  * 80S Q39,0S$y 0`( "4`#/   k B*@-{S-K A 8 /eAD00@- 44@4P\P 0B"" )-@=B'))@-& ] 밦X%G-@P ` M{!>0ѤP V0 0  PP GspP`0$X 0XG0S < QG0 vV )_,Un0@-@tPM 0  m\ \0Xm PЍ0 P 0 0\ 0 [ )T )@-044KQ    Ѝ䐧S @-$MPp  }v @֥1 @00 !0 0 )) 1 p| `P\pATs  Dn TV@D:$Ѝd ꘧֧Vp@-0M,AP`  ;v 0 0 010R  2   $0Ѝp@8 R  #   $R v0S 0!$$("( 18#! 0Ѝp@ 0Ѝp)7Xm  @-pnF)~P@- 0 R * 0 #  @0))P `00CS`0p S00 P0S X0X /X ꨵ%p@-`Pz@8!RP#<10<10 .810CS81V <1S 0<1p0 hjdj`0)zPp <10C<1(0 810S81)8%%X%()0@-@-4MT  A` d| hQ w `"R d2RKo  , d2SA = hk0:P{PST1B k? * +['Hk<[E{7  (+S PPP B  0 @@zj{ k[@  k[+S( 4Ѝ00B:k{{'*k[+S @@?-C6?Y@H))Ψ8%+p))co@- ji0d2S0 )@0@-0S0@d2S j`2"R28%)@-@ 8!<qH 8!s{  { ,00X@ᚙ?333333?)8%O-ppDpd&> ^"44-"P40MRP=p3 204P0S0S `0S  k&@)*%()*(*4*ҽ4)*0A-0S PP @`pT V @\PT$@ 0S$p$00a`@)*%4*)O-!1 0RR㤑S q儡@P  P0: ЍS DP `P( 03_ 000m PP@:SR  0m Q {p`P0ti0 000&_000(*)*8)*%B@-*()*ezX%¾ؾD2O-0S 44妪0b00- 6o 2 P+p P@ 0P 0pb: P0 *@@ F W0: R0*0 S, 70 R S U0!:W00#03RQ00S &0P0000  0 S 0Px0i00` \.0  P@ Ѝ)*%@-*()*8)*X%C-MM Q@P 0S  0 cT000@T0S Ā@p T0:ۍЍ`PP@p0 > Y 6  #000PU* )*% ()*0A-0S 嵩p儀P` U0(@TP`0  RF000S 5@)*%#()*<A-p`P@P pVpDorPT 00 0CR?o20S $P RX%lp@-/0@PB^ 0Pp SRp4*@-8XCm0S$ $00  0 D땿(*ܿX%$0?S/ @-H\P4*8%A-P0@0/0000 Snڨ/0>+b!T0 L< *\P0? 4 Q00?4*T*<%0@- @00d0@0Ѝs@-@P`P @TZXX ?0 00?d+"+R  + VЍp*X% 2G-@`BMVy a@0DXBߍpTW B/ dl0 S'4tx'xpg w@PQ  L1b",4b4#0 440,10S 0S Q0000 {'{{gW:0000R%*0S s0 0S j0 000R*Q p`a0S L `X0`S ! (*N*@\*%Nb|)*p@-<p@ P(@P0P0p<% p3O-P0_MS XX!TsTC P L0H#+0+b!L< ZP L D0?0H @L  'P$PD Yk _P &P7P|_ߍ)*% )*(*(*<%T*I*4*8%#1Vm@-* FfZ8:D*X%@%@- @ 00: S@-*G-@qaP U+ P00S  0 S00P R GRڀ00S |pP Y XgP Y 0:0S ( ()*(*X%VmO-AM M` 0j@0 pP@ Aލ ЍO/9/P( 0`!`ePQ D D @P ,gPD }@T gPD s@D 䰟`T Aލ Ѝ  A>00C 0  R + | wD M@D n`0 T  0 D m7T*DsX%<eC-M Mp p0 /R 崀@` GPP 0S P@ۍ Ѝ00 D :le`D @P 0V bP`VmT*p@-0@ @P  P@p@-@@3O-tM0 S ttp300RS`3`  T3T#0@C0#S<88tЍOޥ,$P if   0p`00ܢܲ@?` U_0@ 峥W6 ! h`V5VW ^@P p0 3?0@! $ 呥厥 L?0@ }z%tЍpJ`10xSiSP@P 00@ 000 0C0X10S 0S`$Y\ ` @X@h0SS  80S d00X00\ `0U0P!^c 08%d)*%(* )*8%(*#X%4*(*(*(I[l)*C@-AMMP 00 pPpP'h!hu@PX TLWYhs< 0AލЍ QD D<Pq`Uhf U + B p0P hD t]0S p T0TP 4 h,8 [EQX%T*(*@-*@j@-%P@-H@0#S 0 [4#S 0@Q8%<%0A-@P` 0 P0:| 0pp ?=Y0@$aH00S$`h>004488<<HHLL>>>xx||>9^E>E>:^E>E""442""442T0ASXwtwvvhwv f Pi PJ vPb|T0Sp40S dd:00eb_ \ Y!"441RO""44"2"44"2"44"2"442(<(,9,T6TX3X\0\`-`+] 0# #100 0222#0 2 0 (0#(0/,0H0T0, X0/X0\ `0/`0d 0,d%Y20h0005/(0, d20=S" " \" R `LrVCDS@"@ <#3 ( 3!0!x30=00 1R # |00# #X0/80\ /`0d 0 %0L0<040h0T! AQhxLxxx\x[X9-0CS P ݽ R0 R R 0N\ \0Xx0- =09!`E(*lTN*)*%k(*@%Q>чX%2KbwC-MB2P000R0 r 0M0 0S a쑟=聟0=P  RP 0AS^|{zt{@zX{h{=0=ꀁ`0VddaP  RP 4!=0=0S `20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ0=ۍЍt0 h0P0`0\0S H,@凘@-*1@)*TN*,* )*)*FX%()*-O-AM30L(0 "S d#Cr0(#͡ A5/0(0#R00 Q#00Уh Z0 (0S @(#C5/0(0,0S3,00?0!P#0,0@* [ P Aۍ<ЍP(0S #Cr0(#͡A5/0(0#r0#͡$0+ $  BRʠ0@SP (0S 1 P@0S& 0 $00S  B 0S 8#R00SR 00S \0l 9P tlx3  P8P0S@)*TN*)*@%j@-*(*%0 @-*Z@-@0SS@)*O-M@ 00 040<00 0b@P 08  b 0@ @ H0LP DpI* `P` R  R  R;  R  0 0PL RM  R"  R`60S TT L60S 868PU),-P"[ 050S  P% R P 0  t% R hh  PЍLU000L%LHW0S50S ( 40S  PP 0 0 8z w  u uW00 040S t 0  a$ R < #PU# R ^ :  0?P gZ 0xl T TW 0 0 8  \30Sc X \T 0 kI"0#P00 020S  02PU-20S PZ 0  W 0 0 8  20S 0 0 "P{00 0f 10S 403/  !TPYW00 0BX10S00S 0 0 800S  0 G4\p 03/PU 4   p0,P s@-*X%)*J%(*(*N*8%0[\\[N*(*qu4Z(*R*]@_A-1(   0 !S@ 1 1R 4S8 !4|q04|0`a@00S/ P0S  R+* RS-<P- !0 010000 QP 0PW 0 $P P ЍPE"0P;C0P|;0S050 000 @ 0@0 0@)*@-*TN*()*Jj/@-M|c0S pp۔lClS0S Yx0SX\0#00,t R0E3 6r 0500K rP5"0C590C990C9000lP|n x呔0S \2d"`2Q09T09 <0S 420C90S 20tS2"CC2PP4^X 0R0%S  P JX HP;#;S ;0``1 Av0@%S ) <70+C? R 0 0B 0S #\)P 00S )XK0STP=S 000Ѝ)*%`N*@%,T*#X%8)*(*(*@)*(* Tk@X*I(*,*)* )*Ds2EX(*z4)*0)*-@-   ЍЍ/X%@- 0\  0P WQ 0 84Ѝ(Q Ѝ(*X%)*%x0p@-P@T 0P W+@ 08p,00S   @(*X%)*%%p@-@T`P T0:pKP 0S 0@P()*p@-@PT0*p3P 0S 0@TP0@-@   f0  xh`0 dPZ0 P8T0 < N0@ (H P\*9BKTY_Q\*@- @P @0 40D0Q3 Ѝ4)*hX%A-Pp` iG00CS0@ T 00CS0 P yTnTyDo0 @00  0 0 SX%)*-@- T L00S @P@0PWbЍ@Ѝ/X%)*OR@-p`P0@T$QP!V+0  ЍR0@TTP ~Vh0 X@H00S <U8 8 00pq@(*X%)*%@- @_ Y SP  K P  CP  l;$P l L3\0QX X ,+ H'@0T%X%L4DVk{0@-@MPPPP<  P$0$ $Ѝ0PP`*0@- M@ \0 00H ^Q; ۍ@-@0S g,00S x P 0@00UH H0DЍ@800S ,,Ѝ@Ѝ(*X%)*+%C-/`D@P @Dp/0S Ѝ/SpPP.0 0P000@-@0S  0S  0 000|00S  P RU H0DЍ@U800S ,,Ѝ@LЍ9P(*X%)*p%@-@0S 0 000x00S  P U D0@Ѝ@!400S ((Ѝ@Ѝ(*X%)*%@-@0S 0 000cx00S  P T D0@Ѝ@400S ((Ѝ@Ѝ(*X%)*%C-0M.S4P@A`p0/SS Ɛ0 0U  嶐  尐        p  xX  d 00@ @e Ѝ(*?, (/6?HOV/@-J _C-PAx@`p P P9 00 S00 ЍW00roPd*_p@-BM @P`0E CR V U)TP50FSd0  AS dOP0P S00@(; BލpPd*_A-P@`IO<0 gpAOW APd*_p@-M BP  D 0SP  P0PP 0@ 0BPS ! 0C R: p  d!  `V$@1@a0T0 0d Do Ѝ0hd*Q+@-@T T  0H ,(Ѝ@B! {_%mP 7P P / //-M M? r`ۍ Ѝ%4`00CS`0X X0 X /ᨵ%O-pQDMDЍOB@x`pP W200 RR00u0PS0C000@@ Rp@T+ W-Y* U U %   Q  _M0 .   Q  OM.0  _p W8%dhd*4T 3<0S/@-@PMQ PЍ@B p31Q``9X600CSꤩd,\\\"2PЍ@M  !0S S/   d0AS&4L<H <840 0SPЍ@|   0L1hS fS5004003001 200j0CS PЍ@n=0(0<0$0;0 0:0090080070060 05004003001 2001jS$ $Q Q ~wr(m xVPЍhd*dQ,x4FCP]kpxI&o.PYO-@R0H?o2 P0 Sp L0 S xp I  ЍOGc(p/00pAxP XL0S P$P*X pvD(pP P7P 000 3 hd*B%ddQp@-P(@P KPp@@%0S $  R RR0 @- Eg*@- (0 0$000 ЍoMYP P P {~u@-(M0D #\S@3@#:@ (Ѝ P7@-  Qp,XZFP Ѝ0 @P .;=PP ^KPdg*h*0@-@QPM <1a! 4aSaD@ @$0d@Oo@ 1e% 4eeT# ! "Q  R P Q ,FЍ0T%<ʔ @!%(T h X%T @ , P" $ @g*d p00@-Q @\.P!P@QR00 00g*i*0s@-@ `R  P.<P ,E0S ,E|Ѝpp0 !PU U H 04Ѝp@Ѝp@B%h*dg*@-@T T 4 0( ЍЍ@+Ѝ@g*p@-@"1Q0P Tp@@   p@0  p@T 3$O-\M00@0"0 0(p0 @@$@,0@6PP PP 0 @@6P``wU]\Ѝ`P0  FX y RAx   <y0P  byM 4\100 0 S0C000  Q4P <0p p 80pj0M Bx`00CS`0 X N0@T:\ЍOX0 X @bl%B%@-00; Ѝ@-0  3 ЍO-4 P@pa TAD -Q P P PPP@D`FRPP00SP Ѝ@-0@ 0 0 Ѝ?@-h XX%@-S@-AMa Mp@0WP0`UqT1T!TKL0P 0@$10 Aލ Ѝ`00 ! !01 "?t0I !R 0G$;w@P< j<<T0 <<@D0L0\0\ 0 DDj*!/I*5,N~o*lo@-Uo*0@-6S yj*@-Y<V<S<xP<pdm/<@P\" T  @  4F, @9k*k*@- = X%@-0h@  0@ 0\0CS @C$%p@-@Pp00Sp8PU``p840#U:_X 0rX0X00P4080 T0X0p`P -7@-@0 P0C 0PR*00B0 Ѝ0@Ѝ/O-dM@P J@DPU 0 S udЍ`p |0 J0]0 0^`!0 0  TF0  ` .0 V0BuP JP\$%aA-@p帀`P@"!023 U 0 tupp p juP@T0S0P   Ѝ背ntu,z-,ML0$0H00D00@0 0<0<  $$0CX%-7@-`P`@ T@ R 0@}  V000 Ѝ0@Ѝ/B%Q(q*"p@-PP@ \J0S 0CS 3 00pMJp@X T 00 AJ, ,Up0Sp(q* ,pG,0 e1pYЍ  0[ H0S  G0S@0 61poKpT 1S!1T p 0  T 1!0 00 0 0  $ ( 0! 0 d ,, 0  0$0(0!008 0d, , 0 (q*4Fc0C-,M80P 唐R/ ~!!;6P`,ЍCl`@ @B(0`0$0F_ \PB%(q* 0jT h@>  0[E(q*4T arO-JM M`@pPq>3 Z0 `@04 0C ?o20c/bS8 TK'1X0 0 04@X```4S DU0@+8<04;00U0+;40@:@#TRT 1S S GR:1 KW00  B@ ?뀪03p0P,D-l,@-\ ,H 7-D< ,3-,倀  , +- ,'-  , - ,-̩  , - ,-뜩  , -| ,-l  ,X ,hL ,,<  ,( ,< ,,   ,,,,ܨ  ,,,,묨 ,,,,|X (0 N, T,L,, 8(dHQ T(L VW 7  0D# /34@pS| Rp,,,Fd7$R [[ 0WSW XQ;X PED0A4H0 1L00 1H`00 D0^+p)XL0 10@sX嬆4 0#R0X00Cs 1STp8X0@swlW 0 0D30; R 0Q(0Q cP  <4岰 ȅ7dWP Z-! : 0 0 0P:/00DJލ ЍW@! ZH0 *p00DH0S  00 @3SH0GS)$X\ X'800S$RY 0 000@P0@3A4/ 00 @3S`1$04S# 403001P 0 *p  Z @0 S0!4sP40S$ 000    $ $ 0 `000`40 0 0 S 8pz'0S 0R 00C0 0( 0R RX,( jP ,( <H0 *p0 1wH0 *p0 p g;㨀H0 H0)pps@0 SpH0pP H0 )p 00H0 |W: a8pH0 ppH)p0pH@P0P GpH0 pp)p H 0H 8 ɞ8 T  k R> R!P 0:{;P:TZ 8@80 Ro aBQ*<<<<<< <<<<<$<H<<,<4p  `080ikklgj   p5p3p1> 8 ] 8X<  0S u>0S 1P00: <00140k0!S0< 2  x 0G0u9Wt)  R> 8 ' 8Xl  0S ?>0S R0* 0%0%00140k0!S0404@kT0m94i9T* > 8 8X 0S>0S `  40k0!S0 (S01W40Sv  kW01Sk4@T T0G?o20ST0G?o20ST0G?o20W0S lNW`J 0sWp0;p00p(&0@A4@P900.`d8 `aP P8B580U08080S@00 @ c/4 4 6@ @&58 80 p@ @0Y 1=@ 0  ! `0400<0@0,&pc= !105 "04qߍ 1PS 0 < 0H0tc?D`D0H 5p`&pH0SX Z<H-0A1 d! N`0D00 0@`q&p= !10`100CS$$1" =+@P qߍOdoob4S @0404(0 0,0c?0040(00000, ,4pA&p;W,{W RT=00D@ 4`P0=S "8 R  4P 0=Sd "8 R ` L 4P 0=S x"8 R  qߍO( T V0@4,0p@[VD@70S 1S X'  KPP `V- t T 0H 0(00,00 p03A6/00 HX\|| |00( ,p0,S(` T'&=< Xqp 3<0"S /< P0 SX0T R (00Sc SW S0G&P00CsL =" (q*?B%`q K@zU+0Nt0lJ7y0Ktfy\B%R? lt*#$67P ,)PP00 U,00P`0SW J1! PJ &PP J1! @ P\10S P 070z 0\6PPPUqWP P  0 IV_ᶿPiP`ZZE_oR0 $P  *4S J P x᱙6hX0 (T 47u*A2K\Hl}H~X%*O-M M@`;j/@p" DP@@ ᐿp p0Wp0Y:l0S y@Pm ލ Ѝ0Wy@P @p[60P 0Z 0 pS 0V9 H1Z ]P CZ.  pZP 5Z. 20Sa00Z00 0&0V9 0Z 0P Z. lt@)0T:Z_P Z.  p$|db5edAu*<h@-0` 0 08PP 0 P@P8P Ѝp@4(PP 2Ѝp=O-@-\M, ($0ŽPPʴ_c\ЍB\0P0  㲽Ppw U ` ᔘT] T` Tc<pq @ H56R801肟R800S8<ȂP0؂R80V3BnWp1,0S 0( S60 @P00 0S, Z0竸JS相%8 ?3<0 `D8 ϠĠ?4 0024 00@2 {0 0{'{EBnu 01 0@0pp+?t H4 $; p @D?0 4 $;Pp @0 0<0 {0P H0{'{8 ?$ 02$ 0@20 lJY@x Y%n!"8Bk,0SP0剴kფ0S? 00 @C% LP p 0@pPLp ?4 ;HBpu ?4$;P8pk P0H @8 ?  022 0P ,2 0`#20 P[ڐ0`Ë4竸: z0剤S?相 02 TQ@@ `*0 @`Pp' ?4H ;@`p 0 0CP$@;` p {<0 {'{; {8 AϠĠ? 0{'{1? 0 1 0 1<0 Y@,@- H$X%G-`DpT  P呮TD PEE$U@X 3P00@3P 0-8 0 P @ @3MDPE@D$v** T @- @Q0O0  V3P  @0S `#P L1.H 00@ 0Ѝ R$#XC%*****@-43800S ,0,0 p ro먥**|0z*T0@-@@3@00S',0, 0S00'T븥****4{*C-pQM 0S0!C:P 0S0=PP 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0Q0 00S0& 04 Cu:P****G-MPH,04 ލP 0$CV:P 4@@0 5PY30S CSc g5PP /3 cs@0S0S PU~T30S4 0 P. H30003 0E>$3S3Q 0Q300?o2P&Q20S 2 0P0002@0 0R R00 R P (2<"00P0 22\ Q100?o2 & Qy10Su 1pP0001ph, $1$0 QP$0S0L%$4PU Q 0S 0S 0P 0 00000Q Q000?o2%Qx00S d0 0ZP00080**P 0z****ȥ***̥***G-PJMM0 000 0``S+1 @ JލЍS2 0S! 9P 0S0i<PP V0  t1t p1 R0 0S0Q)Zp% 41 @T (1(~m! 8P[Z@#P͡0 d10S r@$00 R   R 0D a't0P04qp %R0@B******+*[0 0 0 0 \*`0 0 0 0 R*I*`C-KM MPq*|2 Kލ ЍP0\"C~8P H2@@@2000( .P 2 0S@2l. GP0 caQq0S 0S 00 q3@P -`1@0S p{5PH1` 0-P 818!0001 0K0S ⌶P+ 00 000T   /o" &t0Q00S 0@0P0 00d0@`ဨ*c**p**+P 0z****w***[I*`̥**@-PAMM )0 AލЍ@fPP0 I` pF x;(t0p 0hphp0+b7P0S 0 `X**s*I*` 0P/WvP@-0@l)000  0**Pp@-@PoU p pQl0l0 pP `@ZP00 SP 4)pWv*0 @- 0**P@- )(0 00S/0k***0 @- 0!L**Pp@-Q !0?o20@0`Q  0S 0 k0S P (00p`@tPX0 LP80 4P400 0f**Wv*Q*g *00 @-R 0}**0 @-H 0`**@-(@(0 = 00S0  ***0 @-- 0̥**P00P0SA-$a z(00Ѝ AP0q?oѣ2 PP%P00\ Q 0Sj000kP ,&7`0 P0R00D00$\(  ,**0**Wv8|*ĥ*0 @- 0ȥ**0 @- 0(ܥ**P00P0SA-@ (00PP.p`P0 `0 S   S  0S00hPL04P <| 0?o20**<*8*Wv^DP00P0S@- '0 ЍP 5P 0Pd00}S`00S T0T?j0HP80 0 00( 0*x*****p@-0PP00008@Ppp hp@P p@i'z2@ 0S80 000i*h***P00P0S@- G'P0 ЍP8 V5P 0 2P0 * *@-M P&'H1 ЍP0! 55P 1@@*P0P`p I0@P*0@!0 S0 0S P Pl0  Q0S P0 @ 0P000$0@*c*P 0z* **̥*@-P&0 ЍP 0Sx 4P 0S0TP0@P00 ( 4P*$,*G-@PpHoᩒ @=*P510S1ЍGiZa01w&x1 Ѝp.ZP+P*@PA 0|S@= 7@P1 T ЍGlP*Z * `0P0`ZZpʤP0 Z pXf(PPP 0RP(5|0 @0$P000 @0" **>4*lwk9qI*A- MP&2 ЍPO0S!4P 0 1C)P 00|S P7P P 0t)l1@h@) PP!8Q@a@q@0S 00CS0S )0 0 S Y 3P00 T0000^! H"Q|00S p0 00P00D0@*lw*P 0z**I*c9*̥*p@-PPMMj%1 ۍЍp.)`@PC@@⚰T!),(A/P@.?+P#00S `g00CS0 aU000 0Dأ|0  x0 2{P(Pt00(幣@*pv<***I 0@-M0P 0$d1 Ѝ0PL! 300CS0,P@0S0PPP P@& +T T 0hg0S0 @ʤ@P @P& +Ul0 ,0S0D @& ****p@-0p@P0 p@$\0\`0XPS 0S/0S0p@g $00p****6p@-0`@P0 p@c$L`LP0So/0S,p@f 00p***LP00P0S@- ?$0 ЍP N2P 0h*PL00}SH00S <0<f00P 0 *a**p*P00P0S@- $0 ЍP 2P 0hPL00}SH00S <0<f00P 0 *a***A-MP`+ l"p@pET` P*+ W+ @0 ۍ=T *@-P#@0 ЍP( 1P  *,@-P#@0 ЍP( 1P  *@-Po#t0 ЍP 0SP {1P 0S0,T m1P* ҃Pp@-H#@0 p4@0PP0 8Pp3**%0@Sp@--#@0 p4@0PP0 Pp**3=Pp@-#@0 p4@0PP0 Pp**JOQoP@- "(0 00S@+**WQoP@- "H0 <@0S 0S **@-0P@-000P0S "P0 ЍP@ 4@P@$$ (*\p@- M P"1 ЍpP! 0P 0 #p`1`#e0S@1D0 0S 1( rP5&P+0 0S 0@T 0d!&`!@P0$ d@  0@  0 @ 0@3/H0T 00S00%**ez4{* **c*0 @- 0**0 @- 0\**PA-PPPPU㈀ "00Ppp@h0hPd00P0` 00 T,0PA *****P7@-A P000pd00 Ѝ0P!0P%0SʰP 0 00D00S@ 0 S  @8@00\+D 0 S +<= 4 /P*******Pp@-@ 0?o20 0P }!00pPᑹP0 00xP0t tS00Pd \0DvP(0 4oP 0*ԥ*إ*Wv*(000 0@-S$000 0 **,**000 0@-S$000 0 **>* *p@-@Pp@0 @- 0P**0 @- 0]**PG-rR@PpZPYTP`Q !-`PbTJ -@PP[$$ UL1`H1@W <10S $1$!0$$ S ! p U1`0@W 00S 0 0 S  V y$ v$PKP`p᷸P `ᲸP P᭸P Ѝ****Wvl **,s  @-u0*P@-s |0 piP \00}ST00S H0Hc@YP40 , 00$ 0*** ***P00P0Ss@- @ 0 Ѝp0` 0S P@P ⡆0Q R   Lȸ 0Ѝp@b$Ѝp@軸***+* 7 R Pp@- (0 p@0P0Pp** C-PH2 m@r0S424bP80S20S 1}b0@ 唀 r0ܑS C!!"  A   㒃# P0 U0CQ00CS0F> PI00CS0J5 PAT! -PS0 'p` 00St0 /n1P'tt'P>t0S t00S1S0( N  0 0  A+=0S ^tP' 1Sb=- s)0S NX)P$+d=XM 0 I)00 Q@ )<=0S'0= R* ,t0 RtP=0 t00|S Pt`0S<0vt ⺕\M 嬯\< = 3~p堯hL,X<@0S  1RS4  S( ;, 0pS 00S C? 尐0P{ 0Sx ]&ԋP`{@P@ 0S :0PTV :F)@PU S`@`0S1S `0S\ : 0 Ph$P @% P  00!I/1,1(1$100p 010$1S 0S ,AT# 0S p"P ` }Is0 0 {0S 00S P @0,10%,WI00!0R pp@Q00009.0t10x10f<`P VY0 D |P\P\0S! |g6<W`@yPTu   0^0P0/1PX80S tPP.➔@ |p 00S L L>/偮70 S00?o2'$P P0 P70S P 0SF%P 0S>%7Gp匇VY@P3l*h==`70X7P :00@T p P +00@T a P 00PP ;N`5FTP<\'(P<50S"P`@T$!4&`e&& 0( FW & ׭@60 Э5@T \C?00%0­@!&t50S hPI PX5X%X& `D%D5Q&0&pp0S``4TUPX 40S l5 ክ@ r&V 30S ,5 z@ b&T ]&&p pr~d30S 4L[Wr000p00d000h 00 000N/P P Po H!0SG20@ @1DQ0008<1spP20 00 Q 00S$ 820S0d03 WHAL~t@RQ t 0Dt0S 30tCtX1 RLʄ2"w1R P ܪ81@#2l2pT0ǟs T0T0@hPU 'Pzb0 l0|2l RP 0"0C?o2?v "l"0A0p壒E8}*L *:`*****T*l%I*h<~**   FVmP(*iv,Х*t*****Pd D*` .BW@*jw=( c Qa~*9*@B**\*F**0l0l0 R ;R Ll1P |e0l0l0 R RU 0S;0S 0?" $0"+h0S ?0+U0+͡P!͡!++R0m "0R0+͡0%`PN%PPh0Sh0Sp10S@%@P ޑ❟!4000+R0(,0"+0 x(< 88< pD @@D P #P V t\ Rt20S p20St2pP " h0S PEU0S bL0 0S PZ0S= S0 F`#,3 ,3pŸh U00R0SH PtPr %Ph[PUd f30Sf3 Q a# Q03 V4#c  04R+sr ^+hA!03/@t#p4@|B  4 R04LP TX$0S,(5t 0R.FD 0S ֨00p0S pϨ0p0x0S xȨ0x0|0S |0|0deލЍ0S 03/t0S t寨0t0s@- P@$P  $P0P Ѝpr`P  $P 0 F]U 0S S TP 0S 0 $0PP Ѝp@    k O-`-AM M0B=H@p `0 4@P< 5P Aݍ Ѝ ,D4,0 R` 4000@ !PH@  P8Z 0@P 0 4Dw\4Q400S Z Z  P? P 00*S0 wQ,0-S 0wQ P0,00000 /R0 *R0 ,DwQ,000000S03 0$w7P 00,  0h 0P 0 00S⩥0|iP 0 Ps`P [P twflSP\wBB=00B-0 00S(@P ;PI P y00 ] ?,P9V V XT dwK/FR02 U 0S p41 0` X= J:H! 2S 4BwX0 ! 1V0S 1  0B= 000A-A=80< 0 0  aB=0S 0 B=  0ewU  $%*0*f08[ou8}*1** 7@-M0h 00@P P10S 0S00 0 Ѝ,  qQa @T0 S 00S 0s 0 :P 0 S000 B@T hP 0|S ᗦ00 0S00 0000p**  8}*4**l@-$MP` @s0000000Zp0P/S:S T@c) UL `&8 Kp0/0)@P/:)`P Dv@@P <$Ѝ@/000`0 ?@PV`@00l0@@DcT@@00@0CcS1S@ Vm *PP00/@-,0 @  000@踥*H*@-x0 @ d00S X0X0 p 6<0000S ,@踥***|H*@-@`00S T0T0 p 8 10 10S @訥**|H*l0 @- X00S L0L0 p 00 101000븥***|H**d0- lM@ Hd j <000s  ș븥*U*\*0-@lM@m 00 00 0rS sS t ld = `d T000s  0(d 긥**H***\*@-`PP@ 0@s8#80@U 0s8#8000@? P VU 0A0T00Ѝp00CS0 S0 S 0 /kO--LM|00?xp0  W`"?p0pW (☚`PPV0W B8⊚8 (0,0R< @ 0PZ0S= S0D0Y 0   "@P*0S 0#S |0Sp L1 R 0@@0`5 pP`5刵P</00CS00 S(P50S5U <% 00e n0We S00G00S,+  0S 0 S Z000S800CS0PP00CS0l0d ˥80 @P00CS0 00 0 s`83 ap0SS 00   00BލЍh3@@<30S VW@@ c030!{30 V S$ " R 5U Q Q$Q V RV"d 0L0H"0M0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 01U0    0ZR1@0 RX P 8/ 1X YS P 9/0E60Sd00S 3/H*, Ȗ *D*|**H***x*]X***v$%$*-A-` @T r0 ЍAЍ/p00$  PkxNl0 h oB0S@ uP 5/x**H*, X*WO-FMs M`@  @  00$0p3$ 0(00,@10P S 9ѣ0 ,@r$3 @10 @,Q(' 2@@ಟ@aGT  $r2  1 0 PD0P2d @'P x"xd l 0S 00S DD 0d  ΗPP d@0S00?o 2Pz 2 06^16D01@ @劗pp ωH1p]D0(66S0d000 d0g(| A  av0PS qP AP =0 00S 0 0厣OP@ 0 @050@p,/ 0@Fލ ЍX*(*#***v*h*<|*I*x*pO-JM$GMs~0`0WXg700S00p 9 PEX 660 9Pl2`60 00L0 і97S\4640S# (X6&0S0 0]%Q0*P! R % BR$5L00E0S P,97S9 5L{00\h%h0آ0 RS0$000(0000  0 gPV 4 5X R0000Y4L40܀C XSX t4000C 0h00d0$ 0`0 lT C5P $4T!>\ 0h0d<` ((0# $0$c#!$c4"($ <7 $ &R 30 R0S R3""4408'0PT3Xi97S JލЍ00000 0S  0 p7J8'ڕP\20 00H0 ϕ0   Εpt 087PT97Y^ SЁ 0S [R0sO0010S ;70:70?70='>7<8T0S0,< 00 00,1 $P!1 R  T 0 0ZP 0S 0097S0 嫡0S} [[YX  SS00000 HJH*ԥ**`*h*8****<*****w`*إ*3Zl`*$Rr 2@-`pBWLM LЍ@+ pPk  pe 00011 0S<0 |q?!(  ( 0R0 0SZ=9Q ='/@#b?!"/p80S 0#S 0(60 8ⷓpp  0S 0#S 夓 p喓p 90S0 000 0᪔LЍP4n冓00ԥ**D*MbH*A-0Pr@L0 @2T ` R]$B P 2 Q  ,00EE?AA?R1 $!$! 1 (!(! 1 ,!,! x1 0!0! h1 4!4! X1 8!8! H1 HXL T<0S D0<3/@**Ei****** **\*I*X* \ l%***h\`H~*T P*,*<@** *Wd@-GM D,, <@_4,$00(,0040E@PL0<@@P@<00;0 0oDD0S?;0SW 080< @ + RD00S0 H0PKPNx41S<,\P ,00|S ,sP,/@ 0SR 0 SN , 啁): 01RS 41S ,00-S 0S : w:, qD0S , Gߍ(0SX: <0sk@0sl8JP0080Sf40Sj9 9 9T00,0S  T,  T/00P90S  0 S,P, 0 S, P,H <90SD09Q0SPd@P=D0S! 0S'P+80S  (P  B <8(p80sSt8  h.Pw 00S @#Pl4\440S!P 7 7 R0YfV41SC,P!700D74! @7 00p00p 0: S &00&0`7 R,T7T'TTpe,00|S 4@,$000S, p64! l6 680,$傚000S6,6R P ]|6V 6PU 50S 50SP5P50S 0CS0D0S 5  0p0Q,240%p4000q005P001!/PM0 SF4B80S 8003/00044L0Sx4 SDQ 0d40S 8 4R  qp `⫍%,'`0x0pw 4, X@( ? ( 0˙jpP,\D0SC4 00CS04ppe WL0Lc0L0 W(s=s 0 @0 0@sP`m T0000 0sP`0 00CS00fpV P @`0 0@#{0 ? 0!%U0  S0  4 000CS046p WH0S, 000@ U0400@ 90 S81000@, s4 0p0 7WD!000hwwe0'4 0pf%P01 0#l@L `TB@00S 4 .<@ 00S 8003/4*3'****[ܥ**\*\*X* \ l** **VmDs*w*T **H~%T*Q2<I*h\@*** /0Bꈥ*&QoP@-X@ P0 S eP ~0 @ |**3@-@ሱ0 vЍ0 Qp@-P,@P@pחP @C% - BR0 R  P R ˘@-T@0SHP40( $0R o 耝*e*_@-T@4SHP44( $0R R 耝* *,0P  @-PU @W p`W VN ^ Q/D%O-@p$M`xT oTP $ЍO+T 88@DT#$Ѝa1 !Q Q@彗P $ЍO3b 8S 0S P0 0 0pP  P 嗗X0   03/ , ゗) *j9D% 1($Q!QQ% Q( Q Q QI @-Q Q("^*  ^    0!R/\^^ QQȃ((R ( R (@ ^@ "^  Q(/(R ( R (/ဝ*J%p@-H@H0 (8@08080$8P  Up$80ꀝ***@-MAa(8S @0 S ۖHLL0* P p p( $8S 80pP U 0S ,8S @ (8S  J8p0 08 8$ 0p3/48S 0S 3 D0R <4 Ѝ耝*V*%ez8  P/ @- P0J  PB ЍR!y!@-@@0s2,00p @0CoJ%*t4t$0 00/O--KMPt 0 P 0 0SZP=9 =: k{)`Y0 A8 P@  A{ Q0P@0I03 3# `#(0{x吚Y`ڐ \ Ѯ@#Z43(004# 0f`  ὮZ (f" 0`< <*****)%R%*Z%*^%%%%@-0(@( 2P*%%s@-Pd`  T @P @ @P,@Ѝpj9&4&N&@-@P*0 A- 0@0PS0p`0밀P" \P 0S 0"S0 R S  p`"R"^ 0 00*<***mY**p@-MM P < U`LPۍЍp@Pl7s4/Sf @ P;0@TP/PDsd&O-@`pPV1@@P`3:`E0టP Y/  0/PT@1SZ 0 10S 060 R ;0S*00 0.0 Ѝ**@-P0P0 @p ̀pP0 0SP0 0@Ѝ舥*ht@*P  P @-|Px0000Q/`0000/0S <S0C00S/ S/0C* *&**0@-0 00' 8s R Q 0S0000S b0C("( R S             Ѝ $% %@-`$A0S0 0 0 0!0p 0S:S50P0S0 0 00 0p0S:S5000l d0TpTr000 $0$p(qЍpT*&P*&&'G-@㌠pA\`^ P \T1:00"^ ^ N W\^ \ @2O-pဳ@`A0S00 Ѝ%S V@0PcU9 &/U -U4%U V0% V @PMU0S2 2"0S00C R mU.R T* @mU nU0Sl2`200C R T* @0S 4cU.U   0' 20S0S /R 0R0P 1@X0@LP'*S/@oP0\  R  JR.UTr*PP?* RP?*@P0C Ro Vb @0CS/XP0CTT*/ P *< \ R*9Q*+ @ T =*>@R *0@V1@P9@,@*@(@&ꬥ*l**,**/A-p`P @XP0  T  `00T  0@ R   `FVx`00CS0 ᆴ PpTL000`000 0 ST00.'<'%N'A-Pp `0崀 @Tw4w 00*a@x 0 @P`0 \f^L0L 0 P 0 Ѝ**e''%''**O-MMP @4` 00T X3  @`i P 8#8T-, ) 30S-  pQ pWp }p@0E. P00002> P E"EPt pލЍ |ppDD0T o@ }|p@ To010PS  } 0$ 0/ 0$ f|p@O0$S*F>C0S  }X$ (0Q`$0SZ=9Q =)/@#b?!"/0 0*|p70S 0#S [0AS  T0 0000 0=}p 0S u0r 0  |p@@qX80T wokP_<00vd*'Y''D*Mb@-@Ѝ@|{p@-P`L@XP@ 4R0P@ 0S CopwH(@- P   Ѝ;(@-eSPb(@-|S p  Ѝ(P@-ҡP((@-0lMPQ@00 00 T  40S P 00 P 0 0h 0 lPIcsPI 30S @ @@ `\ ? ;P `(P@ 0S  ں@P@  I  P@ >TN T V2 @0S 7 x傈@p0P @P/T2 Pt42 P n00 PU    P _0 0PU  P PlЍJ/m0S n@P@$v 0S @P@h T 11@T 0 0P`pVPP*000lk 00 0@Q XIP@4*  l***Wi)*(%' )***t*******7@-P$1 Ѝ0Q0S 1 1弇Pʐ! (0 CRtA R hS0R L1P 0S4s,S 0*P 0S 10S 0 0兇@ @x0@0 @p0 @j0 @d0 @^0 00S 0 P***$)**ĥ*0*O)**l)%**)*D*@*) **h*d*m**Х*00S@-0M@, 0 ƳP0S8#U@0Ѝ0@ȥ*-A-zЍp@- yPP@ 0K@P0P$0yp@-`P0 `;@P  P$`x00 0+zЍp@-@P xUSQO-Pᔒ,M0pS@`  z0 0/0  @T T@!  0`F0C 0000VY  xp0S` 0#S\ 0(00SG0TJ ` @@@94pI0p00000Sy 0  X0SZ=9 R =Ï ?Ah(ȏ  p%0S 0#S 0'P0,0,Ѝ0#S @P @`F@P40@廞0( ᪅<00(0D*Mb* "0A-S`p@  OP;P0 000(0(0S PЍ,0S Q 0PPEUPG 00 00 0P 0 00 0P (0S,0S 0S 0 0XlPP 0 S@-p`P @P,0S T000(0 ЍT00b0@ R   `FV 0P 0 ST(000(0T00.'<'N'/@-z*<0!R/P(0<18C8S/[10/*M%)4@-GM000030S3QGߍ 3W ]Z+P SPlt#1Sl!`R< 03/@3@CPQ@ST$A 00@Sc@?S娄@PJ brP RPF&1P @00S 00,S00S0 @10 3/P 2Q  00000000S0S 11 03/ 1Rn屃iP0 0P 0 SԭZ000  4P`Q0 0P0 Sḭ>0000S 00,S 00 S00S 0  P 103/P ᒭH0Q  (  000000PH++++! *)M%+J%)+L+#nq2 \Q))c 0Y+@-T 0 & +@-8 01+*P `00CS`0p S00 P0S X0X /Xꨵ%C-@Pp  l18C8S t` v0S  0`V $ Ѝ+M%+**@- Rp( P@ P ЍX0/LAz P002-,,-)*/*M%X%4*@*00@- @Mu1P8C8S 0S P ouL ku@0 u0nS nЍ0+M%%+|+K*-\M`P { P L00SD0\ \ЍKvPL]*@*M%c*1*@0@-@ZuT 7yK p+w*|*D0@-|AT 0S  0 u_M%+@-/8 LA 0 P ЍM%I  @-@0S S S 0\ \ \P \ @P0PA-@` ?v렀  ?qp  ?lx@P ɁP@T*\ЍA01 !QTUQ s00᱁K%*T /*G-AMMP`PsB|R p2 h2h t\2\ t 0 0 0 0 t 0R  0 S")p@D`hPpᨡ0S1 st10S00 0SR'@@T  @tT HD1< ȠLȠ\ g P0 \!1 'tX[tAލЍP0S S  S0 0< ȠLȠ\ p 0圠0CZ sZ <K0 @+<*++++T+*& *M%*D*+*0@-EM,P tPi@P$Eߍ0 ,PP t s ss x0 <  TPts  ~****& M% +3O-PM t@`hsp`pT#DD3D sUPE,.gp S00CS03p 00R0S eP18C8S5 P1 P8C8S 0 0 X'VPp2d2l18C8S  asz0 P\S,18C8S 2 0 S 18C8S <18C8S p'l18C8S 00t1 (s RK\1P+ 㳽 X 0118C8S V`F(fP`. <18C8S0 r ЍS R   RSP0 U0A0QLLD ++& T+++M%+*+<*+D*+*1+p@-BMd,@P4P1 Hr,!M 1  rPP`1<r> 0嗼4Ѝ08*M%@-`0S@ jP]0S 0000q20\@a^8* 3Yd07@-l000Ph@ R R l  R  P4w03/ Ѝ0Q PM%8*K%T p@-P(A(a1S 0SP vܐA!P00pPP0P P0  P P0 t pwh\0X@X  "  \ p0M%8*:zX9ў3X%L%+00@-18C8S 0P eouM%+(0( @-j0@ 3j+++p@-BM` )jP@0 S`0018C8ST01y0 w0Pn00x0 iBߍpB/ BR 0i00P y0001+M%++ 0?o2 0/M%H-AM M$r$00000a0P01 iPھ0  iP 0SS WS BSq1 +i P  <Sq0S " . 1 0S0PY ji18C8S Ԡ0S  Q@  |PY 0@^ST00CS00  S00 P0SXw+V ++M%<*+p@-PH@P@pP P P @M%10/@-io/A-@PP" p00CS"[ \ [ [ [ [ [ ,\ `V PPtFP0 P00TA- 0S P0000 !0S0R 00 33< `00CS`0p SX0X /Xvꨵ%7@-P\A00C!S0000CS/H] ] ] ] ] ] ] ] 0 "S 0S!uu0 0P0 V0 d}u0"S0P0 Ѝ0@4ru0 0P0  Ѝ0+T W4;0@- R RR \R ^R^@N  @0 N@T 0N@T!0N\!, n0^00@ 00S@ 4G-@|P2 pqp =`P`PP2 00PF 0P  V @P 7@0S@0S400@PP?UP PPP P  0!SPt,4+;M%A-M@PP\1  Rt Uu@P `p崀  CCPӞu00u0ۍ0 P 0@ 0000S t  RP00 ZM%,4@+64p@-`@:PP 0 Tp(PC@ps@-@P`@TUtЍp @g h R h| h(R( dGg0PP @OP ,KP +f@55xt yt +0@-M@@<0(@,0 0 @P 0Ѝ00,娱x0 gᡱPPPP0S 00@SPd +M%+@-s(,B5+@- @yh shSnkP Kn f0P3P xstsh Uh\ f/n HhfЍ+xt yt _5e5h55f@50@-4MP3P4Ѝ01<18C8S sA8 0 9 0'mH bf<O4M0 Zf0E, R0 Of Kf8P 41PP m0(0S"=RBs00ESf f f f f f p6sd4s`\XT H'sKM%5+%5;55+?5nh55560@- f@2+;-@-[0 R   ЍЍ/+-@-[0q-@-A0 R   ЍЍ/+A-ARp`P@1T epP`@DO-P-\M @ oPo0P0 0 ( 8$@ P@ p P @ `00, $0S\  R?$0SUXN LH P00P$0o0$00娂0000Ui j j j k 4k \k |k k k k k l (l Lm m Q 0S0np p0S \ЍP_L4 @` 0C$07 PP QQ F 0CP $0 Q 0CP $0 0CpP $0yWPv pG   0CpP $0h 0CPt $0`WP\  PX Q P0C $0P  PL Q P0 PppBW P>"80 QPI  0Shl l l l l l l l 0 0(R00S @` e#X0 (r  7   P  0@0o 0[ @#P8,00SX d P80C S  R$0PS  P0C [$0 X 00 (c ^dpl>@` UX B6e666+6666 77-7C7[7|77777P6O--lM $ mm`jmPVPP 8@ 0O|  0<0hh2 @0`2 @0P 00?4@P 8 @pP c6pP@0S( P @p uoso$0 lЍHp<`@40S(  c Pt  ( 26( 0PŸ4 0/P,0.P<  B, ( ( ,0pRQ@p(S<`@ 03P%<0%800%4000 0(<0(800(40` 00 p  P$@pB6#6O%68Yd8$868C-paM00PS@ p 0 00qp  _c?sp >@0 Cp00`9 Ϡ pppppW0@0 @ 8@Op`6t00 }>6?@` o00 S @.  C< 8p0ЍCp0O%G8z8888%Tp@-MdP! 0: S0 0 S P@` 000vЍp bp P @TPT0dHS 8$    +888O-]M0 M-SP0S 4P ]ލ ЍOv/x]ލ Ѝ謄@pdP$ 00S0W0S 0S]\ ` kpP@ i e@pl0: S  SГ0S |bPP Vu bW ]ލ ЍOmcP {b|B0v: S+( `P@`Pj ?bP p  00-00 0 0S0S`-$bP`b`2bvL`0S 0 'bP V bP z{ RLcyRwapPT ncPx!1Z[ h 0a*cZ'cUap`4 0S!P !000vCn P: v?b  0S -vapPv廘*P-Ua 0S ap<m+O%88%: 969e69 D9Y9o99995 :%0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00XP0@-@P@@0b0S 0S Gnt5Bbl+@-~kPE6sp@-P@]ip 000/L+@-@uP 0S`P Gi i fPЍpPU P$ U00PdjL+wj[?@-@P @_ 00S@L+@-@P$00SЍ@ЍL+A-p `P@P000 P P0 0 ,@-@P P0P00S@ L+0 R L+ Q A-`0QS`0@S@ P^ ,KPX #P1 2P1  0X00\00`00G?000x000020"00*` 㷱 P0ЍpnP\1  KP4 P. P01  P1  K P1 K P+ 0P$ P0  P0  P! 0P0  P0  0 0 x0 l0 `0 T0 H0 <0 00 ,L+C+ W,7@- Ha@PP0PS0 P ( xP0S00UdPPP  dd0SP0d0(Pd Ѝ0ht@L+j2@@-0@ ShS0CS\ d l t | (S 0h i0 hЍ\XTPLHD@{P0ih0(L+jjjjjjjjj+@-MM0D0TP oP00P00l5}zw t/P0000S000000T4 L400@0)P04 , "P004P00430S 30S 4ST4STP 0S00P 0S P 0S00PHP 0S00$34P 0S00Tb40 0P 0P00404 0000404 0000404( lp0$0`PPTTPd D25<QP``0S PfP!DQsPpp0S   BPrfPta PXTP`H eNP`4`H0PSe 50S0  ލЍ04,.P 0S fL+,j)jjvuX5+ +0W,r!5++jC=*2 +j13U ɥcxPyjx; zH0+w@-T@5SH00S< =000S 505L+5+ Q 5+ 0 )L+ Q 0 "L+ Q 0 L+ Q 0 L+ Q 0p@-0x@Sp d00SP H00SP 1P0S05p5+L+ Q 5+6+/ 0 @-@ L+ Q 0 R/ L+ Q 00S16+ 0 L+ Q 0 L+ Q @-x@5 l 5 P 5 4 5  05L+ Q 00@`/(P%p@-hP@ \  D  , |  vEpL+ Q D0@-0S K00ET@YKU@5+L+@-@05 0@L+@- Bo 0 BL+ Q A-P/o"`bp2qp .@P UA1p PUPHXU`X8/pP V@ P@T*U  AV jjjj k 0 0A.0 00S/h +pp@-@ P 0s 1@p P%)kO-@`崐0尠T$0P ?990 VYvT00S[   [1 RP \@h +>kP%P 0S  R $ ,0/8<//h +:O-M⨔`VЍ0(tS,  RQ0$R00:?002P?00"2 Si@V !sr% 0S 4 30S $S(fP 4 0 40!@0`000 00 @ ` 0 0 000 PPp @@0,t(dvyf`p{V0 Z$4SRA 4? 0 qp0dt2 0Cw RQ&0$0@R*0S 0 00@0 @ 002  @@04 S*0LPe1 qM   10S 1[0?0S  "[0$ $  [ 8dCB/h +A-`pOPP#@c0 DBC.B $-0DBt P 404)0$rdA{@+h +p@-`PUp4 @ P@ D4p 9YT 04p 0 dd0@p@h +@+ 0P/h +@p@-  @0S p@P B bS .S 00CP U2"cS X- P:80BS t +t +kkp@-PP`@ 01S E"0S *Sn0S 0Sn0*S x0sR  dR  kR  0C^S0SP@uR @ @pt +(P%0S B- 00P!P* C\/p@-@P& PP`pQ P @tPQV`u-PPN0Sp Ppp,P%tQ%kp@- edPP0P 0S .40!0`,@$!$Z3eP@P|@Px@P0 0 @ @P0-P-P |-Pl-P PsP ,kkl(lx +1l?l| +kkk$%t +lll ll 0/t +@-  01SP 0 Qpp_h ЍR @0!00P< 4 P40U \40U h40U 0S P0P 0 /7PxUUt0E Sp x L : 0#0%*U @U !UW<50SQ07SN < 60SH07SE ;07S0? >P 0#0CS>P;50 9e`0 S &0!R0?0m60S  G e`0 S '0!R0?0R } !R00 !ıFp70S!R0 !R0 0!ı3 !R00 !ı*70S!R0!R0 0!ı !R0c?0 X80S `M0 S 080Sz 0 S 0  G&px!R0 0!ı2n!SeR0d 0!0<0<]P0WV0S\9 qMJ$  C@90S0S } 9@  <P- 00!R0 0!ı=0p:0<0!R0 0!ıw?`0000!R0 0!ıe-``000<&&9`S:4  @ `0S T \+\ rh;0S`D; P  ;0S 1 `+` 0#;" w,P m!R0 0!ıP P P v !D R0D<D<0QV,Ph L!R0 0!ıP ! R0<<09!R0 0!ı,P . <Pq+qpm < { i!R0 0!ı,P$ !R0 0!ınPP Q Mh=` PBEP h? =000 0g000 0SG- n0% @>0SP >0S $>0S P P 0 `(ih>0SP x>0S >0S P P [0S  % M>0SP >0S >0S P P.P0P/ %$Pg0 b!R0H? 0SX?0գ?0/0 p/0 S00C0? !R0? 0S?0գ?0/0 /000S 00 00S080?=5+00S/t +p@-@/!PpO-pSPM@`PxP800 `@0 Y:X80  #1  X RH W0H 0Ѝ 0S  R  P R  AR  QQQQ R  X180 R    80 `UP VYZKI  P R:p@-P\ HPV@^^'P gP dP fPpdpT ^gP PP0  0SA00p0   /O-PR p RSPP 蠟@PU40PPp0 Ѝ S@0n00@`P` 0S ``F0 S0S P B 0 0R R@0r @-P@L+r @-P@P+r 0 PL+ 0 JL+@-`@ CP 婷P  0S 2P ЍL+G-,2@T @Ѝ`zHPSU P0pH@R`P 0@ǻqpS QHiH?Y W S0 R MR +R GR  SR 0SSk SER SnR0SdSP0EX`P 0 @vT cT eT @ Vx@T@ @ ?   @P  +X+sP7@-@P KP P@ `P, @]S Ѝ0U*Bs@-qD@q0 $$ @ e%_sqs~sss1C-P0MSP; 00S7 00S@/ `p PP@  0@Sd@ 0DSd@ Td@ 0DSd@dT P PEUЍ@+p++@-  tPsr ;X@,`V . qR000 00 !Ѝp@+`+O-@Ԡ԰`P0FPPPp R ЍWpV R  0哺0P@p U  PPUP@QpP RpP`e%ae%p@-@QP Ž0S R SppQ0 QA QR P/@ PRP/@-@P @+P/@- p@ "0@-M@ 2_ @FP F10S@(PaP! DP OP AP dP cPoP qPRi0|00SRЍ0 FPP0 00qpF00@4+ssP%tG-Mh0S @0SP ^0S`  IP3PT{$&0 0`pP 0S ;PO200U p2PWhR00@p PH2  0B,2P 0S HxGP"!! 1P NQQp@000S _w!1W10Sڐ`oQ txP00 XpP00 ?P SQW  KQ=GQEQTrЍEP00S rP|P `` YP E@+<+l`+ +D++0+H++: ;+T %ti5+=tP 0@-@@+00@-P &@`+itlA-`pP`VPU@JTP0xC+ 0 @+ 0  @+ 0 @+ 0  @+p@-P@@P Pp@pp@-@K`PPpVU Pp PpC-M@̐p@PXЍP`PPfPY04Pu0SE@+@- 00S T Ѝ@+@-(@0SP00|+tt@-@%0P 0sS@ @G-`dgd@p00CS0 {p PP 000 P U 0D IS  ELO1p@P@- 0Pt-A-@!+0 0Rp@`0S00 R0S@00`P0S U  ᥷P@00`e%ae%O-MpG@ P 1 !`Q[ Z@׺P[@P* 0 000p0PЍPP P : _X0X P VP/TP  $LP00pWp`e%ae%t@-@9`P 0S PP Ѝ@uሺ@ᅺ@@L0L 0P0pJP9O u@3O ЍpI H@-p`P@ Ѝ0S [PXPPM@P T0P 0p0P#PCPO@OCsVmG-p@,,`P@0S 8P@0S0# CV* UR@ R %S #SP  @# C V* WR   R %S #S 0P jK@@+<+p@-MPPލp@ 0@其qp `,C `P|` 0S:T  K0S 0S   A 0S*PkP@5+C-Mp|10SP ~s`1 RP[NЍ44@P,A 1R@ኹpᇹp넹p``0000 000pDO 3N밐@@k`V i7`"NV @~u0SN T7N NP +lttae%`e%ttw@-  R@7@@0T PO@p`PM@MM Ѝ +u1G-0S" 10S`pP 0 @C|R0 -R LʺP P,J@1 PPP0 N A` MV T" P uX%XBP tT@@P@T 0l000@Ѝ`4PR@t0S5+ +-rlu%t00S/RC-p t9`P% &Pڔ ЍC፸Pኸᇸ PP@0 PMN@9MT  ЍCt Ѝ +u)u0@-MC P CP@JIDOo@BMЍ00@-M1@0SPP LV@I#J BPh@LЍ0@T@0: S +*5@I5+h%)h%@-M@BP͡00 0ῴЍ/I @-@ P P0@/R00S6+h00S /pp@-qp HqpP@ TUppl +@-P4P03#0 R/ +O-p4`08@PV `20ST20S / R 0200CS$0S 200CS ʲQP >)QP 2`V1 }`_`P|0Z0KJY)Y @ PVL1L H100 ut 010S1 10000 0000S"qp@PX  PPAP qp Z /80 ЍO0 `V h+5+6+Th%++@5+|5+DuH00S <0P/000S $0@///+5+6+h+'G-p$@` P*P@T 0@T@@XJ0ZsP`X G hTio T 00Sjh+5+G-p`P P @P qp@PV00SЍG0AhP00 0@ЍnP@P 0qp@P l +h+A-p`qpP@VЍAm0  0@cЍ0P  P/Xh%0P  P/Xh%@-P@p@-@PplPW 0S L0 0S8 00C0Jp@J  B 0@+Xh%+0/+A-p`P@T0$@*0 "0UP00 00(@0@000 ηP @   0S 000Xh%+P// / /00//0// / /O-@0MPut@PЍ30Su200 ?QfPp0p P^R`V0TIp@ P P``0t TV 0S@Pm!! g0P@_ P10S 00 P0P *3t10S``V P PH p ЍO!(100pW r 0 `P `V˯[:p T` P0PPڔ0[00S0O Ppw\0@Pp@P_}@z0 7xC+5++l +5++5+5+5+O-@-$MpT0  $Ѝ@ p20S2T0T00 02000T:0: |PP20S 21P U U P PB p $0 P= P`[P P p 00 000000000 P00P+H1 D100%- X#*0 S0˯0 zpP` P0 0P00S00Sڬ0 0 00S00 PXH00SO 00*:PE * BxC+5++5+5+5++5+qpp@-@P Pppp 0 P P @0@`@@PP60@p@PP%HP%O-PM@`P"@@T M00000 0 `F?0  20S1 ЍOppP ЍO$  0s00U 0SqE Wp |!00t!`F0`!H00 0@Ѝ00Z 00S 1 0@0000@ 0qpP@ pqpP@ P 0`0000 000CS( d00SWL0``00 0@`U5+Tuh+++6+@-p`qp P@P 00S p0 Ѝ@3W0 4@P80 ), Ѝ@} p`x Ѝ5+5+vuu@-  Ѝp@-2P p@da lT`P@  Bqpp@@SQPpp@uh+p@-P@`P) P pGP@000S  p@I5+A-`pqp`bqp@PA40 P0T0A uu5+@-04 ,    00++++@-04 ,    00++++$1Pp@-`0 S@pP@SP@P%P}` P@@R 00SP 0S@pP R @@P[00SP t ++G-`  傀E@E PTPppP FT F   ( # F F @ Ѝ+@-xt@P 0S\00XP 0S<00   ;0v+^`v'vP/<0 4   $ ( , 0  R 4 /+5+O-paP0$MS1A0S 0 !A   W  R ! W @  000000S ⎱ 08PPP /`P 04 `0 `04 4 Z `J P0 p0PWP1 P#P3*0  Z0 0 Z Z`S ``$Ѝ 岵 ᮵05+5++P%P%=P 0@-ܤP/+P @-@P$0ˤP/+O-p8CM4P0 0C BS0S0` 00W[0`0C00ppЍ Q0 QP[` 0SP00 `0 P + $20Sm o0Xv t0 CPPP Z p   `PCl10S900 VQ X ҷ P P  X   P X 0 C R p Poᩒ SS0C0`J 0 +5+t +0'+G-00pxB4$0`0 00P P U 80< S 000@P8p<0S+ 00 0 p0S5V@ ` 0 0CR; 0 0 LP6Y pQPpL 0 0 0 0R* m0S$ P0S0SpP'0 0PP(PjP P~pPpPP 0 0 0  4 0 SP0C0Ѝ+5++A-P` |pᕯt0@ @ @D@L00@TpGЍ `:PP(P%++A-`HPp@@EH0S 0P H@@+PG-pP|4@T pT04S Q   R0  0@P@5T T @, 0  0p4 R0R000S0 0  0 0C 00 `0P0C0p0 0Ѝ P0  V1PU(0S 00011C(PPHꘑQ 0 (Q20H0@` 0P `2R <10?Q 0`@U 0S H0S0S q0(R0SH0 Q0H @`ʈztPP "E E"ETP0(0E7PH00C10H00PP(0+5+++t +++@-(@(0S&>C0(0+G-ppA0P 0P0W0S %> 0`S@U `0PS mP 0 QR00 0R 00S W 00S0S0   000    0P00SX 0   00+5+?v+++0 0@ /+d0, R X00S P@0~0/0P 0/ 0 /+5+0 ,  /+qp/G-`P@P_p p倐x X 0 B 0 V 0U@00CSʝP 2P 0=@+xC+PG-P0P`oPp̀@ 0@D P V 000U00C@C@p T aP0 0C J0 Q@ @D 0@DRC+xC+80P/ R/0 0S 0 /+ 0 R  5+Cv+p@-L@ 0Sp0dS 0p`$P `v PUp 0+[vT0 0Q 0<0< (., 00/0++0'+A-APU  ^%(`P, `(,, R0P`VU, ,0 0 P ^PQ p0࠱ P 0+1G-P0sUPP@PP0Ap`@`V R0 XWA V$ 0 0W PS 0)lP ` AY0 0 v W0@TP0 0` &qp .@PCP tA ` W0 0M0 0`qp @TP5++xC+P0G-dpPU !R00 RS@ U W0S Q0*P @P P`@V0 0 0 /000 r  0@P`P`d@W 00 H000 r  0@P`V@+xC+G-`S 뀐P@p0Vs 0SP@`@ P@tu TUPh+00CS0 S0 S B0 /O-P0-SP  v!'WO4p3\3PE4D:P0S0@ 0S 0S%@T c=E?3(43*YX CA 0  ЍOr`P ^@[@ c@C8 0 A @?D |SJp:tv+HG-@ $`PP,$epPPw r@yz  0Z`p@0f ^d0 y(p Tt lp@ pvI*gD |+C-`qp p9 qp@@PP1 .Y T0 0 Ѝqp 0 p 0a0@S0  /A0@S'0@@-00+v.Pp@-1 $P 'P6 Pp srpp^P@<P@050O00pPt\0,\ O  B%@ $,P P $0ON0@4ppv00+@+uh+5+ 005S /00+@-o0@-M@P P)  000Ѝ0@+@-t @ sr NΎ004Ѝ00+@+7@-~P! 00N.P ēO.|~@P@BT  $@ P Ѝ0@  P Ѝ0@+00+5+@-SP ,0 0R K@+v(00@-5 @P0QAC R000+@-@0Q"P P P0@Ѝ00St T0-Ѝ@D00S<Ѝ@ 0,00 +v0+vP%w.w:w0 4+000S/$   ?A9c0/Hp%h+C5+@-P M# @0.S 00S Ѝ 0S0 0 0 R000lX&QP0@  0R 000@0,0HwHp%Jw`w5+twww000S/$   ?A9c0/Dp%+C5+@-P M# @0.S )00S Ѝ /0S0 0 0 R000Kl%P0@  0R 000@0,0aDp%ww5+ww x@-@PP  @ЍBsP P/00S |t0/p@- `eP p@qpP@ 0 p@ +0x@5+5+P0@- S S00 ЍY00 0p%NxP/,0 @- 00S@|5+5+VmP7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P <\ Ѝ04@P,0, 0 10p%|p%0C+p%5+T 0/05+P/ @-@P @DT@e\0 X PLHD@<840+]xp%cxjxxxxyOyPC-PM* 0&DQ@0 0 B \ D!R1@0,S T0@0D@D!10C 0##Tߍ` @C80Sڀp匐ᾦ!P$0Sᴦ\.8᯦80H $< @ 8+h%h%y*yyT P@-  0S 0 0ЍP  R `ЍL P0< 040800 0000000ae%`e%yyP @P/ 0 /y+0P 00/5+h+@-PU  @ Ѝp`@@JtpPQ 00S0\Q0S 0S@V ЙP 00$Q00y5+@-0 S 0,, *; Ѝ * ;D5+zz@-u@ $n5+zP/0S/P 0  //v 04P/D5+ 0@-4  4 ЍD5+ys@-P@`0-S0 00C  S0 ` T00V L ` !0A0A ^T00R`ЍpzO-P$M c4P 00S S03/040$Ѝu40 @HsHHP 0 R @@-PG 8$PP 0@0 3@ ZFdaD[@T[0SO+P080N0 P 0+S \:9P/Pz@0nP0Sn@z@-P00 0+P0P0P aK[  00  @ =RP    B  daq000000 CR F ,t00S P1T 10S100 P10S 0#S 6+l +@-a 6+@-  Ѝ@-Pᅧ9`ʢ@Ǣ@@ 0`p8 Ѝp@-P-@pw  A'jw Ak{{6 Q~wpY@?h@-?2cX@4$T TwJ [{ A{&k{{6 Qdw.A?Q'p@-D`DP@@Tp80 0S+PP0  pLp%7+++p@-@LP4S 044`40 R:0 @0 4p7+Lp%;+p0s@-@@d`D \0 Ѝp0U4@PP8xC+7++@-@@PC-?O M@T!pP0`0 000  f ޡ0@pU-00F`I3ЍC-o M\0PpoF @ 0 Q(a0dU-00D@Ie3ЍA-PM@0SЍ%S pj@0pnS sS dS  ġ@`D@P O @-  R$00320 P00S@A-P p 4@0T` 4 0@T 00S0@0SP h00SA XK|P0@00@m400S,0 A 7+++5++Pp%+++@-@_r%V0 $Ѝap%7+7@-P0S x00S Z 0S@ D00S  Ѝ0 00S0 զ++++0C-p0`SP #000 Pj@l0 /o"@@P 5DT@U 5 ЍP ~5++~@-@P ~00o/C-MD8  @@Y 0 0rxY@`Y LYK #BYf DYF  @aIY ` (` <` p` P` \` \_ \_ \_ \_ \_ p` ` ` \_ ` \_ \_ ` \_ \_ \_ \_ a PY0 P00QQqpp40SPLh0S > P ; Pa4 P3 qp P0 P PYs 0 0TY@AYhBIY dTd _ b c 8c _ _ _ _ _ xc _ _ _ d _ _ _ td bI0 SMY JXb tb b _ ,c _ _ Hc _ _ hc c _ _ c _ _ Td 0b _ _ _ d  Q0R 0 )qp  82~P0$2 R P B?ӝf qp]0[P P01P 13P 0 0 S0:P0PvP4 0P \ 0 0 S0:0P SA Pu pDPDD,P,|,;+@+5+0;++lD+h++Y,0S|p%l0@-@d00SOoBL0L0AD0<00A400AA9$0 5+5+,;+|p%+++D+(0$00A00A0A!+++|p%0@-0  0SRP @\@R @ TP @S@ @  TP@PT0@100s@-@QP`@ P$P 10T0 r.`@@0T T0TR  QЍp c2P  @C+5+O-MDH RQ. 0`0DPH@0PE1p?J 0@0@QZH0 S50 S  0 000H00D000  0CPЍJo ^P DBZ@pP@C+p%0 @-oP/0      /@C+0G-@0S >PT X0 000Sx@/ qpp` j @00CS+@C+$ +h+1O-`wv@ !00S ЍO00S @00CSZ# ЍOcqpP [ S |V Q @ ЍP%P%$ ++h+@-4@cP@ . 0?o2 0@n@C+p@-@P$0pP0@C+p%p%p@-@P800 p UT 0Sppp%O-$ "ut$ `100@_0 rs Y0 @P0s00V 0S (0X 00 000 :000P"qp P 0"ut R0 @P`000@_ V0`p80?V `Vp ` p@C++0@-MXP @tu 0 PЍ0@-0 00S@@C+5+0QA-@c MP 0SFIP2IP  .P20S 0S   Pv|r0S0S 0S 0 00 0`pP! VN$qp1( Pq0S 0 0>0Sy10SVJW 0 Vda~|XJ7S V1p0X  ~| ~|  Ѝ000 0000 0 d`PP 0U0C?o20S 880 P@C+HC+:5+6+h+5+̆0@-֍$ 00000S@x xC+ 7+0@-ō$ 00000S@y xC+ 7+@-J,㳍$ 00000S@tHy xC+ 7+@-@P X㠍P㝍H㚍@㖍㓍㐍㍍Hy y x 1A-@TPP1 |qtq"d!k0 @ `Pp 0S0S 0` 0?00^80 (00SxC+y ++h+8+5+A-` pP@ڗQ)0Up0P ˗տB)@-4@P(0    0 w,p%|C+O-AMbM.pg,W Q 囗 e@P W0S0000AލЍ0!S   /PA>04S S S0E0@S  00 [Q30S 0 C Q ? 0   ^R000 QR S$R0C00 0S00`000\R00000p%|C+O-pQpPpWCM Cߍ@tcPSTp`3`C`# \\Hs PZ PUA $3T %SpP 0S @DT2P@  @@ 0 X + 7R@ +T@"0S 000P @B?1P SQ@ 3 Pp 0Q 1T RP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0S 0S P? ^00p000-|C+p%%ކxC+$%i0@-@PP P pP `P WPip% l@-@P DP P P,@E #<T1O-M0SM A0 ЍOn` 100;  0p `wx@PЍ0S  0 |00 0ᥕ 0 NP 0S0S S @P@P|C+5+xC+M\0@-PP P^0S @T  0@ |C+p%\0@-PP P^0S @T  L0@ |C+p%0/|C+0/|C+00S /|C+ @-0P SJC+/@-H@ p P0S00PЍC+FP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`Pp?P@P$ ?0P0T0S@ 0s@-P00@a0C`S  $ ȇ , 4 <  P  000@@0Ѝp 0 0 0 0 0\/\\G-1!0 -e \ Q [@`V1!0 e[\[0F?o20S7 @`^V0`0]QQ! ]Q0[Qp.GQ 5 p`0W]Y0`QV0 0 d\Vp0[W` W nW \W`Rp0 V0U+U+cˇ7@-0 P @R RP L L D D   Ѝ0@} @$%U+U+1G-QM`딡@``P0pW0 p3PK P1 H1 000 0cd\W R T R 00P@0  p0 [R .BQ  [TS[Q@]R  00000T[@T[T@  ST  SR,0 R ЍU+U+U+ ^+00@-M00 M/SP $S, +S00, 0 0 9S$\S @P0 0 c0IS0@S0 W00ۍ Ѝ00@00 S00@U+U+I O-@((MTЍ0tS bS rS aS @{S000`V Fp` 0S0QU 0W0 0˔ 0P PUP @0@ `<0 c2pP'C+T^+U+U+kO-`-M蟟_? @}Q ;Q <,0 b \ @\\ `<`,0 t@T @@ (<(,0 @\\\ \0\ AP@000J S  4 P <40 @ R @\T;0S00<+<p( 4b  R @   R @` @ R @S 0R @ Rt AT0 1p @ 9)0 4" X 00P0)9 0:@@\QQd9d)0 f$ K@P$9$)0 pV,1S0 K$,04 @00T0S@ 8 00@90>: 009 Q00A0 0C S0 00,4 P8(0 t\QG THP R,4 R $H,4 00P@0) 00A  0哾0+0 0 0 00)Rm0I gRu b9RZ0RR R 6&0 PT   9R/RRA@ &R- 00P @  y\R0)0\ P0 A  R(6(&0 [Q 50)0 0)0\ Q5%0 (~0;Rv IRpR wR9 iR0 R @ 0S <5<%0 \000) 0)rS0ϔ0 00 @ǔ0"S T4$0 ,=09@0C09@0I0)0S 00@<40 0)0  0) QQL4@ S 4$0 ^?$40S $p5 0I,1pS0 KT% 0S @;S>B0110@\SS434#0 ~ P3#0 x4 @P 0S 00@0  p$pp`p2p"0 0 $$$p W 020"0 20S$000 S 0Q 0Sz @;S> }S Sp 1!0 0w$ 0 0$ (0 0垓 ⚓p$p000p WH 0S  x$p U_$ m$ppXP 0 $ 0     囱!1  ! 0 0$$p ( $ p$p|! $%E+E+U+U+p%([{U+ T ،C+M+@/R$n%EU+U+׈0 0 (\<0< @0 7_00܍<ЍG-`@p娀@XP䘐U@T00S Ml0h0FX0 0S0 0 ,)# PC+U+U+T^+^+^+^+p@-P @(000P @p$r%@-@   0@0$r%0p@-P`PUp %@P 00CS0Np \Np0 NU+G-plBl` 0S2 SQ S$PUVP(00S S ` $$0P, ^0000 00!#QP`$00P0T00, PP (00S(0 #R nR0V ,0020#00$0,0$0!N P( T0R #R nR   PH \T000(0V0(00PP P \$0T\ 0$w 0(0V0(00 000TPrU+T XU+ @-@X0  0S 0S00CS0Np X呃0 oU+G-M0DMX0`Sp00S 0S ]3X0X0#\030 `00d0̓XSXP 00CS0Mp XXX  (pP0 ]0 X PލЍP2 kMp0S ,$0P 0xP  p4S _!0p0p4S \PP IMP  00\0YPp0`0d0S0000d00S 00Si vP00  2 02R]00S +l+{ P0 A]0+^J0+Yr_ wJ` 0!a" P*-\PP LP[#P\c 0 p, \0 r!  0`PS(00>#PX20* 00+|0\`0P l000S S0P@ 0 P00 00l C(00(01U+%_6Z+U+T V+7@i_I7 I*@- P \ Ѝ䍎P@- Ѝ P \ Ѝ䙎@-0 P \ Ѝ䦎0@-@XPMP   0i)0 a)Ѝ0^+@-M Q qM`0S000@03 0@匐0S " 0d\ 0 0S S ` 0l"@P *0 " PL0 {00ڍЍ^+U+U+@-P@   0S(\0 R `p`   :0P S t  \ЍЀ^+G-pA嘁00`PU , R:(,500( &U# \U   0 R`Z &R\R`P , R:(,00(P    "pr P qu PE ,  R:(,00(   t  0^+$%A-@P p0R`*W0 0 qt 0P P O-0/OM00PЍ080?PU 0PH0\\e R7 0ST?0 C0R 0i Pi PS4 0PS>0@oP 0 R >0R*0 0HP0S40P 0 R 4>0R$>0 0S > 0RR0S0S4 0S=0@oP 0=0C>S񟗐긿       ij   8 h                        ̲ ` 0   T     D  d L   h ܽ L  ` L0 R: L ` 0p0080800400S\<; 800 8\4 00}<0S  H0SPP80S4PU 0`  ErP080 A E4 6s0T P 0   004 0 0  0$;L{40 0:0R᠚ <00s Ձ0P 0S <0S 0T( DP2S 0 H΍` 0S0`V: $ 00@ 9@0S  0Y H0 $P x0 H$0囍$ [89`0V:, $s p` 00C 0 30P0 80 R:`8 0 | `[ Rp |`80P  R:L`LL8K D`(1 S:` 0  0(8 0R7 800 g4 00|<0S  PdP 0800 0 TP80SXg4 00n|<0S  80S0p4  HD~`P <000F400<0܆4 0O|<0S  V 0400<0,6 800 |V4 007|<0S  sL0 R: L -` 0pX00pY R  Q T5 50X4000  P 04`Z Z 0Z 000 G 00 00 V,شZ0 0RP  0 0 0 PQ@ `VpX 0  `E0P  ßH`<(LpLHp<(L(0000S c4 00{<0S  ` P/ 000Q00  0  0`Vp P\   `VXp0  `Pa 80S0s "p0 X04 040P0 P 0S 00P80S0s"p 4 0i40P bP P R`03D0`<pL0p<q80Sn4Xk 4!p 0`R$l0004 0V^*00000(0S!0 ( 0Z0  0<H0 0 1 R[S0P' U+^+8^+E+U+|X^+%,r%ht@S<U+[юՎU+ێ ^+ T ,%p^+U+U+8^+0 0$ ( 1 0X`PH`<(pLHp<(x0h0<0 0R,,0Q 0{Q  E+,X^+p@-@P`Tp0wS {S sS 0p P 0 HW0`@p P `T G-`P5pPW00V01 R P @u0PV(AGU !R <BPQ< x d x   V    :R 0SP0S X00 0P00 0V 0S`: yPP 000BS ᯻ꊎ^+ 0p@-P@0`T P ᧇP# 0S  00C?o2S Pp0S000S000V0V@^+ W,0@- MMP@P X AV p89V+  PۍЍ0T *H0  BR R R /ᨵ%X%@00CS0 S0 / ꨵ%@-(AG}0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@__+0-01S ^00So^ P0\ S0S Q0S R P0S0S00QR  \,_+0@-  `Ğ\ @ T\    %R    _+ \,A-\A0 5S <0S 304!0<b$a$q$P0U&%0 ! R8  (P M0  ,P D0  4PP yA00\P ]P D (04 0"PS \, _+X%_+p@-@0`  T  tqyh p dPPT p wP000ST @ꨵ%X%:^+Os@-P r|P]:@P-0?S0SP`@ Ữp Ѝp/P@JP 0S S @Ꚉ0S00|Tf|_@-3 >똏X%0@-@<TQ T00 0001S R0Slp@kTX` T@0$P@ 4cT(8  0@Z_+X% \,!@-Y3 IАX%7@-@P5  0S 0@T '00 Ѝ0!0"S p`@-@BP  p SЍd0p@-к+ e@-6螺+ e@-.耺+ @-&,+ A@-r+ @-*+  @- 0+ + B@-,+ @-)+ @-L+ @-+$0Qa A@-+@-@DwP d 0 C, 0@- 0|1堉+p@- P PP P$[vP P1QkH P z~1S(ʰ1 \H P y~P K 00P1 RF40S 3/j PPP j P,Ѝ0R0 [a 0SpW 0| 3/pv P 0`H P y zj `V~uj0010A\70 b"P 00P000xPdP <P >P qqP uP P ʰ0P <@0CSV <000C`FqP Y$P P 00P_+X%V,RS$%V,a % 001/_+P0 R0//_+O-PPp`*@ [ !  0P@ Ѝ0%z00 0\"<< P 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @_+P/D0 R/0@-A1 P i< @y_+O-0Bp , W el0 00p0o Ѝ`(Z 0S rP  \00010P@P 0S 00@ Z 00 rP  [0S  [00000 00` Z0S prP  [ [ 0 0 00U0 P0HS0SPPSr 00Vr0S Qr+C P [PU o0X!0C0S8 3 000 PE[ `+VUUU$% @O-@-$MPZSQ0 T 0 /(T`,D ;0X0 0S 0h Zqkt븳@q qq0P@0@ 000000. 0DSDU 0 E 0U00ө?0U0 CR C 0E R 0 0kqY 2 k0 BhiY Pp} PC ! PZ P P#0STkpD E]PE@ D9k6k03k@P002P? P AP7 0JSI1000 C 0 E0]0@Pp1P1 pW 0p00@0p00@pW E@D|]PE^|pGT@D¹0 X@P psP@U@§%0S 0 B0nZ00000S 00 0 0rp$ЍOu0XS  `+ 4v6m$%X%A-`PlPp `p@p@0T  `P@ P LP0000 `+@-@PMp 0`T` P@@Ѝ0 00ppp 0 0 @SPu 0u@P   % `+y'Pp@-@*TP0Ps D` R :P 0S@@A@p% `+@-@D0000 `+0n `+0n `+-@-0 0  Ѝ Ѝ/-@-00   Ѝ Ѝ/-@-  z ЍЍ/@- ЍT @-@T p@-MP@` ,0 0( 00 0`Ѝp@- Ѝ,O-P0-M ` HpLp pUs\0 0_Xs 0 _YPc 0S` T00S\ rP@PT00PXP@ 0sHਏȀ0 0W 5p fPUWpV`JЦo`0 S`J 000 tPF 000 `.@P\0 0X$ 00T00 P0X DZ  u pfMzkfifЍ@00Y00S 0S 'rT00P@#@3@pz(uP 0 vu뜰9JI[h^h C 0 E0GtV`PJI`?hBh `+V,@-,, ($ Ѝ,@-`$0P@ 0  00 0`Ѝp@- Ѝ,p@-MP@` ,0 0o(00 0`Ѝp@- Ѝ,-@-00X l $Ѝ Ѝ/,p@-Pn@np `+@-7@- T@i8B$Rk\PU % 0f100h@PU o%T  f100000S$$ Ѝ0$+sx+0`+X%O-CMl@`P \\\ P1Cߍ@ & @⿟0P0 dP@Q q =0P0Y pW    土 0 =RPᓟ PWn0 0 m@cwX%1@-[O-0MM 0p@.v`P2 zPP* P 9=P 0S0 0 :    3PmP}rP 0 Q0 0PtۍЍ|0P 0  0  0  !Vm,00S/ 0P rE@-|++X@-hP P <)AD(T"P@sVmC-@$M S @t00dA%P-   tF0S$ }P 30Sm Y0] )Pf \BPaD' D* TB^ ($ЍP@RA\P@ [A`P'='P'`20S Ap0$A PA2 $ X$P 0)AT 'P P  AP  pXPP0 +Q !X0p 7'WpT+ApT3 {@p 0T3:X#  VAPQ  R@4Q p0Q  R@ 6AP`DVp003/P,00  h0S  R l 410!8@̺++l+T 0@-M M+@(l+(^B+(lB+^(Y@PP BT@PP l0 @@@@@ @@@@'Pލ Ѝ0B(+?kP>-MM+ kP+ V^+ k+0N^ @P  ?ۍЍkP>0@-M es1@@@ #P @  P A0$*!PRU)QW&Ѝ0RL00S 3/P 0$003/0$*@P3&P/\P+X@P'@P# 0P n@  0S 0_ Z'P @P0o,m&)z*00̺++r}V,V,@-M r0@@@2?f#P* (@w  kP 00*!R00$Q 1*@P  M0S 0` 'P%(4*Ѝ̺++O-`M 00[#*0S ` 0B00 SS@@@"np(@ 0 S0 0`0@n 0S :jPP @B 0p00Q %Sg0S iSD %S* dS $$0T !PsS(200P 0 倠ಠ@Z4!@ P %Q0 @0S0 aR7 cR0 3/P Ѝ R R P10 R @ 0QR\P0S  S 00@Q0 @R$R0PPR@ $%$ Tl 00S 0 ! S 0 @S$SS0P @U:U 0 j$%7@- @$PU W! ub-00 Ѝ0llP \ ?!L y ]bqx( (0[x+I*57@-@QPT80800 S    0 Ѝ0@:x+$+7@- @PU ! "bR-00 Ѝ0PP |  bd00S q#L L0[q0 ,3$+t+1w5X%s@-`4Q@}>m[}h chac)h] ch[:hc;}i 0Ao@PxxA:눃P D]Dbb ῇ}ЍpV,T X%O-`-* {MPp(Dd0 "p6@ E 0S  P R S 0S l dP OaTP JaSp@T Pcnl S1Vb0B? 0FW.P  P,@P  G,00tmPdmP; P  @; D;0S @;vP <; 00}3,"0{ߍVz3 ,p0z"!03ˋ1,0ʋ H0,0,L0 L  0P,0 0 pz?"!!03  PM 8p WU $ l}kh2P l l;p0S$P0 vT 0  <SR 1P o`1 X @U,2 @vPU oy Pz?0WC(=0P 0[ 0R0SQ ȫ9`0SG 0Pa|0SP @ v 00TP@@ ,2 @@>|+%ptbtOf@$+x+~`wo*+rR+0@-0,M 000000 00P0 00h0 PPP@P DDX@0Q ,R,Ѝ0@d& %X%$+ -O-iMs?!0?YP 00iߍOЍ/LxB`P81P ,!,0"%`P z[p P@P)PY-*U0P 00GSW030#[0S 00pP@ Pp00@&$+-O-p-(MT@X  ppR`V4  @Q'U` ]PPiP@P :H E0DPU 0'SP0U*S!/ ́P00 %oX/0 0P i0@: 0H: s1P0Z v mLp`PUQ&W z2S022SP0220C2   S`` ݄z000 0 0PD1U  @0 0 PA fsf0 R` ! `U 0 V0C?o20S E`dB`d`gzU @ v 0P| f@j+`z(00CS0000)VP a0P W]0S  :W 0*0eP6 00Zp  @P 0A0 0*D! P:iWz00F ASz 4d_KdtV P_z.f}(ЍO Ѝ/2=XG=ht@V,%|J0@-CMl{PP 0S .QD\@P8 QeCߍ0 PJe 4`+3a+G-p 夐夀PB`A@T:00Z W ,/Z 000 \P EQ 0 .@Q$%A-`Pp p@ l4 pd P@2b+A-P5ho@1ht pd0S DQ0Q.SVP @$ $[W WW4`+Ds3a+@-M4 0PDP  d 0PDP  d p@ ( Ql d P7Un*p@ l`lp d @*PPЍ W W`!i2d+%iPd+2b+8i(dd+WO-p-MQ b_@cllP0S gV:=80$d w-B0$0B. d B d0`Q>d0 (d@400gg0 ,d40P,   TTr>@W R?2, 0/pkp x#|3 R0:P$P o P <@Xݍ<ЍpP<\J.̟ 0  0/P `d< 0 B0 u`````- \ 0tD0D Dq i@>0a Xc c@P  cP;@ 1sS1lSD;"00`&a`P SP@;h@P,rc*0x*0wryhP\8 0\8TY0 yV *0z*0}\8t*0|_\:VT* Q0:$DR@* , Q9ʟP \ʟW ^/H0U>H B0C   APT  8T@Y x[0X649 @p A\)0p HA0jp H0S[, ,)A0$$ @P @0H0 H0A@jp AA`LVp@fv& vj! HrjH p 4P p0 0\6S 0 D88@P ]5( .+( %" [7S  '& l7 P~P7'AA\@P G@P 7X'XP\8<'08\8(GP8 Lb8R 4Y&8P00P8L :b8@ 4"Y&8P0060S\80\8P8 "b8(0S \&8P8 b8 XP000S\80\8P0S\80\8@nN /N B0C   [0S1 pP 2@T ``\xHnHp#p00S X 0S d"<Y$3S3 V\ #C?00N?C0C Y`0  0@F0@`xLP;A?6p@x0P|Ѝ ` 0S0 !X V 0S0H L03/P X0p``P 100,`00S/0 0T100 0<000 m0_pP <@D<)@0S  P 0@  !D00 0S0 !Z Q 0S0H L0 43/4P X0,0 0,0pY PV @-Z P 0P 0Pc PQ\ QTaPQD "P 8040P/(/$//7p@-Q4@P 0@@DPp ,Pp%p@-P@P  X[ M00pp@- %@-z %G-`zMP@PN/b .[0  0S1 0S@zߍX3P# aC-P@l0 1h0$1d0(1`0,1>1S$ FoP j?x%0J?` b0S b0SAT FP r_P @`b̠p( 'p%$  P $0<WY 4 P 3SS X Sb Ob00,?p p؀ܐ0jP 0S0)#0C?o27 #3RR  0R67\ 'Sz?0C'Q0 zpR0ЀG(Sz?0C0(\F 0C Q@ 0@$P }P  P ,04! @F<#Dp}]2P  @000@"0>p@0@N?@@T@0Sz?0 C,04! p@<# !0 J  a aT Ia00I? 00111F01p00 84p1<P( s1S%4p ሠ0!i 0Ad 0_,0! <#@  0,0! <#@t 0pt&27FUa}Di+QNEFX&,$%&&'Q`&@-@M`p 0 @@JpЍ ,PP t 0 @@JpiH<@P 7/P[ꐔ=@-0 0P Ѝ(` @-0 0PЍ` O-aM,MQ0=@POP6 7^ `P- |1^PP- Vl"dT+"KLb+bK`I\P@``V!aV+"~K+byKO-P P&0 Q%3`VK0$P 00S 3/p0$aHbb>0Ep0 S aݍ,Ѝ\QQ0GoG`F]P 0000!N9`P 00S 3/p003/NaV $P 00S 3/p $aV 0P p PP pb.x;9/0  PPpxP".;5/0 #X R1  % J [X0 0stqttP`V b ,PPY  Ht}PQy+"Jb+?"PPi@]P# ;]P 6]P 1]P ,]P ']P UxT J  JP ,ls`(Vm@+b+'XT 4('00C-$0pMP `A@P00 >P C 0 1/PP0@0 @P@00003/Ѝ003/$Qg'O-UMMP|x.`@4PY_.zU_Q_8I(l(?XpWp$[ Z T  7 00 70 0P0@0\⠗z#P40([Z4S =U?h400C2<7\4=1 W =7h400C26\4=1 0 00 0000 00p㠖p  \0440h40s -14s[w0 00 0000 0 0z|pp 0440F40s -1tPw003 E "V5@ UݍЍP =2 (XL=1P⺀N0c ⺀  h \ p$w00?00[000ӧ?&N?/'"T`4`( 4@ TP40S N?/$"X4@pWH4 0}10  A V "V V04 1p$ ,01(.8,40001A B7`$ 1(11)1S04 $q,0(84q,0$1Spy 0 0t ^ pWn, @p#=0$1 0H0$4;B-|2P p>{` {$10 $! ,,0 :0G80C0(1}1S 0}1$1S! >,!  :6$40`040̺+V,% RT %++H+к+,$+_'YPP ,0 0/0@o//BO- M@MPAE0*!Rp0)Q`U0 $0 o  P  Pp ,z*,(0$0 U$(pP l4\,e ܍ЍD4p 9H80Spp0 @0 4p0SW00y , Rv  000;x8,9/Pc0  x08,;*+ %%}%0S x%v% 1JލЍ+)I*$+ )%)@)\),)b)+u*****a(m\Vm((((((((M*-2()*)F*(Z*+#+)+2+9+O-BM@MT\\p P`   @P`T$$  P```PP@BލЍ؃ГCг @3(4@$80 DP@T@@< \  P P  ` H 443 0 88@4 : 2 0 YĒ ( P   똢嬂  8@4 t20 h2@DDAT T2T"TT堶$P D2 <&PI020  ' 20)ATp !0   P' !P%0 Z#P@0SW K0S04@ 0000@;x8 8/P6  %P !%P 0   @$$0 Ip@FW:B p=@ꠔB+(bQ+2n c+u+{+++n m۶+++)+T 4D,@-0`M2 pRЍ!,^04P0 @ PP@4 xp8;7/P  PBi+k+(0 @-@"!P0(@i+@-$@2S 02i+O- PPPBpPP   `PP S@Ft$ର@P`V* ЍD ` P Z P    R0SP pPBND$%b@-@00 zP Q P 0 CЍV C-JMM bpPX 8X@4PTdHP`Y)P8 Yo`GFWI  _UP 0000 !00P < 8<1P <08 <@XNo<0S0 0< 8`PW 40,01 010100 0A000@00 p@@@@z,J@0S7 0S'8JݍЍATP 08 RT<0$!QQ@0P 0 003/@<08 S 0S(0S 0S8j(0S003/@<08 S@+ Y X\ % 0S/p@-@P` !a(0SQ 003/@Qp@ R 0@-@4M`pP0S4Ѝ0 0L03/P 0@ 0pP180/C-`M0MPp PPp@x; 9/PލЍ0 PPA.xP;5/P A> zo, 0@o/b 0  11/o+10/ATp@-@4P0 `"O1111po+O-Pࠟట@p`0* C  !0  PV0+S   +S 0P,SR0B `p@P X 00,0 000`00 Ѝo+T < 0@-MP@*.V1( 00 0d000 0X0@@@@810 00@0 $(Pmߍ0茔 o+O-P4M`@p 0SpqP pPp 0S00W0#S 4Ѝ0L0 3/pPP0 L03/P+ { 0 Q{ 0S  kN0 0P  P 0 0H  , R  T  X $ \ ( ` p, 4@8Td A- +R0 P W%0]PLP 0 a0CS0Sߍp( `V2p0:08V0S`p R S`0a 0 0  p 0U? s [ 0\+ P 0 0p0 0  0S  0  @00t00 00S 0  00P 0 0`![0R@0O bM O 0 R*? 01BV4a0 J,4D d@edAp+:,o+p@-@PuP p@!pC-pPAK L1`90D  #R `)0 S 071DH<LHa@NDP NU `1<P1 NU `1LP1 NUP1 `1NT0T U`1`8 ЍC# (0(0`9`90 0o+Ô,?,Ȕؔ@-M@ iP0:CoЍ@-| 0S pP`0 X00T T0PwL008 80<p, Ѝ Ѝ䞺+,P+L+=.(+)+l+@-Mp@hl900 0X0.0 B00 0 <h $0l !Ѝo+@-H2@,$  E@a,-?@-@P  } R4 (0@(Ѝ0@ Ѝ/,,@-0  0* P L0L D@D @08( @0 Ѝ(+ *+=(+l+-3M MX :P0  4OP Oo3ݍ ЍVmuj-3M M :P3ݍ ЍVm0@-M0  0 0S@Ѝ0h0h h@PX0 PPP00L L0PD@00, ,0P,к+T+ -P+++L+,-.(+)+l+@-0  0 P <0< 0440q000 0$jЍL+.-(+++)+l+( 00S/ /p+( 00 S/ /p+4 00 S$0 10 1/p+o+11<0@ Q !@-0 " !/o+0 10 1/o+@-7M[*.Q( 0lh6 0X 0000080 O(@7ލԔ% o+H 0D *Q/QQ Q/o+Ԕ%@-@0 0 0@QPЍ5-@- @0S00P+I-0@-AMhd@ `P I  P@00 0p9,ⲫ/u@Aߍ0\-o++k-o-P@-@ ^0P  WЍx+-@-  Ѝ Ѝ/-@-0XX0@P D    Ѝ@Ѝ/x---@-0XX0@P D    Ѝ@Ѝ/---x-8@-P P P-. .@-@QLP@ oe3@-@,NP$0  0P0t+L+)+@-@,MP$0  0P0x+(+l+QA-@@1@#PP1P#T|p|` cP (B(Ad##WBTB:: ]A]V,t+@-@P  P8  Ѝ/.X%.0@-EM@DP H s?P0000U (0($p:@Eߍ0+o+v p@-MTMPA gHK01*0$!p o '@<g0 0000 H0 0 P 0PP`HRv0H2I@Up:d J<X (H((JߍpV.o++5d k.l Д%.\-@-@P !0`RpzMP PP x 1P`pZX &01O@0HPF@T 94\ Ѝo+JД%@-@<@-0 0 Ѝ@-0 0 Ѝ0@-@M00 000 00Ѝp@-P<@0*SpQ LPp@Ԕ%@- 0P(+,+O-$M@Ap`P0  P(  0PP0P00P|0 @P P0PySa00ͅ0݅ 000͕0ͅ$Ѝ., +5+.P+*+.aO-`-,MrJ$v@v>[pPe $ >fPe@T10S@ QJPPEUN X1X!XX$0 0  @$0 VSS00R00S 2J 0 C HC$=$ 0   0$ 0VRR  P # 2R @D %J@ QJ `P$ =@,Ѝ. /A-`pPw@P!I ePP 6/ApO-@ M$z=`P0 Ѝp0P0 `+0VSS00T00S$X=-@-0 0Ѝ Ѝ/, -@-0 0Ѝ Ѝ/X A-@PMM``P `G`epd@ F43T0(3T$$c3T &j 0So 0CS+PDS0 ) 0X 0S9 0S r0S 0S QN@;P% h0 EX0 @oH2@P 000C?o2 h7o00`1D(0SލЍ!{h7SJPg1Q! F?@F@}oh!H1PJ0 H 0M( ' 0S 0S| q0Sx 0Su QN@UP 0 0 @P_F? Q. QF4Nj/ik[/?//+/N/к+T+/=/f+Д%gl$,/fr+,+/55-MM P  %P tۍЍ 0-MM P  P _ۍЍ0s@-gP' P`bP >%`]0S ̹ h p x h @IP Ek@TT/ЍpDs.0x0t+R/ @-dt+\0X|T0PxL0HtD0@p<08l40o+I0+Q0+[0+,+fG+I+P@- ! 0 ЍYt+p@-@M L(@H@bL0 #H ,0@,0@0&6Lh@Pp0: S, HDP  D   D܍p,9L 85LA @@@DPPڸaL <UPP?8 1!U8<mDQi`1 08808@TT OoBQ P@10S nt<  R t00 00000 000lpP@ mx(Z(0@tA!L+ɥ(+)+l+{+ e0 / +P+ O-EM08qSP @ ` 0!@M+0S`PW!000 @@3/@P EߍW! 000Z 0SX 0 @T W  00 0  0S h00S \  L0W0 ! ! 000(+*+$+v00T 0+0o+@-Q0@  R < P0 000]Ѝ-S 0Vm0O-PDDUM?44Q (L J$ğ0*S^P3sC00`*V`O# 0SPCUc@ A@ LPtsFP `AX>P;@1 U,1$ PP $ 0RP 9P .^ 0 10S 0S= 0 1S900 000S MP,000pG 0&2G4W 00a !0 0 0R R` 10 1000pXR `0,S RB  0 P a+S  *SPR Uߍ` 1 00000000 .UQ U@P@T xTx y.x+1+Ԕ%o+(1&a1111Vm112'2h2V,V,1(+1.0A-Ph`hp@TURU LP  @P`<%T O-MM@p\@ @P tPP6P  !@ڍЍ tP tP PsPP PZ`P5kb s0D AP0=S@  8 ⸩PHFT [P V@P  wꤠ刐P@ C@P K@`} {wx-T -z22`I*c*0p@-4 P@ I 0Pp@@-G-P`4 H@T$ `V! p0F&04 p0RSP pPp Pp40Su p DPp@V/0 R/0@-SLM`p@`aP 0S0 L03/P (0! "!P 3/P 0S00LЍ0  1/p@- @PHP  p@&@-@ (@A-P@p`p0S 0pp RA05#Ph0020#X00Q #"0hPhp P#"4`V000S 3/0Q #"04P4 A-0 pЍP@`' p᷹ p᮹ ᨹ 0٩`ᠹV{ټ0 t@哹T d 6@PLiP <eP B@7FUa}D,22@-M M@`p; @p  P3pH` H`ۍ ЍA-@P GT`p P  0QP|d zd@@-M M@p; @`sp P0 @aR`nVG`ۍ Ѝ edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPB00/00/4\80S0 S001/\80S 0@- ``@0!SR0(SS QU S!0$0S\  001p@-S@!0a408,08 S0040803/P,000403/,, H0 , 4 T 8 X $Q P 0!SR:p040080SS P Q408S Q0  0040S80S0 S001/S S 8 S S S0/0000, 0R!R@-@ b4  B(B(Rt0! 408 00803/P,000403/,, H0 , 4 T 8 X 0000/0O-p4M@ {PPp`+04ЍO%0 L03/P Ѐ 0P p* @D Z[H * R T Rp A8``pp 0Sz0P 004Ѝ, [ 0+O-P4`ȁȑȡ@ Q 1SQ " 01 r " 0SQVLLSSDSQ R0!S,0S 0 p0p02#000000S SPH P00P0  R R00R0S \ S 00 0S0 0 K`03/P L ( (   0O-P-t(0M000`S@p0( p00 ' 80s$(3 0@(h,@lQ@3p, (0h@` L3`R0000ЍV0V*8q 8 0L03/P 2HR b0 ( 0 0 0080,0<2  ,04 @D@04   @0p` ,04 0x@P23W 4Z0( 0P0,000SPH0 M L00SI0SD000i h0,0 0 90 000(000  i0 -0 00000PY (08O09/_@0 PhQPQ Q*:p `YXT]h ,0a P0S h^ 0$0h0 0  H*:p ` 7 0P+Ⱥ+|3T+3,3C-`FtM0pSP^l @0SL@0S4?0S_?0S?0SG?0SH?0SI?0SJ?0Sx?0S`?0SH|?0S000$ R$000 "0& W40SW4 QQ00Q00Q00S 4 tЍCd ( G?0SWCW@ ` 48P Q< Q44.0 $b4004 01?0 1 tЍ3003 0!?0300 0$3 0?0 0tS(` 0  00 ( (SH P0` 0SH P0` 0SH0\000 SH0`000S$H0d0S  0pP 00 (H"   h0 P z R>0  H0L0  H0L0  H0L0  H0L0  H0L0 p H0L0  Xz H0L0@ @s H0L0= (tЍCj !SH0000 0pG P d 9/0 00(040P+yz{}~L (  ,33p+Ⱥ+3 ( 3 44 444$40484@4E4 C- pQ0EMPE0@ (000S 0CSEߍh0 3/``0d 9/0 00(00 ``50 0pp07/@-M0@0 3/P 0 00000 003/ލ@-`,MHP :@0 0 0PP@00 RS THP pW ?P00P00P0,Ѝ @T@0/W/0  0m:H P00P0$%l0@-$M@D0X u 0P 00 00a0PH0Dd$Ѝ04O-%,M@PV `@\q pXXP`L7p@3,p VV !R "2 V pP vP`!V$Ub$U p 0 0 0000 0 0000% 0MaPP /,Ѝ` 0N4ԕY4 40C-S,MP80S,ЍS S S !S S @P p萟```X 0 000  00000 0 00 0 0M`PB$  O-P(AM@0pP U ! `<#f0!(p<#[UP <NP I900 P DP +0<00P7X@10 p0 `@AB$A  !@pP‑00/C  X!0&-  4!0DP `C<P@!@3@=<T -`@T@D@`0@@< 0 0K-@0 0@`0 P.㨠嬰p 00@` PHzAߍ!00PRPN,p+P+44l5O--0M 04`00 0A000 00```,u0S @8:P !0P40 0H03/0Sp0`P, p p0C@ 0Dp0p00닟`@0SugP 1x'x0p(1XP ! B B2%":$ ,0R B$*?, ? 0 R80pP 0 Rp0x1Gx1p#0q000ЍQ \2 0@0D  V 0$ p0pC 0@D @00ZD 0S , S00000@1<0X ∡0L0 3/ 00X0 0@`,0@Y@p0 00(0 @@@@@ p@@`PVUߍpv' 0! `≐pD 008*0s@-@0<0SH04 `Pz;V09r;?V090V00:! Ѝp@z0S/A-@P0\03/0 "0 0 0!0C?o2PP/ p0 !"P! 0 `pPP !@` B"c#000h0000T0 01P0100A.! B B " H#10Cp kO-OM@P H(>q0!g2W@@Dp,00`Oߍ W,0T00C0 [W0J$0 `Ph4 `ğ[@,ğP @,0T00C0p0NC2WH0 0$ 0R}W$ 0 0H03/{0T00 {{0‐ 9/P#%#t&0 080x 3/0Plp 49X̍ 0 020200 07000 F00(@ o0a VK0W p 14t%pX0 PP00P0003/088q00|X 0L03/l 0 , t T x X h H 0TpX 007/P !` 1Rd 0  0!v!D W p0 B$"D!2 B""1ᴑ0C100C0 8pWpvpW T00 03/`P 0+8 d $ 0D ;+04`Y8 EP0a 0` 0d0 D p 00C!D!2 B"!10C1010` 0S0100C08 !V ,0 80X L0T3/PqA-Pp`a!@P0 p00S p !p e<`P !@ B"s! P<T0 01`0(`10q0000= 0S/ LP0 5/P 8 <0 @ L00P:P04p:  Q:  BZ:Aߍ L`0 6/Pg 8 <0c @`0`4000V 00 V0  R U 00 U 00  RD ,0 , ?7, 0 Q$( 77p@ {$00(0 Pp @0`) 0 $ 70$ `@ 7PpLP\d PP p`@ 0` O-@-AM~Ⱥ+p+4O-p4M0P\0`3/0 @T @@T@   ( P(S ,ß( 0 X0Y0 200120 01T 0 0  00CCR 2"y€0E0 0x20t20p2 0J0@000X0@@@P,({(@4Ѝ<1@1pp0,00姽0Ph @ 0S[00S2[ ZJP P400S/ 3/+嗓)08q P , (0E8(0, PZH D00"0(( 0[P P@ (0,(00T,000(( 0X@ 4+kp   o 5jY4 rT+Vm@-@P07P/NP0S0VmO-pMCxb:TtU`4{ 00 rs ,b0  * 0I P  00@0 B )R RWPQ 0R Q 0TR000US0a0Ѝ0S@0 pp 9PT00U00@0 \%41R7 (R3 !R/ R-R I 0` ` 0R 0R`[YoFT00U00V 5 @P0 /S`Sp`` [YuT00U0,`0,+,σ+F5+T8 T\+ 8Tx++VmG--0MSHp`ЍP =;X0p`0@ R 0GS \ 05@@MS\ 0CS\SS\0X0+R0S 00000S O-@-OM M<00$00$(00 P08 @0 (0PP0D00P ,0 0H03/800<00 0!6 0R 0 , 03/ 0`` S04 `&P40P&XU\40a`00000& 0bp`0:,`pp WX0h05R0p0l`h ' `Vp SWh `U TOh PUIh VU 00D0 TPc><:84P0`080dPS<00O>0=C0H048 <0/4$x.U 0S T0 Pc0 000H0P0 F0_PT0S x6P 0S4 `Q00Q0S 0 L0aA3/P Ȑ0 0&003/f0F0P  !E 0 31( $0Y(00$0 S(0 0R0$(@0D 0@ 00 RD 0S8Xf"a`" 00'X000 ꀒ  ױ 03x 0 dͱ0  03` 0,忱 F03Ȑ 0 嵱0l01h 0 t0hp++"+ " \ [*pV 0 TbU 00l0 Tb0@ TbT0P0%0 Q030#Q0S ,0 A, 2F,ip 0$(&?0 0L 3/PL 0`P!Q.VP S(0 0K$0 Y(00B8p C 01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a+M$0pQ@-4tV #"T R0//@-(@T@Ѝ0 0 0003/@PE'/@-|MPP@" @a1!@p@P  *0@T@pT 0 @p|ЍT0| dp0p pZP T D  ش(+U6Vm^6m6+6g66+66/@-] @6{%///@-0@Q0T˺@o?0 \ 0P000@-4M@0  2P0PU.0U 000 00 0B4Ѝ0蜧+//A-pሀP@`VT0S0S ;/PH0P$1U.0U0 00X0`p@g6+0SR00/p@-@P-<0<`P" 6D0# A0$!pȺ+p+A-`8P@/pP( ) Aꠧ+@-0@-AM 10p S0S XT@P00PU 88 0, Aߍ0]^L+967 71G-`1!MP@11P|!M/  ppqpq{l`PdLt 1$H 0[㺹!ލ ┑@P ^[>, f)@P 0=S, !>A@>y@T@  P p0 X!P L O!<  53x-abc5-7$+B7;7I7T 1s@-P1@-h`11PX M/  L L P D $! 00 eЍp$+3d7n7777p@-M00-0000`0P06@P @T 1X 1T1D 1 SP1 1 Ѝp756$0 @- mP f+C-`CM P@ `t0[P pܐ܀0` 0`0S1 1 Cߍ5S  Jt tP\ ``\0S H <10 1L+7K+6+ 88*8O8l8G5QԸp@-P@1 1  p+17@-@Pf@b0  Ѝ0@s8p@-P@᰸P $~11P . p821p@-@P|1(1 fP1.1 p8@-醸@W8G-M@,p/T+Rr尒@`T5 TH Tol20$0@TPt"tt0PB`pPp0Sh Sb  @/ 0 0`P@MP2 0PP ލP :P !080 0)P !0x1X 0 , *, X00 * ᷿X0101L0d,b,0!0^P P0M?0P0@; !F;   & 0F 0 0 p000  @ᱱ+꼜%ȧ+8+K+L++̺+/89$+X927#93V,V, , + EA-P$p3ma@P-@T ( J"MP( 0 P 0 3 P '@*oЍW``kX < 0ȿx9I*$+9;:K:b99:1:h//B{O-04pn@T Ѝ@T@T( ^& P@ U [Y  [ XY P{ UPE P P$@ @$0"/+O-4MpZ (%t,P@ P @R000f 000V0 0)0 V0 )V1!U@0P@0 0 000 0 U0 00Q0#02S4Ѝ;0 0Z   R% S  P@0     0P @V0V0 J)V1!U@0P@ RM RJ RG  R ࠡ࠳$( , [Q$[3UU [ 0Z0P@V0V0 )V1!U@0P 0@ U00U Q Q 0   +0@-4MP!! 0 P P P@4Ѝ0@/@-@ @Y:p@-P@/@P `@ H%0P P `Ra BQQ pQQ 0@S:p @-H⿹0RH #@-%0@-@P4M0Sh!1P4Ѝ0 P*  P +0R0#@"*S Q 0R+p@-0@ ^T00PUPU' \$ST ^/p 2@Q^U@.P@ @$ $ 0 00C 0p0 i:p@-,@P,0P ;pA-@H`HPpFRT0ԗ@0"T01 PS輗Ч+ 00S@- /Ч+H+C-ẋ(pX,`0@P( 0 XWaV V T0   ѽ ЍАYĐY R  U:0V @ $@T0  尽::,,@-@P 0  w咼@菼:ٗ:0@-@0S~h 0T0"S D0 <00R( T4 0Ч+++G-Pሑ`0SFp@Q 0Q02@1;1':X 4DpB 2 SBpPTPRTP  R T R0S0T0S @0000(Q $( Q 0S T v$ 0@1 00 0R"01+up@-P@mP000p1O-@0pS`P  0PQQQS SK0UȰС0r 0 $R 0 0"60(Q $C(0, 1QX#  E vQ 0#0  R [ R @R L0L Lv R# Ѝ 0W1Q:P Ч+;:p@-PL@0Ss!U @ p(0"E0P054 3050 0(2#pЧ+++40@-@0SYDP0@ЕЧ+0A-`Q@0SG!V P p0 ST  4V(Ѝ0UPP 0P4p0@00 *d 0`p,L p P@ `0"0('p(0,0PЧ+++4mO;|1A-`0pS@P 0 PQQD R<0 *2  0 r!Rv?000 ( 0RU$0X3,000 1Q\RP 0 00  W1Q:P0Ч+K@- @≉00S T $卲@Ѝ7@nX0O-SMM2"a\0@S2"`0S2"bd0S2x"h0S2\"|H T"0SX8 80R\ , I0pQSPPTP_  @⃣@S`P. @  \00`0d  00h X 뜱;S/ʐ!@0;P@_oRݍЍ RQ8 R  %0:S 000a 1 00 0 j0 0C0 ^;0CS||WPpW;:o;;;;;;I*;;#<:<K<0}<<n$%V<n<S<|p@-@XP0S Q0 >q   R@Cp+O--BM MpX\0S@P 0` ;( ` pPv\0 ↯P n@Bލ ЍQ   d 000 0 00u$0!`4X00 v`$00 00; S֭ PbP +RQ 0P \Q S0Rʦ0S R6 S 1 S S"0S000000 000000#P 0S   0 R$ ? ! 0$ S0S 0$ `edA<O-$p6# S0 # P`;+[0#p0 d00`0\ h0|00 X_00 P$`P`l0(08 H⺴000 00 00p; ;@-`X0S0 gX\0@S0 h`0S0| id0St0` jh0S\0D kpP0 U &Q ЍW;:o;;;;{O-TM0(0 0,00$0040 0{P{ @p{00@{s40PX^ TЍ@`DP S S !H0401R < 80#80< 1#4 0@\D0 0L R0HL0( H0LR, @ D`(`,^  ( (0 p S `S(0q0S( (  pQ ʔ10Q02p1;1':X t庯$0ž0\CPWPSWP 0S0W0S0G?o2\0S p2 `$(0 (0(Q $$[  0S G vy00p1 0$ 0 0 0S  0"ıR0S 0$ MB"01+uO-M00D@TЍpܠܰP`@D0SW0@    0 0 `1/Y  S      Q R  0@000Q0 0`p1/P + A-Pp@`0S  R 8p0 S7/P 0403/P 0D03/P0403/A-㙴Pp`@1S 3/P P`VUd0P側T0P0S@000S4000S(0000A趶 ++ 0p@-@4`4P0Sp@覶10S 3/@++0 @\ \ P0000S/000 0#0/0@0/p@-P8@q 0X0S 3/0P  P  01 00080sp `^4Q Q0 0`40$ Rp `083/< 0 2 `P   ‚ 0S0P000j 00//00/00/00/10/Q@-@@L 0A0003/P@g  @ T C-`BGM0pSP;0 *!0S#!0Sڭ !0Shӭ!0SP̭!0S_ŭ!0S徭!0S00$ R"000< R&0pG 8d 9/0 0(0 ` 嘭 |0)( 猭 0SWW W (X TX X Q 00000 0 0 Gߍ0000 0o 00000 0Sl0 0] 0 Q0 h+yz{3lp+Ⱥ+3G-pPM 0S1 =ߍ08 L03/P H0 8 L00S4A 0S 0 0 0000 0P@T 4/H1@ 0  0`  0`hA0 R Z/00 0 Th0:/P h00S0V0S Z Z? V F 3o$? 0!CZ? fh0 010@0`, .h+Ⱥ+<T O-MP塬0@坬0` P8 `(b(0  000 p!@ᔵ000 !ȁPᇵ00p@k 2@p@jt!l@l[  \!0 jfR  8!`0`(H$! 0pW0 R   PЍ 0p!+0i `; ` OT0 0 p@- Y NT R ` @,p+Ⱥ+3 .+<<<٩+=0A-@\0P3/ pW@@P@`ỲP80BW  \W[0 V    ! 0  0 1  |   p  "d , 000SJCT L0L LL嘀H0D@艩+kXh p` oU =8y9=k s@-@,`P嚳01Ѝph+0p@-0M0P,03/ , O, 0@ S:000 00 00 0 Ԩp` ᡥ0A0b0Ѝp0k xU O-P-M@4( PЍ hP 0   "< " `@V0H03/0S`pPI`pB 00, PP x, 0 S!n?2\I0C 00000 0A000d3孨0S 6(00P L0 3/P X0P`Tp`\0p0 S8㣱P[ 80 S (, 0( S001w40P ≡0L0 3/0 0P0 000000 060 00 0]p`@&ᠦ0S @, 0H03/p,T@8@0 0S001Ѝ%+Ⱥ+U S @-@80q0  003/P3 04ЍP2 0@-@0GM00@3/PP$0SP  `p0 000 `0p0S 00@03/PPPGߍ/A-xM@`D 4 P0l00$pp0Ph4@P3 tP 0h$0\ \+T „P 0X*08 L03/> 010100 060 00 0埥pP3& 0eߥ(p0S 0h 0Q*08 @,04/P,qP 0p00 0S001xЍ%d %U S 0O-@-lM0$3/0H03/20PqTW0pZyP`U0 ``ApP 0(3/P\ Lx"##$ 0H00 40R! H 3/080 L3/p@ 08 L03/PP9 0 R6  #1//L"P#0X 80T3/L0 083/p 0倰$0Y 0㙮.8($  pP `;/P PlЍ+5O-P0MS J?0SZU 0S\5\%\\=|`VM L%@T dO4u45@d  0$50 505 0F000000q0@@埤p`3)0Ĥ8 @p!,0`$0`4!0 (`40 0,0000 000 _0$100$10\\0d00h0@ 0l0`p00S<p0  ePÁx ,p3 000000 000 0  0<0p&p`  3d,0il0S= S@: SN@`$P H3/P 0p0072|0 00p L03/P '0 00S 00CS@` 0ST 8Ѧ@P$2Q nZЍ @P00SZ 3/@@OoBS h0&00V 10@!R|!@!x|pPpt|t0S|0X*@F@P TQ 0!@x 0T:x0S@ ͣt@OoBU@|0xT: @+x=R9=̺+h+X [ R,088U HU +XU o ,U $+=>O-Sh- 0:\4UM@08 p D 夬P ៬`PЭ Uߍᓬ0P P ,0Uᾭ,30 00S 0RD 80S:(1SK 1400J ,HLAP4#0A4  H@4#; $別< 儥< @0PǖPE11@T 2"B ,04 P0S 3/P|20 SU0%0c@D0ps `2RR1Y N JH@pZE(HD! @<#?PpT@3P p q@ n0k00@ @040ݪ @ީ _   0 ө T0 ʩI40P1: 1 !  y @0 000000 00000 0Xpp D%D0S, 5#7Q[T Y ܬڬج,֬w ᇢϬf++,j=hU i=c9=G-pJMM/0`@ 0 pp6PP+\P) Y0S% Ut"`0᫭`!` p//0P T 0CT *0C/Q 00Pt@m+q P:i?0  ^P+0: S `VZ>00 ۠PJ>00C0/S@!0]+B S ᭡P+ 6 P*P 0/S`0oo`bS ipf & 0 PV|+ P*+ P*ᨡP@ᦠ@]ᡠJލЍDs=5VmI@-(㥫@-M @֡P(0 : o@P d P {x "88S 00b"!4b4#$("(RSЍ O-p-M P[@P` WȐȠȰP` 0PTЍ R  0P:0*  AFpP壓 P W` 0  巬 匫>==2G-Mx\ `P`P PP<K+fY@P@?  0ኬ@ A7@P +JDJ.0m+J5J.X0^TX WPP~D4 NPPu$+JJ.0>PPe+J J;` 'PPN+㈁刑PJhp0 0J>P 0. P UT ލⳠP@Y+JJⲠPP|pJ.@0+ ثP h lJ>ѫPR ==> >> >=I>v>U>h>)u>>>%=%=*>3>5=>/00/00/00/00/0@-4M@0#|0$P 0wP` uP0T0760 PW P @NT4Ѝ0Ⱥ+-p++O-MAAd2(0!P0B(0 0000m 80sS0`p(00$00 0?00$0 s 0$W h5 0+\%X500L%`%0,0W45 # 500 0`00P0 00倢W D%4`D 0S_ @X%SYeP X:000`@ @`@0S 80< 03/P0p80<P DЍpv'80s D@0 0 0Q:8`0S}0` L0$3/$P & [P Tp|Gork 0$ Wt @3P3 y0 D Q%0C?o2000;00H03/WH0L C   a& 0X` 0z 1!`00;000Q!|  (P R`q02;0H0@20Lp,!<1H0"``OP R0$ 00 00S >P V[0꒘ 401P+ 40S|p , S,0p  08q ^ Q  Q0 0 0 , p0㓒"000;0, 00^00 `00 (0 0 R 0 0!00S {`(0`SppȺ+,J?p+5$%+0VmG-QM|0`Sxpp 00 0 P  "  " ⪩ 0@T0P S"TPu@"&0P@噩@@,0S\|X@T"(0ጩ@"#r4"P@&0⁩ 001 0t!00( XT嵴XP!0(hP@0p00+0@080s 0=0 |0 UT @XЍPU PP@@P ()$!X@0(8 0 h000X@0 400t0S00XTf00P0 00X@0x (@l @8q 3/PȺ+Q?a[?3J?g?X?`?0@-)@M00 p\*3 +ʟ ,ǟ 0 PXר*㽟X [-㶟 F 0Ĩ.㬟0  0廨Ѝ0!0P8q0 S+P ,㑟P Xf|p+xv?Ъ+ A- @"(0M*( l0PQ2X1200500@10<1 081,01000,1800$ P$p 0@`PUp 0S0p\'Pp,P(FAᡜ(F@0Ѝ0`0 PCp0 L03/P 00P 0p0 PUp0ꠄ x  O-4P`pp00W)ZYp !!.pPR 0p  0 @ p0Q 0S  00,0 84 $0T0 0X01@G$, R,R P Q   P8q008TPR40  R RP  P Z0000 Ѝpt2O-M04p@$-P`jPP $0 S{n?2@|x 1 0100 0A00000ܛ@l嫘l%nx0ST(ብPPM p0(P噑!1P~0P(0A x 0`R b ",0x  B    000 8P0h l吾(0, 040x0?o21000Ѝ0~\Yl+܏ o O-pᨁ娑娡,M@0 S0 0000 /00O0S,Ѝ/S  /00P`pU0(`P p㘁!PP PP%0(` 1`v r0 `40T 0 ,0X08`0100+ P 0 0壝 jPᣥ`̺+QvO-p\M@P4 `儰90 SpU  0  Q $0S  0 0$ p;P$9\ЍO*. P0:0pQ ",^T ^ 08  `00000Y(0S`l ` 0 RH03/0p``0[ 80s  P!\00000 SPU0$U00[P 0RP  0  p0P0   RP P 0$U$p0p[PP00[}p P 0PQp0[x?[00S' q !P0!:0p00 0RP 0 1!ƒ \ 0 0PpX0 0S( E 0R 0 0 !0 SP0 0PU pСZ050Z0* Z%Q Qp 0S S0 0 0Q0000 00000000 \Ѝp  0 ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S yP 0 0 0 , R 0S 1 `R <$ P` $ P 0 Q0``T R T  R X `( 0S0( L03/P <00S D0SS000(( vL0( 3/P 80<00S (0, S004 Q00( `sT0\qAQq0[[m8qiP U ^[p8|Sʜ0 :0 F[p㜀 SS 8q 0PUp0pp R 0S  0 >0p @ 01 2 0+++XVm0O-@-M`,p4 00PVY pԡpPT Pp0Z:`PU`J6ERUA 6&o00#h R 0  80s0`F`pHU p 3h0S 00  80spHY pPp  h0 0l0L03/, 00Y:pPp峢p0z0P805ЍOp0H03/,08$ $( 0RPP$P(0<00W]:< R3*,0pp0PP UP`p0$0$ PS(0| (0$ $2", 0 Sn@DS g0S 0 8P`p0V`:40S00004000,0(X~$0( 0c1!$08` 0@<00< R:8`ppLp < p00<<* `8q ,0,( 0L03/0 00 0`VV0$0$ S(0 (0$ $2",P p0a  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0Pr0H03/u8P0@0p0D00[p*p 0<0 `80s^00[ <0 0RU40@ RDp0  0H3/PA $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/00  000 80W 0 a  1!7400000Pm۶?c]?+0 04 Q000Pp`,0 0U=:8ӟ  0$ $ 0S 0 p0p SUpዞ`P p b"P0RTp YT Ye:PpW 00U0#Sw p`Ѝ #"08,0,0 L03/P p开8 Q 08y\ X W 8P@DH P0   8 rp08Hp0!8p 40X 00 0S 0P*` p 80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPx 00 80sh p t Pop@-@P(Mc(0Sם(`,`{000P 0F0 0(PP` l P[P,((P(Ѝp000 ,嚔(0,`(PV, RT +O-phM)1$AS TP T(!0 "PPPЍ00> @ C 0 1/@P0$A Q 0 > 1/P@P 0U:0@!R( CP$ 00S H @3/X|$HLPbU X],0( 1/( ,0P, (0, (0;P0 L03/P 00S 0SPX003/PX70PH03/ 0! P5/P%$%$)@0 Q0TpYI@/Q P, (01/(0, Q 2":jX$Є  0/PP  0 Hp0  @D@儐 0Y80Y> APPm}Lb,0S * 0P p@H H 8LP (08/P `  ` @(08P 4/00@D@H,p\ 0,QQTQ  @DPT QQ0p p@08L0P 3/P `00`00P80P 5/00P  P 0000000 0P 000+̺+,p408 +ă ԃ o Vm?t?m@-} 04M@Pp`#@0S $d0 L03/P 80< 0 ` 80< 8PWV`4Ѝ R00S 0 //O-`XP@ <b"080 0 c# p002    0 S R( 0S% p q' R Q0 2 T 0 p < k+800b"0p00S   4 $0!0R!/S01/Ы+0! /Ы+$1p@-S@ x1SP $003/p@x1P$1 0SO-KMM@040`DpPH(00S >I @t  0o- 0<0%"P{ 娻 K@T8p0 00U 0 00000@00 ,@@@@0ppK܍Ѝ(׍Q(0S*o< !80a&@@ o'O-`MxxM0@0pP,0 0S ( 0R> 9 H 00 0 <0.%"P@~40k`0V,p0 0000000U 0 0000000 00嵐p`ލЍ,~,0S*< !,00C#X0S000C0C0000S0 0,0A$PЫ+ o-@-@ 0  !<$10(10,1P001.@-@ 0 0! 0O-4M`@(0TX\d0hp`P 2"\ @ @,0;/,0P R7P ᪙F2PpC ~ p W 2 u  "0  00 0(0 0 0`hᱚ(04ЍO/Pս4ЍU5p@-@Q-|  P卒 0  P冒40 Pp倒<0h p@Pw80 P<q,0 P(k00 p! @"#@%&p@-PMV`@Y T V 0 H  @ h PB0 UP9 Kލp`.00PS( 0` 40PlP80S80  V 0X0S,!@0 P\0 `0S @`d0Ph0Sڬ @l0Sڄ @tp0SD @PL`ȑt0P3@)@567|95@?@:;*=>?@-PAMV`@ᮑ  V(4  D`qK0 @00S    8`V@勑 0 P僑0 Aߍ(0St  ዚ@d,0SL  ၚ@00S,  w@=)@**+?@-@-0AMP@0Q* < $ < T B q0`N :  0S (0S    ,`VL :Aߍ8 q0`N    0S (0S    ,`VP $0 P 0 P0 Pt0 P0 PHݐ0 P4א 0 = 4T C@60S O-@MV M,Pm 0 0x R#p R0]娥娅qt8`  0@0S D` Pș ` ™PC H    pW00(0S%⏙$B00,0S$ₙ$B0000Sڤ$u$B0+ 0 t0B/すPDdp᭠x 00 0; Q <0 Sy0n0!$M B0#0 0=,0Sy0n0= B0# 00;8Q30#, B0x#0 ᝉ<0Sy0n0 B( J 0 R $#  By 0 R " Bk0x 7#0= 0Sڴ" B[x 00 0=$0St"ޘ BJ0 ᝉ(0S<"Ϙ B;0x 7#0=00S"⿘ B+x 00 0=40S!⮘ B0 ᝉ80Sڈ!⟘ B 0x 7#0;! H!吘 B0000B/㟘pWxX0 0  @8 PQ+< 0 \x S0L@T܍ Ѝ/++wJ@e@@@@@@@@5@ &7@@@@@@@A C-`RGM8 C"U0S1 ` ` 똣0p⇞ 0S    `,pYV "n$ D`P 00" `I2ލ@= 0   0S  "w `PV ( 0  "1 S !  N00S @0S"@ 2ލG<0040!0"0 @0n$ 0DL03/00 Cp p q r0S !0 LD` 0S "V "Rp8`Y a0 x 0QW 8 <0RN  0 – 0 ".@+@墍 0  c R0Ul 0"⩖  .Al?AϸAB=4JAT PA^AwfA<@-x @$+0 @0p0SdF@ ~pA@-@ @000(0,0000>d1@ ~ꐯyAp@-`xAJM0Psd!   0娊1SB  L lJߍpP@0 00 PP@z`(PVU@@ 0 (%0 0(0 00@0a( 6P(6,P#n0`0PP`%o./*1p@-0aPM,0$0Ps@!  ( 0>$1 SP   (1PP$PЍp1  , ,0S$0޷`@VTPP 0 0ⲕ0 000 00P005P05X`@P`@@o<` @`@%oЫ+ *   O-`t  T h D h 0 P 000 PP 0/S  !0ᑔ@@ 0/S  ލp1?o21QUx1N0p,!@<1(0@`1?o21P 1?o2 1 1S 1SIOoVTPP 0 P0 00 00P0ጌ64P24 1S 1Sp`JO 1S 1SP`KO 1S 1S0`N $+*O-4MbPp@ḏX Ȳ 3XZY H  X , p  l bP ׊ X @@04Ѝ<Ppʊ1PeS`# "1S "N !̓ @ b 尊 P0Pp妊1PeS` 㟊|0 1S  1SX!0ᢓ @ b< 1S 1S$1!ᑓ @ b 1S 1S(1 ဓ @ b 1S 1S,1 o @ b 1S 1S01L ^ @ b< Ы+l3Ⱥ+-T *O-0PQWMu01 `%0@ 0Vi40Sq 4000S4l`V$P |X003/$}1S}atd4x 002"+Q:  Q 5 0,$XY/X({0.}1{.{ K#%1 0  &(18!X  X" R b㄁ }b/kZxXXP0}11P }1aS 0S`  1P11UTk p弲<W2f0S20S D 00D0Xb 00020S 2D00H02`L00P00 0000T0D010S D 00D0p` 2R!P0"t!  1X! 0 SL!0C 1ġWߍ 0 `2 0p0 0 0)1S080H$0X80`$P8 0 S5L0X 3/P h$ V `V 00%$1/`+Ы+A++ 8=H+4 +++  t0S _P V 0S0q001 000f 0" $!   8 0X L03/P ht0S 0_Sʚ 0>  0" 00080 LG-0ĠĐ(MpP@0 T㤳(Ѝ 0 ^  ^ 0S0 @o`hP aV@@+C-4M@T2P!`pPP 0TL0 3/P  Q000T0SX0`pS@,YT $0Sb S L L0S004Ѝ0CS@D&4$( ,@L+130S/O-@SMP 0p#00\`P HH @3P (   d  000 [X,pP0S* XZ'0 zPP Tq 0 x0.0I1P/S <(ԋ0(0 00X0SvU `P  ( 0S `P $ 0 SX2vU Z xY $1 0V7! 0l!  0p⋏H1@!Q$,1S  0Q p $ ㌏'pq ハ00!15:% p wP p Q 0, ($! p h$ cP]0 0 8a4Q101S/+,++Vm=,Bh>tBB0S@0@-S@00 0S/0+!O-0زEM 02@PT PP0 2P  |1S# $P| 003/P \2PX @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 َpPP2@0S- $P* 0 x0D 0 H0QЍ10S.  PP(q000C` R  R41$0 000"x8` P08/0 !0 00P`0m V00S.  PP(000AC, \ \ !̓0P^ X^ ,0 S` $0PՌ ">SP+!+C+,+&+1h+DA-0M$^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R(p1@l1@T@0SP.H1D1^0P@@T @ T7 @pW4dpW1V 82# @ R @ RD RV @  @H0p W P^ TXV ,0"0P0 0R,0Ό R8<0+++h+++\0p@-T00P DPPp0AS@  1SAH+++0@-P$4M0@L0 3/P T0  P   R4Ѝ0 ^@ ^T  RR""+p0\ Q0/\P  ^U Q0000@-+O-GM0M40d2@`TL2 00V 0 0000000@@@@ h~0p@c<  & G܍Ѝ$1SpA08 L03/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 t0`@W 47 4U|4 VH0G, <0," B+o Ы+0@-DMP@T P08 @\0 D@  d  0 0DЍ00SЫ+0@-@DMP/ P0, P\0 P  T  0 R X  0S0000000 0DЍ000SЫ+p@-@Q@M`P<Z@P  T0 0SP@Ѝp@茉0@00 D0|U@ЍpЫ+17@-@SW(  0 H  Ѝ0!{P4PqP<<0kP0<0dP0<0^P0<04PVP<0 S, 0<0KP<0 S@  0"l{080#f{0,0$`{000T\md@-@PD x , t 0 p 4 l 08 U,0<    0 0x` 6/Ѝp@IЍp莥]Tz@-@$P04ML0` p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-|M@8 P m0 $V< e <U< ܯ0$#P0 |! ٫|Ѝ0+[80@-S`4M@Pc00 0⧉P 003/00$1U Ut  4ЍS0  000 xp0 7/( (0㜉 ,0 D,p@-00MPQ0@$ 00x` 6/< }`Px1Ox1a1S0C€10Ѝp*Dp@-@<P +P $ bPp0S@}p P OPp0S 4! B! P  :Pp0Sp P R P0 &< !Ppp! PP C 0 1/0P $1$00 HL Q>+80S 0 @-S/2pm DG-`ᔐ唠@PX0r2%S80S00 00 S80S0|1 P S$1S00 0OJp@-8M`8 @ )T P $Qn$00S U  0|1 08ЍpP ?P P Q i P + s P Ы+A-M|8 PU`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 `pXM@080 3/PDG 0!!0#`'  03/P"0#"#0 03/p 0` L03/dp p` 0SXpHO  !0|1 01!R0<0S P L3/00 L03/P @0D t0Rv`p00 L03/P @0D t0R 4 d00`RP  w00p 0Sw`ꈜЫ+2p  DO-RMhbP   @PH<@<  VPpߍP(  e{pp@0S  Nm<08 (00,0 0000400!4 04$0D0(0 P sfVph Nq 0 p H9W <kW 0gW $cW _W  {p {p   zp 8p?pq8SڰPr   00**0@0j  0* *d@edA+CL]i{zd@A-CMMPPp`;8 Np@P  0P;PHyU00 ## CލЍ /O-T 0  1!^ 0࠱ ^0.0  ^࠱X p 0000 @00R00000 ^ 0(00R0#02S<Ѝ\ 00$00 S00)0R $X' S    0 ` 0T0T 0 , 1!^ 0࠱ 00S 0 84p< P ,04 WR,[6^ ^ [! 0 S000T0T 0  1!^ 00࠱ ^ 00^ R pR0؀0@-4MP!! 0 P P P@4Ѝ000P/S 0/D0S D/0- 0S^ 0@0P00@0$^ (( P@  @ \/A-`@@

4P7 #P.0'% D0S(0 D (g0{S  0 ( 0 0{ ~@00#@#000@4(0 0 0{~d@EEE^F~FFCF)F`F^fvFp@-@P} # #0S S z}:00 00$00(00,00p@-MO0`0QЍ S 00W@0Ku F#0$P (0Vp  P0W D @0W  kW0S U0ąA-P@\^ 0  `04pX T u0p04 4`X \^  R  0  `04pX ^S@-Pp`lM8V00 0! (! 0 &PV$8 80R:V t#@RD$ͱx{@PV008P|0 00$00sP 0   080 0 0$ <0S $ 0$ lЍ00000S S   0uFA-`0Pp@ TR:?o2R0S%0   @ T000P0 04 Q\* {PW000 0 0004P 08000 <0S $0R 0$ A 8< Q\00+ \/0p@-@0PS\ UR00p0PU 0P0000 04P 080C 0 0<$ 0 0$ p{G@-@ 0S PO--UM M00 5%H50S5%  P|PP Uލ Ѝ5 %:@0Y|PHjz@P T@x0 $08<0(40PP$xPD 0 ` pX0,DIP 000 0SXPD0(00040(0<00a@08`0S XU D 0   z0U0Q0SpPX X X0S  X X z` z0P,0 X6P(00W80400<0tX*P0 000$0,0S @ XPcXyPP @{ 0S$00)zI` D0pp0<00008``#004S``V Pp0p`00S00PP 0P0 0C50  0! 00$0080 0<0$0500D0V/;`M0PpUH HPLPpP P`0`xL`PH-z:o0S 4 R 000 0#ᷯ0P 0S Mᝯ뼀8 0<$ 0S P 0$ 08000S`H pP`T0S0P 040 Q\8<0 Q\   KP`VGJD+aGjG+|G|c_-=m-P-]|d@-< 0P 0P++-,M0$00 0 00 00 00 00 0 00000000 &{,Ѝ(07@-@ P00a0 0[0 0U00 0 0 0P  S Ѝ0C-M@pP `? ;0 050000 0 0+0sS̀@ {P0㓔$ p0lS|p@ gP0㓄$ p Ѝ@T r@Tp꜠G-pP8M(@ 0S  7 wP8Ѝ70 060050040030020 0100000.00,0  P #00R R 0S T `mPP0c# BXPY0p@-PP@M <@` @ `  5/V@@Ѝp蜠O-M8`@ SFf* "R]  BR^rq/P X" u0p @ 8 @Q%@@ Ѝ+4mO;+80@-@0S_ 0D0  R@++A-P@p0 `   `B 04 8 <00 00S00  SR000O-0@Poo`#0S Zp`B0T ЍZ  R  SR S"0P0S R000Y 0 0 [YA-P$(@p`@0" 0 $ 0( 0,2Q 2R0 002S R02S0(2M 00SM )S"S=  CR9,aPaPa,aa,aXaaaa,a,aa,aaa,aaa,aa,aa`aa,a,a,aB0C0#S S0 SS S S0 S , RЍS  0S0000@P aaaaaa 0 @-?2phHp@-0@P@0Suj00S00ӵ0Ĵ00p+p@-@`PQ Q pP  o0P00E00 s0Q  4@-@00S  APP  00S T <j@Ѝ$@D@$0S[@++S@- 0vЍa (P \P/ ‚!S Q /  (08 Q S 00SP00//p@-@Pp_oRrUp@MrQ`00 QH0H H@-"?Q€+q @  "2/>OHH@- Q1`0d1@@Q`qPp@P0 00{ 0R0 ! P0"<0?020x 200 2ᬙP 02020200>4ЍVGH>p@-@tP0S0SX DR00T0SR$D0 p"@ p++08S^/++p@- @ 0(  P0R0PS 00S:i 5ppC-NMM@<ЀP`u 0 @ @ @``.r@; @媨PPD 'gpee NލЍ/EydG-xM` ✠堐@p"P@J!0@P 0S PU 0 R<\1\!\\=00S 00" !PP0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍZ Z Yd   ZY < q @( qhNgH H4Dw@(A-P`@(P0 p P  ^ R Tl000 L"Ġ "Ƞ", #$ 0 #(#<00 0 << 0+O-`BM Mp@P/0;( @ѧpP@0 Z@*0j0 #;$  j P!14"S; Wdxo@ U01U01Bލ Ѝ 0mP 000 0j RZ0 0J$,G$0 0o 0 RZ 0oS 1 SR 1S  RS1S1S `2?B冏@0Q h0STE 0"0S@0S@@xnP9 Pn 04 8 < QR@ Q  "r" " Q|  2!  "Q RQ" 0埤: 劤 00N LURX@-04MHpL` L1L!LLE<P)n@P* T00 0R0 !?020 20OP000204 p2o@4Ѝ 0S" $0Q00 L03/P P P003/VGH>A-P2uSvw_10000“b\œҁ@FL@$H @A- P@ \T@@ 8ž\ @T8f `Č `Ȍ `̌b` ` p PČpȌ`" " 0`q`1~``Pa n00`T08BGP08}?0@ T\ Qp`82S40 @0 8lŽ~?`?̌p0hx0R @Q2T0S X 22040TP 2SXyHO-P`@p\M(}4000PS2 0\  \^T 0SQQX W@\Ѝfb(0,F 06!!S 0(0,0 P PQTU Q8b0 RW(4 0 P Z P\ T 0ZbV0V0Z 21 SR 00(,`80400Q!`00 $0rq? 00((2@ 2S 01 $  0hPMW30M@2S P  SR q? r?Ⰰsό(0 8 0 R    X 0P@TP@@ 0S$2$"$i02#38( R,00W? vLe< 00 (0$0尰S4 ( 00q?0" 2o0,@4@@P# 80  02 S02@0S qSP 'm@D0S 1H R0!0Sq?r0 8 S 0o s, ( ^\  Rx0 9"0o~ς,ఀpȌ Q 0C0Ʊ#80±W,0HI2pϤT KlHO-40M@`p0PV00PT8T(TT9bPV@8:Ѝ}  P 0 "UࠓࠃR^PR\ "ς~Ⱀ, 4  0S 0Z000[ 00S 0PSVX7 00" 00000 S00 0$0 0$ 0(00S0( 0 0<0 0< @000,0@ 0000, $0S(00 08BV6u? v?( R BT@240r/q?0840s80 0(8  R    T R,08 S000f0D0jD0P7V50Qo_P0"Pyh0S SP kh嵆8 @UU 0 o?0 R S+ RQ  0^/o_ S㴒P!% 0 8,0 S0000IY0X0\04024 0P*h0S PS khfB I $)<1! R02 0C00"@P0 ^(T0^X0\0Ph0S SP rkh20T2S2Z 00,jPR?" 01@22]UV 02w?0"S0 L    L H0H0P LY0H0PSB 0D  *$1!R0 P TP XT\ 0 S 0SX0\04"o0P|h0S A<SP jh巅<PR#38H0 41HP2S 02#38S0Ro_PPUPo/ @T \ `TV R \ Qwτ0 8\ 0$00(0{, R0 V00/NIߤHeI+U KO-dM∐@Y`p 0P 40 PP<Y dЍ003/00S 0( 8"V0 2P0 4  0 P!P "0#"#0 D00 xP 00SY0 0 #1/P0(@#R 0P 0"P25/  # @1/0 , O- Q-aM M:0@ 00/;㢡`PPaލ Ѝ `p H6*P:0@ r,JW 2S 1S<2<"<<6u0   &      0S!?⧻t  0 d T 9 FdPTRUG^L&HRQ  0 1Z!*??  @0Y!)? 0? 4gpP   d?XT D , cbi?X T Pd@2pHUs@-RU0 /6@`d0T `Š P";0H0C`04 oЍpI HIs@-@P04P00 5o0S  `VRUp ]0P 003/8_ohVhЍp@hDk Hp@-@0AMP 003/00; tpP   g`P 4]hi]AލpO-p0\M0SQ `sa8Q0 Pi P0,b 0@>S@0 Pi P0b 0@SP0 0HL R ?   ?/Z[\ P @10`d ἐ 09/0P@\Ѝ*+G-p0@PHL` R0418S ^ @Z R  0\ YX0?Pࠡ࠱000^ 0 G/+>00@-M 410@810!Q`0 P00 0LPU`0 I0PU ! 5/᜸Ѝ0+!1@- I^@ \@- 5 0ig,xKX%@-@@0s\,00p c0Co0%#,-?$M0 0  \$Ѝ-4M0 00 000P4ЍO-p-MM U u] " @l]4 Ѐ0 p0 pW(0 0CSpW"R 0pğ|D0S 0s d0SMߍ0S P $0$d40S` $1ph`#S006 Q鋟0 A'J# A0f{{JOdTd@0Rh3 x3R - B`P  t BRڒPL"B 0@# f0#23h`$ß 0 RSPSB010000 "fh 0 `S$0(00SZP=9 =:k{820\  0 A9 ߦ A { Q0 \RQGA f0 Q +"+Z R+"+ Pd@./+"+ "%+ /+"+ 0"%+C5 `!g41@P0'10 PRldP  !"%+0Am,Šˌ C5W7 g@0S00d g@0 00p ZY@.A#,#,#,#,#,;#,T #,?"#,Q,tJF"P"]"r""|#,@~!"=P0 P A0  A;H0 A k{I{7{zW 0P | >g`|fP<00<@0 )g@ #g@-@W@QRG-PP @ R700Lp`P:X:00X 0fPr@-Pp@`P0S -S :S S 000`  0 P00 ЍU0S00T  |NP$%p@-P`,Zp@  ZP8ZV@@700pp@-P 4`Zp@  YP Z@p@-M@ `[p$ ЍA-`p@T/  d PP*^P. @P0 @ R R0 RR00#R0;R0S Q \Q  "Q0# #Q S 0Ѝ0pC B 0 @-3M M ^p 3ݍ ЍVmp@-P@@ZpPppA-@Pp p` j 0W0 t0WpX U`0\0P P  0H 0heЍU0 0  l ,(d0d8dDs@-`0tM0FP?o2p@ pZ sZpYYZ@tЍYp p2SXZp D0V4 - Zp"Yp0 p@- @ p0 S " 0PUPUp@}d0 S  0 0S rdpd0S   0 0S ddbdL0@- @  X@0@-MP@ 0     Xp||XЍ00 S   000 00P0 PS0  Y p;UdLC-M0Mp@PU `0S@PE8  0P00'ۍЍX700S @ Q@BPE@C000 p 0S 0#S u@UX L_dqdd@-M< @  @X0S\ۍ p@-@$`PeaPp0 @ `P0 002 0pp@-pMj0P` 0/Xp@& Xp!  Xp Xp   Xp  0P <  p(pЍpt W괞L  p@->@P`yppH 0s 40 lp  0f pdXp@-P"R q@ d W01p@@@dq T W02p@px0@-tM0 p@ B WpPW@tЍ0C-QM M700ۍ Ѝ%  Y06` @V 8W@pP`A-`R000Pp@STa@PT  Q*R@00 S   0 0S0 S *aP `bb 0000``0` @ 0@ 舜@-@ @G Mp0@-M0@M0$+p Ѝ ] #Mdp@-P@ `S 0x8 , ?U\( 0 0 008 , @1pp@ dxdp@-`D1P:D11S0p0@Tp 0S  00:00T1p@-S@\1S#l1S.RU9tRUpxbV:tatbp1CaT10CT1T1XSa0X11Ca\10C\1\1`Sa0`11Cal10Cl1l1pSa0p12,P0C2bVabx2,P0Cx27@-@0 PP! P1 0L18@@ @   (   )    ,  Ѝ0@ Ѝ0b@- @VP p v00d @J 1Sj70sa'_P 010 @ 5MT0@1/@-@`'L0S : P 080H0S S@'dd5x!@-RM@ Q|x0 )+ Ѝx1Sd0@-80@@N@ P@- @UP p 004' @ Q 0 @& FM-MM0+ tUp06S , ۍЍ;04@  WMX%ap@- B@WUp  PUp@ P 11P p1@ R  &l'QPEUQ T`00CS`0X .c0( p@X0 X hM%%@-@T 0S h@C-MP`HQ.0$ :0 0 0100 & 00 0sD00-PQ 0a(!"4a#   0 >Q & Pp W  g 080 P040Ѝ 0b"!4b4# 0 0S %/%p0p@-8P`J04  :0 DH0 P@p@P@  @Tp@p@-@QDA$:01`%p4*0  HPTJ4*0 `VT0: I0 ppps@-@7 @1 ` l!1P DQR0$ L Ѝp@%P P 1  p Ѝp@ PU%P P0pPЍp@ 0F@1)#90 -1S U a 040Sp\ @149@1 4T041 Ѝpe MddeX%Ydp@-@d @11P`PUp@0 0S%P4@1p@uEPdp0@-SLM@P 0$M0@(p\ 00 p0 `P  LЍUtP @ t!T  vU`  P10L1#MCeUe@-@MPP` p` 0R  p g0 0 VU  Ѝ@:<Ѝmee0P!LA-@`x0 P  ЍA , 00  ` 0  01PU 0! 0SHP ЍA-ET 0S 80 LP P  ЍeeeA-(M@`k P-H`$pc PD 0Sr PPUn 0 8PU,P c :Ep(ЍA$dW `$X;080SI $0P   A p90S \ U6 A(ЍA U. 0S V ) L0S p`MP |,p RΕP 0S Le; 0S )<I$(ЍA&(ЍeffdeM*fKf5 0@-@ 0PHH0S$ `@n H0p@-S`@P 08PU $00P   @1 08006? $0080S  p, Ax p p@ N@-@M@O-p@찟P`T(  P 0S!W 0 8Ќ# } 0@ X(00U0X0S @HX   ` `f@-M@aDqa0@ 8PP_ p0 P 4 QphhnЍP& P P' P, 8kP5 P!5!.P@1 0 P P` XL!d10B0P1]t tLHmp\ qPʦ#NUdfff|flfuffff…ffff @-@4bQp X00D1 ЍP 0\4NgA-` 0S0 00@p*TAPP8 0S,p`p`\PCNqA-`@  @P00Ѝ 0S  m%0 S   0` 0 8 pPd` @P ^`00P@c\  PP 0S 9$0$0> > >0S **V  0S S`0 S   0001  @  0S LBP0 S   07gNgUNWgmgC-MM0000!@0Qp00%́P+ wPP`pQv07S 0 S W \00d!h1`P1 ލЍP  P" R؀ؐPU [  0 S   0  pP 0 P1p  P  0S 0 PlNggg@-@+pt07S@dm0 S i0VS@NA-`R@M@p PP U S70 0@ЍAsP"R 0S 0 Gr>XU$  *P 0S <0 *. p \. <0$ <%V>P  *@ЍAx@ЍNgh4hO-P@MpP  P 08@ ЍO+P4 `001x@Tx  JOP1L@T@11@1Ѝ$@P000 @ @T X@P`@   ` 0 00V`t`JZX3`#`\3@``\,#,3pd @11@1kQ NQ@ 6Q`4Q`UQpQ xQ nQ 0S0 0 @| 0 uP 0  X S B p 0 0S@h0 0 X S  + p@11@1v 0 DP  0 `` 00b : 0( @10S 0@69P 0S 08  * 0000ST 00S W0P 0S 0000S#0000C0 0'Qh[hahqh%hhhO@->@T( "44p P`0"@"44 0 W AL L0 b"!4b4# 0@> *>@D Ѝ耼x1p@-SMPD<"`%@P/ T0x18"V@5t1;0%000 `hp 0%S {P  @aY@ Q0S T`s WPHl|A|ЍpxA>0S$ V01@T t1S L j@>0S@ ?`t1S  Y0 @\P 0 @  B00.V%p(4#t1S vppppT NpqFq0q 0 R/ 1/#,0@-@T0\@@^0S\P*\@0\PZ 0Sk R0@-M`P@zN (0t`p`FSЍ Rp5 p5 : B\ *R B  0L ʚ;G-P p$P1P!qLu%W@14!<41Z(@`P 1!0S0S0\,0 0 @T0@T"V@P0\400 (P p`P,00@,@0S  0 S0 0@@mqO{qqʚ;q/G-@PЂL1L!LL%p0`81(!4qP000S5 \L0Q H PPL0H0L0 \ 0 S   000S00@0P `pP0P0 UPV `pXmqOI{qqJ@- Ѝ@- 0 ЍP@-0 $q0@00Q 0S0@0 R    R 0700@R  0@00@mq(O{q@-@^~00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@,p0 000"# ЍMb@Bp@-P(`0 5$PUPUR PU PTP,PP@4P`P4\pQ@ mqAO#{qP 0  @- $0TP0/mqXO7{q0P0/P@-$0$ $$#@008< D0mqcOJ{qA-(MP` 10U@0$00 #0@p000 0<0S RKp(Ѝ8010C>S@( ( 03(00@000 0<0S80 ⯷p @mqwOn{qp@-XU@P jLPpV@p0P@ P00(P,000P400T0p@-@Pp0080<0P  P(P0PUHVHPLPp0 S   0|V0 S   0sV0 S ,  0jV0 S 4  0`V@-@@YVC-@PM r`P0SY 00C01@0S D3/H2H"HH#(PU0ST2g0S R,0 S ,  003/40`0P4P!0  P0HS 0 Pp00S `ЍH 00S0`   R 0q   QR("( `  PP U 0S 0 SIr 0S Yo P0S 3/0s0S 0S 3/#,mqO{q@-4 0i$@ .&p t@ЍX%p@-0`AM$MrP 0K0  Vp@ I@AލЍp$F P ڢ!PQP"@ 80 00@$   V8%X%-@-  Ѝ Ѝ/p@-MMP@ 60 `=VV  0(`ۍЍp-@-  Ѝ Ѝ/-@-  ЍЍ/-@-  | ЍЍ/-@-  ЍЍ/-@-  f ЍЍ/-@-  ЍЍ/-@-  P ЍЍ/-@-  ЍЍ/-@-  : ЍЍ/0/8%0/8%p@-AMp ?Ip@ PA>0 dSV @00Aލp$P 0 4Sd8%T 0/8%0@>V8%p@-@PPP; @Go ,VT yV00pp8%X%!V@-@P:.@@oT@-@p Ip H1Sn"@]ToJ@-M@    H0  _Jp1$0Ѝip@-MP@`   /0X FJp 1@ R! (0 p`Ѝpii$00 H0s P/0 #  ///A-XM>PUV0P0XЍU700p@ `Rb0 PU B0>00 0<0  ,> !PP> *$q@-@T>@@-@TQ?@0Q/ R0 /RG-@P(M0'0S  咻P P ዻP:s`P $0!00 0  $0S80 m$00(Ѝ080 g00S # $P`p  P`۶0 P 0iS.S  P`˶4$P 040:S$%O-`-[M @F/P 09`0PpP$E P8p<Sp[ߍ0S00:Y 0S 0S_0PP0 $ P PU0SB 0$P 0PSP0SPP@\1S<@d1Sh1 $P=d1 S S RP@T1SX1 $P-T1$S@COoB@TPQ!P"d$  a0s 0$廿PD1P `1 $̋P@\1SPö@@00STATl p1$疿0P0; @T$ P p$]P00>Q@PD  ` $ c 0[$0E  PZ h0 S 9`001P d0fHp `0 D000S0 35S S  CR0UX P PS y R 02 > 0*v@1 U48#88 S R p )S 0 S U  R P 0?D0{ p 0L0D0}>D0 PN 0000H@@@OXrIrirzr0@-@PDM QP@T 00p@DЍ0U  ˾P @0SA-p@M`PT@Ѝ 0S P 0S0Q   <@P @-z000Q/P1P/$0/0@-MP@    _UP 80 pЍ00 iGi~i @- R@$M`0p0 PR  RU U 1 # Ꮌ0PP  R@T!@T00$Ѝ R @F@-@p !p !p`F8- 8Q  8A Ō8   "  0Q5ã0ã0A-`Pk@P─@Ѝ ˗P\PP0P qP mkpP OO-@Pٻ0"Sp0W"SpGP Y 0@s` Px700 ЍY\ T00W YT X0#0%: T X3#: 0\Sf0`xSmS0SD bS S\ Tn C R(8T0 PT 0 0T 0T 00 0    00 `` 0S& T  80P`0 NRU`0S  8T P00T0` $%P /0 S S /S/P0/S 0 S S/0/@-`R$MpP 0S0U00/᤮@P 0 00 0  20S l$ЍU 87PP0 T/00DU C7rrO-p IjPPx ЍO=d`PXX  ЍOuO@@宺 Y3lO,jPP   pP9 Q0A0 Ѝ YO@ ᒺ`@Ꮊp oN0P! 0 @ 0p00@[    P0S i@PAOrA-@ O`P,p 0e SO$`P,p PP(0e S$ O0(0$0PPO-U  0 pP 0HRP,U H0}H1SzYhPHH0P00U L啺HP0P0  40 00 0 "N40SS  PU 40!00 0 40S =  PU D13r8`&d6P$0 PP``Pp@`@P  RPU\ D1r8`&d6pP$0 hP``^P0@` H0P:0H *P P0P<0{UH# 0S /Ϋ`P /ɫ`P00  V /0P0 P0P0<0T000H0P60JU 40 00 0 _M40HS  P3h7 0 apP $Py 73P@H08SP7SPU ,o`P 0SP P UA 0 9p PH0P580x0 50408$ 00 0 ٯ,004XP uP ,8d x`f PV37008 A ,;⌷84@AK0:9PP880A ;p PPH0U4 0 P 4P 4P*0 06S 06S0P90U1 40 00 0 L40HS PqU H0X U PXdH0P;00]H0P90WU `| PO`,᧪pP pI`PP<0&L AKP0H0Q7;0UtQP% 妸P0Pt1 垸PPtQ 嗸P0Pt1 P` xJ0PPx1P|H0P00UH10P2oPH0P2ePH 0P2[P VPHP gPH0P00H0P200hU3 0 00pP>0S;7P0H0P20H0P60H0P;0H0P80U5 D1r8``&d6`$0 BP0`9PP@PU D1r80``&d6`$0 P`~U =ᥩPxPCl ᡲPH0S P P10P<00+ ኲP   ၲP Pm  tP  nP  hP  bPP`P  0p,p 00 4p 00 pP ,8 05 H481   P  POvr4%~s)sFsTsssss9ssstw3txAtQ:EtItNtVtmtvtttttttttttu uu'u]uyuOuuvu/v@vhvKvv 0vv~Mv@vw2w~~~~~~,%1~u9Bxv2SwOkww ±P  ,p# ypP 00 0 H,8   P   &P< ᛱHP  ᔱP40-00 0/ EJ40Sv P yP$/m`P萄 #PPV00 40 00 0 J40S P  P 0,P/<HD P0H00ZP D6, H! 00D&P0 0,kP/H< P0@00;Pu <6, @! 00<&P0UT H0` WEP`H0P20H0P 000$,PH0P00H0P00H0P 00{H0P 00u(076002P ㉸ *ℸ450S00T01=5 =P5YHPPUU D10@0P@d6`&P 0ShP:U HTHlcPTP,U @1 800P00 00 0 5I00`S46`( "4`#4 4ҳH0P800 P P0 0P0 0P0 0PH0P10H0P10H0P00H0P50H0P50H0P00H,P';,UfH0P90AK&Od0h0UV Z7 2`P?PAK⚿OAK'OAK⡿O/P  400H40S  LPzPP lPq=ȦPPIP PPp`PW>IP`PPph /IP jPPpD P6PIP fPPp P$ IP lPPp PHP` HPi HPlHP!`Y <4  0x 0   X:` ml?o2=y x fW wPHPc HP HP` HP` HP` HP ` HP@` HPh 0HPd DHPe XHPe l p}HPe wHPl qHPg kHPg eHPl~ _HPlx YHPfr  PgW ZP0&, ݍP$@ FPRhPP002HPbp {apP  R3  R0 0,PSP00,0%00 0$0(00XH`  p ѱ@  d3Zh0PP ʎJZ d0PPXZ Z P<ЍU  `P004000 0` G4YpdzPP$ 0  p` 0S:PpPCP  0PH| F0PQ4FP`&|6xvaPPUX HPH6P06H0P"800H0P80H0P7 00H0P70U2 6P0Pp2p2SIPxH0P00rH0P70lU `P 00`@P ۲P ֲPPSPSpVPp ȲP |òPqPpP8H0P402H0P30,H,P 4,%H0P20U  0pHP9PH0P00H0P00PV 0U0FQ h  PU d0@T$(@?(Pww?ww:wHuuO-p@Ѓ8`P P RP PgUD1P ЍO^B$0SX4 ,0840 ЍO' ЍOswA-pCPP6H,3&7,00000 0606VD1@!0`00 0:00304VWO-`S$M0; 0@ QpP  80:0D1H0  0 0Fp0 0000 000P0 U  * 00$Ѝ茯%hhO_,A-PQH1`Sp51Sp:1pS> PD@DTD`fd6S?`Dhfl6S@hDpft6SAp~D|f6SB|xDf6SCrDXpDAmDlD1pPeDcD1pP\DX  zP T0 ST&d6,`0Cd6l6,`0Cl6t6,`0Ct65D6`0C6 6,`0C6O-MDM` 0P@ E 0%0  9p 8 +8 0 X 0 00 +0,0 P#Z1HD1E,BP0`d60,(@ܫP4: ؍DЍD@0p,0@04CYP0/`6hv2@d6,2`dl6t SMhCpv@,t6t SGpC0&h6l6p6t6t"&x"6688@ p458! 00P 00 R @0<   C 0 0 3  @0 R R R P\R p@O@L@@000SS @3@ P4400  C8 ?o2@0@0<@8@,0@p00P j00 R*': LPR0PM Z8 C@pPp@04CP000#Q00Su t 00;$ T$ @0 R R R P\R @@* lp @Ph0pAlq]Pplq @L P 0S 0P  P 0S 0P ݯ@pPy@0 #0S  R  ͯP W@0<   C 0 0 [z0S 0$: 0000$,@CV5XwcOsxbx0Q//Q :///G-p0@0P `P` Y 0 0 R:CS@"3X HGU( HG语A-TpW0 .T`@V0 H0HS @sP X X| |00 S DD0P 0RS OzPVczzp@-P 6@PpV B@-eBi@?{V[czPp@-h0h h[- i_k@P የ >@P Pp{VczP@-,0, ,, Q 0 T{VczWzp@-@P,0, ,, PP pWzVczP,0, ,,@- T0S@i⢧{VczA-PQP0  iU0x ` @T Vp 0S 90S@{V3czS{5p@-@Pp PߧPpT0 p@1@-0@UT 똰@00T0S0 @-z  h{VczA-PQD2D"DDl T0@ pR008@10 2T T'Ǧ@Pp t0 t0 x x0R`5PP P PT T0R88wP `(|0 |0T T0RfPt05 t02 88[`Px x0R p,0S ?p0S 4p0S l)PV S(P`P{Vcz{{{{{{A-`PP e_@T T0Sp&@Qp@- M0  T0S0 PUx0d tPe_`@P D 0  @  Ѝp{Vczh{{{O-4MPp    9@1@0 A@1'P  4Ѝ B ៦똣嘳@T}   ᖦT0 RD1 0800/ P T8p t0SS 90SS⣥PT0eᛥ| `P7 |0T T0R   P  @88UPY0Sx x0Rn iƥT 00 / XX4P  [P T T0R88#P gP$p0VS teo  \\@T000|W!||p@-@PQpd>W|G-PM@` P `bp, 0 b ````b 1 pW0p`W% b뿬 0 0 1@ bT  @PЍ00C>S`"P!@03@000C>S`"P!@03@0NNNN-3@- P lPp @ p@Ѝ0@ Ѝ/R A-@чp@-@Ppp p@DRRA-P`p@@H0s  S  U@ p@@@dW0S  R H R U@ p@d5X}Q/p@-P0U@ST` ʩ00p ỡP@}@T:p/~A-`PM1pSBT  p@Ѝp ᓡPЍA!R @80  @z @p@ bp@V 0 !p@`P p`0S t|0 0 0#40  DPH SP   : 0$W4~9~ Xp~N~e~ @- @0P P"T00Q  6DPp@- 0S 1 `@\0S4 SP U \ @ 00p.S0.Sި0_S-S,  00  ?Rʨ"0T0 00p$%P `00CS`0p S00 P0S X0X /X;;ꨵ%p@-h1@SPSPPE @p B❠0.SSPP \ᩥP LᤥP < }P 0  .nPP ~p@-@P'U^ 0 p90 `90 P90  @904,,)$&#  @       90  90  90 90 x9p@ P NP~u0~~~~~~~$+08AJ 0(ƒ -\ tx Q^ ,\ ,@-QMM@pPX0p0 08QލЍA. !. t l08p`0SPE@Ep 0S:0@D0[hU\n[O--4MtpP $02 cR끋`( (@P74Ѝ0S  x l,P@o 0,pP@$0,PGY ]P,p0[.r7d00 P,p, R oP 8, R, R0S x R $H7:0 OP p7,0S0S ,P! "xB,AQ !!!jq P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-Mp`P@VV:U 0U00E0S00T@D@@V00ЍPW"0$?S 0[ `W R``V?R0U  P70 0  .0PI0 0IV:D Xv0 0 @UR  ES`O-p0 1!@` Y*QP T WP700 Ѝ%PpG@`  <00T W 00  $P     \Eo   ' U/U$ \U0 T WPPT W\%0P00PPpG@`T W pGP`$%XC-RM MPLHp`p= @=p5 7p V=Yp < |7pT=    T0 Ip P1 Ip I/   zRލ Ѝ   #  0I@  p@P0P@T* p0S4 p `@T*T 0 ^7p @ p   ⡠0#$$("( A7pw @  ⎠0\#$$(B(   ⁠0,!c#!$c$" !7pW @@  n 0b"!4b$#  aH    .0I/P4 I/ 6p. 0S @00SP%<6p٤00T 4*~A-p @MTP ɜЍR` R 00L0S 0 -0 0p00#M0 B$ 0V 0  05uO-`-4M`@d00 0ShplP (0S;0  `pp30"4ЍO 0  ,   p0,0 ,0SDX ,P  p 00"0,X44ЍP U0 00!00  M, `0 Mp00h!0xJ p PE, 0 S(0SU $0$00 (000$ 0S *jP @TP@-@P@ `/0p@-` (M00>0@SP  '0x Bnp0 ᜢ0t0 0 y0S00 0 0S0S|0@0|0 0  Xc00Qx0 ?TT0S (Ѝp0 8P 0T0S 0PTb&A-@`儂VPFPPP2Xp`E1P 刂"20 V0  *2PRp@- P`K(p@ F? (P'@p@-Mp@`P!  ( (MX( 8pd(PU@ T;700@ ᖝЍi///@-M @ ⅝/PЍ00 3"p 00000)'pxx,0000X0@ 'p@D 00 0 "'pa^lp@-@Qp &101p@1p@-FM>`V СP00Fߍp@PF/ y9  0ÙP01 0 ` 0C 0*> P  9 ii@-@MP4@ $ⲞP P@ЍaQ@0@ @@@-v0SSL`///ቀa/$00 Hp//M @-@ p000p0@0M00@-,M@P(    VT n'p 0 00S p,Ѝ08i(p@-MP@  `  -  (PD'PЍp:iC-PQSM M 3 #  T0S2"`V2"@p@"ᴠ0B01801T0t0H0 0C@L0@T0H 0H0L00L0@ P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0T@L0 0$L0g120@ 2 T@D@@@0@L0 X:  @L0  XH@L0  @L0  XP ٛUPEPPP@ D$("($p`Sލ Ѝ  ⽛XH@{a/h{{ C-0M`p" 0 0```$`幉p@Ѝ P@ -PP 0 ``奉p@ @@&00 ( P|`Pl1 (hẖV 0@ T*00Y00/ @T@a@-DM`@ pP@  ᘟ   !> U 134  4R2$ @0 |DЍ0Ui@i'0@-QM@ P mPp 202 "j%Ѝ0@-]MMp#P,$p@ P@P -R 00@]ލЍ0S0S Sz SS wR@T Hqps@V@T@S  CRPS @@ @p`P -$0 Bp 80Sr S~ S00,0S  R000@0S  R00@ H ` 0 H5!>50H \0I%pY%0S !01S XXC0S0 0 0 00 00 p/wPq>S Se  f@gPat@PU a jNPK 0H HO@%Tw?0SG H9M P N0l<00S6i@a@- 00 000 0 :Ѝb2S/2S00/@-@@壞V002S00/@-@@唞V0002S  Ef/ bA-@MP`p @@.@M-@P= P#p  $p X0S p #f.@! X p$p x i$p 6/PL ^$p +P Ѝ@ÀqB@̀lBpBfB@0G-0 M@p`0PU  "0S1P   rP弑 0 0S V1!o0 P000ZP0 PPP0PU:000000x  Ѝ@-  # ЍgB0p@-M2S@P`x (+VP@0  `(#곝00ލp@  bB@-P`2$MS0@p0  0*00%T0PЍ 0p`!$Ѝ@-@" -@-@-@pp #p`~B 0`( "4`#/p@-@^P TM00p``0@D^="000œ\p@Tp0,R0@-0 \!Q0 # R 0@0O-QRM@@0@00Ѝ1`Q V00P,p0 Q :@QpSI HB\> \ lP lP U  Z4\[X\T p Q*S0C0 +P 0 0r  0@ S2T0@cSc@-@ 000}P 0S00Ѝ@-@ 000jP 0S ֗Ѝ@-@ 000UP 0S  Ѝ@-@\0S \0\0@-@`q0 ` 0`00@-8@T@[0p@-80P@$ >Q! &T⃗01 RpR 0S TT0Q  >0S (p@ ;080nTA-p`KP*P@00<000S@ (0? I@0K0cScO-0GMⴀĐ@pmp0 00KC*`PPS d0S  GRW ( Q  R `)Qh 0 0000200> 0BS0*  WW00 RS00T+ $0K0`C80$`P0 DQW Wd\ h P FZ <(/$ Ö 8 FQ @p$Q DQW R <0S @FT60 <0 墖 @W 0FS80 0 |啖@WWW 00S 0 84S 0 FS+008$A 8{840@W]0  0FS20 0 h@8 RN  FR3   T 0FS 70 @000", Q2`6,0d&Rj I0Slp0 ?0S<   FP081#<111% 1+ WZ W(,  PW:@QT; 0,S P T(, "   PW: ART ,000D0C00s W00FS9000 C8#< ๕@73S Y 0 FSM007# ক730@(1S 0 F0S=00(  ┕(100@ 0S W02S 0 FS<0 0" {20@W00@1 0 Z00 FR P0@ Q2Sa P 0 FSQ0[02 0 0000[00  W 0  ^0 0FSst00pp95SG 0 FSg^009% 9E@@6S _pp0FSS|00xK |6S @000DKP8:Gߍ0P 0"9 ؔ0F R-0    @  0FR000S0 z)   ɔ0 00p000, cSc257)79RkA-PR1!4@ `᠔0P p@ R1 0R000 N 30 00 P0 0:000 P00;000 P006000P00ЍP 0000t |00 0gp00 0[p0 000ꄁb@-0`0i0 MS$MPp 1 !p Hp@0S i `*i@ 0 P` @QQ0500 0pPQ&P4  ۍ$Ѝʁ%$bp@-`\@T  PP\m0S \0\08  p88 $ 0pwD%b @- 00806PP@ `V@ @T %@P  ᙓ00ЍpO-IMPpBHLPL `PR g%0@P9IߍO(0,0(600 0|400 0 P` `p00,0S2 V30a2@0 0!,0 |T:`0 P :B@PIߍ@:0 P xVT` \`00T:D0 ` e:Pb@!1 DO-P`@pQR帰,P`,2,ES#PU`,@ ,(P (, Q 0S,  ( `,P0cQYRO-a00" `pP@T:p ЍT  X ⢱00U *B"0 p0R0  ┒ @E:0  5)p  8: @ ()p.{4@-RM M00`@PBT Tp@ 00 0!p"  hp ۍ Ѝ DK9 (p UPUu qpT @- 80SQ S   000 PЍ 0S 0# 0O-S-,M@ h@@ p00_0 P? 0o0 00 0z`P3;0T0 @0P000 0g`P 0   X^pP  $ɑX U$8R `P@00 y0>`P3 00S0@ 0M Y@000⣱   Q*5"00"P 000S0 0 ↑0 i `  $|$0 `S  S S0t0 0s  $8 eP@ 0S0h0 0h0  030,Ѝ00 !0`PR @ MYL / $+$0`S P@$0S  S StPP4 1S 2S0 0h0?p  $8 P@0a,eO-MP`0@0400`p 0 ##p#X; X8l0S,0S0㌒,0嚘 2S08`,0嚘 8d6S0t,0嚘 x"R0,80,0H00`2 S,0d6S G8h 0pߍ00 0 $p $  0p 00 0 (p $08 0xp $8 0lp$(8p 0_p#0z0D,04l0u040 Mpl#0k@0"04,0c40 ;p]]dk,0 !P !,d ,hS  R,  P ,  4! 0  0, }R, R 00&0P ,  B, 0 0 !P ! SP ,0 0L00 0 ,ꉂӂ@Hxp@-PUp@0L0pp@- MP#%p@ 0` 0 0 `p@ Ѝp 0 `p ` 0)`p  Ɠ0U 0;100pG-`@p 0崀SP$H` $000 0 0000 ``0 0 `  $6 q 0t000h4H0@1v XHЍG<0 $6 0004@0S4H000s$80406 S 00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!600 ,m*S:G{k{'{*z8 S zkg{{'{* z~$u600 `H0S0SZ h W 0R<0S 0ST2P2H000s8040 P424 P 28 P 20 804 00@0S0i  000. gp 4Ġh` 0HN0  P0dh0Ѝ0S4141 PD1 @18   00S  0R`V dp`ЍGH0x ЍG?? +I}2OV^y؃6PJx=De cA-P@T R0A A0p8` l0 R 0i0pP 0S <0S $5  y? 50 ` `m" ``i"000 00`800`0 Hp  W"00 0$008 % d0h0ꡄO-Rp@\MP`@P; 800 #3P 0 RT0 00 2p` h@@L p 0  0 0@P|D ""X P 0\ЍL0S0 0@S@0L0L }eI00P 800 "2P 0 Rztgjzzz{T0d0S  $ P $[ <Y- y 20; 1C<18#<410,00000400<00@0,0D00 <$@(@ A8`L@P@T@H0pt wu hތ&h0 0<108#<48#8 10 ```P( `(1" (> *>Q  0*⹸   ЍGl  ЍG80  0S 0 0h ß Q 040 PH000s  i`Pqp 00 P R  \ v0 00$0C40 040800 8ꬂ0S06 PU R ` h L0&0 1P DЍGAp0 G|0 $H1  40Sm 0Sj 0Sk$81  $0  d0S  0R/.0/eO-M000PS㴐 @pT0`S 0 iЍ> R*TP 0S D6S<ƚ Hƚ [  S<0  @!  Q 0 S:500 0yp00 0  0 S 0 0Cs||00S\0 S0L040 !p 0 3 0 0 0@P0 [0S?60@ 600 0:p0 0t  ``P L 0 S\ 0@1i6@P "P0S0 0<S<0P0B!0 0 3 0 0 0P 0S6[[00S40S>L0 0 PP  ucl00 0P0SS0$KSK?3050Y0 [ i0 H4 @SS  00Cs00Cs 0 > $P 0 0 0S  0 h3 @0 R@ $  D 0A 0S:0<0@ 0=0: P0 P3 000 000 0[P00S* uP )  p  @ 0RZ600 0<P0 ^0S * LP ;  p߆@1 000 0 0000H 0 ?\ 0000D!0S 0   0S S0 rS 0 B0Sq0 00 P0Pc0 8[ ;.  h=xՇ ,HeYpƈcI}ӈRA-P@`. 0hA*`0R . 0D0BSpb 0 A$BO-`pw 0䜠1P@T ЍT 0S R T0 S> R* tRP  0 O@qC-,Mp@PP P0 ,ЍCPE foUZ`0@SV 0SS "448#8UL:`aVH0UE: م1#ĠČ Ƞ,Ƞ\9 U6:1 S31C S0 0 $0 0  00,P   ⳅaV Q Q% ! V P-  Lh,Ѝ "448#8 C!B0c@- M`p\@M0P000 p 0S LL . ۍЍ0 S`V \@T$cp@- P@ Pp@80S0p@\0Sp0p@c@-M4M0pP ;@p` @ `0偉0<000C$00(00$0CU,00000`$0@` 4`8p06p ݍ4Ѝcp@-P@ST  (@1S pRq *02p $0202p0S 0Sp 7@-PX0C @P 0S0>8 Q'Q'+  A R "'     0 #0 Ѝ0@}f\z  P<gjzz+S$0@  Ѝ0zDЉЯp@-@P0 0Uph0Spp@xЯO-`@PU Q Pd0S  0 40 d0Q{ ЍP0.Q 0S 0P +  08p|0 ?봐8 R0, 00C0 0080<0  P`00 00 0S $0 pW ! 03 0 0 R0H0@S 00ppW\0H0H   pӃ00e+$ `8 #$`4" S /0 @Rp@-X00pPQ0`PE `@@d @DLd@pP/<0`( "4`3Z1S P///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0S1@-@T P@10S/ R0 " /P10S/ R0 " /PP/h0SdP//0 SRQ RoQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cSc1O-`@ \MT. 0S pW$   } ~PP@0Sh0S d0S4$I }d0 0S BPP\Ѝ|0d 0|00 0 05d0  0 0/090 b~P }p8PP | 0|0} >~PP$0 00 PP 0  0 d8dXW ~PPk 7~|0d 0|0Xx}U 0S qP 8plP   L U`  P < $R R0 0#  Q  }P h % <  dpP> t0<0t0|00w8sdQYx Xi }P } U }P }ĠZ 0$8 0  h % < =  [<}Vc*Ŋp@- P =p`'01S #0S 0S 0S  ;0 @T 0Q0 PSP 0U d0S0h0d0p@c0d\/08 /   0S/ p@-@T PP@0pcG-Pp`P@Ѝ0H @P00 4m@P 00000P00 000( ,0 $0  00 0(0  rp{0S t00@ |6P  0@R 0 0000@@ d.{`JX,Ks@-@T`Ѝp`PV08,*:SR h0S LH~$` P (0R ,0R   `P G800000( ,0AP0S 0 h dd0S  $0R 0h0d`Z0SH3]~0S/0S/   O-MPRD08<`@H0!Rʄ00ЍpP P0 U@ UP R R R0 2P!4b@PЍO    p @@0 0'  0 0S SY000000000Cs [@UЍOnd.{0S/C-P@$M T 0p `! s 00 0@0 0 @d@$ЍP/@-@TP@<0S   05p@-@PPP ,pdP 00p0000S0p@00:S 0S @\S000@:S @ $,$%P/:P@-^@S :RS:SP:P@A0 ^S:RS0@S0/H% @-@A0S :^|^  ^ R S \0L:\\ |\ O-`-CMMd4!SP  I SLEpWH `0P0B@ @Pz 00p@@:; 0400S 00,0:= ypP 0 R0 :R00Hd4 0000pPP u0S  OCލЍ P ; 000P;PV%00 0{0PpP@0S!+ 0P R $0$0SG @@P `P000 P00 SWB @DpW:SZ @\Sp S Spp0 0T:C @D P 0SS sPp0@ 00`Z@ S 0#SS `P@?0U u:00h00>P0 0Q :Q0, C B  RpG:R:   H J B[$0 0 PC P[ @D$0 pG HP  0S 0 @p P D$0P P 00S /P )P #P P P P$z :mPuPЍx+,X0@-0S H@ ;000D@SP0DЍ8Px+,+,@-@`0P0`Sp 08P P ЍPx+,@-@P08Dx+,p@-P@PPp:Ppx+,A-P @`pP 0 0084SPUP@Ѝx+,@- 0 00B;P Ѝ+,A-P @`pP 0 0084SPUP@Ѝx+,@- 0 00B;P Ѝ+,@    /A-0@@`P@0 (p00D0& SQ;1O-@P DszpDpG``b0Y:0z  Z # 0@@ DYz 0DA\0:Z: [=0 S: p` Ѝ `p/,A-@`Ppx x x xA 0p@-Q@T 0 d `on2 0$pAT d Pon $ !0p0Rp@-0TM00`p<` @PXp0TЍTT0 0p;}@ G,0@L($0$ 4/00S תL%|/,A-@P 0s P0p`ppGWp0P ```pT  @@P /,p@-?04@tH R|YU{ 00$0S  ğ0 R 0  80>H@`@C3^A40LC32 h  02l 3 p  ! dC2 ttt 00C0'0DS 0 000PxPP| ,0 & 9 % 4 @ P B, * R' \  B\ !\  $   R B @ @P R B @ @P '  (  )  *  0  0Z%0 T0T 4/͟ r 00'0S 0, ( @Ѝp/,L%,O-$MPa0K 00[0S4s )P@P 3@ 3 4/᚟@I @k@YEPT[0T@6 0``Y1000#03,*[ PePB RP: 0@6s@P  K@p 0% D2 1 0X0E30 1%Q _*0S \T\1)P@ PY 1@1 ꇁp K@D;X202 K 0 PEP @1 @05300P[0[PKPPeA`P @P<00<` KE K  E@  @u%Q  p0P@H0'0S 0L 0@$Ѝ*0S  /,L%,.g,0,@-M@p0aPD(0SWTP )@T: 0@(0 4/ᷞ0#880 mP0U @P  p'0S 0 ( @Ѝu@P %Q|0S0S Pp 00/,L%,O-PQL$Mp(0SP P^ o@'0S  p P@i$ЍW >0U`Ph0U*P* 0`0?o 0c  `o `S @P U 1d*k88 U$P030#P0S d 200301S%U#2Q FZ*0U00S  Ep@P 00P@P0 0#  0|0S0S ; p,ll0<0 0 p@  Z@P! 0  L%U#2Q JZ*0U00S  EoT LP )@T @0@<0< 4/ᬝ@Po 006/,L%,0,,ɜ@-@H0'0S 0 00 0T Ѝ@Ѝ/,g////\%/\%00/$%00/$%00 /$%00/$%00/$%00/$%00/$%00 /$%00 /$%00@/$%00/$%00 /$%Q P00Q////////0P/ R//A-`pP@0 P @U*0Q R* /0/ᴺ%i0 0CS0 S P0 /p@-P0`@&lPp@ Tp0A S00//0P/!R/P/P/0000Q/  /$%P/000 /$%P/ 0S S//@-!@!j00/ %00/%7@-@PD@P 80R,PPn; 0  Ѝ0, 4X%PQ 0S///ᔣ% 03P/,cl0 AC\ 0AB0\ CSo \S / //00S00/p %:00S00/o 4%O///@-@H1DqP An( G @^X%]`h-@-  Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-  ЍЍ/ //////P/ @-P 0A m00ЍQ@P m@0p@-P@ `0S  \*. Q  R R  ,  p 0 B##$%@0,qA-P @p`>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00~l Ѝ0S/1>3 !/0S 000/@0,0S/A-p0 @RP:``S * =DP` A0 PQ0S/0 0C@-@0 0  (  ( 0 S/! ^R/0 @-@0 0  $  $ A-@0SP`(0aL T  $ T $ Q 01@pC !Q0`0A-ŝMp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SQ u P0( R, R)\\&|\#00 |R 0S |0 3/000Q R R0SR|\0 Q QQ Rt0S 0S   B 0  BЍ 0S 0 c >0000  B 0B B00 "0 00 0T@0,A-@`P0S<0R"0!31<0S0 0PPR0S! !x000S!!!,p (B0P A, (0 ,P괺% %%A-`0 R*S\ ]\ tpPB@T Um cPfPp괣% @-R@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00@0,< 08 C800/`Q'Q!//$%A-PRp 0@S` * [BP 0!f PPA-@P`p0 SV1 V00W W0StAAAA C C C C C0C0BB C C C C C CBCP 0 B  0  B  B " A A`0 F  B  B " Az  kpG`P  B0  BZ`FpGP|S`FPvA\p@-P4`@g@P@p Tp$Q 00//$,1p@-@0PS<0Q1,1 R40S"`$0V):8p1PS580 p(00<^ 00^ 0S8opU 0! R R0 0P`괺% %%O-@P 0RM b P&  b P 000Ѝ 0@  &AP ЍO 0P  S @ i 0 00<00S*^Q000800R ]R00-R Ȗf0 S*]Q -QR\V0]Sj- 0 S{:0S00L6000S8`V 00000 60S|p0@W Ƞ@bS ,0Sh40Se$0Sb<0S_(0x[ f 0(` pc0@`F `@ 4iUg 00C0b-Q [QR:Q =Q 0Sp: Q 0R00`S00`00-S]S0`S00`t4 R*000pBW R:0`S00`0 S<*R9 :R6 ]R300@  {d0 ppBuP 0SK<0[$  @P    qP p$0  0$ 峠0S00``0R00`S00`00-S]S0`S00`=  R:0`S00`0 S*R =R ]R 0S0 -RD QA]Q> -Z00  W3 0S. W0`S 00`0S<0W00Z0S Z40 ?P   pxbGx400!0pᲠ40 P0`S 00` (B(  P   P: [i 0]S~! R, V08C8 0  EB#ЍOel%@0,$% 0p@-@0(M! 0 0  |  p 0Q 0`0]00000P0`P(Ѝp (Ѝp@$% %%A-@ `00P\UC S:0S004000 p4\U R[U*U .Uy 0S0 S xeP JU @0p W1@p(` ~0 S *R \R0)S ) \ W 1L  e0 S *R \R )R00J 0S00300B3Ud !0CUU0Gqt0S^  <t  3 0 D #OU &)2U  0  4 000p0^0 0 0 0]0000p0S* *Q2  0  BG  B   B0;  Bu  0S> 0S 001006PX\QV {RS0050SP<* ,R9 Q 7 810000  U0 R     0 S *R\Q}Q00 0RR \P 0}S |0<0S 00,000$EoЍ[Ut`@0,)>{$%A-@0`pp?Q $0A  R STVSSSSTVVSSV^QO [Q \Q PUOO{Q |Q020W:0S00500 @0P U1@P(` "0 S*0)S  ) U 1L  0 S:0S00400P 0)S  0P  $  $ RK*0?S{S*C\Q@{SP H$ "!,Q  R  $  U   R  #  ?S l*S +S 0S* *B?RP {R  Q  3000 Ѝ  0  (  (  0PP 0000^0 0 0 0P]00P w|o0W:0S002000 <Q >Q x3PP jT &UO F^{S0 SPp* ,Rm  1000< U0 R  !   00 S*}Q00g 0RL}QF  ] 0  BY  B   B0M  BD   B0@  B 0  B5  B  B " A 0000S 00000@0,$%0S G-`Mဠ PQPE4`PL@P 6U: ppP PP $ @pxp~d0  pt0^ 6up|0pp P   $ ( , 0P4 8 < @ D t000Q R:0S005000 S=:  ]0A 0;P  H00Xo p0 P>3S, 9S $S S <0RQ00 p< 00u04|04040 .  Sc S<0RxQ< s00 p0QiS S S>SUSQP>3S S/ "S 00 0\ S:_00P  B08B0U0 RB@ Q U B!U  E1U, ^0C \!1L0XRU!U! 0>Q% Q% QS 00 080Se 0S  00@0000 0H  @  0S 5<Ѝ0R 10C/TUU$S@0,M9P9Ee,1p@-@0PS<0Q1,1 R40S"`$0V):8p1PS580 p(00<^ 00^ 0S8opU 0! R R0 0_P`괺% %%0p@-P0@SQʡ@QD8@ p<0S P pP0@H0DH@P(00Ppp@괺% %%O-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T 2P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#  )P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R'$%O-PQ ,@`p+ V >\# (\ \[ \G \S `P \[ \Y P @\` \ \L \06\ \ \; "\^ \K \ 0M \ &\y.\) *\ \08#8S00 \ yN ^0s00 0@0s08#8Sy[Y00>@4N5>5. `F`FPV0@0>N>0> ^0C|0>@01>3 St 0O-4M\00(0000 001@X( 0 : 0R00 0 Sd 0 S0^ PZ \00$0000 S0000``P00S  U E0F V pR p#08C800_U0S\ v D#00000_V0Spu\ 308C80000_U0SN wpK vI 0_V0S\p?Pu0 0p$ V 00 upv00w(0ppu0 v0X 0 p,X,w u08#8S0 p,,d1u v? 0008C80000_U0_V^00 0,^,000_V0;0  R" ( ZP $00 0`,@0,Pv00_PU0PSPU R S 0 04Ѝ$%O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0800 0X7  IS~ S F S 0>#0DϠ2@ 0p800 0gX I0  0]P 0 p @0P  0K 0TPPP@ pP@07800 0p.X G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#  $P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R'$%O-4@08pP#8 W Ѝ># R, .R`" Rl RR Rd pP Rs RZ  0N0P BRz R Rb R 8R R M RG "R Rm RP n R &Rz$.R7 *R R ("(R8 R z  ȠLȠ \    r8    r ("(Rz  SZ > E    R P RpG pGPp   >  e  ># !>c V  >  !># RHO--,M , l0*4 0*0 (0* @ )[   0 h  R0   V0 Rc  R ] PZ   R    ``R   0"0P 00 0 UE F V pR p (B( _U RQ v     _V Rpu[ \# (B(   _U RM wpJ vH  _V RQp>Pu   p$ V    upv  w( ppu  v X h p]X0w u ("(Rh pK0!u vS  (B(   _U _VP  h *0  0_Vh P R  R5   0$ 0"0PZ& 0$  U0 S 0 Uh `P0: 0v  _PU PRPU0S 000S00,Ѝ$%O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0v800 0mX7  IS~ S F S 0>#0DϠ2@ 0P800 0GX I0  0=P 0 p @0P  0+ 0TPPP@ pP@0800 0pX G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--,M , l0*4 0*0 (0* @  Y   0 h  R0   T0 Rc  R ] PZ   R    ``R   0 0P 00 0 UE F V pR p (B( _U RQ v     _V Rpu[ \# (B(   _U RM wpJ vH  _V RQp>Pu   p$ V    upv  w( ppu  v X h p=X0w u ("(Rh p+0!u vS  (B(   _U _VP  h  0  0_Vh P R  R5   0$  0PZ& 0$  S0 S 0 Sh `P0: 0v  _PU PRPU0S 000S00,Ѝ$%O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0v800 0mX7  IS~ S F S 0>#0DϠ2@ 0P800 0GX I0  0=P 0 p @0P  0+ 0TPPP@ pP@0800 0pX G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#  P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R'$%O--lM $PQ0Z @$QU ``R     Q 0R S h  Z5,Q 4 Rz 800Sv Pm 00D0 ,pp3P 0S 8 D0I0C0? 00S,0 "@0 S40%0 (1(01 SP HP 00000D0 ,H0SPH`Sh  Z,Q~ 4 Ry 80 0Su SHP@@@@ P$P(P,PPP PPP9"`!@p03 @0 .p@& 0 ?p@ ?p@  p@`N  0P?NPN 0PNPdЍN00|ŸO-1MM   @`D00H "( p C.$ PpW @D;8 (@0Sq ءرp pQ00P$ %0!pt0p@ !0U : 0S7P 0S R/N@001ݍЍ'N0S PEPU R Pp 08D<4! @ P0 00 R 0&$0h,R X@1ݍЍhL1ݍЍHFtHxtgt0@-M0P  Lp@ 0p@ P 0 0mЍ0h l Ѝ0A-@@`v/ PP0P  0pp pp`I00pM`>Vp M``pp20`0pM 00 zp@-@PCM2 /k<P4 4p@$ ` PkM00 u5 :{C>P F0 @4EP@ F{@0S@ VS 00 SCލp@@0S[@l0l 0P@0 U P@1:5M?0@0@.M0@0@yp@-MQMP4@SY TD /<PA QP0s* #JP-QaP` 00pP @ 0@DqpG H Dp@ ۍЍp(0si/p10p" +D@0 P@0  P@1:L?0@0p04@L0#S0p@ L00L@PLPpx|$xDxh%@Tw@-qP`O-$(Y,PSp@`3U-00ï  0k=X0 0 0c= 0R0*00V&(0 `#{`0q0 "4x " 0xkP@r`Up@-@M@ P, 0`0#L` QC/P FaS 0L@U/1 0S2 0 "#@Ѝpꫪ*O-@4460 `$M00@=+@ I\b-0@?o2S00/ 0P 00d 0u QS 0 0000S 0 PW!#ό000 0NY [ȏJ0-0@\?o2  y 4YP$Ѝ0 0s 0 P$Ѝ0@Pb (P bP (P0 )P0CS 00}P Pp\ 0 41000.P0S0 0S #  00000S 3R2 x 0S' lRe d#S[ FPU PL @s@p9CP Q X PHP  Q000S rp!~Q .HP  jt$HP4 ``cQ HP0.S000S00F R ࡟  Q GP  /-F@ 0sS9 ||sGP Q 0S 0`0 4a4`nGP) Q .S0 0SQ0 GP` QA GPv Qs0 0  tT  @ama.m.pmp.m.++**@ )\)WA-@PU 0U0PUP!A`FFqP ``zP 0!Eq1pP 02P''O--MDDp  (0,4(00p 00: H0T ㋟L0X 300@0 SE  !o0CVX f‚!   3Sf,"!]ZY ~"!{81*#bYI@21&%#tQ <200,1SD(" 0=S 00S1X"R 8 [9T  1@01S  OX< A {{P XPL0QEaC 0 ?L`XP0L0000X0"t T 04!0SSQL HX a PA&*021,1S\ U1X2Q SP0\XL Sp |0L0X P LX1/ @KTIЍ\D4ql'.%""""8 Q !X"RL P0R:p} L t[0 1LX Xp SK@QV,1P  PV  0P0V:pQ L`XP1 L 0 1X  @PVH@(00(0000,00,02XP0,^0# <P0  0=R%0@Dh0$0SXP"ExXP A PPH@[XP H@RS@ XP000 Q0S{8< {XP 000 Q0S{8< { &XP(0$S 000<\  =RHNQL0X \ 0@0DhXP0S <\  NRH LX\ 0C00000S ^  0@D h0$0XP0$0 0XP0 0$0S}XP"x(0XP0(0,00,0x(00(0sXP 000(0mXPP0L dS`0d 0 `0d E0E E0E00#OXPQ0? 0LS0$%3@Dh=X0\ 8#~PF p0v> 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00 000XP#XP(0S   R $ R`d D& R  000d 0B #d 0Bd 0B %&0BXP 0dR  X \    Q&PT8<XP0 SE P\0sE `0d XP E !XP 0 E!XP  \0000 Q00SPT8< XP000 Q0Sv{8< {{XP  0 Q0i*0^b*{ r0s{P T80<_XP 0 !X0S(0SH XP90 Q00=:c 0 A0" R  #Ό " d 0A  \00 40*XP0E0$XP00XP00XP9 0 Q00:($^0<P0$ 0=R%0$h00@DHL0c 0 A0" R  #Ό " d 0A  \0 4XP:0 Q00:P0 0<R$0h00 0XP0  0C0  BQ $0 h00$%XP h$ 0$% 0S 0000000XP00$0S{"xXP}XP0(0y0XP(0u$QhXP0 S P^ " \01"?!x"0X$0XP2p rp t t NXP  0 R< P9#R4 & E%9H R*  \Q%8< &"# &0(0 0dX D D00@$0 h00% 0A0\0@Dh0 00 0 C00 00S ^0  $0h0 0$$% 0%#P " R01"?! r0rd 0 {@d 0 u@$O-P-MpTEk`0 0OE0U0 W 0 2c1  删?0 0@P/ 0v> 0`0?d000P0?T0 0804 ?+0<000000000000 000P :0\0P@ 0TP 2 dP 0 P{0Sxʴ Ruʠ RrʨQo001 0Sd `0?#0S/" ES}> `00d 0D@P0D E   P`d`F0p0t0Q RPx0|000H00`0X00\080` 0  vN@h 0)Q @D P \P40dPl`p@8 SW0 S S0|0\3p0Tl0Vh0 Rd0U`0 R\0 Ry{  RRzP8 @0>C 0C0p0tR@ix0S \DpPt`0(00(, \0 :PJ p'?0! P ό 01l"?! R1 R?U0v Po 0D?87v~@ pG0/ QPpp 04?0hRl Qh D 0  qp`P  0qpD0S [R@Q @T C 00 ߍ0C\ j0qpK "'pR01'?q 0S?P; RTP\0 P0,P0  PpFZP S 00@ C0\ 0z`C0S0000 W\ ZR0``o d`a PT\Y 8<\Q @D\I HL\A0pX\0k ]C0SQ WA37#p3gS:3ß0#cP3: 1PN~0@P  ሠdSdh0 `ZP 6pz0pw'C P\`@(@(,P ? /& Rß%0Q0wt W0!> 0" Q0P"0V#0,l`V10& Q#Ό3à\!=30S ( 9L^: 0( 0qp3 PvB#00B0SK B0\|0W" R60"c01 2c1[ß sR BT00B0S"0B0 R 1&`P 2&>`\3à\&=3tB0 0 0fBT00abBT009PlP)\(\ ףvɻ @-@zT mpTat X00 R 0 R 0Q/  /  $8(  DQ p@-0l` SPPH 0@#  T\  Q p/H  Q j.0 0#  Q/00Ɠ\ 0@-o>tP 0@" \ 0 0 /A-@P `p@P@0% (P PPA-`X@@P pjNP@0& P PP輿A-`X@@DP pH@P@0& P PPPO-P M 3`P8 P npP P @ @ % P P0Sp K Ѝy T p V {<  &0p`0pSȾA-PpQ `@Q P 0@DDB(000S   (L`@- Mp``PP( @  ȹ00S@ @0"S" 0`000S0 6/ Ѝ@0"S1Ds\0`T000S @ Ѝ1Ds$  ((K,,K@-@ @O- MpPW  pp2S^`PL fP@C hPp G ,P P6 0nS# p= n/@P00Q Q P ^  \0 HB" 0A 0@00oSp\000S \Z` Ѝ, ( OM`괴PIpO-@-AM Mp3@` 00|LP:/PP , pLPp0:  d;0P: CP@@0K PP 0) 0p  00P: 0 *PPz)p p 4@P# \\ 0dQ `k`V`~ pP  r{ z( <P @PP 0 PbpR fQ }P  ?00P/U` P 1pB?0SU  7PAލ Ѝ 70H00 PP)p@  *Px? Z000t7t!: 00d?P 000a7P`V?0  ! isR0: !=? ZZ00087|1? Z000-7qPo$?d HZ0007c4,T\Dzd@(@ld0- M 0  }(PЍ- M> 0  i(PЍ- M? 0  U(PЍ8-0M  0>PЍ--o( 0P    0/ 00p@-P6U@p>,0,0? `0  6/p蘻p@-P)U@p>,0,0? `0  6/p8d@-D@P 0003/L@-@P 0003/ꤺ p@-PU?o20S@ 0 00 3/pTA-P`UV00P00S@$0$0p0 7/|p@-PQU?o20S@ 0 00 3/p船Hp@-`P7@Pp>( ( 0 @p@/<p@-P@P p 0 00 3/p-@-M  vhp@(0(003/Ѝ@ Ѝ/ጸ@-bhp@0003/@XO-$Mؤ @00`P >10Sp$Ѝ=<0` (P@6/$Ѝ贷O-$Mؤ @00`P <0Sp$Ѝz=<0` (P@6/$Ѝx!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////Xt`|<, t`L8$0@O-`-0:p0*S0pG0 00PZ0G"` 0 `00USXU Y p<0@0`0 p P(V ` BPE @@R> 3P 4U * 00 0 00*Gk0PPU  <32 7[`; YI Ii XR3"^P<^P `0U 4@ YEX; Q8V ` BPE @R> 3P 4U *00000 00*G0[P % <Y ` `0<S Z>0304p 0R 00<ЍPU 4@ Y,PU `14 `! Y@@ Yh;0:+\;0:'Y , 0<p0A FQ P  0 $0( 0p0)Q!*AQ S P @0S Q0| FQbQ0 30 `2 @10 0[0 X 3 "R Y 0HPE000$@ @S>03P04U *0000 0*G 0^( PPU`<03`2070SE , P=S @ZA 0 `( *Q)P 0 BPE0$@`S>03P04U *0000 0*G0%VP 0PU 14!`Z [PU *`0Z```0fQi 2  , L , `[,4 l:0 @220 , [  X 3 "R0 L Y @HPE   $@R> 3P 4U * 00 0 00*G 0(PPU`< 3`2 7 R FS 000S,0000G0 P PU0`00 ``<0( 0:4P<PQ$$ U 4FSY00@,000S0 P<R00S$00$0 00U 0 4 @ZK  (*0S)P 0 BPE $@R>03P04U *`0000 0*G0;XP `PU 14!Z [PU 4<0(0@Z7  (*0S)P 0 BPE $@R>03P04U *`0000 0*G0XP `>PU 14!Z [PU 4[1 0S.Y 00HPE000$@S>03P04U *0000 0*G 0 (0RP`PU*=00 <0(0PU=0304,0000*G0P40PU`0 X00S3 0X*:Y 00HPE000$@S>03P04U *0000 0*G 0z (0RP`PUZ*#00,0 0PU#0304000,00[) 0S&Y 0HPE000$S>03P04U *0000 0*G 0@ (0RP`PU*=00PU0#0%=03040305,00 ` (<00i,00|,00xT|-M{00{*Ѝp@-MP`@0 0 4/ЍpG-PRM^  `UpP*a@/'P T1< 000pp Ѝ80S 1 00< 0 pp80S ЍĠ 80S 0 < @0< 000@ ppw80Sr8 0 l8 0 ܶ |V({<(@- @MЍO-EM MqX@`+pFG0 K0PP@+T! 0 K@0PT 0 C0FA` " "V0Eލ Ѝ8 0 Eލ Ѝ 8 0 ꨔ@-`@M pP/P+ /=K RP  rR' rR  P   0@ P@Ѝ0rS\ 0 @Ѝ0 Ѝ@t7 0 p@ 0P/S /JP @0 Sp  0 Sp 2@p@-IMM@`PP up 0: S p0 0sp IލЍps7@O00IލЍp@IލЍpf70@0 p@-IMM@`PP Dp 0: S p0 0Bp IލЍpB7@O00IލЍp@IލЍp570@0v- M 0  PЍ80Q 0 080/p@-@PP` ˗ PP u ~'P  p@)PPp-40- M,0   ЍЍ/@--M  Ѝ Ѝ/ -- MIM<P 00  0 ЍЍ/@0-@- M@UMP  Ѝ@Ѝ/O-`,M @RPP00:A!0@00Ppp @P}PX P@ 0 @XP Ma!,ЍP@-0M@ %0Ѝ0 0 @p@-@`PLpp p@808 0@-0M @%0ЍT@p@-MT  H P 00@`Lp  Ѝp@oЍp@0@-4M@PLp k%@ \4Ѝ0\p@-@T0 00M`P Lp R% C0ЍpT@C-PpPEUP,M` 0R@@t0 0:2 0U P@ 0 @T YL ,ЍP@-0M@  %0Ѝ0 0 @p@-@`P5Lpp p@808 0@-0M @$0Ѝ@p@-MT  H P 00@` Lp  Ѝp@|Ѝp,@0@-4M@PKp $@ i4Ѝ0\p@-@T0 00M`P Kp $ P0Ѝp@ Q 80 p8@-80@08 880/880 00<(P 80880$ t/p@-@0@00S 000 X[ t PP `00UA.L00p@(P,:|$$  @O-M@P cD `lH30 0+p@ P P00U pp00C |Y 2ATT00  RG LD@D T]:[ 2 00p0`K 6K0 V0 W8 P2ATT 0`Fs 0RB K  0l 0 Bf0SH  K@0Ѝ V0& 0P J 0 F0pHXB0SG 09 Jv B 0/  B 0(@  0 B!  BJ`FtZ  B 0  BJ 0 v 0 m 0 0S J00 0 0 $@p@-@PJpp p@0RS00 /D0D0p@- P@ kJpp p@@808 0 QR00 /X@p@-`@PKJpT T   p@php@-P X @ 00`/JpTT  p@p@1!0O- M  D`R, H1?0Pd 000PV1!p !q1 W0C@8t0 , @@KD Œ Č Ȍ A`|0@p4  W0S 0 ? ^ \\ Wt ,0 000IC1100Q0, 0è Ѝ0H 0 00{P@404 0@-00 @?P80@0800@-@?P80@080-M0 Ѝ-M0 ЍO-@?iM0Qȡ̑qaP 0 Pz? `K͌U PnP? K͌T Pb ? F͌(Z PU> F͌(Y PH|> C͌ 1S P:0> JB͌8W uP-= ̌V cP = ^B͌`p=@ 0S708T H0P, `P P P P P P(` P< P@ (P PD (PP PH PxP'( tQ780L0x100CS400 00C,0000h000P000a/ ,00P@`U 0e1P U.q010 `00V0q0 `V, 0U @ `dp少Wl` 0 V `Piߍ`0 1 S ,0 0 0 !1S 0D 0| 0>p00Y,0P,0 @$000< 8P!P H, $  B@  0S% 00P00C1 0@S3 00Q !1 p WQ  pW,000 p0S,000P$0U1p 0 W 㟾pP~80Ss004 0R0031800P0X000<0P0$001P0, 0P000B0T0P00000P0X00Y,0 0CR0@,00`0QQT d!@YP p00 0W0 pW0T,00` pp少W䀍 0 [ +P 0080SG  !< !^ v : !' !_ !| !o !* !! !Qf ! R |1 R 0S8 ЍQ <0 0 5Dh0  T Ѝ4\LD0h0  S/O-`D判@ M[p +(p($ W㺺0CS0S(఺3㼺P*30H @08p|尰tl8 `%TPLH(D@P<8x40,($ sß弁q03=ؒ@30`h3:|p R 0S1810S \ぁ ЍQ P2 0 PC'qpz@ <! ^v#x:'# # H# p--`_|opryz{@|h}=T|%+!,!-!.%0%`&i%j%k %l%m<%nq#s%t$%u4%v,%w%x#p#rd"ye"o{|z#`"DXp@-_(@@k( @]#T(PpO-MTT7  D7J]8'0  ,'0ᄢ pP S0SZ  p p P` . pS`HS  `r  aRR$S&0 0 N 0 ; 0: $Q`B`q 0 ;0 +p n 0S,4 0 s 00bR44 $S %5 0`Ѝ p P`1 4` 40 s 00bR`% 4 00$$ !P0S 40s 00lR Ĕ4 S4 40400d0S0S0 S 4$00`g pg 0@` `00 4Q0`Q40NQ  0r0  cR0$00S0I Sz? p? W0@`e p6 0 $ A` 0 s 00bR 40 ;0 }p P p 40 s 00bR44 $RT00 #0 `0Ѝ0 ;0Zp4SL 0@`  $ `004S: 0040 s 00bR $4S4!SY 0@`s  $ `004Sc $2 0 2"00`}`1 $0$ r0  aRCo $100100 ?ca p 02 0s440040 s 00bR44n40 s 00bR400o000 ?c0`0040040 s 00bR44T000S00\00S t0t0! 0?׵ <AQp`( o80p@-P@ 0 P% T TTp O-`T4P8 0$QDM@h v :Q{#R3Z 300S 8 00P @P`@-@!P% H!P PFP0S)[P& mR R@0R0 1BQ;RS S0 CmS  ;S R R0 S0S PS0 C;S  Q0RRRiiO-@0uSpM`d`Z|P DU0ɍ <r("( 00nI|"0R 3S(0$00 0tPK?T0 TLP ٜX R 4$40T 4 |2`3X 0 4S0300S5 p0S2 4S, 4S 0D#Tq匑Tl"2 7PR x3l2Z& L[# `P P }0`ų óV 0H5S4S 4S0?o2ᰳ8p2Y2t2 PV 2t22Wx2 P/ |2x2hЍ0 D $l h $ <% p 0$0(0fW  P 2l2Ym  Pl2<l2Zk  Pl2?;~0l2Y t P1x2Z l Px2?;~0x2T b Px278x2W  W P@1t2Z  O Pt2?;~0t2T  E Pt278t2|200S0X0  r("(bH|"R1S0/ 4S+]L%R(SZH0t28p2d40t28p2Y Lhgg,c0 00ܯ0 0- $   Tt Xh h T  lp0tx"| S꼯,8 80 0P X0 0//O-\ M0`pP@T \2 !0S S0SXT Ѝ 0 C-\㠁r M Q Ѝ |Pl@P QR  PK ,0 R "00 Ѝ 0 ЍPa d Pp P F Ⱀ帐 少帑 QLf̱<0<0 0*±W㽱` _ `A-P@pCP @P `D`@D0 x0"P0VP@0 j 2P p@-`\@PU 0S1 RU0S@ɱ0@Sñp@G-lp@`S0 SV0S"Q0S 0SV1C-M0M`@@JP0 , 0 @S@0@0 J~j  唐0p "†0|" QU  P* b YTۍЍ ࢲP ^8]X X0@- M 0^  @ 0  Ѝ\`0 Q0@-@L00S :T g/ 0 A-`0S :#CRPQ# # p*0:@P ##sC# B0:#!BQ##舨T0T-0 M \ ʌ0  - Ѝ䬧8 80 0P T0 0//Lp@-P|``p@0@ 0SP0P0:3S 8 80 0[0 :L#p,O-``3 0Xs0T*PL3B0 `p (VS p p PO p   r  `R  01Q @R R3 RV@ X d20\2#`lpv  @R `  R i \  lp P ` @q lRQ1  X6N @{? ` 0  S, (q 1lRQ    ?p  q`RBos000 ?c s 0`0`0 0k@  0 XQh VG-@P,S,3P`e 80$ RR a ʌ3S23pSzW " Rp *8' PQh100S 0   0P0Q 00  00 0z#0CW3Q  rP+p gPpTpir` `0 00 :\#3+Co갢$8,0 00$d@@-@Z5p@404 0@- @K5p@ $@ ,0G-P1`AA0Y A p!ԱaW`F p坮W0 p R i i  T * @ T:V:p0D 00 H |0 +pq@V*00C  M 0 00ꨝ@@-@4p@404 0@- @4p@h@404 0@-0M @ 0Ѝ$@X0X00@- P4M@ 4p s |4Ѝ0@0@-4M@P4p a j4Ѝ0@-0M@U ^0Ѝ- M0  ЍP0P 0-M  ,0 0  Ѝԛ@t0t00@- @MP \4p , 0 00 0 0 PЍ0t@0@-M@PC4p , 0 00 0 0 PЍ0-0M 0,0 000  Ѝ000 00:3S Ⱙ/P0O-J3\p00P  M2pa`P 0p PD3nτ`3 p  "  _ͭ `hi bF?Yn 㴲 `00s  bDP` Ѝ,0 #$ 00 0 Ѝؙ|p@-D@D0@Ppp,0 $0h0i pL|p@-@0@P:#R|  l ^- # 0p P`p:p8pp@-@0@P :QthQp- p #P`pY :88pp@-@0@P:#R| Ó \ "R-- ( p #P`p.:p茖8p@-0@DPSP @p (0008 <@%8 ppؕ@L0L 0@-@0:#R#R"#0:ꄕ`0` 0@-@0:#R #R#""|}#0:(0 0@-@ :QQ σ #p .P :踔0 0@-@ :QQ σ #p P :0 0p@-@P :QQ |} Ãp #Ppc :fpp0 0@-@ :QQ σ #p P`: :Q贒p@-@0@P:#R   Pp @8 “%\8 --  p #xP`p:pp8 :8@@-<@<0@00:3S 0 0 $@-8@80@00:3S00Ȑ$0 0@-@ :Q$Q' " ""“ "\`#p̌ƒ“ \`##ƒP` :Q|p@-@0@P :Q&Q)  "" "`#\“ `#l \pƒ  #P`pb :Qp蔏pp@-@0@P :QQp “!h"L phƒ p@ #4 :ꤎpp@-@0@P :QQp “!h"L phƒ p@ #y  :pp@-P@0@` :Q Q# hUh“l ƒƒp  #JP`p :QpPp@-@ MZ qQp* c0 |0 `00004| 0000408003 Ѝ| 0< 403 ЍT T0 0`0` V:`c3P``D, 0 000:P/< 0 0@-00婱 X0X 00:3S 0p @- P`/܊\0\ 00 :3S 0- p @-P`/t$0$ 000:#Ro/$0$ 000:#Rq/ԉ000 0  :#Ro30/᠉(0( 0 :#Rq30/` 0 0 0:/(p@-@P0P`M00 0s ?p 0S|000 SC q R0 :#Ѝp R 40,00 3/Ѝpht@,A-MRBP0@Sw R `P 0Sb 1 P00p !1pN  0Q`31p0S0S  hx100S0S  \030p   03, p .H$ЍP Q  `*P 0 :# 0`x 000 00o 0 0@ 00,ht@, @@@-,@@0S00@-$@@0S00褿@-MT@@ 0S Ѝ< 000 00' 0 0Ѝl @-MX@@ 0SЍ  0 R0 0  0 0@-,MLBL2@PQ :3SX0 b3p `+ 0Sha` 0SR1p0SC x0 00 B)1`00|PS 1 20 0Q 8H 20 0X208 0 | :3,p 0 P`,Ѝ0`00|P   0 R0 0 0 0(00D  8 20 0lL0 tp@-(MP@0 0@ @$@؛R8 0X`@ @$@͛<0`00:3S U 㽛(Ѝp  0 000:3S/BDX0X 00:3S 03p @-Y P`/D0D 0@-0 03, p 8P`謀@0@ 0@-0030p . P`Xp@-@QP0P000 |P t0 1h000*UpxP 00 1(000*CFpt00p@- P *C T |Ppd  10*p@$xPp,  10*Cp@Pt 0 p@-P@0:R P( P PpQ 0 10pht\ L0 r10p Q~t0 000:}0S,01/Q'0QϜ!0CS Q0@-A,PN Q (@0 \0C 0S0U0//Q'0QϜ!0CS Q0@-A,PN Q (@0 \0C 0S0U0//\ , 0 B0/\//0@-PU,NQ (@0 \0C 0S0U000@-PU,NQ (@0 \0C 0S0U00Q>@-\Ӣ5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@@@@ PN U  ^Q/0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@a!80-^\ , 0 B\ 0 ^O-J#d-0RdMbZSUd 3,p0CQB8 ?3 Q:SD0:pP8  0, 0p3S00 Pp #@  p, , å3,  P 00 0 0 JdЍ|B 09dЍOU/O-*,M0`P2U 0! @Tg `p$@ $vT+:0pS`KP  0 ҤPP,Ѝ@`00S S@ S0PV%0S/00 04S,ЍO:0@0S A0Q  B20RP 00C P0V 0 0 0C0d0PS  P@0 C`PO-PQM 43P S-0S*U= 000  0@ 000@Q k`@ p (P @0JS 0DPЍD] P 4A " 2  -ЍP0PsDP0  0 /x D0D 0M R *P ЍЍ/`rH0H 0 M\  ʌP ЍЍ/ r404 0  R *P /qH0H 0 M\  ʌP ЍЍ/pq404 0  R *P /q\0\-0 M 0@\ ʌP 0 Ѝ Ѝp0 0@-0@T J#0R4 |B0pQ $8@-P @Hhp808 0  R *P a/oD D0 00SP:P4@//o000 000S :P /$ 0(0Q, 0!0 8C8S^4 0 ,  @HDHT,0Q0 (00S10 R (Q(,H LT,,R(  4 ,!0 !8 <  , !  D=$ 0pH D00H00|00hp 0H SL01HP0< 8 ,    Q, 8 Y Y  R`R F Q<08 0,00 1 1 01IY0Cڸ P0D0o0 L  RQ0YP@r00PPP 00P P p,0 0S0R0S0 \ ɟ`V0JZ 0Z m p 0  P A VfP0  P 0`p PV  Qv  `T$QKD PE A0 S04 ( R(  4  R( Q4  *#r LQL 0  P0  \, ( (B ,P ,?P 0!!!QY@ڵ00S7 80q  d p$ `V \R JZ @ 04 0@NN Œ Č Ȍ N LL\pɟ`V00=9p80QT 0P TD0D0 R 0 R PP! YR *Y $R   0E0 z0p  0E y D000P $ 7  \D000!R@ 9tr <000V 0A B T$ P=0X *1d"0p/H6$  Z< ` 0PP8, ` TpP!Q@000 @0p4 111QU`s 00S4  <0pD PzpV0A0 0C0 R d1SXdЍꨄ 1PU  V R 0 0 x@$$ R 00S0 ?CQ`FP@` 0?3T 1HX1QEP `?0D000L00@ 0@0 @  X X .}P 0L a^_ 0 R @(080 } <00 $2 0 p`dЍ80 00ST2$ 0D000h0S(00S><0100@ 0Cd (0 [<00< 0080@080 Q00C\0 Qʖ@t$ A,1$ 0, QVp! <,\`@VP  V@P P0@, ,p`Q`2J @ <P,Up@WP  KKK,BBL98t8877 ȳ et WP@ P0 @, A`,\,PT ,qDEq@DPP!@X   `  Y,00,0Q0 0, BCR4 R<0084 00C, 00S<,04 00@0@00,0 0400 00 S @`` P 0, !Yp, 1@  Y@p rP0000 0S0000 00 0S 040C04 R00CQ8( 0 0, `Fv1 @A`j0, \- p(@0<00  x0X *1d"0p<0V @ p30S  `3$  D0 00@Q^ R[ dPX  U R d1S $ 3 = 0PU`@W0Vm0Sj 8Q004CQ{0各V0F0<00DP  lPp <0P0pL V H D|pY uPp:U Up` /`FV EPEElUP!00:  ,0R<00Y,P 0A040 0 0C 0% p 0%: 0:5080,@ 0 G40 0pW00W0S!~0S00Y0Sv 0SzS&0 S 0PU8 aa0 lF@@D ,HrTH lF0E @0PE0PEQ!c00 00C,0W<0p0,p,00 0R0C<0 0,P@,,`S 0E00p 0E  +D000P3@, 484(440 R0,0 000 0 0W@ 0Sq 0 PCD0U0 <000`pP4 pQ S4S Y4SQJ H5S4L  (9$@ }0 TD 00pp0 G00P`  `0D 0 B00 T0P P*0 0pG0 P\oSH 00 0 D000Y$ :@ #0 C0   D000ȔY  @  0 oSP)4PK D00  U pPO p0SL 4S 4S Y00Q0S8 L5S;  ;$ @ 0 D0 00p0 D000Pb  0D 0 B00  L00Q@00 0mD000P  T P $ 8=@ {0   QD000P) =$  g0 X R- U =$ @D0 00SUD 0 0LGP1S U <>$ D@0 05PL5S 0 0R{U >$ @D0 00L0P0PU 0``U @$P @0D00 HU @0P:0|P   ?$ D@00 U00 0D000H%RQ   40$ D@00 HUO!tp@-@P0P`M0 R    80x t000 0 00P80  H000 0 B/ 0C?00  Ѝp 0 00@C-M40\` d0hl8p@`Pp\ P Ѝx80 800 0 pCB`Po_`PЍ @-@P @T1!0G-` 0 DRHpp?spS-, P !Q@QT :!80|0[p@U0 S00? \ R!R0 S   0 00@ 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP @0 @T $`U0 V P`姂Vp`V0P 0@PUpT` @参T @pp  ! !@-@P@xT R/0A-p,SP` @T @bT0`SP RQ A0@ ", "Q//A-Q*`@pP 0D "! "U0 "! "TQ 0A ", "^Q`X@pP@-@@@0S <$0PC$41O-:z-*0pM$P( , pPw t00^b Ss @@lRXaoH\0 04@Y @A@0 @TH Q@@[@T@P i``FF\V0^0  | aR\ x`Q'hQ"  @CP(H ,4QT S I@0S $0PC$vX0C,4Q| @CP ^_ S]ʜ80,40SmʈhH`@0,0] $P,40 P@0(@0S 00 CR ((   pp' 8 7@00p(`Y | `nR`F`V00P0S\  G$0PC$D' 00Q6 $70,'0 4(0P0L0 F @& $P)0S|600S00l0S% 0 S" & ,40Q%0 lP,0S  $0PCP$,60 R(,Ѝ 6 0( $0(0\DEe@` % (00 S7$%P0C (00xP0S $0PC$H%  <0@ 0,@(@Q 4000XV 0Q[Q $ V 0$0C ,0(@  00 0CS[ pP40,H41 , ! 10z d 4`000 P ^$ $@$#@ P(@h0 Rv ,,Uq  P+ #  t# (@$@ ?#R WH( , #\ $6 (@  P 0(@$ R   $@PB lP " 20,,40 SN  T2 0$  4B@0S $0PC$ $ 00P0 ! ı 00(`S7A@ 10(`0 V0!0`Fx P(`0S $0PC$~,@% A@0S $0PC$ j,@0@0/|pX/,/...<,..--,,,p\,+++++* <*) ))l)(((''0'''|&O-PsP3pLC@00 S ߙ4004c`(,P Zh34@2`0T6"0C S402P00S00h0S000S200ʔ 0@DS(00S0 0l0S R H"  4204@,P0T0hPr RP0 @P 0( 0CS P1  P1040 ,( ‶ P,P@ c@1(`0 R&T !P  @T 0 R 0 P'  q 00l P ~@T00,P0 0( 0  04@S\CPE@DSP4@,L04Pk _00SL004Pp,8%%$px$h$t$#d#"t"`""(@- 004 (, !(@- 004 (,p!`1`!0O- T *⤒Y|20d1 00!Q:|20t0`1=Q,00S|20lE0 0!Q:|20h7h0 s0!Q j0!Q  t/|0| 0p@- @00CS0 S 0 S P00ApR|P00p@-0CS@0 S 0 S P00#p4|P0000 0p@-00Pnz@pp@-Pdz@p 0 @-@00J Q T\,Q    @\@0J0P\@-\,AP /0S/p@-     @ BJR@P`,PTa@@@AR  Qp03O-0PQ`$MlC@| 2zpP 0 0C Stlp ,0A100A!R   A BQ(\ !1C K" Rv   IK/ T0?3Y00 Pq 0 ~vPP{ 00Y 00 W0(@p ڼ T D H0W D@ 0 ( 0C P7U$Ѝ00$Ѝ8T0 S80 D 10@V  B@DT [p`$ЍHȏ$Ѝ 00C! [ @ D0| 0p H0001K [ @T @MxT @ @kꌁ 0 0 @p@-@Pppp@@0@0p@- P@ ppp@@O-@dMp,y50$0`Phn Pu0P 0h X0P40Y0000Pp0@STI6+PO`0PZP0p00PEPU=0000PS040& 00 P`0@pES1@-,40T R8  040 x$ h40p0PH0`00000S00U0ExP`FxJP`x0`0C00p0PP 0PS4,00 !R0!!ر,(PQ40 0R!1P10CP E" Ry  KPE X40V00 4 ,P` p 08`p4,0@,@ 0 D<8 PU` 0 p4a00C 0 S_ , 0( 0C0S00PSe 000< 'x$ 100pP ב 00Gp`0Pq P&` p0`000S0C00x 0`FopP SHI! U 0H 0000 1PE UzD0|0p v dЍ#P 0^40T R0P40 p ` `v dЍ` v \P /0 0vt@M,P   00ЍhЍ/@@d0d00@-@ P M p T  Ѝ0@L Ѝ0@hp@-P`0 0M`@  p T  Ѝp@.Ѝp茽@p@-P@ppT  p@pp@-P`@ppT  p@ p0Q /0Q /0p@-0P `@0 0@\1000C1.T 0*\ /\p0R000p00p00 0L 00pO-S-M LPP` 0[ pH 0@TL !  5/  @T9 $T0<SX1 0000#10#.R00S0>0P H  0 v00 0KP8  #8 S R0?i@P5/@T YЍ0H\8  #8 S R@0刀0H@P5/@Tht r Q" @-@M  R ! R "R pP^ 0 0 @VЍ /@-0QM   S S PpP$8R@ @ ,Ѝ갸8- M 0 Ѝ(D0D0 - 0 $M Ѝȷp@- BPP0@\SY ^S9 @% ,S'Sv{cSc\08ŸCA\C110D000000}p000%0>C0{)^A 00NS841@`00A 0 100C\00C0 S\S:S '00pP@0d{%t`QO-M  qDPP 04'p p 00R0pp 솟즟 0@P` p ,R&Ti  \@  @  RY  QS%R +NG\ TRQONMqpJIHGFEDCBA3?>=;9876543210/.-,+*)('&%$#"! ?   R P~spP 00Ѝ %@@ i^ @ `f`00 0 "!.Q *Q0 0 0RS@  RP % p0 @  d^% @ @d   R x@     A6  R< b@     A   RyP  % p0   @@ % c  RYP % p0  @ @%@ + c  A 0     B0  < @0   0 @D@   Tp P0 S\R$ W 0`C0@ T0  $ 0  <  n /0000>  0 0S0\S 0 S0 ldm `m i p@-`@0@PM0S PS   00 0Ph 0 Q00QH  < x0  Ѝp0|A-M0TSP!00@0@P0S? `/0 0Ã!1!1"b2c0A @ 0L0L  00210BqP 0 pW$P@WP 0fSPЍЍ 0 0Ѝ(e NgA-M0TSP!00@0@p0S> `0 1à ‚0  @00A 01! 0120BQ}P 0 pW$P@TP 0nSjPЍЍ0"0Ѝ茪c kL>C-M0S!0 0@0`0S2 Pp0 p1p\1G $@0!b4!b Gr1c1c0@ 00  0#3c`10BqP pЍ 0<0qW X $`0sSP p`VWT 0S mPpPPЍ,b -?L*S0 O-LM l znPL $0$  0c0: 0 P@P:  @P 0S  R `0V G #V =V =`Pj z0000`tpP[  [Vp p  RR oP X,     P mV m0PS[p@0 ᠳ U3 112cAp3L112c0B0L0H3#0210Aq>0P0 `H0 1 $ $@b`Hp, `V @T@plKP=0`@ @0l?VP00LЍ`30 ,rp"22 Â0  @00A 01! 1120BPQ 0`0@7` 0qpl1#`!L04A 1c1c$0L2!b!b A0 0 0!3ca10BP 0tS0cS0Spp pk0@0`0c`@ p 0< pv0Snopd_ h^ Ngݸ8] kL>\ -?L*S8G O-p`@P0\ %\0pS sS lS@ 0\TT1DW +01 CR0@CUPO-(?qMpQ00 P` P? 00S040H $  l0H [ 0  R U0 GP@T `%%T 400 R,B*Ph  4 @@pTP, 40,qߍ@P%T =,0,p:T TI 0DSECB@?>=<;:98543210/.-,+pmP" 400p,1S* 0C11ऀ R 3@4 00Q,*P 0 op 40P4qߍ00f0\!0D]SA7Tf  ~x|{|x!00D R`@0A?S@:T AQ: AA DR3@D1p@-1 1OS 0 $pjP 400p,D0?oq2tT 2 jP 4 0,T 2, jP 400,@pn0p0@h 0 p a0 0\0@0W0!T0 ~T00<ꤠ'I00F&@D0q0VT񏐨S}tb\VM:}|{zyxwvutsrqp(nmlkjihgfedcba_^]\[ZYXWVUTSR000p0w- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/ ,A-PQM`p@ 0S! WC {iP X( 0x0 X T 00Ѝ*PP0T0j 00ЍT ZTTp 0 0 R T| FyPp0S T< 5, n`p 0S R 8(C8B((0 000ST00P S00@(P R00@TT@4`A ] D] t] H] ht@8*\ \ |[ [ [ 0R@- MA0S@  ЍA-pPP% U) )0S`$V  PR |@P0DV სo |PO-`RM pQ  0 Ѝ@ PPb % PPc JPd \%D0 FS  hPM  p ` p pp0S  p  p0S  p  0S 0S 0pSa 뼐Y$ PT Ki$%hP ! hPhP 뼐 0$YpP " Y) $ @ p (B8BBxnS0 sS fSS0pS  U R00000 0 + [ @:B G뼰p[ qK +[p  5뼠 0 8C8Rp 0U  pWe ?o2P  pGx?'x W !8  X P *   0S02 0C8#800<p  0 0U QP‡ W0僰 P000 0pQ pU00 0pj0X0   0p /U  R00WTh  gP$) p0(C-PA!@M`p 0Di P %00"0S@ `ЍA@P ^ `0 p  R 0S 0LP` Ѝ` U 0 xP  P`L004@@@+ P*@P8T O-M M0p0:S%0:SS@ 0PS:S``E[ P*  ;0d@0  jP 0P:S ۍ Ѝ@ۍ ЍC-PŸM Mp@`t P> 0/SN GP }gY PE SPP 0 ۍЍC`0P P! p ihP40  PۍЍ0P 0S/S pP p:gX0 ۍЍC  p 0e#g XW P0P 0 $ۍЍ404 0 $4R Q Q Q Q $Q |P LP G-pP @P  ^`fV  UP l``@`P @T P00@0A0G P ed-@- M@00 Ѝ@ Ѝ/-7 Ѝ@ Ѝ/@-@fff@ff f0f@f 0p@-S@M 0000Ѝp0P0 0 0 0` 000Ѝpp@-@(PS:pS eP!pdC- M `@V pᬐP0fU@@`V   W0 nU sU  @ `V@0/00 Ѝ R@@@O- M PU' `pfSPU  q %@8C80P 0nS sS  ]@PU00 Ѝ 0S00PA-P# P 00`p` ,RR    0S,S@BcP  ' #`p`@k C- M@`P(P@pW[*nUR sUI fUH0D Y)RD @ dP% H0D@ pH0@0 H0H0nUp@0 H P6 sUI fUA L00L0 Ѝ@P Ѝ @AP80pY D8 0400 c 0S00 80 @H0R# ,0 0H00H0H0@ HH0@ 400H0@04 H00H04 0H040, R0 0rH00H0 $i h O-0M @0IZ P BY p ;p(080H0b0PC 0 `00 P080  P 00 P⺀*Z P  P " P  p Y    p p 0@ 0 0@Ѝ1!00@- 0 @S/ 0S0Q @\T 0S0 Q000@T0:PA_oRET  \S  R 0S0@x0T00vA-`P0PUM@p"S& scP !   开0V00  p000 00 0ЍPЍa  pz000O-@P 4M #P d`Y`4 p|  PP p =c 0P 0J c` (P c0P c0 0 4Ѝ  0/ cc,`0V (0 0$0,0$ HP,p, P AR   0S00XPr `V  [㼢  P"0 0cL0@ Z$ H0@0D0L0E ,pf[8  ` 0 `P+ Z+  RXEEhn[EX s[ "`0S   ,P` `0 0$Qc 4Ѝ  R`0IK0 0CK0 0PV` ` A-P`0`VM@p(S, GbP$ A  往p000 Pg00 0_0 P P ЍPЍ`0@-P pW M@`R  bP 0 `5 00P 00 0 ЍP Ѝ`O--TMD0 D:0,08:0,0`P| ||zPP00@P00PQU P^T 9POPdaP  P T 0U 0, P  H)0 8 <)$0 @ 00 0hFhvZ 0s 0 PS , P R 010#.R00SOR9 = 7@P# 2PP @ oHDHt 0n  P LKL00SPP P%0 ! 0S t 0"000 0000 n0PM0TS0 PM$0pW0(0 $0S 'aP: $p  0S` 0@S  S4 p 0`  '\S  R}WC%Y^SY @Yw 0` 4 0&0HS 'v 0P_ a TЍ @0@S hFhvP @0f  FPA P;0`C RE C/RVoTSRQPONMLKJIHGFEDCBA@?>=<;:Y^76OW3210/?-=+*)ESO0PpS@ Ss, 400 @ 0 @P$,   P000Pp^3( @ 0g 00P0p0 00 00 0 0(  0B‐St 0 S00 P50 p<0P00L^( 80,  T<0aT0`FPV``0pp 000 000000 s0 P`P hFhv XEXu3 @0n  OPJ 0S00 HP@  08`{P0 000000 000 f0 P XEXu0 0@s 0  P0P   0 f` TЍ?Y O  0 0u0 z0 rydD kr p&hP|ot^ D^ X  W xV V HU PU U T P/f$P00//LU @-M@L0 0!1l!1"b2c N0L 0 0@@0$@B!A@C0PЍ赁NT g P0`0K?//dT @-M@0 0C B0  N\00L 0"2<@0$KAB@C1dPЍkLS >$0P00?//xS @-M@0 0C@N $@L0B!b4!b N|1c1c0L?AA 0 0P0@$D$C!d!bA@C1uPЍ-?Lr *SR p@-0MP0`2~@P 0Ѝpz[00  R 0S"0Ѝph 1!0G-@q0PP03 0 4`S 0`02,0PP00|Q``  VPe`EȄQ  V|0`0ȇ`H00a8@-@P ^^^ ^$^,^^,00!R  !̨ 001/ᔨ001P//| @--@o \@\ @ 00s@ H [PJI HH @ _lp@-G-(M7@ @`0@PS~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " kU{F{{!00 (Ѝp0P0 P 30 0U f U{kka!00 0P0 ~P L30 0U 0"P  0cP0J30{U 0kk yP  0cP0G20U 05{kF{{dPr  0cP0t20U 0x 0"RP=  0cP0x0 0U " @P?  0cP0|10mU 0 !a1""YJ)P2  p0cP0%ژ 0U " R b0cP0$d10U 0T1"" P  P0cP0$10U 0 1""P   >0cP0@00U 010""P@  ,0cP0@ڜ00U 0 0"P  G??^ld Ld Db a a 20 0௵d20 0঵@20 020 010 01t0 0 1T0 0yI140 0pP!00 X10 0cQ410 0Zh10 0Q70 00020 CI0p0 0:?\J J I H G G G H H @H F DH 8G F F F G F F D D D F E E HE TE D TD C D dD B xB 0P0 0 40p0 0.X00 0|00 0\0 0000 n0 0000 Ҵ180 0ɴo41X0 0&X1 0000 ಴h!00 10 0ऴ10 010 0@2 000s80 H2 000el0 v 20 0m20 0d" /L+SC @AQ0@-OQPPP 00 QȠ\ 0{ +C 7G 00+C03Q Q 00A@@1 0^\nk 0+C {6F{7+S 0+C0C LC /P 0S $0S 0S P? @4@P//A-pP`8\* ,0S( 02 ,04 0 S4G0CV@1@! V @D8 ,0400 G 0, 400 (@ 0( 3/P840, 0S00R4000@-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?0$ R(400  0=@0U 0PE@T$0S0  0 P=@0U 0PE@T$0S  ($  0  88( 90,K  @U 0PE@T$0DS, 0 G0+@\<0Uz 0PE@T<($(<,000@00<00SE 70T<0 00CSW0S; 08@;0 Q;0(0 S0(0u080 t0890@kL;0U2 0PE@T0S ;00;0ILQD0ʆ;:0\0T 00T :&0PE00@SU0 pC0 0,0 S P<@@B0S 00*S30 PC000000 00 00W0"1<0 S<@0@0R0 p RR<,0 0PUS0S00)D9 0 <0 30DЍ X R S R  %P$0 PpB 0Se 00 0 C0 S 04j0U 0PE@T 0 B00 00 000R00SP 0S($<,(<0$(0 0R 80080 00 80B4 R,5@0 00D 0R1 P! BD A   B\000D0Sx70t7 UR00\0 0 P<@@ *0|'S ʆ0  P<@@ ;TU 0PE@00 S  S7 S$ 6威@D00@T80PE@TULQ{X60 Ql H0 @S0 0CR*ʆ+R 600600 pC00@500 pC00ld h ^X0Pt00001p0T :0PE01p@W0U Q 0SU 0PE@T 0S 400l50U 0PE@T:0D 1ʆ0+8@DD0\Ux 0PE@T:0!H0ʆ0H0;8@DuDp840W U 0p1Wp!WZ 0 0C 00 00D0PE0CD00$Dpl `R*$0ATU< 0PE@0 0Rl @D⨁:R (0,00C 8 P0l0S>0p0P00X0?0X00 p0tP 200T30/ R=0 U 0PE@T20H?o20$0S0E "d2$($B0#22cR:0S 420020 0F$Q   R D Up1p!W'R0! D $ R! D $ R$!  $ R40,0000 l100BU  PE@T  & !X# 100\100+0008@D;Dx00 R 0 B D  0T0052@? 0? < 6?7?8?=?>?N?O?5?@9 J?P?t,M?7 H?A?L?5 4 C?1 B 0 9?:?;?0@\4 @Dʆ+8_(4威@D0A D0B L4p(8#W" \40040SQ  8@D;D _ 4 +04HL0$ 6 400406 0@S4Dp0H Z0PE@ZU8tgx|p@ ⨃p ^&:l0 0:00pZl0 0S50P0;T0l50 0X00\0, @D5威005@D0 ;@y 60050 0@0h(4890(8 (8:0;d600D60x6l 0ZZj0PE@ZdU0L0Sd  0 6  0p41q岠pT*Um 0`4`UU PE1q岠@pW0`8@DQ{8@DD-8tgx|p@⨁pV7L00 PpC? 8(89i0+@]\8@D 0w@D(4l8l0U0 0 000P0<@@O0 0`pC( (0R@D0+S(0,80080$S>0p0P0 0X00tpXp04040P. H900 8( 89gSR: 3@ 0@0I9@0i900900 pCp T  d\ 0  \ h gP 4:000 威pC0@D0d:00l:0 0S|:0W0 pCp@-@PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000f@Pp`W2@ R2Q <00 00S!B <@0 Q00cS R#2^ S3#Q0S1 R[ @ <00 R<0@ l0pWPV H R 00cS  Q # 2R S 3#R0S  l0pS0pCp)x 000 0P,04D0p0 p0 0 0 30 Ѝl0Sl0@@@GfS???@P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pPWPYP 0!(`3/@PR 8X8 (  0(3/PI 8 (!ἶP S>0Rp:oRS B P T  B T p X0Bp (0 #8ា8@p 0BS.  p 8 ᏶d ዶP S>0Rp*p 0BS.  p ($03/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?00@C/O-MP@ @㬰(0:U 0C0 0$SP $C`0p sRpW(-0 p p0Ѝ0` Q`V00p=J\S 0W0T0S30b608#8P0U 00CP R"P @U\! V0! 01 002T 0 T 0SЍЍ 0D?o240%R00S020,0@0000,004@0D?o280(0 0  B<00 0$ 0 0S03@05 :^N , %0! ' %0 %`03!305(0<9P0C1P RP@00F3 0S C 0 $Q B("(R$AVG  ` V$  \ F ( Y FV(*Q BR  BR^ : 8 Q  Rb4 %Q  R\<  BB!   S @@ <01( 00 ,0, 0 00008@, 40S" D 0O-0CDM000 C  2 00!8ӗ1х1&=  x l0tJB H0Hxt^Hl0:8HpXT`!4Dp`ᶐH@ᰐ00Rx0 Ph`0l \0S8 B0l0\000S[ tAP`tx0l h Rl R010#P60 6SB \0P8 B_l0\00PЍl8  R&0&0& PV) )h0\0P8 B2l0\0{00SЍ  O-T$M t<4Yl 8H0XT0#D04@@QH0  ,0BA?C0CP`PƘ_p00B8#( Ƙ#<0Ƙ@l30 B0(1I>R<30+"8ӗ1҅1&=  `tQI6 Y0 60Rl00XP80tT@V` l H 0U#@H@0 Sl \P8 B0 l0\000S}$Ѝ806&6!ƈ9096tl I Qtl 1Y^ 't1QX 0S Q. Ql kP (l `f@ p400D`H0A `l @5!0 PH0  ` 0ll R1#:\ 6S \0P8 B 'l0\0p0P$Ѝ\0P8 B l0\0^00S$Ѝ   0, 0CSO-0! M00@p0U\Zi6P*0U 1oPEo:l0\`匴`C 0 S[ P1[SEWo᫲ZSW 0 0 0B % B 0 0B 0 #40BV V0\ 81!  Ꮾ\` 0  PE 0C ` U0 \`  Z  BP  P 0P `S , 8Rr06Ab,0l06\00P `Sl0&R65UP    R\ S#P Ѝ<``FV*\,\8 CLl \66&S06l0R, ` 6V`!VW\, Q* 65@ 0CP!P 1RV G/o"S W  R  PR#P`1`!WG80  =\00\0YPl0<AQ0Cl0 6&S06l08R6 J  ٭6,AQ  l00l0&n8 j, l0B0Pl0\P`1`!W 8 0 \00\0d  PR#P" 0S $0S 0S P0X*SES[SgSqS9 CS0//O-MP@`?o2P0S}@00Sx S t0Ss0,0S$ RiL0Dp 0CpB ᨱ,0lp\pv`FP0*SWtpWT 0k ,0V0pG**0  00 P  t0S"l8PLPXTD@p4`H0 9*0Ằ QH0岰0t0lt0Sl  l \  60x0`00 th  00Ѝ* ЍA-@P 0S $0S `PcpP l0t,@0S@1VTU@80C ͬpp@-@P$ 0S! $0S ?`PP0 S0c```,0S`  *00 00(0p`p 900p@-P@P pP,0L D0<00 B@C ְ0\ 0 10 |0:l@\@t@Fx ` h@H@pdp@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P( 0S% $0S" PpPU0&0R:k`@`U@40C00 0 &PUWtPPA-@P P 0S $0S p`|P0p`P|0A-PpQb!Tc@Te?P0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`䯟 0P0 X  0@S P X0 SQ\ \((PX\ L\  RL/Sv0S[Q gQ 0St0S 0Sx RH R .0 103/0@S0S>0 X0S S000 00#400 0 30  0#400  0 p0S0c0?o20 Ѝ0So= 000>Sq *S/0Sq00 0 0&S+B{l0S=  B0#2 2c0# 0l0Sm q000*0S9QI B0 00 t0  R 0,0S0Q0Q0$ 0Q00R 000 0 0 0#40 0  0 0 S0 S 00R01 0 0  0S 0 0 0#40,0S0 0E00Q P p K 0S  0PESPo p W *G 0 ,0 SR0 B0Ztp 6l8&`6&6!ƅ909&tpl0pG0Qtpl0` Wt0SX$ :Xvy 6S \0S8l  B0 l0\000P0S P{X: X!0S0(0 Ѝ0S 0=0 0 0 0 0 0 S0 S 00R01 00 q000SEQ0X P7 R #0SS@ }S  y 00#  #800#"0 w0  0A ,0 QR 0 0I000S'  0 0S0   0S,0SQ9:{ RY,0S  R0 0[00$0S,00  0$ 0S0   0S,0SQ@:M R+0 B0`00,0S!  Rg  S 0 Q*0S 000 #4090q000SE 0 B0+0#  #800#"0 IQ"V\ R8 C0 l0\000Sj`ptZ(l 8`pR B 0 ^L 6ƅp6ƅp6!ƅ9096&tRl0A0tl0 Qt QX Q Ql 8`p0 w X 0Sq0 B000 B00,00I ^ ^<00 Y Y Y Y Y Y Y^ Ioᩒ#Y0C0KS`00`S&&p 0C0ƅ0 01I>  0001&=  &6tR` l0A0`ptl0r\ R8 C0 l0\000S500 0*0[(B  :XF 6S \0S0,000= h0 0000 B00P0U0S_8 `٥ 0p!(3/@PU X!@Υ 0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/80S. @ R+ D PR% , 8 ᣥ, @@ ឥL DD ᙥ 啥0 0C006& 0&;> 0$0;/ O-QM R0  \ " !#4"  `P `p  *@+)0 @$ %q 0 1Q`!;  Č ` 0#:  Č (9  Č p'4 6" Č$ !Q P%D R`  ! @0#   R#4,  " "0 0S"$,00# "0 0S"$, 00#0#   R#4  P% 0#  R#4  PUTp @RR.0R$D. R$.0#0A0R.$ AR.D$0#00R$D. R$.0#0APE.4$ AU#D$ 0 @  P   " !Q#4"Ѝ` " R !L -Ppp t < X C-`R! p `  01D0 ^00# PL  "`@P@1\0 C @$! C-`R! p `  01D0 ^00# PL  "`@P@1\0 C @$! @-@P xpxPp`@` 01ē!0Q0 0#B   @-@P xpxPp`@` 01ē!0Q0 0#B  d 0@-18P@\0 C @$!0 G-R (h Q R@O(sR$cW-mPVMD0@D\\\ \ 0\  \ 0\\00 0\\0\00 0\\ 0\0\0\ 0 00 R8΃7` cVV- 2T0HN0 T"R @0Q1X1H#H7cN1P @@1^NNTUD0 P P, R0R0R R0R0R0R0R0R0R0R0R0R0R0R0R00U0 l@D B @0 QD0'7b"c2HNVME1@Dq$R'@-7Fc20B c!'b "0C0  L A R,A B<P C,0@P @@ /qR'@-7Fc20B c!'b "0C0  L A R,A B<P C,0@P @@ /q/( U/ 0`0/ጦ47ς 1O- p:PTU$1` Q U @ σ1\KU`0 ẠZ 1 @1: 0V: Q- ^ pQ Q Z @00O-DM pPjp5W@T4PPTQ=N0 PP0\ˀC Y Q 9ʶ 60p\0 1 0Q-p qX䰠 60C6Y 0 QI 0CAp P0 Ȁ  gXQP4 !\˒0C`K P4`ˀY`;T$Q BXKT$T;往P PQ͌Q-PP ^ Ƞ 1 ",ȠA  `{6P4pSTP I0`T$!\. @   pѥ 1Y㲠bQⵟPP 0100W0 [.0^A  װ& 0А##U60 6<,Ɔ0 SZP. Y> 0  JJ0RP LGP 0 QR0C Y> 00 B 0 \0000C01 LR  0P0N  @0 00T0 0s P\ R @00SC00 R0P\DЍWP 00YQ / !0@[1^PG65#6pQZ p J0 0=A-@1^PRPA@D@0+}nR- R1>000^ ^P0T0 S ^ SΌP^00 P0P0 S0Ѵ000°0Ѵ0O- MⲐY``00RCJ!Pk΄  R7 Q. R2 ৎP01nh Q&80pNFh0`0#4``06cUQpPv R0Sz P`0 [ ЍYf0q 8YC8 !.P&pe(WB(0 `p0p00`#4pp06PE`0cQ38C8f6PaUx0Gx#800P``pp0P't``pvApg^xGx B(Q"(a0APP0#4PP06cR!0C 60S 0 SP`0 P`0 R+=ʲPpeW6y`p8C8000`p#406PEP0cQ UAVfN.0 APP 0#4PP06 c^ 0C6qpPp6gQ0#80A6`00Gp`p!0aUQA6 S, N.0 APP 0#4PP06 c^ 0C6q`0f /P UAV B("(PV^ B("(06VʀO-kn6@SMN 3003P0030 0300300%10 Jb ^@$HN@@p@p. BnS.HN@ἦ6S&00H DH4P  p, Ḁ! @b T H DH)& B @@$D @F @dXDHDH&qZ" tqN.r@jTHp DH'x&pp@@p$D@F J @d^DHDH&0CS㎀ޕޅq᷀ಠBj^@$HNI @@ @"$ &J bX.HN@ἦ p#Rs `D0C8#8JO6S@ἦj 0c Q.AP`kNP!``0C0aR! 6Ѝ@ἦk. 06Ѝ 6@-S k>@@0 #400k.06S0 k΁0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&谔ʀA-Pk@8` R.; pNp "$pp &bS0 B0&0  8#̠   4##<V0 0 v    &*60@-S S00k@@6 0C60k>@@@!PPƂ0k΁6 0@-# SH$(<0  PDHP@ 0@#4PP06 c^ 0C6 S0Ҽ60k.@@0@#4PP 06 0C6S S00k.@@6 0C600 6 k>@@ @"$PP Ɓ0O-@ MPp,0S ᔀ&]P+(+%0 N. 0r?010S!@P j600&6 0!R1Q  S030#Z0Sk 0("( Y9>8C80 00#40编0iR#8 IC8἖(+ ,K("( Y98C8k0 00#40编0iR#8 IC8἖ Y("(98C8k0 00#40编0iR38 IC8἖ Y @("(98C8k0 00#40编iR I!἖T30M>0k.꼖ό YȠ,LȠ἖ ! Ɩl^ LƆP | y 0x"0 P0Q ;S ;S <SE S 0R  , &] Pj0S  Z R, 0G.0 0R0 0xS0  0LSI>W&&&& Ѝ ЍO0 &k0! R2 ʸ006N.V g 8C800 0#406 cQ 0C6@!!἖:8C8἖8C8἖8C8἖  p  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF 6@o0ƓAƃDQ  !I.!ѕ"х&  p@-@P`d0P \0P 6@T @@pVp"(@ pyaratcid@-M @PoЍ膟@oЍ@-M @PЍw@u@Ѝ@-M @PoЍf@oЍ@-M @PЍW@U@Ѝ@-Mp`P @P F@Ѝ _%p G/Ѝ6@@/T 0A-S ` 0@ Cp'P%U P 0 0A-S P0@PCp'`$V `000A-S ` 0@ CpP$U P 0 0A-S P0@PCp`$V `Ȟ00Ş@- MP $p 0S p@0@Cu'`$V ` Ѝ訞0 0 Ѝ衞 Ѝ@- MP $p 0S p@0@C]`|$V ` Ѝ胞0 0 Ѝ| ЍA-Mp@P `P $p s. 0S P 0 C, @K$T@ ЍR`ЍM0`0ЍF@P.T` Ѝp@-@lPz0PPptcidp@-@`Pn$0P p!00ploobp@-P`!@P   @ap@-@>@@-@8@@-@2@@-@,@0@-@&@N@-@ @]@-@@{@-@@@-@@@-@@@-@@@-@@@-@@ @-@@"@-@@8@-@@L@-@@b@-@@z@-@@@-@@p@-P`@P   @pp@-P`@P    @pp@-P`{@P   @pp@-P`i@P   @pp@-` PV@P   @pp@-P`D@P   @|pp@-P`2@P   @jpp@-P` @P   @Xpp@-P`@P   @Fpp@-` P@P  z @3pp@-P`@P  h @!pp@-P`@P  V @pp@-P`@P  D @ pp@-P`@P  2 @ pp@-` P@P   @ pp@-P`@P    @ pp@-P`@P   @ pp@-P`@P   @ pp@-P`p@P   @ pp@-` P]@P   @} pp@-PZ@h(0P p10P 0pgntsp@-P`@P   @Z pp@-P`@P   @I pp@-`P%@3HP p6P U %00ppatadp@-P`@P  c @ pp@-P`@P  Q @ pp@-MP@ d0P @Ѝp  h)`P  @P`+Ѝpgntsp@-P@ (0P p0P 0pgntsp@-P`3@P    @ pp@-P`'@P   @ p@-@R  @ p@-@"P $0P p00ploobp@-P`@P  # @ pp@-P@P ?#@y p@-@"@@-@"@@-@"@*@-@"@H@-@"@f@-@"@u@-@"@@-@"@@-@"@@-@"@@-@"@@-@"@ @-@z"@$@-@t"@:@-@n"@P@-@h"@d@-@b"@z@-@\"@@-@V"@@-@P"@p@-P`@P  k" @ p0p@-P@P "@ pp@-P`@P  H" @ p0p@-P@P "@ pp@-P`q@P  %" @ p0p@-P_@P ^"@ pp@-P`N@P  " @ p0p@-P<@P ;"@u pp@-` P*@P  ! @b pp@- P@P "@Q pp@-P`@P  ! @? p0p@-P @P !@. pp@-P` @P  ! @ p0p@-P @P !@ pp@-P` @P  u! @ p0p@-P @P !@ pp@-P` @P  R! @ p0p@-P @P !@ pp@-` Pz @P  .! @ pp@- Ph @P g!@ pp@-P`o @P   ! @ p p@-P] @P D!@~ pp@-P`L @P   @l p p@-P: @P !!@[ pp@-P`) @P   @I p p@-P @P  @8 pp@-P` @P   @& p p@-P @P  @ pp@-` P @P  ~ @ pp@- P @P  @ pp@-P` @P  [ @ p p@-P @P  @ pp@-P` @P  8 @ p p@-P @P q @ pp@-P`y @P   @ p p@-Pg @P N @ pp@-P`V @P   @v p p@-PD @P + @e pp@-` P2 @P   @R pp@- P @P  @A pp@-P@, (0P p0P 0pgntsp@-P`@P   @ pp@-P|@P @ pp@-P`q@P  z @pp@-Pa@P @pp@-`P7@ HP pP U 00ppatadp@-P`l@P  > @pp@-P`{@P  , @pp@-P H@P e@pp@-P X@P T@pp@-MP@x d0P @Ѝp4  $`P  J@P`+'Ѝpgntsp@-P@W (0P p 0P 0pgntsp@-P`@P   @Ipp@-P@P @:pp@-P`@P   @)pp@-P@P @p@-@Q @@-@R  @p@-@0 P &&p@PPc!0S ^!pW!0@- @@>!dP 0R @-P Q o// 0S p@-@L`P`PpwP p@$. - P `0 0 o@--먳 ȳ @-P Q @K@ @0@ 0 a( (0( 0 b4 t  P 0  0< @-Գ  m@-0P M`0! #@P 0P0 `  Ѝ%ppp ⛌P`   %@ Ѝ %`b@- #@P $0 0 0 aA-pP x#@P ~0 0 0 `g#PP  P `0 000 ,0X @aܱ  @-@P ϐ@ te-@-M(pW ,P0  P&@P/#`P  0 Pr& UЍ@Ѝ/Ѝ@Ѝ/ 0 0t ?а EHi @-@P @ 1"p@-@P x0 00R0 P"0P Q ! p@^pp_@ p@-@P `0 00R P"0P Q ! p@p_ P/0 00R /^P/<0 00R0/P///l^L 0P p@- o QP  QQ !/^ P/ 0 00R/]@-@P \0 00R  `"0P Q ]!00X] P/00 00RP///\ @-@PM 000/o"P R Ѝ R0 ` 0 `p"PP 0 S  R L  h% `PP R$  00\$ @-@PM 0 00R ЍQP! 0 n pp !`P 0 S d  P/% pP` $000( (0( $0 [@ p Ȫ + P H0-00/o"^ R  R/ZP/D0 00R /@-P o8Z P/D0 00R /@-P ԐoY P p000/o"\ R RP Q  Qஐ /Y8 , fP 40 00RP /X f$0A-SM`"P@U Ѝ0 PP %!pP 00 0wP S _# !@P d0 0 0 @Ѝ4 PSP  (W! 0 //p@-@P& R 0P:P PpG" P `0` `0 L0L L0 808 80 p ܩ l L  , p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ Ppp@Jp@-@<PEPp/>P Q 7P Q>/P  p@) 0p@-SP` @ 0S @Pp<P QQ P/P >P  p@p@-<X@P@(@Q Pp$pP  p@,  $@-@P@ p@-@P  PP 0, 0p!@!p@-PQ@` )0 S S   CQ R 0 S S CQ\<S0S !S0-S 0F?o2-R0S0S -S 0-S >R/S `(` 0 S S  /S  >S   C\  R `Sr 0 S S  /S  >S   C\  R0FU0 P[ .YPV0/S_ 0$00>Sc Sj 0SI S S   0CS R` 0 S S   CQ RS3 `0 S S  =S   CQ  R  S! 0 S S=S CPQ`B`0"S0S  0"R. "R+ Rp`FV0S 0(0k(0S0$00>S`0`000 0`pL L0L H0 0`tC  >R00p舡  P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /0@- 2XoO-p-KM `Y됊0:P10 0 0Q@@0 >SS @S@P@  ( A-PRM`Pp`0 @T- 0@0W  WV 0/RA 0CW /RW  CW0  B/Q p!@C@T@!  ;@04D .00Ȋ 0 S* ي^p@  U j0@ Pc0@ۍ]? 0 ۍV 0 ۍ S0p ePcD,p p6@ C-`M]oP@P4 ,p`F <p@ pEe0R8p"0 `jp)    000jp! 0PPЍ 0 0 `jp  Ѝ@Ѝ@@- @i@@- _P 0 0 되  O-IM  @T V 6/ p0  PS @Tv 0 R 2/0P`^a P0 p0 3/V@ 6/T ^T T @@T. 0S2 0 3/P V 6/^0S @0 R 2/0P`^ P V 6/X3 003/Iߍ 0 0C/( 0 0C/ 0 0C/ 0 0 0 |0 l l0l 0C/B뤖 , ,    \ 8 ĕ E ; | p@-P@PP  P $0SP  R PpdUP P ZPP , `PPꌔ \ P0/O-MM(p@ T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT00 0^P $ 0R000 Mߍ R00 0 0K/< |  0/0/@-@@HP 00#0 0 P 0S S R/P/ R0/  @-@Ԣ 0p@-(M{P@ | { h``VP (ЍpD { P j(Ѝp $@-@.@- @@}#ܡ>p@-M@Pᾌ` `0Ps0*0 00 Ѝp訌0"Sp@-M@`ឌP Pqp 0 00 Ѝp芌0"S 00 S 0 P:\03#/S 0 P\0///A-P``᳂@P  ( pP ᚂ@P s>W@(0( (0   < ď 00 S 0 P:\03#/S 0 P\0///0@-M @P  @ Ѝ00@-M @P  @ zЍ00@-M @P  @ lЍ00@-M @P  @ ^Ѝ0@-@P ,0 00R9 /P/0 00R / 0  Q 0R* R0:/- ^ : P *0 S0*/@@/ / 9P $0 00R //8P $0 00R //h8P $0 00R //08P $0 00R //7MP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/7P/l0 00R / 00 0  S *0/ ɒ\* /7P/|0 00R / 00 0 S *0/ - ^: 6P/|0 00R / 00 0 S *0/ - ^: 6P/@0 00R / 0 0 S /p5P/|0 00R / 00 0 S *0/ - ^: 5P/l0 00R / 00 0 S *0/  \* /4P/l0 00R / 00 0  S *0/ ɒ\* / 4P/|0 00R / 00 0 S *0/ - ^: 3P/@0 00R / 0 0 S /2P/d0 00R / 00 0  S *0/  R* /2P/d0 00R / 00 0 S *0/ R* /02P/\0 00R / 00 \: /!S /1P/\0 00R / 00 \: /!S /H1P/T0 00R / 00 R /! /0P/\0 00R / 00 \: /!S /p0P/d0 00R / 00 0  S *0/  R* /0P/d0 00R / 00 0 S *0/ R* //P/\0 00R / 00 \: /!S //P/T0 00R / 00 R /! /.- P M D000/o"^ R Ѝ R Ѝs,.P/L\ /  JQ\/-P/L\ /  JQ\/t-P/P\ / Q/S/Q\/-P/P\ / Q/S/Q\/,p@-@ 0M PR000 0 Ѝp$0S `0-S 0S0xS vP T LP ЍpP`P|~ Ao/A-PP@@Pp t?0,p0P4080<0P`p @@P@p+꜎  @-@ @p@-$@@ 4~P*@-@ @O-4@T ,`@D¤@@`T PpQㅑ DŽPZ P PZ  0 0 } | } z @-R 0P< P 4Q ,  D D0D @0 a0 000 0 X\) t} @} c } } p@-M@4 00R<SP,0 S R( 1`V9 P` 0 07P 40, 0C40P0 `ЍpS 0 0D Ѝp3f/ЍpR t t0t 0D \ \0\ X0D H H0H 0D a~ | (| at~ p| { P~ | { q,~ | { A-@`,pPP W 0 !G,P0`,P0`G-@pMP P  `00Ѝ!  0<`P (0S1  0 0P (0S$`V00 0 P 0S  `P  P X ` 0zP ( (0( $0\ hx p T| z \y I 0  0 @-W{ Py y  0  0 @-I{ Tz x 0p@-S \  Q @PPp 0  0 )h$ { x `x {p@-0S h`@`PPpDP p@ 0  0 \ xz |y w 40@-S , 0C!40R @S@ @0@ <0B/, ,0, (0B/z (y dw y x @w p@-@PP%0S ,  Q<0  0p@a"O-p`@40Sa H%P@ P 2P0UP 1001000`SZ00<0 0 00S 0R 圑 # 00R&P P [H P P P 0  03/P PP 0 S %O  00CS 0 0PS $Px@` `0` \0J/.L L0L H0R/%t "T! (s r w Lv tt v @v Pt D@-@v|0,S<SS"\PG-J `p0VIVP@* 404 SS= G000,0 100,0$ 100,0, P   0 ?o2\0S `P*    0S~P```D D0D 0.}, ,0, (0.t dt Tr t dt ,r G-PP' 0 0R"p4w`P 4 R @, 儡ᄑ! ,04 儑@ 0T:80804 `0P 0  Q@-P80080/p@-P@80080p@p@-@P 80 0R@ pP4@php@-@P \0 0R@ p`Pt00S@#:np3@A-`@aT 0p0WPP \000P000I0@S <0 @ 0@@A-`P 0 0R4 p,40S @40S,0 @PP'ppA-@P 0`0VpP0S P @T @ @0@ <0R/@@Hp p ,n A-`P 0P0/o"Q@@T 00R p @P @T @ 0  0R/ao 0o @m O-@PM 3` 0R PЍ4 00R80p PP @`PЍRP yP3 p 004Q\ h4[_ P,10Q1 050PYUPE Pl 0 !g 0 ,0傑14 `<0 0P4 <0 E~,YF<YHYJPUE 崡0   @yP!  0,S<SSCPP <0, P0`<04Pw100 oyU& t ,rP<nPP`! wg,0 0 |0^/l l0l h0^/~)T T0T 0c/Utd{tzl |j i `l i i 8l k i G-@S ` VP p P n 000 Gx\ 0 0i/5 `P  x@pT X X0X T0x X@p8 808 40x L@Z (Z Y dZ Z Y P/0 0R/0P D- ?o2 ^0S 0 S/P/@-D@T  ?o2^0SDo(A-M$PU@P` !0 P 0S7Ѝ 0P    PP 00 0P7  0R3  P, pW-  @P6 00P @| Pp 0  0R0"S | |0| x0  Ѝ m @P P|0"S X (Q W W V /P/<  ?o2\0S /0SP/@-M8@8@G 00BЍ`0S 0O O @-@DDMT, Ѝh X`8`@-@P (0 0R~P/0 0R/lP/0 0R/D0P D- ?o2 ^0S 0 S/0S /$0p@-S@ P 0P   0wP tth@@ @(@pLLL@@808 80 M pM t^<^T |U PU A-PP@ @Pp |```0,p0P4080<0 P`p @m @P @@-@@ @-R 0P< P 4Q ,  <0< <<0 i,0, ,,0 aT U `T BtT U @T GPG-3 pP0`W2W@ 404 SS& 0000,0 10,0$ 1P0PP* { y v tPP@ @0@ 0( ( (0( 0(  tT N S PT D 0P D- ?o2 ^0S 0 S./p@-Pt@P IP 0 03/P ZP @vpg@op0S /p@-`P@}P $0S p p@E9 p@-P@PP |r qPP 7p'w0@0"w@p@-@P "0@F\9 011/A-\@`pP \"1S 0 €  P 10P !`p P 1@0@ @0 B,0, ,0 AE lE D D LE D @-\@ ^ \)QRS  T00 QL R S "  T € 00 0 0 Z@D D C 0@-@R00Q,MP! P! 0       LT0?o20S00,Ѝ00 C C 0@-MP@0  0q0 0q0 0q00 0P   SЍ00@- M0P@q q q000    S Ѝ0 00@-Pb"M!4b4#  @ 0kq "44 0cq "44 0[q00 0P   UЍ00@-M 0P@ Cq 0b" b! 8q "440 1q0!$$    SЍ0p@-@P(MP`/ 0S, R00p$P (Ѝp0-S 0 0 0 0 0  0 0 0 0 >M P0V00(Ѝp@ R 0S V00@ @- @&uT00@-@p00T0g0h0i @-@"T @-@T000 000S/@-(fpx000 000S/@-f0x000 000S/@-fx000 000S/@-ex000 000S/@-epx000 000S/@-e0x000 000S/@-ex000 000S/@-ex000 000S/@-epx000 000S/@-e0x @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^  \#AhA,A001/@001/@0 01/@0S@-@1/00/h0h0@-@ M\P Ѝ'eP :tЍx/G@-e-@-000 000S/@-exAo//- M0 0. Ѝvt- M( &Pp Ѝwt@Q- M Q Q s 0 Ѝ   Ѝt ^t ($/(/$/ 0Y.<+ < 0/(/$/R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@r P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pn8000 0@0 !0#2 /UUUU3333  (=: S- d S V Sb00Z r - !=w- S ^ >S-00 @Sx00: r0-0 0w0-000 SD !S-00 Sx00p!r-0w- P8 P2 P8 Px 0    Ss00 ! Ss00  Sp00  Sc00 ?00 S&  Sw00 Sl00 S00S00t 0 T 0 - 0 A00a0-00{d00xs00uG-]fa`pP8 kgP3  fpP$ 0A0]f`@@T iP0=S AP`0AT CU! qJg:fAq 0 pp"p2C-hM 0 PLP T0X\m ``P P唐嘐圐堐夐 bp@Z xp  bp@e ,P7  $(0p@] `0<S0<0x0@S<00<0@DHg'<''0'f<1<000L0 00fW'X %pq0S dp@ Zb Vb @Ѝ3OoBЍ@Jq00 :b 5b 1b1 1 1 p0 / O-pM`@ kP-TPk +T@` 0 0Th W p pǯ 0 a 0 aP !ˎ @00D \a0DSW0DA0DS70DWUY :Q P S \ pP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0@ 0`00XS00 C R @0` p0 A BRWp pꙙH0BR"\04 0Sp@-@Pp0T0Pplp@-BR"^p@?@Pnp0T0PpO-pM`@ )kP-TPk +T@` 0 0Th W p pǯ 0 -a 0 %aP !ˎ @00D \a0DSW0DA0DS70DWUY :Q P S \ pP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0@ 0`00XS00 C R @0` p0 A BRWp pꙙH0BR"\04 0Sp@-@Po0T0PpDp@-BR"^p@?@Po0T0PpO-MHP@QD0@U P0 `8 (" 0@P`$Ѝ R4n"0P`0n^!0 $ЍX000T0 0P00 0vP00S< 6#R0P` U03[0:P 00$Ѝ!0 P`$Ѝ?/%1R5%%;R:*%6R1!%?RP`\ ` 0P {`8 ` 0P q`}(& % $ h$ \$ @-M"{ @|d{ @0S D <0 0 |0 30Ѝ  :d -M{(, {Ѝ 0 0 9/zmNA00/yG-pAB`PQ! @Q J5T1P@ V B  PA@Y0@O-,Mȟ08 00p8 @p0S00 H8`0S 8( (((( KaP@0+0C< W Pp  q 0 AB000 S 00PU- 0X0F0-SPUPaP0-S0!000 ,Ѝ ,Ѝ60p p -U0 Ц` :U`< + B R 09\0P0 WU E :Ro 0S000\6\0P60`u0v` 060  ,Ѝ60Pu `00PEPCP0 S000500S 0:S 5 ?0P;R0S00BX0@\5 00@500S 0:S 0505W 0 0+ C :R :S?k:i 0S`0  :R 0X0! $ 00O|40p4 0$  RL$  = [0P0| C000Z p p@P`@p`W  yd0Sg 2 PR z PP  0pQW`0S p @Az `T 0RZ0S" 2 00S 0:S  XR0 S2 00+ Cd`0JS0S:  00 SP0 S`,Ѝ p @ hg1 00S 0:S  <1 0? 1 00S 0:S  Z 0 10S$000<1 00S 0:S L 00C 00 S 00 00+ C0 0 0 00S 0:S  t00P0+ C108<,xxxO ! Xx Xw0wvM vxv\v, TL  tK ttlK @ d   qG  O-p2̒0 \`" P@T6圢 0 R01-[@lP-T@PB T"LRPP NZP -@GZ0P  :R8 2 0 0S! 000PP@:T0S! 000100S 0:S D0 |0?@0SX1 0@ 0<P ,10P$1$$0 0:S  W  00:R@ 0S 0?@ 0000|0| 0 @ @8 ToooTF Xonn t DE 0n`nnD mD  Pm8D @-@-Q Q Q  0Q 1  0 0 0 S 0 0 ySϠ @ ND^0   0Svj 0 ojT 0    X  \ A-P @` # 3v0 aVp BT@! e 0 0R ! 0 opP   Fi0 p `QPA-M! P`P@ pP& 0`0  000 @P WЍj@00Ѝi0P@iPi@0PpiP|0 0 X  ((0 @-@0X @  Q0  A0 AQ;  A@-0M 0@8PЍ0 Qp@-@ ڐ\00QUPQ\p \00QUP|\00QR !/A-pRP`@ @T T !03/pWG /p@-@PT 0p@/pA-`Qp@P RGxP0D00 00㼀p$`,@(P0RNi 0 A-P`p@P> 0U0! V WppP`P`xP) 0 0 00㼀@D $P,`(p0W PpPpV W dpd`p`TPPH``i00t\p@-@0`M1PS ,0S Id$0S Bd pЍpO-0M @#$c`pP 200S 0S 00*  0Sx "  D(?P` h0S{ 03/t"  4Ph0X S 3/("  !Ph000  P     @ P 00  |00 UPX Y$p1UAhh1pP@$T!0,0 H1 ( 0 0ЍXJh  03/v{PP 0]Ѝ-h0S )huXf#@h0@0꼰h @(  Pht40D0@-S @Z0 P @0P 0 0001 1 00Zg 0 p@-@0`P1S ,0S 1c$0S *c@ppp@-@Z00CS00 PZp#P--M  D?Ѝ Ѝ/ -- M0 0> ЍЍ/0P0@-$M R P@0S#  S!b0  B0!  0 0$Ѝ00bL0 0 @ P 0S$  _ f * d_P 4000S$/00//0_ _ pA-`h!  8MPP 4 . D<  Q S  @2 &_ibUp  _ $@\bpU 0 0 40 30#8Ѝ@@p pW dP\ 0 P  @22bp,@p@0xا (  - MW ЍG-0!MPD!004081 04p0<801 p`{@P !0 0 <8 304 !ݍ  \f0 00@p=P@T Cnx` P 0 P8T{PcP @T@` C-!MM  !0 Q00 P <( 040 x1@`{0P@4p 00H1p{ P4400 $ ( ,  0 0 ppޅPP"@T Cnؐ` 0 P8Ti{PCcP @T@0S  嬅d L0 0 <8 30 !ݍЍ800嚅( @ \ \ H O-@FM# M3 0Y㐤T`p0d40X ( 0Kd 00; P0S 0K  PU  0P(00HP h$ 1Pu ,Pp$\Ug ,#Pg(S,QHP $IU ,E  Y "2 0 d4 30Fލ Ѝd 0P0D bPbP9 / xP@ @U  ,<V< VF ! 0 0 kd0 b[PllVO0$0SH / ~x8! 0 P  01!0  00 0  }0 qjc|| @  D D ,     `  x X @ <    \  T  H D h @-@441M0 `Pp 000~dT T) d@/00 0 0 0 30-Ѝ0U000 @@P@00gvP "448#800U0Pd0P4d@P-똷@ O-P-*%GM: 5M $0ĝ0l404 0P@`9 @@0D`H`L`J500p@> l5l(000(ph 0 r@P!  Pu?d00S/ ;d0=S0`S0`V`X`V `ሀ\P(d0#S 6PU @|$d4 0 l4 30GލЍ(00C(08d0 @h00000 02yPc @P0h00000 0yP 3   [t  [0S(00C(0p  0,0`Pr #`p(0 ^ P^0U P0000@8`c *Pzھ0w 0hPC 93Y0i0SO SM ^  ^  ^  P\, R"J0  ac 0b5 0,P(0,0 S  P (0S 00000,  phxP8 P4 P.c0S ,&$0pd( $d   < $  | &  t T | C-PT!`P1 0\M.0T004,!48@#8 xp|0000000 $(,0_P!Q ,Z0 p(@:d T0 0 T0 30 \Ѝ  @ 4 ԯ خ -MЍO-`!p1 Ƞ0,̠dMČ!0\00< 8P#8 @ 㐐刀匠0$000 0 (,048P80Q ,  LZIP 0S 0 @Ł 0 0 \0 30dЍtU0  @坁@ , , ` ` -M|ЍO--M*$04 00200: زEodg0 0-0P PPf 1 S Sh x#@ l# Sb  000 S SU S0 R R R R B RQ@  BQRS 0 S1@+S8 -S\QUp @Up0S Qr : -00_op`R0+S6 -SI ^PPUpw^ WPZ Pp@ S S 0QUp @U50SY Q; : 000+S_opR0S @S: PP  e_opR0S @S': PP`   K_op`R pPpU2 t0 0 2 30ߍ ^PP    d  ̫@R"O-`2 0ŸMM080 0y@P6N 0AM.0 ;wPY 0SV ܰ + X0+ MKr 0  0  0 P @ P3H0: S8 1!0 &G  !d1 0 8 30P ލЍPPP 0 `P &100S1!0 &w P \0S  S 0 0 &0 0 &H0 |0| 0 &0 `C    C  |t Tx A-0M0@`p _00 0 P @T@T 0 PP 0Ѝ @P0ЍP -$Mxx0  0 !Π0 (0 0 0 30$Ѝw -$Mtt0  0 !Π0 (0 0 0 30$ЍS t(A-` @pP BW_00 0 0L ^aLQWLALQ7L \  R AAQ  R C`0C R0 ą S: C    G-0\AP@`?0 PR`7U !/*0$A$$q$$@ p ?@??p.Q  S*!" P* V  R0*S *0V000?0R*00x?R1?#p@0 .0S0 ? S*: 0 U: HD@ | p@-PH@H0@`M000 @Ѝp@-M 0@@ 0 0 ( @ Ѝ -,M$0t  0 00 0 e6P 400 $  ,Ѝ 4@-0M,0 0@(0t 0 $00 0 ?6P ! 0" 00Ѝ^ 0 \ O-`TM0  000  0 ! 8 L ! {x{PPS h@ p^0 p@P= 0+S+0S((c P,$( 0  P 0$,$:,0S5 0 0 L0 30TЍ0 sP %P^ 0 X t L @ М!1 O-IM0p0107Ytl PPQ \@ `0 `2@P; 0+S+0S( P   0  P   0Sa 0 0 1 30Iߍ P ZPF] 0 4  0/ 0 0@-PQ0M@000  0 @" 0S0 0L @0 0 0 30Ѝ0!PP T ԙ @-FM0 M 0 `@p0d40  PPd@"+ P .]0@)] R@@ 40 0 d4 30Fލ ЍpĘ0@-@x lMt0 P 00d00̅ օr0 (0 0 d0 30lЍ0l ]3\3@-M8@8@ T0 Ѝ, , `8 #4`43Z!R // 0 0@-PQ0$M000 @ 0 @" 0S0(0T H0 0 0 30 $Ѝ0)[PP 6T$ ԖG-p!P1M 0砐 040 E$e P;0F W08p;t0' T CPP!  T0@To0Z\0@U\@  0 0 4 30!܍+C\0@>\U@ 0P P*TQJp x@|`d- M0 Ѝ0@-@x lMt0 P00d00 =0 (0 0 d0 30lЍ0똔Lϟ? O-M0@@ \000KW\ `` T` @!?b"`!P+d+) pP b)͌h P%d P @pgbx"n.'t*|bt'Pn* )dA, @PL`lp` iA$@Hi!h(Df& +e,)f)h+ t . 'M `k(+x`eq "$p,k$"eq'f& ! p*d (+ fd+eQ,P)P|Pe%}(nd.eT(  "d)͌ g. dA k(+ "$,@k" @$읉@l @&`g!,(@@ fH&g!"$D ! Li,fd$@gA .aH!*$DLaD$p*+匠- `j*i +j+i(P% `&b  0``ian, ah!&d .lad&.'. _%@$,Pp_$bq.p4PPbq'͌pe%h. ) }eT)l. +,*+. +@**b!d($"$(,dD"$ *.,/"+.0`&.o&+o&4(`+ha. ` ha& ` _%_%_%, PgQ,Ph P%PO$O$m`O$g @O]g. fA @͌eQ@$gqpfA% @?fA$f1ꯠ`*!`!$` .))@(**}*,la%..` `&gq.0l'`O.P=OP`'].lc1O `#.p͌p뿠+`'' @++O+4ea# @O `&`꿠@m/+$/"/"+++lOe, 0(O0n,= eQfan&P@) ] 뿠坌+@++cA&+(,@$n@. , ,.4eQ.믈`$.c% .Mꯈ`c1ia% `&dAꯈ0ia$`&P=Pm P8_% _%_%_%n$,P_i+P 쟠_)(_%_%PP*)P*))c1ៈnQ#@P%潋韈PfA#]n @$k쟈@f+.00$.!!(.4..M0e+f!`.,`)8o)`.`.=.dAea$ `& ` ⟈c$m.eQa럈P@c!.鏈@c1.'鿠'p0/+/"/" $ ,.].f!M(v.0! "0%q0 ?p0%0?SP@@g RQ0gS@pG" ` # *G0S@@:`F ARp@-@10MP 0 00R00113 R0 0~? S `` 0~? S U PE "001<3 R08 (0 0 0 30Ѝp  0 0@-PQ0$M000 @ 0 @" 0S0(0T H0 0 0 30 $Ѝ0)vPP Q @G-QM !P1 0稐p 0 500E4e%P<0G 0S08C;t0' T D PP!  aT0@To0tV0@oV@  0 0 5 30"Qލ+]V0@XVU@ 0P PDNQ@cp p@`~}- M0 Ѝ0@-@x tMt0 P00l00 ;0 (0 0 l0 30tЍ0|| {40444 000{ 0/#EgܺvT2O-tM@@ 0UQ P?D @`  0 p, .`h d` 4   *d,! L꫅appl[ P8 ` P%lk.0`&P p``{[d[ ppmܼvmzNSdK P%P[`[h0nbk*@`<nbk& @`'i` .DfinlkajK(l @%LjK$ @g a,`dMbKh &͠iˌb+h  .e+ "8 j f$jlf!  idah d  b-g+d)h,n h ) g{T苠fp`! g|e{D`)fk`" l )e[Pe]n[fjLdka( Ha)dK@ 'b )n8M X`Kllˉh& h)` h0a a0%g;0# f;$0f;#`x2@ahhlʠebˌ *b+ +g+bd )@lhf`fk $0n )g{Dplxe{`!)*e[`PXm]dkn[dKea()@dJ`KTDbhn)( h&L. 隠gllˋ *4 jabaj+ f+$L "dˌah(,d+.e  " , P -8f+fkl̠i gˌ g{p8ye[h (e n ( j{ pp'` d ,` ph"+H`knn0`lkk,`H`gz@h`i{`!ik`mb j !jk`nekh` `&`fj$lkfh (@`+.d@bb+T@gnK(@<@ @!l˄ k(! ɠb-je[`` \!0ag;g{C-$M`P0p @`` 0pp8 0pV  ,``p 08pI  0, ``p}8p<  0 ,``pp8 0p(  R / ` p LB\^1!Q+̠J8p`$ЍN R 0c @-@!1 M0 M` p080p P FP"#3 0 0 8 30 ލ ЍAp PPX FT" @D0*@H5vN_HtH^ p@-+,@@PPpcN0Pp\A-P8ApM@0SE P< q p@J` J(0``0J@@P"@J` J(0``0J@ @P @@JJpЍpЍ'?.@B@- M PRZtqt1p`@PP@@T 0Q P Ѝ$ 7ZP @ Ѝ@ +ZP"0S- -S?@0 0000 ` 0V 0SP0+S@@D!0DSX ZP0S +S!@ ?@!@ܫ D\l  X ?P L0P00 1 R/@P/!R/Z0@>S 00 00//DZ@-M `P @e>ppPU0D>S 0!31000 M>Ѝ>SL 0!31000DM00@M00Y/-p@-MNP@U@0 ` ` EPx0x 08 R;0Ѝp@Ѝ/0 a0( ( 'Ylx H`H =QC #XA\#\ !  +A /R   /R   +S -S =S000@/Rh-+"    000000 0@- |A@0RuS#WSRX0CSH6 ,0!0R \PSPQP\     0 T 0+S -S0I@O-LM`V 8@0 (P(0,00040E`pB  `L @ FL@T2T7 `000000   0pa0HSt]rqpon7lkjihgf*dcba`'K00K0@K`@LЍS  "=X  R!   P:0$`K@ $EK R "@$`0ኡ  Y 0 S:$`K@ $EK0S 0"0C$`0X W     X  ,X +X@ 0-S=X000$ | 0 P @X B R񏐗~}b[fxa^S  Z0$`MKP 9EEK RX "@$`0ኡ  0 =Xv Y+0H?o20S Zp 0W0 X00 Z$`K PEK0S% "2@$` 0T 000 W  | ;zI?xI0v0tW  p |0S 0 S2*- + H  @ LЍp'}C~p=X   00$`J PDJ0S "2@$` yq$`J P$DJ0S 0$ 0C0`1DsPJ00LЍ 0Xp+P-@ +0B XR R  +0B 0+R XR  -R  X@PPQpU -0M   3p`ЍP 0 @-I/o`/00/00/00/ 00// ///00/ // /A-@p`e8+P8U PU  0  P@P PPr]P \000p@400I0PNLIP  0p@-P@`T =@T0rS 5Ppp@-+P0+Spp@,p@-MPr\@` @  0P D0P0 ` @Ѝp.  0P<@- M00b0P0L10 0  <100S>p@( P >0 0 00S3000 Ѝz0 0 @/ I@m>d0 00S d H00@ Ѝ(TIx܎ Ԏ ̎ Ԏ @- M P"!0(0040000310`0d0(0040000' rd0BY0P%Q%00AA0$0 ``00@E,0 `0@0 `M`M`K2@sp L GzG@  T 8  SQ` ̸ O-@́̑!M0 Q:Tf PU# U* U T 0^ S^ЍTPU U U\?^ @0@ 0Pp`WP PPPP& PW P`0T`Pp0W 0ST:0S#`@0Q @ 0pP W?[*!]-JE0@- M0MK04000S0 0@ $03/P H0 0 4 30 ۍЍP<8<G-P` ``a V00"5Ep@P5 PI 0SH 0 R0CÐP0P1 U  \   1`V*o`CqaP Y !KEE 0   1  şO-px- MMM㰠UE0 `nE05T004*0U@@ R R 40B?o2 000TU$00 S0E0 )0S}0000Slp0+(0:=(0 @  (02/(0Z 0@ 40000:0F,00 3/ P   0S00*  0.S 0S RV: R R   (0P8 (0* R $ (0R(0P , CQ/ 3 C1100 0 P000$0 000S  0 P80: S 0" $2 MލЍ Rv 0 R u P (0HE(0Zu@T  R e0D04/P 0 000b$00 0 P04 j 0.Sg0SR 0.SaN Rg  0@0*  2/0S  00.S7 F (0Pr (0 C 0 )P$ 00>D0 Rs B00$ \Y+D0/ 0 00@:9*X <L7G-`dp`" KMM\ؔܤ $ 1 //\P @ P\/\   W!1 0 4 30lKލЍR8/\3^*P`W0/\ \@ @PP 0   R  = V/R * R( R 0 0 00`  0P!K R @ (03/P 0: SW/00Ɓ00Ɓ TvC/0P0P"44O-PM@$$M; ~^0` M 0 p ^  圤*^1 0@^ ?^! [^ !R 0S0^@000WS 0GZ 0< S H@V 0,@ \< 0 0\ S #0 @ 0  p G0 R/R00B0 4[S 0G*0 ;P4S 00C PJR*00S;R{ W @G 0Gz+ @PV t"; 0 2 ۍ$Ѝ@T@0DjSq 0]S2!R020 ]R0    -R0]S` 0010 ]R0! @, ;  0LXm 0\ Sj0LXg 0\ Sd0@* 0Q 0A  001A0 -Q Y;P\@0 0 p050Pdk0G*0 ;$PU 00[0!R0 0@0SJT@a2?**/[!-]\ O-MMQ8@Pp`9  @ =0S @}\ \ [\ {\^! N\]\@ \ ~ލЍ @ ]RRR @ QP+[S0 S]S*SP[0 P{S &,S^U ' B00S0 &0[ 00ލЍ0]SS 0]SS }S^NU  E B   <  0A- M`Pp 0 S +{\ @ \ {\@0 pGP  Ѝ Ѝ0}S0S ЍA[A 0 A-MMP    ,  ` P \  ލЍ`` K RB ^ \^ pWލЍ\@p@-`Pp@0T1@D 0CP@DP t000p0S. *S9 ?0C R#S 1  \0S /Q0 S 00 /@-0SD @#S@7 S S$ S" 00S "S.0 ^ \S 0000S\  00"S 00 CR S 000   !0@- QM MP 0   @ % 0 )p @EO0 \^00P p \0 0 5 30 Qލ Ѝ0DH8  0P04v %@u w %w PG-Mlel` p #S$@0 VP@$ 0S %P @ 0S?0SЍt `p+0@S 004 0   0Sy ltlpp0fS0fS 000#3R0 $ 0000@SX 0oS 0oS0nS 000#3R0 # 000 7P 000#3R0 \# 000H t7P 000#3R0 # 000 ^7P( 000#3R05 " 000 0#S RP@0 S009.P0@@0Ѝ0 S SD .7P 000#3R0 " 0@00o 7P  7P0 000#3R0' ! 0 00RЍ 000#3R0 P! 000<< 0@S 0 4@  6P =Q-00P 6P=Q 0 0@ 0͞ -00Px$Ds ds $Ђ8r xq 0q `p p p o o o o 00 A-R` & LPpPpr@T ;P $P 0S 0P@ W0CQ0#R7 L0CQ0#R M0CQ 0#R N0CQ 0#R 0S:V 00'@T R B K /P= 0p'@0000@'@ e0 ST@;' R P@ᐺ$< 0'0'<Z0ST 0 <00  {<V   Pᐺ0S @<0'0W'P<P0@[0 0\ 830 0@0@ ' 3 0 00  " @'@2 0 00  " @'@0'0cp08400P00P08040fH 0S \<0'0'@V<@ Po {g ' @^,-vC<000`00R 0SCN @@H x0@' 0>0@:  @' 4@2@G0 <Y0 P @ᐺ0Q P@ᐺL0S0  k' `00C0  _'  P㐺@. P㐺@) P㐺@$@{ hppp5P %0Pp<`<`PpxDg$gW X ̶ p@-0dPP 4P pD`D`oP@ pWpfV ,W8+ C VTC V0C tVB p@-@PA 0S, "-@T :T7 0R/Q T&*0CT$ /R0C0C/QT :0 BPU0P!Tp00p`@@PX; 08@/S@0@@(@@@QQ xQz ؙ A-MP@,T0PC H!0C `0 00   ! 0b0C S0:.-,+1)('3%-`b10 060S@p 0S 0SP10"S 4'Ѝ T1r0:?1 0 Ѝ`@ ɵp@-PP7 0S0 o,@U3 0U.  /Q0C U!@# *0P/S@ B=>@T@!P;P 00pUX0 B@T@!@@4@0/S @ @R@ 0 4w -0DM 000 p 800S DЍp@-`Pp@ P ̶p V U ph @p` VF@@\: v Q?o 0?oA-@c^?c%^& ^ `@6$6T&pc@c$0GCH6(0c1C  1. "0;:(0C0 /0 @- /? P!Q/o /oC-@@bT?b(T) T `P6&bpb0xBy66U b1r1 . "1;:( B0 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C J@ @-p A J@ @-p Jg@ @-dp J\@ @-YpP `Q@-/00p@-P@` <Ppp@-P@ x<Ppp@-P@`D m<Ppp@-MPP`V _@T |00*Ѝp 0 :  p@`$ ӳs,QPp5 00 R hJpP,@-/00 0S@δx4P /"br1 0!@0lR0cR0A1R 0< 0 B``C/  `Q0"Q$I)\P ףA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BP`9* @:;P PXY  P 8@-P@, $1M`00\7 00@|p\ 00#30#^0#02S000R0@ | l0 0 2 30ߍpP @@ @(@$/O-`P⨏DM 00 ?0000 P 0  R X4p@p%Rt @0@0S 0R`0 S S0&4//#b!!"AK/ "bQ3:bQ#3P. ! P0 !>?3c112AK? .##.cR 3: .cR # 3010!00C0 0 0R PR02R0kWhp`% FURb,`_^]\[ZYXWVUTSRQPONMLKJIHGFsRq(9(<;:865 +*)('&S2on ,{sk"f  ; 000V `DЍ0@@0@000@ $p (Ph`8  0`,pC@( P9P @ T 0S $p ` 0`(P,pC@( P9P @T 0S  0 00S zV0@  000 GR +Ro -R 0400pp\:S 2a2c2SR0c$00 0(000 50400nU V 4 00000 @W^00qWZpWV8  9 0N00 494 4 W B 00> c0400@0@0W%S.UW+ =0 00v W\ ;0 0x0p S00W000 [ 0h00  0Y00A c04N0S00C  4/"b!!!4    (0 404c030S4 !!!v.B B4 00 ǟa@ 4  0@@0@000 0 B R0`0` W G $0 0` d' $0 0@ b8 0P `V' 0@ V8 0P0 00 Qu4 W ! nWl 0 Rp00ZXW^ 000O I 50400 4 04 4  B 00=4 40444 v.B B 00, 044 00@aa B + WP  RM 0s 0v0 @@?3J⊡j ` ?A1c1c B  B0  UR ZRW R   @M 0 0$0t3 @0(004X $p,(P0@W00  $p,(P0@W00 #/#b!!"A0K/ "bQ:2bS0#03"10 !A 0  4 DRd 4 0 MRU 0@^h  @cQ 0 "#^  z F 0/o"#PzVt 0@0 0 B8 <000C Sp10^S10L0"1 `GO0!0 BV 8 <000C S 8aP 000 TR RS p @H0 CR > A ALA p \WOJQ @ 00 0b$00(09LP)\(\ ף1 t0 Qd+ n* x* l'$Il& o$ Q00P00C4\`000s\qT0?2c 1A;S40f`2ca12T @0@000@-W@ A\N A R$ M a"b"b"@000$ (0$p(P, 0$p(P, 040 @) R& @" R 00@ p40 p  0P 4 @0000C!( .$0`00 p  0P 4 @0000C! ( .$00 0L"0p  P l24 0!0@0c( 0$0| 0 0 0Op@-P 0 00M`0,00 @ P00Q Q Q ) 0 |t  , 2 0ЍpP 0< ữ0( ᵯ05t,t,t,0@P/ P @/G-X# p`$V@P0PES  R  D=0PEV R  SS0@0D@R@- 0BAs@ @Q 0CR (@O-` Mz8 VPA @P;  pP< p$001Sp Y| Ѝ00PqP 0 0P Y0 0 ^$=00 W$( 0 M 0@-RQ M@@ "PP TU (0P Ѝ0 Ѝ0( 0 Ѝ0G-p!|1 0MM050`1`P L` PMp> @P<@X0^00pAtAT0O␳00 TAXA\A 07qύˠ$@P,0  (@ @@P P t `0 0 5 30ݍЍ@l(0@0g(0@0H 0, 0 -0 --M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-R( M @p` R00?y v00P @ P +00 P ! !  :1XP<  cVP WE V[X0 SPpp` `2(!(1 00 Ѝ`᫵pP2 PPSPpp`000XPC0 P P00 Ѝ0`f0`pP V xpP `\@-@ M(0S2 0 `(0` 1/qp0Pp  0 0 PUR <0PUn ЍPPTp 0S  0CPYi'P0p0@-P MD(0S< 0 #p(0p 1/qp0@`3  0 0 @ToR <0@To*1`VP ЍP@T` 0S  0C@o$'T 0  ' 0 0 R/p@- @Tp0 Rp 0R00  P 0S P0 c ( 0P0 0 S,P 4P 8P p@eEp@-P$@@Ᏹ~Rp@舱]4.@- @@ၱR@{p].p@-,PPt S@mp<]-1!0C-M P@00S   0 XR0  S= `8)p@ X80CS60I0 S0QT-*@DT)T' @00TX   "Q T #R.S 0a A 0C "T #R Ѝ`0@ؾ4  R  *4 8/+ 0X\S 040:8 R РS /SxB@-Pp`%P@P@0@D尀 U   㕆ᰵp  - MP@ %0 @p@- h` PPPp P p@PP3f]UJUI1 \l00p00 %00p70000   70D3( \O N`NhN=A-@q`p PUh !2#3b!b DqW7 0S$ RP QP0S! 10 03/P P $@00W L!P0 $@嬳0V0 P100S) 3/000PP0S 000S) 3/000(000 0p3/P WPVSP 000S)P0P 000P0Mp L4lL3JJ8JI=A-PP| @`Px qp Pf  00Rc<!#b!b0CaqV- pW PWV $00dqp0ST100S004 x,1003/P00  $000``0S 000S+ 3/000(P`0003/P 003/000$0S P 0$000HHPHHGSR: G-P000pS` 3/0Y @IOP  T0 0 0 0 Y @IOP  TT0 0 H H0 0p`P   /FXH HFSR; G-P000pS` 3/00 Y @IP ϰ T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  /Ep8((EA-@P QP P@`p\Pᱯ0`P PpW w 0"S o @00@`O-PM M Q0` 0 Q /QE P.00G PP7p/Q/ Qp @0/SS.Q8 0E00 0C S$/0 D 0 I0 0 " p 0: S-  S/ A/o" R_/Q PP ?0V0/0000 ލ Ѝ DR .QRV  u/R0W01ʨ! pu0P3 0+0  R'0 :(/QpPVP/0000ލ Ѝ ㈭`P `d00>0000?0000  p@- P\QMP>  HA@00X P@ 00@T' 1`0@@:T `^ 0 \S 0@ S @ 0:S@:T T0 0Ѝp\0P fH0 0ЍpO 0 0`0P/:P-0 S\ S:RS0@S0 S S@\ :R \:\0P:P 000/>0A@-@\  \:^|^00^0S R B|S0 0:SS O--MM '7 $0pĝ0<40t4!S S TG@`V 0P0(  ㇬PP 00S < [ & ϯ0 00  P@ 07Pv00 ` R0@p`0 S Wp :S \Sp S Spp p0Ti*R0+   P 0`0 SWZ@p 0#SS  \ P5000S 5P0:00,0:= pP 0:RPh PR0t4 00 04pVP/ pP* p):00e00Z  0 Sm300i:SZ @0T:H E@D P @P4 0:R` ` R,0 F C 00SpG:S:0 0E I0HZ 0 D0 04 @PC00EpT@DpTgH @DpGPEP @pPP0S g$ D0AT0: 0P#2 0 <4 30ݍЍ00 0ҬPP@ ]PP} ]|2@00@S0-0`S哭`0SRM ~0@凭y@00    :@s  4p,P0 `0 6/p P0003/004`X80,`0C0000 p PP  03/P$0p0H?o20 0Pm&0@/!00@c03/ 0  0Z0S 40S 00 ᦡ ᣡ << 8-M 0 PЍ@-4@@ P 0 0003O-p0`C M M\@` 0圓S S P@T 0S l @P 0 0 C R 830000#30:Q0#Q0S(  0R\Sz 2@0 T  P P 10 0P0 P 2 0   >0S00S\S00 R{DAP 0S7\S5 00S1 :S000 0 Sc4S\ A 00S :S|S@0@ A@M0S't!H1 0 8 30H ލ Ѝ %@P 0 0 C1 0 Y P |@P @@PP P @0 0   0P 50 0Pm @jDT0 <h 0@-@PP MP 0S n0 0$0 0   Ѝ0@XG-`= j@P dmPP 0:SS   d: p \S@0* QP 0:SS ^S 0S:S 0Q0@P PBd ᰪP 0P:SSd Q0 B@A0n0S:S 0C\6BC2PBYU?PK<;:9876?432802.-,+*)('&%$#"950+000C^/000C\@& @0 0 @0} @pz 0 @0v 0 @0r @o @l0 @0h P.P@ @@ @ @| 0@0wA-P= `P7 d㢨pP9 0S:S@@c0%0:SS   \0@AddP pA\@A p`pPἪ@`@@Ც@ 0@0p@-P# VP 0Q @0XS@@<,00A ^a AR70AAAW0A^TppO- AM M0p`#S\3 00(0 0J @`/004 P PPO P8T   R00CS4%210/.x,+*)'&%$#"  㜞4$ 㘞` 㓞0:S 84St0S00"2 0 (0 30s K P( BKI8T 0:SSa0 44 440$0<4 0 S BKJ4$; 44/ $0C 0$C0$G<4 $0C 0$C40 44 < (   l; t 9 0 00 d-H-M0S000 0 0 @ 0 00^100M ^0@    RL00 @ 00 0 0 30KH Ѝ/,4@-eH$@@00x hl O-P"2 @`0,M0$00㽤l20 R^ 00@`pR 0 QHP Z p P p J   J PP0 S"3#: O U(10 r# 1$4S!1$&@@x!00P @P0S?"@!1 0 $0 30= ,Ѝ100S  U r pP Р P 5SX0(, VT00#    PP P0S40(8'  l|r\ @-;(@M@@00=PЍH  { k{ {G[F { //=A z z k [k'kFKE{{ //=A  { k{ {G[F { //=A A{ k [k'kFKE{{ //=AQ@-@0M 0 0$0(00 0#  ,0T P0 0# 00Ѝ 0Ѝ-$M0 00 0WP$Ѝ-$M0 00 0GP$Ѝ-M0 00 0 6Ѝ [ b0Z/@-uM 00 0@p`010P8 xA|AV8O⒢PP8PTAXA\A`` 0 , @4 (0 0 1 30uߍ"\d 0 -0 $O--M$0?000301`S01Y h/h0  00 00, (00  pP0(%Ypp- 0S0 R .> 0 3 30 ߍ .P0 P 0 0C 0 S 0 B `0 zR1fPLKJj]~}|{yxhvutsr0p,+*geJ`\[Yv``YBR0000C`0 PB 0S 00 0@@00S0  @DT> = lP0 1P 00CS0000@ 0D S*}v00D00 SL0`I4 @<0 L`  H4 8 BPR '+[ 0ZpC0P M:jWp!vPP p` 0P + @MR^f\dZYBTSNMLKJIH654321A@?>=<;:987654321)/.-,+*)(!   XM P 00CS0!000pWP0 1S XR    0 $ 0$          00 0P0 0C0000 S000@XT @0 FP0@ S0 B0 0 R kP00S000000S0O >. #RR 0@00T0C0 0 >. #RR 0000C T0 S 7P Y 0 00+ E   BR P X *P@NU 0U00CS0P\0X 00L*P@ XRo  BR  PER*P P0@@40 cP<D0U0S00CC SP00[ *@@P @0ESH 40SH P  0@0CSPH00 400  0T0y: `8 <@DV*T *T@0 PT0i 0$0` 0  P n$00 p400S P0Sr 0$`0 00000S 0 @0CS0P0T 00*P@+ E  BR P X <*P @ P 0 @0CS0P0 IU00CS0P0X 00*P@W(  R H  R~ WW BRpP  n 0@@N 刀WiU nU00CS0P0X 00*P@ R8P. ARJ p BR P@ p; P4W2*0P@(U  BR P @p$ PW*0@P NR p BR P @p 00@<00 0D     SLꈀX@ @@H00@900 0' 00  $  0$  㰀   +  00 $ l @ H@  0 ;P 0 0C 0 S cP `00@00   =00@<000 0P0^U00P0@@80800,H0U 0$A40>>4 0@<@pD#C8`0-S ]Sm Sa P>>4 08`#C * 00000@ 000 0@ 0   +   +    )     00@90 0 0p *  + 000@ 0a0 0@0[ @40S@@@XL  M PK ?PS40bS9 2 P 0@0CSPH0  0 0 0CS0P0R%*P00 P P04X } P40@0  P 00CS0P0[ *P4X ^ P 0 0CS0P0R*PdSꃢv00D0?L0@`0@0CS0P0T *P00E =PT* 0@0P 1PT*0PT$0XpP$0P50TP`p00  00S0P0S)@T@ 00 0$@P >. #RR  PR  B   P 00I P0>>03SS 0PU0C0000P0006 0S P PYR Q 0$@0 0000@00C P0BP0 PX*0 @PV 4 P4 R*0P  P R*0P00 `SP00[ J*P @Y\Q$@`PPP0 R P `V0C0P0P  0S tP 0 0 0P0$@ P0PC cPT*0@PS$0xxPp$00400TPpX`  P @0C >>I v 0 ͡p P p0S )P0SY4Y 0S0 00 0 ᳡p ᮡ>>3PS 0pS0P0C0400400S PdXb*0P0@0 0 > ᵡPD @0C >>`F  vo7  0 h0p. P p R`<@pD8000@ 00=<@pD` PX*0P@P 4040P S@ 0@00$00 Pj$00 PaX_*0@PA P[*0P yPNXL*@0Pb800C08000]S ,0 P 0 PP80H`0vp80`Yp  P{P00 rP400P 9PT*0P004 ,PXs: `8 `8<@TQ @t YJ `8 @< `8 @D<)0S@F `v Y?` 8<-P$ 8<@`` 8<`@0 `8 @C<0 S@!@30PUG$P  0P 00 0$P<U$0X`$010:0 `pP ؟Pg @0C >>p G [  0 vጟpS P!YPE" 0pS$U PU WP0 T! P@DP UGLp YPE`0pS P W P 0C P0 )0@P 0@-@ MP 00 0P Ѝ0p@-`M@P@ u4P0 PtЍp^2pA-0P7 !@00S5 V0`1S010e C000PP! pW@0P@ ᅝ`PQ 0  0 @0 C PC00010  Q  Q*RQ' @<08 0  BP0oP00`0 ؛P ; B #A ?#@ 0# B0 P8^4p@-@P P|Pp0 $<@-M@ 04/@PЍ @Ѝ\0\ 0@-M $̜0@4/@PЍ @Ѝ[0@-$<M0  $@4/@P Ѝ @ Ѝdd0 @-M00$  $@4/@P Ѝ @ ЍZ0@-$<M0  (@4/@P Ѝq @ Ѝdd0 @-M00$  (@4/@P ЍV @ ЍY0@-$<M0  4@4/@P Ѝ< @ Ѝdd0 @-M00$  4@4/@P Ѝ! @ ЍYO-M@pD0X`@ P$ 0SP  $,0  ;/0$ 0H@ 4/@PЍ @Ѝ$ (@- @MЍW0 $<@-M8@ 04/@PЍ @Ѝ\0\ 0@-M $̜08@4/@PЍ @ЍHW@-Pp`ặt@t0@l@ ᤞU  |@0 $$ ⑞<V 8 0O-,M`PP tE@0P0 00E00X5p0ʿ00 0  P @0 0! B1 b80B p  U\ @4B 0@3A0S0 vTvtsrqpogfedcba`_^]\[ZYXWVTSR]PONMLKJIHGFQDCBA@?>=<;:9876543210/.-,+*)4'&%$#"! #       0 D R R Q  R \000!#300@ 00@00 @0`PUF*,Ѝ R\ 0M$ 0ڛ$ 0`P S^?0@00 0  ٛP 0J ZS 0  0J ZS 0-00h10000 ,Ѝ0\  r  `0\  s  `0\  a  `0S\000000 0``0\  b  `0\  t  `0\  n  `0\  v  `0\  f  `| @v 0P_ Z0\  @`oVA- Q@Pp` ရP=0D! D?o2]R0S h0$"0 !@1= 0 V V 0 P0 Afꐯ A-p@P` P$T0 AQ_T !T '0DS(0$"0 !@1% 0 O-pX'-SL7UM 0瀁0L10,7儱0001P<0 y @u0P(0 b`m0P,0 00S080p 9P40 H  8 T. (`000P@Tp` U T 1 # 0P0?0S0e PkP P6&0 Gg(0@FDA T @! D`#0P$0 0 : 40S V D0$ 0C BP$0  T5? 00*R  05` 0$0'R` 00` 00` 00 `"00@`\00000 tpT0 (`,$@T+ 0 7/P @00$,(8($4 0 L1 30Uߍ<0SP,@ 9@p(͇0ňp` ć)p@@庇T @@@- M@Tj P,,f5S S%* R| ` L0Sy 5S0S@`T`L0s ,0 @L0S,0 $0@S005` Ѝ 0BSR@ @D 0R\ 5`V `ƒV`05`V    ,`嶒V`P@,0  @ Ѝ P@ 50 $ 5@T 0   0S00,S,0`P00\` ,0?/P Vv p /0p0 00@ ЍSR 0 , 0A/P0/0 \ @ Ѝ5#W,0T! PM ,0<,0 P,0 ਆp(W 505t,0(孇P;(孆+@备P% (壆<, P 05,0@<,0Q0S ,  sp( 505@@90 0 ^0(`n`,0<,0&0 $ 50 $ 5  T ` R%/@- 0 A-LCPp`@,0<0"% R0 R@T @嘑T V,0`<,0L0`S00/S , @ 0t pp0@ P0[ 0 00 x0x 0p@-@P R 0`00SLp@((((@)x$1$0A-P (M\`@ @Ppp 00 0@园 P& 00CS'  p0 0 0 4 5;1:(Ѝ 0<080"0 0(Ѝ0(̉ p  0 0 '0Q/0S/S/O-pM`@ P-TPk +T@` 0 0Th W p pǯ 0  0 P !ˎ @00D \a0DSW0DA0DS70DWUY :Q P S \ oP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0@ 0`00XS00 C R @0` p0 A BRWp pꙙH0BR"\04 0Sp@-@P0T0Pp$p@-BR"^p@?@P0T0Pp@-LMp`@$0 P 00YP LЍ`0 kLЍC-P!1 0MM`0p0<0㙍l! @PS `1 0S ㋍P(/ u  cP& 1R P$P yPP 0 0 < 30&ލЍ 0娀R 0 P PP0SP 囏ᙏ@P(H(呏0nS"}P##xnfs"uniop@-`T@p@  P@P pc0P^Pp`@-M @qp 0: S  p  ]Ѝ@ 0 ЍЍO-P-$M$@p @fh300;#;S0 000U00Sx00w e00@P` U *<@F `PP@  00 ោp P@PE0S: 0S00 "  X*0 P  P 1T0PJUPP6ᇌP@0@D`@0 @@p$ 0$Ѝ0 Ṏ000 00S0@ 0^P @  0! 0 0 t0 1@T 0. 0 SZ@ T  0P S x0@  ppu0 \PV p@-P X @T @RT0 0p  UO-P M Qp 0 `eV 11* @ 7/P  T VK:00S0 0 ЍO-RDM4~Q@ 400008Pŋ P$ x 000T0(0u@D4` 0  $P00( 0  :/@PppV*000k000 R`d `,@0P@P U` :/PP 0Y` ,@0PES*0p P@0PU* E03/P P 4 0pE$ 0pZp 0  S ^ 0* 4@ 0 ,?0( $@40, S ,~@DЍ$4V  PH PW0P@ ZV 0p'Sv0( 0S 40,000,($ 00P<0 00  0( 000,S$  C000(0 0 0$ P0C, 0 00U00U0#Sz `:/0P @@p`pS:/PX @Y0V0 S0 T 00T0003 0RP00 R0#03Q0S P0S 0P 00C0C 00000 00( 00R00  00y 0SPp 0Z:0  J3/P4 0PJ$ 0PP 0 @Sp'HW0 `0@  S`^ 0* Yd P @ꉐ 0TPU:/P@ P [00P50P1p1 * @:/Pp [:P0@V0US[ 0T00T 0003P 0RU0 C0T 0T0@D @3000@  U 00< P @IT @00:/P 0TPP@pE ᛀ) :/P p PU0@P00 C0T0T0@D @3 P0@ R 0 00P R P0 0C0C0  C0P 0PC0000 C0P0 C000<0, 80 S( , $0, $ ,0YP0( 0 H$@8 f,@0@0$0,040$0@p@-@ PU 00S  RQ Qp.P{ 00P{  pH0H 0 R@-@(0(@xp@-M @T TPT @TЍp0 Q 0QP ``#0` P 0 RЍpp@-@MP`0 S.$0010 0`  宀P# 0 0 0CR00 U S R 0S$0Ѝp\$0P0P 0 R@-@(咅0(@ዅxA-p`@PP0 00S (uP   (i0S `P   0S(O0S00@xp@- M00 uP 0`PPp@  Ѝp@d0 S`@` ЍpHŸC-`@2 08M000@Ϡl1?2c A1A11A@@>a\AD00ä?8P=<;:9ZDDW7/.-+)(5l_#$~|H F-  U [n 8-(= 0 |0 30}Ѝ #`!!4A ,P0 P $0(@:, #"0,cR:,c2S <  @@͟ 00C L``C@ @r  ^^A!/3b112A0 <  ̟ 0 cPp<5: cP` ;0!3b112A0 K 0 S 0! [ K 0P Qd;Q0 0dP  Ᲊ [ 0 S  R    BtQ1:0/A!b0dP  ᒉ [ 0 S  R  0  ``:Q0 0dP  n [ 0[  R  0  `i 9Q0 0dP  E [z 0 Su  R od d9 / b !QQ0 0dP  & [[ 0[V  R P8Q0 0dP   [C 0 S>  R 8 0   ` ,0 S0C0  B1D8Q/0A!b0dP  ߈ [ 0 S  R   1 '(0 dP0  ň [ 0 S  R |'1 00dP  ᬈ [ 0 S  R  [ 00[006 Q0 0dP  ለ [ 0 S  R  001?2c  1R11Aãd0Sâ/d0CS0c0(6dP0 Z [ 0 S  R  08   8  `S80S 0R05o005dP0 / [d 0 S_  R Y4 0  `*M0dPS004 0  [@ 0 S;  R 5 [3 00[^, 0  ` 0S8 4qp  qp 0P3  0S! -R? S30 [ K  S Q X# L "`1aa!B! #<0 dP0  ዇ 0[ 0 S  R  0  `/  0  `u`0 0S%  P0 Pt [ 0 S  R Ps0`8 i0 S  1h [a K 0PZ QT0S 1 [L K 0RE Q?UP 1 00 / b !Q dP   [& 02(  QhlP)\(\ ףmg hg \Y f X 0f *e Te d (d c EwwXE E pE XE HE 0E P00/, 0p@- VM0PP0T10㓚p! 0P1u`@u  u0P`` S 0#< ,0 0 T1 30Vߍp8p@-M`PS^@@PЍp A`P ]P ]P 00000 PPDO-(,p`@]PP pW0SP[5 WP) @ :/@PWP0S 'S[ WPPW }P@@f P~00P WPtB 4B G-`R p@P8/PPV @!1 G-@Q0MP`000S UI U P.00!1 0 0 30]Ѝ 0p  )0P00S000 GtPP 0  ]P ]P 0S S\P p@\p0p@/p@-P@]Pp >p@] ]0@- MP@q\P Ѝ0|]P 0S00 ^00000S /p@-P@M\PpY]P A\P <\P p@6\0S S  /0S0/ R R   /0 / 0 / CR  0 / 00/ 00/ 00/0 0/ @-/ 0SAS/0-$(0@# A  A A A0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030p< eWP7 YP RP (! 1 0 3 30?ߍ(3@ R. R  0 J} p0S p0%  0 | 0 2}  R4P T Rꤖd7 7 O-IM4M@PJ p`$ PI=,0 0S S  pH@$I= ,0 2 Iݍ4Ѝ RJ- RW# " "  J= 00岰p +4# 4J8#8  | J=00PnJ=  00SO S UVZ J= 00p,$3 00$00':00J0 40@SP @'0Sn0S  0S0s S0S J= UV 0 ( J= 00piY\ O < eVPa P Sm 2b"!4b4#"R<J= VU 0 p[pYpU<0J8 J- 0%$ 01Pj iJ=00P00J= 00lS Sm#< iJ͍ 0 pp p 00SSL2Sp S SJ= 00Y0  UP pJ͍ fPpqL6 5 x5 h 3 O-`$@4 0MQ@pDH 00020P0CS,w6)('&%$#"! : QWX00 R04 0S SQq#3 0 0 30Ѝ30030H 0 D@pЍOgWX= "44 X#8#8 p{pP'T%0SR0S # $$("(4 "8#8 DW{PT QWX00VTDpVT 00" 0  7{ cX* P00Sz "0 {T@@? 00y!D {PTp!0 {iT 1i #Q\倡們P0P p0X! 0 zP030#?W@D p0W0 0 zP030#?@D0Q0 0ĠĐ P0 pUp@D 0m   zP030#? \  z*@<p0 0 / L/ . . 0@ t. |G X. d? - F D- O-p!`1 0IM010> P@p6 .P PV kP&VO 0@S008#<tx'4'< 110#  0 'xP 0 0 1 30%Iߍ [: Jv Z"448#8WX 0S P 0 I0ꚓ 0@- M@P 0 o 0P  Ѝ0R Ѝ0p@-MP`P@@P@T 0S  R0S 7P@PЍp/PPЍpp@-P@tH$Hp0. AAS0C .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0Rd10@- $M#B 0( A S0 0S  R lQ  hQR 0S0\000$Ѝ0\ 0S S!0S.  R  R R R0 S 0/0S S S S S00@-/ 0  00S S00/ 000S00/00S 0@-P M@Pj 0P^F@b0S0S 0S Ѝ0/O-P-M@"4M0 0$08 ,0 2p0:,10`0(000  ```   P:1000 0 SP@ 1] 1#X 01  8 PP 0 00 000 08 P KY 00 8,01)؍4Ѝ !448#8S 0 0PU 0S $0S S S Y0 0 0$0QY0 0 Y0 0Y$0 0h\$ @ȿA-p! 1 0AM`@0 40VP PPU( 0@ `w # 0 0 4 30Aލh0 RP P@ .R@ A>PdEX 0 딾( A-@TT!0 MS  8 S* `V" pP Q 0S @ T S   0S QRp`Vx p0 0 0 30 ЍL0 0 0!  Xꗐd@-`QM @QPp Q Ѝ RR dPP,8#<8#8U R R  P0R  Ѝ  R RD0 P 0  N P G-`p@ otPP  p @  p@!O-@-hMd)4M40= ,0 080&<$00P :&< 00!S90C &, R &, R(0 0: "448#8S_n 0F @0:0 0 pWP00  03/P &< 00@&, SS 00R0S00j fP0<040'4tx'xWG [7 0D0$`>j,P@ H0( 0 ZPE0 PVpP^00  03/PU @NWpKWHWZ 00S W+ &< 00SWWW !WU W<mt0@P0S(0S<80ZCW$0HD00S S80 C, 0 0SP, @0(PS$`E @T ȕ@ pPlp tT7 @0 0%|%x% %% % 0000 00uWP + ,0"!0 R R 0   PR, [tTU LE0Sw V00R @p$= ,0 2 ݍ4ЍV0@0&< 00SQ  G'WR.0@Y: T:30 0<s0@PN0pSpW i$(%$50 5s (0S: 80ZC@$0\RC.@N&< 0@IPF #40 0%u@00SD@s6V00<:04Q < } ᑎy$0DRC.@<0H %u00<0\2z0 0 sU@P 00  03/P U 0R 00<@j: @"448#8SPPUP=(00(0Y Uz UU@\10 0 L3UPP00 ! @ P qPP !Y@ L0R4  4 S Q 4S @00@P#UP@0@0S 0R $ R R $R 0Pƍ(Ĺ\ J8  O-`$4SM 0@0D10pPP pP $p Y8P00[3  P00 000 _P @pPY 0  MPrr@P#3 0 D1 30Sߍ0000U Pq 0 .P0P R R. B/o" Sa d! S8*0Sn 0 00 DD0Q 0 pp00 Paʄ0=S T0S4 S* S) p0S 0se[j0S T00ursrP0  PrT0S00G 0 k000  Q000S000 0 2 30ߍ0 0|0 S0$00$00 `P$`4>$00,0@(z `\6< l2 L;20\0 |0 S   S  Q  RQPP  XPppWS|0R0Q0S 0P^㄀Sg : P|Q ,0 z0S Q0zS %s0P40 pJP8x 4  B0 pU0P00^X[ 40 4<@D@P@`XG 0S0pS 0S S 00S . `PD0 0 8>`< R R R`0S0S`;0SX: 8`S0$00|0 P4<@@`D8o00SzXz\t0zS0SC x``>4*4: 0 ,*@ 4 *0,`$@ 80Y?@ <0V 0 f362 F;2P |0SM0 S F SRCQ Q : \Q^3R?o20S QP`0 `P0 000804 e?0<00PZ@P񏐒0S Y`V `tV`Y(? Z 020 P @ 0@TPU 7m0P0 gP0`ภnT0:  0@@P@ PPRnt0S 0S In  t0`0| 0dP)b: 8P| R 0z0S Rx0z0e  rP : 0P00z0S z`p,@$P00u`V0 $P,@P@@p 000 Po`V  R R R`VQ $@@`P mmV$@D 00Swr 00`|`z 00 P 00 :0P00 0`z@P mmX_`]  Q P $0 X 0S 0A\?o20 P00S>0S Y p`5 P 0 R   L" l1, 0S = 00 8Umz`kP  0 @@P`H`ZPjP HJH HT0 V@0T* /m3z0:0$Pt` P@z X`@o `X輐Y0|0D Y000 000 0 ۬: А bP }aP3D0L  L0bP00D( | z0T SR S ^  Q 003 Sኡ*0 S :0 SJ Ha@$P1 0 z0"t0R00lPP @0T 0@l@0T@lt02`zp,@$PDꤥĤp Ћ l3 D Ii . >@4 lbP1x00x0 NlP@0T00T0@BlP 0`zO-LM XXa `@   PP00 0PD pp R R R0 T@0Pp ((0(  P00 U pWpW 00 ᱆pW0S 00SU$@LЍT G-`M  P@P p ` @o00  0P <0S0- `ЍqPk 0P k@D@PP <`PM 0  h O-`-M0P 0@0SP O$00S(Ѝ  @-@ liP 0  @0O-p"|2 0M020) `@1 p! GP PX PPQ xP Qp!1 0 2 30`ߍ0@SPX 0@SZ00 01P 00 0 P ZY0 S 0 ˡ 0P0 Y:   X 0S  XS 尡 P 0 8ꍄd 0@- M@P 0 H 0P  Ѝ0D Ѝ00A-.L RO-LMP `0 D@00p840 <0T 8 0 ȟ 0%00#0(<  .  " b* . ,@Xǂ@# !p8Ha@@ 0"00#p0H<@@ ,  " p Gb*@ @!@@$$ @ǟG #!(p ǟa 0"00#,p 0ǟ<  $ 0p " b*!){G OpG@,4pTGǂ@@# !84Ga@@ 0"00#VP0p: sT0hV@Hp` J0S@@:p`F AZp@-P0M0`@ 0 00 !? 7R8 bx b   D 80 0 0 30X Ѝp@{i < G-M\\Ÿ T2T"0 `00  p6 0R P  0XS PPc(p,p.@ ЍXbP  (,@(}0  Ѝ0 00@- M@P  0s P  Ѝ0 0$  0$0 P Ѝ0.p 0$0$ . Ѝ0O-@dULMP$0  @@0U0PH$0`pPC 0 @@FP8$PPU 0`Q QB QR Q' 0U 00S| ``bP  `0 @0Fp R  R/ RY R 0 @Upb 0J[J0 0 0LЍ   @QA@  0U` (⼐p 0  ,  p0p 04`W G   ``` @` `@U 0@ @3bLЍ 0@@+bLЍ `^ P@Q  QA@ PT ^ QP @  ,  0 p    S QARQ  R  P@ P@  A X% X X9 p X) T( QX X X0` `b`  ` `   `Q@@   P@U`a. aoWO-P M<`p8_``0@ p    $$[0`(0,`ĕ[`3,`XI0-0(ppP pi QFpv&pUU`+ `U( PV%Y5X( 0XQ #((R8P P4PE2PE1PESPE`0h  PEP:`4;P Ѝ 0 a@ ЍX030#1!-05-0%0Y" #((R8P P4PE2PE1PESPE`0i PEP8`09P P4 :0 P0 80p@-McUp. @Vp5 `0v0'0 @iPaUu 'V o0Px  -P Ѝp00VЍpBU 0 Ѝp9U A-'Qp@D P`AP0 A{00h / @-\ ,@\ \ Q :\ :AT 0 N 0 A-@$MPE P0( O4`6 6v:p`A6gL8'@87;p$2'6g37 L-A@\  \000 8L9>031  (0LЍ1 0 0@-S@ 3/@_O- MP@X Qs 0`  @`f&AA! B B&"`F`F"f&AA! B B""`F`Fa&AAu! B L B \᧗" 0\ P3 L0 1 0T0p0`0`Ff&pGpGt'PEE!0F0C!6# G B("AA!0C0C1# B B%"AA!0  Ѝ QTr0`   J 0p Z K`f&pGpGt' B B&"`F`F"f&GA! B B""`F`Fa&AAu! B B0᧗"Z P Z Z 0\ 0X0 T00 p0`Z$Z5 Z1 Z3 0 p0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[`@p`G0|0x0t0l0h0dy7( G ! 1 p@-`P00 01000C 11.Q   @@P0: S@XP P p0 P 00C1 000APP 00LDL_\ ʚ; d4 `ğ0A- 0@P`@V @0`C0APP@`@ 0PP@`V PP`pV p0`C0qPPp`@ 0PP@`V  0`C0PP.S 0`00@000@ 0PP@E0C2S20/.-,+*)}'&%$o"! kf ]OK@2S2[0/.-,+*)O'&%$J"! I; /*)000 @ @  @0BdABdAdafAAFBdABdRnAA0000paP00` O 0PEQQaP00 E 0PEQ`P0兀ಀ00PE0 0` 5^0@- M@0$BÃ!l! A1!1@DL 1D0]PAD0@% Ѝ0 Q O--(FM@ ' M8 t d$ `!0PP006RPPU0@06Z0P40 0 060: 6 0: 6P0: 60: X0,0h60< P0<0 0  UP0 ?oR20S 80`1  <0` 0` 0V T _T0P0S50:,0e?Ⲁ5`0x0 `VJ X,0p?Ⱀrd50? X& Y80*^PT,0? )R d4`0   NP,4 C-40 eᐄ40 [p40 \QT4 0 `H0S\P 7Z0P40Z0 #3 0 d4 30Fލ Ѝo`: @\T0S 00SU80`1   D]@ I^0#2 0 d4 304Fލ ЍO;\X$弐,0!?0"( ,^YZ2DP0H@PJ^IIY:`d 0!$4$(#"(R(. X ^` ] Z0 1@ 000 .z,ZI0 IYDPH@ ꈡ0   Xh0 ݺ 0 ׺<`L` ] Z0 ` L忺0@ 000 .1, V)] ]K,vY0PPU R800 0 ]`1S   ;`1S0 "0 0 PL0 0 P9P P P&0 0 P0 0 P0 0 }P0 0 qP0 0 fP`1Sy40S{ < P5p0pW  0R  0\$pW 0pW  0R| ,0\pWg 0pWb  0R4 00o\pWHpWE 0 PS 0 ]\`1S   0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P 0 001p0 001p0 001p0 wx1p0 Z[L [tЍ tЍ 0 /0 0  0 ߸0 ظ 0Ѹ0 ʸx0 øQL x>ܹ Ĺ L< ̷ 8 \:( д | 4  Դ t T  @-`0 0AMM0 40@0p0 0 @;PP0S sD 80 0 4 30AލЍ./sPJI0,@- M@ pp P;`PP 0S@  Ѝ00S.S 0S Ѝhp@-Px AM p00 ` $ 0 @P  8 ,0 0 4 30AލpsHH0p@-S@` P0 @S XPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝ p@-@MP`X0S 0 @S 0S@V00ЍpO00@0 PhV00ЍpX 0@- MP20@0@x0 @T U Ѝ0l00 PEU:H@@ Ѝ08800 P@5 Ѝ0(48 ̮  Qp@-`M x00<@P 0PU  0VЍp_40P0 ` Ѝp @@T3 20@- MP0@0@? @T U Ѝ0p00 PU:L@@ Ѝ0<00@00 0P Ѝ02H X t @ 0@-@ M T ' T2T7 0DS3m~0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P0( @T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP ̭ ԭ @  ܬ ( 0 (  ( , 0@- MP O@'P Ѝ0 0( 0P  Ѝ0\ 0@- MPl0l@0A>@0 @T U Ѝ0O,0@0 P Ѝ0.H d Mp@-@ML ` 0 Q0PP@0<00 00. T @D 9S000T H0 0 <0 30 @Ѝp@Ѝ/.0 T1q@ ,@O-PM`@P P% 5 p 1 0 R ЍPv SPPP -\00 +\00 |3P0 0  R0N1011.\ 0 @T@ ➀( P 00 S #3@  PR Z 00 S # 3 #T$P+<0+80+40'<0'4 0(<'( 0(4 0((0P p 0S 0p X 0T00  0R00#3@0\SP   0R00#03 3TP ,0 T P00 S #3@ \RP 00 S # 3 #T 00P 000J00  0L   ;?O-pQ- \M0 R Č  $Ȍ (̌ 0,l8,#4[ :UZ 6UY 2U\Ѝ NTpRp(pO x t\ЍXZ HY 8ig< MbQ D0 Ԉ Ĉ @-@9P0D .R S0*SQA@0T.S 0@-MPp00P@QO 0v. 0 0   >Ѝ08 C-`@P@ MPpOP @U FTP@ W @ Ѝ @P@p0 0000 P|#0S0Y@OoB@#$, 6 C-`@P@ MPpx@P @U TP@ W @ Ѝ @P@p0 0000 B P7#;0S0Y@OoB@## 5 p@-@P 00CS0 S  P 0` PpV`00CS 0 S R 0/V0@-M@<0 0϶00 !R !8PͶЍ0@-g  0S0@0Q R  004S 0@Ol@0QR Q  R Q 3Pp@-@@P@0P`0pp 00,p@X0#2P D D0 p@-@`P0pp0,p@ P2PHH0 A-@pP0`p0 A1PC-P0 M0`ppp@ HD@ <80  @Ѝ 51PxC-Pp0  M0`pFp@ (0  t@ Ѝ ~50P0 0 /t0P0 0 /T0P0 0440PXA-pP0 M0@P` p 0 pЍ 0P 0 0j/P|@- tM pP0 `p@ ( 0  X@Ѝ"5/PC-Px0 M0`pp@ 400  @Ѝ 4.P8@- @  M0 Ѝt.PH0H 0p@-@0pP p@4p,.P0   0-P R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-M(@,pP  03`PC0S P0S7@000  0``0A 0ЍX 0S0 S.R 0 R.00 0  .S 0 \ \  000p@-P0S@` (0 0C0p 0 pO-0 M@`PP)X1*00T,:Yp* ԰Ԡ@  Tp  ူp0 @\  P0 Pz000000 Ѝp00 PG Ѝt ؞ ؞ x @-R M @ 0ASPAA`0 p0SA0qp0@ ЍD0hP Ѝ 2 00P`t O-p-MM0/,0= <0 =-=80< 0 <000=004080@?͍0$0=P.M00 P 0S` @0⯍P 8P(0@0 P0:= 0 =H440`P= 00- 0C0H;0H; -0 0<>h0d  0  Pp*0LPgZZ 0JS񏐺Exu>rt:xc7TxRe.-~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      T0 P^Y 0S .Su 0Sr 0So00S.Sbjl9ZD =<00S 0H)0C ( 0, 0 B QP5D0Sz@  0D;pD+00Sd t`【0`Sp[ 0S @0D+@T 0Y4  0d  0  uP@ (= <0 2 ݍЍ词@0 8P(00 XP`0 0P:;=<00D S1d D; 0D;t700  5P( 0, 0 B PH 40@寍@0 8P(00 P D;0B& <Q060d  0  PD; Rx6 00 B(0#8 ,0(00,0D+00pCW``W$p@D+ 7 V@ p I 0 PSWrʰ0 PI0 0&PAt5 000W#80P5$ D0N 0C0 .  . 00CS W0 A0 PD;`0DkV:U`D 0 PD;+$0F ^D;pd0`d 0 00  cPD+0D  d 0  RPD D 00D+  D+d 0  >PD+0D;`V  spD;`V0D;  0d 0 00  "P(00,p`C 0  P0  P 0  P=<00SD F0D; D+  D `D00 D;0D;  \20 Ed y0  PfP:D '0D;b0D;`d 0 `0  PMD 0D;0D;0d  M0  P:D /d D; 0D;T10:0  P'( 0, 0 B :PD `1 A PpPLZ ؐ `/Z 00 FxP0J 0GS ዸ0 kP(`(t  t H!(` 0 L @    , ؑ X  ܌ * 4 X T , < D Ȉ P   T (  Ȇ p   d l u Ё  ̀ d ~ VUUU xp~ q | | | `i =<00SD c/D+0DD 0d  0  PD `41 Aa pPWW X `/Z 00 FPs0J 0GW 0 Peap`D D  PD :W0 PQ+ZD  =<00SD;8b0`d 0 0K 0  P8D0D d  : 0  P'D;p0SD;j*b`D;0SD;b*0d 0 0 0  P =<00D SP.d D; 0D;`30 0  hP(00,p`C 0  PE003d 0 0 JP=<00DS+ 0$0C ( D 3B!?C0 SH0 ,P=<00D S0$0C D 0 4P D;0B$ `D  %0 P( 0, 0 B PD; pBqW8` `V D;1 Z2  0d  v 0  Pb(00,p`C 0  rPV0 PN 0  bPF0 P>D 00CS D& =<00DS0h&0C =<00DSx 0&0C D; D+  D `-6*D;媠0D;6Z0 yPLD -`D D -D+(7D `(`0(  0 ]P D D7B!?C0 SM0 KP=`D <<0l Z0 :P =<00SD {-D;`D v-``2 D;0D;P80 0 PpD 0 -P D;h`D 0 P0D  0P D+0D; 0P}D 0 Pv D; D < 0Pj( 0, 0 B }P`=<00SD; R3-< R i0`d 0 0P 0  P=D+0D  d ? 0  P,D0D d  . 0  PD;D 0SS( 0, 0 B #P 0 uPD D ,D;D ,D H[D ,0 3D;H[0D;u.=<00DS 00;d 0 0  EPD`VD'  1R̠p`0 0000a= 0 0H+%H >- V00B- 0D; H D 0Sx 0  P( 0, 0 B P 0 PD H,D;l0D;`d 0 0  PnD 3,D;0D;0d  n 0  P[D ,D;`D ,D;pD ,d D; 0D;=0P g-< R 0B- -< R( 0, 0 B FP*D  Ro@>B!?C0 S\0 P_= 00H+_$Hkᚴ= 00`C= D  0HkD 0 lP= 00H+?$Hkz= 00`C= D  0HkD T? 000#80y|7 D;0B/ *0/0C % D;0B/ 00Q0D:H 0 $P3Z 0 PD;`DkpW@ 弯 GQ9g D0 10"3t/ 0;D0000;D020!20;D00030;D0#100;D0100;D=0;D0  P`Dk`Dk0S>0: 0D;D+00SP p〠0pSG 0S `D+`V 0Z6 :d  = 0  P) D0 10"3- 0;D0000;D020!20;D0000;D=0;D;D;D D0 10"3d- 0;D0000;D0200;D=0;D;D;D;D D0-10 0;D=0;D;D;D;D;D;Dw D;0B, 9` pPWW  `/Z 00 F7P0J 0GW J0 *P00,0C l*`D D g*D;pD b*`2 D;0D;;00 P` epPWW  `/Z 00 FPw0J 0GW 0 Pi= 00H+"Hk- D;0`B- Hk D;:d 0 X0  PED; 0SD;.*t*t * ` D+p@J Z0 P( 0d  `-0  PJ`p@ D;S: 0 ~PQ0)0C b9d 0 `0  jP0SG PyD;p`0`SD;0D;; 0d 0 00  MPD 0 BPZD 0S 0 QP D;0B( 0 (PO 0BT( = 00H+!HK2= 00H+a)xD;p0D; 0`P7d 0` 0 ` P~0 [Pv|0 PnD 3)D; 0D;0`Pa= H 0u0PY-  B H+ 0H; 0-PH0 P@D )vD;p0D; 0`P1= H 0E0P)-  B H+ 0H; 0P0 PD (D; 0D;0`yP= H 00P-  B H+ 0H; 0P\0 XPD (D; 0D;0`JP=H 0`P= 00-0C 0H;0 H;0 0P0 P0  Ph0 P`D  0 tP0 P(0 `CD;t0pD; P0, 0 P}D; R0 Pp.(d D; 0D;p30q0  P]0D#0C W00 PM0 PE 20 P9̒ g D;0B" Wvڤ0 Pn$` pPD;WWc \ `/Z 00 FP 0J 0GWM ᔰ0 tP0`0DkV:?0 dP j0 XP Z D;0Bt! 8 D;0B`! 2WP0 >P410d  0 0PW0 %PP} t} p} (}  { { z y y `x x x w Tw Pw u v v u t Xt Xt \] s $s r pr q Xq 4q p q q p o o xo pc n @c xn dn n o b Lm a m m l hm m l ` =Q| oP [ W0@0@PQ 00@ =Q  VPЍ`@QxZЍ`[P` W`@`_][`X`Q 00@=Q "P PZ` ZQ Q 0@[W0S `QQ 00@=Q`d @b 0b a b b b a a a @-0 a0S`A00XS=P 0SQ.C+S^2. @@p 0000   0 C R@0 37 #0CT0 \     0B ^037#> BC,  A-Pp<U00 P@W0`x0`W0 H.p\p@ R0070"200 0 S037#0R0 \00/$~o/˫ ~///@-DM` @ 0p0 < 2 0 RP =00P@0P< 00 0 <0 30DЍZ [ , O-M葟 0q娂)`ᩒ A'r0 i C0pqB!QP C@$Ah!dP@@C3.*T6W>YFX @00 SP$Z R 000    00 R @Ѝ0 W rP0 DhPW 0 H^PY 0 M SPX  ꉈ%I$: t @A-`pP0S.@ T$ 0D0 .R T  S\R C @D.R @0. 0T  S\R  @@m( 0 0@-M0 M 0 P @080P Ah P>o8 ,0 0 8 30ލ Ѝ0Y ` 0-@- M0@R0  ;@PP * Ѝ@Ѝ/ [( Ѝ@Ѝ/YPR0@- M P@  P P0 ? Ѝ0@4 00 Ѝ0PR0@- M P@  P P0 ? Ѝ0@4 ծ00 Ѝ00@-@Q M Pu  P P0 ? Ѝ0@4 갮00 Ѝ0p@-P@q4P  p@ p@p@-@P 0P   L  S h P }  p肮 0 pQP@- 0R R  m 0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!   P $ T@T @p P   0 pp@-PP @ P   T 80,D0S  0 p T@pH--AM  ! O@00 00 00 00 >00p0 p+l 0t0 4?0S 00S S S S 0t0 0t0 0t0 00 00 00 00 0$K10 00-S;298765432-,+*),+*)('&%$#"! 00 000 00S 000 000SG000XS xS2l=0,K00t0 0 KL K,KK1000 0a 00SI S10 00 B0S <0 40Ked0^eL 4KDK0# 800 000 000S 00S# 00 00 00 00 00 0S ʔ 0100 0000C0 0S ʐ 0100 0000C0 000 000 000 0/S09Sڴ00 p00 0S00 00 0p00R000 0p 00S 000 000 00 0Sl000 000 000 00S 00Sf09Sc00 000 00 000 000C0 0S? 000 00 0 Sʔ 01000 0Sʐ 01000 000 0R0 S ʔ 0100 000 0Sʐ 0100 000 00 000 000 0/S09S00 0eS 0ESm0S0S0S 01 00 000 000 0+S 0-S00 000 000 0/SG09SD000 000 00S 00S309S0000C0 0h0 0100 0000C0 000 000 0/S09S h00BSʘ0'Sڄ70 00 0S 00c0 00 10 0Sf0S0S0SU0nS, 0nSR0iS 0iSL0IS 0NS E0K& b0S; 00C0 0K& b0S000 6@0 0D0 0KT& b0S 00(S, K0K  _0S(046@0 ,0D0 5@0 0D0 10 00 n 00B0 00 0S00 0S00d0 0:g{{ d0 S d0 0CH% 10k{k&0:g{{6{ 00 0SW0SC 0S;0Sʠ0S {G{{ 00 k4 010{{&{ .00c0 00 R4ʠ0S {G{{ 00 00B0 kD4 010{{&{ k 4 010{{&{ 0s0S {G{{ 00 [00c# 10k{{  d00B 00 00 t0Sڠ0S t0S00t0 t0S 0t0 0S000 0S k3 010{{&{ 000 0S 0MSF  t0S t0S,2@0 0D0 <2@0 0D0 0S 0bbbbbx0" t0#20 00 00S k1 010{{&{ 000 000 0S@056C@0 k81 010{{&{ @ 4100 0!S0 S0@0 0D0 @056@0 0S00c0 000 0S [0 010k{{ 0C20 0Sp 0S]00S j00 00 '

D |00S6 \0S D0Kl@k{{6{ D0Kc@k{F{7{ {@{ \00c\0 ?A?*^ {k{.\0S 3#K#K#KFD0S@046S D0S@0Sg 3#K 3#K1{k{Z l3#K{k{'{ {G{ { {k{'{ \0S{G{{ { t0S t0St0S t0S {kF{7 {  {k{7 { @ 200 0"S%$K"K@056C@0 D0K@{{({ k{{6{ @ l20X"S (0L"S,0s% 42@0 0D0 e@056@0 /0S! 0jS{pk{{{:0 0S00 0:g{{ \0S{G{{ { 0 00Bk600 D0K@{{({ k{{6{ @ T100 0S) 0R%{{:0 0:{kG{6{ \0SD0S@046S {(k{8J{%k{3{!k{,J0q^o^m^k^@??A5?55?5???|P90E^C^A^?^=^0S \0(0 0,0 k {{&{ @ |00S  0" 1S 1 0S {G{{G Kp@-@P*Tp (0":k0cSp: A p 0 0 ꤻ A-@`V pP0S @ ᷝP 0S V@Ep@-P@PP0 S :pSS00 0R:ppp808 80 e~$0$ $0 fv01 2 L1 \1 1 ,1 A-P`L@IT,EP: AP- pPW 0P P B $$P W 0 P d d0d 0 C1L L0L 0 E(4 404 0 D0 l0 0 0 0 / 0 D0 / 00 7@-@PDQG-^8 pP@`  00+00CS&OC#<!  5\U0 S\p RXV``W`Q`VP\\T0 S@\` Q@-0-rw0-0-0x0荤 0 臤 0 0S wS -S rS  0S /xS /  @-P@20 0X 0 P P//0S/ S S/0S/0S/@-@ᆟ0@0T S R RT/ ?/PP/ ?PQ/?SQ $0$ $0 p@-/8, , P,  ??SS $0$ $0 p@-/+ 0, , P P P`/AP/Q/Q Q/?0 H0H H0 p@-Q/?S0?/0?/P+ + h+ QP   ?0/@-黣 0 p@- v1@P `P``嬣 Pᙝ奣0Sp蟣0P3뚣@Ppp@-@P0 ESM` aЍp 儣 Pq}0S   p@-@PpP Q 0S Pr30PSl3p@i3A-X Pp@PEX `g@P``O- Mp W" @`IW   K @PP0SW G!pG0p1 ЍP Ѝ  3p -BM MRč dd  X @ +N P]'  p H(  D( $ 0@- @-`RPp"@ M Mp $( N WG Ÿ R"@$@P  p`M0 H"02 0 $8 30ލ ЍMBn"` @0Mp r '0 B^P.!0 _4100qp00P NP\A AL+\ 92( PPPPPPUH ZLXU l'  T\' & TT" |& R0 4\  t 010/C. *      RA-P(M`p |@ 0 @0@0 P0 0PSN P@ 0 (Ѝ8% $  d00 5CS A/0cS#:*'R A/0CS!230 A/@-@T  S 0\\0 0NO-PMp ` P@P-ZX +Z @00ZU U Pap`㈞p"..@0J \ aJQW JAJQ7 JUT^RQ E@ 0T  R Sn 0I00 ЍS T0  Ѝ0 0XQ0A Ppb P A@PUPpbꙙD0BR"\00 0mp@-@P0T0PpH p@-BR"^p@Z@P0T0PpO-pM`@ ᢛP-TP +T@`00T W Xp p 0қ 0 ̛?0X 0㾛0b 0 0ᷛ  @Pp P 6 Q P  S  R- !R  00B ^a0BSW0BA0BS(70BU%| X[  Q P  S  R ! Z"00S"00 0S \0F00 Ѝ@`r00XS00 C R@0` p0 A BRWwp pvH0BR"\04 0;p@-@P0T0PpȤ p@-BR"^p@'@P0T0Pp r  Q0?0S @-J-- Mj ЍЍ/G-`PĒ00PE! R !@T3Up U< ϐP, P@@D @"00穒 Ố 0S0PU00咒 [P@@D0 @0ꐟ0 @0 0w XpA-P`JL@L@0 @@p |1U  TC A( p@-@PB00CS0 S  P 0` P9p1`@-@" 0`00@!- M? & Ѝ00@- M0 P@ 000} ˞0 0 0 r0 (0 0 0 30 Ѝ0Iܠ x O-0-`MQP 0 Q`\0 0(,PL 3p0:30: `ញ`P @  " 0P@ S0S S#Y`@T 0@ G T : @D0S Y@Dpn P  qPYp@D` R.0 0` 喞00ߍ S S0 S S `DPP 0  0C?o02P@  0厛 0P !W e*@SU @ 0`P 0S S S` SY W:* p``P @0S|0 0Q ᄙ T: 0C@DP Zp Hጙ @D Q ZP hpW y(E-G P  P 00.r(4- Pb pG 0p 0 P,.`]Q T1p@-0`Q@P , 8P0 p)0 X03/P+ @ U: p  @T0 X ( R W  R 0G'WS8Z :U X0  A@ pP4 R 0d80Q L0R00SK h@` pIPZO[P 0 000S !烡 Z(B(U /o" R WS0\` PT&00X 40S@0 I@H 0SSQڰ S"@UP0S 0 0X, @C 0@0CSX:0,P _+80@ XC 0 0CSX:@@N 00 RWZ5}0 0 Pe0  TN 0X CR00STʒX0$0X? R R R d000XV*00P R+W 4 XpR000p00p  QX$H 8 Q*p 00X 000X0408p040,00$0<0t3}0 0A P0 R  TD ,01Q05R*X@@0媕P@X@壕 0 CR00XSX0 @00X00 p|00< p%, P[<`w 0@X CR00S'X000X0 03/P X,@ 0(D0<)P 0,0C0 X0 %+| P00[04!000H8!rEnX$)X0P  A pPm0 #  TV40S0X@@P\@X@8p @A< T%+DD ,01Q *0X@@0X PB WD,@ 0(D0(P 0,0C00D  Д  tD 0A-@SpM07 S20 0N'PP: `P5 80 0PP&`   0*0Py)ᑙU Ѝ 00S S Ѝ0 0a)y[) 0  G-`0 00" BMS $ 0. SA~ P @ p0u #0GB*0P @T *X<<" ᦃ02P 0  "2 0 4 30wBލ 0    ! *&@PH pPC 8 0 0@IPAp 000 0000 0 0P(U8 0 @ @IP  ,00S 0  0@T(   0 0ܘ 0  ( 0  (̘ 0  Ř 00S Sẘ5CD     G-M0p`ᔘ@P0P0 0   0 p`LPᕘЍ 0 @PP A-M`pPn@P ,  ( 0  P* @rЍ, 00Ѝp@-RQ M8P@``/0SC 0S 0S0sA S 04< 04 0 0 0@PsP00 ЍpR R / 0 0 Ѝp0S  0 0 Ѝp0S00  0w L dO-P-P 000S 00R0 0ADB Z  8 I S  3  0I@[#:0C1PK  ᭒ [@v H p  ᠒ PE A W @A |[9'7') 0` 0|!h1 0 40 30N<Ѝ(C& P @D@&P?0P6      H|p 00 0&`& 000 0& 0000Ӗ0`0nA`ꨃ tȀ @-M@ 80 00ɠ jЍ@-M@ ((  9Ѝ@-M@Ppᣖ`P0@0 ) <0< 0  0 pY@ᢖЍ0H0@- MPP@T x 0 00 000PT 9 {@ Ѝ0@T001!0@-M @ 00p`P 0^! 0 0 N RK0100 N.^U 0 Ѝ R0XS 00 9^0 ^PE U Q( ,$V0 @ c#!$c4" 0O@0p} O-P"2 0,MP@0$00 P ҕ/ 0 " $ 2 ,Ѝ\"P2 0 $0 30,ЍOg0`:Q000 0R Q p 00$0 0 0 `p  ዄP 0- Z0@020YZV  $0[:0  "WF X0H S0 sbS ͐0 WP0:YZ Wp@:Q@0S  0Q:@!0.Y0$ XPʠ X$?{ x{ H{ p@-(M00P0 @ `$ ,&P* L @0 0 $0 30(Ѝp 0 ?x `x O-tM # 03 0P0l00 P / 0 P#H3 0 l0 30tЍ(#3 0 l0 30 tЍOp t0C01T0@ 2p PLT0` 0r 0S P r v\P  0S` rw v00 X0S  X``!<0 @j0T? P UW*:0VT09 J0  %YPI@T p V00 S 0SV:0@0Tpv `V0 S,*: 0 S&* 0CR00:@8RPX X X00S0 J P f80S  0 1v  >w w w O-MXX P@QpL ن(ZB U U U  0 ӆ`Ѝ0` Rz  ?0Z& + `PP 0:/qp  00P @ P #00 0 00㜆Ѝdp  0P  * R + L UZ p  0P 00 0SM   00 0:/qp 00`Pÿ\ <`V:X0`v R00ᨃ0 l0P :/qp0` c 00 0`VÿR <`VpX0PZKS 0\T 0<`ÿ800C`V0Y !QJL`0`f? ` :/qp@ 00  P  @ P #00 0`Y 00 NP)0S&:0C``0ۅ`ЍP`T 0S  0C`ÿ 00C`V0Y  0CI `\A @0\ " 000  ᤅ`ៅ`ꭒ 0Dt 4O-S-$MP  0 0z`0:p#0 B0S0 Q6  R00S 0BQZ  ! P ԍ `0p0[] U0 00 @PS  0SRRV  RR00S R Pd  D0 P0Po ^U T~ U\  C0 P  P ATq ^f S 0 P02 0SV. P) Q0 P@P 0 Q ^@T T' T. T6 Y@@ Q  p0Sp$ЍZ P 4#00\00 0%W T TT T S ᓄ! `p@-@00PFG p 00p0@@@p芑0TS 0 pp@-@PPeP P 0 03/P Up@op003/P U 0< 0p@/p0  0p@/G- M0 3/Ѝ/0@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ0 R R R //00/00/ R R R //00/00/0@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ0 0@-RP M0@ R R Ѝ000P3/P P Ѝ0003/P PP 0@-RP M0@ R R Ѝ000P3/P P Ѝ0003/P PP0@-0@ MTP T T Ѝ0003/P 00S00 Ѝ0 0R0 02/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ0R /C-`QM@p Q) Q PЍ0 03/PP WP:UR X$ ЍC0 0  3/P PW*UX X0P0U URPЍ  PpHHBP0SPP/px ;A-Pp`@P  R 0 R 0\A/W 0A/0@-PMSp@`  SW- 0 P R`V V V Ѝ W` 00 R D0SPV00Ѝ00Ѝ  Pp@H (#p@-P@MT` T T Ѝp0 03/P 003/P 0  Ѝp 000 3/P 003/Ѝpp@-P@MT` T T Ѝp0 03/P 003/P 0  Ѝp 000 3/P 003/Ѝp@-M@P0.S00Ѝ@-M@.p0CЍ R? ..R0) .Q -S.S AA#Q0L \S' .S 0 .Q AAQ0B Q AAQ0B QS  Q0L \-R 0//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C///*0 0 /Z P$ $M 0 0Ѝ/Z H0 4 /0 48!211!A1A!0 A]P㙳p X0`0@\s0X0}`@X0v@@&010( R003P[ 0k 3 ""pAk +\p6K 0 L0SE*.00:8,Q8pO-P,MX0 p4pt0@p` 0)[X> {P @Qa {P @Q㈀ zP @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] zPj  HZ$M0xSJ3  000 A P0XY /Rl ]RRP ^0/ $$ 0 ]R& PR " YXuP   Z J b" R Z A @Rg .RP`@ㆋ0@,Ѝ P` 0D0C  [4:w( 0 ,Ѝp 0 ,ЍP    Z"    R  PXY  ^0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYy U xl0G-paQ`=*0 S) \5 0P0S/ @S" 0W*U  @000@琐@@ P 0S00BAU0SPQP!P0WÊ( 0 TP @O-`VP3P# M0 VP3U0p\ @H @R9 R R% (00 ЍW@ Ġ[? A @ GRPR@\ 40S @[A  Y*@T*0Pͅ0 A\ Rɑ!" 40S 4 00- M ЍO-S,MP  [  0S 0S@0P0w @Pa \rTp000[000 0P0$@0C0@TX @0S @S^  0 XL*PgT p@0T00S 0 Sh*`V` ^ N Y[ R0P Z PC (00P0S  0R* 0G S 0S 0p$00 0AT" 0eP@1\0[ 00嵉( 0 ,ЍATX0S ! " 0SP4?<00 R```V0 S000R0 ABQ AAX QS R0SY 0R?0)4@0 )_ 0 ,Ѝ 0H p@-P0 0M0 10 `00p !@p < 40 0 1 30ލp@3xI I A-P `0 0M 0 10@0 (qp 0 p0 (0 0 1 30ލ3H lH Q:/R/0S/S:00/@-\@3$* 0^ @R R R ݈( 0 0S0QA^ R! Q 0Q" 0 ARL @-  RQ0A  RL   0 C螈( 0 /C/G-@0pTS* W XTӔP@0TS P`  o 0 i( 0 0QSp@-`P@ 墔P`VP@  0R p/pA-APUQU@A`pPWڀ1AP%( 0  0 ? 0 Q" A@-SRB 0@S A 0 ( 0 /-- M ЍЍ/@-M@ p TЍR/0-S0 \S  R 00O-@ M` P {P-Yf +Y_ 0Yh T @Q {2`paOPq2`pOP" [)SQ" K0I P0aIQW0IAIQ70IT| V[SQ;+\W0S \0J00 Ѝ  00YXP 0@ \@ AL\T@D0BR"\00 0dp@-@P0T0Pp@ p@-BR"^p@Q@P0T0Ppp@-M 00 0@``010P8 xA|A8O80 TAXA\APPP08 @(0 0 1 30ލpo14@ ? 0 -0 X?  -- M0 0 ЍЍ/-0 -M( 00 Ѝ Ѝ/> O-QPM@d 00S000!pR !5  wPP E`#3?`<0P*Q30A !!!!  P6 0 0 A U pQSBP 0@pQ 00S  Ѝ=T 0 @00Ѝ2 0 0p@-@MP` y 0~P yЍp0 0b< X0 0p@-00St@@@pdPddP@P@P w0000 0p< xP0 @-M@݅ Ѝ@A-Pp`0t@t@l0@ U  )<0 tS  A; <NK@-@P0S  3/000S@轅 A-P p@` F  Zj000 @P p@-@P卂Ppp@!1@- BMM0P@040PPPPP*010PT t!`D0S d!p0 Pe P@A0@ P> 10 Op!0 0 4 302BލЍPP NPP  5/P Q Q 0 0'px0 00P 20 0 - PT/9 9 h09 \ O-MqQpP  A@pf a@0` RD0 0]1PI 0SP p Z [ @@P 0[pP 0PU :Y `P`PS@P TP 0@U:W @0@0075@Q|00p@@=ЍP7Ѝ<00 o 7 D`T 0 0@-0P $M@P P0L0 0 PP $Ѝ0 G-RPL 81040SA a q`p@ #)/0@S-00儑 000S 0 000 00 xx0 00 \p0 0 @hG #(00P԰ L@0$tG-耟0S@P$0 @S 0plP`P0S PU @@P 0U00 h8@ 0@ P` `O-P-dM␐0YS3RQ0@ # 000Sc`0S00 000x#x3 0 0  0tP W@3@0 083U0 @ 0 Q  Q P0S-   3/0 0'@W$U 0 L00L9PL 0SI 0<00@00 0<0)P< 0 S@W@ RPT00S-! 00C0T@dЍA@@@, 10\U , 00S/  R||1$ 0 @ $(0 e@ $0@S( @ ( 0 [p+ p1S `bPI 0@0C00$ 0 @ $(0x P6 @@p $0S( @ ( 0f @$  $(0] |2 x\@   X @  L H  @-0N \0N@ T \sT 0 \i 0 0@- MP0 @P# 02c2c200:S Ѝ0;0 P 0 2c100:S<0 P0 000@-Fl@040F. "lV,h PTQhLl -R 0 P0R 0R R0p @- Ÿ 20#Lc\*0Sl S| 0C l l;Sàʌ͌ec\*0SZ SP` @ 0cϠlT 1C@010|0CsFno2ffaap1@S@ 41N?@1c1c0^0B0P0B\`D4lL S( 0S``Vàڤ0PA0A0R002c2cTÌ l làL l làP)\P ף*Qgfff$Iȧ0 P /0S/ 0 S/0S/0S0@//O--M0@ S 0 P H$L(@0 48<0 DWTŠౕnPnnAD(@,jP知GNΠ౔^@n n@,jR柵౐BΠ@N` !B0 4 jQ柵౐AΠ@`0A8j`0csP\0SjQ8v8V8F88f80Sj@,lX:lZ1! R4 Ee@PϠrllq q qC C Q BP^WoPU4 X%80 c s<0 <j( ;RT0:`@Qq( $Pz  UTZ WV^ V0 P@` Pp/  / R0AͱV0 aͱ 0  F"F,l Rl0l0U"R*P;<Ѝ"R 0S*0Zb/ 0*P;M@@` P P00C RWUW,`㸠  `PPH 00R 0R0S V00oW2 z6 @S%VCL00S R ;S,S SH0\- 0(\ 02FSPPE4HspP>0HmpP+ H00cH04H9 l@V|@hƃlhpp崠x|:… ᴠራ r|ЍoPo  0j [   1 0!0pS0S >S0C#1 0<P0:P 0,Sd0:P 0SH L$ )(l6 0 $ pbhƁ p60(圔ax|倆0*ğp0;lcXh4 1!?p00c0["\ L   cX*-S +SL P~L Pv L00cL0p p,0唃唓 p|#cR 01:d#cRp3 0! 0  cRp c s S R 0R㞁# 33 p0j8P@@D,@P 04p0f΂Q4p8P<@@00HS0Ű1Fp p,,0s 1T9u00H2`{z)\ ף{(\P3p@-@@`0S p@YPP @P x0 h0@TH0 0 8 9t@8  [H2ultG-@QMP `VC `Pb 0 000STK0SE `V LqVLg@p`_cPV`VF|pp 2V oPOTR hQ8 X1X!0d0 P000U00(a]PP`F U0P0\  RP e?PE  PE0P0U0S00#  1 @PP  l 0 0W@ࣦTD,u4r h[q( hx@-^Ff'P   0 h@T @8Ѝp@ k@-0M0@ R0P 00Ѝ@-@PM D0 Ѝ@<C$0$0 0Ѝ@0  p@-@M`e`QU d0 @LЍp, 0@ jt \p@-@Q0 0PP < 0p@ 0 0 0p@P0 0@-@P M    0Ѝ@@-@4M 0`  0$0 (0$`` ` P0 0Sp`4Ѝ @-Mˀ  hBP RZЍ- "P?Ѝp@-@P00 0S 00Q +0h T 0S‚ZHp=02@T_'ed  lgC-P` hR bQ€Zh r@P@N\ BZ^@!hp @ W@\ BZ@T SRW͌ • @WR hP  r@X@\ BZ@ R p SR00͌ • @X͌ • P0@-P| M@Dl00 0S \00P  0uP81 Ѝ0dsȐ xdx d!1 A-@P0xMP0t00S 0S?@0 S=|a`\`ap!p 0 |lP1H! `p ,` 0Hk00UP@@ l 0 0 t0 30%xЍ0娀 S``  pT 0 p0l l 0000 t0 30 xЍAk ,eeddT dc d8 c{4H0H 0-  @P000^ N @D0@-00@S $000S 3/Dp@- TP@Tp 0 3/P p*@Tp p0A-0`pP@P UP p, 0p `@X G-@R p@@T `ᗆ% :/@DPPA-@p`pPT P t`L2P @0L€00#S €^"Rul<0O-`Q MP倱bxP2 LB0/p P2T- P R; S P@T" V0S !Q L/`3/L2 S1P2S?T030# T03S 0 p0p@T@@P20CP2P2SW pbW ЍS @  L3/L2 S @|h@ [A-p `0 0M@Q010.P`0 80xQ|Q8OT0800@D 001TQXQ\Q@@*0 L @0 0 1 30ލnT 0  \ ,- 0  M Ѝ 8 - -M(0  0ЍЍ/ 0--M0 ЍЍ/0 0p@-@PXa`00CS`0p S  P X0` X PXapX4`P X X0 `00CS `0p S R X0X/X -40- M,0  Xb ЍЍ/@ <- -M, 00 XgЍ Ѝ/ RQ3G-` # 3Q  RP@ /a0.p W W* i0J009*P8p&S .n0T @0 0 i 0 B  a pp*P0pWC0 00 ` Ij`` Ij--M  Ѝ Ѝ/ -- M0 0 ЍЍ/@- MP ,)pp`P |@P \0P( S!ʴ00`@$ 0,0 0 ( 0 0Ѝ@Ѝ 0UcЍIm0000@Ѝ 0Dp@-Pt`@$C@x`pp@-P`@h R T0U:T:0T:p@h00p@-@!PR ! 00 0S 0BPQ`0AP R 0 U00SpY^P0]P `]P 0 2m 0`0A- R P$@ R00 0a RH 0  a0R00S00L0A PA0 A0P`#p#1 L^!! C0 ` A P S P  R PA AR#@1`, L`!0C000A0 }C-p@P@!W MP` l fl0S D!gl00@ Ѝ00l fl0S  gl0 @l0@O-=<;:9p7l3j10/.,+q)('%k#"i PmLKJxh RwtLIzS WWU0 W   0Q񏐩00@0C \$SjPg u0Sq0W p1!PL  u0S0W p1!P<  u0S~0W p1!P,@@@3 1u0Sq0W p1!P"  u0S p 0W p1!P  Z u0SU0W p1!Pg uq0S?0W p1!P `0*S1 0C P@00C P00@ S0`a`0`F0@ \$P0 uA0S0Wp1P 5 u20S0W p1!Pu%0S0W p1!P * u0S0W p1!Pu 0S0W p1!Pw  s u0S@0W p1!Pf > u0S0W p1!PW p <Ѝ 7 u0S p 0W p1!P9u0SJ0W p1!P,pn  u0SC0W p1!P  u0S p 0W p1!P u0S0W p1!P p] p p0W M*0P~ X<Ѝ@@@@ dp6c ]pz\ VpU OpN HpG Ap@ :p9vP/p. @0Wp10P"  p u0Sj0W p1!P^ B u0S p 0W p1!PIu0SA0W p1!P<$P}0`tP00 pu0SO0W p1!P)@J u0S p 0W p1!P p p pur0S p 0W p1!P p ypx  uM0S kpk 0W p1!Pu:0S XpX 0W p1!P00@ S5@01000C0@ \$P u0S7p6 0Wp1@PsP  0!0 p Wp1@t$P@0O-@-oMMX /L0? 006000!R !0s0 0\0H 0SE   RJ D?Xp00d04?00h00ܐ$00 @@匐H0`TPU @%Ug PU 0T  `J 0 R 00S0U`O0S W  YP)    R0s P=*X1RRXOTXTQXQ\Q.h0N@QD,TDl(8PD 0<X ``P`XP``0@0@00 0T0pP`r01 000 0GZS.oHGFEDCBA@O "s:0f+~{zyZwS00G@ pA@00G S$Wh @ W000PAU`{*`(;$0 i   S5 0SP|-0r0[T0$ @ 0PU[PPR00S@ryP(@P@,@8@4@V000P @0S @v0@0S0000PP j)9 0 6 30( oލЍW @q}`r(@PP,841 S0@R00S<0n00000`BVpQ 0Qr0S0Q 0Q0G0S00 R} ( PEU \(  0 p R0 /S1 DVPPPz0] 0@BT%S<00e007040[0$ SL0100 @  | L040Sx00t0 `7| R1|0PP @x0P0CH0 ~0P@0 t0$@S-0r0|080s p00 00  W xP?P0p0XS0` > 00 0 R *0    S20    \ 0 R   0S{0|PUQ@ H ( P CQ000PxH0 0Cp0H K[[Pdp` K[{0\p0SD @00NSD `Wrid|pP0@0(@PP,P8P9Sr0zsQ\0p( P R Rmdp R A0 ,"0΂!0g0 PwP 0PP000P0 c@=:_ T $00]u@H:q T $00o<@1 8 PL $ L 6P,PQӯ$84s0D `hP@, pZRӗZ,  B, J0 K0Q 0 S0 sP0P( PBUPU ڐ0QpP0;U@A@TT}ڌP  @DT0Q0S@DT 4 0^@0*P000 P_0S0 P0PNS0y[(mdp!0 ΂00  0g0SP000G PpBUo ` 0@@`pPEU 0R`0 S O000P0O000P 08 10R0bB+ S- C S!!/΍ L!/A!bCcS000@0 @00L0@^B0. ^L0`0`0[0r(0t(0P0O@p(0PP,P8P{O0PP$ L L    P  T $$ @ NSL$01LS-0`r0͵[$ 0@ 0BT $$ @ 09O0Pnr0@ p ,0 Q P 0S000T(0@pOT0P0P,040D0  m  S $0  j b  SZ $ O  PL $ L 54 T $$ @ T $$  @x{(0p$0`Wp`{prT0S 8  B0S0S S8 ( 00PT,(0(0PO@p4PzpN 0PKR @s0 Qp(00  `$ @Q P040my?80T0吊,0844`` 04ZVpJ0  J 0S U  S  RX0 Z0P@0,4`吊 P<ps0(0 0(mTp  d@p;N 0Pp1N4000Pf4 00 ER0 ."!.00A`0p x04 ZS 1 0(0p@ N4000P?SH 8 K B¿u Peh` (@@`p PEU0\`0S jM 0P {SL0$@@L00m J T$L@$ $ L  E T$L@$ $ L PL $L SG $Q0S$L10L$ Te $$  @ pPL $   L T< $$  @ YbM 0PupUM000P LMPPP DM 0Py0X 0Rp 0SL0 L0$0  PP0 |PM000 PQ0' 8 O@pPP , >ptp(00J0S 0XpJP@ p(@T8DP@( Wp!w0m40c0 80 0zN00 ! sNP@T`L$ L L$  L  L00LL   L L$  L L$ L L0LJSL0$L000$ |?  pX 0p@@0 @0 0T $$  @^T $$  @TSG|P0 S $_P $L0L00W\ 0  0|\ 0  0zL$ L &L$ L  L$ L L$ L   L 0PH|Pp@8 S$L0L000$  0`0i@O gfff8L )) )&dG #4D " L0$ L00 L0$ L00 @W0P0,0! 3 S$L0L000$ 0@00p00G S3@A@00A S$Q0S1 p+0pS p$@$J\ 0  0S$L0$$L00X 0p> p$@@$ P@ `/0X 0p) 0SL0L0 p@-`M@P@ N4P0 %PNЍpt 0@-@ MP 0N0 PN Ѝ0O-pKU/ M 0`PltbX  ЍO{KE{&{0:0 SA. 6b@0c 0c33:0$0G{@+S6L0[(000X0 Z ,0Z0JPC0J_oPåRS 0S000[(0000 0 0pW00`P 0SZ00WPPU0 Q1 0 1kHK!"0 1 0{0KR {0k& [( R {[2J:Wk{{+S 5AH k+C0PS3{01;:00G{5  [ kDk6k+ K R4['k&{;:000C{5{JG[2 k0U 00 pW0pp0 Ն00{00:k{{+S 5A{+CG{5{Fk{PJ

p`Ѝ -- M0 0~U ЍЍ/0p@-@Q r  P p0 S 1P po PP   ! O @0O-M` p A Q P*5[$ 80Sy SP  @P Rs Q)Q0<0  ZT" $W `W `k Ѝ @WTQDQD@ Q A[ <0 P   N <0`0 <0 QCW   `V0BSTQ; "!` b <0 V 7T P a PPl3 j P! P T@@b   2  ` 0  0@ ` P !R/0S 0C0/ 0RA-@P)p`B @1S@  C BS   3`MS0 pg3wp1V@ * C BQ   9Sb R PPO-p-tM0<0@0  N0\0h00dp` -R-+*)('&%$  C8000R 00B S 00$00lP@T0PA T00Bd @0B Q\;  EPJ dpd+QS -Q,,d0A P0Qdd0Q 1AP*0Ad(d0A Y d0L0A Y( @P (,P(`(0S\ 0p\tЍd0W(XP  \(  AR  R /o"0 ZT@g{Xpp XGڐ: P9f01k5[X 0S# 0Sk %0hS 0pHpl00XS `d` 0R RKQd000S\00\0R  h 0 0SiQ IQ NQ(d@g P 0 00d0\ 0(S 0h 00nQ 0h \0dp{I:ț\0H 0\00S`0KS0 h Ph  l00C l0  09 7 5 D3 1 0 l0RA 0 00S S S+ h! 000 @h BAR \ *0    Q 00  0 b3"  0Se $0S 00P0\0Q"00h YX   Z BXTd 0A P Pd d0A P lpHpWh  h501{'pH `" PhQ ` l BpYlp  lp p`lp 0 A0S@0,0Q GY  Rh` rA0`000$0, Sl  @00Sh3,0@0000 00 0S?˟80(  J ( ۟ 0:DD@ PP   ! Lh0 `P h   !L`pl 0G00@P S( 8 B p,0 G(8pS BpGpp W Y (0RpGJISGQF 0SZY  @P  pP 0S0S  00SPX 0 S #r Z $@0, S0\0 [ht 0So 0CQ 0 R00SqaJ400H0000` l0# R00S 0<0I XT3 Pc TQ0hSQ = h  PhQ 0S A ^G@0, Sl`0A0`  XJ` l0<04 CRoᩒY )K{8Ik{-Zɋ10SY }?@?AV瞯<r N?\ `P> ~dp( pg  D0Hk01{p W'"00{0z?C0C'zp:0 0:AQ'0 0!:?C0Cp4656:RH k ,10{0  QH ]000d0 R' `00W'"610{0z?C0C'zp:0 0:AQ'0 1!:?C0Cp4656:RH ( (20{0  0Q l d0Q 1AP d0A `  QP d@PS d00Cd0 Pd00d0 00000h \0 h  Ph9 `0 0`0 s P300 (  J1k\00 {0G GPlP H OZ/ 0J4H0  aPh A ^0S ` 0Q0`0K@P  P4 K4 ` 8<PP Z" PPhPh @0 0C@0l00Cl0- +h00 Z 00H0΋000H^4U@Z{00S相 zI8 S ˋ2ahDPA\00Q00\0b @000h0  0\0N"0 0 0000h Kh aPh~ l0` 0Cl0H9P@!0\0 0OJ4 H0 ,  b0   0 10<060SN 0000 h0dP\0h Sdp0p @00h@0l0l4000H 000\000  P ?N 0S 40400CPh@0`0Cl0 Ph1L0L0LLQʰ\ (_l00000,P0 \0D [:S0 0!l, h:6 l0\, `0 Q:00XS Q0LR)Ao^& 0 0S  0c1# 00Ѝ QN0O0l1 c 0R:v00Q )Q 0 L@YPl #@Ѝ   PL 0X@0Q 0S00r KS S80S #0p00 0p b@0DJ"00@@~P  D21 2 Qn\  B\  ^   @Y 0Sg Sh S @0p 0ЍI  PePgy0S`I@"00Ѝ@ @QA@E|pPJ 0H0Y@HT  21@ 4PEC@80SjU U EP  000b80S80S800c8080S Tp0+  RP!@L80S L80SH  @X \y0l 00f@`  BR"@^"1P 5"@!@V+P(&0R  /A-`> RϠP@pl3 ^P 0 W`00 p 0U@PEPU 0 BP `@ pVp  0 BP0U@98@-`- M p\@KUW0  C00C2S6cА*ZKE̐* Q A@{ Ѝ@-@0AC^ 0S R0A@-B @SA *@Q0A0C00T D B @ sH0"S1 1  !2R / 3RS/00 0 c R\0\0 a c R8080 A c R/ )((A-^"PbA1! !0T2, lp(  T2,N10C#10R! R 0000T TN0NC1^0 !P@-@M: R @ 0S R0y@ЍA-P q 1p0S2 U`e@T`* 0S00 000AT !0S 0x`e@!0 0D1S  000S 0D x'd 0p@-@P0p R pPQ`00App@D `0 S,00App@|C x&d&0  0#10/ P#8 R#4#2#10 0// /A-`P@  1,0@Up00p 0S1pP@P?pP   ! B`} 88S00000P0 0/@-@P0@0O-M0[pp  @S0P0= PaU*0 F B  F 0 X 0 *0I0Cp0Y003 0[P^  0 p>0 Y0 0[ PT@T 06S 0@ЍG-0q@p9$A QPiV= @ PU `  PP+ @ h10S~PP= 0S ,1r1mPU 0C  P 00Si`P! 00i0000000S x0Ed0@iV0S 804 ,0R0i ? "xd8!q4!G-P`0b@Tᡢڃ0T&P# Zp !pE0 n .  P2)0@R0C`0P003 `LpG  P`B-0P!1^$23\ *G-P@0p@DTG !1PG*32^ =:P  @aP @0 0S 0SQ 0 A BpQ3 3 V  0 0S3#V0 F B S 02NS @0@PpP 0 0p@- @APG0D ` PR @*P `1<P0DR 551 16 +CpP56 +Cp4R `5<5#11 +Cp0?C- MkWPAP @4'J66V0`0 T 0  CND@D@5`@ Ѝ P `!30  0S  T0 C@1@` Ѝ00S/0 R /P1@-PHQMPB@s`P4 pP.0S  Q6 'p 0: SS0P ("( @0 $ ,( ЍDO000Ѝ, D 0 ЍD 0 8 0Dp@-@700CS00 P7pP  BR  /p@-0rSM wS aSOP` D`00pLP`0S e C+S/ ^R$ L0S@@p0KS0DS0ES0PS`@P`0p@-S4 @07P00 P! !& 0S 3/PP೼000P @ P ?00 :00`aa7@0`` 0p+k4PD 0P000@-@!R !P 0C 0 0 S /L4p@-@Q1P00S2 0  EK 3000S7 0!$0 3/0:0P-p00P @ P 00< R 800pzR0PeG4P0035p 0 @0 0pC0 @0 0p$4 4-Ѝ/@- QS S S C00 H0 @ ,0 @Sb 0 @6@000 0 0000/@\SA-@M{`p$ C_o᥂  P$ (P G SS (\y0၀Q  0(Q\ 0 p P Ѝ谀X (P 0^\ P  X X%8SPP[XA`B`($1 $$(0XQ0$$1((Q| 0 (0 ^S:0 # PBpp,qЍ0S  0Q∀(1$!$ (QsP0 PnP(Q XP@- 0At @BG-@ M 1 3/ `p 0  ` `pp 0 `pP@P 0 `p00  !``#$%&0'()`* "pp#"! 0'&+ %`+p,$p*-.)(/00/0.1-3p4 567809:2`,`3p2 1076059 ;`?4`8@A0?>0BDp=%|E F%(%I0JC`GH<`0LpM Npጀ K`OPGDFPEDEPFGPKJIP`HIJǐHPƠOKPƐǠNPMDLFEPG`P`P SR`PPDE`GPQ`P\F0` pP 0 A/^p^ APM_Āmp[Q 0pfPM`Q 0pfPBQ 0pfP8 Q 0pwfP.Q 0pmfP$Q 0pcfPQ 0pYfPPQ 0pNfP Uލލ[AOXA,aQp@-P P4ATp  @P 41S P0p@4A@A-4!@j pP31S L+ @P!$4Q x0P0W0S!R MoPPP !Rp W@p@p@pp@-@P 0@@A-@`P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ  V v@0@Aq@ @O-,M R0  1 sp3/,0 (Q0 P `@P@P0S$Pp NZ@ PU@XX 0 y`P] @^0( PUJ[d`pp,Ѝ 0 jPPu@ $`jPZ $ 0 P`P4 @^0  0 0PQ QA Q  ᰠZPರU` K@(  cP0  fP @,Ѝp0  pjP ,Ѝ0  rf@P00,Ѝ$`  cP(@HT 1SX$0(Q$ (1ն`o0@-@ 0! \ @?,}?00,1S@-@0 @ n?00,1R@-@1  0@[?,U? ,!G-`(0S M# pPw@P3 Uq    8?Qv 0 p,?`6(?P`ލ Pc  0p '0 VN pWK A/ q ((x 0(p**x* ..p.,|,,Ġ  !! !" p "x#"$#Ƞp  $0#4(, ))x)Ġ000#.'p.*|.*Ƞ*+/ 30 !!!"!"$p%"x#̠"$&##4)*,-p. 0120(48<@D )7;4)x).<.,.?C5p6809:@A0HBDEF =p|L 'Ġ**<*pB0BBB嶌(tǀp*<**0LLL尠p*40G **8H*0HH岀0(C **Ƞ*4 0pp' **Ƞ*4 0pp'**Ƞ*40p 'R p p APXl^T JRPPğ  8/@0PH(p'pP  D!B08 !0N⸑V Q UQ`PP4Q$0q$aPP ||sxx3xx@tC  `p `pލO`iß p= =Q{=Q r 8 8 40D ! P=@ L=V Pq^4Z X!3\@ ,2$\ \@c4:P3u0 uD H  p$bP!82CG<,0(PX QsPpY N=@`@q@8  408 D ! <@ <PP '$=0P0pW p=PP=P^=`GP = @=@t! a l\O-@(`'X'P 20 2Ѝ0Ѝ0u8 0 b1p@-P@Q "'00p !'p P dP `P \AYWP`ppR0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/R7@-@-@ / ?!BC4 @P/P/0 00P /Q* 00CS1$%&'()0 "00"00"0000"002\/0  O-RMPm @`T 0Sy V_ `` `qW}Ay R00 \\S 0  0C1"00Q!  pW  0    01 01 p  Spy pt [q0S0ರS 01\P @!00 `0!13``F`1 0 0010?o2R@0 0 =0A0@Ѝ@P PB WpGq0X 0 @0 A@01[PЍ001 A0@000[P 001S O[P0K\@ 0A1Q=11/C- MAT' }TP# `P b6 0 AT R0 X 0V@T Ѝ0r[P 000 00 1 01 0/p@-Pp@ U ቼpP pe60``6@`!1 @-CM0M@P0,40:P; T10P!,` @a PC*p0  0000寺\p@ p#  ɺp U Cp 㕺 0 0 ,4 30CލЍp)0P 6 0P{᩺6@P5?0@0  O-@%`5 0LMPp0D00  $00 RPZV PX 500d%\5 0 D0 30N LЍ(00S w0Q2RP p/ 0 0S000008004040P,,0 p 0<0<0 $0@0(000 0SP$pV #P 100 w0Q1S7  #P䑄0  00 0!00 B{R00:!R  SR0000 0P 000o  R !# 0P0 0 0Vq PU0! B^Z:@.[6: B(" "ȉ 0P( RN !R  # VN 20 2!QM!B!  B R {ⰰ! N L !0 "  0 Wp # 0  PP q# Q! R "!! 0 Q[0{ 1 AASQ0 0SPI008#809~400  C-@( $M \P`F ഑ p0pf0 pp pp I.8("(#BR(#8p Q1W ("(A ("(R Q1!1\A(0 0S $Ѝ0pQ1S 2 0( @a'  0   `P4  0R1S0C1 0 p p0W V1 C420SQQ[1 C200CV) X@a (00(0d0F 1 @ P(00(0+ 1᠑0C0 0CV*0@1}P+ 10C0 0CQ !P  pqgP@(00(0 S" 1  1$0 @1QP(00(0 !Pt 1 0C00C1<P(00(0  ("p00 0@aPr R "~p@-@PQQp y!P 00 !Q l!P 0 0!ppO-P M,a V0Fi 1S!@P `V0ര p010C08#8S0S_ 0SmP 0 Ѝ p !0p pp K1pF 8xV 'x1  0 S001^p!0`B08#8S 0 R(1"(1 S! B! y! R _P00P00!10! 0`!0O-pP-0MS@  Q!00 b`LT; T 2 0 Ѝ(0 0 @PN 10C08#8S 1  A ("(R0vP   0!0S "0  "Ѝ  `P RA 2@D@H $HIY*P0  0S  0ЍAᴐ@D@H$H0IY0   Z&0p0 0B8R#80010C08#8SP@0TPoob10C08#8S  Y   0K0 @ 0  P @0 RpS Z| t 뼱, Y: l 뼱 [[ 0K 1@Pz 1#0C0[0C\  1 x 'x p011 0@1p @0 1?  PS X0*@ 1  @PE 0R #  @P6  b  !P &T  0$0^B1 0 * P @, 0R Z 뼁Y;뼁0Y 0H 1E@P XR  B1x'x p[0K1p10  &K@P q1pGppGx'x {p!   @P-0M 0P ЍQRO-PKMM " $ $wpW @RQII T/ P 0000p008"02 0 4 30KލЍb` 0[XSk>X 0000 I;q00& Z#Z! 0J/S  0\ 00P0: S d00 p0 R I RY0?004 <0 0U! -۴p"F00SY `0 S00R0J Z  $P/0000S p pP 0ppGorrL  4r0qR Q0P:Q0Q:d+@-ྺD @-@@Ḻ ! @ 0 p@-@P |,P!  p@̵갌 O-@-dM\0P T:,+\   &+\p

0C0.t%01 U* 0`b僐@ X@ H0B$HS񏐊laW~}|{)X0Ƞ,Ƞ PX* 0UU X !    s     jT     8P@ 0X%X@tH[$H8#8A[08#80 1$Ѝ00 0   8    8`Fh&h08#8K08#8E0 ` P0?YC-Mp`@P' PP"  0   Ƞ  ,Ƞ 0 !! 0 04000000 @PЍЍO-MPp@Pm 00 0 0(R 00㲁1.@@ ^C ݹ0`PI  10岁 0@00D0 00a!PK&P@Ѝ 嶹 0`P!   10岁 0P 0 001@0 P@Ѝ pЍỺA-pP @` 811 X0  P 0M0S@   L Ƞ,Ƞ P^00 000  0:ЍS)!1 0C8##Ȅ00 P  80  %  P 0 0 0 WA-PA A hL &hPp a Ƞ,Ƞ\ L Ƞ,Ƞ⌀@@ X  !00 0F B0 Ƞ ,X8QQ#8P("(R  B("(`` @@V0,800 000 0O-P-0DMSx0"tp`2$ (0:*@p P 1"pC 2x '811p 0 g'Ȁ 0 C000S_ , Yp pp 0J 1$(P`P[ 0Z 08 #8 B2R񏐶k: 1! BRG*0*S00:\ ][\ `` 000CS񏐉~}|{z7!qW  E p SR008 1%0C00 0 0 04<00808 7/ 00Zp p10 0P 01! C1ğ0C0  B0 *811*(0  V; 0S 2$ (0 00 pP  뼡 Y9$ ( DЍ2 @ 00  V  ^ 0 10C08#8S 0C8#8 0P0!0 B1 C("( 0*R0岡ᴡ  B("(0 P 0 01" C *8 1W10  *(     Z 00d  ,#, PM 0 0 0.T' @ 00S 2$ (0apP $ ( DЍ C !P *("( B0@  101`p%[  p$ 10C001A$x 10C001*x      z00 pUG- `P?@PN `V8 2 X 0 `(  pW' Q0; R    P@ 1`0C08#8 0C 0 P0 0RpW 0 10C08#8R p YW`0 R  L`p`0Q ` P ` 0C-P@$M`Pp  "00 WW 0GS ( S񏐥U|R0GS@'00$Ѝ( A  0 ;p` 0S 1  1 MPO W W W(0XW p  W  1P3 H⨀H(弁PW) WI,0t110C0 8#8CS  (1 01崀  P,0p1! B ("(R[ 0 Hp0k P 弁pP 0 00(0 00(0Pr?⸁p (=` 2 00$Ѝ0S? 0S< 0 X7弁W[ t &+긁0(0弁  (01ḁ0C08#8(XPW+ p  W  mPnH(<꼁, 1 [P] 0WSAqW 0G ,p弁 1 APC 1ᴀX0C08(#8XX 0H1崀ሀ!0  1 P pp 0C 0( 각 0H⨀H(0!1 p 崀  Pp@-@`PP õ0 00(0`00Q(0pO-,0M@0 1 pPC ap`F`h&hV1 PXh%XV @H$H  @K 0F 8`P 00!01@0 @( 0U @EH$H 0f0@ 0p0Ѝ " US ! B ("(R p0  PЍpQ iP `  ἀ@P| 뼁0S0  $c뼁0@S 0H 1BpP 1X0C00C\   ("( Q  " :QP P7 !@ B  B  `P' Q0S0  V@UT@ Q 0R `0E 1pP p` pPm nP_ pga A1@D@@DH$H vP@! @1 0PO `FP@D!H$HV@ `F! 7p / p `1 0p1p`01  P @T0*pO000/^ @-@P , @ (# 0"`A2O-$M p0P (@`$ \0  0p0p pP@`  y%Ÿf#""0`( "$ `$"     Q!  %&d!"d+" !  pp1p0`00\1 0`P P@  j.. @\ !)!Š`, !, $0⦠b*b*, 0 0 0 @ 0@P0 P 00`0` 00$ЍA?iC-@P Mp' $Q`?PU($8 2#0(0 `8`P` b8"#4b4#  0V@h # Ѝ 08R(@R )@ b#8 ")8 b" 0A-1?`@Pp @f(XI P 0刁$0@pG0( $0p ?W?@`G?`@`` 0$ <@P U 0$ ?pW (l 0$ qp0 p$0?W@`G?`@`(`@ Y 0$ <@P U 0$ K 0$ q0 0$ `R @-/ C@-@P 0 /@ (}" 0";R @-}/} &@-@P 4@  P`" 0$$ ;O- -\Mp (@$@,@A@<60@(@4@0,@8@$^_~?L P @<@H`40P08`0 P p:` p@0(00,0@0P`p@P` p$0 0  0 00$)$%Ǡ07")%ɠ7" ; ,40# (000#&0/'!!,  "' 0&$ +$ (̠ Ì  " !,# ,. , 0   4$000 P(0, 03 00#a`8`pIF᠎   `!7p! q9ǀ #"Ǡ"97Ɍ,;(4%(0#4 `,` @ 0(P0#0p`+p ?,P)1 ` @P) ?+1 p DP@.̠<3Ì` P0( .@ 0,0# 0, $<P0P\VL 0 000 00 00 00 000000 00000 00 0$0P(0$P0(0,0 , 00 0008 40 040 <08  0<0\Ѝ|:@8Jip@-@@DQPP`U  0pRPQp b p  0P0H <@ 8p@,R Q b "p x @0A-1`@Pp fPXo @0D 0 #@0D  H00H0L00L0pGPpP3W_`G```@0D ;  SP@0D *H0L 0 H0L UpW P@0D qp 00#0@pD H0L 0 H0L W+`G``P` @0D ;  SP@0D *H0L 0 H0L U@0Dq0  # @0D`R @-o/G-@PM )PH8 I `p `~ U@ Ѝ@-@P 4@ l P 0$$t0R @-7/PG-@PM PH(  `p `E U@ Ѝ 0` a!, a c,/0@-0dMyP0~P@xP񏐧}gpjZTNH#  vChgd}b|{d]\[ZYXWVUTSRUKJQPGyGFEDCBA@?>=<;:9876543210/6P ژ6P 0P$0 000P0?CP 0P 0# 0 0p dЍ0 0  +0#0 0p P6 0 # 0# ,0#0 000:P 0# 0#000|0 lତ F0# E0# D0# C0# B0# 0#e3Pk 0 030pY <0#d G0#_   00 04p[ A ?D7 *0#B )0#= (0#8 &0#0a 0#) %0#$0R 048 0 0# 0# 0#  0# 0# 0# 0# 0# 0# 0# 0# 0# 0#0P0 0# 0#0֣P  0#00040 0# 0# 0#0w0rd 0#`0gP0b2 i`0//d/t/,N48.++++G- M0`p@  000 0&9VJ QP0S 1PPL W`A 0S7 %P= Tp8 T 0S: P8 @V (! 00S1P0PW 0000 T 0@0 @ ۨ Ѝ WPTU U @ U U X00YY  @xC ܆|B B B B hB hp@-ཧ0@T 03/@TdPP 00@T 03/@T\ࡧpH00@T 03/@T$pA A \A A A @ @-MX@@P Ѝ  0 4pЍ O-PRp M ഁУ@  `980 S# 0SK: f0  0Z  0080 S 0Q>0 O 0 0 Ѝ 2  0 0 2 0 @@8 @ Ѝ  P00 0 00 0 sP00 ЍvP   oP  000 0@-P RM@PQ   0 13/Ѝ0sr? 8P100@-P U1!^ 0C BS \ L0D0p@-`PV@1@!T 0N B@n\pSVpC- MP `@(3 /``0V#pؑI@ T`1 `! @D s T@ p PU Ѝ ЍЪpP p`O-p-M؁ 0:PH 0F PU p  @P 0U`1`!000 0FW0  PU0 ! ЍЍ@- M` @  ~ P 0 q@pGs @DP @PPT  Ѝ Ѝ ЍP/0@ 0A0S*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:080pO-@R"2 0|MP0t00\ 00S80S `h"`2 0 t0 30|Ѝ4P  |P8 0 1\ 40b`08 04 0  0$ pW`9 P%8X= 1!0!` 40 4PU 08  R88P@P`0X A@8 12480Q8 :g0 S pa08Pj\P8pP 8 ` 0 `P p8F00B08PK=P8m90`0h`e긋 l @3 O-p-M *0: @$00 20D2 0S{ `Vu 0H"4SkSi90Vm ,0:0`000P . S\ ] } S`PI \0P 0  0CX 0 !>01H0 (0p0S(00S1!R00:X Z c/\ H c/D0p 0S 0 Z00 0p 0SZ0S00H2S708 R,0:, 4P,P0R\ ,0(P(<뀐4`0D 0 @ p  (`VP` 8H7(047_V04`8X00 S  0 \ V Y P& P PX V0"2 R8\((\ 9P00S%8Q 4Y4 @ [`@- X`D 0SX 0 1PZ【PX 0SPc/  00 0SO ZD 0 SR@T @0S $0S  !M0 0S 0@T `6  P0 SR@T 0S?00Z【 c/\ H0 SRs@T  R 00"00($4 0 2 30 ߍ  p 8Qc0 SR@T 0S00Z【 c/\p0z@ rvj0 S ,c`\oP((\X` `0bR48 0\R408  \P0` @ B;0 SRI@Tc `x^X P2 `0 R(S VPR V`Pa `8@400 SR1@T K0S00OM0 SRc @ c@ ``㣤 0PP ` ;8@P@,@ Xs q@ =@ 0 SR @T 0S@ GЈ 1 h40 p/ ؂ d+ * 0@-P`@$M@`@ 0O80040000 00VPA$Ѝ0( O-M\C\@qA^5SQ`Pqx q6 @2 0@T`0  Q2@0"B   R R @E0@"2 0 0 30ЍhTŸ <qAЍO5T 04S:`W ~> P Pp`  X `X  gTpK`PYH  T  QX Q(   ` T 04S`WA @~p _X` `H`p7`@ T W`@Z~~ @-@0V@p Y ! 1 @pU VYp:qT?o20S` P@c0 0 ^D ~ r r D} } q p 0 ! ƒG1p@-S@P  0P ! "0 2pp@p@-@P` VPm p0-P@  P 0S RP0/P*0    PP0/0/0@-M<<1 0R020* ^3 0 @TQ*QQ P1D0"A^ R QQ*QQ  Rl d0 0 2 30ߍ0D800230ߍ0@ ꐿ0y Xx ,x O-p$M"10000 00 P0@@ ᠰs#P@ (P P`# 8/P 8/P8/PY  0@00 S0 00P @c8/`PT*0 0 @T:8/PY Y}  0 SYz0 0 @`TP* 0 0C0C@J BS0!AQ RS Y B10V T0Sv* S:P 0pC00000g0SPd0P@t$U[*`c⃠@W*0 0[ @ 8/P Y Y 0 *  T [0P0U:$Ѝ0  0SiY 0 0V~Y 00 0 `r0 0S0 e0/R $ЍYu  S` 0 @YF PSe  B[Yv  0R08/P8/P0`P08/ P P8/P0 PK8/0P p8/P 0 J0P 8/ PT  8/P 8/ PP P S*0S:  00S  fP0  @a P0 W 0 R0"! RS  B#10S 8/PU 8/ P PPL8/P8/P8/Pu8/P``n8/Pt8/P``_0 0S 0 0C0C @J ES0!s 0 0C0C @JS E0!hR Q0P:Q0Q:@-k 4C-S MP@  $3/t`  0  QP `C4P4S  $3/000 Ѝ 0 A-pd 4V:@T@T 0P R 00  0R 0 00 @@P0`0dp@A 0A-`M pj@P"0: SPP P\ 0 L tdЍ-P00ЍPЍ( $$4/p@-P$0r0" @`Pp4U $0000C0   0R 1  00 0p  0% 0 ?l  0@-S N  0 0R 00A0 ޡ4O-SMx`A`ↁ0P@p T0? S+Pk $ 0  QPSF$R PWTR000000S@` 0 a 0`4 S   $3/ЍS   00 S`0a  0R` 0 0 0  0000Ѝ V 0 P 0 HO 0 0Q 0A00/0@-S@  R   0 ;0S6p@-P@T @T 0 Upp@T嫕P`p  0S S/P/$(0#   @// / ////RQ3@-P # 3Q  RM@`Ѝ0p 0 Pp GQ pЍ%S 0T @0p 00G-SH 0Pz  Rw p@( \T B,B R`  k V`!   0 B0`@ 0 p`BV` T0p@p@T  T 1+#,03/P]0p0CS@D0R)  0 T`1 `!0PVQR`,03/`P;Z c 0p0CS@D0 T0@pT0  .P@7Pj00S *V * y 000P @D R6,03/`Pʼ0@00Vp* `@ 0`V:"0P 00 ``F`0`X E 0Z0C00 00RP  3 0`0C0000@I `& 0009P{  0  0 0% p@-P`V @@D00T`0@T` ,0 3/0Pʼ0@00pD0Spp@//0p@-@P0 b0 Pcpq 0P0, @᫚ PᥚpHb  @@-00M>R@ 0 000P001 3"00 =P0Ѝ?00\N0@@- 0M@>S   "0!,03,0 P0Ѝ00- M% Ѝ$H-M  0Ѝ$0$0- M 0 ЍX` R  P 0S/ /0 0@-@ R 0  R 0  0 0c 0     0R0Kz0 P @P Þ0 0 $0 _ 4@-@`pM`pP   ᷔP0 :RCo; 0  S  L 80(0P  Ѝ ; 0Ѝ^ #0@-R lMP@ d  C 00  "2 0 d0 30lЍ 0`0S p 0Pr P"P 000PSp p MPP0000S!$p @APa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00 +{ 0 0{'{{j 0SP ` 0i ppp  00 pH^P\^ ] ] p@-@0MPe00TajV( p0T!R O⶘0T!Rb0`U00 UTX!\!R Ѝp@@\!O00Ѝp@700UX\! X\!0 000S/Y x0 0p@- PUp@000TQ0`U TQUP  pX1P0X1 0T0`X1Y xh0h 0 R/@-@00 X10CSX1 @OT1B0 @ޗY x0 000S/gX x0 0 R/p@-@0PŗU00 \AQ\ X! BRX! p@ⵗ`Ƙ00OT!00p@⪗|X x\ \0 -4M0 0,008 00 0 ,0 304ЍqW W  t,@O-MHP@QD0@U P0 `8$>=|=@- @t,  p 000O A-PPh`` p\@P 0=S SP(00@0O ,@-@P 0@ ,@-@P 0@ ,@-ڕ@P 0@ @-@p PP0T 0/P0T 0:00p@- M@P` 0p 0 0`qp 0:p  0Ѝp@ǎY 0S0< Ѝp@-@Mp >0qp::0P0TЍp ݎ0!@-@!0!1100 000Q000 0#0, 0# 00!R0Q0  0R0000@-@1 MS 0?P"1$Q 6Q 0  R& @  @1S 1  S( P  P    Ѝ0\ w100 Ѝ0@m0000 0/A-`Up QU @ @E 7/P@G-PTp AT P PD 7/PX PPHPG-PTp AT P PD 7/PX PPHPG-P@Up`L\ @ P@E 7/0P/@S@@@ ;X; 1Q`0000$ 00@100a0@00 0 `PT1S%  ! 0V000 @0 @10a@P@@ @@0@` `010 @a1 S Do @000Q0 @-@"P 0 PC^0  0 R ^P 0@/0p@-P`@T0M \ [ Rv    T0"k \ ` ``R```0000000000 0#0 0#0000`0`000T ^pp@N ``P`  T2 0V0pp@:R /o"!T0#00#00!0 0PT 00pQ  T \0 !* RC/A 0\R#R! R/R00> B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/`!`1@- @0,MT0$00> `pVP0STA 0ST@!0 0 $0 305,Ѝ  @`:( #<@$S V $ C0S 0S ( !0$ R0 H 40 0 $0 30,Ѝ@B꙱tA A dL@ O-pM`@ P-TP +T@`00T W Xp p 0 0 ?0X 00b 0 0  @Pp P 6 Q P  S  R- !R  00B ^a0BSW0BA0BS(70BU%| X[  Q P  S  R ! i"00b"00 0S \0F00 Ѝ@`r00XS00 C R@0` p0 A BRWwp pvH0BR"\04 0;p@-@P'0T0Pp= p@-BR"^p@'@P0T0Pp@- M@P` p eUT 0S*)P  U@p Ѝ$S T@p @@@p Ѝ@0 0 0/; 0</0 0 0/L; 0</0 0 0 /; 0< /0 0 0/: 0</0 0 0/: 0</0 0 0/<: 0</0 0 0/9 0</0 0 0 /9 0< /0 0 0 /p9 0< /0 0 0@/,9 0<@/0 0 0/8 0</0 0 0 /8 0< /0 0 0/`8 0</0 0 0/$8 @0</ @/ /H-M 0ЍG- `Pp@ @T @'# 000@-/"Ϡ R@ ?#0! PO,M  P!Ѝ  0S RP/0    P/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RAG-Q `@PpS Va p@RSV Pg 0Cs ?oo0CS00cÁs4V " rS% o?oHX0 0hs4ÁO@0Ϡ 00 TOOXp0VP0BV00R' 0b /ob7 4?oo0Cs! X7 0hs4ÀV pV e0o`10@@h47~t<ΠQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /| 0@-@ P  000, / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/00///Q R R  // U /Q R 0 0S00/ 00/0/00/Q- S Q P 0S Q0  0P 0000@-Q @% TS$ C0 P @D^TPPU0N QP  00Q S@ 0Q00 / 0U0/Qp@- S @ Q0CP S@ P` P 0U0pQ 0@p0@p@-QP" US QPEP  SU @`  0U0pQ 0pS PQ U //q 0/  // R S 0Q 00S00/ 00/0 /R Q 0/ 0U0/ 00/0/R  -/P00 000S00/s R S  0 /U/ 00/ 00/R S Q0 S00  /0 /U/S 00/R S 0Q0 0S00/ 00/0 //q 0/-Q S Q R  0S 00R 0Q@-! S BR0C  S  @ QR 0 0U000 @-M0| @000!00吆吆00劆 ጆ4 ,0 0 0 30Ѝ$& % 0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$ $0 00S0/8$ x@-@p@-0@ ,ppPCr0Pp//////@ //O-Pq4Mp@`T x10 0 $(, ( 05/4Ѝ0S-  就 ,!p S㴰0S S9 3S0pSQ00 W00Y00Z0 0 \ 00!" R 0S@L RT\00 P0 0 S00H(D0  //O-M+ 0; 0Q000t; 00$0d;0 0 0%SS``S5 0P p 0GZSZXWUTSRQPMhJ~}|{zyxw?>=<;:9876;43210/.-,+)('&%#"# UP( (|x`\lCRW ,pP 0,@`P`@^H V [`4 ^ \ Z0˄S0CP [0404 R*d 0PCUPE_ Z 00˄PU*Y00Gp00G S`   0 00Sp0-`p Hp `@T u  [0P 0CUPe0 E `p `70xp `0uA 0SU00:P @UP0Lz 0P I   0pp@ p*W 00G SPpQP00G Sp+` 0 pP 0` 0ppVp ` `0,0 `6 0``0 0`u 0SU00P @UPV0LP0., ` `u0 QU)P @8 0  0 9plWp ;p倐8 0 0u`` 0 @.10d0Q00 S000D0@@CE @H 00<y ` `. 0, 0`uS 0@00 "0!0d00CE @~e< `u ``g P00%0!P%: 0@P*00  i #dT0* 0P0@CC0CE @Q [  04z [x* 0``Zp˅ ^qAQAl Z0ࠃ˄Q*fAQA[0 Z 00˄Q*0S` M t 0``0 0|0 [0K0L"42 0 0 30Ѝ  e 000?0 * `0 `l ` `` `P`0 @$00> , 0 @ ` ` `3 0  @0("(0  0 0@ 0@@@) 000 0 0 @ 0I@G  0= 0pPUP 0_T0  0q8! @, `0` 0A-p`P@PU J0SPE 8/`uX@pW | 0SS S 0R / 0R0@o/ @-oG-`!p1 0M@0<40P0쀟@  0 @0 <4 30)ݍ  08p 0`p$P t 0 p\P+  8 7o T <  dG-0S0 S,QU) X&p@`V@ 0`S0P0 S0 S 0S0S0S QP PU@0@\0  R!R  R R RO-`-AM M ! 1 0HT0400#DDH$HT1  Р @Dp@T):0 mP U: mm0 XPKPL @0 0 4 30Aލ Ѝɥ  O-\!X1 0AM @ MT0407 0Y4:0px0(S`;  !4"T4T8X#8%XU"UPE/ @V: km gm 0 vP PU:t 0 lPP D0 0 4 30Aލ Ѝ0x0(Sj  O--MMh .> l0060 @|>T000G 1SD 6 Sb`1  0 >40X0 00h l+/ @0D0 >00S/ S/vP`㨐0pS AP! p O0 0夀P0S1Ss+P  @`TP00ST0v`PPP0Sqs`V0@  ^ 0Sڨ @ \<, XP Th080v?@00<0h0: 8 T 0S<0#H 1S0 x00S S00L01< 021l0:ATY0D0Sl00h040800SAT} H0@P| @0PPPzz 0;4@ פP @0P-P g 8 <0 @8 @ 0 T<0@ 0 P  SP Q D0S,0SN < 0 h0 S00D0!*px`tP␪60 0 P4/P t$*: 0 6 30ݍЍ0X0 00T0 h  pW A8@P@0Pz !O@0P0 ) 4`0 0}P W,0 P: x<0`SP0c  :`@pV  G0 0P`?t0$00(0  i0#( 00  F | &}PP8 U0I  QP `1  0 x80X0 ,0&,0R  -0,0$0 0 F0 SOb0!`倠?A9c!@00e}P 0S @0P a0t'@& 0Ɋ ( ,0,0P1 Q!  640 P0`1  0 6T0X0 0 0 0  +1 01 0,0`1  0 H60X0 r000O 00x5L Pb0%0< t XhW80x00SA0L0B  00 @00D00,0oQ @U`D 100 p 踠V@00uvWU1 0#03^U1#3 1 $03 Q0Cˆ UY10#030 LP#D @EU d Vʐ$0 @ 0 @0Y0U  K ˆ0v`100@0P m0#@4#4 0Չ W (0X00,00 T3 X0@00$3 @X෉B0"@" 0⪉0 AQR % `1S 0  Z tP, ]`!!! QY   T20 @t X0Q ,0D RZ X AT v*`tPh lx0Pp4/P?V0+S .0CS,O@M0P_HPq0 p1D@X0 [0,0d {P0q@ E 0D0,00 0@X0 <0`!`V A ,   CԨا8 $|DxĢ 8̝ t|ܙ(4< S0P01SH 0T0T00S S00 0堠0 f$0P1C WT0 |P0 T0X{P(1014@ `PD 6i p0 00 z0PypP 㸰D TP B("(RD D  {P}0X0zPx0@:s@ X0 6S$0S 0$0hVPK0g(Dp"( D T B("(R0D D  zPH0X0E@C0Pf ׇ0"@# 0?YW 0 0R` 0`1  0 30  X00;V0   * UP  E("( 0R00  T B("(R D  R,# zP0 3\0X0 0,0၇0 $@P$P 00 84 X00&0R  f*5U 0tP> 0 E@`P V@ 0 2ˆZ00P `8D0S<0X06 X 0 p0 P| # 0Z (0X0@0 0{PTAP 1011S1h= 0 b 0 0 46d@X0" 0s&0R  )0 x6 X0bA 0 0 0eц0&0& 906 @ X0"! P0@K@0X0@0P4 ᥆0|'@' 0 '0+S .0CS@0P ኆ0'@( 0 P0@ t0@(0T(T ܆rf0x(0( Ά/ /MM  00   ( R1#0e(6,Ѝ0/ɚ;M- 00S  R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@-zP$Ѝ0 5zP0͡"c1010$Ѝ00@-$MP@zP$Ѝ0 zP0͡"c1010$Ѝ0MM {2aЍ{/M- $ <{LaЍ{/MbO-!1 `0AMMp0 40pPH d PC @ + 0SP7 \4 !P00\+ @ uDP0 @R  R R @ J@ @ @i eD ,0 0 4 30AލЍN T F O-@#<3- 0BM M0$40103Xd0:3@0:$p00S000- 0p   P?QP0\400 PN0d04 !/ S  0  ˄\40 0P 0  0 0  PP P03 e S1 e hP10$430KBލ Ѝ!448#8S0Q Q/ Q me     \e + "448#8 $$,  P("(R?e s U$@ @ \G-`\!X1 0AM0 40004p@ V < 0%VP PP U.0P@ 0^C8ĝ 0  0 0 4 30Aލ PP P@0.S@L0 A>PdE4  dD >| O-p#3 0BM M`P0$40PS@@d[: 0.[@[VS5.K2o11T- d1 0T 1 #R T40 0hPY 1T0) [ 0 '0s"2 0 $4 30Bލ Ѝ0 QwPN t"PH T40 0Y0 D DR000& 000SG .SB T400Pa0=S 1SA S5 S6 T000SC 0sL0SQ0S +d00d1  @@T?00& D DR0 0 " 00000S0000   R00S0000< 0 0T400 P\c00V@;cP    p@-@P`KwP p@Dp/O-p0dM2吐0@`P&T V  0 ,#à  #4:U@  4U 0 dЍ!0 (}(0  V`0 0 F 0 bP0x 'xcc0SUPP   B R`00 0 BbP lcicjc bc뺐HdЍ `F 0S0   Tc Pc Qc  IcY   <H0 LC-@0 M(p`P/@D T@/)&cX c0c c "440(",4@0 Ѝ  03 -d<G- p崒Ḃ@`P E0S@P0WU! b@bP, EG bE謈(0`( "4`43Z1S//0O-䱐 MP0S5 DdDtD`p @ S S0   P&  P0 PI  P00^ 0  SR 0  SRS Ѝ d10P0d10 HS 0P F  P  P060 0P ' P  P090\ 000<i0:0  |P  uP090090| fP010r  \P020h  R0P0[^ d@?P 1? # { 0 2M$ 70P0[C @?P 1? # h{ 0 (32 P+ @ P010   P010ThPN4T<M܆MlLTL2(2D4@-@(M)uxu{` |  0 %  { 00 xux(Ѝ0@-$MAT t0   0$ P P00  0t 0 0$Ѝ0@@ 0@- Q0|MU0t00& ot 0p`0# @0W a @ 80 0 t0 30|ЍPP < A-@P s1 0!1n0SvOPpPp rp0Sp@-@QU x3s|p O~01P I~01000prcYtVxrP //VP //@G-p`@>W`PW00V0S@ 0PS1S ` ] Y `4+4;O- -0_M MP@050Q`0* $ [T: 0{`@',d!0  d! . 0`1111A05<0|P  0ʏ0J( @$zp d10 d1 :P* `@ y`0SH _D@X S\  S S00 Q@0S S R: 0CQS0 C0SQ0000 09P 00~?080:} + 0PMP 1#S;S 0(S# 8 R 0(S> 0(S 0|(S0 l8R00sS1 S S0@(  (8R1 S S 0S00 S S SS@@ `0 By_A0P0@@0Q"0A'A+S? 7R1 S S(00R00S 0`0 S S00 ,@@0S S 50@ @@@@@06@uO0 8=0H*[ Pd4@ R`P 04@ 0R`y6 `L0d!S 0 0 2 d1  A.q| ;1|rAp x0τ`0S [ `0`SH@DH .S0S[ P`.XKV00[0S  00P % "0$004 0 5 30_ލ Ѝ0, SA T T Yʔ4 P00: 4$P000 ᐪ,p T T@ TT  ;T RR@T $$0 `p ;T 0000@@T  P 0 0 2P  80  qh1P- @@T;T X30 0000@@T;T   P 8 l! Y@ P,pk 2Rz1 S Sv 0S`00 S S SS@@U `` w _AH P@`0D`S \R?* S S00 Q`0S00000-/}OᛖP.hP `8x1 x#|# |$DQ haD@`|QL0 SQ  P 80-1 `t @ 0- ll `7]2  (]ȕ  Th8 ,domasearnamesortoption~inQerh|D:dzzh 4z zchvvv!1 p@-Phl@(MP ^ T 000(Ѝpp Qx#r cqV p 1 xT000000 qPT $000(ЍpTtlA-p RP@0`P  R P  @R0P\ R 0  0 p4lO-0-OM |0P: p?x0P0 @  0 P@@     R`P zP[$ RQ0  0N/ !pG00#[b 0PP yP0S [0 0{ R& 0pG0 PQ.  ` }0PaVpG #U X@@W  *  0  z *00 Oߍ ` ᐚ0 0CQ* @ 0 0 S @ :0C S : @Cp  P`P @pR & ` VPE:p 0``@P R @Dp U+  T: 0 @Dq`V p 0  y 8[ 0  y 0  0 $ 0  uLz !@0@ 0@-@P @#J 0 0{ u (0( 0@-@P00 00/Hu @-@P @I00[{u @-@Pܤ00@-@ P 0  p@-@`0   0M2{PP ưP !Q0P᫤ 0  ЍpᣤЍp 0  Ѝptt DP!P @-MD108Q0pP SpG0`S `rdp4 Ѝ nxP 0 hxP 0S@ R Zx@P  A0wzЍhh h  0kzЍDD D  HжClBl3 0$  T` # 0$`$1,hC@ 01$000b`,0Ir,0 PY `F `$0 ,P0 (suP 0SJP( 01 (0tPP$ 0,P`1 0,P$`1~Pt `@ P $mb0`($0 0$`1j(,@@ P $-uP, 0` 1R(0 `<1!0< ^ς}0S0 00@P +.000@P$! /1:^0   ^00 pp<_ XhThh hԦ0c (gTإĥl 8Pb@x|hHX^^]l]^^h^ܝ@]@-@P300Q  P    $00<0 0@ ($ ꤜHp@-l@@`VpPPpS0U1pPE1PSp  (0$ 0pQA-pA@PT`QV0o@P 0 pPP``p`0(`,`@ZA-p`@oPP T  '0 000P   ZZ@-@@0/V 00(/D000/0004/00/00/dV 00(/000/̙008/ḙ008/ᤙA-x``PU pqW@Ptq<0< 0 ,(0茙HU op^q/< <0 44 -0 M0  s ЍDU Y%@-@0`00@@-@Q 00 2  0 G-`P@M@pZ 0㙪p TV 00J 0000 00 000 0$00-hPP9 0 2  <R 2"  "V &= " 2H 0 p000 0qpn W* W+ 000@WV ieP@Ѝ00@T00-0PP  02 2 2: 2( fP)0? 2< 2D1D!00<1 0001 0 0$100100 1 00P 0 R00   0/T 0 2 1 3/pc0SW 2: 2l .P 2 @0 2@001P,00ꔨ <@0UC-p@ MPP  00EPEUC\A@E=2 2 X b0 R0S 2 +13/PP"?o2R03S FUPA (0$`(  2 P500 Ѝ(0 $``VP ЍP00 Ѝ(0" $``V000`V "V00"?o`213/pP s Ѝ@-`@ MpPP  c00U,0`V( 2S * 2 P13/PPF `P 0 p 2 P00 Ѝ 5 Ѝu0P0P2!C-RP Mp-:b V %*AY 博pY  0  P Ѝ 0  P`V: ЍfnP 21`W 2< 2 ЍO--Xr M9* 0:`Q̡@Kp@ W ZJ̱ PE8nPP( ̱10PEUP 2< 2 Ѝ0 PE*P@ P Y Ѝ0 2 P Ѝ"1C-S` M2:rBW R"*T$* RU  R00U00SR i0  PpX U"B Ѝ 2< 2 ЍmP"! ЍG-r"W RbM"*R* 0 @\0 U@D0  PpY  U 2< 2Ѝ"ЍЍG-邀഑@ 0`P? pp Ip ("(R1 B!8. 1!` 0S001 V 0N 0 L Ƞ,Ƞ\ L Ƞ,Ƞ0S81#810 R2N0C2p0@- M@]0P  PP   Ѝ0Pp@-`P@0S  00T T @00p0Q 2S@3:A@P p(0 2S $A@P$00C$0 2@:0 2pC-@P4M0`S  k00 Vv 2+ R3 13/p* 0 000" "00  0$03 p`0 9/0P 9/0P a0  ^ 4Ѝs$  0^qp 0 哘P 2: 24Ѝ?(0p0`,0 09/0P ===O-P@MQ` &0᳀Xp0\\@T0o P? @Q 0SQ 0P 0SP0S 0P%@P 0S0 0000SW 0 _P 00080080ЍOЍ 00008(8ɠ40PЍ0000PA !C 0厽 0@! 0  ᳀0 00pG0 0p0@ 0XPP p@-` @501@0JJ@0D @$ 3AR@D$0@N0!PR T00t2 @@lRDAp@ߡ, O-@ `5V-`0\M P塠0P 0d 0 ᙠ P$ \ h0&h 000 000p:0S,`K @8괠\ ` 8#8 F 0 0 C  0`0000 S@ڴ0S4  F ZJ Ƞ  0,ȠP L8 <(`0C8#8,, 0 A0 0 p000$ 000\Ѝ 0,p$0@AH$HQ4 0$0(00p0000CSx@@ᴰ[ `Vh4c&hQc@@QDQI LPv   0 \000@H$HQ@00 `V80S BAD@  Қ0 S0QDQ 0P0> 00  0# 000  0   0Q00S 0(00H00 000 &PL00S H0X0 P0S(0 p00l 0C40A0A8,#8@TL000( p 0^0P(0 `pV 00hS&h 0,`r(000040?(04,`00?00S$`(00004`,04O- @X1T@0 pS0P`@D%P f eP( [  8#8R40 0 S(!$10$10 10 0S0P 0 P0S 0P  00S 1$10$100O-`@ M BXp 0Z pp ` XP !PEX%X A 0("(8#80EP 0 P CKpP{ [e0`00pQm Q 1 !(c P PEX%XpG 0PK0K000 Bೀ0@P0@000  B W2 PP1! 8 #8 P0C8#8 H(ܺ0 pW0!8#80Hೀ0@0ഀ00000 Ѝ @  ` ಀH(eQ0 Cp ЍP u`P 0@00 0@ A-0p`@PR"  0S00 0U@ T: 0PX BPR P Q00S000Ӵ00A 8Qx#8 0 A0 0Ƞ,Ƞ000UU800C80O- @`0 T @@DH( $HR(P.X` 0S %᎝JPP# @0T @@DH( $HTpW  TP  PPPA-`P@ T0@ Tp Q Q\HPTG-@P `R  R  Q0'@PR$  00 SᲀR> 0@S5 \A R0  P  0 0(!S%$! $! 1Q0 P 0 㼐ᲀ@p 0p 0 S i10@Rx ἐҜ'xP $1 0 !$1(y 0 O- @1T@0 p0CS0 M@DP`!P jd 2cP' 0 0 ]P 8#8R0  Ѝ0 0S0ボP 0 0P,000@- M@ Pp10 Ѝ0O-M 0`p0 DHP@pB S P. X00   0  \ @ ಠ Lᱠ0  `p0`000S XЍ 0P   C("(0C 0@00VP @G-`x"t2 0(M0$00w?0 @Rb2 SA:0JS> P Pp2 Sn1C PX: A  W1: 0C8#p#ȅ@=” 20 „ 2X!P1 0 $0 30K (Ѝ P@ ZPp Z 00C @ 1px'x ᕷp#    0  ` 00 pP202 p }r q A-p@ MPP`  00 2   Q a:1Q強0" B!2!00 VJ XGFZCBH@0PU; "R!* 2 13/pX "\* 2<00@PI\0 : 2 J0 EP VP V$P 2: 2 0 Ѝ 0 Ѝ0PU "R:(0 $P0PUP`" 0`P   ЍaP 21 mcb@--M @0 00 0Vhh 0 ST000S 3/ V9X(ZLm 8 80 $0Q/$$0S/ l hp!<<0 0R/( 0S/x l p!A-@T 0Snp`/7XP0P@QD D0@cP0 A/PX%A-`MPᒄ5cqA 9fp01A,4QSX 0 0 0MVpL㖝BS b0CS<S9ꄧȧԧ bJ(00000 00 00,40000000g00| pcЍ 00 0 0 0 0 0P%, _, %%%v X%O-pM`@b3#PWc#3pH RPGPP/ \H@ P`dtPXP f@QQ l@0!C!-\\ R0C0`20pW WT Z( Y 8㵜PPPXPrPT! ၄ `P  PPc 0+0V!YqPPpVp@`x ㆜% B RꀫLDDZ V  X ڃ 7/ P  R H $ b  q0 $ a  th0YGPQ0S @6`,<% _,%0 e    T  O-pZP8XKP,KPPPX `kv [][R1 , 04 `墏QP4 1SqH0S880S5@0S2 L0SP ≏P4PD0S t$<00 X+ P4<4X(D`尠pUV 0PU 0040D0S gލЍ P0`@0S0H0S 0  ᛛP L |3R㓥'F  AP3mY`8 Z ⊒P 3 HYP ] br삟0PE40P PPFP B0: S;P4 01!޲P4H  P  0 D *  = P40*YU 8SR # WpVG   <# 0+ <# 0, $ <# 0,(, 0 0 0 004 0 008< 0 0 0@D 0 0 0HL 0 0 3]P p  P40SPP`S ,0ST , &_,rX%I% =T `jvA-0D@dTP0000Pr0C?o21 [^p 00C00S4 000-S/ 0R2$0pP EP SP t  [yYsP xP30202020100000C08㺼P>=:7xz@P5 Thd0S\cT2S H  [00/ P$CĠ@T +0p/S[/ P 0 S:  &`p ᖫ ᙻP`,l&%XA-`@MPDry3 0 LP  K LP  K LP  K LP  KL!H30D3PPP P$P( 30eP+( _P3( YP7( SP;( MP?P(  PEP( ?P P8$@Ѝ(P (1P60"#(0S ("P(0S (P(0S (P(0S (PJxPh!Gp X圹`PPa D1R`;PU 0E /R SPp(|PU  <00,0/00=p00CSP0$0~00S t㥑O0s00Px'X%@P'Y @Ds%*@տP@P&&{@A-@P\xVp` Zp 00S VPjLP PP ``P 1$ 0@#U,L%%%O-FM⨖P`xpV` ` Yp p6 HX.0S ЍfP WP! PP p `RP dP vP iP00p `rPxPpp0p0 p$p㹵 qX 1S &VDdeddPU J$0P S<500S5=;@X*/Q /-P.QQ .QQ[$  Q00@  0P0S$0P`S0S@ pP PP0S ㉐50C SWhP0$S P  V $00 $ V ,0Z0S $ ?RR00R0SV1 $0SX  P 0 0C0 IP 0S H0S  V<0S 5S 0S 0SJP 00 0 0zX  PsHP k0S 0Sd 0?S` 0SSS U $000: S R# S /o" R 0: SHP 0S  JP SI 0SIP 0S 0?S 0Sp'K,%<T QK!K AKA-P@gv U`p Xp 00S AP@PCSpPp vHP;PW` /P 0S 0S0PHPy;0,2%T p@-PM  7 $ 0G_HP_H@sIUHTD0 00GP00hCTҶ3P0 0P 30S S! S 3 AIh3 ! l3 00T30S  R 4#6 R #!SR3@3 3 L20S ( #2 20S 0S'002@T$E0"P#@!"B00CS00 $A 0 D A0S60016 R0S 10S<"E0PT<"001 10SQ 10SM("x1d1POT10S P10S l1 `1 0S 7! 160S 84A @@$1 H01 8K(N" ' D0S0F0S 00n!q0SD0S 00t7a!@P`@#=To.8',Yb%p''d''x't's4Mvb%%b`'%|l'ibLG-PM tSb2r@@@0 S XX" }VpD 0 L1 04P8| HPh:dx HPP:L8 HP89T< 0DS 00S8 0xL@GSQa0D0@0 0Q)@0SZ L PU㬍a0@S񟗶@ꀁAFP d㔍@@LP #RP PP {RP 0@0 00 LMLM0@0 00 0 qPLzP}!dUD0S hx GPTw9Q,%%}{{{Bt @{ht@{t@{$%{{_,T xgt{@-tEQO-Mpt RUlT@#` @@@0o0C?o203RS#3p3 X XT 0S9 Z`7 [``3 hRPGPP UH@ P `hP vP  fP@``k0T 0080 S1 : ïP @U A0S #S@T  ᬼ`PM 0p#?. 0P0  n0pfp TFp が0S40 080050C SCTT|0S ƾg@Pq0S/ V $Rp p 0 3/P00S  i8 $Q tZ p[h0X0 0S O,L'h|_,%%p|G T X'  O-MMM`E8J^ *50 0 5M5005 900 嫳P T 妳 PY yPO  PpTPQ|ыA@6P񟗳Tdt0p(0 0USxP TpQT QH 0(<ȟS SS{ (x055050050505 ᙼP  ᓼPS T dpf0"S dJ Sp S0"S  CpE0"S P 0LpT0050 00001 00 00m0k0i  ^@ ^  ^ QS00 00055X ZoNU5SPP5`FV5S UUU0%0;pPl%5S 8DP@0: S055PEUPV05WVZY4$04P0Oэp6yyPP Cd$iB`%la@z\D00 0$0( 00B뇡PP#2 (BC?CCCd0P`  0S #PЉp@Od`0#S (Bk6ADo0E?o2? (BX<bPPPO6f/3WyX ZPPD`O垮00CS0 zP Pp PNU0 P00CS0y0 V0Z0S:00S:0A^1V51Z1S(1S (TTPdh!iB__%p`V|OP 8iVP,0V0@ YP,㣉0`FV} щ P f/ 0 XT  ITPZ`'}WЀ_,0dٍ<%%,'տv=T I*'%qH~vI %mdO'PC-Na0 P !`p@X@PN Pyd`00CS`0 O@T ЍX0 X @bd`'%,O-P$udM`@$P(P,P0P4P P  Qp4pK[lTT1Z03rTdT00 0A0p-t$tSPPP@S ,a0@Syd3P0 0dT5 RT ST# QT040  㯈pT[ S0lT[0 0fd  $⾴H$ Bp8 dЍ $ⰴ$ Bp㍈ 8⣴8 Bp( 8G 8⓴U  H⍴[K FJ@Pp`| v `[X\@T8 BpD7@70"0P\ ! G   "0P-U!  IP Q !"t80P 0 [`&:Y@|MxM:L{-w08fH8 p0 @0PU TS !d L` V8 {J.0P 0P18@P0 P C @Mۣ%^_,~DD{D|D(*7FUa}DrͤT VmyaratcidX%O-0XOX_-TaM22242222322p0 000 $Ppr>`PpG ȇPC 42"S 200002^S R2SW10 dbV%L0 ``p L9IpP L0 ``ppd2S PTAPX0: S0d2232` 3`Sd2S|}0 t=PpB0SP L I03PE/PF1@PC9P<DXdpp|4@TDA@9Pd007000` ,b,000S0?# 㷆0d204202020202 h[hk@ @4LTaߍ0220202;/`ᗩP000S dp, 00[ / ᅩ`P000S  dp 00V /sP000S cp 0 08*0 j2000 0B BP 000S A3 S;3Ť)i00 0 P 000SX"\2RRX2Xi/ ,P P $@PX0: S00y `P 5J/P   0Pd>`P!2V>I#@p X:{\10  [xt*}>d[ H2!14@(S8>̲03%703 7pm7037 P ʴ0 S 0R& 2S# 2St 0sd 8>pD1P0 P$5 f/H70L7 w?STP'\@<"820,"(2 pbPPO0 0  RZ$ 6G$ P`SWd2S+ ?pXu1>00RX!\1  _\1X! 0 \5b02T7,2P7 %%'1 SR Q  RQ!R!RS !14!8!04P`CQښ. .a0C 2 0׀'_,Q%edAb5T 1X%''r %,' HXh'zd@'O-`ؑ؁Q@p ;Ip%W㰑 0S 0S p1`VA QP hL0S PFH`V.Z ЍyPmPPP fP ;nn0@ SL|LLLLLL00000000000000p{W 0 |P w,~nPznP 9X_,'%@O-$M5%pP J:P!!l9D`дЄФ8000``` Hp6Y00S 0S 0S l-``4pWQ* 0S00P ,㭤0S 㧤 墤00W30S$ЍzPOPBP4 FPt P@*PL h  0$ < X x   0000ϰ0P2 ȰP20v00 0b㭒Ej 00 尰 P00^ d 姰 P00U H 0c㏒PN,I000E00B00? 0mx1>0S  G00000'000#00 00000000000000 ` `0S^P` b0Y0S 0 |0P 4++CPpG 0u70X7.X('_,('%`(R?<BS҃ !%xO--MP0e]H  PUPEǰʐvPlP*HP6 TP8 8 `px@|p,Ȳ  gmqp@p!0S 4 40Z@pxx ~m@ P@$$8"8"$$$8"8"$`0" Gp2 R Y R !$ Q ᚯ$ P R   0*8!P83e -RH 000000@  p0%@P@Ѝ0 0y ,)+?0,0P 0000R0S f```0pZ0S20S ~ 00 0@xp` @@@ P@T n 0 3/p T fG''%+'H~_,?'"%@-(@(@x(#%O-M -Fp,埱8 0⛱f`P8^ p p }6 R0 8 l,/0P0T 4PP\80 pHPF U85WE`hC`0IPHPU0 Fp0(5O005SO /5,* 0(0,00(00 0G'P,PP8%8_}PzS `SNSM *AS> CSP 00pjaC Qh*)()((($)(((,)((((((D)(\)d)l)(()WSL4$  㽤$ 4RD +3K L J ~O c{05xN 0Vt 3M pH n$0%c0!0 0  ㏤$0S@. X|I 3V``R zS NkS CS BSHLS aSDcBl0CS>0))('('('('('H)('('('p*('(')b+b)ZimPeH0SbI0S_O005S& LP" T( p0 (0S 0C !P Y@P!#@Ap``p! nP|! gPd! 0S1H!|h 3/ 0&\@ PH,`Pp@(,P1!2 HR #0 mp^(2 PP 0 2 0➫0 Vp\@#%(#%RH$%R(#%R`$%%7M_,R0$%R#%$%$%SSIJJ+S?SK[S!QuL7ifSvS7gui Sm@-P {@ B( (<p@-D@DxP}@(u tp@0 (t)%p@-D@D`Pe@(] \np@tL ()%h A-|@|p `(PE,BH0`E8P@=@@4708J?ANd (h*%G-`M4P'tP't5P0 p) P4\4@P Lc5DŸD2D"0@@2@P 4 5 Hp HQ 'I5P v' a@1  p0Y0 @ pO0 @I E080<0@0D00 0000P0 0 80$@0P  83 HL@P@T@X@\@HP H333 0400,0( ,00@@0P刘pPPUPh0PP 0/`Ѝa8am`aaa:avab,%0.d.-- (O-`-||FMx6P(`0  ACp<6X0K (V0S8v@`@0V}P 0SЍuPfPFP RPh Cg@P33333443333d333<400E0P0 Dhz0#S .P00 $L'$00S  $@'$00S $b`P Ez0#S (P $%'$0(0Sw P $'$0(0Sk 0fP MP?q ?q ? \?` @epKWwQ73@533@0 RH0cS pS: bSAJJK[0 0\Z9W W, 8 80,3/8 RfV Ha@3Xi 2Pݭ R00C?o20S`l tZ|WJ% `yĭ0 $0 000 00 ,0 $00S WZ 0 %ꫭ0S0:10S1 0S  0宪0 P 0 0 Q0s  `1000L,0 028k3PX& S R 0@0@0 #  R S W2P(00s  J2p_%43X 2 02c_,4% (T cchc{ce ccc.d$%dAdO-P'Mf M@p$PP Ap6 @DT T/ TX 唶,t`PK'ݍ ЍAP? a@PP񟗡:H<H<:H<(:H<H<H<H<H<H<H<H<0:H<H<P:H<X::::5P50S $PW xe`pP%000P00` ϩP P ʩP @ ũPpP P  崩 P \P( rx- qMlPq/nx00 000#0 00$000 P@i(pPPLdHTx(00-P(xX@SW x 2 P P( ! P( (ms`@P TP0 0P`(Ȑ⨀ qkP 00 00$00 0pL@P s@P  [s@Ps@PSs@P ` P P P !g`LP X  P( (`m` pP( !qk@PP WD 瓖Pa>^0pp+ɫ0S > +ģ /Pm`` 0V@ }r0 040pp` `$ 1P;00S` 00 000$00 0e( 1p#0!0æ0Pa0SJ+S'- 29S!S 1aV`dh%(h (_,hXhT  * i4iVihzd@edAp@-P@^p@-P@^Gp@-P@]@-Op@-P@]>p@-P@]p@p@-P@]p@ O-nM M0잟@00p4`)V<PI 00 >R㸎0$0 0^>娮000(000 l?p@:x>P10?0S@>D$RP$r R  $t ⏪|00<4A @0<4x00 <$00p0 vP اPp`FB@D4TFCCCChICCCCCCC D,DCCCDDCDCCCtICCCCCCEHEC|EEEFFFCCCGHG|G\HHCHCH I00@ᓧPh< $wኧPr tt r4< j$< $$r $b@<tP; $0 00 0 N <L00(0 0,A ;0@= v`; $500 0 0 * (;(00!0 X 0  : 00(0 ( 0* :$00!0 0  :(00!0 0 X:,00(0 0 $:0:0S  *P0$0H: 000 0 $!00 0 :00!0 0 :00!0 0 (9400c 0 0 (: 00!0 P 0 88괸@0S 0 hPfuh}ᐦP0@4v ቦP@p 8(Ku }HPD40  uPD40D4Y  &"0P00O \@00 1 D1 A 48C?  * P0 067000 7 * G: PP/ P t0S 0T4000(0 <4 T!P\}:8PFU ZU V⩨  ᥨ0HVp0`R 4S<4Z0 H$L40V.p`p@?HL4@0S |$H?H5HLX  $?գ|5XHL0$4SH$L4R0& 7-p`  V.p  4S@  WhP = wt  p`; P p`Pd%dV.p `1: SD : $R,@P  <l0P ,0  U.P ,00S,0Z3$R  $H0$ p!|$ L{ =p403P40 r04LP  GP$,03}pL{ 40S0X44SP04Sڀ2S, "20# *$rP 0T40SPp'0ST4S h38#d`P P3 `s$2S 2H$L4P*ps0 L4H/0#! 0bp<2 C  s(0) ;p̞l  9 PL X$L4H1# 4S 0 9_X0 7P0$$4RT SQ  X0  +p XS  !S0$Qh +S0$:$40 Q$ Qq8*jm (_,(%aX%3;eʼn $%Y j-%lc;H~Gу((5|Ƅ (܄&b5I`C%׀2ޒ-vņ,% &NhYVm `nHL$ Q,} Q+Q +*0$$0Q0$SV 4S$nP 44崀S04144 0S @4S 0 0@4,4S $4R#1ѣ1,4$00 00 00Vv `+t \+0S 0+H뮉p@ P! 0!d|7N]Q;+ ܎P6+-XQ.041$4+T4S)7 ,"d0|7+$+"+ +<+\4$P1H4P<$T1x00@ 0++pegc||P;=0Z +SP;=0mPN  DΙp  TD > 7+-0$ !O--pDMؓcM0p 4, :pP^3`4pGs04WY `ɥ  ťXaO 4S<44S $$4R0#*p  C `,p = 4S P,0S Hs$0 $tY0 0 $0 P0$ x1S  $$4P*`DqZU CUʭDPEUWVZVVWVVVVWXVVV8XVV|XVVVZ00vbPEUU`YVVVYVVYVVVY$ZVVVVTZVVZ (Y\!8#80( R!0C RJ ("(Sq044s04>00 0 0 0100(0 0,0@# p00 0 X 0_,%Ƅ|V3; `2%܄&u(Rb5I`' lp((-v00*0 +0f 00*0 +0Z00!0  0N00c 0 0 B100!0 8 05,00\1 +410(40Spt!;VlP!p`*p 4S 7)PP!$h0P0!    (@厜P<2(0(p00S0 Z400 p$T"x$` =0sP0 r04勡P ⅡP"0Hp3m`$`4S804S 1S !10 #4 0SDjcP T3P#X\cRc000  $Ĕ!<#d_p3   p0 $ rbpԑ0 2P ` 4 $$s(4S$ 05?W  4 $tR $4&S 4%㉠X0; 4 44 W  0P(0popWmX0:S Q4S  0 ݞ  d(0Z00S \(m3 $!ȞBX0⫱;X0+O-GM MPh K똔D嘤 8p40PEPEUa@@5Px`_``__`__`__`_``___ab____________$a@a\a_xaa_aa_a_ab4b__Xbtb_\c|%04000TH(43 {p00,p00000802"k2 d@2 ]D~2 VHw2"Op0L0mx2`"Ef`2D">_H2("7X02 0p00V2 'WH1  p00X1!81 `1p00x p0(pp`$  X]qpp`0S   0[p` n0S0Shpl` 0A/yP"0 0 @x3xIM@P`n Gލ ЍК_,%$p|{9 ў'bO- -M@L K@-(UPP-n "(P&pIE'Z'p  TpC`# 6pIC 0{0狟@{{SH{{S $'P{{Z'P<;S'Phͻ Qr $@<q< @ AG8 ({:ST(; 302HS<+10Y2E20SD +&C@4P@kg@f@f@f@fj@f@f8j@f@f@fhh,j@fxj@f@f@f@f@f@f@f@f@f@f@f@f(g@f8gg@fgjgg@f@fh@fLhXhdhhhiDj@f jk 09 0r PoP0 P00R0S nm_ 0;8;08;X 00d1IQP,1 P00S  ( ?+SHm P8P000S0? < - 0< 0: 0 .m@0 00@; 0@0 00 008;0`RMb@A?{Gz?eA`u_,()ʫ1W%Ъ )E^p,()D9H(),))$%Ҭ))().X()()֩);\0()}H)ŭ8%8%8)) PP000S0?` Y0P 00@ 00= 09: PP00PSp <> PP00S0@S p0K 0!; 000% 0! 0 000P1 P00S s  nY <01 ,$d $P 0: 0 @>vP2!.8` [`22`VȌ0 V̌00 ň p+< 0).< Pt Jl 0@ 2@  0@TgPi 0C Sf0400000,00(00$00 0000000000 000000l 00w 0`RD @@1뤃夓VD W1rx8; 00 L0%p 8; 00L0 %p$8; 00L0 %p`8; 00<L0 %p `D  |0 x;0y; D z+80;0; ; '0cy;0z;(0x;+ @` `L0 v%P@o;"0#10@00 0pKpQH E p   p0 Q%PJK0S ``K0 D%P= 0  006 7%P(0d B088v <0@6``D0 #%Ph6h&`l%t`!2(1kkkk,a0a4aV0 0P````;$V<;SV$>@ 7oz蛟{  A 7:S$@ &oVz{  A 7I:`"2RifT' 1#{ @l30S 0 %' !#@MHIN2 X0弅f#pX00 a@+V0@V0 00D O0@0`" #00S O `42 $P$Gw42AQJov$`s%okfik@A{@⠋{'8NjG"@8HIN%V X({*#P#U8 0S4 /$@<0T0x`T00`0p+t"pP s0S $+$t;@000!R<  W0 0 $|kA /d2"SS 0  -C6?8~A$@@@8)()%))0()() %X%.8%)!G@ 1PS+ 2R`2 C8#<48#8Sh0!ddh|d&h!L0 0 d20 "  +  `]`"0l0hd"?ph"{3{7@{{{{{ {  M )*3`f 03  h/h~h2`0h2d20Wp |@0H #$$@0(0"(00 %2 0BS0 (S8; 2 |0;/pV00#P2!(008C8S! 0 0H 8(#8"(. 0 h#1币;    0;. 0W|x@0H #$$@0(00"(0p %0Y 001 JeP@0<0SW "0 0RZW|C@0H #$$@0(00"(0 Q% 0 H0D p.lph0Zp. .)8%Sή~))%() $90CSzD{h{}}{4|\||||}8}\}}}0 $P Q<zzzzzzzzz{ {{{${,{4{@. !݋p`zlhd0\#!,.D@<840,($ 0 $P@ 0 $P7 Q{{{{-!-0 b$P 0p#$$0(#"(!-0 N$P, -0 D$P 0 ;$P Q Q rp0 )$P z0 $P 0 $Ph 0  $PH 0 $P( 0 #P 0 #P 0 #P h- ``  #pUrկ4Jaqǰw >` ر(LVfzƲβ()ݲܲ0SL S<0( S W|>0H #$$@0(00"(0p #-S<0KX0C W [B0C<0<00C <0=, 0D0H> D0X0 <0K+0C ;!< D0 D0 <0 RKX0CWD0* +X  cPWD0 <0,<0 ḋ奖W ,p 0D0HD0X0 D0 D00,W@,!O-M`P5FX0@-S@0P084 @ ($ t$ |/$p+4QP a`F0pP[N(ȳPQLpKG!PL , fP@\3 \C d@P 긂؂؂؂؂؂؂؂؂؂̂؂؂؂؂؂؂L@0S# @HGG 0 0p' 'Y a`fZ'9_`P}P`4b2 R 2, K,0 S &, !,U+ 0 7,!,00!0z,X p84 p:0S X` p(0S3@0 p  + 0e VpÒ`D(*G%=T >7\P]o,t'5ʳO-PAM Mi"@`ᅍ눧WP |~Pp700-S% 'P 'Pe @H p PZ )`F00S @DDA@D `v .p ,0Stb@Q6 1 Ql ٔP'P -00 J&`@Z-00  D0B5S񟗌l@L\llЉl l, 00S ePe0 0y긄54P e00k00ht400dx4 `0S `d XH4  T00Q0+P J  300S P80$030(000,0-#t0Cp ?o2R0S0$0nPilfPaP.x@Da08z)y5T(3@00`FrS= RS iS1 _(tS xS?{,2뤢̲ +="A0p 0@00@00S B 0- T)r*.0S *?O,2"?#BR0(0/S k2;,&(0S ` 0@-()*)C*R.*0S (0S xJ10t 0n-\1S <T;2 ,(0S 01 0@V-2<,(* .c*:?+r2pP+!@ 0 p6-PTW9(*տ _,-ES*g8%ն%@$X%K8%%h)%:UgDs7$%PO-TM)@@pP4/D,p ?,#@DRQ0I  Q@@0SRcvP cP SP- TP0(3 LP Gd0@ST`x0D003030800H00 30$30,3(p 90`FVJnGY% _DP$ b0@SS<H`tl0 60$60(60,6006046060860<60@60D60H6$&R <&4  <&,&R 8&R u4&R <&R 0t't7QpfqQr P$P@@7=CP \WP0S g P 0000zP&T60 a $WP2P061 H(VUvpd`$"0+S L`X.4 y`E @ P|X4̢5 000F<00/P 0T& t5 0 000:XP00F0000 C000C2#S0d000 C000C2#d v>C 0C0 0B 0 B "00P00 C0 2#10C0 0 0C0P00C1# 0 0 0C0P00C1#00 0 C000C2#0% 4qp 0P 0PQT+T^귍JZ2V 7w`'os`F rP$ 0SU030#:U %5PXP H#1i 4#P&T6K/r0uF 3PvTS0 0R3# G@RPEEX!EK/r0^FPՊ"E0<6S"46S|" 02Q|" 42t01#㽊\徼6S L幼.FP W0`W 0 P0 Eᡊ,6S m/nPP E|哼㊊勼<6S46S;ZQL10@6D&Sl1 0 00R\! H& RL! $&DR@! 8&R4! 0&@R$! Q!   @ 6땑 @]#돑@ t0P0\j*_,%Ij2jq*lk*k*\$%%7D> =ak1d.>G-PHM`pI %p10PEU& EHP h0@ S S 8,HHII/00pa<  P ` 1 !  ("aPP \؀ L`$@@`(` `C gP  P0S PxW `P X\0 0000 ?>B%_,%b5q*T {yt HCt Q\G-0HM`p0yC C S #%p 2B1 `FS 1S 0$  !RS@$ P+PTSPQv\xP`PAP MP2 Ea0@S,<LtT 00 04044041! 00101@30@3101101101101ДY 000 0LHЍP J"PPp   \0S  P% 0 k`PKPV q V P`FV R $Sa (08 ]V ZK(q*_,%YB%Tz,q*T %C-Mp`:@PV J$p-6TpF`F5 VE@T XߌP HڌPIU0F,V *$p6PU 5 `V V 50S aP tP0S ]T500@V 0S qpG TP`V> \\!X L!tP9@PA0@3S,,ذ,,,,,,,,,,,,,,,,,,,,,,,,,,,,(,<HT,,`h|,ȱܱzP0S<0S00y0S00S00S00S00S} 000]00Z00W00Sm@0000K00H0 0 B0SZ<0SU00SPP0$0-:FU 0SA 0S 0S;`V UU5P xP P& UH U U6PEU2ȳU( Q P! Z U4 @U U0000  U  U QaUPJ 00000  UP  S S$0S U S p zqp*u@T  0"600"$0$P @YP TP`oFu*%_,vX%(T (4MG-MbrM@P "p10S AġP` R ލЍRP fP74[WMP` YX@0J|mP1 JP/0: S2  S)J BWP0 JN@~p 04S00p2t뼍0S hp J WPJ W@PJ(`E$v*%T blHC-GM M0LF@<P<8 <8X@8DX<`{X`XdXhXpXtXXXXXXXXHhLhPhThXh\hxxxP0D80l8"=C0D 8PP   QP:? 0'Y#K  P ; <ڀ@P PN; T(XE8@D0Pbx+TX8 Ā`;P  0SD;<+,8Kh8S <PUL hXD 孀P@ 4 OoB(;p *;8(p P Z`T`hPdhJ0㊎pP 0p`PT:T YP4: h(tPP: T(X(P D܉P9 h(40FDS=Ի|(4XLмܼܻd@L<T08( p`H0 *d8  B 01W0، ܜl  d8\0>0X `X0P SB<0 0H0X8T80<<0<<0<0<0H80L80P8g+ P: ?  07p$Pt780T80X8H70<887 P 00S~ 7 W6 P 00Sm 6 0t8f6pc0<`$` Ӄ|6@`忔눖 0  `P  @dp4C20S 6(@0V0` 0000L85呔P'0`8d8#0e#P ՠ՝ 5?Q0Gލ Ѝh5ld 5D0L<<0P 0S _ PPvT @P `d<S P 0S L I(4 D8SQp>3  tC`D u|~ p̈́~ XtƄ~ @t忄~ (t帄~ ᲄ ~$嬄~#妄~ 堄~ 嚄 F-*'$!0S0S2  mt@h288S# @PxsN @+ڂ P:$B? h  081<S|w+Ku P*{0:yP 0Ps@Px ;p҇h χ뺅L;@P<Ň4 ‡0@` r|yPP0@P`5x@+ᄂ00@0@8004`<0U00P<P8,8U0C?o20SP ,R `0 ,0S Z,8S=[ ,8S ,*<4JPտ` f%%0z\(h % _,lX% # +o7 O _,e y  sVm  Wi!     !q!_! (!  4   p*  7!G-P`<8Eh 5 P03壞p2S l PUU$|PH 嬄p 9PB/PE0@' s :pl40pEWQU P4 000`P, L ,㯁PE0S#44$ 3 P 11bG01/΅01$1幡<y0"02Q$lp`h Pe Q18C8S Ɂq`mVl00C?o20S P  \ܡ=S` 0 0000l {18C8S 3S P P=?o20 P Pl _18C8S 0 P |`P?o20S 0PRx8*3M3t3a3%$%3H+3O p11%3M%:M%33D*p*& 43@3T %;,@*C-@`3dP᠅PT1  LDqH p0,1QA= 1P5 00၅P |P0 cS 9S0S00C0VS X dS lS0 0T TTF エ0S+q:O%%-6wX%>:G-PC00`@0p0P 0S00*3L*P00${ XLOZpJ0W* s/RrP00"2PP H밂V 0+0C0S;P8P ;y `FP j0S ]P(2   P 0S P 0S10P  0S1 0$pW pV 0SPPFP`FPvpP2 10S 10WPw㖫c0S0|PP㖪VPqp 0000A"rkPPP +i5+w{i<5+iziiid+5+j@5+p%l@j5+O-pB尒専尢P`9` p2 0 qQ pPpGz{uP`P GP( IP) EP 2 0 a@P$LHX0000<&6Mu}gtO-@((TMPp` @ yp1 PEUV Pp PgP uP GP0 00`0S@0T  PUP  A p !PP 0P 0S UP p U  p T e p V pP0S k X0/xP@P 0P@O *_,%1T CDsjtpv{O-08@0050%@,5M@$5` 5bp@% 5b/UP P  #@T$05$T5$500wP]D=|mPN DP> fP@ CPA \`3pPB rP pPB]$0 P80: S0S00岄`P p*P 00SpW᪂W  Z`P 3 t3t C[@00PPPLs||0 @HN$P PR N2k _t\tYtmH @pP0@lUPPP4.@<00Vn4 P ,,< NZ00 $2" 21QY 㠋o\1 Ѝ<x 0p?.40TP 0 <0S0 <0S0 " 004 0!00L1QX C0008sH$H( Wp2P0 0P- P('e@P$ @  Q$ h !MVP 4}04tt 0jMPd M#,K_,%T KKKL9LCLX%ht@`LLvLL[LL QLLL ~r1 bPRԁ0S %\0 0/X0 $ ,P0S   $XȠPpw20  Q   S  R#4p0S0 3r UETP@Pp` tO-0MPp0 0Ph~@P\ X~@PHHD!ߍ@P/ ?x1?/0$202@2<211t122H"؞؎klp00m10&`$0 001 0t. 0 h>Pp0\0J00 JR181劼0 J1!1q匡:0 b@P}0, = J0R0 =00-+181BVPMP 6P^ ?PU 4P000p=` 0N@P񟗭T 8DL0=` 0f@PP񟗚x<0x1<}+|0$0yu|<` 0q131k0$000AC0` M0<` 0W 0 pP 0yP 0%$P~ 20 JR0 I@P 0 pvk0\ 8d&`@0$01@p  oP 100 01Sq@(P ;,@4>@:q  i ̹8:$0P &1@ P 럻1@ tp  $qp '1$@ 0S  Q0 0  P819:0  0  @K0|) t MpPd #P ,4L '11X  {P`0S9 (Q90( 0(0+1 @iU``˺' @p8  P券 !◸pL V  2XhVV`` 0S 8岺X|0S @bV$0 RS 1S !10180X7"/0 V<!0 <2s7"/0 H<<2s "/ >p<Y 10B@` JP:#!1 01 6 `巷p-| $ PVV``  0 #$`6`8001p $00cS$0L -~<Q8&< 0%p !⟸P$A~0S 1 ~0S\ Z~0SV ~0 SR 1011'zp~0S h%d``p~0S @%0չ@1P q@ ˹' ӹ$夹k1S $P夹1 t (0 #㐽p容 m1S 00 #ヽp zapW P x910,A>0 (0t10T$t 圶m1Su 004p1,$p 0ᐶk,0(t10#t 冶m1S 4p p04mpl1S 4pl1S |#TTXPhR(ap P 101<D0 0@@00 0`P @ i0 10 ᴪpY !1! !" 120ۼpD ᱬ+ pd`" 0!R1411ឺP,% 0$0!$0R0S"RA1n1t!޻$0P!  R! Ҹ$00$0 Q[ 0i iQhNlll4%h hO%,1mff_,ff m mN=pNpUd@VmKmXml DsQ Ngmmymnأn}mmmnl-p-n>nTncnqnnnn%I*~nn o0nn%no7oKohhh]opo|ooooop(1Y8 ቻ1 ]1pW41!( < V ?= :0̷@p1`@T 0S 0 @咵@ 0S    0S ᙫ߸P`p P ( RV  R   1 g@X0 S   0Y`V a  Q/0@-0x l P ^0fQM @ 0 0$010k@ |k0@-MdPP@T Ѝ0L0 0 0 @ | 0@x|,ii0ƒ S&* 0@- "@ R P@ 0\ R^H00"@<0 0 0^$00"@0/ᨄT@(p@-`dAdd1M@0`` H1H!0  00 0  0 e QPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝpȳ #x#"" h\ ` L0| @-M @wЍ$h  Q/X-M  0 p 0 S 0 0 Ѝ`؛ q /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/*/*/*/c|*/2y*/v*/s*/9p*/m*/j*/8g*/d*/a*/^*/[*/ X*/U*/R*/0O*/QL*/I*/)F*/{C*/|@*/#=*/:*/)7*/=4*/1*/.*/"+*/(*/%*/"*/*/////^*/*/*/< */ */*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ሬ */*/ */*/*/*/W}*/Kz*/+/ju*/Or*/ho*/il*/vi*/f*/ c*/`*/]*/Z*/W*/T*/pP/< /!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*//7*/>*/4T*/ */6 */*///*/@-@y@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogressTj|~#-&,t/<w 0d3:(9(h`'p=C]IOx2TU`2dfG!`%/i$2Z9od@|@ 3@@@b@A4A4A'T((_jPd7DЩ8@T4hL-ppp`0\n%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory xp$(@@ t@@h È ,@@E,@@hunblock and -DNO_CONV?@, t\oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot close file descriptor on %sCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... 4Z @ZRZ\ZhZuZ!hZuZ!UKZZZEZZZZ[[#'[ '[_9[^9[F9[<9[>N[?a[t[PATH= c;tn!f2SddZdSdsin!cgdSdm`dSdlndudr m`p}d_ndSdv d0b    EOF reading here (<<) document8eimiqiuiziiiiiiigiiiiiiiiiiiiiiiJiOiTiaYi_ia]D abaD }-+?=;'@'kkkkkkkk@akaaaakkabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Ȗ'0n '1'n '1-nx'87n'0En'0tn'0{nd'0nL'0nni "% 2*ij Gt02 o 2 4I*J nn !x!kTz                  -$$DspLx HmpkmXaǝ^p> p`^f%pH(pyzpx.px2p8p2;p2$2\\CpX1aJ`T`<Kpw XqRpZp*~ap,vgpUip|opPyU| w| yT vp\1Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(((...)<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalshifttrapbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:202405161232Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedww Mww܅ywww w1 TD0 w c;y8z>w:,,x.x,x,xp,+x,y4-xt-ox.ч$/y8,Q>$/|xD.x`/1/,.x-xp,l.px.XJ$/ByFyJyNySy#Ry3[y#Zy3by2ay3hy3gy#zzzz z@o@zzzz3y2y5z=zLzTzEzy z@zzz5z;y%z,z xC$xCxC$xC?yyy yyyyyy}yyy@!y@y )y wyoyyy@yy yxxxx\zczjzqzyz z@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.3;C@@I@Q@X@`@i@n@s@z@ @@@@@%+ÑʑБב @@$*5<BHNV[bisy'Y^ˎ !1Dfsˏ.n@ 1!!1œɥȒϒޒ @ !%1/3;?!EP_k{^$+29@IPY^cjs{ɐҐݐ %+n@ 1!!1œɥȒϒޒ @ !%1/3;?!EP_k{n@ 1!!1œɥȒϒޒ @ !%1/3;?!EP_k{changing %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] (۝eUsage: %s device %s device command [arg [...]] Available commands: forcerw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'Iڼ$7^ ߽  ) E gw$¾վ4H]s ÿ!2#2$ӿ&2122ۿ3242562899:(;B<`=x@ABCD*E@FUGUHUJkLMNOPQRST UV*WD\Naicsdefghipq2s2t2uv2wx.J[(Dd|.Fcs%@Sbu22220@[}}}6To/e22_Jp2 92Z}/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.cannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype](2Z-'2Ȓϒޒ @ !%1/3;?!EP_k{returning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctbadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblocktttt        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-!!""""P"Y"""t"&&&1&F&X&l&z&!%"%8!%P!%h!%!%!%!%!%!%"%"%"%0"%P"%h"%"%"%Ȓϒޒ @ !%1/3;?!EP_k{Iڼ$7^ ߽  ) E gw$¾վ4H]s ÿ!2#2$ӿ&2122ۿ3242562899:(;B<`=x@ABCD*E@FUGUHUJkLMNOPQRST UV*WD\Naicsdefghipq2s2t2uv2wx.J[(Dd|.Fcs%@Sbu22220@[}}}6To/e22_Jp2 92Z}SFH0eC1SFU0eC1%Hah!IdontNeedEFI11(s*K>;6!1|nQn- q+,181|nQn- q+G1Q1|nQn- q+^1g1|nQn- q+x11|nQn- q+1{=rGy=iG}11;Mt?11mWC 3KOO11yD<#*=(113Dh&11\ M}-22-чH(2-чH!=2ZIчH2W2IчH-j2IчH1u22IчH2S'@ )Ѹ22*1@ )Ѹ2_1x )Ѹ22backupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsKKKsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatusprintallmaindo_setifpreferencedo_setifcapsRzi$%?yiipipip`$%`J'% ipip`$%~x(%%H(%XJ'%[S'%L(%T|`$% R&%T`$%T'%T'%T`$%T`$%TTTTT TUU@U*U6U>U GU0PU@YUbUgU[x|lU wU}U U@4Hfinit_current_mediasetmediamodesetmediaoptsetmediasetmediainstQWG\WQW4gW0z4\W0z QW0z`nWvW@nWvW\W0z4gWmedia_statusmedia_constructor5W>WEV()%JV>WEV()%>W>W(%HW>WHW5W(%GW>W2V )%҃>W҃X)%paddr_match$$tL$$settunnelxX`$%~X)%print_link_addressessetvlansetvlaniflY8*%YqY*%YY,setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanE_H_K_N_sethidessidsetapbridgesetiffragsetifrtst_*%s_`$%{_+%z_{_d`$%&\H+%%\&\,* `$%S +%_(+%_*%_`$%d{x+%\d{0-* `$%Os(+%kZ*%_D,^^*[[4+YY%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s input: multicastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %se8mmX(ix )*mg ii gfi|g@iiusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o ؇Hۈ;XDl?_%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @BC&F2IKLUNbOSabceΟfh'i3k?mMn^omr|su@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp 5` @  $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u%s: unknown standard format180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()ZZZZZZZZZusage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYAkQyUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printddd%Qd(d6HdU[jx dd dd+d;dMdYlPxdYddddd"d;QdowdodododLLd&+d9@Qpd{dddbitmask_scanxffmry%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlNysendrequestrecvrequest,""""""***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230505NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gzde%xe%Le%S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data,oZLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i#[+&*+3,(+;,l+GP+a+rz+L+)++, +, +,r+ ,++!(+2,к+<2T+E++O`+l,+y(+RL+cK+J+K+I+,g+,f+Rt+ cs+,r+&4t+Fq+R,+^,+collectX%\+&%Ȓϒޒ @ !%1/3;?!EP_k{NAME='-Zj(mount_disks>      !"      !"#$%&'() str_arg_substget_available_cdsȒϒޒ @ !%1/3;?!EP_k{ edit_fs_type_extL (   (  1L@ _ o edit_and_check_label Ȓϒޒ @ !%1/3;?!EP_k{disklabel_freedisklabel_set_part_infodisklabel_write_to_diskcdt2 ? @@ HC = TC $: 6 A 7 T: \6 X6 hQ > L D< 9 1 8 C G pJ 1 1 K 7 7 6 h; 6 disklabel_change_geom D0outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default0++l+L+pm_from_pepm_whole_diskgpt_freegpt_create_newl#"H10$2//+p$<%t+t*,8PH"% hQ <L:h>= 3>T!P T   211661- 11!1222 1!GMMGGG2Z-GGujGj'j7GC1j(jj!GW2G1gpt_get_part_devicegpt_get_part_alignment!P"""t Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC1SFU0eC1%Hah!IdontNeedEFI11(s*K>;6!1|nQn- q+,181|nQn- q+G1Q1|nQn- q+^1g1|nQn- q+x11|nQn- q+1{=rGy=iG}11;Mt?11mWC 3KOO11yD<#*=(113Dh&11\ M}-22-чH(2-чH!=2ZIчH2W2IчH-j2IчH1u22IчH2S'@ )Ѹ22*1@ )Ѹ2_1x )Ѹ22 III1JAJ,J+J;J NJ\Jmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new  \g`a[bThWNhcNNVWWHWtWiSThQ tzHfDPp$pfPS eYdX\X<mbr_get_part_devicembr_read_from_diskadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_free/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.0_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.0_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.0_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.0_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.0_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.0_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************,""""""usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump29Kdhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_geteloop_q_timeout_addeloop_event_add_rweloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionaxb4c|dxesrf xg shFsi~kjkxl~m!xnxo(xpqr3xs:x4tsuvBxwmxIxz7yYxA_xBlxCAqDsxE}xFxGxHmtI`JJxKxL MxNxOxPxQSUTxUxVxWxXxZe1y4 y6 yx|X~$y}/y-y6yFyXyfydymykyryzyyyyy(vyy~uyyyyyyyyyyzz zzzz.zw7z xCzdefault_configread_configrt_compare_protoP&P&##rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt$$rt_buildrt_delete##sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initNR~Gm~~~qJOsxb~script_buftoenvqyxdy~make_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os[if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CD@DCget_leaseread_leasedhcp_openbpflog_dhcp.9ETdhcp_bind`iq{ yO dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d %s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccallback != NULLnseconds <= NSEC_PER_SECread_cb != NULL || write_cb != NULL%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIASfwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated lease%s not foundNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\Bd..... /+$/)D/d//4//BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~$,%(x1x +) @4  P` +),p4</etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist