ELF(@4J4 (@@T@"B\\@0 6QQ O@@@( @0 fH!@P@Q?3|Р -Lc$/Tɀ"ـmain() returnedۀ   ! X(@@T @@ 0/݀݀T (/// P-Lx@-@PL00S @0080 0 0 0 ~$Ѝ__*^P/00S 000/A-M`NPP @ލ0s pP N00 0@T  h"@  0R)0R 3OoB]?_edA*^\ 3S/0!8 00 (   !/@`d@-뵀P|#0 !!X0T0P0H000, !  !\1^*^@`dG-bM0S;"pPPP3  @ԁԑԡT9 ' @T jP'h @  P PP 00 B4R 0@!@a0C0 T P Pp$ЍGz @:P 6P jP P @ \P WPlRPP p 8!$ 0@ ˁ]?_ _*^ˁ*^'+^b^*^@-<@1P$+P%@ lA-^8+^ _=+^@-l00: SIT 88S!~T0Y{@噊 00 彊ـ@B@-0@0PS@"@e.偊 3Sʀ0! 0    !B? SKQk0 !! H D < 8R0 TJ-@`dY+^{+^+^@B+^ P00  /$$@0P  000/ddP<0 P0/S/0CQ/ـs@-@0S7`P`P) P' {P P0 0008iPЍp@ÂddPX0` P0RЍp@z @P8P0Ѝp+^+^+^p@+^ـ` @ @O-Mi%pPu ?g6I[!7WGRp  FP000p710d7d' `7P\7+RJP7尤ᴴḔἄ e U `P& 6 0::Sf0㎅G6P W "01%6PQ P!! *!& 1分 !&f06#6$1  1# @P  *Po!L6Lf0H6UST$1)0C$10!10C0PU0S 9#9S  @P :I)$1*0C,$11,!p1c001 1 @P :|5*$10C$1 1 @P :$1Du*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P~:$1lt*0C$1w0! 10C01 @ Pk:$1*0C$1e1! 10C11 @ PY:$1)0C$1SP#Gq㰃 u~GW#wG#sGx#xoGp#pkG$p`3`` \3\!T3 0C 0p 0eG ! 0I 0J WG": OG": GGt: @G\: 9G0p09 1G 0p0 :'GXp!7H!p0 F<G$1Q 1!0!>0>00!10B#6 !$1 03/03/03/ 03/x + 1kH0fHbH010! ,1,! (1(!($9(o! 1"ZD Ѝ+^@[@0 DSBOـᆳ+^0܀AiP+^??l`?+^` )i,^@h݀݀T݀݀ڀڀ ۀ ۀ@4ۀHۀ\"@_{_ۀTۀ@@@@- @0 PЍO- PܱLM P 1 0LЍ 0!$ R qW!R!R!R o@ aUTWpp , ``< `008Pp`@P'   <  $ ( ,  ^ 005 05: 0PR0 0 $ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/ـ` D)p@-dPTU@ $ ``06/Tp0`$ p@/D)/p@-0 P T@``06/0 ``6/`0p@ /p@-P@@0 T000S 0d00h00p0x0h0x0p@ S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` ـ)@A-0PST@ Sq K %Bu 00 `0*b6/`P :  @p0  `p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0   0 7/0 `p 7/ `px0 7/`` 0 6/ ``H0 6/000S00 0 00$0Ѝ@_-^v-^܀p@-P0 ` T@003/U U ,  p 003/-^}@-00 } Ѝ 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dA-0`PT@ Vp V tA00 3/\0U00 U0 `P5/AU00 ``6/-^|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A|{-^ 0o/xۀ/0@-0M P@ 0vP 000 Ѝ0.@p@-0@Tp@tty$0dP 5/0 dP5/0}0} 0p@}xۀ[.^p@-(MP@t1PldU`1`0: S#L!L1  00 8!0,0 5 W0 !00V0$  ( 4000 `0@ 6/0P (Ѝp@   A4 00  f/0$ ,0 0( 000x aPhj 0 0D0 0(Ѝpxۀ+^ـdpA(.^,2@=.^.@ 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`d@-@-A- 1@TA0P`dp 7/U |U+ |U U$ U A||U  0dP5/|0dP 5/0 4P5/xۀ[.^p@-0@TxxPpPP0 4P5/ 0 4P5/P| ||xۀ[.^C-1M@TЍp\0` dP5/ 0dP5/P |||XpPP p d09/0 49/ C0 49/ 0 49/PU U|S|Q|0 dP5/0@?L$xۀ.^[A-1@T  !PP0` dp7/ 0dp7/ || |~0dp 7/0 4P5/ ~0 4P5/ 0 4P5/P{xۀ[_.^O-,1P@`({,{0 {4 {0p,{({0{4{{{ { ~@P0 { ~({ ~({ ~[P0{ { (e{ ,b{0_{4\{OL{xۀ0S@- S S@@W{s.^00@o/ـ` @-a@PЍG-@Ђp2`RpP0CR_P2R 3C7CR0 0 $ G2RR 3C7CR008#8S800 0g &c1414$00PL0$0! 0R0015!1c$ S  1X0$0 05$0 0hl60d007 101000;P008#8S308#8S0xP0 p l(P8p< 151`P5008#8Sy308#8SsSW HdHd.^F_ .^@-@`P@h `0 0X 0P0 P0H00004 4_P$Ѝp[,J[L <@<<@=.^@-z@-@n0 0R/  ]ـ` [lp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/0/-/-/-/-/-/-/A-PpO`0@ 2/ p 0S0@0 @0000@A-P M@`N0 0 0  p7/0P * * p7/0P  "( p7/ Px 000 00@0L1 R `   P $q Ѝ@0X@p0$0:0d0 00!S   1 0 0S0h006Qd  җ|0000100 0000 8/0$000\0` [u,{.^+^.^/^;/^|ۀa/^ K^ 0 /|ۀ/$ R/P//A-`0S @+Pp  5@P# d@ 001Q0000!D0  t,0  0Q05/ 00(0@@Ѝ0S   00C0/$ R R R  /` R X0R//! !  / /_W@@W@AW@EW$o  R0" //@- o/^@-@(00 S@y@ـ<[/^A-Q@P@@DT@ 0S 0S`T pH`T@T@ ;{` 00 p@-@P@0`000```0P0 N_P40| D_Pd*0X :_P< 04 0_Ppp@+^P[ۀtF@/^\F@F@F@@-O@A@-I@@-C@~ z0 0@-70 0@p0 0@j0P/dۀ@-<0@TP Y0 0 @Qۀ0P/QHۀp@-0PU1 0S S, S, P@0@ 0 0p P @T( @ 0" P0P0000C00 0@$0P @@ۀRW SW 0o/ۀ///@0Q 1CQ -1CQ00 /// W@p@-PP2SVw@P@Rw0P00 L< @000* R Srـ` P0^0@-C9!: ^SpP3 @4T004 0040606L00L000 0,4/@-@(  0 0Z?iЍh^@0^G-P0 VPU0p`P@T qp YX !Q0S@p @P \ HPH@/ ?@@ۀ0^0^0^A-P V`V@lPpzP@T 0Q`H0s )@^ PۀG-`0000pPb0  @T x (&  R ( R Z@@vM@,@ iЍ@T "ۀP/eM0@-P0M0@ 0 P Ѝ00  0@-M@P 0 P Ѝ00  @-P0$M000@R<` pO000S"P0 }P 80 0`0 0 0XP00P$Ѝbtۀ0@-M@P 0 SP 0  | Ѝ0@-@ 0 =P Ѝ  e@-@P T  ~O~Oۀ0/ۀp@-`PpPCTʀ 0! # 0    !0 2/P 0!H C0< 4  , !p:ۀ@`dp@-HP0PSp P@ `6/:0  0p@/ۀT00S/p@-D@PP  B  R `6/U000pۀO-pP`ܠܐܰP@ P& P$ PV `FPE @P P #P  P`T  0S R  0 0@` Ѝ+^_^0^0^/@-0,\ @T 4/Ѝۀ00S/ R//ۀ00S/ R//ۀp@-@P4`G/ A/0p@80/ۀ 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/ĂA-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 Ă j@j@ 0  )?)/ 0  )?)/^/@-@q dV Q0P0CN q 8I  q (D q ? 0^1^1^1^1^0@-LP$M@ 0  v000 0h$Ѝ0+^ k@0@- 0@ ,MPr           0 040$0IP 000 ,Ѝ0j@/0/ //@- %1^@- ?1^A-pQP.  @P` t0EP Hp|`@U80#+0 'J 8@[///1/8#81/1/  R/ R/ T0s S40o//03S0//W1^p@-@0PT3/.p`R0p@8/ ,($$#  p@/o1^d1^[j1^s1^Q0 Q Q // ꍲ^o1^|1^-_O-M@  0 3/ 0Ѝ0 3/PkQ% 0 3/0 P( `X+%>X !7/&!0A`YSp@w@v@w@w@w@w@w@w@w@w@w@w@w@w@w@w@q@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@,v@u@4r@w@u@w@w@4u@w@w@@v@w@u@w@hv@q@tv@Tv@w@u@w@s@Hu@Xu@du@w@w@w@w@w@w@r@t@tu@r@Ts@t@t@t@t@t@u@s@r@Lr@pr@u@Tr@t@`r@u@ r@v@r@w@w@Lw@0c0C S+p@lq@dq@dq@dq@dq@dq@dq@dq@xq@q@   0x 3/ 0h 3/@ 0X 3/Y  0@ 3/ 00 3/Y0 9  12/0 ( 03/0A CRS 000 0Rx3/  0H l[0`3/0L 0 80,3/00P ( 8 R0 03/70S 7'0S 0$3/<0S03/ 0S003/O8OS0 0@3/0S $803/ 08 @(@$3/0S 03/} 003/0`q V &S 0X3/ FR0\3/0`V0|3/0pqSh3/&0DLt0T0\0lX0,f0`000dO0hL@q,0S0s00&0l 0p8H0t0xA0=0|t90hh&7S0X! S0L0@3/ 003/ 0 3/ 03/0X000000  0R D3/03/0$3/<0S03/03/0S2 .003/0  `6/0403/40 0 0`6/0 `02Sp7/ 0A0CS003/00:0020%j4000000P0%4%&0 00#D040|20$0?0%90 0+?H000?à 0 %p 0h00 000100L02% %20|030,0,00 T0C `008X0@2Z<堡\ 8@  ` N ? dd!Q A x%@t`!p p # x0000#6l00s>(00 0u00(100Q503/ 01^[[I2^1^p7^g_{@_^1^[2^1^1^1^1^xS^o1^1^/1^w-_j_?B_1^1^1^_1^1^1^1^1^1^1^1^1^^1^1^.^^@_y2^T^3^^2^1^1^2^2^2^#2^2^(2^:2^7^8[@+^ [//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O}- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ 0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P 4!"8`<` H @ 0 H H L  H 00  0(0pwwwwp@-@$0( S  p@J ,00,0/0 R,00,0/@-(03J jWVP 2CP/2S @-/@-2@020@#R 0PL  R <2020 p x Q @ p@-\0!C ! 2 4Q0 2(0$! ~ (0$!p@R/L-,倣 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ倣 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-倣 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/ -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480G-pM@TB @ T T T9 !TX ``0 P0 R =R  Ep@P 0=SPX@@ @ @(@0@X 0  SR0U=S@&@ mP@@PЍ _  P  zEP@7@- 0@P P0P R S @ܑ Ѝ0@-@0 |P   oЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X @P0`(0 0?PN@ @0 4/@?Tp?P @> 4/@w?G8H<41 !0R$04$0//s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQLۀۀp@-A0S! 0S\X l\0_03/UA 00<000S*0"*030103\0"#   B0" 0%& %6 " ! \ #30 00C 300000C0'$00pCBwۀAi!i̋5^1?/ //?0 0!0S 0@o/L//0/////?  22//-P/6h N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: NTX\`1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S 4 ⍏(00(0/O- R\bY I* b$\" .in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0H00S/@-@0  "!$0p03/0 !!h܀ۀ03 /0@-$@4 .< 4 @ 8 L < @ 0 < /p@-P$@4 40<080@0<0L00" @0200< @  00p/$ 0L 0 00/1 41400 001/$0</p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@04\Xp<0001X1070 0 0\1pO-81MpC04 40$P刢!.!n@B0` 01018700"r=` !.p=W Zr0000 0 00 `L<`刂0@0 0S101ߍ@00S/A-P@`4q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X19=101101o= 0\! O-Pp4!00 Q00S@M 46CSЍO)t ⟿000 0$00 L04P0C0C00OoЍlPPPP 0  Z0ca ƿ0 J<!`P741aZ 0 :`P (0  3/ Z`(  `02v V  v L0 0C0CL00" 0 0 0`0`20p@-0@ c0, !0  P80T V0X1 01  L1  ,41 p@2/L00CP02/Э@ $0 " }|00000 0 0$00(00,0000040 080$0D0(0 L0/SP.!6  \* p@-PjVC0 L00L0p6t&0 p6t&phPC  P 1  0L00L0p6t&0 p6t&p/ppP 0@- @ |M l Q \\ QQSH0t S剾0  !0 @@n|Ѝ00!R 10/܀p@-@P Pp ܀0 S   0@-4 0S$ @ ܀lG-<2pP&TxM TP&  , ! LP PEPE LPR`L1  ,` 8  V0 01! 12 S@ : V 8 \A! 0"@L!0000 0 2SD400V` YV# V t 0  !0 Pm\xЍV@ @0 :/P t 0 !0 P$@wmxЍG:V ܀+6^^@|@ @@<@@BO-`P|T&\0> jJD 0 0 8[7^p@-PN@N@Q 0A p@0[80@- 0P0@SP0S   0#0G-p`@00hTЍ PZe 0 `TP1 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 ЍO-p , 0  (0MP @0800T0R0S R(0p,0001000ЍPU @0A#AR M<< P P P9H H0P0\H0 0 BH0P B`0 0 0 H`P``B@6*a"*U:bS I0 0  0 P PE$0 00009 O-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T vP%@ۨ P @[H0@@ ͨ:S P%0:0PD0@S B Ѝ2 O-@MLT) Pp` а@0SЍ0S   0 00H0  0D0 0@00 0P `@D<@<  HD@rڀڀA-PP`@pU\\0.b Q   \ *8  00GS0!>000P-//G-)0PS@XqM` $ R   +(0 PVPV1 0 0Ѝ R  *P0V0PV 0 0 x$ R Ҽ +(0 PVPV1 0 04[7^28^i8^@-M`@lP#Tt&Hp&<lUH/, 2?0Rr pB```@Q```CPPP T@%PP `1l p/ 000T0 ' @Ѝ@!Ѝ8^8^8^܀܀$݀(݀,݀݀݀8^8^#9^A-CM`PTYЍARI  !pŸ *Q   0"3S߳0P 0Sh ʳX!\1- H 8 J(   W3W0pW0! 1 $  G RE33@3  plh1h!0S \1*B0S L!60S+? Q R6 < SPP 0  P1( 3 S& R000< 000S00&R ! R &R ! R Q!PUPPP(0 0x 0P(000S 40S R 0S (0L0Ѝ0 Pt ⶯0 Y0 Y Y ( 4QdPz_P0 0 l3 0(080PS0 4pp0V :&&iRW @p&: :6R01 0p0P `0 &? 00 0V:U 000 Uc0SP0P 4 4 0C40S+ 0寛P0'   .0ۀp@-@@mH^G-0T\`T 0?003/03/@`p!HP 0` S@03/@@@00?003/݀ۀ0' 70/݀O-xBMgV<*dԣZʀ 0! #@"08"0"   !&j aw0W:Q<03/,03/03/  0!!ԣ0 !!   !Ѝ!':'|00QU9 '0 Q P*0-P0.71p p0 p0 S!7  0P 00 0R"007'0+;'7 P  h5 S7`67$ 0݀@`d/ۀhp@-PPP@Y$F@00?@003/0p@/ۀۀ@-$^$!ʠ A@ ! R   L" !R  ,, R !$P/$0!/O-,4,D,t,M W@D0 0=$4   `س~ !Q+ $ P$  )  PV㖠 `    ἐR; $[P$  Y OP b<03/03/03/ 0 72唗ЋP  )? d唇h,딇PP d (? `\唇"0S70977'3C?6C0C#:%. .  0#2>0>00' 7TD h@t1q $4!*$010P,$020 0@01 0(1C0 0@@ @@@1 0000 @@<0 0000@@ @@@+000@0@0 @@@ <0,ЍO/݀./H^"I^DI^I^ۀI^8݀.ۀ4@I^@I^0@I^@I^ހ@/@-R릣0@ H묣 @G0H4݀O-$M8(0,1@`m}PQPP(PE(0V6#:$Ѝ0 7p@P0 0000009  峟PtphW T: `  0 Jpހ 8J^ڀڀJ^@0!S@0L4 S00P4 S$0;00;010?/݀p@-0`S0@TT!* Sp0XT S`0dUP0SH_P,E$EO0?p݀>J^iJ^@-@ !:0? 00$ 0D謌O-n0PP04 !`nR@` R Rph1ě{`1dX Ѝ@18!L{T(1 !P{X X[#0$  U /FVH0Q   P  |($"(XR#  UJ뚿HXH B/JZHJ^݀[J^J^ !:!/ *ꬌ0 /7@-P@<00@S Ѝ0     i0@-h0 P00 AP0 S0@T0C0@S00(X0 P/ -A ^0 S00CQ  p@-@P`++`%L 0+T$;;L4;PdkXd ;/0SPLdkTd+;+ ;;+ ;0+0 ;;t;l;0+.h;0|+U.d;0x+.`;,0p+\;$0X;0?00?p݀ !i@@G-p0匐0@N@N@`THPFO0?0000?%: P(%U_[qJD\`K^O-@ᨐ娀zT:00ЍO/ 06Wx`!`1$U?PPT:0?L0 HS @03/003/ ?Jۀ0$4 /ᬌ0  ")//0 !Р!/0 ! !/p@-PMP# @,`~0t00 \ 1(Q$  ,0(&#(0 <@0?6/ߍp8.ʈڀ4002/ RB>00?0 S/ڀ 0P/ڀd0qp/@-gP P8@ 0ASA008.O-\2\bM<03/ sr @R0S0(("S  & P<ЍO>6lpPo 0Sl $@*tЍO$cP71@Q0@į 010 SxE 06 SPH1@H 0 $1y:0 0 0 00`@T0@D@p 'i00 /lL0000L0K^[O-pRMS `PP1P000 cP@  0S1 S9% DF Fd˂0 01/1/ Y 1! IE@VSP S0  003/03/Y 803/`J$JQJd$Ѝ00?[ۀK^@- @ D300/0p@-`!P @P$P`700~@p@p/A-餀`@)0PU |#p R0P R 0L  ~J$@A غ/]L^L^7@-P d000@T )T 0PE%VE$ @ Ѝ00S 0ES:@/0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/0@-3@PdM *QLdЍ0  00R( 0 }  0xL^[L^p@-H!@0PS }?!60#Q0P(?0` ; S00,0|0YZ2Xl0%XS40L10H3/H14 P3P0P P3` l0P &0 p$1$ @ WJX0H0/ @ 㱹 ) B$ H$  ))`, 0徲4 #(08 <#L! H2/H! ኹ< "`H!aV0p@@0u[A-H1P` d0dR PPVL@DDpDV4 !@TA[L^L^7^1^^:^O-(`p\@_[00H1JH*0LH1H1Ap 4 d$t"<402P#  h3`S002ձ02ű@202(0@HL1<03/DQEAEAEAEAEATVPT D@<L("00L^+^L^M^M^M^@-_@JP@G-pPW`@(  8 ㎙@D (,$D00PT`H00#AD V (,W00 02P3  DD(0h, 0 Q0000P0S202l4S H10  W0 202 0< 0m4S H10  0S2<2P3@20202P3 0<2P30 0 2022<20mSp40p4L1H03/GG-pʝ@mzH1PVSH1p$0 S 0!R* Pd0P_POyP08 ty#PCFAp@-]@Cx#Rp@}d0x3T-p@-]@2#Rp@ld03T@-@`pP<M$,(o(0 000Ѝ*C-@ Fp0@`MVPP 4P X#\30 P3A> S9@A WT00 00pЍ*p@-L(0H@P#04&P3 @l3$0S$@p@q*@-`MtPKpڜ@לT 10'*"*0*00(00,00 $0$00ЍX[p@-PP@00$000H18 0P$P \`0H15 V`p@j09SVSNQQ~P|0Sy 030 30303:303:33030400,0.04 ,$0 00$00202H120080$0<00L!H 2/0H1c-& c  00*00` 0C03 aS_S<00S 3S 0l3l0000 0 `~ ,00*0020 00#0-000 0#4>`j;M^vM^@@11p@-l0(@!60XX8P300$00p@HjPP p@*G-@2PZ H1ЍGr T`D00LpWvLQAPAxPAPAPA@QAOAQAp 0 00000 R!W 0S@00L0S03d00!C=w ЍGpt 0  0H1SH*0 U H1Lp$P0S  ppx3 d00xC0 00 2@0S *"*{0S 0S$00H1 1p4 0Cp4lЍGM^*^M^+^IAM^M^M^ M^M^PIAM^p@-`L1H P0@3/P P4 P@/ L1 0H3/L1 0H3/P@ P PH10S( T6c@00;00E0@0 0FFH1 p@N^N^0@-M@ PP *p0B8#8S 00ߍ0:@ <000l$RH!     8@-M` PpP`-*0B8#8S) ' Q#H16 0,00@400300r2L10H3/H1>4 H1`" ߍ-`0u[@-@0  6> C"l3t$(0W?0,0U?000P3@>040@耣p@-铚L1@0H3/PPP3#P D=L1HP03/pP30P3P3;P3HN^O-Mp`jP@ @a 0pTL10~H1 H1% H1  xSS v= vvBPE h pPH%~ H1   48P `F~<00,(`$  P^0P 0$Ѝa@0  k_Q Q P\  儴 tQD1S /0T l#wl D1  H1  H16^ ?0UW P3<P3>0 P3@0P3P3 o D"> C E1h3? : S?/0 <8 p#*0 R l3t# !t#/  P! Bp###` l⢪P3@ E0 ?F E!l3Tl 000000it3S l Wp#R 0QOMl#ph0   " ""   00H00D000h0$[p@-@"QP `" Q Q0L00QP0 <0L 6#p@ /0L00P0 |Q^Q^p@-P@`Pp0D02( 02<06# 2/p@ 0,   , /  ,/  A, 0/ @  /O-@0(DM`<0P 0 0hpz [G 0 \0$ pp + t0S 3/$0 $_02\ 0:/ \2@ 87忏P㸗 NL2@ 7小P80!0d R2  R00p + 12\ 0< 000(h0,00000$0$ 6哂" 000400S 2G 2p`(员`X0 02 p  2( t x@0'x 00 S0!< 80 S( 2@ ĠŠ0t0S $3/,0( 0_0 $2\ 0 0,à!>0 ,#1R0 @EMb-  2 05S=00 `a09#80 8802 0<<0A-@`Pp<`3  A vG-pP娳@PPD  ,`ᣇ0S00,0!=2?408`<00 3/33@  Շ0#S 1RR00R0S40\ PS P᭦^0,0;200R80 0K0C?o20 $$ \0&\,PU "440 $$ NEFXPi'TDG-p`P(@PP 0,00202?Sb40003/P3 PP6O-`M M @LP00SK000H/;,⑍Pv :00070\"\RS007S= ; p0S700c Wed0S  PVX Qd R  QG0 00000 0S@ R*7 p0S';pW*0 @00R D@000S0S00ą p 0p0p00S Q XpW*Xۍ ЍApPx ;Wh W` WT10PWD@X7^T^`^+^T^T^U^U^(U^4U^AU^O-|@4MPp80S<0:l=S808(QD`V< #" R=宊D`08 R)ʅ80 S-d0S 3/ `80SOrpi 0pR00 勹D 0@x< #"0^0<` `00SQ  00  `0Ņ0 00 00'y< `V A<0 `$ <0 0Q Q<0` 0 NU^rU^sAU^p@-P@` PU;p0S \P0 P/ 0 /p@-@P@"pp@-@`P0 @Tp0S \@ Pp@-P1 P#UDP30 P0 0@$ 00(0U4,P$4<pU^U^U^U^@-@4<@Dj@-@ ,Aطe0SU^p@-@P 00P`ueehAp@跷A- a@SpUʀ 0! # 0    !e 0  @ 0! S0t l   ! 00 0h0 03/@T \p P @`d[/P 1?R, /8#8S00  R 0 0 000C00, 3,0/?Q0, ,/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-Z - Ѝ0P  @pnp P=,K0帢,<zpsL!DH1003/h#- _?0QR 0xλ 100100100 0峻/@@@U^U^G-@p`Myd1MbCTJwW^@-XM@X  e 010 H0XЍ6$p@-P0@$0 3/L`V 1SSpp@-XM@P`X @701H0T@9C>H0 @H0P  $0 00 XЍp@-XM@X  < H0XЍ0@-P$@\M h帷\Ѝ0X  0 010408020H0P 020W^2p@-$`P`XM 哷`XЍp,0@S QS 0R`,@X  0T`1 hT020`H0hTP`  hP,@ W^W^@-$@00 3/ 40S 3/00 3/00 2/p@- 0@ `4P4P0480(0p P p `PU 09 0PA-@p`0 03/ 0PPy99 0U W 09 00<0S 3/ P0p03/7/PP| 0 4pW  7/PP L屹$0 ,娹\03/$02 PP$05 0 4PU3 q币$0  0 xP | 0 nP qPU4P0S8PP$0 0 0 URppԀU 0 9 0> 0 9 0ЍAv0 0S $0p p00 00 Pr PW ЍAЍW^X^(X^hX^yX^}X^BX^ZX^AA-@`(HpLp@PU  0R0D0 0 TP403/T0S4 0P  Pp@0 &X (/w0Y!d0@0h0l00 41`0D00(p0$00X0@P$0 00 @0@ [w@cP@P $0 @ <03/ 403/T@Ѝb@ rG-`0$ M@p0c   0P*5/PP@008P< 5/PPB(1P 0<㓬PP4< 墬X (v0$d0 !RR p0,  q0 S"90 ม1!(pp00p  0 !0r1000([^ rr]^]^]^]^]^8[^^^^+^^F^^L^^R^^X^^^^^c]^h]^y^f^^+^|^^3^^^^^^^^p@-P`@v  0 DW P= PN0 00( 0LP1 rH TXX `[1ap P0!?A1c L\1`0P!2 SL!4L1p 6 `'`` HLaPxpP  r{ 6Hv `'q`` HLaiPe T`XX\ `[W(0ap P0 ?A1c\18[gfff^^_^p@- `P`@0  p= `l8 Xp3Pt/Hu+@v'8w#`0xya | pH!R0BS2l` ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w0x yzaD_^C-lM@d p$X p02XP*00 0`40 ` 0 0 `h0&hS `PbIp$0 P 4c9$0 00S00P080P$0P8PX0 0 3/ p4P0`UlЍ$X or08,00X0aP  OP 000 0  bPPC\_^@-0000000(Ѝr_^C-P@d`Ѐp\MX  o$0H010 0 )0  1+P$ 0  TP0  1 /o"/`V<T0\ЍG'p@-XMP`@X JoL0 H001`?oT20S $0$0 00XЍp2W@- 0@8 0 0$0dM 0 03/$0P$ P 0 R0 0Q P0SQ0 0dЍ$0 X n:0U210$0;P0P,000 03/ `P$0` 0Q p zP0SQ0 03/T .P 0 0 X n20P0 02QP%P 08 00@-\M@PX n010 PH07\Ѝ02p@-$0P@ ,Pp 0 YP000pP p%O-PpM`0 0$0 0 @ 0 @PplZ@ Ѝ2 0 @P00SD$00A 08 S00 [ @b’E0Y 28d1 000 0@PL00 00 i@P00 0t `00 00 L@P 00  0ԣ00 0̣0 6@P00  0ὣ nᵣwO-P0M@ 0p`% 0 0 03/P k VЍ$0 P0 ~0 vPplY2 0 ]P00SG$00D 08 S00 Z ’G0RP 28\1 000 0/P00 0<0 +P00 0,'t `00 00 P00  0 lm00 00 P0 0 0_^C-P@$\M@>R`>:p`X  l 0@  0#01020D@H0@P X l 0` !0$01020d`H0m@P X l&0160 H0`@h\Ѝ@A-@M@! `Pp 0 1pA?!0/@P !0@P 1 4;<ߍ0 @_^!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-q O-Pq@@9P)i_01jaV!j1SK=9}o p\`LV r|z||Aha$pMP LpPW $00X9q[ 嗟LPL1 P ᨞C-MPpphQ@101o0|1 0p!]?l処 0t 0p1l!Rp!0 rH|Ip|!0 z?|@p\!0 6| i 4jZ0ᰁ10ḁ1ā @ L01$ F40 00\` V1 㘁0l!1L1/p10 4P5/P0 4 9/U 0 4P 5/Y ^ 0 !0  8/` 0E(?EScLk(/C#b?0E,EAkPɣ1  P !  Z0P00 P(00 000 000YP 000 P (00 000p000YP  yf0 0l0 0kW4Ѝ4d b^0Ab^b^@b^Mb c^?^Sb^(c^]c^B@ec^c^@c^TB/O-MA 9090:08 0800 aq᠂᠓[0000LS\ 0 1\Ѝ0S @0\0 0S 003@ @4 1 = 200/4@-D 0S 40@/0S j4c^@- D0Q d@/Q 0Q4c^0/4A- @0PS ` p 403/dU00 A/ R 0Q000(4d^N  0O   ! "`"Рo0:! P!: P< : ? P \* 0\ Ѝʑ:” 0g^_e^g^ h^2h^^h^7B0A-SPp @ሀW@0000W0Sbv000S00 0@H 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dhzhz@- 0(0C*s` Ѝ1 @P0 d0L`P 0SQ cQ ,Xs`P,pWQ cQ0<00D00 87 H0R1 R2 0SH01H0WH01H0 0ps8 4\001  @ 08 0@@0 0s S#4  4 Y2H02,00@008000@@0 0S%40040A-@$2PWD`q@pWA50@0 80R S0p 0 r?Sg8 RS808 ~xDpTXDL6 ** * RD01 "0D20LML q @T0@00 R"4@P4 ,W  ,@ 0S#, 8 R,  0 ,0000001  @ 08 08 @@0 < :h^/-0*T00/-0 T00///- $00/$00/@-@$00 3/$0@0//@-@$0 03/Is@->0`@ P  B` 0ŒQΌ Q @叓0T00 P05/P  0 Ѝph^p@-0P Lw00T0@4`X 6/TX0d` 6/p@h^O-,M^x0@ d0SS0 pࠟట d0S ,ЍS CS 0C$0(0PK(0``03/PQ^ 0PP0D0 0 0P`0P  !pGBi^i^p@-@$0 03/$003/0$00) 3/ $003/$0 03/ x$0 03/\XP$003/Pp}PUp3/$0 0 N'p@-0P`@ SY0 0T @ ` BT0 0p@/0@-@ 8Y T A-0@KDqDDa`PU P P50  R00 C1$003/P00P$003/P0 00`(d0 U T0X 4P5/T0 dPX5/P.i^8i^/O-@,M d1!Q ad0S TX00 P0H 5/pP \,ЍO/d0T 0C?odP2X5/x0d0SS0pd0S J,ЍS CS 0C0(P` 0pPP3/0 0|0 0 0$Ka h p@0 p7 h003^7^Bi^Oi^]i^CBDB6x^8CBp@- R 0@P5/00 tp op@-@9dP8 5/0dP 5/p@ Y@-@@s@-@00 P0 5/PP `哒00Ѝp00 (`06/00 0 00si^O-` R܂p p9 d:/ d0":/0 d:/;`0 d:/0 d`":/ 403/ 0 d:/ 403/ 0 d:/ 403/d0 :/ԡ 403/@D @0 d:/ 403/ 0 d:/ 403/ 0 d:/ 403/d0 :/ 403/ 0 dP 5/ 40 3/0 =dP 5/ ЍZ Z Ye9 dPT 5/ dP0D 5/0 dP( 5/= dP 5/'O-p S0 09 d`6/ d`06/@0 d`6/x`0 d`6/ d`0"6/ 403/ 0 d`6/ 403/ 0 d`6/ 403/d`0 6/b 403/@Q  403/T@0 d`6/ 403/ 0 d`6/ 403/ 0 d`6/ d`0L!6/ 403/d`0 6/a 403/@  403/`@0 dP 5/= dP 5/ Ѝ`V `V YX9 dPT 5/ dP0@ 5/@0 dP, 5/= dP 5/'O-p a졟⁀9 dP5/ dP0!5/@0 dP5/`0 dP5/0 dPt!5/ 403/ 0 dP5/ 403/ 0 dP5/ 403/Q 403/@ 403/P d`@0 6/= d` 6/PU bY dP9P 5/ dP0@ 5/ dP@0$ 5/= dP 5/'O-0 0@d@t0"409 d8/d0$8/@0 d8/!`0 d8/d0#8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/8 403/@  403/@0 d8/d0"8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/H 403/@a  403/d@0 d8/d!0 8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/X 403/@*  403/(@0d`!6/40 3/0d` 6/=d` 6/ ЍX OZX JX E[ 9d`T 6/d`0D 6/@0d`( 6/=d` 6/'p@-@9dP 5/0dPl 5/\0\ dP5/08 4P5/90d p@/G-P@ep|0 4`6/`pW 0;@@ 0@<@0dp 7/@-0d@ 04/d@-0d@ 04/dp@-0P R@0H d`6/0d`( 06/ p@@pA-P@  `000dpH 07/ PP0 4p7/p@-@PT 0d`6/  00d` 06/ p@`^O-00pS (Y+0d`0h#6/40X#3/d`B?@#6/`4,0HSX$XJ 403/CBP #SY`k ` Ѝ0d`"6/d`="6/ `㌢ 403/P `V <d`H"6/404"3/`  0 40 3/C0@SC Y=d!8/00YV40!3/0d!8/|tX 40 3/0S3 3/?d(!9/$Y 403/ჰ[+  d`9/X0d0 9/ 403/ B?d9/Rdp 8/@0dT 8/`400 3/0d` 0 6/ `'G-`40p@!3/o>Pd(!:/0 0 p0840 3/?dP 5/00p 40 3/pp40 3/ <dP 05/p 00=dPL 5/  8 86000( "(0-[i^i^p@-@ 04P5/0 0p@-0 d@4/s@-`PLW@`00A00 ` 0 6/P WЍp@$ vR@0`<SWH"8008080(040,0Ѝp@P5 0 00$0i^i^i^XeBtdBaB0bB@-@QP0S00 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dA- 0 @ ?  0FJ3?=00 P@`HH@p8 x0P4R0^P@JF@p0d 8/0 dP5/A-@`0p4P 5/0P4 8/`{?0@ 0%3?0 00 02d%VP0 P0`d/// QX0S/X0@0/-0d$ / j^ Q/0Fj^D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/P\`\p0 48/  U 0PEU A謋xj^~j^ 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dp@-P@`U 0p U /0S  \]Ppt x0dP 5/0dP 5/Pj^p@-@PT@h@@pp@-@P0d` 6/0d` 6/( d`\06/T00T0spp@-@P`\00\0dP( 5/p@`@-@$X H00H00X0@ep@-@`gP\00\0d`( 6/p@AQ G-@PQ10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPZDpPpO-Q  媊0L0GP堊0 d:/ 0dp 7/1 dp7/P0<0#!H 00`@00  00004040}P  <q0L0H00H00X0( $00040(0(@ P T0`^T0XP0T0@`0dp 7/ d`x06/0d` 6/@``p`X0V0C?o20SX0S<0 0. `Fj^j^j^ k^O-0@4P, 5/0P( 4`6/P  PX0S   P0_ X0@0S X0<0X0H0@(u X0L U l X`H0p+ L,p0< 4:/04< ;/ 0 X0L00 4p7/H0  <0% 0L0/ 0< 48/04< 9/04< :/H2$p 4 << 0(p,pLpL0S@0SP0<0aP [PX0S  `  X0L P0 X0<0X0H0@(S?V\n \8PhV C/P` XpP X` `0HP0H0@% V P0S+9`P I 3YE0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@C-4MPCS@P:囈 0P 0 P05/`P  `4Ѝ0p"RP `҈0P P5/N02p0ltNP000DXQ01 01€^7^1^]n^p@- 0PQ@ `M ` 8噃U < 0 厃܍p2^n^G-p`@ V@0s5 S2 r/ PPE_oRP! Q |GP P Q sGPP Q jGPP Q aGP Y U @`FPY P 9/P@-@  000P00 Y  Y Y 0S[ S00 @SG 0$00000 0R 0S4 0S 0 00,8/0=@00@000 0<0J 0 00,9/ 0  ,:/ᴚP0`0S  Rl S0 @S| 0 00,8/00S0  10 01>  0P 00 R&0S  ,0   \}3/0PP1>  X㰀  X,0   3/P0S00  ,0   \3/0P 0,0 00Y8   ,03/   ,03/   ,03/    ,03/ P   ,03/P   ,03/   ,03/P0S   ,03/   ,03/   ,03/    ,03/ P   ,03/P   ,03/   ,03/P #P 0P 00 0 00,p7/ 0p 00,8/0P000 0S 0 00,p7/ 0 P<<00;00;001 0 00,`6/P 00 0 00,p7/ 0p 00,8/p 0  ,8/ 0 00,p7/P\ 3/   ,03/q3/   ,03/   ,03/  V00YX 3/   ,03/]3/   ,03/   ,03/  B\ 3/   ,03/F3/   ,03/   ,03/  +O-M$( aE`8@ 03/ P400\00@;P5/P 03/@$80 `0<0d00X000 @% 7R0P0($0P3/P6  043/@083/ߍ`d,03/P\0P0 P X \`,,0 d3/P0T CR갯B B B B B B B B B B`BBB BHB\04\0\08P 043/TR 0pS0 000 S; 7/80`0<0d00@S\000\00X000`\X ,0d3/PP'X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0OP/0C?o\ `X2 0d,03/\ X@` ,0d3/\ XP` ,0d3/\ XT` ,0d3/@<@0\0T 00\0P\ `X ,0d3/\ XP` ,0d3/\ XT` ,0d3/\ X` ,0d3/\ Xp` ,0d3/X\EXP U*t0 S3 1* W X 0ly`X d,0R"3/P @GPQ\ `X ,0d3/ 0 T pRhU p($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X`0  0d,03/\ X,` ,d9/,0\ 4 0 `0X ,d9/P@=@ 0 SSi<p1A!T <T ;!7/T\000\00X0000Zp^@-@M. > 010K/0  $!(! 111 1014!, p1>  ލ蔖BO-PCDv  Q)R, R v@ C v`t0SvB(1$!u0aVKO0SB OuŨuV u`uVB du0 S1B B(B0B8B@B\BdBlBtB|BBu u@T`u\0SuB0 u0S Suu 0SS0S hup\\\ R^Q Duu@su0 0nu0 iu0 du0 _u0 Zu0  Uu0@ Pu0 Ku0  Fu0  Au0   0800P 5/P v @ 8$D0<4>`P2嬢42 4GVvG 0 P Q CPP`P$0 PP 2 ,42<0424 242$42(484,;/P00@4$0 00  1, 041<4141$41(484,;/P00@4U 0S R !0R "0R@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4$0Py ٽPyu0 ϽPou0X4Ѝ+^Bos^s^`t/P0P PP@t0H102p@XBos^ lB,B2^hCԌCC=.^ 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-@`a>|4S@ Px8@Ptp@- 0 R\0S 0 00P00 ЍT\p@-@8>00S @pTPt 0  tI@P xQ to0x4@ 0DPx@xQ t\xD߁ܦCO-M`>@_s` tkP  f P ЍOs 0(P000A>h 00S(0404pE>L00 9/PB4Y 1000  L0p0 7/pP@0pL4D0P4Y0SSxs 0L0X0; 9/P@10<100:00 P0P   0 @00P00 l060pP0<00 0*0 0 ?060 lPt s*C0|4ЍLKs4X4$4\4+^xBBos^)w^Dw^BxBT\Biw^xBs^Xw^ 0R R ?R//p@- =j1S@ P @P$Q `pO-@M`P *0 SP*0 SP*0 S 46 .6PU :Y@00 0 0Y6Ѝ0S0`pX d0`\h0Pl0UtT=S3t 8: #8;/T=X \Sx < 0`;/X=\p`T=S00| 0> 6/P p `$ (, d  0hl 0W*0p4W Q0CpT=X \S3t 8: `#8;/T=X \Sx < `0;/X=o\pT=``S| 0> 8/z0@-01 0P Ѝ\p@-@T=X PS0@  ``\6/0  T-X=\R B 0`6/T-00X 8R B `P\#85/L 0 T=X \S`PA0 @ 5/p@0  =x^O-CMPp<U@a 0h#0P$  "PP $J0$=P1S 0 # PP q `ԲԢԂ0 T-X=\R(  09/ P\X T=' S  ` 09/T=X \S  `09/T=X \S  `(29/T=X \S(  `99/`VS  ``06/T=X \S  ``06/T=X \S  ``06/X 00`` \6/daT-X=\R` 0 08/ `VT=X \Sh 4 ``06/T=X \St : ``b06/T=X \Sx < ``06/X=\@`T=S0| > 006/0 SW0l l 0-POCߍ$Q |$]l,C]Dx^=x^#EX\G-`@;Phwp@ X P G@p 0( 0X= \ R R! R pWT-0R @ 9/APqpP0,=T}:m \0S`G0P xp GW P S01|p+^Bos^LB9^\x^=.^G-p@ `APCQR {U010! A-@` 0$ pD\:m QU0 A\ P QUG- @$`(p,00 N\:m QY PPU0 G V P QU/C-@P@M$0,T*c 0`Ѝ-P p@- &P <@4=* P l1  0p@6p-@-@xP$hMp\`!*P l1 0040 000p`00IЍ-G-`&P0p)|0@U  Z 40 00 pЍ0 00:/p -vd@-@($0$!60)@[-@-@`pP<M$,()(0 00|Ѝ-@-@dP$TM`Hp)P l1 (0 00DЍ-0@-P$0M 0 0 岳Ѝ0(BdB@-(0 0600㣳Ѝ(BdB@-@c9 |1R0@-80(@!60$$^)$h@讴-p@-`@PE9^ 0 p@/p@-89@+s@-P`19AT 0( `4/@P lЍpvdy^@-p@-9@]ȱl1x0p/0#!  03I !x1 0X10T10 P1n0 ?3 P"x1(0X1!,0T100P140@ /H0H HP8m0h(ЍAU%(Ѝ,z^%]4z^B8BxB=.^Bp@-P@m|Q幰pp@-lA@ P0 >@Pp$Bl1/G-}@^`PQL1S  eP tjጰ:~/99`a7P!QY0  *`0 *VPmi>x>6}卵 oeGoz^&]4&]p@-@]}}L1!0CSL1Q7fJp@}p@C0S$00n0S 0S 0 d=;d=//0S0 d=;Ód=//Q9 )R4 -09/00@-DM000,00(0\0 0T0@00P0<$  0A<0 P iDЍ0z^m3^&]z^A-@PT=X `S80  `p\#87/T=X \S8`p8  #87/pT-X=\R8  08/  pW0 tl9<l=D=Sa  60 ,i9l=hml]衆z^z^G-@`pPT-X=\R` 0 09/D=S+4XT-X=\R0P  5/x0PX0 `Bl<T=X \Sh 4 `08/ 0 /l蠆{^5{^000 ͓0\S kp@-Ph@W1 01  hp@WG-@}`J1匀01!3R R11P011S @dPP 10CS1ePp@-@mP̮ 10CS11dp@O-`p@0pPh=Sl=SX=\pT=Sl 06 ;/l=0l=d=   P Ѝ T=X \Sl 6 ` 0;/T=X \Sl 6 `0;/l-9T-l=X=Rl 6 0\;/ P DrkT-X=\Rl 6 0;/ 0P4xVY{^@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=Pl] ЍP =  -0=X T=\`Sh 04 / A-@P`}X= 0\8/  D=SpWk<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/{^p@-]p@1-P Xj= S-<<g=0=e 0>03p {^&]{^ 0!< 04 0 (   !/@`dO-p`@P㔰Ȑ0S # 0嘰  g0P U  00000@@ T Ѝ{^\ P/0 !8 00 (  , !/@`dp@-@P T⸖9S 9S 404 0@a 0 (Sp@},Bgfff0BD=S/p@-@=P0C==0CS=>3;3p@c=A-=PS`p @PVD=S@ 0 =@S蠆A-@p !P`P  0P Q- 0T  \iЍ0A S 0 i 0 e{^!|^@-@00PPЍ7@-P@@=S 0 5 00009Sd=000 PH=S Q  HZ09SBBBBBBBBBQ  Q  Ѝ0  DG-0Q@p`0MQ w0ЍQ o 4=3/|7S ({h70?0?h70?|7S 0 0@a 0 ( |7S H/ox" "0`" 0 S 00 .0xYq .BV|^gfff0BAp@-PAM@`X# dP00C0S0Aލp S;03Qd + Q  QG @=Sa2Q 0Q*$0CQ 0Q-0S00?601|2QY 0Q |X2QG 0Q *0CQ@=S d= .6M042QF 0CQ0Q 5>8#8ST` :.0SS`   /  ("(  e@=S d= 0 GP6M0100@=S d= N@=S d=N0@=S d= N09S >S$\:'0 SUL S*0C#100L 00-D0QN0 mN0N0%*FA-όpP 0`@PU ,Ѝ0 PP!@-0  ЍA-`@0Pp8=3/h7U) 5h72A9#9 @s@-H-0PR0CS@t 0@ӕn R 3 0HHd <@Ѝp@S @0.@ӕЍp&]&]n|^O-@lM@=S D=Sd?`< ,0,=0>0$0=S >S3;3lЍ9S9 YU 0S990090C9Z0 I06 p 0 P 5 0 03/039Sb.030@]  \P303TW ?9S PJU PU 0S000000C08 Z0(P 0 S30 03/YpP2 0 Π;t PP1\2(傿9S0 d=00 0H\ʔ# 0 G  0  ᴦD9Sㆍ P0S ` P 0!:> *00! D20a08/>0 (00D100 00$ 0C!C195 S' 10170< :0k(0 501ଽ,0 P( 0h!dNf3*d=    qP0 0HYX0S S0! 0 0  b=0  0$  0OPD10=   =0C== S-"0>0>0p&]|^A-0=@S 3/`pD]U' PP `V|eT=X \Sd 2 0``6/T=X \Sh 4 ``(06/ P N}X^A-S@\`M 3` <3 7+`0 `ЍP坨 bV p 10E?o2P0S P˨   h+WP `pPP弨3<30C-M M@p|$aPPo``$A0Vl  V7* V  V @-R zv$VE ? V Vv  V@=S0 S0N0B Sh*$AS0N09 S06M03 AS0N0-l#VP)  V * BV H RV=d= $#VY  BVd= A *0 O0 ۍ Ѝ Q  P RP@-R 6  -* P P@2Vd= d= S0N0 S0N0 VAS06M00 PqP0T 0C. PM 0SP@=S 9S H=S S S@!}0>039 0000 P0 00@=S2P 9S#P{ 0}P Pt P9S9  09j }PP c:@=S_ > :S0?Tӥr*F%- S/@-@pP`,M" ) @*"0 I,ЍC-3@@DM > H=S  CRP-)9 R L)"" JPP> CPP@ )[0 l U C)@PV0@0 \P3@ > Ud=;d=DЍSP- 1R >  =H=  S9S PPn PP`0 S 30| Q ;S d`P{0 PP` V@p * !(#|O]$ 0d- /p7/@=S/D=S/QG-@@=S`떟p  43/=S-D]UT=X \Sd 02 `:/> ?P=0 .:^^XW3XR=3 ,=3/@]GO-@`@}W,=3/PP0@= J-I`oH-娂R00S989d=0d=9S C| C C C C C C CCPP  ?;< ?5989H-R9 ;Sږ_%#>  ;Q("( ;p0 0 (0 @9  )%$ מ  d=   d=  d=6   d=  :S0?ӥ=t ?9S H=S)> L <H=S $> CN0\V ; 9S 3   9 : 000======H=SX S`3`3ڎۮ= ⨽  P& ,,b P (b  H=S ?V  %00C0S00\0ӕ ꠲T-X \R` 0 003/2[da>0.>0R 3;@030)9R032儊T=X \Sd 2 ``06/W9SHQ P Ѝ|^  -%3&]2D 1|^|^8 |^L]Ip@-P`S4P@@MT @:Ap0p@-@2@=Sp>PS 0CS>02lQ^p@>S 0CS>H=S >S02p@P}^C-P`Mp@+P@ @P EЍ1W0CWE1Wg 1W 9 -09 x94P@4 =$@=S( Od1W8 1W  . G@P#@= S8 9S    S@1 o4P@3@ @6T0 @0 0V@P 4P@3@ QH=S@2iii9iO-@=@SdM *P 3@  0`0 T=X Sh 4 `<\dЍO/T-X=\R` 0 0P5/   T-X=\R@  0P5/<00p  0P 0`+`?`$ 0 T-X=PRD " 0p\7/=-0C==0=1 a 0& T-X RH $ 00\3/00P (0P㖏, 0p*h`=0.U3 ;37 0& {T-X RH $ 00\3/<0 0P 0} P▯> 0)_= 0.+3 ;3 0 T-X=\R  0P5/p 0pU1<)S { S  BS T=X \S=h 84 `P#85/= d3  d=0S P0=00S0 ( 0=T=X Sd 02 `2 9S588Y9S-2"8'09PP# YF0 ./%0< 0(320@@00` P! (dw:"!(' (& (ʔ0!.0" ( (.70 p07/0)0RSК <+P 3 #*8S00C8 ṇ?0 0 0iX44 \N +_ 8EP 0/P)P U0%ZE'K+~Qp  ß 0H(མ=[)0D%d^= -JZ%4^=0= 0E%>=~)0 S$RP ^X [ [ [ Ttᆤ [0S x[t[U)pXG%^P K+Q 0 /0H(མ=[)0#O^}= -JZx#B^=0= ំ0G'>=^e S0 0 02_0CSy CC0ChCXCCd=0d=9S9Sj p43/Q`d=0d=\H=S >Sl"PP 0>M9SJd=0~9pS 4QpPEUP#D랄 U >^pP>PI 0$ 0 0$ pI" 0i2p 02"0000H-Q0R RK RE2H  0M> i Ppp:w>  )#L>ZP 1>#G'U  001  ?& f#22?2 ?"LP0C.>2>2?5?3 S 0>.M#tn]nD&]#}^']']̰']:}^H}^Y}^u}^0}^}^}^}^}^ ~^+^~^O- @$MvP(  bZ,] -W'|UT=`X Sd 2 `P0\5/T=X \Sh 4 `P85/0D=)P0D=T_}0 DNP 08)PXA  " Z0p 00 pp'ZH}0wQ R)Z0SH=40S"Y0H=0 000l0 0d1!H2# 0L=4Y( 20(=y p Y0H=0dp0 0 1!2# 0H-P=R0&SS+ 000  P0@S0.S0-S0 S0H=00 C000C 2# 0 B2# 0 B2# 0 B0P=&H=S% S% YH=̥̕S L}dx:/9"b0AglYPd4:9ȏ"a@h 0DZYV& " )+5),|05p@05\r0404043099!= 0 SP ]\:0㠠 0I10S S2 ԊJ베YH0X 2PJ0  SBQQr  `RQ"< 1?0:H=מS0 d=  0 P0 d00d= d-H-R' R RB d-P#Qb?d= x#Qژ0d=h3)Q8<9 9<9< (S:S$[/d-P-R j>0d=2R 9;998<92R 9<9<  : (0 P0S909 0 0h 0 uPg 0SdڴyZ ?!> 2 t=2(x=6=⾠ᰠWṘ/K%ܐ44=4!8=141:1:141=1=1=1 =M@p1X 0>9/   >p`1a  8 >p0T8H2$43/02002ṏ`)p5": d0@00 Q000C/CX@C/C<0C<2CCC;C^@-@4S@/G-3PA@,p0 <300U XHۚbV  $P 3<300UHGd = >Z2> `H3<3O-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03\"A09/p(p0 7/p/0 0\00 p:/W .pß0 \p P 1?A3c0>+\t]t@{t ́1@Xt@1(@jt@mt1(Mb31S/ !*! 0P0@0S`̐@1S 3/P ,  !) '0$@=L0K<1h t0L ,0L0H00, ), , (, ,06,00`1Y1810<1t1D1 Ὃ 111@1 01 10 1  - 0 ⼌pP0  03/pP3 0@00S-*⏋aRs Sh00SZ=9 R =?A3c2#d S 0"#!0 "#1R 0 34SI+^Mb́@+]p@-0 `"6 0?H1Sp@P 31S ^FV 1  10 }p 10 10%1 1 10 1:+O-H!R ZP %!`R %! A(0q 01pBR0  R<" 0" P@PV0@S @DWc AN!p PGQUV: !K !  !-! -!8!R:-! -!90@PES AU    R<1! 0 03/p !  !  !0@PS @DP BR-!Pt5/ ! !  !Ί$!R ~$冊'Q(A(5!@ 0 2/4!  #! #! , 2/"!R "! $  h0AM0,0 ЍO/ Ѝ[CO-H1S` Ѝ@}P  tP=03/81` SP0f03/,!03/03/`81 S 0S @0{ 3/1q0+ ``n 03/  &1S 0!&11!aV5 0V`!ؠ0!:/10C110103/`103/ 4 R $ Q P$x|  PQ0x0 x8!R0 !Hd `V03/03/`0S`VmF ډO3/0>  3/,!0 3//!03/0!03/,!03/ 03/Xs03/ pW03/0p3/ 0gF0 3/0@,! 3//!03/0!03/,!03/, 2/d20S  $0 R Q x0| 00++P04S x00pHS q0x003/ Xq 10%1 10S 10 1X 10 181S3 0CS-100-1-!03/03/'at!`&`'  ܈v )!" (!`(a)! 00110$1-1-1 -10-1-!03/!1S0!10"1 %1$"!00 -`Z'́ۀ@‚^^@-@K<4@A-p@`0S @S0C0\0@3/\03/\0P$3/t00S "SRP x0|00 ! P4Sx00x0@ۀ @A-P0@`0 p0 7/pP p8U `0H3/ Yp` U+8 `#88/ }`0 83/ `0<3/U `0(H  (3/U`0) U@   `0 3/Ѝ0ES `083/ `003/`08 3/`0 3/F$`0 3/C <3/ `043// `0,3/ `0<3/ V  `0H3/C-`ph@(h  0 iPP 404 x (lpph`t Ѝ@ۀ5^C-@0`pMtP0`;D   4p  p081@0f-10-!3/t?P0 | Q S'  S  h D= @60S t0h$0P qA81 0CSt,(0S0@00000810C S񟗽$CCȅCtCXCCC܇CCC C000e00 0M  \bD0  0H0eD858eAl105Pp1(5t1 | 0 1Չ *10*1@ d d ` 0p$  $00-Dx  @1S0H1[0< 0Q0 Ѝ000d00@000d00000c00000 0003/c000 0003/ct iPt0 4`x6/  `R006/,cZ0 006/cR0 003/dT03/PbL03/PbD00081 SB b81 S803/0` 3/ 03/03/ 03/,,0 3/ 03/03/ 03/ D B @000a;0 03/03/ 0`3/ 03/03/P,,0 3/03/0P00 0000 03/0S` S` 03/ 0`@R`C+^^'^C@ۀ5^'^`^t^lZClCtC(]K^uC^^ƃ^Ӄ^ރ^X^^^}^_^8^t^A^V^^Q^0@-@PtM0 0 00tЍ0p@-HP0S p`@=P 0ST00p@@- 0 0 t3/p@- @tP 03/03/pp@- @^aᝅp@-A-4@@``03P`=#=\p"07/2",p7/$00 #002#,p7/ @&& 0\"A/p@-4@@PP03"P=#=\`06/"\`06/2#,`6/l"?0 \` Q- ( "(R0#6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@, B0\P 5/2 ,P5/2P,` 6/ `> 0@S! > P0 \`&N6/0 `xp0 `0VAOH>$P@ 4>0P,>#Pꅄ^^Ą^-C-C)]ʄ^ӄ^#^O- P\h p(` ,@,4/ R@ WdB0 0 ,P5/0D(0@0O-P\h@RpC$P 00d10`0YPP Ѝ[ t0S 3/0 \$8/  ,0,3/ t0S 3/0 \`$6/ ,0,3/[` d0L ~~[ 0002c00000 ^\0O-Q x5pph` M@c |03/}㮧0 ,9/p +40\89/ k0 00 l0 X0 $0\p 7/0 ,P,5/t0S 3/0 \$9/ q0 ,,9/t0S 3/ \0$0X0 P+> Ѝ^^R R R3;33R 03/.x 3 ;3@-6;= ^4^O-\0@hp@FxPP`3  5P 0 ,,;/,0 ,;/*0 ,;/0 ,;/$ 0 ,;/"$ $0 , ;/"(  $0 ,$;/3- \ p  34 8\ 0 08/0 ,8/2 420,8/",  $0 ,8/$0 0$00 ,`6/$04$0p  34 8\`  0 06/-00-03 0 3w`3 p +40\@84/ GV Oov 0  G-@`hp3~|03/<08 PPUPR4S00P U` Z l/= Xs= Dm=@k=p +\q!40\8G/K^k^t^+^ 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dp@-@`h 0p@|P0wP\ 0T L0D9 0 0 0 00 0h0 03/ꃅ^^}^@^^O-\0`pQh@P t0S 3/ 0\$;/ tp +40\8;/}i0 ,8/p +4 0\88/ XWx0S 3/ OT(0,0000/@-@0\KuhA-`p(!P$!@|X0VP`|`hp&}b`"}|! !ȣC0 RD   R8  | R, |  R  X R X ZtCĘCȣC8[C@-@a0Q !@\0@00A-`PP@0S P 0q@P PHtPp@-P@tp@p@-0`@hPPp 0 \00 ,@,4/p{P 0 0 0 0h0 03/P 00 0pp@-@P|p@0,vO-Pp@.04|Y 0 S0 0 ЍO0 `P` Ѝs@P`  0 P  0@ T@^O-@MphPF|lt`P ߍO?|yP" \0W%p,, P@<0 R80S@p<0$Rt|!س80SOʅߍs80S<0Qt0S 3/0 \p$7/  ,0,3/p<00St0S 3/0 \$8/ ,0,3/<0 R@ 8 R4S@0 rx00S{<00  {<0S( 0 xP {0 "Nx{ < xP {<00 Rp    {`nt0S 3/_02 \$0:/ ~X0\ :/0 \:/ ,03/XP<0p00 ,03/P@ 000p<0p \0(0 2 \$C\#<;/. 0040p0 P2 3 p +4 0\89/3,   $p -0P00P+ 00 0400Ba 0Z3<3$Ѝs 4 @ppP ^8P P#8 MbCA-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`x 00 0wPP 0S  0  0` iu08 _uU P 0,r p@^r^\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/-2 \00/@-2 ,@4/p@-P@2 ,`6/”0P\0p@ /@-P`p@@Đ$0\ px Ѝ8)]@-P`p@@Đ$0\ py Ѝ8)]p@-@P0 \`6// 0 \`6/&U0\ p@/PG-p@c尐PV㬀ʀ 0! # 0    !&w 0!!c0    !0G,@`d7@-@ &^Y0202020 DR2|0e@4S000 0(v2S " k" Ѝ0@苇ꤹCCиCķC-C-C@-@ &@v@-&1wPp@-@P&[w2020p@-@4@SS&w 0@@-@&@Zw/@-00 ;x Ѝp)]@-@8Đ<0\ @/@-84< ,@4/@-00 w Ѝp)]G-p@c尐PV㬀ʀ 0! # 0    !&v 0!!c0    !0Gk@`d7@-@&^ 0202x02p0p DR2h0夆000 0lu2S " ᯆ" Ѝ0@φ꨼CC CC-C-C@-@; &@v@-&uvPp@-@P&v2020p@-@&dv 0@@-@&@vP/ 0\R/@-@ 0^   \R@-@0U. V? 3 Ѝ@b2^3^C-PQM. t@pT*P P _.`0l 2d0 _@P 0t008 2 v.Ѝ@b^f^xy^]2^ 0`( "4`#/0@-PϠ ,@ / 00@-P@M0 00000 0 0 0 0R 0R  0R  0RPU @Ѝ0)]@-  Ѝ@-   ЍG-M P@`  000 00  p`V .   ܍00#000#000# 00@0# 0 v p@-@MP `  @ @@ @@ S ~{x u. P  L܍p@- v Ѝ@-@ iЍO-MTPRH@` 9 A>;0 00 (00(p00080 @D < 4 , @  :0,0040 0<0 0D0 (!$0  8  @ $@ ",$  ,4 4< <D D  $ 0T 0 (00`00080@   (( H (,4<D  T.H (ߍO-MHb@@p L P ( 0008 00000S { (x 0u8r .@J Fߍ[ 0 P0# 000R(  " ( L0 "0 G08 $0 0 ",008 40< U L O1$p!40),!- #4!'<! !@p@-@MP `   @ @@ @@ x  .   ܍p R R R @- 2 e  ꋆ^O-MH`@L @p    S 00# 000#(000# 00 00#800 <040,0$0 @Lj 0 !0(!00! 08 ! 0 6pW`@x u r o.@J FߍP0 00000 000M00# 0H00#(0C00# 00> 00#80900#$0400#,0/00#40*0 P0# <0@ @L :0 !!0(!00! 08 !0$! 0,!04!0< @!0 00 0000 0 00UpS/O-M0@P< 8 0 , $   0000 0p0` 00 0 0S  .0 ߍ  (p' p`&(` <e p (` @PS/O-MH`@L @pai e a  ] S X00# 0S00#(0N00# 00I 00#800 <040,0$0[ @L U0 !<0(!700!2 08 !- 0 pW`@!   .@ ߍP0 00000 00000# 000#(000# 00 00#8000#$000#,000#400 P0# <0 @LJ 0 !0(!00! 08 !0$!0,!04!0< @!0 00 0000 0 0P0UpS/O-MX\ P@v ~ , y0 (0t 00o0D0j 0D0e0Dp 0`0D`$0[P  _, [(0WT8 00L0D0<04008p@`HP[\0 P0U0DSy D3D/pD+`D'P00 !)08!$ 0@!H$0!@@ 0J040  >2  >2  >2     jލ0 0 000 00pG0  0000000 00@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *j%nD(hT$ *h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P%n% ! P"..@$iD$a.@$i.lD$). @$ . @$dH.(i.f..f*b. *l.*b* .. @ (@&(h.&#a. 0#i4#f.. !a'p'0iT%b.b4#b!bt'bT% "0l! `&l4#lT%l. !lt'l$",p' ".!`& @$a.fh'dH"`@ ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:aOZPa!e%a*ek!l,l., ,a, i)i!0l!b"b$. ",c$#c4.P%P%`4 bX%`$"c("  a,b$".a4#b8#j. P0~000//00 0//G-@`pP0@M 0a800,($@ @@ @,008 <0a,($@ @@ @T00L0000P 01@ 1P (0$0 9/0 0$@4/ d P 0 1P 0[0 0Q@T !0tt ⾳000 1S X!a/0,, ⬳@5]5]2]5]5]2]^ۇ^ T߇^^^^H^x^C-0EMP3/P:@F'`P@`@T@@d qP @$ 03/ 0(9/ P !0 c0 ^@P @Eߍ 0((8/ PP <!0 @0 7]ܘ^ۇ^ T߇^Ӌ^G-@`pP0@M 0a800,($@ @@ @m008 <0a,($@ @@ @^T00L0000,0:00640280.0< )0@ $ 0\ 0D P0H L T0X t~L08p4T0H00@,PP0D0(`$ 0\0  0@00<007]7]7]7]C-@0S !&.8yPP &> 0S !&> &>ş 0S " &> P0 05p9/5 0S !x%`CP \5 0S !<5(( ş 5 0S " 5 ۫P0 04p9/4 0S !$ P 4 0S !h4PP ⴫8ğL4 0S " ,4 ⥫P0 03p9/3 0S !#P 3 0S !3xx ~`ßx3 0S " X3D< oP0 0$3?p9/?0 0S !? P ?0 0S !?0 H?0 0S " ?0tl ;P0`B&.0808/&.uP &>0 %&>/ P&.0!008/!WP 1 1!P&.0t!|008/T!89P <1@$ (1 ! P&.0!008/ P 0 ˪0 ƪP&.h0? 00@4/? HP ?0P4 ⭪?0 $娪Pߍ,8]:]:^ T߇^8]_I^L8] 0@-ALM0 P0`5/(@ @P @0 ₪@ 0P00 (p7/@ 8P @0 m@0xP0 (P0 p7/8 PP 0@, XPLЍ=]7]\^ Td=]j^=]x^p@-`@pMP喱 ⚲ ▲`a R ⎲@Th pЍp07@-7P|@~ Q@00#47 b0 P Q0 Ѝ0r00#4p@-@P`\00M 0 0 00 P  0Ѝp@-t @0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 80 p0 P@`pPtЍC-pp0MMPSvX@`P `ް0 (`(07 `ܱ `ر`0 N 87 (epWIO0"R%U` ⳰7 (ⷱ L 7 (h `⚰0 `0圱7 `☱`p 0b"!4b4# (007  p0h 0p0` Mߍj7 (nƱ ( pG 0O-MpP0?0BpP 000d  07 0001 0D \n D0Qd 7`D ^R 奠TRPPPZ 0Dd0? 07 Z0 0@i$ d0  0d P0T RP0P Z0   d7 v0 $ dZ007 PV dRP PXpWZO%Ѝ>]lI]p@-l@P  i ,ap0@-,M@P#4\0   = 000Z?,Ѝ0ĸ^ 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dG-p`@4Q#U 塖, \aUP! `V,10,1 P   0 0  0< 0 0; ,aЍG/@-$Ma#p||`0 @P C0!4q000k  w$Ѝĸ/0@- $N@ p0D/2D@- Ѝ@- z Ѝ@- Q@ AiVPU 03/@P$041d0$0@00S$0@0ꤐOVXD0@0 `@|0 pD0S`d0W0T0S @`,  |p@@ww w @-00@T P@;}^/@-[ 0p@-PS@,Pm[4 0"p`p@-P?@P0,`000<00@ hB8@P P*0 @6[Ppp@,$p@pKD`MDKD^,JD=.^Ǝ^@-@ @,0S@ s<00,@Ըp@-P<@L0,`P@00Ƹ 00V$  p@"@^^^`@-qO- Ppp`0DM$  0<00,(Pp`@ᥡ <0400,0@0 080 000(P$p0 0P`叡DЍ^@3^N^P/P0 /`@- 0,f@-0 @  00!P 'P `kPP |!Ѝp0 P 004P0 PhP$q!`K^LLDU^-Dw^4/0|'R02IN 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dp@-P(0@Tp0S @pp@-@P 0T 00Q 1S 0<1e2 L.:1S!!1! qcfxT(0003/p@Wp^^ 0P 0CP@@d #/  N @@<0P 0CP,0P @#// ̇@-@Qc>0T@DD<0T T 0 +2'2 L]^^ P P/  N /P PP0// p@-`+P80@T p +P @pp@-W@U" (R  BR(13/4WU PEU4WiD73/4W(8S 0CS(8 88 3/(8P80 0"pC-w~0@S!P !R 0X"0T'QQD@b原10 R U T 0 S1S 0!   RIV|DXS Q ;V6XhU} Uy?NxP qG JPMN Ѝ0 S'0V| X'e 0! R U!VV0 S|Q0!V&R! 1?0|8|Q|#L]^!^L]4^W^O-p@0'V2 0iP>05/cw^ 0lo00`0S P[ 0p  0벰p W` 0S2001n8^0 Sd0001c00fN8R0S00d0Q00@Sg/1!|115#Jh01 RC 1GS  s00aR310@0/1S01 ЍO16 "6&0- R    R    R   "-" R   .R 0  S0@008Sh0 S,i01 k^L]ptpND^0.R  "-" R   wP/P/////RYDYDYDYDYDYDYD0X 4\ 18/P x7S0S/L]O-`@0u_0Pw>0S4 0!0p)눐到0US|"@TP Ѝ P @  0 0W   pd^x^7^^+^^p@-`@PPp@0!0/00007wnS00q 20|7S S S0< 00CS\D\D$\D0\D<\DH\D|7Sx8D!0 0<00;080p0808070B;0;M]Ȑ^O-@0`pTM0=^0 ^ qw>0S9+ 3 0 ^p7  0 ^p7  0 ^p7  0 ^p7 0 ^Y0ZYpHH0SZ(PD^X 20PT TЍ0 p0P5 0` ^p7  0 ^p7  0 ^p7  0 ^p7 0 ^ 0pSP  07pB0pX 00 0 0ZSʞP  `P( 0 S0 `` _^p7  0 W^p7  0 O^p7  0 G^p7 0 ?^poM]@B00 S   P 0@/L]G-P@Px"x.\8 Q8 1Q Q  Q2 QwⴀXa` 0 S)200SP7 P Q%u?0X pPSZ\0Q Q 00P PP2q?0^ PP 10p |p  ppWQX 0S MP48S|74XS|wWbDbDbDbDbDbDbDbDbD`Vh78h7JlK4h78N]Ȑ^0000 000/s@-@` ^1 R S00#0 0S0:1D!0CR 0 D10D1! !0 0 0' 00 0-00n\!0D1S 0S00 000 R 0D10CD1! !0@ 0 0 0  R0Ѝp^.^΀\Q:  / AA////p@-@8 MQ_ 1P 00#!" 0 0000 `0V :3/P 1 0l t 10 18003/@ D08003/0<000 Ѝp^^XN]i^^|O]G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::|O]|dDdDdDdD0S 00 , QQ  /qN]đ^^0S 884!RR   !/N]đ^^P0P//QG-@p ڐ1 0" $10$1 Ѝ``PXQ1I(10(1("1h1 0 O -X  p7岠`71 0! `W p71 |! `80S0S$ `03/P1 0$!< 베,10,1W 111h0 00 8003/ 0`R*0 9/P 120!S 0! 0\  W㲠`0`4!S 4!p 0 L j0000dN]&^XN]=^^ɒ^^*^i^^X^p@-@P:3/P:3/p@-@:3/~:@/G-8p(MW 1@P` ᴐᲠP0 0#!"!0 2 03/P1 000 0000 101(Ѝ \0R 1 8 @ 101 :(ЍG/^^w^N]^^C-`@ 1RP~P1US^1 P0 0t1t 000P Ѝ08 R@@^  0 RppSh7p0pp 3SH0L RP00H0 00@Q%@0 00T 0 (0 0(00S*o@P  # 0 3/P o@|O]N]^O]=^C-Pp(0`S!R# p 0@ l0 0R@@@N@80S*oPU@ 00 0 Ѝ (0 S*!R $ $ $03/P@O]O^|O]/A-`P@HM p&40%sV   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M^04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p $+P`Ѝ,O]=^@-0<S !"  0 , y Ѝ0 ꩔^>O]<@-@ P0@00LO]/O-P0 #`1# $ ( #$0  #(#< 0$Ѝ0 R@-P@0  <0`101(0 0C` "&ЍpC-R@P<M0 & `p1 01(00C0C ( 0Af &P 80R %Ѝ4f$"P//O-Q0 0. R XB Dd(0HL@@A0 PlQ!@DQPU)T* p1  I0 @Y  ZIJY ^ . .,.0 , ,,̠  @P^ ΂ a\aNL^Q !^UIߍV]E^A-@` 1Q @ 00 >0S TC (`PJ`F@ V `!J`V@T*Z+ P1  H 0 ,B0 #"$!qQ PAq@QpppW0#0P` "4 0"8",  0>P1UP N@aTaE1DQU@00>01S0#0}$IߍE^V]p@-.0( ,?L00L0S 40040Ѝ, TG0d0252P5c $YX0Zp0S1 >.Gr0p>![D00D00J S*1 =-Gr0>!FL00L00S S0DDDTDܙDؘD8D4DLD2St *Sp 0S ! 0 =GP00P0S/Pk xl00phQ1 <,Gr0=!L00L0xx7S 0450!0P0C2X00Z0Q1 < ,Gr0x<!L00L0Vx7S0X0Q1 ;+Gr0<!L00L0?0`0H5Q0[0 1 T;T+H00H0Q  04 8 <,S0S P |0S! *0Gr:!H00H0l0S1 :p*Gr0:!vD00D0 R1 $*Gr4:!dH00H0X VY1  )Gr9!NT00T0YQ xQ 1  x)Gr9!9X00X0A=P:1  0)GrH9!&d10d1xU !/ 0&W101<00<0101|7hWSPm2Sj U   iPd d7![0R 1  @D[ 71@w. h7R7!66h7[071?%0#  1  @C ?pw>0S㺟)  };5?|Q 2  PT<`0S ;!0:1h7 0 000T0(08U l7 I#l78l70 000T0(5   P! T $P 0`P00 0P  x8Xh'* 13/?S PT04$ df|wW 7S 40040  0 RY-1 5,%05 &D00D0BP*1 4$0L5 L00L0P 2P P00S ! l$05 H00H0oZ1 4($04 D00D0^0 S ! #04 H00H0MS x R4P 1 3  5`00`06h7 1 |3@#03 `00`0$x8Up W , "pPU 1  TB :0 00 00D 1 2t"02 xW % P   9#P0P a6/1 JR  1!0, H2RL00L0㸁qἑ  @uB0 p:S  0 3/P1  101!,000|7S0 a86/h7 1A $10H1t!l00l0|7S0 a6/X 1 000  0CX ! 00 000 e^^^^—^^^^ӗ^^^^'^:^P^u^ؘ^^^+^Z^l^^Ù^ՙ^^ ^7^r^^N^^^t^:^2^^^^^^^^^@@^4^^G^^^^^Ș^k^m^S^^^s^^#^2^:^d^PP^ɖ^^Λ^w^ 0 S% 0CQ  0B000 $1%000 |Qp( 0 :0S0GSX 1 10x1l!0S ! 01|7ShDDDhDDDDDhD! 01!7S !R 0L2:W W㐑C  H2H"p0 00x8U,  !PP` 2 020000P ,r1"  T2AV $30, a06/pb ``x8U d |30|#|3\,PX 3#03r ?P  30#3kh00h0D3   T@ dd 7S/W) W7,P 30,0Y 1P$  T@ 0 Bx8U<10<1h00h0 1 3/|P  ,0 a6/1 858%pm000Q7S 13/X 0S! 05%000|7Sp x0p |7S񟗻괬DDDDDDܬDDD! 0060&7WS 000x8U   PP 2 020a6/1&  T9@  0S |2 7WSY 1'  T@ 0 <x8 U<10<1h00h013/U 1 3/N1S 7'd00d0|7S?0 a 86/7|'R7S 40040- W0,P 0IQ*1 T8D(Gr008!L00L0xP 1S 8(Gr08!p00p00S"0 $0000 0! 0A S*1 09 )Gr0 9!_L00L000S/ S  S   0Q 0S!1 9)Gr09! ;P0q 0 00t00t071 (01R40h7 1+  T> P 0 a6/}%000 @ D )$ 0R !L 00SL a6/]%0000<,0 Y1,< 00Z 1,= 0A@0P !4 @=t-l0 I  00Q0p 1 =D<08 f8 <0 pGWB#hI!   1 .8> 0@>C1 4Y&!`z 0> $ ( ,R  R  p0CS #l E p1.Y ?!M 00?\0 Y1@/P?@ L/Q00Z 1x/?2 0A@0P !& ?/_0 I  00Q 0p 1p d:D<08 8 <0 pGWB#h I!   1*: 09C1 4Y&! 09 $ ( ,R  R  p0CS #l E p 1() 09((ppgYFp !чЅ$$́1(  T^=0 40P0F00D0 0C00A00@0080,P Z00,0(01S  T8= (0LP0@80< 0, a6/#x00x0m00 /Ph72 1S  T = 7P0~0, a6/#|00|0B000040?(0?x80101x8M? M? x861610S @000D0049;$0S 45202, $0P /0004P /$04020|7S7S 400400LS1 $6$&Gr05!nL00L0꺁xXX 1  T<0W5 0x8U<10<1h00h0 ሕ 0\Q:1 `5H%Gr04!7D00D0LP*1 4$Gr04!"L00L02P  P P0Z   P0S! T$0GrX4!H00H0s0ḡἑ 1  T<0W 30x8 U<10<1|00|013/OX㺯ᴒK  PE202k4wh7Q / < 67Qh7 !s30Sh77!66h71  T;hǔ  2ŸP0W04 13/20276h77S40040 00CS 1 1!00 1fL00L00q00101 P400401  T{;0 |7S S 40040 1 3/x8U "0q00101 P400401  TH;0 |7S S 40040 1 3/x8U} !y^#^2^:^d^w^s^^k^m^Ü^^^r^7^^P^^=^^Й^{^^f^^^O-lM 00PR0 = @ 0`  SW0:0|[ 0S!R 0 T?[ 00 000=p 1S ?pH00000}'  h'[ @DXDD@DDD@D 㠅  P 1 4:h> X>000V t)Zuf $P$] 1 =  0 =   QI SQ0=Z 00 0 0S:x8 㠃  $0P 0 P ! 4T:0P HN:< <P$[Jo᪢Z  uP   PP` 0p000K|7S0E00S0S !R 0 <0ppW9p090!& 05"# #^#PQ\ BQʐ 0  0 |;|+p[000101}^^^5^)^$_@^f^|^^^Þ^?^Ԟ^(^^^^^)^X^^^^^ӟ^^^^^<^2^@Q^4^z^^Ϡ^^  @! !WT (3*R7@dV0 0 0 4T {UVph004 0ȏ004h000S@0@@0@02S3060( R S p1`! 00 0 @W Wh' 1 H'`6 0  |'R 0@0 W 1 2"02'!:40040h7 1 \20`2l")$00$004 KP 40 0@004t0 0 0040a6/4Up10p180080|7S00S2S1@# T30P#`3D10D10 q7/l S   03#H10H1HqW 0SH1L100P10CP1!W'R H5 a L10L11S7 3/3PX R  H50 E09000000 0Spp0p 000R  H5 '1S 3/1S 0 0D5j -0@-@PM0 0 P5 0Ѝ0@Ѝ/^0000S0004 R 0 000u/@-0@|7S2S 000ЍA-`|7PS2Sg 0!1Rc 0pS\:@020100010020 0083/ ? 071 01GS00 D1"022222220 " 8," ZN292S987-7 0C2c70r0Q   0   04Q   ۴@@p@pЍ3254L]A-P L0R8pL `@o|'R"⻴(R# #0 83/?G/@0? @D00Q0000L00 ◴00 R  ⏴001H0G-PpaF少MT9 0 Xd (  $00 4S! 0+ 0Q0 S0#"0000000083/? 0? 071 0R1GS00 I0S/S1`Caߍ (:0( 0" R 0Q   -0   0" R 4Q    P0p`F@L]p@-1BMS@BߍpP` T@P  `P 0,ᥳ0Q  R ,u!0 R1Ł!N@p@-2@SP 0aS 0 6/p@03A0AS@-@e ų/C-`p Ax8TMBRR0DpDpDpDpDHDTD\DpD`DhDxDDpDpDDpD0#8S >!0R1Ɓ!!@RI@PCQ4UB  @PP 8. 0000000Q<<0 0 0000m P)""#"0 Ȳ0S00 ࿲000T @@ @TЍUJxS ^⧲ 0 ""0 LxG %OoP/B χ166S1 000@ T0!01R !@%TЍC\TЍC1S @P  PP 1ZS01Ɓ! B@2괁X @P  PP 2 01 S@0} p l01 R0@TAp -% P, @D("(!p7 0 0S < B )  00/ ARD$D,D4DDD00000p N9~0p :9?o2xN8v?th728o"}0l:Su (0TЍC/Z]DDA- MPp$%@`P0%`Sb BS` BSJ? S#* S~  S< `⪎0pⲐWC嶠C z ɯ@0Xp8&S BS6 BS  S7 / BS|7SU cPB 13/<%S r Sr`A0W SQ`8#=0 >  (勯03A0AS)7S4`%WR0SO!V&R!I 1?0|8|7S3A0AS13/4P` W53   R< " ЍR <3W"0SDDHDDHDHD Dp'  |'S|7x'R p' p' W0S08 w~0S 㴀u?0XS  R0\ Y"q?0Q  \ W "= s W "= m W0S p7  h78h7|7S7S03A0AS7S4`h7|  8h7x  h7 H 3Wt0Sx( 0•nh7< 0Wg0S.0‘aW_ (W?B0CSY"= |7S$ pG  *x'/o"W1  0R P00S00 ¡VYY6Y 00 S C  R` -%EOO-?@Q`|MC p3C>6CQ m3>6Q$ ?QO 70Q8  |ЍO0`?Q0 00 0p0PPxx0@FShDDDDDDDDD|DDDDD0DLDdDDDDEDhDDED D$D0S Pp7  1 CbR.0‘!1R7|Ѝ!h7R00h7!h7R44!@R80PPH<0 SP:XJ=0S|7S<xh⾦ >PXp:3/0= 8PP <0S00$" 0#0 Z< X⩬V > PP 3S>ñ:3/V 4U > 4 `PPXCs`~!R<8PP8Q|7S xHe 9P 1Ps 9 @P lhQsa!*R8PP80SS*|7S9 iR B0<~P` P@0CS|7S < @P 80S$ < |'R R0<g0 S < @P 8(1#3/ ,8  |7S PpP P !?PP x!> O!h7R 331Sh75h7!R R R5q}4{5y1S p7h7:qyh7:m!h7R33g!h7R22p'P50Rӑ 10h7GPX!0B8#8S ǕPPp1S5 U0p'0 P UX㎀:P1S $ "ґ0z*!0B8#8S Ǖr"!18p7l1019q W PP 8x7 ?o`2x`QQ 6\Π x@Q@A0 S |Q 0x !@ RR! 1?0|8 x0@`P|V` e 803A0AS7S 0 S|7S c.PPg 13/P`!R8z?PPWW pP 03/P z186S003/1zS$ 8#8SW $03/SW 0:03/W pPs 03/Pn z0W 03/!Ra8PP  8 C 0P> "8Sp7P 1 0SN <^ 0/@ tB 0PEEdEEE[) 0PEEdEEE0A!1P9 919"l A!0i979!^  ̥ å 910!^  ̥ å 910iiii9ii:ii87ii8i(o?) tDZ]Z]h^* *Z]L]@F^`di@!^  ̥ å 910! 910!/o"  |7SS!0B8#8SN(ĕ|7SS1 C=R.201:!h7R 0 0h7w>0S108p'1D!S8P#8,C("(R"-0! 8!PP8` V#=0 t h9©m! 8k7S (#8 9⳩! 8Px 8  0BS^ !R r39S0SQp0  Q ARQE0X@ 838 R@ X P:3/>00S J0 ᴐJP-PY@:3/Ue媞0Sn@Yp0 0CR00h'4PS4400Rh7H PP B 80  J  2-kP h7~N#2000@000S@@W` 0PP0T0 TrPP  > 0S p7  h7 ;h7h7 ; h7N50000> 0  <1h7P:: xب1l%Sp58 S!V&R! 08#8108|87Sk|'R8%S x(0!S`R|88[ x(0!R7S|7S|u|ЍOQ0 00 0p0-PP |ЍO:ꔆ<##P   03/P#|ЍOr`ԓYʀ 0! #'0    ! @aRa/#P7PPWa/ 0!'ԓ0 !    !D0C-DM,00 `p\(00 00a00$  P<0@wqP0(0`0$  0T00<0 a ,eqP<  JDЍ#^hP_F^o^y^Z]@-  0H2$,p(`0/0,2  0408 nPv 0 00졟!18 $ 0,p(`40nP`0 00!18 $ 0,p(`40nPL 0!X18 $ 0,p(` 40nP9> 0 00!18 $ 0,p(`40nP$w> 00$ 0,p(`408 nP0N@$ 0,p(` @408 wnP  <<]TЍ財^E+_3^\E^¡^Ρ^١^^^y^Z]cp@-@Pp@-@`PUp0S00`00C0 t `D-@-0 0$ ,Ѝ Ѝ/^p@-PP UlU`@@P A0000 ( &B@P@p^^.A-1P@`p x8 Qᔀ$ 0.x8 S ᘤVde0 @R;Ѝ ቤV0 gl1R7^2^7^@-1@P` x8 Q|pp$ 0lx8S 0 fR Ѝ@  Z0 hR Ѝ7^2^G^@-1@  0@ iQX^2^O-1020`003/0900*= 20T100 0 0@0 01 `a R @`PpЍA[]!^L]|O] ) @0) 8408008,08089!= 01/!E`!E GEEE2 029 0/202/@-8040#Q0l78l7 .0 0 ( ( #- x YЍ1@-@ h70 0 ,00( h7=h7l78l7rr^y^q^[]p@-@P83/p@@-P` @Q6V2xw w> " Q!P R 1 B0S Ѝ7SD@1  |P0D DPw<G?0L Q ꊥ^^^[]^A-`P8p3/@P\00\0  s@-`8 P3/@P\00\0- 1 0 = ⪟x ⥟00x822x80!L0003/090020T100`Ѝp[]^|O]A-P`8p3/@P\00\0  x8 0 0x822x822xhx80!x8 99p@-@P`q[@pp@-P@P xG G@1S 3/pA-P@p`000 ( $  0?0?x80101 M? 061071 N? (Q 4$Q 0} 0 1SA/@-P ` pk@P 00 0w ЍA-|7PSS` h7M @ iN@p0 R0S P@xHⲘA-|7`SSp@ h7] P i^P0S TAT10 R0S P@xHₘ0S i V1Sp1 0D D0 0PgAЍ_[]^A-pymP|7 `S 0 xHKT |7SS @P <P@1 m0 000\]^C-P@@@`pGAT ݐ  rP01S P1 C0, , 0i Ѝ@\]5^G-p@W  `R 0S RBPp PUC .P 0R01 S  R 0S R P0 P0X@C-p`@P P@T  Ѝ0S P⏗1 0t t 0 !   AT  ףP0S ΣP @8\]>\]5^A-P@U+ pdP ЍA0S0S i V1S1 0D @ 0!<P ЍAЍ\\]J^@-@xP 0x8i <P R0<8HPL0H8p@-|7@SP yn)1089,8kxxXP 0 022220000990w>018|7 S13/pi^A-1@` !my~|7]S11 P8889,8*PPp Ü(# ⼜x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGgQ hARp\]r^I^i^@-@xQЍp`P ⱢP P 1  <10<1>)P 1 qh\ \0   D@  ,h70SU? #~Q A1 "0 `~0Sp7  |7S 1 $!$n2+~Q A1 0 W0S1  Mh76h7p7  1 l |@h767h7}V @AA$@4^U^r^^\]Ũ^^ ^5^T^O-P`|7MSS00 0ppp1 0"p0W  ЍO @T 00Ѝ0W p|7S2  0S 4"|0 0P700x8S| 0 0C8C80Q Rn P1S: 00! 0U0 00HP 0SH1L100P10CP17H1S 0 R B0 Y 1 2 0 1P Q䑄13/0Sʐ1  0 c E2S 0 ᬑ9/000a)Sʐ1\  T0T E⻑ %NS@]]]y^^^^^ȩ^2^C-2@SPpM !Ⰰ8#8X 0 a6/ЍCa< `Ơ 92<2<! !000w>0S:? n0001 0 G=P202n0001 0 7S 1 l!lh76h7? A `!H10S ohǔ00  1VQ01S 3/9-8C800ᬁ0 8/: 0S 3/ ЍCS1 0T h776h7`^E^)]]{^@^Й^7^{^^r^^^A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3P@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 0, ,.P00Lp@A]]^p@-PiN@ @P`xhqVxHp 0^ 022220000990?p@^s@-!]1 @R0Łi <b >H`1 00|!|1| yGY U07D180$881]PVW,884h0h 9 01 00 0in  F1 - 0(' 0' 8' j^6D'@7<7Vtx8 p  p'    L ( @ ) x8 Ѝp\]]I^ ^KE7^"E A-`jʀPrpQ EQ00C20U U U ,U UPPH$H@&|V`h@&h@@@`p@-P@ 㩕s000 0u t      @v w 0  " @x 0S @@px]]A-0 0SP@0p `.|'RXE0XEhXEXEhXEhXEXE0 0m  i e003213030 0V  R  0J  F t0/C-@`M21PP000w Ѝp0 `ݐ0=0 H02 |7S0000(001011 =`߽ X0P   D 00L7SPP7HWLW0P7^<^@^@-205 2S 101 , ʠ,ʠ\ 101 S&0#*R00BS00 \   0R!  R  (R  B/o"S0|'Rt@ 60R R  R R  1 0S "N)Rx]]O-0LM ShP@p 8≔hg`+ |7S 80] 8R` >0 S c39Sn`$7R 1 8>0 07000`㲢 $7Rh7 4@V80  3S'H0L0S#QH 0P H  0C IRv%0@P04003LЍ>0&S c3)6R0Yڸ |.400V 0040  B    04@ 0PR 043P4v4@T W0U 0      $D"$ (0 00 #R,H L R(QH0 P0H0 00BX0 B 000 (00(00 0|7S"`E_E_E`E_E_E`E_EdE  I3@P000w 0 0▓ > ⒓ 8⎓0 0 00ZD 06 R0 R00R":)0R  w  #"!# #"0( R00 V 8 W > Sx 0 08I  E >321303(Z !%%*0(@00 000 0J$0(0 0C00$000 00  Z 1 Y: 8(`Y  |0P`PM.0I/   0 101 00 00 I0, 0/, 00(0080(0`0 C0000 00000($0C@/0 8000000C001 !0110/1!P`Z2V [8000 0徠000Sl V` $0R h7 |7S8 0 R 0@0080 R (03/P1 8L  810812@Pu^|O]]]^^^^ͫ^^O-0@P H BQ B0 00 `(0 0(0@01011011 `B 0H00L7S@P7HG0LGP7$Ѝ^]^^O-`Q$M p1@p w0)0 `9/PW9  W W W  1S ]0 t000@0WW W1| W D 0 4PP 0尐00(0202{hk"PP000 @ 埏x8?0 00|7h'S000  0 ;0x  Gx7S00j000짟    M? 0#40券 00#300~ 00P#3@0  6! |7S   0 0Y w>0S*0 000>0h 0S0000B h7 l  g000   *0  8I#8 CR,X SXSx HoᨂZ  R㈰ 0 UPP 00 R㰀岐崠 \%0 @, 0S 1 B5 0:0Z(110011|7S0 #R H L RQH0 P0H0 00BS0 B 000 `(0 0(00000=00H0 1 PW|'R  3Grpq珷 0 1 0100L7SPP7HWX0P70LW弈2_@$Ѝ  0 D%PP 0ᰐ00(01018S>HHPP |7h'S000 (  0/  p' ; W00  . x V000 G_ih7  40S  HQ 50 00 00C0(0*3MPP* h'00  0  ;Y00  岐0  " 101G!h7  40S0 0C0(0k 101 -PP, R :01  P0 Le0@00>}^0^]^^\^3 ^ŭ^.^D^]^A-`p)@P 00(0K0P 000p⮍  ⪍p@-`P)@P 0; 0(0 `  ⓍpG-p'!=⼐`0G% -0p@ PP 1S 0`#`000Ѝ 0/ |'hR    0  + h  D0 Sw0S 00000   00  00|'RV00 0 ! h7   Yh72h7h7 :0S*0 000>0h 0S0000B  00@10 @( #RH LQP  x,PP    N  00001H   CR0C00(0 0(00㲐0⥌  ⡌ ❌붑+Z^]^^O-@fMP |7h'S000 0 0  ;0h7 . 9) S!  " 90 9p9S!  ! 90 9`09h7  h72h7|7S\hw`u@ !PUPPZH(0S PU0J$PQ0CS*e!0 Rp p!  0圊 ppp 0 Ⱑ PH!h75h71 0l x08 S0R 0C00 S 0S  O Ѝ pq^]^C^k^}^@-`T1P!pR@MX1\!^0 X1\!1S 200 @E@X1 0 6Ѝ@]+. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 0 4`*V1Ѝ@/Ѝ誮^ڮ^-0 /2S/p@-@Pa0 6/p@? 06 08880 8077090(10101/* * EDlE@-:@0S 3/ Y:S@0/p@-`@0SP0P    00T ,P1S 01Wpp蠙^]P0/P 0!/@-@ d0@^0 R  Wꠙ&^p@-<@P0S,)@T {P@p蠙H^ QA-0@P PS t6`lp0FUAT. B^R0%,"`$p0FUV^_^Q^˧^C-1@pg 4!1000$OxX倇X$E EEE$E`FVEXE؃EDE|7S S 0 8:0S 3/ Ѝ0 a6/c  |7S S 0 a6/3V@ExEЄEЄEE|'R/I032+L3Q' zh7  1  !h7^M^V^]^f^k^+^d^˧^ ^(^0^^8^1^D^O-@P`$M 8sP0ᠳ q?0000 0 AQ R P R?o20 $Ѝ^5pW?pW q pp Y [8^p |^p, W, pAGQpGq Q [5pN5xpqpW0ppWD! h7Q;;h71S//p@-h7w^6h70@S S|7Sp!0Sh7 p' 76 67h7p0@-^0^T R0 P@0^]@-P\0 B\0C P0\`00 VpW00^]@-0@M 60b1c2d3eI{J|K}L~S|7ST 9 h7  w>0d!!p740!h  i j9k9 0g901 \0 E|7S!=0S* 9'w>0 01 9i9 00\0 *|7S 93/1  |7X `S499Ѝ@x829009h72h7Ѝ^]_]p^^̰^p7/p@-@f_qp@p7/O-P`㼁qMpw>@VAM VO VQ10@|'RP 5) 6) 7) 8)0991  99 0894!4 079069059000N9 O)PQ R   0 0 `VpPx8S   19ЍO0: @h0: 0\ 00: 0590690790890Ѝ_]_]2a]^=^R`]`]@-h7"1 @ i|Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@^5^O-pM`0`  P妆0@0 00P 000 0_o`@KRPPU!R:"R :"R:0ЍC-MP 0`p` @j0 0 00  00P 0 0@K?o2P0S R0 Ѝ0G-@M,00 p@P(0|10A0p$  <0`OPJ<1$ 0<0  A,p(vOP91$ 0<0  A,p(fOP)0'00弐$00 00A,p( < QOP0$00 0l0 0`0A00,p0(0< 0 0C0000 0d@S2 001 00@0 (sH0L 0 H0L ~lЍ$1O-0HH!DM 0 0 巭P3@`p\0  0 0 a 0,@($  PL0  0 0 a40@,@($  PL 4 h 0 `    a 80@,@($ PLDЍ/ ^1'^,^ ErE_O-t`,M@p0 0 0 0#TTX%XU *0 0 0 ,ЍO"0 0S 0S*"@P` Ш0 0 0 ,ЍO٨00C0E=P 幨0 0 0 00C0000/PP' 0S S S/垨 0$ 0 0$ 婨3"0XU$S 动(0, 0 (0, 啨O"T P8MP{   u1,Ѝ0U 0 01P0S1300 0 P  0S 0S 04S 2o@ * P`0SȀX38 . 0S R $R  RQ  BREEE,EE X *  0嬣8 0@! 0004 0 004 30 R S 80< 0 80< ^ 0S < 0P`0 0X `P] 00˧@0D 0 @0D ֧0S 0CSK00H0 0S0尧004 0 004 廧3 %10 R S 噧80< 0 80< 大  0SP`0 0  >`P 00x@0D 0 @0D 僧0SS S1/00p@-00@4S 3P1 pR0 0S``2p@ap0SLP 000 010S100 p/0  BR/ $R/ #/0 0S/[A-P@1S `pW 0 @1 @T Ѝ0S 0CS0@q 0S0 0S1 @/@- 801S@ R  R 0/@-@ D0Q  0TS   ;@ /03 ! "/03 "  /0M0P@Ѝ/0M0P@Ѝ/L@o/!4! #4! B#4!0 P/60S/0 @-@U!.   p@-@`ɻP@P pP/p@-@PP %p@-@P %@-@ 0:p@-@P &%p@O-Q$M0T `@Ps pP s0$ЍT@ @ ` X0B00S @T  Y00S 000S00 0 0 0DB0P`` @Z 000 R0 1B0P0  *B0P ` 0j 0`G-p`P/@P[*U 4 0 S H0S 4 R 30 #P SH0Y 0S 0C @\P@P ѷ  " 0x0p0PPH0$_Zv 05 06 06T$1^HE!>00000 0/6 0@-MP@ 0VЍ0/,0/@- 0MP3p0pp``P@᫺ 03  T!,0 , ? 0 Ѝ@>" 0#000W1 /,0,RpႺ 03  +!,00,0 03   !P,00,0,0 0 0I"}0Ѝ;EA 4 #4 # /l0Sp p l p0 0S  0 00/A-@|`pP1hSl l0p نADՆ0P1p00`0101S0@@Jaq@-@Td$,d,lH,l $ . O-@pHRH2DM p00 @@ͨ0A10bA U嗹>  M EF? C`pP#1 00a0,P($@ @@ @G000D1 0<1 00a4,P($@ @ @G1  00a40@,P($@ @@ @G0'40张0  00a80@,P($@@ @PG040p0 00a80@,P($@ @ @PoGDЍT^'^pE\^>d^pf^v^@-@40 0S +P@\0X0S@E"P d0`0S pp@-P@0 0DS P@ 00S \0X0S@pDP 00Sd0`0S Dp0S 00P0#///0  S /0C\ B /p@-鸸 @dPPRL0$!p@ϸ 0S  Q@D0R0 1p@-P@ }0!S <S21pp@-@Ptfp@p@-@ PiJ00p@-@] v<@tE0@s5A-CP@ `WD Rt@PTq00S0S 0S h0S 0S d0S `0S X0STD1@/p80S/@-3`A0ASM= pDPP@4Ѝ@00S%['0 00P0 R00M*0 0003/P?DЍp@-M@`ԷDPP@Ѝp@00S0S 3/0000*믷P D@-@$1@Qvp@-@P 4e001Pp0S 0Sp@ p@- @P8!@P@!p@P@A-`dQ!pP 000!Ѝ֧@PA 0 000 ` 'P !i@p}P !]@q 1S0 ` 1@0D A0, (1 q0p(1!1i0@-@M*!00CS0 pЍ0@u!| B L 0@PS   (10C(1`! Ѝ02iC-0`SM 3/; 0pC @ /)P 00ЍCPPUT նT TY  0#   Q @SPT Up@-@,0P `0,0EuVt x0Rx0t 1x0 0S  0 00l 000'p@O-@,MR||`SPp踠 0S XP R R0 00R0P00080S000 X P 30Sڸ000ܳԓYʀ 0! ##0 ##   ! r 0!\#ԓ0 P#H#   !Ḑ\㸐 00踠 P 0SP00 00X00帠7 `P帐#0   R$"\ d \R \ \ d X d 0`0H0403 $d0S00 0` 00\0X 00h0` P0S ( ` 0# ' '【0  |P#ᤵ 03   MPP,00,0$ U"P  0S0S  S  0000Y% P#,0 r=3S0S00hoX 0 P 03/,Ѝ2@`dO-D>PQtM pC(> RF 35Q X@ 09@mW=W26W`0ST 05征=0P@ l=l-WW00W0S9 T`1P@4=Q 3C5CQX U & =W -W !BW -P9    R R  @ TW( <W% 1CW0 @y 0my@ iy0S P by!>d600 aPtЍ0`0 0i  00R 0`nDiP@  ኴ1P;W 0 00 RVr  00 Sl DR xt0Qy 0Su0 @x 0 y| @y3 P yP x K0d0 X8 0  tЍO00000 -P( 6060X0\  0 *Ѐ*0S`00t990 S,E8EPE8E8E8E8EE8E8EXE8E8EE9WW 6C 0CW 90ST `H9W ``90SS񟗁ELE,ExElExE E 0S 0R W0S00}0SY|00S8W0SX哱Tꀐ0Y(8((WW TD800 0 0 0p`P T"W@P7P 0| 000?8`93 `!>8100000087W}1CW D70 SPWԥD700 0 0寧`P `O SlExEExExExExELExExEExExEE`| V `P}`32  `3* x ` 00 ( 0`3 P  bPP `&T``V 0+c,0   `3 PVM`0 ^`P`PP0Vd010P DP`Z _XlE0t01x0@t010S ؐS{S ؀0ؐ YjC8V P`0`V `000d030 !0S`0 0 R ` ` Z00   `3 !0S P003 P R0`@ 0S  v`00`0b2 4@0S 0S000؀S 0 XY܀{Y vVP``U 2 P`/P `PPPb09x1|`W| v  v @\ R0@1 0@P>W0W26W> `h00 SxEEEEEEEHEEEEEEEW] 00SSEHE(EEhEEET >T i ii ii@'i i^iii@uto%iߖo?i^oi!i#i"iǀM08 P R/ !  / !  t{O-MP@Dp `0@0@@P)50P@N QT100:l 0`P H03HDP@) 3T 0Y00C?o20S4 0S1 ?MP@ T 110@0EЍL0S# D 03 @P 0  80S 3/@P 0Q(@- 0@R0S  R P `PŰ 03 0QṰ/p@-`LP ]0@0L0`0D00@0 0<0(080,040D00040,000m@pE EEEEDE(EE@-@@"0O-,00pS@(,M@P 0 0 0"T1T00XS%X@P  00 ")a! 1 00 $a$" 1040  0h`P  0 !H 0 ( ",0 $  2) .( ,( ) 0,8SP f  kP`d0@0d020""448#8260S   &"44 8#8 !R   0 1 &"44 8#80 A&"44 8#80 1 0$"44 8 #8 S03 0#  0PP K 0 P (00 0`ЍD0 W 10R@10S 0 6P/D00 W +0S 0 $P  (0R R  @!@1 0RD0 0  @1 H0(00 0\@-0S 6PS 0SQ@` 0S  @(000L0"P00"P00Ѝp0SC-0PSlM=0S/90S_ 0` R@( RU dr   R R S$0 0 0S0C00匀XJ2# 21 2(0 (0000p08_pP 0S100lЍs000S 0CS # 00峩000ꈩP d0 ( 1ꛩ(  (0060 0,P.L0+0SQ 0006l0S (000L00 00"1UPR $P /0A-p(`@pP:0S    0R, 00! shP 2 8 p60SP 㮲0S0 ܠA00S/@-40@0006(01@@-0SЍؓS !>00 000080p Ѝ8" @- <0b",4b4#  #$  #(  #< Ѝʴ^p@-@0M SЍp@P` "448 #800Ѝpִ^R=dd Q 0S  0CS0#0/Q 0S  0CS0#0/p@-@PT # 1R !R BsPpEp@-40 R@  000   N   Ѝ@-40@ R  000   7  ЍX0 0&-$M840, (  0bn$Ѝ(C-M 0P`` @l0tp 00P 00 0 0@32?o2P0S B~Q Ѝ C-@MPp 0` l0` 00P  00 0 0P 2?o2PPPU@ @T@p@W T @<Ѝ @T ? @@1 O-@`Pp3DM ,@0P 0 0p(`$  53ᄃ 0P,@0P 0 4p(`$  5 0 0 0'!,3 4P0P,@0@ 0 8p(`$ 50 400!2 02 0P,@0@ 0 8p(`$ v50 0 0!2 0P,@0@ 0 8p4`(`$ `50400 0 0!(2 0P,@0@ 0 8p(`$ I50 0 0!1 0140P ,@0@ 0 8p(`$ 150 400!1 0x1 000P,@0 08p(`$ 50400 0 0! 1 0P,@0@ 0 8p(`$ 5 0400 0 0!00PP ,@0 0  8p(`$ 4 I 12T@TA*DЍ'^^ ^000 ( h40800 $02c0 00_P2jU0 0 0 ` 0 0#$$ (0"(DRD ^pP 3p00C0H0S2<4 0P9[ @  !PQ0 L d` Q)P@0  1 0 S!00 P X0\ 0 X0\ W, 1@P@H0L 0 UH0L  `0d 0 `0d W  0 W 7Y (Y|0P H0@u床0 @0 0 ĊP@11X@-!>@tPM `0@@垊p0 0P姊ЍL000E坊1O->Mm @P=ЍO`P q 1$!0 1$!|9=@@0D0D0S S [ 1$!0 1$!f@PN0 0 0 Y@0 <   S@@P60 0 0 0S&P@0@S "0 0 0 @AT 0$ 0 0$ 0TPP@ 0S0 0 0 ;`( "$`$"",R a(!"4a4##<S3 @1, @000@S Sۉ0 0 0 ~3 @;0S P!448#8T(0, 0 (0, c@(S峉0 0 0 V Q0(0 CC@ @0;00 ,000P$0@P 0@0叉1!0 1!20SP@G @0 0001S0_0 RmP0@ 0T 00000S @0 @p0(P0 400010C00STr D90S@k 0tPPe  t0@0Z ZT 0S@+0 S[QDZ Z 0 P 0C0Z Z tb!>7T80S 0S @E[0S@@D  <0x \8t-0P08 <0wZ2@0 00 0 0 80`80 [*0+S80 0 4 0 P 80 b80 0C#10 0 0 0 0@C@ xbZt0P00 0  b ( 0Sx00000@@@T@xLP Lb @ tib!>7(0Su[MZw0[:0J x(0bҝt0P0 (0 b 0000(0= xLP@g(0 LbYB0K $RYBY0 #"  02R07 0IS  S7 SNH @H`000 tb!>70 0S40x0wu08P80ᑝ0S ጝ0 6b ᄝ000 ta!>70 0S  x!bKt0P0 h@E@ :@pT d30S@CA@$@ 0DPi8301P0P0S 0CS# 2X0X0SD0C N8 00SJ Py媇X0\ 0 X0\ M U T  X $  $  [ #X0T0T0Q  R UF hUC `U@ XU= Q: H0\0\0S D0CS@p010S ]X0\ 0 X0\ h@%$0@S 0 0dGX0\ 0 X0\ R`,00 Sᴜ 000S @ P@0S 0 00010p0t 0 p0t ), 0 X0T01# 0@3/t80t801X(a]O- LM H@P`pt8 ll8 (p000`,P$@ @@ @`*'$8 (p0@04`0@,P$@ @@ @N*4䗟 0 07(p008`0@,P$@@ @P9* 0 07 (p008`4P0@,P$@@ @P%*0 0D7 4(p008`0@,P$@@ @P*0 064 06(p008`0@,P$@ @P)0400 06 (p008`0@,P$@@ @P)0400 0P6 (p008`0@,P$@@ @P) 040 0 06 (p008`0@,P$@@ @P) 0405 05(p008`0@,P$@ @P) 040l5` 0`5(p008`0@,P$@ @P) 0405 05(p008`0@,P$@ @Pz)44 04 (p008`0@,P$@ @Pd)0404\ 0t4(p008`0@,P$@ @PN)040 0 0 4(p008`0@,P$@@ @P8)0@ 040$0 03 (p008`0@,P$@@ @P)040t3 0l3(p008`0@,P$@@ @P)040(30 3 0<(p008`0@,P$@ @ @(0402 02(p008`0@,P$@@ @P( (p|24  0pD08`0@,P$@ @@ @(02($0$200pD ,` @ @(p1$01D 00,`(p @ @(1010D 0,`(p$@ @ @( (`!``0@S50@ T0d^X^^^F^^ȵ^ӵ^JG۵^x^ F^^ ^^'^1^FrE_C^M^DGZ^Gi^Gd^(a].u@1@-@ @& A-p@PP0S PP 0 0100`10a0 0 0F] 0X *0F`FQ0C000  @-@0S 00@ 0 /@@-P(0dp`LM @ S@ 0 )P@  0 P@PP"   0 (02,0(0 P@ `"0  ````(0 ((LЍp@-0P@1 01  p@103 ! "/03 "  /p@-@`9P@P Tpl00S @-i P3D8#8 ("(P "00 /|@P/i0P7@- Ѝ0P @R R00P0S0!> 000k]@-`Q00pPg8'#TgT%%</@P VP Ѝpel00100S 0CS W  @#RP @000A-@MPp  `X@P"0 R@00S'X@ ( ] @P `P 00@ЍHP Pv`XPᐘ1@P nP00v႘A-@ PR`   P PRHpPf1P 00\0\ Q ]0 0!0;0\ 0!A-PS@` pPl0 A/4@宂8!< 8!<幂v1hP/A-p`0PPQPEU `f @ T T@ @U@  \0PEpO-,0,M00@010 44`Q :$01 000 BpWSZ0 0 0 e"(P,Ѝ0000 000000#![@ 0C 0 (08#<400 00000@ ,0@0,0VP! k*0C S  U R R0 0 0 7P0 0 0 UP"PP R0 0 0 V7P`T p`@0P000010 0!00 0000S #000 0-0"> 00 000K1$ 08#80!$$ ("(Q:0ɱ pB "4400  8#< 400P 0( 000@ Z`P偁0 0 0 匁0002,0@ ,00,0 008001vO-QM00(0 p@ `G"448#80ST:0P0(P(00000NC10@00Ax0| 0 x0| L[ ( [눰,0S 0 0S 0 0R / @Pp @Pk ,PP,0 0d mp 0 0 0 `(0S00  QHLQ RH0P0H0 00@V* PP 0 0C00 0000<@0Z(0@ 0(0Z 00"44`8#<d`i0g0 0 0aYP10p0PS ``P\p垀0 0 0 娀3P 0LpP [剀0 0 0 唀@0000 0sPT@z0qSBq(0   R  Y Z\0 0 0 g0 sR 0 V 0SS PP LpP |Z`=0 0 0 G@0`0N0` sR 0 PP3 0lPT @P H0S Y 0 0 0 AP@0D 0@040 D 0  PW0/T @P0Y`0 p0 0 `0Hp4PS0@0D L`0@00 @000D 0W 0P0X   p J0  #RW  3R 0S# tPP  X014!0 014!1P80S t80,3/PP tD0 0t  ]P/ 0S 0S) (PP$ 00SmPP ,0  $ ,0$ 0,000$ 0$ 0 , 0S 3 VL0 0 0 W(PX ` 0[ W L DЍ 0S80S X `m80,3/`Ph `0 0 00S U 0 0 0 dU6 3 |U~@1D!0 @1D!U0  HU~@1D!0 @1D!~ P @"44D 8#8Q0( %0%<#*T~@1D!0 @1D!~(P( 0<00 (0(DQ ,   40#0 @0Am`V X `0 ("50 @000PP( R c~1 !0 1 !~`H 0 000< ` <$`P03 P30S ( ,0@0,0 ("44 8,P#8S8 6k04| 0R0  Q~0 0 0 x" R  t23"41d00t0ℐT4~0 0 0 >~Y1P&1P00,0  @ 0( ,0@0,0 3  10S 10S (F( ,00,0( 0 ,0 0 0  P-3  H10S 410S #( ,00,0~  (^PP((Q U}0 0 0 }0U0 0(00   0, P P R ZX)11c]l^lC-Pp@p0M00S0TЍ0S  S` S0#03R0S0S 0 00000 000B00SQ QR W0 NP R 000*A-PpU@(M \vPP7@4 000030P0 0CSPFdQF|QFQFRF d @P0S@ x`0P #Rᒒ1@0S  2R`V\v`(Ѝ20|0S0@0 A@ 0 00S00 0 P@+ Q' 3S$` 0V V;@00 0 ❝ ^ R `aP 0007@1@ K0@ 0S 0 AP@` 0V1@ 1 0 `aR0C000 0QR ^ Q ` -@Us@-0@ SP& S) S- T 0S000  Ѝp0S`P n0P0@000庑P00P 0  0$0O-,M00P`Sd@ &St6P*,ЍP Pb00CS񟗌lUF4[FVFVFVFVFVF4[FXFXFXFXFXF4[F4[F4[F4[FYFXFVF4[F4[FVFVFXFVFVFhP i0h0[9  pP7`  U[`#0Z*[* `V'[%ZZV0 U `F` ,R0 U`hpd@(V U`p P00CSDWFPWFtWFWFWFxVFxVFxVFxVFxVFxVFxVFxVFxVFxVFxVFxVFWFxVFxVFWF\WFxVF0XFWF00000 CR0ŕ0S@@0S@@0S@@0S@@0SKK>0 00+0 0p0P20SJJ P0SJJ  z P$0S 00 `$P᫐1SP 00塐npPi c P0SS& @\S @Y S PP0 CRyYF4[FYFYFYFYFYFYF [F [F [F [F [F4[F4[F4[F4[F,[F[FYFYF4[FYFYFZFYFYFhP, 0 P < 0CS\ZFtZFZFZFZFdZFdZFdZFdZFdZFdZFdZFdZFdZFdZFdZFdZFZFZFdZFZF|ZFdZFZFZF00E0000D600D1356 R R D0$00  0np"j  0$*e p@-@PP `p0Sp@\nsPp@-@0x`S   !00C000C0PUp@ R0 0  則HG- P"TpȀ`H@Tp@W< 00C@S@p0S00C0S0  z@0D 0 @0D +z @1!  TH1H 0O-@pDMP!0l 0 00,@(p$  v 0!0 0 040,@(p$  c0 400!X0_ 0'> 0 080,@(p$ P @KDЍH'^>d^^p@-@`M0P0@@ @0 dP  <@@T 0200 R00C1 2"Ѝp@겶^H@- eP?>@PA-@40"0R S  B! "2 2R$2S0p`P"0#Q00S qPP@UP#00C?o2PAHPO-Mp0 # 44 8)#8!H'1  CRD4G,y0 0 0 FCY 0I0 Y V`f "2000#?0AT1 0y0 4 0 4y  `P 0.x0 0 0 y8{ 0S:Fx0 0 0 xЍP R\ \S @ p R  崑 T !A  Y"RRx$0@Pr       !<  0 0 1!     !0R @A4000S0`0 ``0 `Vx   Ru  !Ryix0 0 0 tx0`}1p01W 0 !1Rp!AQ ڴ! Q"Ƞ,Ƞ B! R.10C100C0/x80< 0 80< :x ` $ Q   p O! B!  B W[ R ` ``! R l0!`w @R  B   B q `  pW,0p0 8#< Რ0 00@0!0 0100 01C0T 0V(p,@`X w0 0 0 w0  0  M0p0@p00[ ᲑIY ڴ!YN  " !) A!ᴑ Rm? P0`R Qa lw0 0 0 ww1HPH-//-/-/@-@" -@-p00d0@ ` P d0 (00  0 ( 0 P(BP  Ѝ1M  @-e뻶^@-aŶ^7p@-@PI 0S 0S 0Pp0Pp* P p\!>C-@pPM0 0@@ 0 0" A"440T1`V T+ 0p Ѝ0S0S S0S  S0S S T P 0 _@`, 0  02# |0R0@l@ vh0l 0 h0p0l t 0Sp0 t vW\(a]hiF1-/ 0!< 04 0 (   !/@`dT0M000S ~S 0S/0S001Ѝ/\ P/0 !8 0 0 (  , !/@`d0@-S@)@p0`000S ~S 0S/@vPG0P d0  0S ᎋ1@0ᇋ0@0 ЍA-@pP`@PoA-@P@`@p2hY\p@-P`@Kpp@-P`v@?pp@-@`jP0001p$p@-P\@&pO-@`p\!DM 0 ( a0,$  @P0 00( 0 a4,$  @P 4 p 0 h (d  00 0 a8,$ P DЍOD'^l?_Gж^\G-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 c]E\@-p`( PSR M $ @p NP0 _WP Ud (0I0S*0 #R:H L R6QH0 P0H0 00BS+0 B 00T7P 0(00(0 0 !$$   R  h 00` 08 BPЍ |@S>SB 0 #RH L R    @P P 0 (Q&(",$ !$$ 0S(0DS 00 0 0XP0 0jt0 0 0 ut(PT -P1G-p@P`W1  @P  02W@9@00008@V U $s@-a0SP@ 0RPd0C500 P0  [0P Rd  ++d ЍpS Ѝp@P P0S=0Pd Q  0Sd00 0W0  0`( "4`#/@- "44!0"441@- M Ѝ 0<P   /  .ꀞ4G0M/ X1M/ {p@-@Pp`8`HPPp0Sip@= 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`d@-@0:0@@-@0 :0@@-0 00   00wЍض^p@-Py@pp@-P@ zp@O- MQ( P '    pWS   RK0 00 00 0R010 0! R010q0;S@T 1 R00 1`? 0`R00 0R010 00C 001 = iЍ HR@T  R 00 000O 0R010 p @@p0 `0 00 R" 000 0.0 R00 0R010 T@ 00C 0 BRJ C\_C^B&\`cRr! ! !$ !$Wr 4 T `^K\ R  @C  0  000 SF0 000 0R00 0R010 T@ 00C 0 1 a0R1q1 !0 1 !q   0 0 0 H 00Y0CSp 0S?p0 @p0T@P 202q81<081@1<D 0@1[D (!, (!0!,4 0!40q0W0 0S0@0@@0 00 00S0@@@p0G- P@$pφ` 0PHAhq0 0 0 sq,  Q Q Q ӆR00P Pp8 #<4 ,(8 ( #80#8S S 3 00S  0PY Y,0 Q Q 0@ (00S  0ilO-@PDMppDUXDЍ`0V V X `XV0CSꨁFF,FhFFFFV  0 ;S0000 "440HPV 0 ;S0@000Sg1h0 0#2S S . (4. Fg!0g. \t V0 0J J 0 ;S0<00h10l1V 0 ;S800S0 <00 l^^@-@00CS R  a``  B BI00C0@0CT嗃^p@-La@P?p80< 0 < 80JpP!R? 11c R P!T!S0cB1C0S0T100S 00S 0 P1R0`1S *00Pa0XPP!UP1H1;T1N1C1UP1U0P000p2P11T1$P,O-CM0M00o0 0 0 o XI0 <H060`0SP%0%* h0P h0 QP%* PU o1!0 1!oCߍ  PP0P 0#2S S0 00S AP0#dd0h&h`F0T00$0040 0#21V,000, R0S% po1!0 1!{o0S 0S0S0S 0S 0(``Fy 0T00$0(0, R`F 00 RP0 , 0iP 0,  QxPPUy ,00C<0080<0 S  0S_X:P  0@0X0U\R8@`,0 @ 00$`0P00n@@$0SS S )Y; 0S Q[:@(pT +RT  Dd!S d0`) hP 0h00 h600v  hH H$0S S' 00SR 0I  h[ <0800 0000 }P0xn1!0 1!n $P0 hpff0 00h00#oPxt8rn1!017 !|n 0 tpPb0^\n1!0 1!gn,70S 00SZh"    "44!$$8("( #8 ~[6 P   t0 0000p0 0 nP `6n1!01D6 !n 0 fpP0m1!0 1!m50S 00SZh . q .q "44!$$8(,"( #8 . C. ?0 @ 0p @pGW4 00P @@ă "@ēpGV097St@m! ! !$ !$m0pH00`F001W00C @ģ1V, ,t{mX1\!0 X1\!mp]~ 000p0fS  0Rj`m(!, (!0!,4 0!4em00IY-\sGmH1L!0 H1L!Rm=mNm 0 0CS0S% 0R!+m`1d!`i0 `1d!5m0 @H0  0R6H0S 00000``0 b91 P0@0@0` `0`04 S0P 0 3SH L0SP0\ 0 P 40004 <  0CS00S0 0040F!>6 l 9&0009lp0060+^ B^t^{^n^pH?|x,00S= 0: 0 h+pP2 w  @T, d13 0x00D1;Sڬ0`1&80S#0  0$  70T00S S070 1-lP2T"0 P2T"017l0@ 0!0CS103/X\( `0S(0 1( 000Cp!0C(0( 1R ( ^00S\ h!\00CSz  !0QSQ@ p  Ql0Qh\ t0CS`20l1\0h1V0CQVCPS4! RO:+RL( R0C HQ L!0CS20Cp``Fk1x!0| x!!| 1!k1!0CS0X1%10C10    BR901!Va0 BR1011J 01Rh%0S $0SX40S 0P ܀00      0 ̀@ 0@oP D>k1!0 1!Ik~ KoE+k1!0 1!6kX0000< 08P^x5kX2\"0 X2\"8%P50x%Q0S~ LLR Q0L A0CS0Vk@08 !$!01j1!0 10! 00 0 00/ j10S00 `0S !+0  @0    BR901 R010!0 CR 1 BR!0 BR1;0CS;꼫FFXFFdF8D!P40 !10C S01 10C11R0#0 500, 50C01Z 1  Q $40?0  0; $Z 0;31 Z 31 V!0R1 S *@f1!0 1!&f 0 10101\1S01\15 0$! CR$1 0C0 !0CST01@01`10`1!8#8R0  @0y !$10BS$!@x@q0 0P00 0P0;Z0 [ ; S1 $0S1100S 0S$10 0;t@11 110 :P 000000```rWP z 0R$0S S- $4RX00<0 08000h P V. 8LHp@-0  0'S(5P L@4e1!0 1!?e$0 iM9 0`( "4`#/ 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`d@-@0:0@p@-PAT1PD1AP \!xX1+8T@1D01@ xSx0 S 07; S0Ҳ;p諷^dd]O-0M@S0 S/`̠Z4 ?(0S S<` P`p(` P P(p !R `0d  SP3P# RPPUOfC  0S 0S0S HXڼ; 0CS0!0; 0CS0!WD0 0 0R0100`VʰlV 4F00P4%4158E00P8%8150<01H00L00S80P`0S p`-`&P0%T00S 0 0C1!04!R4!4180P0D00X00@00T0PP0P0 :0!0P$0  10S|!  0  0B 00  00!0CSp0aJ41l,dpV`!; u ;SvdPn !41dPRPePe 0_BQ\ CRa@PP1 C QP@U0000S VP`0 Sȃ0SR0P J ;SGP P@0 PE 3UDڠ!410d 0C 0C?SPȳ0S! 0  0 !R: !B\: \*  B \  Q!X*P0;0 0U#00S P U1E P 0U00000<00S 0  00CsC Q1S A0CR0U,0 0U 1  H0L S 0 0S*0S\1U*0!00C ?,0Se|9, 0S 1,1 0C?SR\0BX RڃQ0``! BR  010CSPP8P80[ЍHP30 @&QR P0S0S0S0s  h<1ShݾPP11SHH0a8c``x8^0Px H0q8'ypTqH0L S7D!00C Sz:47P0 R嬾P 7P0STP 41R !00S01V@`@`]0x0 00$0t BRP1 P80;V PF03 PE UVP0k80PcP0<000000SQ PM8PI LE0S(0 S<0080ph0 R[ YP  T 4 1`P0H7  0 ph + ip"jk   @ f1ppl40S 0   p l `0S `(VA00 00d4 pp1pGh@1S1 @qp$0S+ 1(00` R:(  (P4A`|q   $0p0C$0{x |qq$0S(04p- p)W&5`0SP@P0 0"0 $00C$0\ K\  C p00:v80U0402 Sa00S0U0S- 0 0 0 P2Vak`P 824 00S<u07a.a024"0 024"9a" `p)W00/0CS202000000 000000 ,!0Z 00400 1S ! Z101 0弡1QQ0- 3SH L0SP0\ 0$0&PHt0SA01`Sf$00( 00Sf(0 (0( 000 0S0P 0[1 XSq5^0 0 0 0 @0D 0 @0D ^,0S, 10,! CR,1 1t1000 00<0S !8R @0`S`(`<`)0 00400@-1D @0C100C0 0R100  eXA-@0p0!R蔀0 0RP`|dP 1T010`00 0 R 01 @ @! 1`X\@-0 00   00pbЍ^0 /|10|1/O-4M I F SPPQPU>Q: Q6 @X1J0 H\-P|ap 8 80 c(#"$ c$"a8! #4 a4#CQ 0 CQBQPE`FPVpQ[4Ѝ Q A0 B^0"Ap10GS1qSA BPP q0p CR000AS0 0PP 10CSQ0 CR00 P0CS0BS0P 0 CQ000 CR00U 0 GR HQ PHPGQP\`p@-@0P DR@ѐQp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R ,j1M  0MX @p@-PUp@`0P 4 ) 0Pp` d H Q1Q44!010p@꼛p@-PUp@`\0P 4 ]X\0Pp` d H Q1Q44!\010p@꼛@-0 4ĸ 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`d@-@0  :0p@-T0@00SDP@?o tT$3Sp0p@X^xF@- @FA-0pS@ S P0S S0S0S0s0S0S0sT( PU  0R v00PP 00(0 v5 0R` R: 6P 06 00001 @  00(0p 0;00S0 000! 0 80SPTA*(W 0$ 0 0$  00!/A-p`PUA0@T P P (W0 0 0 (Wg0:0JP@-@01S0010SlC-0`S,M"P00P0S@0@SLPP PR \10S UL 0 SpH ( 0R*T ,Ѝ &1 0T0!  00WP@ 00TP00S h00@ C3SR L0Lp 00 S00/^j]F|7Hg]0S,4! x!/@-@0M 0<01,0 00 0S0Ѝ`Fg]@-( (0 i OЍFP Q Q@\ \2SQ Q @00P1Q0 Q0(00S@080P1/ἛG-@0SPp(paP`2Sa 0!QQd2S01封+1S10S(pV`aP`2SP ̐ P6P>d2S01`o` 1S10;`U p0t  0kV *F 80 V1 Gh"R l2S0aPp2S<0h2S l2S0HPp2S<0꼛|g],p@-@PPpP1S#0S X @ (`R R X!!Ff`Pa 0 0< p.X1TFS!P00p@Cz@-@|M0t2p S' `0PS R C   O   K   G   C  D ?  f 0 02 |Ѝ\Q 꼛F@-0S6& ЍS6&h^0b? S /A-P(p 0X`8@@ TL3K@D0S@D0S@DV x0|  0T@ D'7X0 P1X%VL 0   @T8A%815A꼛,0S0 S0(0 b/ R /0SA-0`S0MVPTPR 2q0@S0@?oR20S@[ P0@S PaQZM WM0000 0 P 0 0 0UP" Q 20`0@S010@Sʲ0TpD#TT1X%XS 1P090:0Ѝ  10CSa0Tw00000090P2 W R. 0@S0$ 0p0Q0 0 P00S @0G3WS .!>20 2 0 $0*<0 $.0W/c]FEp@-0P@(T1 01  (p@TA-8pP(`@xT!0@@(AT 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B =0C=@-@P 0 ;@0:P@H 0!R R  dd]FO-m0@SM S( / 7`P t@$00#.0#A0@.H>@$00#|H4 00 PU `0S l2P  2PP%@-0@ 0@00 00@@OV$$00S@ ЍG^%O-@R@=`SxMvMm0S SR 0(68.0#p  "`0`3 p\a 1  QᨁCQ1!0 1!Q @ ^00;m1 S 0 0Q!A`000@0@00=0=Q1!0 1!Q ЍO(68.0#t  " "1-0R:jQ101uQ 0 SH 0 A SS0!\ 0  %xA-P`ATAAp@O-NPP*eN0 0 00 00 jNrv000 [000 00 00`2N2"0 2"6,|@-@b$Mk0  $Ѝ@褥pP  % Q" 10SJ 0CS1) wO00 00B 00 0D( 1}x$Ѝ0Q1;08C8 S; 0;MH0L 0 H0L M>Q<MP0T 0 P0T MP!T1 1X!C1S01S01S000001S ;S M0 0 0 M01;S|P!T11T10P1000110H1;S0;0103/\DFdd]p@-@Q幤0  p@8P ;` S DP T1X B R*1C1S014cR :HMx0| 0 x0| SM<]:MX0\ 0 X0\ EMS00u00@-@aMn0  Ѝ@觤`pP HQM`0d 0 `0d M;S6S00 ( 1( 1S D  B0R#*Lh0l 0 h0l L0 0 B !  x01NT01Lp0t 0 p0t L<p@-@P0  p@@`iP 01; S !R D0D00CR:001 @-T@أ'HH 04004 000 @0<x0 R   R-  R   R   R-  R/  / b /ᔞgfff@- @@0 Gp@-@TP劣0==09#9S p@P 000q@-@8`@0S-//A-`@Q -`pP!P+0B8#8S1i; SQ0A?0\R  0?!0C-MP00`0p0 0` @% P  0`  00 000 0@I?o2P0S R0 ЍO-pM 04@34R垷W X` 0 000 S K@DTp0X0 00P$020@3ˢ@T 0X2|p3+0 S PP(0 0000.UP -0<%0HL0$0S Sg 0 S030#Y0S -0\P 3Ң ߍ(0 H L  P d T 1X0 0\00S0+0` d0V! 0C80(0 ,`(p 008P40$@@ @ 0!>4 ,`(p 008P0$@@ @d> 00!T> 0L>4p,`(p008P0$@ @r> 00!> ,`(p008P40$@@ @\"040= 00!= ,`(p008P0$@@ @Fx= 00!d= 4,`(p008P0$@@ @0(= 00!= ,`(p008P40$@@ @040< 00!< ,`(p008P0$@ @ 040< 00!t< ,`(p008P0$@@ @ 0!0< 0<4 ,`(p0@08P0$@ @@ @ 0!;0< ,`(p0L08P40$@ @@ @; 00!x;0<0L 0,P($@@ @ 0 !(;B0 ;L$ 00,P( @ @ 040: 00l!: ,`(p008P0$@ @~: 00 !:4 ,`(p008P0$@ @g040@: 00!0: ,`(p008P0$@@ @Q0409 00!9 ,`(p008P0$@@ @;0409 00!9 ,`(p008P0$@@ @%040P9 00D!@9 ,`(p008P0$@ @0409 00!8 ,`(p008P0$@ @0408 00!8 ,`(p008P0$@ @0 400!L8 0 <,`(p008P0$@ @@ @0408 00!7 ,`(p008P0$@@ @0407 00!7 ,`(p008P0$@@ @040`7 00!P7 ,`(p008P0$@@ @0407 00x!6 ,`(p008P0$@ @p0 40D0!6 ,`(p$p008P0 @ @X040`6 00!P6 ,`(p008P0$@@ @B6 00!606 0<,`(p008P40$@ @)5 00\!5 ,`(p008P40$@ @p5 00!`5 ,`(p008P40$@@ @$5 00!5 ,`(p008P40$@@ @4 00!4 ,`(p008P40$@@ @4 00!|4 ,`(p008P40$@@ @@4 00!04 ,`(p008P40$@@ @3 00!3 ,`(p008P40$@@ @ 0!300T 0a,P($@ @L4 040 010 f1 SRBAA0 0 0 A0;0`1 0@ Ḭ@P  :A@P T0Sƭ7@S=0f1,G-PU@' p@`000S S@  A@P0S0S0s0 00 l@sA-PU@ `0pS 0S Q @@P Q 0@;Q B@P p@-@T P\0`S2:pS=pp@-@T PA0`S 0S=pp0S p@-P(@5 p/A-0`SP}@p0Str9@@+0S ;2XR* 0R 001000@0PMK7@A-`@pP弗000S S/@X>1DN>4D @G-`0M0@Pp0S6@ЍZ U U @%  @  qaYPx YpGWDGEGXEG\HGEGEGHFG_@P0S0000WQ@P0S@+S; 5@PpW 2Wq @PpW 2pWq  @PpW <2]Wq @PpW 1JWqpGWmFGFG! 12  0 $00S ( , I`PUh P 0XP  L0lP L0 QP%P :U 00VS| 0 8 Ⰳ^'0 L3 T⼄T'04p 0L 0xp 0(P\k /(0, 0 (0, ᴀ$P2!0$0ΗPP4(.80< 0 80< (."$XPP$`0S&2R0S $ S0S  S &1R (0  (0`0u Pqt`V x00( 0 6/p` Pd 0 0R: (0 `W . 0$ 0 0$ (. 0 P孡 P+^@-0S0SP0!0@SP R \\0 00 00忕Ѝ 00c]}GEA-0`0P@ Xp X/@0S  O0S  @ЍV0dS*@P~@P0S S @d0# 1# 0# 0 0d `X<4ꈚx408,C-0PS`p,tM S+ '@!0!3 $$(000 0"(PT00d 00   0(0  0Qw6PtЍ!0!0(@0 0 000#0%( "(0$p (ÔPT0d0 0 0   0 Q86o o*h4hG-pM000 `P%00S'0A0@@DH$H0P'}l0P0dP PX%XRP PЍJ *Z`C-`M00p0 PPA0@@DH'$H7000 #P 000Ѝ' "0@DH0$HTPA-`M00p0 PPA0@@DHt'$H 000 P0 00Ѝ!@DH R Ƞ$H,ȠTPC-`M00p0 jPPA0@@DH$H ᰑ0QY!0I0 P Ѝ@DH$HT#P0@-@|M)' PU U     0 0   |Ѝ0     `    O-MPa0@p (0` n0 00 0000X@h0 00poᨂPX0 pP HhpP堂ЍXpf]@-0@S S 6S 0S0l00l06S  l Pf]O-p$M000 `P2P`- ؀6S@`Pk&@TA1@@D?H;$H0 & 0 Q PX %X& P 0 P$Ѝ0C8#8S`O-$M000 RpP$Pp A1@@DH0$H` ᰰ0 jQ PXᰰ%X P0 P$Ѝ`Fh&hVp@-0$@ `TPM Q Q@x@T@l !p  7/P0 #P 00@0 P00C0Ѝf]0 QQ$/@-40, ($ Ѝ@-|Mp0@P`` 4H 0H * 00X 00 0000|Ѝh4@-40, ($ Ѝ@-|Mp0@P`` H 0H * 00X 00 0000R|ЍhO-p0@P`ᤠ夰M0倐` X `  X 0` 1  01` 0 1 0100PЍf]d^C-`@ 0R0%0 * 0 ᦥPH Ѝ 0Q0%0 *$<S p0pQqS  0≥P  0R@@T PE0S& U  R @C)0 0 0 N) SPEUp 0I  p7p+^`U<8 @-8 <(@<D0 L0B0"00C0hTG-P@`(pTG 0 0 0Z 0  2$!@ Ả0 D @  &hT1O-PTM000 S@  p * ,0Px},0 Qp%p *` <W P8<8400 004,L寡0P 0L0` `"44R8#8 0 i00 0  0 0 V |1 000;x~(0 0 0 (V |1 x0|0x0| !44,8##8G`(h0l 0 h0l k(V |1 000 0  pTЍ6 6RQd*0 d@@0 00 $0L6T?D& QRR* L !@PK &< @ 8 <@@@ @@00x000(00@00D00H000[(0I@000@0S 0 00 0ST 03i Q  iP $(c0P03 8@[ $ PBbV |1 000D' 0$ 0 0$ 'Ꭱ50 0(0$0T  @00 0S0$0 0 0 0  0$00  0C 000000000P#40 000000S0 0 R0T Q   BR$g T    BR 0 0  "000D00D0 0T 0 0SP 0pp 0 0T$ ; 00I 0SI!:_ R @~ 0 0 0 000S弝勞$  p+ᴰ0p(00pYJ  00000C0@0TF(06; 0R0% * 00PP 0 0R:P @p&h0l 0 h0l &V |1 000z|N~0P 0r YP{ Q ` @0H0 S +^T`U1hTpT@-) @0PЍA-`P}}@@Tp!p@ 0RD0S~A~00C08@<00S i&(0, 0 (0, t&<PTZ&004 0 004 e&DAhT1`U 0 /hTp@-`~PpT@TP`@0Sp@4}5& 0$ 0 0$ @&@1hT`Up@-,@,Pq}0S 00p@}hT 0`( "4`#/P/;P/wp@-@Pc;w@P;p@-40 R@  000   寝D Ѝ@-40@ R  000  嘝- ЍX0 0&C-@MP`} 0` p0 P 00 000P 0 <?o2PPPU@ @T@@dp`V T͝<!}ЍÝ@T w@2L-$M840, (  0 $ЍT1M/ JA-@Qp`{lPWP㕛0d 0T00 p` yP @ #RH LQP@\@V !`VQ  h@VTI L@D .PVp.WWTpL>W AN^ pApGW0N ^  p 0A0CS00L-\ S ᾞPALX 0 0QNV.Q TR0 B ́@-`P@M 8p.{( .h`v( .r( `p0b6Ѝp^0@-ASS0CS꠳GȳG(GSh $B -QGG4GXG|G$A 0 0 0 B$A 0 0 0"$A 0 0 0 0v$A 0$ 0 0m$A (0, 0 (0, d$A 004 00 00 Q QV$B 0 0 0 M$B 0 0 0 @V$Q Q Q<$B 9$B 6$B 3$B TO-PM'U@50S 505%0(000f6U(UL p0( n(E⭚0/S0@PE ( p4:0(0)0p`\(0(K1P440P,0( HDP PPPH0 `, )PH⣜U d40S .p'L$TPp060/S0㾝@PЍ1PPO 0`00:0p0PP|13p000 0( :,PR0 <030S00P00P R 50 00Sၡ  10SF  .4%0  5Jx!0330+000 0VPS[<\\x™L10SS0x! d*| % !0086lBύ00d0 p⬜P 呙~txD0Bύ1WꨟP+^T>f] ^M^^^/^q^^^^2p@GO-(PWMPEsP |1܏ 00U0  8$(0 8$( |1 0 00  0'S (̚P 0 00400S0% p *  D0P D0 Qp%p *4W  P00 p 0 : 0P(0 >0S 0@. PK$(00L.0H@2 (8,(0 (8,(@~ 0mB?! ! 0S0: 0C R-=0S 0@. $0J. $200\-`20SZ00C S񟗞G,G,GGGGhGG(GGG GS,GGG`G0800S 0p004 R   0KP 0 Q`:X |<0f@P8<P |1 000T6GGGlGG/U 8$(0 8$( ᵙ|1 000 |1 0040004|1 0$0T 0$[ T[ 8(0 8(|1 (0,0T(0, |1 80<0T80< 㱜PP P 0 R 0 3SH0L0S 0 ᪛@P @PO0 R0 0  H0⟛P H 0Q:00S U  a88<(0 88 4<($$0 4 $$f Zr|1 @0D0@0DT U' |1R0p t p t I@P   %MPx | x |M|1 000U084(0 084(V\80S UA U P 0@`S 0 * L0%P L0 Q:: 000S 7000=4@nPP40S00S- T4@JnpមU ᚘ0STPP 0 @@ 3S H0L RP@\0@0@D4@DT"w&40 "44(8"(C80(0 0C$0pC0SS `A00CS00S S@ @ 00SW0WS@@ W 0͔bPP  d`P PPM P`0S 00CSd5@@ 0ShtGGGG G<5PPk @Th0Sf  0R0% * P0[PY P0 Qo``VO 000W 0 P3 0SW@$00C ,0R:0   RR4 0$ p0C000 B$ , CR7 G0 R# \?R?^R$\ ^ 00CSᲗo R\,\0P< 80LP< 80 0p0pG00S` 3@@@S 0000<$0 0 ?o2R0S $P@'`21,0T0T@Tp 000~OD900T,2@P2X00PXp 0WDpGW 0SL Jr,2p8p W{`00S$0`S 8P 008 0bP P P 0  0 00S PH0\0\pW DpG0 0 T+^Sf]W^{^@oDú́dUg]`U0001`0`@T ~OD@@`&`mpP XXPލs@em }pmWT 40 Xpp`d 000U 03S H0$U0*`B 004 0 004 `Pdp03/@2GTO-`pDM%40SE PH4,$0$(PP20S  .0000"0! 0L00 M0[0UP>DⅅP  Pg {4 D00X000 2`  1.P0 >Py Sf1S 0 fDP 1(0,0<,0fP d` `0 81  p`>W* P`>1pU t G`LY  @|\f1S 0 Kf{H0U ᐄHP )<P $0S(PVx42f[lf]^^#^u U`YIUf]C^f]́́@-p@`v0P p@L Ѝ@-@e @ep@-dP@e0SA?C p@@e!R1S A?CSP U U@-@D P0QQ  00S 0R  4Q DA-@p`#P@P [#A-Ppw#A``P@  `P U%[#p0S AUp@-`DP@Tp0S  lPUP $4RPD@A-@p`4#P@P [O#D@-}P0 R R 00SDup@-@`#P@P _[+#pp@-0PS0S0S 0S, 0S00S% "A CP@ #p`00#d00#h00# l 00#"pA%Up@-P"A`h@PT"p `P0 "pA@U 0 S 0#/00P/Qp@-@p@ HvP 0!S p00k01pp^lf]SRG-M_ p4PQ@ $Q !BQ -P,    R: R7 RR3 RR/`V,Yd @4Ya 1CY0`9  $ P1PЍ@X$ (0S,0S0 $lPp H 8H Y0X0 0\00S d Y 0t0 0x0 $fYD00^00008 900P `09*  `F $$0 0$0 (0$0(0 ,00,0 000 00P!DP`1P!!Y  $y0S DZ  jR0 $00 000 000 00 0P1XY p H 8F X HB/ d ;d 700!08 t0 X *RPP#0  QP P Q00 dꟿ^iikii O-pP9PQ@`M #49Q 6C0CQ 5CojuPiku( iJi(i? i i Ni0Kiǯ> ~$niji ߖ>> i i %i ixtuǀQi Ti >!i O-N낏DpP@`dUT D @QP6W@R@ Ѝ0S0 0SpDPN PT v0 `0 00`S`$4R@@00S0 0S@DR  4Q ꀟ80S/G-3`A0ASHMp6DP@$$$TOyHЍ00S/vVB0 000S'`P# 0000S .` c  00 00>FPPVDP@0Ff]ſ^@-@@@G-HM`pDP)@耟萟蠟T |1S  00 0HЍ00S!VG00S .`  00000PUD@꘠f]޿^@-@|1@iQAp@-P` @P@ P @pp@-`OUPKUGU:M 7i0@0L0`0D00@0 0<0(080,040D00040,000Gi@pGGLGGGpGGGp@-P@i0@`0%_;`_*U(U oMp@#U0008C00 0/p@- P@!>00000p0 @-@     @-@ M Ѝp@-@TPTPp@-@0Q$MG 'R`l P'RX("($( t  0Sp*00S-0000010S00S"!10!0!0!0!0 0$Ѝ@.S000CS0pS000CS1^"^A-`@Pu200SD0CSpW"Op/o"\ R\ Q  ^ SPR `P H000S D0C40GS SV`##S@ &S0F0 XP  RP V 0 #   ?o`ЍGS S %SV000 00 00 00 00 00000V0S  v0000 QRI p@-`@M 0 C^.^ P?R1  000 C0PU'X KXм Xܼ XؼX :`0 0<000 LP`ЍpA ER PPC/C-40@SOM p S|1 0 0 0|1 00 0Oߍ R@D  Q *40S $0OߍCbS S #3R t40S h$l0|1 0 0; HT, `P2  r4Bύa`a`001411 0``1CP t30S 0t#t|10 0(0 ST# 21 2L PP ` -2P<2034P09zP 20S 0"WT iPOX20S p0h"lp,20S 0008"@000000 00000000 KP1B110 0141P /P d10S 0!# 2) p\10$0$PU!X ``⍻(1(` 嘻`<⿻<0@ 0000 0S 0 1(0(P~_EU T P0 <00S P0L xPAtuLR꘠g]L^x^|g]g]g]^g]^^^ 000S  OPd01@ R S 0S0S0S d0NP 006T  @P 0P0Ѝ褠f]p@-0 MS P Ѝp@8`<P 0S$ 0R WxDxPP;xPP0S0S0s!.0P,HxP!xP PS0S 0 @@8xO-pPMHhᰤX$ &h*D $ 0 0 H+0!  D! # " H0,&$$$H( "( 0 ATX $ R  0 8/Ѝ R5&R2& R/ R R R R#  P R R R R  mP 0 Sr 0[sd   @0O-M0 00S PЍ0`S0S/P0S' 0@S(00S 00x4pDPP 0S 0S0sd0 0S0S0S0S090s 0S0S0s X3# 21 208S" 00$`0D `0 0 X0Pp`0Q0W0S `DP O 0S0s`V t+!>7l0吠 x0(0t 000NbpP 0S10 0 P`0 @4`8`c3\ K4`Qz ZDO 0,%S 0S0S0S0 0`pPe0b0S0S 0sS0SQH 56l0S (0t00L0|0 t7P -8g 00000SP ^46c(#"c 0 V NO 5 0S10 0q rP P1P0PꤠO-hp&h &TT$M 0X ' "%X " A  T0zS) PAQTI$Ѝ R R d  &R&R Rzd   0P 0C @ &018E 0AT 0S0S d0 6S 6Sd0  P @0S0S d0 6S 6S Z d0  P @0S 0S   0S0@@g]0S/ 0@-S0S   Q Q> (0# ,0# 0#.$$ ("(0  !R   0 1(0# ,0# 0#.$$("(0 0 (0# ,0# 0#.$$("(0 0 10)0# F0# ,0#.$$$("(. 0  " " "0  !R   0 1)0# F0# ,0#.$$$("(. 0  " " "0 0 )0# F0# ,0#.$$$("(. 0  " " "C-0@SPM0S0s  0 0h!0 Ѝ0:0haPP U,\PMQPJHU"PPpW\PQÅUp50\S0CT* S 5 A%CQÅQpÅpRQP'rpÅ0W0pRSpp5U0Y0pRS'p5U0Y0pRSpp5U0Y0SP:0D^)]p@-@08M S8Ѝp@yP`.t "448 #800` 8ЍpN^ 0 /@Y@@- @(㧟LFR#DD=A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00UG-PQ Mp@( Z% 0S B/`R`0d 0 `0d ]@@ ЍP 0Bt@P; 4``( H.P# P0S 0S0s  g 0 %t@P.UA`/00AVX H0S |1 X0\0X0\ss@PA`0 0 0 U` `0S  TR H0R SX |1 X0\0X0\s`UO-7M #p 21, 20P@00Lt@S0 0 0[`S$ 0S! P *MPPP Pt0L 6@P t0 H0 GMt P40@B A@3@LtAs0\00C?o20S MPP@ 0S 0P 0SZ 0`VV 0S0S0S 0SJ  t<<6|pU7tIP*1@L0 U FP Kt0 L0 PO @@P 0S Kx5,# 2!1 2Ѝ@@0`SPW 0S0S0S 0S @U 8 h@@PV80(04$0H00pH` 00VAoFVWD$ D P J@PcD0( R_t`03| 000SQ @ t2@PK < t,@PE@ <0RA0>30S q 3 #0 0 BQ/:` P%Pp`p$W 0SP8? 5?00CS0  0CS Y00@S 00@S1L0L`V AoF 0  0ZSq t2 #0 0 BQ :p H2 #0 0 BP:q  #0 0 BQ *q #0 0 BQ* 0R-S0S0<0s0 X 0<< R<R R | rP! Q RSSR R QR  #  R} P00P00uY 0> 0S 0XG X Pp_R 00S@X\Uu<P P/Q|1 00/᠟p@-@PL0@ 8Pkq P H@aqpp@ꠟp@-d0,`P( 0 0@M 0  0"` `YP P"(PP d03d010!"446Ѝp(0 @-HL H K < UC-騁M@s`W0ʀ 0! #t!0 l!d!  , !Q#PTPV  R0S  0T@ @ @H@T0 SPPPPPU 0 0! s0 |  , !ЍQ H0R:H  P0H000H00@@`dU10SR@-LMPH <0sLЍ$RP0 p R0 $1aUH@T IP ,$CP" @TPDPH @L00PLP +PP ,$$P @-/0U0L0 ꔊmuHU0-A-@q`_M@P@0D 0 T@0D  0 0 0 T |1 80<080<0p @0/S0! x f?!0Hp.  U. XPPT0D@@004 @p _ߍAЍ/`U`u>^a^0O-,00\M` p"0S( 0S  0S0S0S5 0S0 V@oX 5\Ѝ5 q@h50C0( 0MRM.s85P0S" 5@D<00 ,0<To@P+d0 0 0 U0  o@Pyo@Pxd0 0 0 U0 0,00 H( (0$0=P H]= (00$0 3U0  $ <P$ (0R<0 $ (0$0<P H5=(0 0$0 D3 H( <P$ (0RH 0@(0D\0*bZ<,0 <,eH0S |1 000UC H0 @0r400V h" R6  00p3'H0 # r`< <0H  aP <,0 <,&U (Y 7Y 0 K)P0  0 R <,0 <,o@0HP H0S |1 X0\0X0\@0D 0 @0D 80< 0 80< H0S |1 H0L0H0L[ H0L 0 H0L U [U^@2^^`U^^dV-$M840, (  0g7d$Ѝ`UA-(0@ R@Ѝ`p 0kP3T( PPQQ0S{kPU@k0 000 3SH L0SP0\ 0lP< 0CU* 0kPO-LMK  a 0@P`p㬌!< 000P,`(p$@ @@ @娘 0)!X<  0@04P0,`(p$@ @@ @唘< 004'!< 008P0,`(p$@@ @|; 00!; 008P40,`(p$@@ @ft; 00!`; 4008P0,`(p$@@ @O 040; 00!; 008P0,`(p$@@ @8*0@ b 040: 00!: 008P0,`(p$@@ @040\: 00!L: 008P0,`(p$@@ @040: 00!9 008P0,`(p$@@ @9 00!94 008P0,`(p$@@ @ח040`9 00!P9 008P0,`(p$@@ @040 9 00!8 008P0,`(p$@@ @婗0408 00!80< 008P0,`(p$@@ @吗040\8 00!L8 008P0,`(p$@@ @y8 00!8 008P4`0,`(p$@@ @c0407 00㬇!7 008P0,`(p$@ @K040d7 00!T7 008P0,`(p$@ @40407 00!7 008P0,`(p$@ @0406 00!6 008P0,`(p$@ @#040h6 00!X6 008P0,`(p$@@ @&0 400!606 0<008P0,`(p$@ @ @֖5 00!5 008P40,`(p$@@ @忖l5 00!\5 008P40,`(p$@@ @婖0 400!505 0<008P0,`(p$@ @ @吖'0404 00!4 008P0,`(p$@@ @yl4 00!\4 008P40,`(p$@@ @c 0!40<D 008P40,`(p$@ @@ @K 0!3030 ]9)0 9)h|1 000K0 0 0 V 0N H>(   Pj RJ30 0 0 >|1 0 00 0A9)0 9)R @ =02F?! !2S28(0 8(8(0 8(0'S(i0`Q 0 0 0 |1 0 00 1Q QP P$P P \| Q\ |0 0 0 |1 0$0 0$ piy0'S(iP _ 0 p00! !0(  FiP x<,0 <, 0p 36P f0 0 0 %6 P 5 P50P0:L0S1|1 000PD:`V P `20 0 0 @0D 0 @0D 7|1 80<080< g99LD00H00 \0 $0D h$0`SB pYP0T 0 P0T d 0S |1 @0D0@0DV e`Qhh0S   S 19)0 9)L 0( (0R"0 0 0 -|1 0040004p+TX |1 0 00 0 0 0 ,TV`, 00@ ! 0(3/ P@P  PP(QQ Q$`00  WP P!<,0 <,PQ D2`U@2H8j]^+^g]O-p(0P` @M |@00`Sd0  N32. 0)0pP@d0 0/ 0)0cP@d0 0 1b"!4b4##:0= )0PP@d0& 0 R"(`P AL0 0 0 ЍOU00Q f)01 (P@fd0? (0Z +0JS7 33 `P 3Z0 S3Z Z +Z ЍOe<Zd0)02   ed0 )03 P@Ѝ`UR/A- M 0(P`0 1pP)0,  Ā@P 0 }P|e Ѝ1M  |@-(Q0 'QPttp`0(@TD Ѝ0 a,W0 03W0011p@Bj]^@-`P,Mp05(0PS3R!(RR S: 0 aW0000;) B RȗHHHHHHHHHHH@H<RQ'S 0( a(W00,Ѝ@S: 0 a0<SW00 S: 0 aW0000(0SRj]0^s@-PS0`@0P00PT @ @Ѝpp@-0P@1 01  p@`U-$M840, (  0Y$ЍhVO- 8BQ| p0S Y0 0S0A@ ЍO_B @T `V x0S 0CSx00`0d08V80< 0800U < 0C0E008ꔰlV|H[p@-@PP `0 |P Mp v{p{\dp 0!< 04 0 (   !/@`d\ P/0 !8 0 0 (  , !/@`dO-pP#`PlM73Q 85<085p0<t0p0Pt@lЍp7#0S 5S @@@0( AfPPH 0'S 0 3SH0L0S( dPP6 0dS lS3 c@0p00&+ \Q% L0t&0$ dR lR! 5%0 %L 59Ph5l%0 h5l%7@<p00@ 0T결pT(/ "R;( ,Ϡ ( 8 ,< 8 <`0d 0`0 h0d l 0h0 l ,0<0  /@P /@Pd@C T0 0 0 I $Ϡ  0 $4 0 4: 1<02 0L8#8CQ ##,3)$ ,/P DQ0 0 0 \0@`0008#Q#(( </P $0R (0R(0, 0(080 , 0< 800 < c 0(@004 0 004 &;_P "0 00(00fP b0  Q:HLQ6RH0P0H0 0AaT bP (@(@@<2P@TL00^(HrE_hV04  R0kS &u /-/@\p1G-P@D 3C7CPR, P0#  X @ |t@P@\ |zt@P 0e0# 0# 0# 0# 0# 0# 0#015 %0 5 %[5%T0 5%0@@$0@$0@$0@$0@$0@$0@$@1Qq\ |P $v@P0S  kPD $eP>0S; [( . L. 0 0;00|;<3 0&&'0 x000C0吰[PU[g0Q@U2P< 7@0Q0  2U_ 2 P" $P|;<3x0S00C0xP |@@;<@30 &&'xPP`10 @\ |os@P|L$@(0@$,0@$00@$T0@$X0@$@$@$`1@A1QqU}1@c $P $T|@P0S! pP|=s@PL|0St 5G@E @C-@A0@?o;<3K200*2@hV|HH^(\C^f]1iP^h^A-`0S@Pp唀0 S 0x̀ R 0 S030SVPQ R PU @H^lVO-` MR0Ѝ0@S000CS0 B S7 0S40S10S.Uj@0D 0 @0D ux5xşxU @0/S0 .   .P@P$ 5@P0 p0 T0# 0# 0# 0# 0# 0#$ 0#015 %0 5 %X5%|0 50%$%0 0$%M1PK !a`P a1C P $}P0S 0'S 0 3SH0L0S(]`P 00# 0# 0# 0# 0# 0#$ 0#0010 0X 1P 1]6705 ;P $50P R0( _P 0s] 2XTP00ph0dS lS5 0_] 0000 002 08#8Q XdQ  lQ0 P Ph5l%0 h5l%<0 0 @0 0HQ5% 0 % 5& 0@$0x00 000030Q10吠@0@`0Q0 D   00 Ds0\ 0 P ЍO`U`u>^^hVx[@H^^O-B0`00 0 0 (ppGW 0 0 0 \"/W0 0RPP 0^P 0 RPP 0 0 0  ЍU 0  R 0 0 0 0S00 gP 0 0 0  [@ 0$ 0 0$  0R*`-/Wq0 0 0 |g(0, 0 (0, 00`S 0S 00 v^@P{ X0<< 0E@  #hV+^@H^tj]03 "  /A-0@(S`pUXPP[7Y(Y( 0(0C00(00@ E@@A-0@0t0Pt00`0x0x0|0|00S 9/PN 000S */P@  80S ppq/P81  8 <0S ppq /P<"  <p0S ppq.Pp  p@Pppq.P@  @ܻP .P .8P .<P .pP .@P .7A-`pPW@P UW0X7VP  奻@-l 0/G- @XPp f^`P @V<,0 <,a[|10 0 [2`3 0  G`U7@-0@ Q)R*SP SroP 0sS :R0S Ѝ000:Sn@- @00t0x0|0qp@-``.Q00S@P P H.00/U00S00=U00S0t00U00S YP /.001U00S 8P $.080#U00S <P .0<03U00S @P .0H@0zY2U`VppP .0p0pA-p@`0 ,0P(4# G Rğ)R&dHHHHHHHHHHHlHHHHdHHHHHHHHHHHHDHtHT @Ѝ R  R  R  R R @T. Q00S 0S0S0S 0S0S @1P@0S  em-P7@ST  Q @T0t0@T0  R0 000 0 00P@T0x T0T R/@S0S 0S0S0S{ 0Sx 2%@Ps0-P  f0 000 0 00pPT1= TU 00TQ1,P8  @D0 000 0 00x0PT T3 T၁.#W<@ 2W@p@,Pc  XT3T0@ST@@x0 T Q0 R000TT0 R|0L*@@-@0PS`pM,P7 J0ES* ,0 00000(000Ѝp@-P`y,@P / $P ,@p@-@P+@,G-hMP pሠ]m@P0S( 0$0 @@@0 0P @ P 1P@9hЍRsZ  0S @( @ĸ0 ,0" r!.$  ,00( $@WP@@W`P H0 M1@|W@WZ 0(<$0G-pH pMS@P  )S *@ `FVP P @p4b@pЍpNaP[ P @00F<SHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLHHHHHHHHHHHHHHHLHHHLHLHLHLHHHHHHHHHHHHHHHH.0 000 0 00 @Pl@P9V,VV0  R0`FV񟗙tHH4HHHHHHHdHHHHHHHPHHHHHHHHHHHHHHH@Vx+0 @@0 0@Pa d0R55 d0R88 d0S /0J d0R88d0O d0R77  d0R77  d0R66  d0R66  d0R33 Y  d0R11 6S0S 0S0S0S d0R99  d0R55  Pk@Pt 0:Pk@Ph 0 *P k@P *R 0@`@`T *@P 0:@`0`0000 0CSHH4HdHH PkP`PP  .P 0)3S10" 0S200S@T9 0R;0S8@T5o*@1P]kPP0  R00s800 >kP0S0ĕ8# 21 20 000P $0 P @E$ (00 ,0s p_ Pp. Q 3S100 $-#P` pV0 $P P 0S 0 000S $%P `4` jPr4 800<0spI_fDP  7.P O Q "PNp WJ X 0X P pD\8l6XpTP0X6Ph="P2-0Jj@P0S S Sd04Td044Pd044Lj@P 0F<S񟗆pHHHHHHHHHHpHHHHHHHHHHHHHpHHpHHHHHHHpHpHpHpHpHpHHpHHHHHHHHHHHHHHpHHHHHHHpH+V* VV0@ {iL`FVHHHHHHHHHHHHHHHHHHHHHHhHpH|HDHPH\HHH9V( @Vd0;0d0C9d09d0:6d08d0C:d0?0d0=d07d000d0C;19@ 388`40 00`=0 0 0G@}c# !tct' qγ (0@0(0000@SR ZF 0$ 3SH L0SP0\ 0<[ OP O0 ASm`0d 7`0 `0d wt< 0CS00S 0000 0008#<40 0@ 00 <000S0  Z  0 000 00Q Z < 0Q Z +  @ (@ {3TH0@@0T `0d 0 `0d ` P @0S 0S0S 0 000 P0 0 -`@R0S P0 0 0 X0\ 0 X0\ <Q0( ᓲ<<0X0 @0SH0<0t0S)0s0Sx1S49000@09000S" 00< D0!`PP:D0H0+!(     R  b> l8 4b:#00X 0Sx1S *P DP@U<)Q`P P`0d 0 `0d [p 0`000T00S |1 P0T0P0TD0S @ DL Q@ D P$P tg `0d 0 `0d `*?-dp H uPb60PW H0RStp H \PIt60pP> H0R:3_V]h d00l 0p 0U  ⮱5Jύ.0$&PC Ԑ@  Jύt0&oᩒ2Y1 |50S .d _@53T%T41d00>Xu`0d 0 `0d U |1 X0\0X0\Y1`PoPlD0 `S 4 R000<0R00p @ 0<01 S@<0SD 44Jύ$ 1T0 P08TPP T`H00Y@  Yp33:$ R*X `d0D0S O Y 0X x0S 0SX x0S0S L0(0@ 1P>LPpm0 @A`P@0S~s<,0 <,pU@ T0<<0 |1 0003Sb0 0 0 T |1 X0\0X0\3`*P x1S 0S  @S0S 30SQ00SM 1 0R00S  @ P @vPD<ZO<0PgO9([ 4(0UUߍT@Uec X ( ,0 < `` W` `w0 0 0 (`S  R$  / P *$ P<P0<10.I^j]l^dVHl`UV W? R  S RF 0`0P @ $(  $@1,``0 3  00S 00S v@ ,000,0 $00 p\S $a0 0 0 ` Y*`a0 0 0 Tq |1 h0l0h0lh00S p0(00n0,pG1Y pppW@00(00S1 0  , @,00 #  `" R t20S @ ,000,0@8#8 0 0C40 0XT, |1 `0d0`0d#0S ,0R  0    0KP@#Dcr`0d 0 `0d }7`0 @0p4O@PWcZp0t 0 p0t e0 0048900(0@0 ( $   $ (@0S0  MQP 0Y    @P 80$KP  80  0 0H8#<48Q#80¡0<pC0±00,000 040 8#<4$ 00 QPs @0 0S @唕  ( 0x0| 0 x0| T |1 p0t0p0t*W`pk0P @ $(  $2D000@ Bp@`CwNf0 0 0 U |1 X0\0X0\A`00 幮VN +P/80< S001R  ! @0pS001P0/03 "  /Q/C-@M }0(pP B`Po T0P4`00 <08PP= @` @0P4`8@⬎Ѝ@B(0s/@-@$S@ⷎ S0(02O-2CS0 %000#5T30?0000 P)!10@T ~ODTInT@-4 R0R 0 00 ЍtI0S!p@-P%0@6S گP `N6S006p6O00C0p/@-0@0,M`S6S 6Q0C?o20S R6,Ѝ@N@0 P0 pt0\ 00 00P p$pDWNNN|10ꨟp@-0PM@\`P ^(0(S00 H 000 |0 00@X0<8@400 `4 L@VPЍp0  @`g]G-1币帑1!(M0&# 2a1 21P0 0 @TlAOD5"3 "`&a b(&(Ѝ10pWAGCq" 0 BQ* P%P4៼&@TP (@T#| 0 B\*PVP TIoUuG-|1P`p M0K S200S#@T6  py  0  0 0 3 |P@T p ЍD0CS  R   ` Ra R H0 0 0@ 00 03 mS Đ# 21 2 00 0B20@T D@DT \3 "( 00S  Mt 000" |H00@^0@-M-7 /M00000 0|0c00@P  ``XP0P $0@ Ѝ0@\2no]4 Ik^nj]u^IIp@-P@0@0d000?00:<0?00 0400S 40S3 !0 0p0u(0p@-P P@2U0 @@@D@H @Pp@0S/G-@`Qqԁ@ R HQD0PP DY>Q*C 0 0 0 4P 01 0S@00@H00C Q6<I<IlI<I<IIIIIIIII<IQ! D R  @ 0L S H0`S@A 0 0 0 D0S < H$D R  H0S Tj]^T^^Q|Q/P/M.p@-@P !p@G0@-@PX0$M @L|1U0 3/PgL$Ѝ0p@-0 M @`BPK|1 0@4/@HLU BT06 Ѝpp@-0@SP M 00ShP  P0@o Ѝp`P 0U P LB0P 4   H R|ByB0P/@- Hh@m5C-|1@`d2pPMm 0CPI 0PO 7C0CPVP P0PPЍ2P$ 7C 0CP# 0PQ P1P 0P,0S0PU 0U Py0%U?0040 0S0$8 ⨥0-00,0000 0 0$0000000 000S0PU 0U PH0%U?0040PUP `0 PP PP 6(06 06$0X0\  0 , Ѐ( 0S`0,0IKysi WiHliHutC-@P0,M 00px0嬀P`0PPTPx0P$P-KVJx00Cx0,Ѝ PP 0 `O- 0  DP`0S"a00S40GS (S %SPGP P|1 X 00 0 V (V gЍS8o6^\^O-pMM`P<@P Y" 60S P .`. 00 0`%fUC 0 0 0 f 0R 0/DP  0RPPIPU4E<A 8$(0 8$(Mߍ0,p00 G`P,0S 40S  .$00@0[ Y0 P40S @$P JVeP 40S #<rAPU! 5 00SႱ 30Sw  .KE500|#0iP P P ☹P! 0 U  40"P PEP  P . 2ld0dh|Ph20S& .00@"d0 pP [7o5 婒RYOS6060S %`0fᶖ 8.PVV6 1P00P@00 d00.O%06.`U 6` 5 j`P`0U 0  R, Y [06-F+U" 5 6060S 0606%0 0306  06-SU0S꘠j]^T+^^^ ^,^a^^40GS #S 5S S 00/S S S/O-`0MȐS p( HW5P<@P PP0@PPU[<0V=Ѝt3 04 0 0$00 $0 Pc H?@34`,0  `H0,0DjPU 20S  .p"p0u `@(0 0(0000@0@00 A0BA U0X 0 0S0W<002101@0` 0(00XPP00 YGV P b`0,`20 Y3P 5`(0  ``0(00 00@⠟0a@0A` 5 B`(44( :00b'000Y0``H QW |1 000|1 000H@P4T$0 P4T$HN>j]ٺ^TA-0 p003A0AS@``|PE%DP 0  P` Ѝ@-P"H0 0$(0,000 QX 40" V@  Q- 00C?ot20 p$0( pp,p.1帀 0P2 PRP  0 R 0@ NV Q 00z 0S Dp0 0  0p0S0 000 S00 00 @0 @ Gꨟ+^Tk]^^^^ ^^p^|^^^R^f]8o  ,0oG-0P8M ` . 0 0!8Ѝ` R008ЍGI 03 Xㅺxq@ `P @T X8ЍG診T 5.` [ 00 {P0`` 00``0@0@0S `p.` `90 pY 0h |1` 000H @a{<0 $ ^0o^k]^Mb/I8op@-@D 6PPp@ p@]8oO-@Mp`,PP- 0S # Ro @` .pp0.   0"a[X XC P~20S "P,:/ 00$ 0( 0  0R p0=P pp 0R2P FLA 8$(0 8$(,mЍ0S00S x10S .@uX!h@0XaT!XP10    0R  0<P p 0RP F 2| R 50 00Sa  l00S .@2pXl005 `FLX, @0W`0 00`꘠k]^ ^+^T!^^^?^-/1 -$01019/f]/-/-/-$M840, (  0.$Ѝ0S@:00 1  @P0# 21 2$0 040p0p 80B@P0P 0Q0[0S$0`%P # 2!1 2LЍ YP @1@ 0O-`@p\DM!t! 0  0,p(`$  @PRb 0!(! 0  40,p(`$  @P=b 04 0! 0   8 0,p(`$ P#b 0!| 0 t   8 4@0,p(`$ P b  8\ DЍ^t^nQ0 7/,0@ 3jl (0lLpA0 0,00 <0*c^IA-@( 0  R    RA~ ` p  P ,]@[  [Li0 8/,0@ (0LP0 5/(0LP0 A/l]^7@-@(0HPކ 05/0<0(0LPӆ0 5/040 Ѝ07@-(0$ -  @ Q 4 Ѝ0HP岆 05/(0HP媆0 5/04 0R408 Sps@-,0@9!;0(0LP准 05/}_(0H`~0 6/0S5#PU 0S , P(0L`i0 ;6/Ѝpp@-,0@7 6/(0LP60 5/?Rd(0L`+ <6/(0H`# 06/(0L`0 006/t0 (0LP 15/(0HP 05/(0LP0 05/(0LP x15/(0HP 05/(0LP0 05/(0LP 15/(0LP: 5/(0LP0 S (0LP 05/(0HP 05/0<0(0LP 05/,0 w$p]\p]tp] p]@  WW Pp Ws@-@(0LP9 5/@P(0H`0 6/0 6PUЍp:A- 0pP(@@pD0(0 `He 08/(0H] 08/0@00@0(0HpP 0 7/0  D00D00@0Ѝ D #D  I 0 D00; (0H`3 06/ D0, R0  R1  R6  R6, 0D00@0 R  R6  R6060D0(0H` 0 6/0 D0< D0 +D00D060D0600A- 0`@(P@`D0(0 pH~ 08/(0H~ 08/0@00@0(0H`~ 0 6/  D03D0 ' D0 0 0D0(0H`~ 06/(0H`~ 06/0 0 D066D0 D00D0Ѝ0A- 0pP(@@pD0(0 `H~ 08/(0H~ 08/0@00@0(0Hpy~0 7/0  D00D00@0Ѝ D #D  A 0 D006 (0L`\~ 06/(0H`T~ 06/(0L`L~ 06/D0?, R R  R0 0D00@0 R0D0D066D0 YD00D0 0 00 0A-@40$003/,0 < S`P^(0L` ~0 6/(0LP~ <5/(0LP}IIIIS8  0"S4 ЍpS  0"S (0HPy{ 05/(0LPq{0 ;5/$03 (0H`c{ 06/0V>00(0L`W{ 06/!S  0"Sxp@-PP p]G-PV{p@`@嫰  C<0

^7@-P B@ 0R IIlI,I 0"S 0"S (0HPq 05/(0LPq0 ;5/ Ѝ0$03  0"SpSp@-P0@ P@~U0 0pop@-@X0S L2P0@` P$P(P,00PlP00@@p@$4Iop@-$0S 8]@0PW 0 R00 p@i^ooA-@ 0S p`@P@UTx P T 0R:$ $0Rp@Pp@@p0<0 0S 0 0 ` 0$00$0Noo@-@D0 000(S   0$00C$0@5op@-PPL@T  0R 00 0 #Tp03/o 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dp@-4@P0 P0  " poIp@- 0P@48<0 00 ` 000@ 0@0 0 ,0 0@0,00000003/ 0pP(` 00 p@ o)^A-@pP 0`R00 00C 0 0p0 0 00 00S PPB0p 0@@@z #AX 0 )o@- 0 8 00 00 D 5 0 Ѝ^oA-p0S@`@ ʞPP D kX T @P  0@@4 0@`o@- 0@ @0@ ўo@-04 4@ 0 , 0$  00Ѝo^A-hp0S@ @`LPP @ q@P 0@0 @Po@- 0S 媤@@֘^op@-P`@U@p 0RiP PE @-N Ѝ/ 0p P/P ///$0\1(0`10@1/@-T 0S 0S 0S 00 @0 4/Ѝp(00S @- 3//p0p@-LP@0 S   R 2/$0Sp p@/pA-P`P 0003/Dq@p0 R @T>o$0Aobps]4\1 A-@P0QP0000`` 06/#P`p0 400U000E0P00 /XJp@-P$o0@ n   p^p@-P@`U000000ޝp@p@-P@ ``"UPEPA0@00 00 0S p@^O7_^^:^|p@- @l!`P^0LS  1S P 0 p@ 0/pppD+A- @!pP`p^0AS1S  0p 0A/D+C-pp@` @`!(^PP 0S48 ЍS C0QU? @T8 0ll10А p1@0娙P@ YZ0810<1K<@10D1=`1\1*0 00003/PY 0 R 0YO000000 00 0D+ JJ+p@- @!P`.^\ p@8\  1S P 0 p@0/pppD+p@- @!P`^\ p@8\  1S P 0 p@40/pppD+A-P`0`%@ Lp]0S 01S 0S  AD+L@- @<!]0S, S c0PD+^^A-`Ppm0UP @RE0PDP0s$=040000U0 40S R p R@0X 4/#P P A[000 A#^E^j^^p JA-`PpLm0PЍ@qU00004P&Q !R P000U00000SL0 H0 0S800 `8/#P  ЍAc^^^ JpA-`Ppl0崢P@Q奡 P 壢P0s圢040000U R00000 P #&P000 Aq#^E^j^^k 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dA-@0 A`!(\00QU0X<000hp 0`0h   8/`P 00h  P 5/0P00VP 0<00QHD+QA-Iq@PT`B 1Q@ 0S= 0 8 n40S0400O 0 ]%0Pp 0 R   8/0 B00@ 0 03/  Ѝp^A-Pk`@Pp0S`V̙x P @-@0   00@A-pQ0@`P VP0QeP `O-Q`4Mz1@PT`0r P; 0   (@ g0@000,  ( @$0 4/`PR$00(0 0,0 0 @ 0pSB P 0  03/`/0@ 0000:/p0 0 0PR  T 1@40pS  0 8/04@`4Ѝ `O-pRM@P8h\ 0U40S0000 Ѝ\0 0p ЍOD AT Z0  4p0 ЍOj0p $0 ;/p0  pp D+TW@0@-MP@gx0S  8P@P  圛Ѝ0 ^@-P 00 0  / ЍW P/ 0/A-pW0@(`$$0PV`T6/UUs@-@g40S PU * R >+*R T R 0(0Ѝp@/0 R ` 6/@TЍp0@D( 02/A-P`pgu@ UF01SD  |40S 00Su0 00P4P00 0000S  R h R  A@@ 04/#P  p J@-@2g4QT T@0 R@ /P/p@-0@SP` 0P`4 R   p03/P p 0R  4Q000//?o2\0S//Q1S ///40S0/qA-P,@`p400S0T0S0 @QpW 40`S@ 0< 0 00i0@S @  @.^@-@f40ST   @@iB,A- @!PvV`f0S8 S 0AT 0S 0S p`003/0S 03/0 R   2/8000S 0  2/ 00 0D+pp@-8P@0S0T0pP00p0 0$/0p0 0 0$0/0pp@-PfPS`Pp; S 0 0//qQ/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0`(0, 06/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q" 0Q0 .0 /<AQ.Jh.J.Jh.Jh.J.J.J0 .0!0 .00 .00 .0/5Q0 .0!//A-3A@Q/J/J0AS/h0 S l00AҒ!lTX 0 AQ   R 5` R  R  d    BQ / d /O-p<0@@`PM  d03 8/,,0 0 0S<0@  d03 ЍO/P`]PEUd5J5J5Jl6Jl6Jl6J5J(6J46J4J4J4J4J4J4J4J4J4J4J4J<6J0 S묀80S0C0 <00<0\ d0P22,c R0 A S:0Q0a BQ0000가W  .0 S 000V ?o2W0SE <0!0!SH<00<00P0S.01؀0.01SXEXQ<0 d 1`Q A02 ";/0 Wd0#0@000;/0 d2!cR0<00~!03/8Ѝs]_^0S 0S Ҡ /0 A Rh0 S l0Ց#"l /0 S 0;Qh0 $Q  /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 \0 R\ 0Q Q Q/ @-@'0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@O6Q 0A R4p7A,Q;J d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00Z R 0PD05/`P  oZD0d 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M:?SF@0C4SBGJHJHJHJIJEJEJ0IJTIJEJFJFJIJIJEJEJLJJEJEJJJJJEJEJEJJJEJHKJEJEJEJEJEJEJEJEJKJKJEJTIJKJFJEJEJEJ\FJ,LJNJEJEJEJxOJEJNJt*SS h*S \*SU  SW $Ѝ@*S 88$ЍC$*S ! BS;  SPl`h0S! AP)S7 l$ЍC7Pl`h0S, .PPl`h0S, ]PPl`h0S! RPl$ЍCl$ЍC37 l$ЍCAl0S 8M0 hx؈Q \PQ S00 P #  820 tl0d S031R`SP101cQ2 `"6/Dd 0`2"6/]l 0TR 3CQ0C` 0C0R 0S 0d00 00CRE0C0d0@XT0 0l0C0CQ3S  `0 S d031bl0CQ3S   #l 0R 3R0C0C0<00<0l0 S0C BR 0l0<S03 T X BS `0 S 00S0 d023p <R 3S0!0C0 S0! Cl R 3T`XP00CS10@!0EL\TX0T`XPwd 0l1RcP3PP11`Q2 `"6/d D02!e`!1NlQ3$ЍCPlQ3$ЍCld 0Q3D32`S0!2P"5/0S \0Q0C0 S S0 l0 S03S{P0Cl0S @qwl0 S0C BR 0gl0S Sb \$ЍC&X\ 0X HPLPphl@P@0 0`` 09/P@ `` 0` `  0` 00 ``009/P0@0 070S)S)NJHNJNJNJPNJXNJNJ`NJQhNJNJpNJxNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJNJCQ P^40@0D0HPLPpPPPPPPPPPC$P(pC pl0S0D!0 0 G  8Vl0S S S< 0T 0C 0 S S     l0 p S03S0!R 0CQccPv< T0X000(J?u&p$c>^l?p$?^G_7^^^^^^^^^^^p@-PUpU- @\W0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0^ ^A-@P` 0!0`3/Vp4`e%n 0!0p3/ WHt]p@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@u]v]; S 20/ <8#8SA3=8#8SA@At210/>08#8SH2AAP00/<1 >8#8 S2A0A`01Q%0CQ 0CQ 0Q1 /A+AQSJSJSJSJSJ1111111 t1Q 0CQAA QTJTJTJUJTJTJTJTJXSJTJTJ>08#8 SAA QTJTJTJTJTJTJUJTJTJTJTJTJTJ0000/000000000}00y|0|0ut0t0q@rw]/ ^^^^^^^"^&^,^2^7^<^A^F^K^P^U^Z^^^b^f^j^n^r^v^P 0S -S"0A(0,D R!#(,0/0A-@M(00 00p@P A<00,p$  `< >0PL  D    p A ,(p$00 0< *@Ѝ^̣&^<0S/@-@0@OSA-@ S  ppՎlP`pP   03/@NT@ @AX x]6^G 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dp@-@P`Pp@@0S/p@-P @ 00 R PD  7t@ 0P 4p̣VJ@0S/@-@@"t0@04@ O-D0Z S(@3?:pPa0 S.  S`lc`Fv @ \V`@ 0  >0@0000@X Q@ T`` 0 @)`@X J#@0 800@P  Q Q @ . @@a0D8#8S @DH$H 0D8#8S00T0S; S Q< S 0T0+ 0}@0S0+ 0Ap Tn 0S c0C S@0@ 0; 0c; S( 0 @0D8#8 T:S00@2T@ 30D8#8S@DH$H8T@ /T@ 0@H$H 01AyAv01 $'*@-@(0S2 $0S 0S, P`p40 CS4 ,0 0, !; S  Ѝ0 0 3/Q Q 0 0 %04,0 DrУ 0!< 04 0 (   !/@`d RP RP //A-PsSx0UTPS@UTp W `W` 0 `U`RT0 0@/l00p3/`PTPTpU@ #S qS ^^\ P/0 !8 00 (  , !/@`dp@-@0Sp@{0PS 0p Sd :!.T0S` 0Sh0T0=`!Mb@-MPRX0@S `..x0S 0$ P`V% 00S" 0p0CS00 00P < p00` P RHh<U@R0 EЍDr^^Lx]Q @-噈/^p@-`P0@  `Pa0(0pDrgJgJ8pJp@-P@PPP[(PpDr@-Mp`PtR0@S 00S.VD0S$  hPP7TP0S1 S P0 0!! !1Ѝ@).h0U h0TPP 00`SPU0P00 0P R څЍMb^p@-@;:S0P0S/ 00S/x]@-Q xJxJyJyJ8yJ<00000000000000000C-0S@P`p 0 RB"@TP`p000P@/ "`Vp`WS0CUEFQ 0C2? 200 4 0NoX9 X6^3 AoP ` V >  P = P Q ΁ Ƞ,Ƞ\ @@dPTlLoV  \Qڰ 8嵅A; @ T P !^p@-0@SP S`奿 `僿 < Rp؜0000 0O-,M @p P@DQa|ܡt%,Ѝ0PU Th PUa 00@  0^LAoY YPQ, ` 00V@D"* + R,= R Q . ("(R  \ `* Bo[  RQڰ  #" T q^G^p@-Pl@PTp003/\@@-p@-Pl@Tp003/PP\@@-@P@G-(`pPPl@TUЍ0Z 0 :/PP\@p@-<0@0QP`?o2CP@Dpt (00 1PP D/tH,  ,001PP //t<0 60$ 0 1PP /t/@-P`xH@fDp0lpp000 P$⫂0@@0 P0tp0 Ѝ^xp@-PP@0S `H`0Pp0pt^@-PP 0XP\0p0@`0\0p0T0SPQ 003/P 0\ X0`0R`0p0`0\ Ѝ00S 3/`t0S 0` p0t 7/Wp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HO3PV *>C 0CV #PV V >C 0CV t300 P0ST0S g lpWX` 03V0t0 3VV3V! 6C0CVP 0VlPUe 0 0RnN0Pi2V`lPpU``PP xrxxRctVʀ 0! # 0   , !0 00 0 0!c!0   , !$Ѝ0S S S$ЍOvPU X0SP0S0 QX0S$ЍO$ЍO\P Vp 0`00'N\PP $ЍOtP R 00S0<0_P 0 0qW dPP0S 0010S0  0;/P\p2vt|fW~fdWcW@`d$ 0tp@-@` F@sPP@ @ @@p`V X0S P0S@0`4$G-`QT@T` PM PlpWXPVM@ M 8ނ00S 3/PP\p^^@-@MTT0 TQ S S @Q @-咃/^p@-@PX=PpYMP =P X0SP0Sp@p^ 0`( "4`#/R/`0  B"11P/  R  ,(0 0//C-Pp@(`V Ѝ 0䐕9/@C-P@pW Ѝ 0䐕9/`p0S@`A-pl `R$:Pp@Q:AQ  A8/ 0| 00CS%p0 C0 BR%0P&<019P*Ѝ0 PA-`l PR :pp@Q: BR B8/ 0 l00C0C%\c&PQ9`P*Ѝ0 `RQ\ Q @-:#:^:\:0/y]A-Pp`@@0@Dp@0@L$<#@`W F0pG`@A-PlL0pLALA$ `@`W yF0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh !$ X F!Y P0!`pW:X  QY Q  G 0Py]S/G-`@ P p #$Y@PW E0S  qG00pG@PR/G-PQ`0Fh pY@p`V8h LG0S h EG@pG-Pl @R`T  V Pp`#801U !0S  !G0`0PEp pV h p`G-@ `p,Ƞ 0P !VP`W 0S  F0`0pGPp@-@P,P"$R@0S000SR@0S000R0@@ R@@ S0 00p 0A-`T0@Pp 13/UT0LpP` 0T01A/0T0A-@p`0S  ePf p A e Q0000000P蔩QO-P`p@@DT 0 8p0 SX Ѝ0 #p0XC-RP`p(@@DT00  0 00 0 X ЍQO-P`p@@DT 0 p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/@`dO-`T)@sWʀ0!()0 ))   !0@S0VP`P0 040$d0@04 00$00 , 0 4 00CS||` ЍTld40, PR@0 0  ˰P  Z N \  @ ^0STPX0 000V`0 S ``00ZddS`0``` `uL 0dr l0Lp1˱hPL|00 10000000 P 0 T 000! PYhPQePP LPEd 00C0S% 0R0P0PC!0E+0 0RS0C2x05A05t0x50t50p50l50h51101YL%0 Y1* Y  $TR?  =BGSA S S @<Π` P" AP QY  0S,0a#0A13!8#<4("(R 8L $(!#8"(PE  ᾐḐ ḐP \ [꾐 ᾐḐ Ḑ吒01 `@3 90  BQ RZ    0S{ bLx@D}m( eCh@`p09Kl8!0 IYR TP    Bτ000000000000PTP  Bτ00|00x00`00\00d0@`dy]^TJTJJJJJ$J R0T0: @($ ,0S XYZ0H00h j0ha0I0 0i 0$ 0Jp EX[\ΠY\\ˠˠZ ]`\ˠàU U RT  U $PȠ,̠ TȠ T , (0[, (0 }]*^C^[^^UUUU z] ̠ S /0QT0   R: ,0 30,#1 #2 R0/ R,#@-*B/ z]O-@P L0`!P!U1 P Q0"0!`V800#0Q00P0qpP b0C  2 `V8 0x  "  Sw  " 0S  A0P0   }]]]S/O-`4M@AX0 RP0_! @ S 0P p j@p4Ѝ W LD  @ @J$̠̌$DL ^@ @$$DL0 DH @ @,  ,Ġ 0 @ Ġ  , @$@P@0 P( !   (! k   R  D   R W@TqȁSp p p@PH0@T @BpGBQ  !$ !(   d   Br r  R5 ""$, $""$,  Q Q ! ̀!1! ̀!    "  " ( E\e  RQ  RH N ,, ,,Ġ  ̠$̌(    PZ j ,  ,Ġ 0)̠  ̌) "Ġ "$ ,< $(, ))$ , H,X ? "   R $ r@ 0 pPU>T $(  $"  "$,  $(  2 ""$,,m[  |$ k    , $ (,Ġ,  @ğ A@@S0Q  ! !  @P B  Br m  Rp M " "$, *"̠ Ġ "$, Q Z pj ,  ,Ġ 0w'̠̌'t| "Ġ "$ ,<{Y'$,' ^ "Ÿ  Qpp A   a$  Rc P 5 p' Ġ 't |,|  |,Ġ  \Q a !|$|(!pp7̠, $ (,Ġ x   "  R  m? 0 @PUp[  ! ! k   , $ (,Ġ,   Q, $ (,Ġ !"̠̌"$,   ,, , $( ,Ġ$ 2 "̠ Ġ "$,     i}]]]O-P`pVA101!00 `#8010 S$1@"pW* Ѝ 0"00#0 R00`00Y b@D Z Y B? !1pW:Y  ! !QZ ! !Q  > `A}]]]O-@P,M@PpWwC^s*P`! !"PV`PP "( !P ", ! S Z $p0~' 0p RhʈS:0 02 $0Y4:0!448#844p R20!!Ġ000 0S0`0P 0"00#0 R00`0PY*P0 0t 0c PRx `R ,Ѝ裯( 0:0 B0c 0!00#0Qa0 !    R h@P"    S0 "q!d0p0cR2 $00 1 0YX:0!448#844pq Ϡ( 0<P!̠ !P_q w0s00 #!0SJq   !0S  =0 `0PY*P0\ 0txp0cPQ`0WO 0PE0s00 #!0SQq   !0S 0`F Z= pG 壯(  0: \ !Ġ ! Ϡ( 0< P! ̀0048!0000S  =0 `0P3}]]]00 00000100/ᘱJئJhJ8JO-@MP8@PpW2C\.*P`!"PV`P)( !p), ! S( p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  <0 `0P[:00!448#844pQ 0S  <0 `0Pό\00PE0 S 0S 0 `Fx<pGO-@P,M@PY C\*P`!"PV`PP p S"!  P )", * 0$ )(2 *    0  0 XS:0 0>R0S   <0`0PX=:0 ^0$ ^0!  n0##C$Y00cR#\0$00;+Z0K0c[3];$; [ "BX  bQ;0@ 0P0S  ;0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `F;H z]T00  ,0X00500\00/J,JO-@PM@PpWeC\a*P`!"PV`P8  S"( !y8 0p", !)$p (|'"ኰ0X0:0 pS0S  b;0`0P0 !448#844p Q0S  D;0`0PX*80 0txp0cPQ`WЍ P00PE0S 0S 0 `F;pG O-@P4M@PY C^*P`!"PV`PX p S"!)ᇨ X *ᇐ", + 0$ )(2     0  00 $0XT:$00 (0>S0S  :0`0PX=:0 ^0$ ^0!  n0##C$Y0 0cR#\0,00;+Z0K0c[3];,; [ "BX  bQ;0@(0P0S  }:0`0PX0 0t x0c PpR`X4Ѝ0PE0 R 0S 0 `FX:H z]X0S  0R   Y  Z0X0[ 50 0\00/pJJ,00S/  R 0trA-`P/V0@P0# (&( : ` p $ :0$p6P`6 H0`000  @@tr"/p@-P$0@Tp5/@tr\0P/ L  \/-  , "  trA-p`^@ PP@@@ @S PU$R : ^V WQ 8P@^T0  NR@D@D\'LD@D BR@D@D\ @!N N'O-`pP`08@T U00400 Ѝ 0 VP`@trp@-P` 0@Tp 5/@tr@-P0P0P`@P , 0< 0 00 20ЍptrO-^́́%^p@-@PYj p@D^O-0pM0 0! @@0P 1S 0\`@ 0Y":0S0  H j0P R`0 R SPSP2/`0S0S-  R*  (0\0"@0@/?^0 0 C)@C)0c"<3bP 00@@ 0S@P 0SЍ 3/0@-0MP0@ 00P!0000(0$ P$0S S Ѝ0.00(0P(0"0 B (0 ->^O-@ $P0`0( ԡԑp00[ :(0$Pp0`0S000.V"R/ p R&R%@J0JHJJhJJJJJJJJJJJJJ ` pW40( 00$00C$0 Ѝ R Qi"  `PE  p PEp`V. `0` `` ` `  1 P  \^->^́́0Sp@-P` U U@ T8P  @ 88P0 <0p/p^^w^0-  ^]R  Q 4 R  Ă\?   //ᘻO-pP`088UV@6 0 .Rv ;RP@*YC0S@ 21S@@S@TS S# S@0pPEV  0`;P?T ;T@ '  Ѝ QCM? @ R \?@F? @H$H@pPE00C Q@4$0@DWP pV@D  0p` 0P@P A0@S 0S a0DS @DH$H@DX W@;@T@꘻(]O-8P@Up=0`P40a040,($@@ @\<Ѝ^^@- / Ѝ@-0 R  @ @b `@ /ЍЀp@-P@000 0(0/0 0 !""##$$)0/0 pG-@ MP /`Ё_[@ a/P0 0$(` b3r~ B1|(Q \fFp Ѝ$0 QL\L! B"0?:pP \f0 000S \0 fbH _L0H 0P0001@00kX0S= 07  R4 0# b00p?   P ro8 #61S0SS$ 0S 0p=P0H @R000@0@y00  WSX000L000)u0L N=r^^^^sh] ]xs|sP P /ꜻ'p@- PN@P`0S yvDJ U@E000:0pp@-` MR@@P.0  `$!1/@P00 08SE@F@ Ѝp7@-P 0 dG@PJ@P E00 Ѝ0s@-P@,`(` 0ЍpA-0p0000,C R#C` @0PPj" (,f.cP` T`$ ` 0RW00Ѝ0 0`O-@0qM@ 0 @00@ `PDZJ@@0"v$@WT`0`( UP? 1-20 0p`0000; 0 !?@P0 0@0V4P 0R R 0S700V hh - 0$ kp (00(01 10 10:0 0= 0;(0 0$0P p``P $ 0C` #0000?p@Ps0 0B\p0P00ãp000p /000LI Xp 00p0 0SEWH 0`0AX  3 @ 3POo t@B3P) T+  p@$@`-0(` (UP @HV``dWpp`P 00d[:^0X0@W t@qߍ@P |V wW r[ X00@edAn,^^L^P^T^cC-`RM sR P Y@ p t @@ p Pf 1  1@P0S D@Ѝ0h3PC@<I< 00P 0&000=\@P0& S@PJV0 y@HT S9VC4V 0000 &0S 0 0R\VC@@]0@-0|MS00P@ ||@Pt C|Ѝ0 0t@+@P 10(,ҁX^^0 R< r9 rq4 $ rq/0 r, rq' r$x r!| r r r8< rqHL rq r "sr 00 CSR-/-//O-@4M0S 0S-p圀L Q00 000S("P a 0SL RS R H0A0 0iP 4Ѝ  `1 .$P 0P`E\#Q\0V`!L^QƯQ ` @, `<P(%  $(P$PP 0 00PEU` . Z0SV  JA-0Mp(`X0S @ЍP 0 $ `30 @<121 @)@)`"30#@P$ 00$ 0/0 ϠQ01!:0 00R0  Rp%*0 &^@p0 P T 0 E^tpT  .L0@ 2^0 0C0000 00C0[xC-@`P800CSʺ0 V0  =# C!) R%0P 0S = C!P0S c> Pc>O-P04M,P000QP4(`$00宜?P0P,TR PH6p@W\vp 00#20ᙜp0\`60X60 @&D6 , !PP  ᝜4ЍL0]$00$ $/ S X0S+B.0]% 0 ,P ,0000 P, 00Z 0  00/ 0  Z _R QsW,P he> 0X& 0 00 P 0B0 0 S0  0 0 0 X0B S 0  `* S*0S0 (<80 40 4$ 0C  ?o  20  *0 ! ;-4S S *00X0SP .0-400, ( 0`60A00ph->^P0P 00\/@-01"\A@P |D]0@-PQ0SU L0R @@T00APES Q T 3=?000QS^T ?6?0000-A\\^CQ Ӂ0ѳ 0ҁQ/0G-@0P00pU5` q 0R  (: {>C 0C"4 W0  !1 /@+b! T l0<#\0r#0u0ppЍ0T00W0;k_kų@-P @ 0 Ѝp`00 0020050 0{2?0   P 0 pPd/0ꀖ0@-0S00R0100 P PP0 S .0t@00 S 0R010\0000S*@R@@A@] G-P`0A S0 00.SR0 .QR 0@0S Z@00V@@Ѝ \.\ 0Bp@ X .X2Q^ZR@\0= QLB@0 A SR!R@L0 㸑L\  S Rp*\@S_0 0S00TQ VQpX T@^0C@ 0 \0C R.R @ X R "  pW T@R0C@0 .)0g W1 `V00C R 0H aSc~00Wm*00p  V[]C-@PM0Q s.R R 0E $2S ZA p a0 0 2`P 0P 庁&  &  &Y@PPĥߍC-PM@@B `ZSX `ߍ p /W0@ pG W t& p& 0k& 0PTpEP0 @P T@o P XU RQ@AOoB$RQ !QU@ 0?PPET ]O-`@?00CSLMpLЍ@0 pP0R &  & & 0 /Q 0S*p0 PS 0 C  '?0 \QX A \B 0  ("(R ! @ BP$ % \Q,? Q, ? 0S @\0 S/  @-0Qs.\ \ R 0 #@aAON/000S/ 00/0M000Ѝ/ 0P @/0P0 @-@tPt`t0 0x0 @`@OP0 00 @`@}O( Ѝp@Zs^^]/@-@iSgS@Os@-Q|L =ЍA-@ MP %0`S rBL S?xP@x $ !08` 00$0$0 0040X& 0L00!s0X0P0"L0X0\00M0400X0S\  0Pld 02\0N00$  0 pP tR Ѝp @$0 H0 0I0 0J0 0L0 0M062.*&"pX$0\0800sX08X0 L000 ;X0@0000H0H @0p0P`< 0280@[s!!u ]^ 0Q0lA-` @ P80 rGLppF\\:k]pd LE01p `0S7:0 00P 0 \-Ѝ\` 0\P20 00H0 C2 000\0 >0>00C000\ c2ЍA^O-@L8`P04Mp ( 0s $ @3[P4Ѝ0 ;2\0S* Pp0G0d0W80H0\X0Xp(00$0h $ [p[ $ld0 LT0C)@Ì @)0`,$"<3nPP,0p 0 B [#0, 8 [0 000H 0\pB1P9$ r 00(0Pd0 23h0$0l0(Q 00#0  $0H;PP 5 AH0 C2 000 0 ^p@-@PL P k:0 0`_l`婠Pps@-P`]@P■N@P0 000 001 0!00Ѝpsxu@-P6L@P4oЍ ygXPxuhuxtp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0z@0 0C?o20p@@-D@<gP$(FЍ0 0!xuhuA-0Px0 0՟lb@\`FT 0S <Ѝ pO@xuhuG-P|@xp*D0"HC \ ! `.V xy*x 0 u-   1 `00C`0`0  0`0 1 /@- \" Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0Ts,M 00P 8@0000,ЍXPQ'L00 d0\PV l 0CP 230X l0CL30V00R d0\Ap0Y0VRp0 00 00 0IS0'0 00h00 r 0 R:0#0n P X0 ld C@T   V0&q000 0SPP\0S* P 02)00$0 0 S P 0 l $0 B$"FPd0$  S:P W00sQ "" 000000 V P 0l0Ch0bu h00\ %S/G-@PP`M/ `0S 0"!030\.000pl 02 B"0$0Ppp`0 00z#!0 {0!0 080:>r0"\!o0C00D0l $`$0 B"00$ 00 0 0P   &Xp.0Sp(( P XЍ4]$^@^C-R,MHPy\0@Sps: E(000 0 l 0 B$"a`P= 0000s7;0@S  R # ! 0Q( q. *BQ00* 00 0 !Ġ !0 00t0 P ,Ѝ 0 0%RP00 200$ $M `@-M`pP0 0 0o@P ЍU 00@-@  11 c0?o0cCQ1! aQ\51:  P0#03Q0#S 1S c0?oAO-@P`4M0pQU4Ѝ{\ 0F0Spἱ弡X 0t0X0SP\0S\` b' 00$0 7(    $ l0$  0C#0}P0Xp P( $ p* P0X   0 (0 0 0 R 000 0"R*X (D0)Ġἒ 00' 0),0( 0# 0 ,0} 00O-PQ@p`$M @R H0`00>0CU\  9T'0[*0 [3:X& H0Y 0 0`  " B r  /oA  W0 H0`00 $ЍX11   " B r  /oK W0H0 0`0X1 1 mNA0A-P@aq(M00T\0S *Q  (Ѝ d&00 0 90S Q  z    l0$  0C#0vPK0S s& S000R0 @ 0:0 20#400@000<@00 0000%@0 02$00$}0C-@$M0\ S:0`,q`0\0PS *U? : 0 %xQ&UQ 000s(0S `U yP 0 P   l0$  0CP#0P $ЍO-X M@Rp@8`L0P1 R hhhq Rh0p0l0t0WP l  l  0PP ЍX00Ql 0jPP0[pG00X RX0 00l PP h  0C h  00Cl0 L0 0 CS  dT00l0$ BL,p 0C#0P$ 0LXP^uM!Ѝ/O-0lM `00L0p P地$  8@0 ~D@P )0(    CR@lЍ     eP 00S@&GPM@0  / 0.S,R R(0.S%0D00R0 $0ZrLS(0S) u  1D@PX  0B?oQ20S O40p0\P P8 P000 @  j0000($00 C/oQ" R0 00000,0 004 00 <0\0SBH00 ,D0P P P7 @p  80l0TP C)CL@H)0c"$<3PP<0L00H0S,00,0000QQ% S000 0Qr40SJ 40SG  C@P.0J@S00 0000 S 0J2 0 0,0 S00 0S 0 00 0  P>  8P 00S5  \"P/ d"P)08 ,0$0SR0J000 B00 qC0岤 BCL QR ZRPDLw00D 0RP( $0 R S R  u  C@PX  0B?oQ20S@ 0D)X  0B?oQ20S -30p000  0DP @|O-8@LM00 \0R`p:,p Ad01000 0PP 0 \LЍd \002\0d800000@ PP0l@000)ASh0   )0a AD48"03$SPPhp4 0@00p pH0 0I0 0J0 0L0 0M0 0L0<0\0<0j800s@0 00S 0 $00(00 J0,0, 0[%:04S 0S{ L0 X0r00L S0002 S200<0 0PP0<0 00]h m04S3 d8000@ :P+l@ A)A)0aD48"03$Php4 0 0pp80 0($ 00 0 J0 0 P P pd8P0@ 7Pl@4 A)A)0aD8"03$Ph0  04 0 0 pG [ 04S: | pGPh h+04S# kd0@ 7fPl@ A)A)0aD8"03$CPh0 40000P 0C}O-`p844,M000 4@P @DOoB,Ѝl A)A)0a$"03$ P00P000S pQ @@Q z@  P  P  i PZ^f^A-@pld0Qp CT0AP(`P 2#53Qh50L L)L)0l13p$"PV 0h  0PPPЍ@- 0$ 8 ЍO-8@PP$?Ѝb2P S- d>PP3-^RKC-` MR@pP$  0E@P  0RF@0 @P 00Ѝ'2@P -@-P0MS@P0`pP@   $  0P @P ЍP P /w 'p@- P=`P@$0S h]\$10 S$<$,߈݈000:0pp@-0`P"n@P1@P ,00p7@-@t0P0p00x  0 000 0|0?000000 r 0000 0 1 Ѝ0 P0QP  000\,O-@`p04MP 0 0m1@@0" `>V0$ ( `0#`P |0< $00"$0 S:@@|A  0`P 00`'@P ݀qn0.0ifcD`]0403S]< Z@k 0Hh2Se  CbS_@0S\ |03?SV3S$04SP*2 (/QHDRQD" $(0D00020|0 0s- 2 S*:@ 4(Q,":@ < h< "b"#b#D D D R 2qH0/$04S,. DH0L02#T0T0@@D0b X\ | P!$0S3<@0k.`6&0AL``PT`Q8R 儐0 0  F0S:2YP#|x0f0?o0cl00Fh00f0?o0cd03VSp``` Z눀 `X< l @ B 0 `Pm 0 0`PP` yJPZ DPT >PN{M %0 0R r \R0\ 0 0$pR`P20(010000t010@1100 0 10:0 00 0l0(0d0$0H[4Ѝx(|j00`@ P T P ᴆ00`^^h]^@-0Ms0P@ @PP *0 00 |00 0t@x@`@P Ѝ@P s,ҁX^^C-PRM@Ѝ R `  R@ ptx| @2s|000x00000S0  R0i -@   Y@P 0`P)@0LM.0 @`0&00 02B@I<T )0&. 9@5<T0 U@P@P s. y9<)$ 0R b000 0 y0S 0 $.= 00` 0&000A@;T?0100S8 80 s@P20Sw t)@+]G-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0SЍ(,0 sq 0   0P08< rqHL rq0 000 UP@ 0AP00 8< rq 0 R 8$sr 00 T0V HL0 0L00000 r 0 0 9P,0@AP L000L00000| r 0 0 P,0@AP~| L00 0L0000ЍG20Sk iC-0@p0S M  RP- 0G0P S 80`\pH@X!V0 /P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-@$M0S $Ѝ 0SPp`\ Q00S8. 䑟 P \  0 R0P0 R H0C200 00 0P 000 0 = S[ 0d hpP R b0S"   PESQUP!\ P R0R00P00 Pl A)A)0a"03$} P p00 0CSP1  [0SUO-`$M0S S@ pI pP 8  \000 0 P0S@$Ѝ00S\0S0000@00\00 0?R  -pd0P0 l0  \SQ00C01@ 0<@PW 0 \ \ >0>00S H0A0 0 00 0H0C20000 0@P0S; 0S0\ vT [ i0 00L0 0>000  . 0:@0T003 0 - 0  H00S 0 f@Pn a0I(# 0 C8RP .t000 #8 800#( 0(9P @ [>$ЍOa@8@6^M!Ѝ/A-0 @p0`SP , PW&&G-` P@U&@P pp, @P 0 -0z0@ x&B@s@-@0P000CSH#SR`88 d0l 0C S c10PQ0`P 0##sr$ 000#sr  Ѝp@88l A)A0<)a21 #Ѝp^@-0P@"XiF @804"60(0"$0]F[FЍ^G^+^00\ <00C S0S I`  "` !_K 0 >mO-0dM0$0L0P 0<00S40@ P$08p40!0埁0`0S0000 0#200ᑁ 0022 0$0X0S rsL Sp@T0w0 夂0X@0g0s L0ld0S A A! a,3 1T 0 0 #0X 0000 0,, 0h00SB: PPB0 @S  @   0 R30d l1 \SQ0h p0D0@P80010!@0$0\0HXL00$P0X PP3l\X0 A)A T L)a"31$PPLT L00CS0@08 S  8 T8 000X :0PTD00UQ0 (0< 0,0 0004 0C0$0 \0@T 0S S0 00 00S U   00Ҁ0 00  0ɀdЍQ 0S0  0 0H0fp40 @ J 0J00|K0$00J00K048 ,L0d 0Sl B B b32T 0 0## 0 0 P'   0400S*Tsld 0S B B b3?00 2="0 0 00  P T^ PO 0(00,00S ( ,     0 R TFP70w0000?(@,D000@0(@,0@0(@,0PH.>^->^A-@pM0@P`00 R@@400V T0L0 0L0800"0 VT@`00R l0 W@T @M00N0P Z000Ѝ@-0`P pMX0S, \0R@#8*x 6 P @P.00h@l@ 0!0\0!" 0080H00 080 000  0p 0, u@P  0 000 "Ѝ7@-@Ph6!P ʄ墉 Ѝ080 000 W0C-0@P8`rrd!!L dl Td X0S  0SL L l3<'0#"L0!10P  000 00HpX0000(0""p 0 8080C  0M  00|0L0 8|0080xp000h \0000000 Ѝ 000  0SL  0SL L, l.3 < 2#$ " 0mG-0p` M8P0X0S, \0R@#* 0@Px 1 0PP(0 000 ( l0Bd BT 0C!#p00$?v@ p 0 @ 0] 00e   XrL R:!{0x.ue 2- p8m6j 40r&c`@" X @P0d00t@p0!# 0, $00@P  0 Ѝ<@P ꌟ]C-`0MPP@ PU80 000pH L0C40S@ PP: @ H0 0I00@J00@L00@M00@L0P\pp 800sP  PЍS@- `P@P 0   0L 0 0<03200/2 0wP Ѝpvd 0`( "4`#/p@-@(0Sp0PSP 0S0SpO- @P% @Pd0Sk`Fh &h 00@?o V20S@P XA @P $P 嚼<Ѝ(`< `0P00 x$ $ # P R!$0(@ 0 001 00p @P  `0@T aPI@ PH@P@U ]0@0 0P M0@SI@H@ R B 0` 0d0S $0d 00$0X^KG-M8P Qo<@0, @pc0`0 0o, 0 < 00 0 0 %@P0S000Ѝ$P7@꠆A-PPP Up'U@Q0`ሦ@P` 4 A-0Sp@@P 0`PP`P0 PD⃥00`p@-@004P0 pp@-0`S@㺨@P P0S00 } zwFpG-0`@ `Pp@lT Ѝ 4 P0@ 000`@`@O-0M`@0@PS%  0 1PP刱居008p,080 p[6囅W88p08[8088 ( 08+DžP0 SC&P02#` 05:$0P 0 @ 00 000 00$0000ɪ 0`pC@ 0Sb$0@&S@@T 嶪`㨄0S|`#p!t$$(00Dp0(0#00$ 0uA@P $`?0V0d00!"$ $0( ,Ϡ RQ #Q#0 g@P0  ,"0 00"u巪#0Sz !w0 P U8 0(< , P\I 00$0 `000t0`$0  0`0 0avV8p<$w 000$ 0  !P!$ 0  !P` p($,0X 1# 0  g@PV g!0FT!@@0 R9 P0R 0# 0! 0  1T 8@@8080T#pV@T幩0S 0`|00!!ᴁᡩ0\ R3 0  8@@808&o^,1uO-DM(0h04 800S0`Sp 0S DЍ0地00H83 000  01 0( $Q  0 0\0:Q P @$,0 Q( DЍOF=0 (P Q QN QD'00040000P# 0 P*0S S 1H0C200<00003P  0P0*U00 Q QP QX Zn0SU^&00000 0 0;00@PYP\ 0606P LP0[eUP!00 00:0 @P P\060 %P  ?Z&D00 0( $ R 8S  0Q\ k00P$ B0 Z  Y #ROY*  R$ QKڸ \RA  B00 0( O#80080000070 P 00  *8Sr0RPl #000 PQY I 0 $@R$$ 5 3, 5$  000800<000Y*00 0Rm* $0  $00CR\0X$0000$0)! $0 00 0 0 0$0 n% 00 %$S R0 $0 0 P000PE`10S0|0S8S 00 wP 0 + %0600wP ! +<0S )!  Ay000  P 0 Pm[L\9F$0 0,0SPv$R9sQ, ^O-P $@p 0 P0@@``}<04 @ 04/@P 7 Ӳ^iD^@- 0 0000 0PЍ @-0 000 00 0@Ѝ@-!>000!44 0'ЍO-@Pp`LM$@@T`WpxB7X ߢP0 7 |8/P $P  LЍ  4 ``:/P 7 $P r$` P m `880080`` 0( $;/#PZP|p0 3/Pt0 SLx0S $0x 00$0<^^ 0呢ꄨKp@-@P 6p@ 0`( "4`#/O-P@P 0 5c@P@P] 停00#P P R R 00U>000 C4@0000 08A4/P#P00p  0@P R 0R  CU80000008Aᜐ0 4/@P 2#0D?oU20S 0 #T T0S0S0T3T0S @0 0C0m$Y @ 1 8儀00008A ᜠ0 4/#P@H  P#P@ 0 T0C0d0S @T \ @ZP ڛ0 00 S00  P  ě~60Q &(10(1P/y6@Tz 0S0Y @0 00000x60S: 8h&,061*"S80 < LS0C1001008  0`000d0嘚*0<00L 0  ! 3 0005 000 s 00bR0d`0Y %  P:dd0 00 0`0V@< @:@8,0< 8R, 9981!p`00h0 !0c+@1`10ST0  @U. "1 0`( "4`#/O-p0P03/: R Q# Q3#8#(, PU0 :8*5ߝ0 00 " '51 &0S#<Ѝ8,( ?0(? $0,<80p 0@|0@x X8    08 08  0`Hij]0] ]4t0@-@ P0 M0   0CT D P  0 xЍ00@-PM8  @:84^0 00 " YЍ0@4Ѝ0O-PS,MR 1PpЀT L0HS PHP`0V``Ӕ0VPPaS X\0S P:0`Q\1P`ш0U$ @4 t1$  1$X?P0000U 0P00H0 00000`00X0.181u,Ѝ\0``\0Pp`1 1\X?P0Pt1$  ,U.181t^^Q^y^C-DMP` p ~j <  0$ 00 0@ "400 00 0 f 0|0 0 P0 S 0 wj P sjDЍ0L\ \0? 0 0 90-0 0 0Qj 08p@-D0 @T0_P3<P<#p/tG-@P&q000`P0Y0000Pp"SR \ R3#. q3 +x3 8   088 H@t 0`( "4`#/O-$@ s )0q00s0a@S 0F  `s0F0s0S  0 0@0ssPU, 00ss0,00000(q,06"N눐!0!  *P!X& h! -++:10 0 ឲ4 :P !*!0 0 ፲4 )( 00 40  ++! ^^G- MPp  @` !?3@T Ѝ! !Z @0(020 Q0 R00 00@@hTP0J00PPi $ P0Q\(0 R @0 000tO-@,MP0 T0P`pX ` 0 T00C| S 00   @P` auO @1 RPQK?|0D!0 SA080@``?! H!T1 ,   00400`5000@@&!?{0S0 !?r0 !?j@!?d-Q P@@0S   0R00   R``  @P 0P 00T 0,Ѝtp@-@PWq0 Gp@qO-2MsHqQa0S 00j'}qЍ@āT0S_@qq^ PD 00 0dq0  $" u" S R- [03 H0 $0X\ RP(0` R  X000 R 000p 040 0 '@0HL RP0P R 00 !/ ;&vvQp@-@ @Q-G<0@$0@0$0pPPp$@pTp<0$0$$@p@-Q@PP @Q G@ppD 0$ 0S (0, 0@@pD 0$ 0S (00, @@A-P`Pgtp@T 0S p4` 00S0C04%0S00  0S00@)Ap%@ꌼv@-@ ;p@%v^@-T@0S 6p00]&,~%0Sjp $p@s%vvA-p1MC0S S@"L1H1H0 4Q4"gp R100 0 ]@P 5pЍ̀PU!@0@0` PX0 h00|400%%0@0P`T%4p@0SP000P]<]v^8K^v- $\/p@-@PP00SL0 D)U|  _!p@$f3^d]A-@P`p㲗W0 A:(Op0@-@P0M 0 @0P@wh0 `0 @0P@m0D 0@0<@@<P (P+Ѝ0^v^wK^w^@-@P N @;vA-P`p @@V0L0L000唀@0 0L 0h,hd`dPTPS.33 0&5L 0 v8wt]7@-P0 @P  @P000  Ѝ0@-@p0PS` H`HV 00|03 8 6008o<080S 0S  V 0 ; Ѝvp@-P@ 0S  0S  0 @QLk\PP Y P U 0S0n-p蘕wv 0`( "4`#/7@-@00Pnn000U  Ѝ0@ Ѝ0nA-$PU0@$0M1  Mn` pv1SnA赣k$i$#@-P 0`S4 Rt13U @ @Ѝp $`V@ 0@ 坐 ! 00\4A4/@P& U& 7T 0S 0 0 0U>0( T 0@(T @0 0 DR23200   (T @7T0S   ( ^'^O-@Mpᡌ,4@P0S0㭌0@0\<`3IW00 Q, 3Q00 3`0 0'00C0@@0SPD0@H0`2 |#101Ѝd#0 00P30 04008300P0@0 00  O|Z @G[ @ R 0 P 20 030000 3SH0L RP \0 0@`0 ,00 B R  R@0 00  `H0GS4KKK KK40u400 3SH L0SP0\ 0 Ë0`@0<  0CS0$000 $ `L430W0D 0 3SH L0SP0\ 0 㔋0`@0<  0CS0W00p + ? `ĕ@-8@*P(0, 0(00 , @xؕ7@-@ Hl d \P\00P0 D00(0 ,00p0 Ѝ0xLM_o^;^G^@-4@HdlP(p@x0/xp@-PH@Wl00p@lx@-Q0   0P0"3 fa 0ЍA0C-P4 $0# @ 0@P {0  000000) 0@P p2"1П@P 00' n9@  1 4W?o20S 4 k@P 1011 Q 0@4Qq 0A  101(0S+p@x tT@1eeO∀@ 2@P1@010@00&@1:\@LHD@X@T@P@d0`@h@<ЍS p@x tT@1@eKN∀ @(0S b'  000000t U0 R00Htp@ሀ@M@ؕR^O-@PM1 pЍa封少 ᬡ  pP4aSUʀ 0! #l!0 d!\!   !@k0S6(:k 0!!S0    !wW' 00p 00P 00"8 0/P 00 \= R (@- 0puؕ@`dxx`^G-`@PC22 0<0:t0p0x0000|0 08l0@00X 00RPPl4 0 (00,0'S0 c0?o0c$0 0(0(0SP :000 0PPK0T`M"p0  0S    0 O M `0S00000=\0 `p0p 3 6B PP c W  o v z6z(ꈼv^}^^^ؕ^G-PR M 0GS `2 V Q 40p @P00  Ѝ00(0@ 0,0000t0 0p0$0x0(080,0<000040|0<80l0D@0H000SK@0LJ@pt〃 VT  7<$(, 0 00@SE@5M t@P6Z+MY `0@P)Z `ZMY p0D@PZ `000锛@P 0 00 pp@MM Mv@t@r@-1Mc1Pe1 <R00< !0 0BP@P BЍ<( 8'(00!    u@P  0`0X0 0(0@P (W( (plJ0 @ Al"(@T @n@,ҁtG_M_^^^^ 0`( "4`#/@-0$ (0S\ 0 B @B2 b41>" 0S& p@-`0 CSR!0@P P  0 P  0 0# Pp 0&p pG-p0M0`0@8 ;8PPh "\D00D0D  0<U@ (v 8PPP# #RH LQ\P AQL0S0P0\ 0  0CS?tU3, BU1L (PP00 00 0$01  3PP Q 0 0 0,,cPPJ =x0Ѝ(0000(0( 00000#0 EQ QE!(L #RH L0SP0\ 0 Nt(0000(0 <  0CS00S( 0 00 0 L0,00S00  R,0 U^O-00)@P|0\0|0 D lM00圀 p ,0@@jU`< 8  " QRHLP\P@@ @D[L0S0P0\00C Ss[ A[L ,<.@P wP<0000<,0<,0 00 0,0r0K! !B(L< 8@@@ QHL\ࠃP\ NTzHL0S0P0\0  0CS sT<0000<,0< ,0000,00DA AD)0 !(LQ0 3SH L0SP0\ 0 Ts<0000<,0 <  0CS00S< ,0 00L 0 ,0Z< 0C 3SHL0SP0\0:'s<0000<,08   ATL ,<t@PEY4Pv?@ X808 00U0@00S0T0S@lЍ<  0CS00S< ,0 00 0,00 Lt0<0 m #R'HL R \P   B[cL R0P \ 000B S r[<0000<,0< , 0 00 0,0^0 K K !  @004000080 0 @P AU 080 X0000CS000 (  PP(  4-v@P[,000B[ 0 ,<@P P 0 0 X2PPX0 080 P000CS (  R`P(  4u@00002 0R$78 00 00CS000 (   -`P(`X\` `HL`'S R00$00PS;#S R7800C?o2080 Dp000CS000 (  `P( PP" 0 0D`PDp[`$0S0S P00`X0 `?o2X HP 4suP0%'[FT[^̕O-0pdM00 ,0`0SPdЍlVH$@&圀t00t0 $0   V@ 8t 8PPP# #RtHL R \P   BUL0S0\ P00  0CSQqU\, BUL $8PP u` 800008$08 $0000$00 EQ QE!(LD0SGt`?P V8080 0儰,,00S0U0SPq #RH L0SP0\ 0 p800008$0 <  0CS00S8 $0 00 0 L$08 ? PHLPP\ 6 $8"PP,00(004 00 023PP nQV 4( `000CS0(0%  @P  0TtPQ  @Q0$P000$0< A A! 2 0R54 (0 00CS0(0   t@P P TX @@D' SR0 000HS# SR8Io4( qD0T`0H`SX <0 000CS000 4  z@P4  8 qWP 0 0H7@PH`<HP0 000CS000 4  T@P4 P 0 0H@PHP`8p`pW H\@P @p~0@ H@PH` V  L~P8pH@h$0:f 00 D0B@8TuD0T`0H`SY <0 000CS000 4  @P4 xP 0 0H@PH`k<HP0 000CS000 4  @P4 UoP 0 0H@PHPH 0 ?o2R0Ss  n0 D0@P0@ Hr@PH` )U #@@@YT^@-0S00R Ѝs@-P0S`@P d   0;Ѝp@-@<0 xM 00CS 0@M@-@08 <6ṟ0@ 001/,]H@-@08<7ᦟ0@ 001/H]H@-@08 <6ᓟ0@ 001/,]<@-@08<7ဟ0@ 001/H]<p@-@P*M0 i#p@aMA-p P@P&@ 0`P@`0  d030000 @P0 .TV ЍO-P0Si@`冋ᨋ`Ve 0 0p`00S00 0{PNP & B00S(!``0000S 0  0 Ѝ0S- 0 00R0S @ 0S 0  0  00p R W:0L 0C0000p0 0 0[ ^@-@8 0 ,m@{P%^G-`08MP0@0CL S tqLXuLXuLtqLXuLTqLtqLtqLXuLhqLtL, 0 @ 0T@ #圐0 00D (0V8 P@@$@# #RH LQ\P AQL0S0P0\ 0  0CSjT, BTL ($@P ynF$0000$(0$ (0000(0a0 DA AD!(L d2, p3  p "  @P A , 4000CS0,0 0  PP0  2n@8Ѝ%P 0 04FPPT  , 000CS0,0 0  aPP0 00CStLsLsLtLsLsLtLtL 0  0 0C?o20 0T  0  1 0 c># C,0!0 0 0 80 3"@P8ЍG TA^̕0 X➱7@-P@0LP! "T0S, ,00 13/H Ѝ06^ ]<+^@-@0S @; C-`M @P* 00 0SS S 0pS0 IP  "P  0  l  0@ЍO-p0PDM,sr`l90V06 %P00P0H $08 `@@8@= #R2H LQ\P AT3L0S0P0\ 0  0CSNXiTBTPРZ@IX0 @T@ T0Q' 0R, BT&L $8@P3 l TT0S ,sr 0S 0T0  0DЍ800008$08 $0000$00 DA AD!(L8 0 3SHL0SP0\0 h800008$0 <  0CS00S8 $0000 $00R# @04 R S |00000 0(401  3@P A4( <000CS0(0 ,  `P,  0Vl@fRSFP 0 0<g`P<T 0>lTN0K 00G 0S S@A4( 000CS0(0 ,  r`P, 0 @DЍO|S@ 00 , 0@0+T ^up@-`P@M8  ;8?P00 a  08 H@  ^ 0 013/Ѝp]HA-p`@M8 ' Pቛ번   P00&  0H X@ # 0 013/Ѝ]<p@-@ `(MP0, 0 0$00 000 P@P A xk(ЍpO-0dM 0/@H0p0H0 <D ` $0XP 4q 8# #RkHL R \P   BYL0S0\ P00  0C SpgY, BYL $4P kZ400004$04 $0 00 0$00 I I !(Ld408 pZQ #RHL RP \ ,g400004$0 #RH L0SP0\ 0 g400004$0 <  0CS00S4 $0 00L 0 $04 0 3SHL0SP0\0f400004$0Q #RHL RP \ f400004$0 ,000BS00S4 $0000$0,<00n40  p^ Q( #RHL RP \ f400004$0,000BS00S[4$ 0000$000,000BS00S4 $0000$0 ;00 &40 pw Q? #RHL RP \ 6Uf400004$04Q #RHL RP \ >f400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0900(,40p|  Q? #RHL RP \ 6e400004$04Q #RHL RP \ e400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0 800,f(c8<40~{  ^[{ \< #RHL RP \ 3e400004$01Q #RHL RP \ te400004$0,000BS4$ 0000$000,000B S00S4 $0 00 0$0408@HL4 ~{0 $^[ \i 3SHL0SP0\0`&e400004$0^\ #RHL RP \ e400004$0 ,000BS00S4$ 0000$040\ #RHL RP \ d400004$0 ,000BS00S4$ 0000$00<  0C S00S4 $0 00 0$040HoPl4 0i 3SHL0SP0\0`d400004$0^\ 3SHL0SP0\0 d400004$0 <  0CS00S4$ 0000$040\ 3SHL0SP0\0 ]d400004$0 <  0CS00S4$ 0000$00<  0CS00S4$ 0000$00000,000(0@0 0 @EP X 0( 圀000CS0(0b 8  PP8 Y ,g dЍ<  0CS00S4 $0 00 0$0p.000 p0 p0 ( 8@0s ?@c00HP0s0 L ?@cx 00R01o^ЕtԕMb]̕ 0 0Rp40 (0 00CS0(0 8   PP8FpPTp AX>P@Dp9'SR0SH#SR8ppGor0( <`000CS0(0 8  qPP8 RP 0 00<0PPE<0X@ ZW P00@X00P @WP ,P0%'00 0PP` @P ,fYG-@|0s-P pr`0s 8<0sqHL0sq0s 00|(,圠p|\ 0>0 ^0P3j:0S!S"Pc PPc"V"؀ 0h13 NPP!  0CE0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s Q003 PPЍPO-0DM 0x$`pT0|0T0D  $0WP 8 8@@@# #RH LQ\P AQL0S0P0\ 0  0CSMAbTAڌ~, BT?L $8@P000000(4003  3D@P WA 4( <000CS0(0T ,  PP, K 0e@DЍ800008$08 $0000$00 DA AD!(L #RH L0SP0\ 0 a800008$0 <  0CS00S8 $0 00 0 L$0pP 0 0<PPT 0ie4( 000CS0(0 ,  @P, J P0Me?@P@ 0  y@PT4( 000CS0(0 ,  @P, ! P0$eH@_WDT#^O-0`TM0 0/P0:00p}[P0,0,00P$0 0VK%X00X0p0, V0(040[@Ht 8 PPP$ #R^HL R P \  BUH L0S0P0\ 0  0CS#`U<, BUL 4HPPP" d $TЍH0000H40H 40000400 EQ QE!(LH0 @ #RHL RP \ 7`H0000H4020 3SH L0SP0\ 0 `H0000H40 <  0CS00SH 40 00 0 L40,000B SH 4P(0 00 0401[5 ,)00D008@0 00 023PP mQ0[L0e D8 000CS080 <  DZ@P @dPP< P 0 0D0L@PL00U@8D8 000CS080 < 8 D+@P<  D8 000CS080 < 8 D@P< p0@P@cHP0 0D 0L@PL00P 80DP @c P@c$0[`F0$0 Oo 0BS@T0` 0(0S`ÅPU^O-M<00D p p  d P0 @0/P0:0 0<000` 0@0000,pSX040H00L000(`80$P$0S`Vڤ+H \00\00tP$0SP1<04PS   T0 00pSd 0 8```$ #RHL R P \  BVH L0S0P0\ 0  0CS<8_V0ڔ u, BV. TdL `P= b0 8<0S Y@00C00Syʐ@K@D0( V $00Ѝd0000dT0d T0000T0 0Fa aF0 !  (L d 0Z 3SHL0SP0\0Q^d0000dT0O0 3SH L0SP0\ 0 ^d0000dT0 <  0CS00Sd T0 00 0T0 0 Ld 0 3SHL0SP0\0^d0000dT0<  0CS00Sd T000 0T01.+D0`&` <0S `b^ HL 8`P   T\P$ A# d X`P0 0C0000 00C00 0 0{?000?  d B00X0 0`00\00 0 00T6 3E`P a00Sm `X 圀000CS0X0. h X `pP% \a`<  0CS00Sad T0000T0 | T0dU`P h <5 0RI` X0 0 0CS0X0 h X `pPh|, vprptmx |x\ R00 @0,0R0 4\ R8Ioᩒh lPR0p0@?o2,0 @,`X l000CS0X0 h X `pPph -P 0X 0`0lMpPbl[㜀 @0S3Y P00X0?o2 prP,p VT` X0 00CS0X0 h X `QpP3hUP\``P0%'U0 PE00040C0 0000 0S 0 (0pS SPppE>0Q圐A  0PQw>(p,0S P0hH0\`V$04 X0C$080080a 0 LP0(04 ?oU20SU $0 E000$0C0000000 0S 0 69(0  *P   (0S0YQ0X 0`00†PP \a``xꀠ0%~`VcZ^r^^4lL̕O-dM000&@`p0pl0p0H $ 00圐 $08@VP4m 8  p" QHLP\P@@ @DWL0S0P0\00CSE\W AWL $4@P _`400004$04$0000$00G! !B(L8ZB_`?@ V8080800S0T0S@dЍ QH L0SP0\ 0 [400004$0 <  0CS00S4 $0 00 0 L$00p40 j #RHL R \P   BW`L R0P \ 000BS [We400004$04 $ 0000$0T0 Gq qG!  ᱿800,000(00  0 @P JAV 0( `000CS0(0  ~PP  ,$_@-,000BW 0 $4@P 2 0R p50 (0 00CS0(0   NPP pP TpXP@Dp'SR0000HS#SR8ppGor0( <000CS0(0  PP `P 0 0<PP<YP 0SW P00PX0?o2P @P ,^P0%'WvW^̕0@-00 8 ЍO-lM00p08-@0唀`x00x0 H 0 000$0 0$  ,0@@[P< 8  # Q#HLPP@\@@DZHL0S0P0\00C StZZ  AZL ,<@P #^ ` <0000<,0<,0 00 0,0 0J! !B(LfWR^ `?@0[ 8080 80800V00@00S0T0S@lЍ0 3SH L0SP0\ 0  Z<0000<,0 <  0CS00S< ,0 00 0 L,0 0<0  #RvHL R P \  BZHL R0P \ 000B S YZS<0000<,0< ,0 00 0,0q0 J J !  ν< [ 0P8@@@P Q*HLQP\ATFHL0S0P0\0  0CS ~YT <0000<,0< ,0000,00DA AD0#0 ! (L倽,000BZ0 ,<@P    ATL ,<@PX$0@<0  #RHL R \P   BTL R0P \ 000BS YT<0000<,0< ,0000,00 DA AD! @004000080 0 @P A[r 080 p000CS000J (  PP( A `4\@P 3SHL0SP0\0 X<0000<,0 <  0CS00S< ,0 00 0,00 0L>,000BT0 ,<@P +ꐤ 0Rp` p68 00 00CS000 (   PP(+`X\` &`#L`HPP'SR00 000S#SR8``Foobp080 D0000CS000 (  SPP( gP 0 0DPP[D0WP0  0S'V P00PX0?o2X H7P 080 `000CS(  PP(  4[@`P0%'0000 R p 68 00 00CS000 (   PP(pX\p `LpHPP'SR00 000S#SR8ppGor080 D0000CS000 (  PP( Y`P 0 0DzPPD0ZP0  0SW P00PX0?o2X HP 4<[;P0%' `TT&ZZ^̕@-4 0Ü   ЍO-0\M0 0 0 0@0 <S0  D0 00,00㜐$0+0 00<0, 0`SPw 8 PPP- #RHL R P \  BU#H L0S0P0\ 0  0CS& WU4 F 0 x0?R*00h, BUL <PQPP ZP0000P<0P <0000<00 EQ QE!(LP 0Y 3SHL0SP0\0PVP0000P<0N0 3SH L0SP0\ 0 VP0000P<0 <  0CS00SP <0 00L 0 <0寺P 0p 3SHL0SP0\0g|VP0000P<0e<  0CS00SP<0    < !              0x00@0 0L00H0000 07 3`PP Q0S[ L@ 00$0CST0@0# D @ L7`P HYP\Ѝ<  0CS00SP <0000<0D P 0@ 0LT`PT0$0UHL@ 000CS0@0 D @ L`PD 0000L@ 000CS0@0 D @ L`PD |0`pSpP00SIPL@ 000CS0@0 D @ LPD 0 S*WoobVppHWYW[ 0k [0 08#800C0 0C00 000 B 0SY !8888RL @0 0 0CR S 0@0 D @ Lp`P8D ( 0@S`H YHP*S0@0 D @ LQ`PD(ppp,kW04 04 0000C00000 C   A0Wa0 [(00`p 00 L 0C00 00 0 0C0 @0P HX P0pG pG ᷸0 0C00000``F`L @0 0 0CR> S 0@0 D @ L`PD0S 0!  0   0 @0S- L @0 0 0C R0 @ 0@L0P0 HXXPxS0@0 D @ L`PgD0S90U^O-0M`000Pp$ h,`` 0,000\ 008 @@D@+ #RH LQP\ AT!L0S0P0\ 0  0CS.5TT"H r0 x0?R: @, BTL 0D~@P% W,P Y JЍD0000D00D 00000000 DA AD!(LD 0 3SHL0SP0\0 SD0000D00 <  0CS00SD 040@0000001 000 0 000 000000 00xp0pl00<00$0 0 9 3Ǹ@P @4 L000CS040 8  @P <k8 =P 0 0@L^@PLX <5W@V@4 000C S 040 8  @v@P8 0000 @TX00 SJX@ 40 00CS040 8 4 @PP80 S*oᨂX <VZ0S c0 008#800C0 0C00000  B T !8@888@4 000C S 040 8 4 @Px8 0 00@S<VH@0,cX0 夶0 0000C00000 C   A000X0 `s p0 000 S0Ḁ00  0C00@ 00 0 0C0 40P <XV @y0 H H ]0 0C00000J 0000@4 000C S 040 8 4 @P8 T 0 0 0 @ 4P0 00C SST040 8 4T @[P8T `@4 000CS040 8 4 @CP8 Ph @4 000CS040 8 4 @*P8 0@?S%@ 40 0 0C R 4  8@4P <U @@ 40 0  0CR @4 e4@@P` T88S? LHP9 !,Hp0 ,ET H0!,P001x C60 0hd,P YN 0,0@ 40 00CS040 8 4 @P)8WE<0 H0PH0T0,0S040 8 4 @P 87 P@4 0 00CR 4 ձ4@SP @;NT<^]O-DM000'pL00L0<H $ 0P$0 0`S8^ 8 @@@# #RH LQP\ ATL0S0P0\ 0  0CSQTڤT, BTL $8h@P T800008$08 $0000$00 DA AD!(L Y3T?@Pl0S0 3SH L0SP0\ 0 P800008$0 <  0CS00S8 $0 00 0 L$080 p #R;HL R P\   B[fL R0P \ 000B S P[v800008$08 $ 0 00 0$070 K K !  ᔴ0000(40 h0 刵@P Al00S0T0S 0S> 4( 000CS0(0 ,  Z@P,  0T,000B[ 0 $8@P '0@?S`0SH@Pl00S=T 0l 08 U6 93 `4 (0 0 0C R (  , @P,l00SR TP 0p  L`0 @P 0SDЍ @QL L  L h`L 0  0X-@lЍ, BTL 0@]@P R@0000@00@ 00000000 DA AD!(L0S0R?@00 #RH L0SP0\ 0 N@0000@00 <  0CS00S@ 00 00 0 L00@ , PHLPP\# 0@@P@0 P Q- #RHL RP \ $~N@0000@00"  @Q00@00000"0A A1 倲,000BS00S@ 0(K0000 00;0s@0 F  #RHL RP \ 2N@0000@00 ,000BS00S@ 0000000h:00@ 0? 3SHL0SP0\06N@0000@004 #RHL RP \ M@0000@00 ,000BS00S@0 00000000<  0CS00S@0 00000000@ 0 3SHL0SP0\0 M@0000@00 <  0CS00S@0 00000000@ 0 3SHL0SP0\0 M@0000@00 <  0CS00S@0 000000008@<@0~t d'^T P \ #RHL RP \ HM@0000@00,000B S@ 00 00 000408@H@L@0~t  t^T \j #RHL RP \ aM@0000@00_\ #RHL RP \ L@0000@00 ,000BS00S@0 00000040  #RHL RP \ L@0000@00 ,000BS00S@0 0000000,000B S00S@ 00 00 00040HVPS00CS@ 0f 3SHL0SP0\0]L@0000@00[\ #RHL RP \ kL@0000@00,000BS@0 00000040\ #RHL RP \ CL@0000@00 ,000BS00S@0 0000000<  0CS00S@ 0000000H2 08#0`80004<02`   3 @P AP0S <4 000CS040i ,  @P, ` 8OQ #RHL RP \ K@0000@00 ,000BS00S@ 00 00 0000R01e0 0008]@0s0HVP0s0 T ?@cL8 ?@cE0^ԕЕ8]t]Mb̕5<4 P0 P00CQ S040 ,  |@P, 0@?SP`8OH@P00U s 8080S>09 P `< 40 0 0C R 4  , F@P,N00 H0n@PFH0TP0S< <4 000CS040 ,  $@P,  8N[`P <4 000CSST 4 T  @P(00H23 00@P(0TP V@ 0 0XXP弶@PXP0S <4 地000CS040 ,  `P,  8|N@`3 0R :< 40 00CS040 ,   `P,T`X\` O`LL`HGP| x0RQ   R=04 RQ8800C?o20<4 Dp000CS040 ,  y`P, 0P0" 0 0<D8`PDp[` 0S 0S P00`X0 `?o2X HYP 8MT ;$0PP0%'T!p@- P`0 PP@0 勉p0O-M @0  ( , R 0 @Ѝ    0RL ( 8 <  4 H/p`00`0408   D0>0PSXr 8 @@@) #RVHL R P \  BTH L0S0P0\ 0  0CS"ITP000, BTL DX@P XMX0000XD0X D0000D0@0 DA AD!(L坭0S@8M?@00S0VT0S 0S S XV@ 0 3SH L0SP0\ 0 SIX0000XD0 <  0CS00SX D0 00 0 LD0X , PHLPP\# DX@PX0 P Q- #RHL RP \ $ IX0000XD0"  @Q0D@000D00A A1  ,000BS00SX D0000D00S_40X 0 3SHL0SP0\0 HX0000XD0 <  0CS00SX D@0000D08600T00H`P0 `00 0(:3廭@P Q0S TH 000CS0H0s L  TPPL j P9L/0sX0 F  #RHL RP \ _HX0000XD0 ,000BS00SX D0000D0800X 0@ 3SHL0SP0\07/HX0000XD05 #RHL RP \ HX0000XD0 ,000BS00SXD 0000D0700<  0CS00SXD 0000D0L700X 0 3SHL0SP0\0 GX0000XD0 <  0CS00SXD 0000D0600X 0 3SHL0SP0\0 GX0000XD0 <  0CS00SXD 0000D05008@PPD 8, 000CS0,0 0  ᆻ@P0 %0@?Sp4&D`H@P{8 ,0 0 0C R ,  0 d@P0``H0 勲@PH0T` 4C`8, 000CS0,0 0  @@P0 U P08, P000CS0,0 0  "@P0 2 0R p$68 ,0 00CS0,0 0   @P0pX\p `LpH@P'SR00$000S#SR8ppGor08, D0000CS0,0 0  ̺@P0 rkPP= 0 0D⌫@PfD0Z@0($0S1W+ P00@X0%Ps 8, 000CSST , iT  n@Pc C0 0XX``@PX`X 8?o2X H⒫P 40C @P0%' 00`U`[ZGO-@ 0tM/00p0 `0,@l0V<0d0 0d0H $ 0<@  00 㙹VPH_ 8 " #RH LQ\P@@@DZL0S0P0\ 0  0CZ ?ZhI, BZL 0H]@P B`p!H0000H00H 00 00 0000 J J !(L0S2`Bp?@Pd0 3SH L0SP0\ 0 >H0000H00 <  0CS00SH 00 00 0 L00H0 \ #RIHL R P\   BXRL R0P \ 000BS >XtH0000H00H 0000000*0 H H! 冢H0V y KpV Q$ #RHL RP \ L>H0000H00,000BX 00 H◺@P 8,000BS00SH 0000000:00H 0? 3SHL0SP0\06 >H0000H004Q #RHL RP \ =H0000H00 ,000BS00SH0 00000000<  0CS00SH0 00000000H 0 3SHL0SP0\0 =H0000H00 <  0CS00SH0 00000000H 0 3SHL0SP0\0 =H0000H00 <  0CS00SH0 000000008@W.P D4 000CSST 4 T  @P@V D4 `000CS040 8  P8  @> @Z 0 0``PЦ@P`P 2 0R $5D 40 00CS040 8   P8`d h|TPwX'S R00$00S#S R8HoD4 L000CS040 8 4 D⮵P8 M`P 04 0DLnPLY㜠 $0SX P00X0?o 2` PⓦP @1>P0%'T   p 00@PU U ytЍXZMO-p M0`y0 00S$N@hAᄵ3 41 HdPO 0 081   E"   E$EVP  0P 03P 00 P" [ 3 000 0VPP PU 003 00 0H@Ѝ000zS0P$z^^)]G-P `MpPL0S@& ֲP 08y003 0P@ 300 "H0S0 TP@ 0U&ҴЍ P0SH0S ⟦@P @0 CS 8:8ꝴ^G-`@0 S_Tp  SXuPڜ0H0S0S 0 PPbs@1 3 00000 00 0 P MJUU0S 00   xT 0S 0xTVT = PNЍ0 P-O-0pdM?@zdЍv%`000D $0P8 P@@8@# #RQH LQ\P AQL0S0P0\ 0  0CS8T, BTL $8@P s<800008$08 $0000$0[0 DA AD!(L帜80  #RHL RP \ 8800008$0,000B S8 $ 0( 00 0$0' $!04000 00 00|@P XA4( 地000CS0(0 ,  WPP,  0;@=2 0R `54 (0 00CS0(0 ,   6PP,`P T`XP@D`'SR0000HS#SR8``Foob4( Z00S>>0 30 00C 040S4L3,0A`0 : S 0003#0 #L#32024P /l0-l<Ѝ葺 00 00k0P Sk4P Nk*TU tT]^J^@-0034!z?d 0 Ѝn^0@-qPM:Ѝ0@@80@ 34P@z?00d0 Ѝ0f^C-M8`0@XP:@őD  8TAVp pϬQ @$ @P@ `8Ĕ< Rd`Ѝ^^^O-p00@ S` 00P `ƿ 0 Ж 0QP_ p(80 00j`(`p Vw &0 '00C030S3 L32  B \%D1R.=S+T @u0P SX0rpppZ ڨ u0  0 t~00C00 ST0T00! B!00 080 0c 0c`` V"&P00 0S ЍU TO-,M 0%!`0 @00;PP1`\!Q-R ( d1R\0 嵏#p1>0S100! 0 $=$S 000W0 00p50 00Tp4$04L3 $2   0: S 00C03#0S #L#320C2T3S! !,ЍOtTU ^]&^O-4M 0`0 d0h0 @0l00 ?ÕXPL4\<$Q-R (  ?ᰕ0( p$T S`z00 Sl` Wb |%P0S 4ЍO0  0@@` %0 %000303L3 2   \% 3R0=S-T @sp0"PSX0b```X ڨ s0  0 sn}0l"000ST0TPP101T3S!  !80` cpW!$ w bR0cQ4 0P`, $ T0R3, 00SG$00$04  04L3  2 ` `$080aP0\00$``Wf $P $08 0C$08 4 0S4L3  0  A 0 *%000303L3 000V(00Ss 00lRPà 0@ 0oH( 0(@&31`tTU Ҹ]=^y^O-p` P,M?@ᔠᛔ0؀ 1\ P$0 0 T0 C)C$)0c<3"kP $ 00\ Ó\ bh,Ѝ00?0 0 ZP  0 0p `x$hTU s@-`@PUЍp80 C0ST1UP! 0PT 0 U"000/ 0C0O-@P ` Tp Gg 0ga2cwʿ 0uA ᯴0 0C R S R0  ЍOO-0@4M 02$0L3P2`VX\00 S" T 0\%t4Rk5Ϡ," T0/ C,    )`C)0c <3./k0P0,00p4 R Q\0 Q \PQ0 Q? q`0, 00 0T3`S !!! [ Y 0 I00 T [  , ˿ 0 0 ,g4Ѝ00ł." 0 RT0`Y `80 4 S5F\ #`0, 00 0a `?A 80S# C$0 0$04 $ 0/4 $L3$ 0 40040T3S! J 3Q`0Ss00nR31  0`0 S, $0 0C$04 $ 0S/4 $L3$ V0 B 0!0400C40 `Fq400400e!T3`ȏS !!!00S  s00`R31000,P f `KTU tTO-0M Є00T0@H 00p SP; 0T !_e``0 Cc ca5bS4D $P<0`@$!0c ~P`U08$<4X000 0S  ?j0 0000 0{P 0 O0 0L0000 0P0 0 Rh  h    ʯ L 0 000T0ЍL0 ^^TWMO-`LM4000p@ T000$40 00: S(P,@ 0'0@0,[  0E? 00 00D0R ,ᥛP 0 X*Q6@ ,0U0P#@!0ӑH#0  PS03 00000%0 40LЍL P* [Y0 LԜ\*[X 0 P%Q!$+KQ3((HQ34,R8< 080 !<SD0v0S015 8:#Q< 0*0 0 b0S ᥚX! X03S Y P  Y1 Pf L320[a L$2\ (\0,QH30XM L$2\ (\0,QH30X9 L320[2 SD 0C0A( @FCM^^O-,0`@p(00P  `p L 0l7t0̠\ doQ 1K^Mt0 0/W0 0 А0#Ϡ80![ K P0 徐 @?,`p@0A ᷐0V 0SL#" R: Ϡ!800L#" R*08G-p$0P` (0@  `p L 0l6t0̠\ nQ 2I!0Qt0 0/V0 0 X0#Ϡ80!Y I100 D P?G,`P0A =0V 0S ?&L#" R: Ϡ!800L#" R*080O-p@4M`Pş 0 0Ł#\%4XR 0  0 0 T 0 N)N,)n"3>Tg0P0 ,刓0P [ 3 S c004ЍP3T` ( ?Ə [`p 00 ST0Z0D` Wr iP ,c0 0 0 0C030S3L32  B T3S   ,d Q  q!`RR 0 S8 ` bpW 0P" $08 0$08 4 04L3  0  0 00C030S3L3 0  B W00!8 w ppbRPa4 \0$ $ Y$0ʯ 0C$04  0S4L3  0 C 0 80aSw0P00y00Ss00`R31TU t@-M@0pp04`PP 00pЍ@Ѝ]@-(Mpは`0@t t```kPP (s@Ѝ     :p0VM'^.^A-@P 0 S 00 p u `V00 V K<_ ] A(0O-`0$MЅpP H@! 0 @Pm!   0@I PbX 0 H@$ЍO  * Y T0 T3?Q\ 00S P `0S@ $ЍOM 00 I Y   0 00?  T" ɮpP `@0S 0 S& Y @ 000  $ЍO$Ѝ]O-dM00@ 00sc@00PD0`0到 Cs cq6rc4D $`<0p@$!0c ؍`pV00 00000P T @)8 >0 00 0 00 00 0"T080 0S  ?ᣍ8u 0` 2P0)0C$0L3T $ 2 0QS8$@<4QD 00@0D00S S<0`SD@$! 0 w$ 4P0 80S  =00p7`  000@ D0pP0`00<0S 00S" 0 0 0 $0 0Rh  h    $  0 0000S! T0X C)C) c1<62 8<0bX00) C0{X0 X0 , ! X0 00S@^X00000 00kd0P(0O (dЍ0S28 0B 0L00 ?T0 000/0S 0/LS0H0T0,0 \%5R:Ϡ*" T0/ C\    )pC)0c <3.,d0P(0\0,0pY 3S5%\Q-R ( ?៌YH0`0?< 0T 400S2000 <0H00 SfL08< N0T0H Qq00 A!400C400S A40040,A 0TS̠<0 H0? QmT3S !  ,k \`$000S h00h0 0 0000S T X N)@N)n;̠#S Rs  00ʂ*" 0 T0 4 X00S 00Q3= ~ 0 4 Y00S>>0P3w s4SP$A$ Q LP 0 @ j\P _, 4 00$0t zaX000$ X0 X0 , X0 00S0(00  <0D@$0C!d 0 $ 40`R0#l00S x W0@"0XS8 0S Xk_^^]7^^TWMTU tTv^^^O-pἠ0P4M 0 ?W0@00 !0\%0$01R 00@o&!! X0 00 `P ? j2*!, ZS QS:bP ,l 00\ Ó\ _4Ѝ $0 R  X   !4,_T ]U O-P0@Ḡ $M0\ `#,^ 00 0T ? A)A<)a>21,, X:@ 0@P5bP l 00Q Q ^ $ЍH  0 0 PX'_T] ^U O-PḰ@ 0$M⍊0\Ŕ00`0!\    ?  ?` a2! Q,S QS1, X:@ 0@PC aP l 00Q Q N^ $ЍH  0 0 P^T*] ^U C-`PḀ@p 0M. 0\Žß0.SX! 0 Q   ` ?0W0M85p@5pL0p00W00W0S? (0TW001<0&$00 `001`00p0$0d0 01010000p$  0bpPUP08 c00\`dT80< L31)l< QR>QR!<`0d 0001 O ]00P 1`80d0 L pl<000\0<827,< P0 `6:d000000 0 00`pPd0T0<d Cb0)C)0cl1c"8 <`!d0!0?o!2R0S pP 1\Ѝ[8u@%@4L0pp p0W403d000p0 0 N`pP@d00T0<d C`0)C)0cl1c8<`dT80< @31)`0 QR>QR!8`0d 0001p(0T80&"00 `0010 0p0$0d0 0101040p0"  0pPP0405@50%0L050(0TX00 `0010 0p00101 0 0pPad001p 0 0T0 C)C)ct00<21 0P0 c0c Cl1n1s V  V  Rh  8 #.38,P0^*85 @5 L00000 00R  Q RM (0T )\5S0 1<0 1<00@00 p0010`0{p0$01 01010000000<00@000pPP 80 B2 b081") !0a''0001S 1$ \ Z0P 0 `B2 b6<>"p0X Q0 :1S 1000000Y8e@4 L0```V 1S 00`0 0 _p(0Tn\5&S0! qq p0@01 0 0@p0$01 01 010 0`p@upPh''000Q0405@50%0L050(0T40 p0010 0p00101 0 0pP=1S 01p 0 0T0 C)C)ct00<21 0l0000 0 1+0P40l00Cl00 0!00n(0T1 `40H0 0{p001 `@000 0 0HHpPx0"d000 000tp`0T0x`| C)C)c2160" * EpP d[pP0 0a0T000000`  F 0f Ϭ2fYd000 00 00  0Pd0+ YJ?o< 2 R0S R&0 T 000<0嘠`l0Vd  0  2 `PdX`X< 0 bd0000000%FW\P 庿d H00 1dY000" 000 G4 00040S 1S0!0Y@ P0 c0c Cl1n1s V  V  Rk  8 #.38,P0a*85 @5 L00000 00R  Q RP (0Te\50%S0 1<00@00 (0010`0sp0$01 01010000000<00@000gpPZP 80 ` B2 b081 0嘀 00 \0p !0001S P 1T X Z0P 0 `B2 b60>" pPB Q0k*8e@4 L0```Vw(0T\5&S0 @qq(0@01 0 0p0$01 01 010 0`p@pP0p  1<00gVQ0405@50%0L050(0T0 (0010 0p00101 0 0pP1S 01p 0 0T0 C)C)ct00<21 0l0000 0 '0P40(l00Cl00 01Sg(0To1 `40H0 0p001 `<000 0 0@pPx0d000 000p`0T0x` C)C)ct02160" * pPd XpP0 0a0T00|0000`8pL0d000000 0!ZpPxd00H0H 0l0L R 0P00 1W0P0`040pT0x00040<0@0?P dWR(0T1P pl0R 0 H0p 000 0<@<0@ 00 0 0<@p001 p 0000<00@00 0;pPp0h0000 0000T0 C)C)ct0201<" "8pP0 dV080Slx`00V;:40S 04 h@hh0wWpP080L S0H 8001d gWr)Wp10Q㸖Px(0TsH0 010l02H0 0 0p001 01 0000 0`P dvVp0 pt0!R  !  0  T B)B1) b082 0 pP 000004l0 2H0H VIHV1S 1h 0  000 0 0YpP l 0000T )B 0B) b830 0 d 000"00  }PFd0n ἠ?(0T0 `C0)0c VQQ? Q?1.*\Ŕ0d\ !Ί  0 F f ? 2fVd000 00 00  0;Pd0) VH?o8 2R0S R$T0 00080嘠`l0Vd  0  2 PdU`U 8 0 bd0000000%F YPd0H 00dKV|000 000?4 00040ps4pqO-@PA(,`PT:ppW0 S0S fPZ@V 0000000@@000@@O-pTM`@ 卿0Sᔿ TЍ@T@Y@T  r"" ( 0  (04 0D \ 0S,0@0H*0 0:00@0圠<0 08000  R0Ȱ%d*}P# l2L \NS@QS 80 P@UP!PŸI͠ӈ$ P 1/PD$0   0 U$ 0 7$080\< 0/Q \00 T0 P@ \0 A!. a4,AS ?0$0 00AQP0 H_oRYP$ZUU000@Q9  @ PQ;Ã9ʁ0ˁY @0 R 0@@DT@Z@@@;88@5L0AO-需|M00-P pᬾ0S0 000対P|Ѝ0 00\@000S/0P35:080P0X00 \00&2T$00PT@p00h@l0 000<00@0h0S < d\`/ ` V[4 P@P  TU $hPP e2Š U^Q^ L E @e 18E \H(@@EVO@%0@( , ,0 BZ!0 4 ? [0 [ƿ 0:@@FWPU@7 S0@0(@@@ @L @ Q  E e<Š V0`H@ @ DHLD`2W(`@`L`0@D TTx 0,0 X .PPp@S@P[P$0080\0P0000i0   R  R *5 Rˡ@-9^000S -/0   R Q   -//@-P`00S-@! < A@P@P 00@ 0 P]@ 0S R 心@ ЍpO-P$M`00S 00CS 00S  R 000@Z0   P @L4 l2>, R0:0 @P 0S 0S@$Ѝq@P |0pJHp p G pp y뼀00 0  @<p00 @W  A Hb0H0P L" l1.Q0* z  M0 S 0 S@ 0p@ 0 P| pL| 3 F|     @P H  {     开帐5 -@l@jA-P@00S> 00CS:< EPP0Sk@p?oV20#S 00W: 0R R 0000@ R@ ⫂@0`@-A-P`00S-@ 00S@ 00@ 0 @P 0S 0S@Ѝt@Pp 뼀 00 0 @Pp |]@ @ A HtHp k@O-lM0P80000000<0H0000 00Q.80S0008 080}<Pd00`00 00p  0` PEd0 75#l20l20$ ;60 0RCt ?0 0 0 0 080<000P0)#00嶨dO@Pd`@P d=QlЍd0000S0$000$0?L0H0SP0(,0 0ѝd00 ,0~<00t RWdQ0, (0S,0$00$0t 4pLT0?X00## `0`V(@1@pD40<0@ SP0D 05L0 R00S 00S$01pp0 0 80000C0 0| T0 C)Crq)0c9s 0 p@h  R$ !00 R4 $  * 0<0S04 S400S @" 00 0000S $0! 04 A0T 0 0X 0 0pG` 0@00S@0D00D0400C40}Sڤ0 00\0C00 T0 C)C) c0<;2  0@P\ ( 0T0R0S,0S @0,o00? d;P(@(@H0S dPT@@S^A-`P!0[ @px0 Wp0 P  $0 Q D 0! 0V`0 P ( ,0 Q @ @0D 0 @0D 0  UP0 P 0 40 Q$ H 0< 000000:00Ѝ    G-`0M0@pP 0 v00Sn p0@ 00@ppp\%1R,5S0 0 0 {0 o."p1`\%R  0 ? Ϡ ,2 `x 0r{`0 C c00T0 ` C)Cba0)0c03"R0P   \Ŕ P\x 0@G{ }W P0Ѝ0  3{,O0 TTO-]M 0 0$0@ C0CSRP]ߍ0S1  ;100`pS00|h$0\5SB\\?@5D0L 04;$Z$SØ,.1  0 Su0R:$SZk00S(p>| 0)QY 0000 P0  DbP<,\(Q?00 \P0{R&/ 0sR & 0 000PPr  P(P(8Ŗ0 @L ,QYP! 0PS 0u )R 0Z:0 0 (00$01 (0S$0 0kP0( $ c2# S,P!Q$ RQI P S1Q\Q\3PR= (08<$ $0 H0ï (0ZX/  0a10(0  X$00 ( $0e PP 10( $0Y !#H0d( $ . ?ǥ 01 0 S100 05 PP 0v0S , 000000S0    0؉0 0PP 0 a? R02! Q., S,Q, US180,08 0S40800<0,0 0St P0T 0SX0 0S`04@00/\d ` X  !!@   L/ X  !P0Cs@0  ^  !4!¯Y<  Y ^P Q  !P0 C 0U00 0|P 0Qq1(( R@ 0 Pe1XXϠQ(0 0$00 0PR(   $ $   0, 0080jq0P0U0 S0&t P0 00Sp00S/0S tx0| \%0R  ! 1( H  0 T0D C)C)0c:"@h0 0P00DQ" 00 0 0800S00 0@ 0/0  X* 40S<0 0"40< rs \%5R400 0!! 0 40 S<00 P80, @0ᜠ `9;8^0D:0 000000S 00000 0040 S<00 P08, Cᜠ c3;P0):00S118% ("6600Q$00Sh 0_P 0 b R320 QP1Q SQ ☀ PBᜠ b<  XS:0 BZ%Z b^3P2Z0U P11(0 堃S$0  0H0(P5$5C2000 0 0E00z= 0P0^PX 0Y'0%0 0 0ḣPP  0 S100 0'PP 8@L0    1ptpt1Ԁ 01Q00#S $0U( #P(0 0$00 0 H000 0R     L   0 Rh  Bh    R  000b\%L0R !0 !07 P L l0 ^85L50% 0@50 0<Q Q0000 0S 0 01H0L 0ɟH0LX8L0@85@50L0T^^HXp<Q Q000 آTS0 ?H0L 0ȏH0LTPP 0 R !/P !!0/00S1/P11/A-PI0pMT@@P ` B2>0@@ b@ "<1@P 000 vx9SsK@ЍHG-p0 `$PI@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "0008HPMC-0P0`Mpd@T 0 Mp P x ЍsT80< @31)` Q0R<4Q0@ 5  a3SxlØ|h3 N,t3 p9#$+ 00Q000Q 00SQ  B2C 3R0  5P 300W0 0$ 00Rp00p0 $0Z @o0?@0\^ ^ CP00 S 0 V0   02#2L0R W0P0` 0@Pt a2뜰40 00800 0(|@P#1(#1L0R5<40 2&CGP0& 0 # 40 02 X c ( dT( 5 0S 00WUW 000S   @40 @20  0 &CL@P4 00"X 0 ,0,,0(I( ( $ 0S( r K p  0(@P 9S 0<0S }@T0$ S12 @@Àp@-P㏕0P@ P0  PPPp0@-@0@s-/p@-P0@ `V V 働00(,PE ` \V0E/ !SCE?000V `S000p@\ 0O-DM( 0ؽ`(0 h1xP 0Xr QRsQ0 S0,0EC4300000 `$0V@Y W0?R0 r00h Sf W0( 0Mh0 00Sh00h0 00h00009S@ 0<@T @009Oo,6BDЍ0P  B20< 0 b71" 5@P 00,Z t W?s<00 40$0 0R40 <G|0C0'0S 峮 W0 0000`j <00 9<S|H0$ S S8H W0<G(000 0<009<S^HY HW W0<GZ 0X @P  j~ 0  @P 9S 0<0S @ITj0$ S00^O-P,M0` Ḽ3300@ ., pWg eU0 p00Z X l)` @ `Ό4\P0P  004Qh0Ah0 0c?0P B20$  b41"0 1P 84t<$0S Z  X$Et0@|00 0P^00*`0 C# c.4,3RS" 00 00CP  004Qh0Ah0 0c?0 0 $0 0 S  0 0Q]  0 h 0 hP z0h0@p P0PL* 0@p 0D00 B?pr0T 0Y0 60Qd0X0000,Ѝ,MO-P0 0008<Ĕ?rP0 C c00 0 "P d 0#0X  0 h 0S000 0p,pp000  08 2B00I> 0008<Ĕ?qP0勱 C c0 0, P d嬪W 00 0$ <0h00k000S"s!^E^p^^,M^G-p0`@a PU 000W Ghg R 00 0h RhQ9S000}39,MO-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MR Pl p$`W0@*F,Ѝ ,0W0*\0Q.0j T0 C)C)0c03"GBPd 00\ Ó\ >x>0吸(X0: 0 TU p0Sp/0@-@0M 0@0@ @@@㍝|P|0 0@0@ @@@L0 00@@ @@@ rЍ0@ ^<^^8 p00CSp0/@- @@<-M zPjoЍ$^@-0 R  @ @0b ` 0lЍЀO-0,M H P0 -bpeW XX@?n /h+p+ 0 $+4A0P0 0床  0k %0 ! %=4\%R0 004\5 P  ᠊0|t4RR  ᔊ0h0Z 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3k  q000T0P0,(5 0S 0 @0@0 0T`0$S> ) %> 1S 0LLH30V0P$T40X4S E>0X440`AQLY$5S0P>$BZ| $kZ`P P>P0 /800pH0Y40LpIT0 C)C)0c 03"@0Pb  00j0 4=80`$%!0, R0 (a0PTp i0 _."~\5P S 0 0/ Ϡ , pPx 0i`0 C c00T0pP C)CRQ 0)0c73"]@PP ᡁP$Y0,Ѝ"   <Ꮑc]<^8 TT7^G^-^h^0O-PRp@ ) %> 1S0P$0T40X4S E>0X4h04 S<0400P008T0<P C)C44)0c"03e?P440$ R:;4 5Ҡ  0Z0S000004圀AO$%,0R0 0rL0Yh$5S0Pŕ, H!i4lS944S@040T3$0P1nZ1,10 1(5 0S 0@0@0 0P :> 0$ (  * PP$0`p0,0 0t D t a /o bH T  BL 8 48P ҰZO   <Ѝ000,20V0800P00 0800S40 B  HLT0 C)C4)0c"03>P+4 0h0 4(;804d$%0 , Re\4S  5  0 000V0 0 L嶇 T h將]4P :U P 㡇(ᜇ00:0@ ]8 TT 8T^7^G^-^s^@-0S0lP@ X@P  Ѝ 070@P ,WV070([`0u/Pph0Y VT6C^ WMc,ҁX^^A-P00`SP pW@P W@PHU0  Z`娑@ЍC-@p3$M/P++  h0$+4`P6T!0h 0gZ0 51 50@0\%R=S04, 030304040 50g0" " 200(0\5W:`$Ѝ68T8 O-,M@40A)Np PL30Uo[P ,Ѝ800`H0S40L`GT0 C)C$)0c"03 `8P$ 0g0$000S:8 P7G-`,MR  RPpJoA(RP@  XPU!@4 _U@P0 R@j0mP Ue 0S 0 0R\K~`~UU 0ULJ0 @p0&00 0儖@囐T:040000 0IaPU3PtPP% ˍ@|T0x n0@xT`P  彍^}RP 0M}`P=S 0 @P=04=S:0 0S"0SM@(0 ]@PP 0 0S 50ó 5u=S  0  @P Ѝ 0 5< 0T!T000V@1 =00S00000\4S Lu/V2 5 0 5=S$ U♝T@p=S 0 0C>00x0SU`~010@O@M@K]7^s^-^^t^A-@`L1pP〃P 00 pPB=TS>P 0 <=Z0S 㖭= SŌ|$%0,RL1҄hτP ʄFÄ000:0O-P@`=MS =S  מTT㘡Tp@ TP:TT 00T RdXX T 崍PpT=S* 000Cn PpЍ ዁ P ||T0Pp\| 0   ဍ<] ^Mtp@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0P 9 ;909  000&00PP 9 ;90[ 0 }00p!1/0  J00S 0 Ѝ0Z } W0 0 00ЍM/O-0\M0,0 0 0) 0% 0 000 ) S RP0Sc0$0$ 00 0 ^0W:$0S$= 00嘠 =<000H p  (00Z08@0 @0<5  L8 $  P ࠱DZHDP `l:l \kWhQ VW08 l \0  Q^̠^Q0 ^V-  0`X V%  0r(0 V 0,000 0P(0S } #H0 .`n`@ ?70:P00S"<0S a #H08<ř  ß   . ?P0S 0)Қ08%0`00`F0 <V`!V 80DSL000 SH00Q0 "66 00>00S`00000040"R4 0 40T6rTQR(0@ 0,00 ;P< H0C200000 0'"0R4 0 40q[ @0Sg0H(# 0C8RP\ 000 #8 800#(0(ဍPI $00,0 p-\Ѝ0, 0 ( @  1/[ !p@- @P Pp0p@0@-@Pp富9S ʰ;S  0"`PQ 0 SL0L0"}.0P0i 0  Ѝ@D8E R@(@@@Z@@O:0@(p ,,p0pL W p!$Y0$p Y$p B:8 @j8P80% @DWT $@0,0 $eP 848Y 0嘠0 0 Z$   0 $ R0 8P 4 45LЍ(@@u@ @Lp@  ^ @ `Z>*(@ L 8 <@ @<*8O-@P `R0 pM0 ЍO= 0 P0?:P= 0 6S ЍO0\0'*㸰: 0 0S  ) R 0P0 1R H0 C200 000% P0S  ЍOЍO-需,0 0/\*0 ,\0 0 ) o,0 V00P `0 B2>@ b6<bP0:0`40 `FV`00`d@P 43" 0 @P6<Ѝ8e`@`L`(04S [4oTQ 00 0S14@-P`FX@P0 0@P    0 P0 ЍpvdG-!0P`XM!0 0S  XЍG0 ?Y_0p pU 0 00000.0>000 @P: W000 09@P-$ 0S)9 0 @@T0S3- 00S00E@P  0  0@3 200uXЍ2 1pP 0   00 1@@ÀvdA-@P0@P l20 p\4SQ^Sl4̠  ^P @Dő L0 ? 8<őH 0 ?00@-i ^`  R ^ 40Sp4O-|Mpᜠ0W@P娐`$0p 00$0d0@0 T 0R*Y   Q L B Pb<P" P VUq\PMPP\I 0 00|ЍP$8(L0 C c2#00000P C R 01!01/P 0R0*@0 @!0L A1 a<20! 0 U8PY40 0P00 400Q00000 0P0400CS403U .0Y 000 &R00S P0Y00L0 C# c 9!300 v0 6SnP$8(L0 C c2#0g0!CXT 0 003 UC0 0000$000 0j1PP 0 = 07L0 C c#3800 9!600< 0 |2#l20l2,P  u.*H( N( 0 , ,($(0, SU( ].(  00P 4'0Q0YW@ď000\0@00D0T00 S00!1 0001/P0Q00WS@ď D0T00 S0 1 A1/P 0@00 0 W  R@ @ CP R ' '1/P 0000 @À@-0S    P (000 00 0 <Ѝ 7N p@-0@00P`06/ 000`06/P r00pO-`DMl0hp$00P$0Bc 00$00 0"R 0 01/0f? 0004 0>0 @S0$F F6S0JBS @,@Az`F`$0pWƟ ?$0嵗j1 0000,0 0 0 `P ᬗ yDЍp 00 t J $   01/$ᔗ08 0 ` 01/3,Q (P$`$0`S 6CP  8?P<0 00ã 0 QmN l0A^Pl0740SI 0SF\0X080L0 000tP *\0S| 0 ST0(R00St0,00 1X$X(0h0@0C(0(X @8  X Q :  0  <0S\^340XS@@)@@@@R0*#d0@圀0S0@ @000t)H0S 0S0X 0c0T0(0(儠0"ZQnx`,0x0@00 )1)H0S@ 9S= D0 " Y~P@0S $0d `0}U0 0X00L0$0 @=0P0Ѝ+~0XS$0 80LJL00 L0 0 S 0 00SJ E x0o@P@0SD0  \ ~P@(0(儠0"ZQ@  x0o@Px0, 0} x0o@Pw0SX0$ ( 8  C(0L 儠0"ZQmx` xp}@P9  0 0 6 0 `p埆P @m{^^@A-Mp@ `0. 0?PP% 00 T 9 0C8C890000|0TP00 0 9S00003/Ѝ0 B?PP 0R    A-Mp`0@8PP%00 0@@ 0 9 0C8C890000|0H P000 9S00003/ЍO-,M00`p P0 0 00 P *0 P0 00000 0 00$00 ?}@Pj@0$P@T S@@@@@ⴀH X  R R& 0(\P0@X@Ǒ!$@P@ T@ S@@@@@ 0IU0 XᴐǑ@őPS "440 U |0@P00 R ?R *  1/,Ѝ]]^^O- 4MPRX0U0 ` 0删00Jp ((匎0 T @?4/@P7 0 00\ 00000)c@ "4400  00C00    |0p s`0$H @4  , 0# #88DLS 0 K0 0 p$@PX0|0#880'00 Rd0X00$00|0 *P\P*Ѝ z0s8 0@@z 0 { &@*0 p@P 嬰0 Rt 娠0 Rp000*P\PP*"sr AQoNlqN@oN@oNoNoN@oN-@^@P#sr`?$sr;&sr7x@ 00w0 ?P *ᘍ00)0 pu@Pf9:(0尉000尀*P\P)K00C0F  0 ᳍@@ 0 pE@P6#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P @@@@A-`p0S t 0d0 0 0P0 L\@P90VfЍ@eO-p 0M0 k@PSP\1)R`#@#H*H1 0`@B0 0~`P@`89 08C890 000000@04/@P 啁  0 @L$@ 岁T` 9 0C8C890000xV wЍlC-` @PpTLp T, T4000S-@ Ѝ贀 P@00@ jN   bN 00 0P @ b 070 @gl^O-34M`)R@#*p0 Pሐ0p 0g@P 0Jj@P0 :e0p4ЍpP0 000900 0 00Qd0X09 08C890 000000@04/@Pd 0I2(0 0(0$00S0Ӻ20Ӿ1ш000      01/@PA/ᘐ 0Q  000)\ 00M,t@P&0 0009/@P 冀 0 0L 0@ 壀Twm9 0C8C8900000 90000~dY]lC-pP`UP 0SQ9S B@jd Ѝ 00"P 0!@0 @@ 0L@P  0(9 0C8C8900009 0C8C8900000 00 -  01/ 0y(5d@dO-`!pY\M00000c _[? 0 0@00#3* Bp W00k@000880DP4p<@@Hp9O0L 0800P 05/PP k\ЍHP0PG0 0k 0 [$0 2 #Ϳ0P @0 00 0U* 0R Sm B PS.0@0D 0 DOP000 00S U0 ὿0 0 0  ~k{k0 0 0\00#0300S00 0 000ź0 000,0$0S:00( `L ( ,0A  L 0000000S  1!  0@0PPgꫪ@- 0 RR@ @Th R( O@  p  R0  0@/@-0`0CSx%8<)Q\8uPP PЍp#sr$ 0KP<0SsP`uPP0V0 ": 0S`p`V @P 8003/P $ 80 @#1/P DPP$ 80 P0@#5/PP 0:0^@À@-`0P@ "6000 00"4000"Ղ)`т) P*˂0S< <00 13/(忂Ѝp$^L^c^ ]<+^0   000 0 01/,]H0   0:0 0 01/H]Hp@-P@9`Pڈ000`0 6/ 0p@0 1/]H0 0000 001/,]<0 0:00 001/H]<p@-P@`Pڈ000`0 6/ 0p@0 1/]<00CS&DNNNXNNdNNNNN|NNNNNpN 0X / 0, 0 0* 0+ 0 0/0)HR.@-@`P9#61S0 S 00S0( '0S (0, 0C00000 @00D0@Ѝp ]O-M@P$p`ID` R?PoUЍɯ U  @@H 0L @ 1/P  0 0P*)P !PU `0 R0: 00/S/0A-P(M@ 0HpLP`Ѝ 0@LT T hW000@0 4/0V0/oS" R(Ѝ000@^C- 0" M0p0L @P. !FP`0 R'0 S (pI0 `0 R ` 0`0)BX0  @H@00csT `Ѝ 0@@0 0$000 0 }@@QA   /@-@0(0$S, , ,0( @[3@-@ CP .0800,0$ @R(( ,,03S/S  !!0/G-``pP Z|@P@4P P lh000 Qpq0$0 PIhP ChP =hP 9h6h  M|X !,3ȩ@-! @P  !H- $MH7D 0 < 0 4 40 * 0 0 y$Ѝ3N@N^p@-@ PQgg g$0@sgp@ |A- HP0D`p0C ##R@`V( 01S P ᖥ`0D1X  Q R 1P ქ`0Sp@-P@P p@[0! 000CS00SmP0U:00Ep@O-0 0C0 0 A < ; < 0D0 0`0000C0^^p@-P@ 7gP$0$0p 00 $0Cp@A-@P`"vz$0S000  AG-0P@Sp`P0p0S(W !R 0 !V R"*0PE  1  BS !!  100C000CS0-G-`@$PpT T0 @0  0 TЍ0 00S F0 *0 0C%0@0 00S `G0 0 0C `  0 P R0 0S  f0@G-H`傊p  V@ P B5^:4\P`R  \ #RP  V 0S*0S    0 D@PH00000  #P0S .v PPLP0<0u0S00000000C0G D  !! !R   1   0 S  B!F00CS0000$00Cs0 D0HPD03A-P$0@S`p000$00Cs0 AiO-pPH@,MD`0P 0H(6 0'60(% p00$0s   B0U C S($00Cs0 /P,Ѝ 0 B00 0pAY0F0D$00Cs0  QI$U@ q S0}0 $0C000qG 0  D 0 $ 0$  D `G!E  D0 R 000D! !00SPÎ!e 10$00Cs  d  d  d  d 0RS PYY  0d0S d0S dZ  d PQ0( 0U 0C $00pB U  H  !E00 0U 0A  ! E$0!eEU =  !E0Y$0? U7  ! E$0!JEU$L  R0 B0 0C%A Qʸ 0! 0yE  0!0 0!jE[0$0U% 0 P00Q 0Kd Hd Ed0Ks ?d0 `C0 00C 0pG0Dp0C-P`dMpN1ȁ̑@0%T00SdЍ,0(@0P,0Ѓ(0,0(0SX0(0X , 0(P\0P0 (0SX@ @S , , , P0X0S\ , \ 0RP0SP0! 0 R00R0S"000P%0000S (0X@S, , , 0X0S\ , \ 0UP3^ 0 !6/ ! !Dp@-PS`@!V 01P 0 U 0ap0 1 Q000 !  !AR !  B /A-p@P`0 00A0p@-@P`0S00p@S000 p@0i /-@ $M0 4  *( 0 0 00t$ЍԜN^ @-wP00A-PĀ@T 0S 0p5 0S 0  m`Pdf@0 G 0S; 000C0^ A-PI P P MPp| `P @YPp p:z7E77iT e^@-@ P4`0AAbAT+W5 n@P`- 1@ S0@A BPQW`pV00C00S0S H  Qp YZ @V000`3O-tMp0圀P@`@ᘠ) ` 80 S6 ? 9P 80`1StЍ"PR0%VZY8 0`0 < 08 V8N0I0 08P "SR 0 !580S 8 0J0 0p `|8$:00@ 000R   06P  E; 0 0 0X% H8 NX PN 6V  7 !A$8h0 Sz8 Jp@ `t^^G-Q`p VZ'v( \A0$pp P(00@0?o2X0S/ $ AP0# pB"   40V0X C(00(0XH`$p@p P(p@`,V0h )/Y L@/DP @18@AS8 80< <@@!]35@/0@-`0ML@T LPL   @A0 0,0 0X0@@kЍ03^ @-WP@NO-`$ lM@ ^0@pP 1@N@pP0 * 0x$p @v$zF   lЍP@p  (D70I00 007P<7(, Q0   4/7 27(P, ZY 0SllKz Y 4 4 4 R ڝ( ,"&{ 4^>^]F^ A-?Pp M     6  %:&p`@BT @0 ЍM44F44 0D0 0&7O-$MH L $P!AYp[ `4!C20(2>B"  YV^ |f$ЍO#0 AT  QPP SPUR QP  RQ  R R  0Rm0@P 0 L000 A`P X0P`@ď T0,0 PL`@$Ѝ蠜3 0s/@-@dM" H:P2"@e804`S< (q< # 国 !6 0`e6PP60  N $0AQ0%4 0.U4.H _dЍ 6Μ 0  Y35S(0,#6b3,^4U^G-q  @QU|H`}|@8PU v:'"AR0@4 R`001S B YXP Q00P `U[V U U,0!Y00X0S `"V0P `᭼U34O-@M ` @VsC f %  ! . R0 ?  0SI-!4    BR - 00> $!*ẕ  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO0 @ =P 2 2 2X    0 ,  4 @, [G- P@<  8 U `D`(00@0$V0:Pp$$01Sr0 H0L 0 H0P0L T 0P0 T %R0XP5\p5~`P(0p]^e^O-4MX 09 98t0:cR 0P?d*%(0$ 0AT,0@T ``DF`pfW 0 0 03*$$>(0S, , " 80S< < # 0P 003($ Q( (( ,( A( $,0S8 80< 0@<00"S040Q,400400`0 000000000\0$0`09 0*@"*0 # 30 #6:,00$0g 0! 0 0*⎔h0 d!=!0 \    ,  d . 01/pPF ᵘ04Ѝ0U QZD (@J 0B!p&:d0 R  R *Z ᕕ ᆘ,d3_6Zd0$0 S00 p,0W k 0h 0 0,00 ``DF`fN[u^O- 00S #6:(00  $ (01/#P1 0B!0S@(060``0T:0<Ѝ0@s 0,  0J0S Y7 uP, ,W20З 5S0,$02P  , / $0  0  ,0,g0,J0,0, Z 00 0 0^0@-,A,Q0  M*[P & [0,0,  P0 yQ0$( R*0 000 t0&jP pu ,#004 ,0  $ 0,,Ѝ0@Q ]^8#8^(N]^/O-pP@0S >8"< 8"$!< R$! $!+~9:4P8<040P0 H04 8\ P 4U@d\ b  Pc a\cb R t p  l 0 , c R$ Rd$4+$P  $  @ P$RPp$X w$ Ѝԝs^4[G-@ጠ@MT:@ЍPp! PpWZ``X`VEW H W@ #I$`[@-. .   Ѝp@-N@N@`P@ l p@4  O-@@0$M^00`10 NP  ^P  P(`00@p5ApF0Y0`$Ѝ0  $0P0S  0` <+P D( zI "@0 Cjԝ4[{^O-N@N$M@00Pv`P%pİPAeX0垊0 00  00]$0PU (`0 `  v$Ѝ H W"@0 z^[4p@-P`N40@N@ 0b p@v4[p@-8PPp8x@4x0P3#p4G-p`䀟V@0 ᘬ 0SP%PU!0A0 0S0S  A+  0S 0S0S##U `FP-P 0 ^A-Pp`V W @$T@A0S0S"000""`W@0 0p^@-@ 0.   0R  0.p@-0Pp0 b"@"0S d""o"Rp@-@P |U x p@O-VlM4, $0 00S@lЍ40L0,0P00T040X00d0XPX` PLXo@$0 S 0$ 0CAP0``X000 00Cd Sd05$0(000 P(0X00\0d080D0<0H0S  0008 R0K 0H0S L\X.7Sd `0< IpP] 0@ P 0  Q 0S `0L$ Hk@000p >`0 HL P r #Rl4 0/\ Zf 0 6C0,0 6,0_@0S `0HL?$0 S @v0SҊ!000!!@ 0S ( `0R $@HpH0Q L@D`0 ( I @,0DHD0H 1/Pb L`0H I"HD  01/P #Ph2 d0/ }LWX D0 @D0 0 &X `P 0DAP LD 0 5!D DA!D 00 0Y D 0  E!CY 0 "D'P E D00 ]0 ? H@ 0 pP0 pp0p 0!pP 0D00 0    00@Y000唪 LKD &LP T p( H)L^R^^O-4M\$0X0 ` !,PXX0U@)X0 pCW6p  $ ?0G 0 ,   @ 0,p4/@P #T$ U  Y4Ѝ &,T  @qT , !w,1 0   "@ 0/ MP^/+p@-,P,@0 p@5Ld]@-`@ 0 ````"!PP 1" 0@0 0F 00 01 0S g!ЍpA-p` 0 pppp @P ? P!"p X 0; 00X000C0@ 0`; 0! 0XD0 0 !XHW1 0S1  ( 000ЍІ 0S:0P//0 R:P3#//p@- P@00E_p@W _ꀥ0 @0 p@- 0 @`BH0PS   DD00 $p@%p(0, 0 (0, $0Sp0Spp@/0C-00p0(`$@ @`<Ѝ/O-_@N^G-M 0p` @`+P0 P 0 0 0 0 `@?o2P0S0S 00S00Ѝ R 0000 0ZP @0A /R0C 0a000/P @- ^P010耥p@-@P` ! 0P 6  P R0C P 0C0060@* 0 0T 0P3#pP 0Q ppH 0R  S01 R  S0100S/0/-0 0R 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B %0Sp@A-Pp`e@P *0H10@0P  0 A"&D&$P 00S 3/000L00L @ 0@A-00@SP  Sppp 0X  S```%0X   B YWW 0 R 00W K XFVV 0 R 00VA7A-@lp`0S #S PM0S \ყ000p@-P@Pp0S p000pV030/@-OP 50@-|0$M@0:lPl 0@@@ @@0P Z@0 00@@@ @@@ Z$Ѝ0^^A-P`pP @)0 1000000 @ 0@AA-P`peP @)010 000P 0 0 @ 0@A0-0\ ^^ P Q : Q*C-p @P(P Ѝ`0S 0W  0S0S$0SH0SU % 0QP0  00 I00 P000U X `F,p00 `p`` Z P0Q00Q0000C0 00 O-M000@0`S@PT @` 0 Ѝ <0 S:)=0#Z00S   X#< V@00 R0V0% 0@ 0 0CQ 5:0C S 0 0 0 0` p P 7  0P UV00000 0U0 0 0@S0#03R0#S  0 00 0` ep P V00 0S0 PU 0S:p 0 V  P%W \ Qp!*Q Qp!Q:W  Q *Qp!*Q Qp!PS*QY \V:PQQ*V V  BS  S: 0 P` p6 PP0S9:0P V0 0 00C S 0! 0 0 ` p Pp V0 S 00V 00 00C 0P 0` p P 0S0 SS:W V 00 00C 0 0 p Pp9 0S*VPPV00S  R*0S*V00PO-"0 SA00T ~0@0[}@@-P`p $SU@0 p Ѝ耧Zp@-H0@SP 00p$0p@@-00@ $0H0S@O-@`p<0Q1RP1P!U`1`!M @ P  R* R W R   0 R R % %8 40 Y U 000  P)0<0OUbЍ R F@ 0R `0 0S  C  R    B     R ` F  0  $ r 0 LLZH R  S 8x w| X]^0O- 0PP ph@0000U24w0s 00ĜVPY 1!@0W0 T`#`2V`0V $00Y `$0 0S 6>ЍpWg 0 0CRb00T"hD(000n $8" 0000H00SWB;08"5F,H ,0P S""D00<00+!D%"D%!D(0 00 0dh00\`0"%D@0D0<0<,020@040080800400 L0./L 00C100L0 @  0L0 ! 0L0 0 0 00FN P00@X r0 S0 S00P0$00 0 0H00 0ER[  0 !P P@H O``0s\  3h]]]@-@pP`MQ  0p@+ P =ЍG-40@P0`Sp0S 00S R 3/000y0P< 0040@0 00y0SX@`@@O>O|>O>O?O 00 0C0 @00 0 L  00P 000H0S 0@0S 0 0@0SH0 S S 080 540 01t=00000 00P 000HP 0 D B"&0DH00 $00S 3/000$00@O-2@M `W0r   0PP 07/Ѝ4 R 7/P@QD0  | 8  $QvS 0r 0 0 HP   R^ S [ 1q30000 80P[ Pq ,0H0S H DI<0P  0  000:#:00 00H0Y 000 $0 03/0 `F(,0`0` 07/ Pm0  DI0P0H0UONNp@-@P0S@ S dS003/p@ H`00CS0.6^- 0 ^: 0R:  0 \ P00O-i`0@@ 0 (0 $0"` 2 QM?Up0 0S?#03@, 03030300ߍHЁG-M`p` P)0  ? t1Ph1BU/PBQ<Rk @Z ! 0L@CT04 ,  0000<0@0D0H0P0008  0000000 0IЍ41L0 0S S 0CS Ƞ LȠS (QP0@HDH 1 S*NO@NLH0a/Q/0S //C-Mp0@`00 0` P0 P 00 000 0P?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0Rb*^ 0 B 10^ 13400,0堰0#3[ 0I: $ ^^80@4 60  0 ;P Y 0 03/:#:S^X  0  0D %6SP0S 0P 46R*@0 x00 0Po 0 i[H0ʠ,ʠ 0C00S >0 0>000< 0#03\03@ Q03S/O-@$M:#:S0>0>0 T*4!`#60 0 0 PP   VP000% P 0 0$Ѝ R* Q R: R ! 0 $p  PR0T :0 000 R R:J`H[ W 0T:W F[ B[0!W00S 0 (,0 D 0 P[J` DDP QP]O-TM( 04aP40< 0TЍ   PHL @\ 03:N@ @@| 0C400 #@3 S:<0S03:QT0Pp0@0<0  P0P$0 0 0(0S 80 0D00@00<00 0H0@-04A 000 00P Ѝ` D"Q0,`d^:0 P#H@-04A 000 0vP 00 sP ЍQ 041, 0` P/ @-410HS4 00,00C0C/00>00pC-0$M@؄SP`p0 0Lp@07/p `P ,0 `00000 0p0s$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0   00O$ЍO-,M\p `P0T@ P(X0S0 0S0G| 0 W0w W:<0S ,ЍZ P0pG0 0SPZ p0$080$000  KPp+ZX0X X0 !0L @0 ." @    !\PP   QU@TQDE 00 "0 0Hĝn^@-X0S:0 0B000 $GR0\H^A-`Pp@P@PUPD0S TG P  YP脝^A-$aP0AS \k0!>00000000 81nP 0`8U 0CS*MG뤀p0W@kW0``N@N@W\0hЍP< 0 TeJPH^,^[Y^O- B 2` APp LD pW@@qpGq@P%q(0崁!S00@0D 00@0 61A@0婕0C@@@ r0 ᄠ0 S 0ppGn@0  S0P N  ' @:P 0>0000000x (0D0 , VHI  1뛩*@8{^HB}P@- p U Ѝ/p@-`P@D,0`P @ p蔩0@ꄝp@-@lPQ`00 1Ġ  S0 Rp@lF@H^p@-@ Q] Z :p@ 9S@- 0pt0SЁs@-P@ ` `"""&*C6z 00#  0+ 00 0Ѝp@A-@ PP` ""&*C6b U`" 0p P(,`0p S 0: ` S 0; 0`P ׉]]@-@`P0plj0:0F0 p Ѝ0 /@-@V0:00M0 Ѝ/"&*C660S/Y 0S/] 00CS0/@-@`@-@^ P@O @-0@ST000`0S/@-@F P@; 0nPp@-0P0@*gp@db@-0@ R0 @藉00唉@ A-@ P ""&*C60S7 0A P  0; 00  0:0 08$0 00S) 0SA0S 0 00C0 A 0 ; 0(0 0 00 0S0SPU 0P `V' 0S 0x0oU 0  :0V81` 0 >>rR P A0S 0 `(0` 0 01sQ羈9 0 6 &! R  010@ 0"61@ 0"601008 00000ֈ`6HO-M 0DP @@pH렲2 a  00"603S P0 PYYHP PpDY  F PX ("($($ W     " "g 0C0W @(0 0p,0:  0+ u# X  [0^0L PY 0 P0 P0 ЍP  0PY T  R * R + 0`, P   H^]]G-p` PᔀUY GA0Ds 0 0 0 0 0  0 0bP0 00⮇IPp@-0@ RP0 ߇@00 R ؇TpP00χ00ˇTUpp@@-@@]p@-@P0p@G^@-  @-  @> @- 0S Q ꒰P0Sp@- 0@ p PoP U  0Rpp]000 //000/ S0/000/G-@0 P0LS#%"&A6p pXl`P ` *6/P0U00000Ѝ X`P `*6/ZZZZ@-@QPЍ@Ѝ /A- @@Q P`Up/ Q 000  0 (P+P0@/@! R!/! !APT `P 00S 3/jWe 00S Sp@-P@`Qe@pe@/@-|@|p0 S 0S``&0000P0Q &0( Ѝ谩H80@-@t0tM@@@0 @LP @9 @4P00S 3/@TЍ0X88]O-ph1,M`ဓ\1PLL1H! 0006001 Y,A   0 00  0 $$ P Y R 0 50 04$$pU0c$,Ѝ d X 0L \0 `PEzHD8 ^^@-PfMu`0@dc0 06S 嶅0 0TЍ@pM 0 p`0@AX X 00 0,0 004U Ѝ0@ꄝ$^9HV^̝X@-X0 < PD@@0:@0P@PPH9̝\p@-`Vp(U@QpCBU 4  10 10  P000pHP/@-aXtTH0, P<[@(,@ R R0 0\9H̝A- 0@S0p# PU# ^P`#Ճ«ᐃ 0S `U 0S 0  ; 0 B 0SṃP0S`PᭃV p@- 0@  P P 0 0p p(0, #6 P O-(EM 78 5@5 `BpPP /?4Dt#4L 0 0PkP 0S 0SDUBp40$0L000 ` 0V R 0 `3000@00 0S$14{- @ P <Y  88 <P/ 8 <D@   <D P   (,! p D 04@ D 屪<A ;  `</a@0P[<0P<|:T P0R;$ 0 R00S @ @{^9]Ov^H^̝lX\P@-P P0XA`hA<0@@@  @ P PЍЁH0  48 h0Q8 D 8 4P  BP 00 4000L 8 4 L T  T 0$000/@90  48 l0Q8 D 8 4P  BP 0400/ 48 $0Q8 L 8 4T  BT @9@-04040@D 8 4 D P  P 00 00@9@-000CS ܜOOܜOOp@-X`PP@  `U@ 0|,0@U v@`Tp999 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dO-,M2BPHQT!LaPD`@!pqtPh``1 0 A0 0S000T0Pl  x .#4 0!$,#4$00 ! )4Q00030# 0,"#400 Y00030#00#"$ ,R,Ġ0030#0`0吣* Z+0#*0Q030%%!0^ 000#*0Y0003 0%%0!Q$ #*R 3 %% !0  PP 0 0`P P 0900H 4< R80L0$0@H@H0,ЍO蠀Ё@9Щ9ة@-8@W00(< R@@ 8L @ <00@芀@9ЩO-$D R <@Tg 10`0 19P s< @0R!80L0@0< 40!S<018 L 0!4 @0 pWI 0 SEP> 0S; KP!000xP.0S+ u8! 0$0 0$.CpW @0 [101]ph0 S [ \0R0S @0 @0D0@0Dx@9ЩH ة]`]O-\MP P=9A0a@0 0  P < @0R8D@ 4 R8< D40@  ppW U    PPE0S o^ \ (10(1ק@ Z8 D @ \Ѝ@99H@-@S^00000000/000/0000//0M0 PЍ/00M0Ѝ/P0P00Q0T00/@9p@-@ ~P0@PD00|`HP !L0g \ c h _ t[ PW 2S p@N@9O@-@ 000/0TX0P/@9@-@@~% 1( #4<@ X0S X @~@9HG-`Pp娀 A0S 0C0aGe~ A R 0PA 000 ~000 ~~@9A- 0@R110@00P~PH`p0 S1%Ah~ Q0~P 000000~@3S 0R@9@-p@ l\ `h Tt H < 0 @@9^^^^^^^/////// 01>.2h !0S000C0< 0S0 00 00000/ᄝ@-@P R00 O-\M`0 PSPS@#@2T`Z V0!:3A00C 0000@0  V00 [0S ` 0" "& '(0, 0P0ÂV 0S ik'(0, 0P0$@#0#6(00#6C0#60c400,0P0P00 ,0S$0S`d\Ѝ0W,0P\4(0Sr:Xn*+@LP@!@1-p(0S`1`!@D @@0S807PpL X@1@!p)@DpW @`1@0p0S 8040C $ @@D @@ D0<0C Q<0S80C[ 0D @ 0@D  N A@ @  0K00$0[ `ZV`t `0S pP0T00Pp#6$000c0000c(0|0K640 6,0P `n 0 pppp@P` 08 0P00SP0TPP00A0 S00R0SL 00P`n 04 F@D@0@ @ @T@1T@10S (00T@1a0VSP10S (00UP!, 0ES0%#`F :0T* 8 08 ,00U: [@P[`PP(|$0* S$00`F  0w  0@R0T0 0P8 00000 R0T0 08 0;$00@0P 00S0So0P60S/Y+*PP U P10Sp!p1E W-PX PGE 0KS00 0[ ~YP1 P!Pp1|E 0  Z PP `<A K@^H^(^ {(@0@ 0Q @-(7, P0/,^/0@//(0( 0\, /0P1,p@-P`@, \15#$ RQ \$\J* Ơ     R p @T@D`@ \7,FPT,`\@o#PpA A  B RT `V`F` V, @,LPp,&^p@-P@m, 05# Q *  R  p\ `V`F@` D7,DPV,@p,&^O-01M0S6p`@ VP50 P44T00Ѝ V,0 `T%"0 pp  `P 0, S,\06# U,J ,KPHG^m^^^,p@-,`\0\P0Sp/P$ \:\*Q L p0C?0,p D00P 80D0S , (00 P///,@-P@-PA@-P, 00  ,@-P, 00 ,@-P, 00 ,@-P, 00 ,, 00#P00 /,, 00#$/,, 00#(/,@-@P, 04#(,,0G-pPP% I W6P `@G$0<`@`D`H`L`#&#Q0R*D  00 00 0000yp,H7@-PPP0"D0H@S 03>80=\,0E$ Ѝ0000ꄝ,^^A-,0d@ 0P@' 0`SS@ 0 0, 00P@0E$0 0  Ѝ,s@-P0@D0S 500S| TpP: \5`A P@}5,04!`P$@Ѝp脝]^HG^=^a^^,O-`p@PP3 Ѝ Xlpu3 PdD0S0S X=*0<B5,0P0 0! P X1pW-5pGp,0`d&W,`,F@*D0S  B , $S  P P&` ,0D$H0pp `A ` ,3P]^^^,&^HA_O-,MP`@` V.P 0p5P@00㘠N@T ,ЍX PPE%&$ $    01/ 00@00-4 $M  ( 000 0001,$Ѝe_ @-W.P00 }.QP@- PA @Q0/S 0!  U06P`0!R0P`!R AQ:R 0 o0P`pWv#P `p S 8P`P`P `0 Ѝ U000S00Q RA- p$@`PX&w 60 003塠Ѝ l00S/P 0 4\ Q/8< Q<  #  H00CH0/8H P00S/P 0 (Q, Q/80P  /ľp@-0@` PU` S R   00 `800l <0@8@@H00H0pQ 0 P0S  0 zHP0P/@- T000 hT0 @SG-@0Q00P00CP0wfP'P""R,40Xq0S)4aD140P "!_wL00CL0$ T00CT04:PR3 `Mw000P00P0w`0``FV`C`ptw, (A0H,P` ` %H:]k_ľ 0 D0@-P$0M 0 0 xЍ0(QO@-(0 0600vxЍ(QO00@-  v-0 0000 0g%@P0 S 0` \ WP$D6p  P  @0S %$0P000CSlOO\O\OO\OTOh`P0S |%h' $0T T0,0h0X 00m#\,`P h@h@p0S@0P4 4bW s`PrP@  rT n%hPc04p00`S 00 ($ ra@P rH %HE@ r$70$ 90P0 [. !`340XY Y" @0P $30X ""@P 7rqrH%Ep ?4; fj0S0F0Yz 00@2,2P0X020 0 4C#"#04>0CYCF 0TI,  ,ı !(0[;@P0S& T!0S    t 0l!>P \\-"h@Pp0`$0 @0S0D0(0(0,`q00000L L P Pq@MxqzP\q@0@q @@Hľ8.`ˁ_E_:_c_t____ __0O] _O-1 0S H0Sp+匙Zq젟䰟0PUx+qOљ@T P 0! 4  C N `   6qV  XV+8 <0R<00# H00CH08@ľH(_:J_<_O-0H0SG0` SPQ@ 00 qpW R00S/ @T p 0$  0 0S0p #R<00# 0800X<0@800 00 0T0 0T0q(8@ qH:p@-TPL0S@ DpdX40 0P@T@@ppH:ľp@-@8`Pp@eQ$P$Pp@p:p/p@-`LPp@( F0I 00C 00TATp@p:H00 7@-@HPDt@ ,0 6 @P Ѝ0褜@-@4QM }0`Tp@!N@@ , 0DP0P3P#\P#P2U ~p PЍ0Όƌ R pp*p0 0P0 DPP00D@#F@ZpP B+00C@#FD00S("06BS-XN, !004 0 #6:S"&0:///0R/.  0 '@-@oH0 0a@pO-$MPH0TQ@`LpP0#0@ 00S 0S6ݗ0S R0 0 6 0`P0 H00\XTPLp$ЍOn  O-Mp800800  0<0O<1@0H1DH00 0L0FL0P0? 0X041T(2\00/S@)@T& 0`@hP`0 F0PT00PE 000 @"P @@ "P0@@@xЍ`Ps@-@P`QBP Ѝp@oЍp@- D@P 0S1(S"3 SR_O-0M3S `P@P1S S @ 2S t$;$@P $Ѝ22 0 00 00 0$ P $|@vF  000,080400"R0pl0@0T L0L00 0 4/@PL0>[(0` 0@ QD T! 3P0P*CP@D@00A $=@Wy僒Q'0&0CS$-@6 000p0 0$ Q@P $i00CP $@0 "R"T@10 @ " 0TL0  82$S10S,0 40s0480WXQ (0tD041X00  L@P t0t00h0S6 @B 5 J>0LH00S S00 00L00H0 @P HL0480 ,p 0P*,000S0080@" @P00( 0;0@P40【 0 L0@PL@P5S7S 2$0$00h 0 @P 0 <0(0s(0D0 0P(Q $3.  l0 B0 04L@<00S04/D0400(000'(Q$0, Rf@\\@Q R 1 0P([+D0< s0D0D0P0C a00D000H00 4D0@P0d 0HR:0R050B0005D00D0 0(  (   . Q 0 0A B4@0 0CD00@0S $/@' 0,@1!00 000L000H00 2T 08 S0002 02000p0h@|0l0 $03/@P 0@H0 @pxPOA-@pTP` T @ RPUp3P  R@'@P Q0P ]0O-x0bM 0FSP&bp0 0`0 $_PP  PP0 2S   0SPЍ0S @ T 0@0$ 0  7P  0 00 @DP@D0P@Dp 00 0 T@-P@`pP  0 00&PX0@0X0 ЍG-X0 `Ѝ0@S P `P 0PPPS*0 P000 S S S 0 B Q  p R R0 R 0g` RQp P   FW`   ;`{p 0ڵ00X $p0 $0X 0  0"=`P0 L<` X0V X  R"X0`P 0X0 0\0iR 00dX0"Up\W L"w pP _P P P? @//ሿ@-04`*p"*0C00@ 0 `0 8q> 00. 0.0 %0 (034100 >0#60ЍЀA-P@U 00 ` 00000p*U`  3"`谿A- $0p0 $0 0@R`P:    U@` P ;00 00$00谿x @0D0@0D0S/p@-@P`0S000p P P갿A-@T1  0`/ @+ P4"p@P0|000A0 q 0  0 0{@P 003/Ѝ@@-$M4a02@00 0000 PP0p  @W 0 00 .  00P$Ѝ0@-PMP 04@*"*0C000C0 X0  00. 0.0 PЍ0@Ѝ0 -,M $002040 00000P$0S,ЍA-X0 !@ 0S10$#@04P,04 R1D4(2@`Dp0F@B` <`FR  0H0Ds 0 0000 000H0@ 000 0 @@ЍP$0 0!0 00 /@`d@-0`iM0 0 ;P 0 iߍ@P p<0 tpv Pd  U00> !0pˁˁxˁˁedAO-4Az 4M(b$sS0S b 3 D mPD202 000*09PP Q0  00 倲倢 0  pAT \XDXP`<DP}P\DP D0/S]0`00FD@-0` 0`Q s0!00  "0PU ` P20 T | 0S 00PrP;0 0C4/,P000 P0@P@ 8 8P<`ZP#$ ,B00  ' P0T0P0S PvAT00hЍ_O]_ 8_s__]__i_ _w_N^___|___@-<0CT 0 !0  !0@- ! 0 !@- @0S 0@凞ˁˁp@-T0PO`d !0UF Ϡd 0!T@!p謩0@-0dM0@ 0 Q00 P00  g@`T#ʸx@Q   4/0 0 &#: 4/?&6 :  \ 4/dЍ0l@D T")^B_w*^d^*^2^5^TW)^'^1^M_`_0O-P`p'DM,00> 0 00P(`$ p>0,0> 0> 0 00P(`$ p+'0 !d> ,0  00P(`$  p 0 ,00!> 0 > 0>00P 0(`$ p 0 ,00!=0= 00 0 00P(`$  0,!t t= 0 00P(`$ `Ԭ0,0 ,= 0  00P(`$  p0,0< 0 00P(`$  p嬬0,0< 0 00P(`$  p嘬0 ,00!D< 0 00P(`$  p儬0,0< 00!;0<$ 0 00P(` pmS0,0 0$!; 0; 00P 0(` V0 ,00!P; 0 00P(`$  pB0 ,00!ʟ: 0 0 0P(`$ ,0,0: 00!: 0: 0 00P(`$ p0 ,00!`:0X: 0 00P(`$  0,0: 0 00P(`$  p 0R!9 ,0 00P(`$  `٫R`: 00,!t9 $0 04P0p(` p«R, 0 00!90 $0 04P(` p婫R00$,0 0 00!8 0 04P(` p呫%0,0p8 0 00P(`$  p}&0+,00! 8 0 00P(`$  pi(0,07 0 00P(`$  pU)0,07 0 00P(`$  pA*0,0@7 0 00P(`$  p-+0,06 0 00P(`$  p,0 ,00!6 0 00P(`$  p-0,0;$0\6 00!H60@6 0 00P(` .0,06 00!6 0 00P(`$ p٪10+,00!5 0 00P(`$  pŪ20,0|5 00!l5 0 00P(`$ p尪30 ,00! 5 05 00P 0(`$ 嚪60 ,00!4$ 04 00P 0(` 僪70 ,00!4 0x4 0 00P(`$ pn90(,00!44 0 00P(`$  pZ<0,0$3 0  00P(`$  pF>0,03 0 00P(`$  p2?0 ,00!P3 0 00P(`$  p0,03 0 00P(`$  p @0 ,00!2 02 0 00P(`$ `A0 ,00!l2 0d2 0 00P(`$ pB0,0<$2 0  00P(`$  p̩C0,01 0  00P(`$  p帩D0,01 0  00P(`$  p天E0,0L@1 0  00P(`$  `EP_7P___47P_pܐWI_R______EP_ __CP!_4GPX^P_,_0_8_@_H_X_`_m_u___4P_|9Ph_CP>@______ 0 00P,(`$  p4 00!4 0 00P,(`$ 5 00!(5 0 00P,(`$ ݧ 0!h5 0p5 0 00P,(`$ pɧDЍO- 100a,$@ @@ @P 0(00 00a,$@ @@ @P 0(0l0 00a,$@ @@ @P4Ѝ_^_Y_3^O^_c__-__P^_P ƒ #60 P *R  P 0 / 0CA-`0@~`P WP(0p, UP1p1:PUp0S S0 0!0d P0*0d0Z L0 0!0d qP0:00 d__@-L@P 0S  q00P 0000A-& Uz@p `PUpPz?00ST ~z<0 80}3z_d__0000 z0@-M 0000P 0`-@PP8 @P 0 @@0@ 0 K@P ѻЍ0S ) @""@P @0Dp?@ @Sp"@@Dp@P p y_0S@|!z0000唻@P K0S00p 00>@P _YPO-䒟M0S@ 4X y0Su,0 a,0zX⎠UQ08 0(sQ0(@8(0H> C'ሣ(@HL (,P 0L P H BRP =)Q -HP PH8( , <@H 0L pP Q H =)A -BLP H!HP CJ "?P.001`P RPP0SPPWPtU`፲`P P 0 0=0`1  PP ec0S P UP 0LP80S101?1?11` P@ V@@pp@-@HPE@080C@00S  0 1Fp@EJ@-!2 !@!$!!!r!E0!311Sp@-@P@ [E @0 S:Fppp0@00@TPS 0  PE003-EEpJ __K02p@-1Pa@fp@-@@\Tp@-!2 A!R!!r`!U "!P "!001Sp!AA2S^ 20Q 0 0C0CSQ Q 1p00Q2-  a>Q 0 "Rq0 o`/O-MAQ$ 408@|9ЍO͐Q3$0pS40$000 00?o 2?$0GS!0 00G?oR20S0G?or20SKWD`xZ 01x0#D0D4P$0(0U L0S9`0S6 0Sd0 S/D`080 ``P 0 @DT?<0xm`P D ` D1@,0000,0 0S` DD<!mP00 R 00 0L0L@T WD3$ 0R 0 S030#R0S 0@0|Dd0@0234(Y`x XV0X@\00P XP@T`Փ 0d V`0(0h000l040p00| x0P00P xT`忓 0V000P00P T`嬓 )0V000P00P T`坓(0S V0000P00P T`匓"*0V0000000P00P T`y@0000 000 00t0=D ;DD0( X8` CVM(0 0(00 0C0W0 0$000Cs  0002`W l@00S0n000< DW(D$0S 0+40ЍˁOOO-`3|M34cXV3@03?0 |ЍPU@Tt3 0,,00,@P 0E@0C8C434pPU L0SV`0SS }C0 0000P 0@CTA?$0*lP: C  `C1@00 00 0S! 0S  0000@T  HC00S $ 0R C0000?S0G 0tC qC/C$kYYP134W@ 8 #0S1 0@0 0D00H00L00P0 0X0$0\0(0`0,0d000h040l080p00S<0t00< ti 7C@0 8P0@p@0C00$00 @T0 4O40 HD00H0 LCP@00S0g000 C`GC`,JˁOOO-@QUJPHPP>UP@pT 0d34[JPvtO2MR  !Ѝ/G-pP\34a !@P   Ti@-@Pp`P @ 0 W321001  @ @ 0@t 0@P ЍO-upWpMD@P\31 0 00S;<1 ` = 210030 10 )11 R`` =%+ TnX \PP P3 4kV l0 Ѝ34 =60P  =  ~K _0Q`/wt@A-@PxM␀ Pp`x dp` Pn=T eIP  ]o,=xЍd^IP 0 }oOA-pX0X`@0 0"+ P0(00 p 03$R34Q-//-//-/-/-/-/-/$0 0!0 00 /@`d0M0 000  c P0 000 cP000Ѝ/0M00 P000Ѝ/ M0 00#0 $0  00#$0Ѝ/Q7@-P@ h<`0 R 0SP D00000S !0"PT = Ѝ0@Kp@-XP`@ PD03 1pV T( P p#p@KdL0 100S/I@KTJp@-P@<0.p@<@K@-000S :  0# ЍTJ@-@0S0 R000000S 0s0000S0St00ddWPX00SL|$A@-0 0 0 Ѝ@K _ _](TJ0L8L7@-@P ƾ ah04t 0G00l00p0000 Ѝ0`Pp@-@P, ᪾00 00 0X0$00(0tp@%ꐮP@-@ 崡@0 -+`@7@-@`P0 0 00h1S\P\0Z_00 @00 0 $00@0 Ѝ0 _M _ _ _@-QaAM0 0$0 0S$0 S*;01S< d10\00q01;W  +0   ; !(0,0(00, ಅ \ . 0R1!0CQS B0 00 VP x.S1! B0C 0;0  8{xL P@K0LPuHK]81 _` _A-P|`P p吀H0L,A0 U P#H0LTp0    0Sd;|03/0S;@@KTJ@-<0CT 0 !0  !p@-80P@0003* pxL0@- ! 0 !A-p@t` PⳄ0S C C S S T00S F$ h0l0h0lA@K@-00@0wxL0@-A 60V0S: S>cG5@P0,aWV@ R[pĒ0VSB s5 .5p`,b'5200 00< @0 @@ C 0(p@囖@-P1=@PS1`Ѝp 1xK1t0 0@ 0000L`P <1 ` 0D@ 0 0<00<010Q.1OP@-`@P \0@-@\0@`O-8`M@``X0p0X00P011 00@PT``o Dpd0 0H0H0L0L0<0<0d0@0d0000 $`%0 00"00X 00{08005 <`$0d0/(00,  0@01 0>0~0 0 000p 0`P 0 0 `100 0!#4#0 !AL 0Q0O0X00CSX08sЍT `[ `A-pP .`P' 0   ( H @ 0h8k"`0@@@%+3 2 034Ѝ]_A-PU@D0p00`H0/!30]p@-@D0`P/!p@!0p@-@PX0Sp8&UpA-@P pP/80 @ 0P  0X0S/`r@0X`803V00  ///A-R@P` \p/H003//H 0 + !01 0 R)p/80% @00C@0 0R 00 80080/ /H00 LA!#4#0!10  /p@-@`P @0 1p0 00F=00`'t` pA-A@ `p5/@0Q0@ k/ "U "h P 400 /,0P/0 0R03 0@2#/`p@- @`0PT 0T@)0,[@P"WPP@ 00tfWhWP ,<XW0P@p LW@k h Bp@-0` PA@>TL ppA-P` p@0U @TP . A-P0@(PP3pb..@01@0.1S1S .w.8 HI1 Q  PP10SPH0 0///@-@,M  00<00@00PP  P:廓 P,Ѝ( `P ;pp/.0P`@00q 0 0"b.0 :P@-CV@ Sh`Px_O-P 0pQS dA`2V PP 4|V0 s tVPQ# S PS0P P E h[  ᳰ  P(  S% 0T 0EC1 00  喰V002V`hp@-@P 0S UP |Vp@P\VpPU @Vp[ PP U PVphA-Pv-hAT H0pS ``j-<0$ 20S$0 -@A-x]A-PpᘀS-ATA-H0S ``F-< $00$0  eP$00$0$0S o-@x]G-`p_AT -P0 C;00",`4(0 00 0<0!$00$080080101 C-0S 0H0/]O-sM 0(0 0P$0 (0S (` @1S 1 083/@P801$00000 0 0S 0Sx 0 @ (?sߍ 00S0#001 @ 04/P0`2,00:00 p\ TP 0S8 U@1S 90?00@01 @!04/@P10C1000 Z T @ P  j,1 1 R!Z PՑ0@ D0 000 0LH0 0<00@00 00!)H0SS  Q  R0Q @>0!#4# 11 \ p",H003/P@qPpP \L,0 0@,80080?,@@+ @ +80@08080 R08008 0P@0PP0@0 $x ,@0 R 0R PUj +Q 0#$# Y^  S Q Q  11 0R!ŁV@\+0P+80@080H7300+ pTW Y T0@,0 `S 0 0C 0 000@w+80@@0806300X0S  ++ a+ @+ 0<00@0= @1S0   532 0$0P1S: H@Xzp0! 00@lpPp` h⼭0`0xP%+0010@015w  8@P@0!S&1S XHSpP@qt@ #T >+@ 0S 01! @04/ 10C 0@0p00h t0 p00+Ȁ 0 **0@hT8 X" @   R S8@ [ +Z  **Ym Q   h T81 S *~8  8 " 8 @  B@ \* * - **80 0Z!080@00C@00H0 0SY 0 0 080P @ 8 P" 0@0#800 @00C@0*   O*M* 0S@08q* * 0!01 @04/@ 5*3*0Ȁ000 0  R   T RM 'R 00'@ 8FY* W* 3/  $!080@00C@0 !00 0080 0 0@@@@. P0r\ )000H0 0S 0040)H @ 4/@40*T * *6h]@-,0 00000 00Ѝ]p@-P@Tp`UP m@G-`p3bM)1 PUG)P )p@-P@``) @I @p@)p@-@PP{) 09 0p@)00/A-@P@pT\`i)H0000H0)@]00/0 S  0S o/p@-@PPF)80D`)P|)k80080Fr)p@o)0 ]@-@L傓$PQ 0 @ x@-@X0 0dX0 h$`03$"$H@5 pP tP @x0@-P0M0@(000TЍ0)0 0 @ 0'H{x 0Y{xO-p`@嘰  HQ:/PDPWe \   0P ?P Ѝ0S 40A3/0`@00@`XˁO-dMZ@$ ` +ג0T L0P $0(`"T I`P8p$p- dЍ P@`P$0匲p$p .41 00<`P P/TxP W0Sx@"2PPs"(BPPm00h( 0;0"PP^2 00 0000P 0 }PPM0$ 0C0:P0 1 T01 R " ` !l  2/`PH0T S*P S:00S418 ,0 0Rk pP ptP tX ZxP P`PxxO-hM@ `@pZP+0xP@@0/S WὑЍ0 0 S?@# ,* b0 C /  C41$@ O00<`00 ʈ` PV@ k`F ި0W@C `F` bxO-,M00`\@4q̔ 0L0 ?0OX+4 e`圑|4LP0010 0,0 p00 00p0P Y,0/pt0Q0*#P$00 0YPPo$0L 30P0P0 0PhP|P ᙩ0(0L0 C5<0X0pPtPlPxP⊩&O >SPP wX0`QH`P aP0S X0$P0PX 0$020 0PPe`1$ dQ0`1T0S h20X T 0$PPd1$ 0d1d`1l H0 0000C01\1 $  BX! 0D 0TRg:D0,Ѝ H @k v[10S pa 0 [`10`1PQ\`QX00X0 KPPP\`CX00X0 EX0 0dX0s$b"$$< H (pP GtP ChNN E/o\0"0S R 0P PPxxG_ _@MRRXˁ00S/ P 3/@A-P0 `p00l 0 0010 (@0XP Ѝ PP'0}P 0@00 0 0CS 08P`V pZ.Pp )P'0VP 00@0G-PM" @@M a0 @@9 gwQ1 010;0 @00`!PpH(@T m`X,W/AU1@P _000` S&Ѝ 00S S S pp@PPxxl 01@ 01p@ 00P!0 R @M8x _ _d]2^C-PPMD (@T* $` 0`V@% @T5 e0Ԑ03/ @0~p00~p 00@ 0 ˇ@P C003/Ѝ  D0 R(0003/@8 _P/(0S/P/ R  00/G-@Q# PHM0<(Q!`,V \M@ `V `V ^KM@ R(0  Pp iP `V *`0M @(0`(PS0p(p(@0S   0 @MG-PQ, `L@(pT p(쀟W MPx$d! 0S$@0S LPPt$hLPg"(@T 0Q S   0 R!p@@MO]A-@`PpU 0S  A  0S SRP@-@ᅉbP]j_$hP lP 0@A-@4`̠00Sʬ{#Ѝ0 00?PP0 0,0pp00 0 00-P ,0/pt0Q0!*M O-SpP T0:T0d0@1h0Sh h0l 0h@l01 R @@0+g 1aD03/"(Ju40004`0]e"H"1S( A"|%K #K(0 T T0  "T0>S "<ЍCF,(4040pWct $y"  lU@ "GY Pr @KJ,J#@ _M_ _&QOO@M0O-,Mp4Q#0@`P`y@T ,0〰t2  Pn@PP T P` X !P P`@#0SO>嘇V 0UB >0$0@$ 6@PUp `0V):  `V 00 ` @P1 00` 00# $00@PQ  $@@,Ѝ0 0S S+$0$@P $0$ 喤`X cuPMxP|0S/@-@h3/0|0h0O-4a4M00PS@!!1S O0181S X0T P30Ѕ,00000>0#6040080>0#60D0>0#6000<00@00剀80S OK!0/01000L09L0!4T0  0 0  0PpW(pWL0<L00P . /`1Sp upP70  0  pW "p|r|0P k 2p0 !;\0   !X0 t p娐帐AX0T0X0L6p3pGor H4qP  $忺$01 0Y:p₼$妿"$]$债WpW /pz pD DD0ĐN I41 0`1H!<1d1 D1l0 p07/pP\T!@0AX0  81 0<1$0@1(0D1,0 pPG l0 0,03/l00S 3/l0 (0$ SKv [t Yq 00 Lp@07/ 0 03/3 0000  0 0ÂpP 01P 0 03/HZHX d#`HT3 pP tP 0S ZvpuW   /o"^ R    2/pP#pttr0H`1S B l04q 00S p0Sy$@G$0p  $@(H0tp0P  1S 8 R l S 2/l0 000S 3/l0 0 1l !D03/<10S bZGZ,GuT 0% " pl _RfP0. pp 000p[ p p $pMa0 0`000C0XS0 AH` 0S L p4ЍrXˁO@Mx _G_P0@-_MP P@P0 |_ߍ0@-(000000 0ЍP@- $0000000ЍPO-섟lQ@cUFB O@MP/L0S/0@-P0M0@000TЍ00 0 @p@-@Px "T0  ? H R  R002 P    0(0d0 0$(00,0(0000pG-@`,p0PdY h.Q-Q.Q.Q.Q.Q.Q.Q.Qd0S J)P@ `0S p0 S 0`0Ѝ?`(0 `0S? U 0000P0 ? R002   00d00(000(00 0W PX (0 Ps?X (X0Ph g?=10S 6`10$0uPw`p@-P4a@T 0Sp 0>P T $P0&P R 86P0s_8A B  p0S/` B\R R  B 000X00S0H0d0<1t0Sx x x0t |0St t0x 0|x0p/H-f4A0pSM dP0P:P00Sړ00P0 *  JPhf0p 0000`00C0 0 MT]I0 1111|J0`00S I81S ~뒏_DLz6&$7{0$04H?p 180S 3/9?l\0    IxX0 00X 0 X A 0%10S0 Z p 0pYచpp%[  N ! p0 0000 W &Z ᾵l Q(HG*T0|p4Z(1S,!,!(!,1 0S   2 R @@00p`0000|0S t0Sx x x0t |0St t0x  0|@x0L0pWp  |0S pH0S p  dM0(0 =W y~[1S )`$' L1 `5L10``0C000000}p eC4v0 .5\,hNe[0k P 0fPa 0S 0ST t   T #+T Cp Q Q ?00  O ? 5 1 _PO_P(_Op@-4a@PP0  \ AO-M̠pZP` 0  TV N80Sr 6X34A WW1p|0 $00000$0SB 0  `$%p9 Pn 0S$0' H0S* [$0` R( R2 $0 R-P * !P  00C0VJ 0000 T  H0S P80$0$0S YIT0 W^F&P(. =B $0` R RT +    B V /  T0 00꜐PY$ $0t0$0~`0S 0T 0` P(P $[Y 0S00S ZPS 80 0 0 Ѝ30(0(5P( 30(0(,P( `0S(0`0S(00(00T0  `(YP 0T0  `(LP T0p` ! 0V T0P3;T0@ T|2@H0PS (  (K , P(*P0 R P ( #T00T0(<(X<((X<Z X ( SX (N0020`00S   00C0t0Sx x x0t d%D~ % b @g,C=(g? P 2Db 2. ~|[A %5 B/o0"S R0 400 d0O0` RP0 C;00"4 0S HOOPM0@-q@M QaT0P0` ,0 TP X ěЍ00@-P0dM 0 0@S0 0S0 Q  ?o 2Q0S X  dЍ00@-@0SMPS 00 0R  0 000?o2Q0S  ?o2Q0S ?o2Q0S Sߍ0p@-T0pP;UT0Pp@0`P *PrpT05T00 Spp@@-X0C4T0; SX0  K 00S @-SXˁO-`DM4Q,0p( @`\80SH}HHp3P <<J(8 R/#<0 00PjP:,0/pt\ *p0 0 0 0 0PSP #x}}x7 R 0p0dkXg0P$0 g} DЍ&@P $gbT} c RRⱚ>$100L0㑯48<0L0 !80 !!L0 !   ?T LP [00D2P DP  㘹D< <0<0= v,0 S9;,0 00X00 01`X010 P0T0`5 pd0<10|080C4dP0(% P00P0\0\0(h= ( gl 4R g?0j?0l0l  0000p0$  0h00,00?v 00!! 140S  3/D&10 0S X0X00X0|0St t0x (0 |@xH0"T0#  R#000 S pxT0:T0d0@1h0Sh h0l 0h@l0x3 R @@0S[ 1aD03/20283! ! R ! ! ! !@P2S X20S QP1211S lSX\0   (Jh 0p? 0404 0<0<0ZHP00J 0 0` 0000 t0S d0t 000!T0  Rh!000 S gT @10t0 a TI[qAO @ 'u$:, 0808000`0X1ST 00 Y +t0 I;8c8M @x._-_T_M_M_ _@QOOXˁ@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- 0   Q      0 Ѝ0@-P0M0@000TЍ00 0 @p@-QC 1嫶@^g@00@00 00 !!0300000, !  !U==P 0 V@0ew=Ps=P@3S  @`d@-@0M 00000 t0lP dY0P  P H R  "" "301Ѝ]_KQe_A-`|p0PS d @P U W= p0S0@U@` =TNQp@-P`@0`S LɺT 8=PUTpp@=0 3/TNQ@-@!==舻p@-PP@ =0S   Upp@a= 0\@-0@0S R 2/T 0`@-(@ P0S   T$0 0S/ R0/0T 0_d@M@M zd 0Ohꈻ jꈻh 0>ꌻlꌻp@-X@P0`S @'8<@Tp@ <03/@TNQ 0p_@-0@T0 3/@TA-Pp `- @P  p `fd00 (R $@ @0@0'T_t R 0$0 ) TPA-@`!PP0q$0开0PU(0(0SA*S 0 #0 3/00PTp PDU(0 S 0 0 3/PTp]__<^p@-`P㫵@  ` c000p@-@P @㍵0S   兵G-P`X 0003 0@T@T. 0pSW00  `@pW @ 7/}0SpW r W j@ @@A-Pp`.@ ``pT0S0@@PA-P`@pC0S 0S   At00 00S<0 3R W pcoWp@-@P@TTp0@-P0M0@ 000TЍ0@0 0 @@-$@ ?0 0萻_O-p0S`,M@PTXbP p 000 00P0lp 00  00 @0Dg@ pP b,ЍZ  叴@ \0 @$0v[?```Ѐ x0V 003/U 0S $A 0 "P! "  2< 2 2@0 2 2 0 21UY 00\@-0C0P @p$!Qd 2  TgLP 0S 0< 0,$[ __E_p@-@\KTP 0S H @o8` 0S (~pꐻp@-40CP0[;P0gUMpp@-@00S P00#;#P0UTpp@L-0 0/R_ 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dG-0@TP᐀;p`ᄣ6QP Zd0 `0R@T0P@ޓH0P@P T0 $$ @߁TJX_f^U _]_z_0 0 0/MO-`PC1(S 01O0ಀO{ㄐ0I0SaO pv@m0S p0I0SOa岀` vOvDLMG-餀PဓopWUpP@@ t@\!8R#8 @L A@ 0B062S FS B! 0B0*M0@o/M 0Q/TN΁0@- 0<0@000$00᝿P Iu ΁C-p0MP0 0`` @ܓ0 P 00 000 0@.Y?o2P0S  R Ѝ:0@-P0M0@000TЍ0 0 0 @@-@08M@@40 00@ 00@@0@8*0|0 0000,00 (00!P0 0H0$@ @000'> @00\8ЍN]Q]Q_DN:P^Q_p@-t t@t@0@@lPSJ,(1\0,1s@ LsDD@@0 2p@N@N܃R_D_P 0 |P QRp@-@4Qr 0S p@j0`0P01P00Sp 00C00Sp@R?0S P00 0000p@-@4Q`#FP08P0`0S P0S 0 000C03p@MRA- 0 b@SPpbbu b=0@44100S 0 !!03L0H0@000, !  !@`d7@-PQ+u@ U034100@T0@ P@ Ѝ0x 00S8An@P 00S u U0 #4!Rd0SO@-P 00Sp@-@4Qb|02L1SO P0   (1S,!,!,1(! ?  PL1 P  $!$>+ @P0#hG0@ 0P2>00C0A0S  P W.0   Lt(!0b0?o S,!0b0?o S `/:8aVO__A-@4Q apP0F7S O>P3 P0 ! 00C0  0 KP0 6P0  0 000P00P0? O-`Pp4A0$00HP0   P U Pi L1 G0 0p PR16$1U8SH1 SJ P" L1 UD  \D \ H!D! W B $! t ? Ѝ\ X  塿U P D! R D!  B H!J 0R uP A- Pp`3@2: p@#@`5<`%J2zPP   ㋌0@D@P0Q @@p@-PP@p@Tp``FT@@P  ᴌ B 00S0R0S/ p0Q   0RH     /  Qxp@-P00@Tp0 P @xp@- P0Sp8 P`@[0 QV R Pp!!0p@-P@F@0$P0)p褻@-@000)P 2@@.ꤻC-MP00`0p0 0` @+0 P 00 000 0@}Q?o2P0S R0 Ѝ$0S/7@-D 0jP0PP0@EU Ѝ05F_0/᤻-@-,00/7* ЍЍ/_+^O-P`ԡ,M @T pMP VPPp @P @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #X0S 0 PP 0x P j0 000!R00! 0V0C0@x_i_5_7@-P p 0⾪@P Xa Ѝ0Q000 $!R@ M___._-@-<00S 0,0t|o ЍЍ/xj_+^G-`2Q" @P"PX  P$0S00SPqP @U003/PP80S 8VU  ( 03/P00C0!R 00! 0S% P #$`X!P ᰩ Y0000000@0@@000000!00C0S_z______x'_O-$Q$q `⠺@T  @$0S' 0$ [}<0P000@03/ P R0S  ; 0S " P0D000 @ 0" ꤻxH<_tȻ0 /$/O-Rp@M50"T@TP:  ` P1 !R  !1 PUp㔡' P10 U"P' ,PP PUP7궷0 0 00 0[PP Ѝ0Q@D0 `P PpW F0P0U0000000XpPP ḨPU 0  0P  ]x]n_@-Q`M ^P0 ( 000@P t@P Ѝ裹Xp PU@ 0  @P0P S  !  00C0xO-DMB,0RbS2r0,0Ի |002@000"S20000 0000 尷U:0p`l"(00 <0 P0p,`$  @P޲ @@ 0ㆴ@P0 P6@@z?d 02x_ 0 ꤻ0ꤻ 0 0ꤻ0 0ꤻp@-`Pߣ` P@00@0  @@0000PUp6/0ꤻxp@-@L0PU  R8 00 p@㴣 03/Px@-@ᆤ0 徿00Np@-@@`P00 尿 yp@蒤Ns@-@`ÿ0P000@ ᇤݿЍp ⁤N@-$@ 끿 N_O-M0S0 P0 FY`p/sPp 0#׻  ⿣pW @@T /[Pp|3|#PP彻X  ⥣pW >0Y,0 Ѝ0媠*S Z Yx +`Q &PPv@倂Pj2 6kP @O P tT(0$ 00 PPP僢@P:(0⮟@P+0 "R00P@# ͢1, 30200 0000($ <0$ @PP,0S- @ᯢP(8(0$0m$0 jQ 巶T  $hT(0 媶r1U@ tP$ w$ PP@|Y uP \@-00P Ѝ [P @-@rr@-@sys@rp@-`00@0P᪁ 0 0P0p]_A-pa@0PS T喴mrPPrP p0.CP Pr0S yx0.0P 0 )P 0Sba/sP 0SUdT.rP 0SH4GrP8_v_/_+_]i__ __A-M`PPPЍP00S 00S!~~P `t@p刀T _tx P ]P s@߁߁A_^J_X_1^_+^@-Pp0`Ap00<@00S V Ѝ 6P0@-MP tP@! tT 0S S S P  P  r[Ѝ00S osqP A-lq@0`S P唳kqPPqPP  .GP.AP ;P 0SmlrP Pq0S ]\0STdSHqP 0SG4F*rP8l_v_+_]i_~____A-M`PPPЍ* ts@p崀T ssU -P/P P  g@PPP r@_1^_+^p@-`0 MP07sP@@ U r @P+sT 2 Ѝp0000/7@-@PP 00P Ѝ0 Pp@-M`P rP@@ V nr:@P rЍpp@-M`P rP@@ V OrP@ rЍpP7@-@P0 000 Ѝ07@-@PP Ѝ0P 0 0000@- 0 0Kq ЍQQp@-`@P㣦P PpTp 2 \0p XP@0S T$  p8___,0 0S @-@8#_A-Pp`@᭙00$0p ` P@ 0@-l@P0^P UPU  PU0^00 0@腙7@-4Pp@P $000 p Ѝ0舱QQ@-` i@dtPp1S`00Z1S0@<0 AA0,000 p Ѝ8@XQ@-0@`P 00 0@0@s[|k0t tt@`P0P``X XX0@P HH@KZ 80Ѝp@Z>_PQD_M_Qp_{_HQ@-`0@0 0@0 0000 0@00C@0PN0H S/P  \\81] t000 S \/4d0 SQ/PQ//P@-P`00C0 -@-]yFTO-\bM P"0L@0S 0Q* R00S 0 0Ѝ 0 hP@  op0U  f 0倐 0 00000 \ 000  0#00 00000U00 @PE B堐[p[0@@DT00@@00@h @0`0 P,00 0 P 00@}NPO0u .;G-MP 0`` @px 0P 0  00 0 0 p@I>?o2P0S 0000 0>P0S0 0Ѝ0@-P0M0@000TЍ00 0 @@-p0 0  ^8 0@0000@00C@0PN@-@T`0SX02X0''h@ p@-81M@T-  끳Q g 0  P@@  `  t!00wP r ϴ0 x0@Q 0l0300@ @@o DDЍp@蔦]OP0uN_(Q_0Qx_0O- a 000p(P$@ @_A0찟,00 000p(P$@ @ @PKA/0,00 000p(P$@ @ @P9A00,0`0 0X0000p(P$@ @ @P&A<ЍQ_|Q-__Q_000/p@-00CSP0@@$P,U ៖Tpp@(㙖OA-0 0 2#PU 0`S@T Alpd0S R@D$ 0R l@TAjPOA-pᜲ@`00Y 0 0  00@PPTPU @41 0 0S ᤲ@ᠲ@Ѝᚲ 0S $1S@P@-@M`0p0Y 0 0  0 0 @00TPPU@U 0S~@41S$1SЍPp@-P`-  0 00@S @R@T  R@@4Q 0SPP@MPpPOP&$0@  !"P/ R0S//PQp@-@ @PXTd0P1@0P !0@@T@pOp@-P(@pdpOp@-`PY\ T d@00  R$AP @p$pOP d0S  0  /P 0 y꘽p@-@Ph0Q@Sl l & 010Sp@p@OA-p0P1@Q`p 0SR 0 0 0X02X0|PU1T  R ` BRQV X "X  tP0CS 0  BR |O-SP ` (`p"" 0 㒣*@T 0 S8d0S" 4P0@hJd R p0UV#1!0 ST  SL0 P @[ 10S P1 Q@S@V @oYQVT T R S(@0`00pS V d0P @$00@01 00001uX00X0@`@`p `p - )h0Sl l & 1 RA0Sh h0l Pl@x @V (LW GOP@-1PM?@?@`pL0bP?oP20S`ߍL 0RP S@0@6/P0S   0Op@-L0@3P41S P0 00SWQ000ppp@-T0TS4A,00S bPp02p@ڣG-0@Ppဃ4Q0@` SL!,L!81SbT zBYL0<L0/WᵣVG谣 0 T꘽0倱꘽0@哱꘽s@-|R   D < ,2,BRN<8!"$0 <1@11S7 Q4 0D1R? 10$01X0; 10 R6 0L10S00VP10T10 U> 10 00S0l1R0l11 >0ZO000Ѝp0 >0!0 >0L1O- M`SP@@ D H L P T X \   0$ 0$0, (0(04 00,0< 8000D @040L H010T P00 %(0V`00d0`00` `d`n>phpH0| l00p0L[>p00p0PX U>p00p0TD O>p00p0X0 I>p00p0\ C>p00p0d0t0<1x0[V[VQT偞(0B(-R #圞- . A. 001Vq1`00` Fd`>1 1mRq qV|q00 0& ` h!`|2[/x1k1P0C;00400z0 = 1 =0/h2p0l"/`2 `0S pCSWppp'p00 $! ! ! ! r"&" 0r &0B27\0V/p2t"0 0p0`00` d`= 0xh1P=p00p0T00 10 0S00@00P x0 p R ?S Rt 0 S0i1x0j10S  bB=0V100`00` d`n=00 8 0 SW 0@DHLPTX0\ (!@0@J0@0,!D00D00!H00H04!L00 L0p PNp10S7 $0 |01f0010 0Sh00h0100Sh00h01<1 0=X0 100S R  V 0X00\0`00` Xd`<` 0BRS000#0q-( (! m!( %0!!0 00X 080`00101 01(01(Gp 0 HpW0/! 1! ! ! " " " "  " $(" ,0"40/0 (X0h\ l00  ` p , R00=9B =C00P20T2Ѝ0`` d`{< 0` `00d`s<$0` (`00d`k<(0` 0`00d`c<,0` 8`00d`[<00` @`00d`S<40` H`00d`K<1` P0d``00B<q qqqqqqq  ppppppppp81p00ЪP 0 R0 *0 `#8q:]]4]P]d]p]@B@-@P`t4 Pt tPt {T0 00000 00㺞PP t 0ЍpOO-Q,MP@\|,ЍO8QT@@`Vp: FZr@RV6 @PH >00O0$`@ _;00 hM@ TJX@D:@@u 0Uo6 xP@0DATu A@ jX` @u0`8I6,Ѝ0V01 0@P0V@0 T01 0P0T36lPP& Z00 @@0P 0 P@  X`F0070`0 CSRL@ @꒯ cP@T0F0@P V0$0 0 000@0 00 0@OQC-M p@P0S !PU @@A2` 0 sq@P`P 'Ѝ@@-@0 000 0@0㍝oЍO-LM00|0P80;@3p 4`Up0s  80`x|000tpLЍO6Y00(0(00S40OU 0S0U U0 0^5 ЌP ˌ1L0:`@000 Z,0 01 0!@A$<0T0Sv :ATr 00L0S`0S 0 00080@ 0P  @U0媿0 000Sg0QQQQQQQ$Q0QdPP110$X0x0/S 10 R 0S0SL 0S0`0`@ 0(0Z#04 0S0R0S  40SW9 0000  lW000 9 l lW$ 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@lH0WH0L0L0P0P0T0T0X0X0\0\0`0`0a0a0d0d0% h0h0l0l0p0p0t0t0x0x0|0|000000W0000000000000$ 0000000W0000000$ 00000--....////1W1 1111 1 111111111 1 1$1$1JυJ?W81810N/N19<1W<1@1@1D1D10Q/Q$9 RRl1 1lW  11222/W22!2? !. (2W(2,2,20/80 <0$ 8.r[ 0S$S 10 Rx ?RQ ߘX٘ޘ٘$ 3P00 80  80 80 80  80$ $80( (80, ,800 0{804 4v808 8q80h hk80p pf80t ta80| |\80 W80 R80 L80 G80 B80 <80 780A/A180B/B,80C/C'80."80E/@8@0F/F1080G/G80. 80/82@0@ 0 Dp7070 M00C0$0 0$0(0 0C(0,0 0,0 0S [00 0SY $0 C00,0Y * ,00 U=0% "2 LЍ RNO41d00/41d<10/41<10/p@-@$P4a'100bpOp@-@`XPT4110$000PpP1@0@$00Op@-@`PPT41100,5pP1@0@0O@-@jp@-P@bap@-@Z@-@Wp@-P@ONp@-@Gp@-@`Pp PpR0p@舗pp@-@4Q0d gd00p 4R0QdR Y/O-MPp48h`Xu@w5xGuYw PWx ]  P @ P  0 堙P ? ЍΖP  ǖP  ÖPẖP    ᳖P   ᯖPᦖPᡖP u ᘖP ᔖ.O+O눐I⋖i,O )OᏖx ᎖w ᇖ wPzO-MpP`48Șw@u6vHwZu aPXvl   QP @ MP  0 P  Ѝ3P  ,P  (PP    P   P PP yw v u  P@- 0  Ѝ"0@-00  Ѝ@-0t`rȕ@uŕP$0P 000 Ѝ7@- 0  < Ѝ"0@-00 2 Ѝ@-0t`r៕@u᜕Pᗕ$0P 000 Ѝ741L0#400/s@-@`ڗ00 0PᲕ@PЍp@8ᯗЍp@-@PT@#D`4qM1  h ЍO0A-4a(M 000` 0P@P p0 @P ?T@(Ѝ1P0 d $0R   UP 0p0z/d00 ⏠0 004O_(03410S/00S/5@-h03" " R @@P2S s'@T*P p@-P@Tp "000000@p@-\034Q0S m<@T 00@ TnpG-@`PT1 TG TGUE h1*FRA:0CU= p81P34  1 0SP{?% P$ V* W%0034A } @T'@ 0V00CS  @G@@ ᥆@00D 㚆@hA- `@p60P 0SP\Z0S=ɌP ͌QX 0 S R^   ЍS0@-M p@`P6@0 0S @ P0S \Q S000U0Us00Ѝ@-`pP`#P @HT 3S 00 }0 $(ˁN^XJ0@-M 0000 0@ᅖ0P     圢P ЍA-B@p B0 p᧓`夓V1U:ᙓ`嘓V U UL0341S ( ,02 0P0*P A-qP`4A T@P<&p Pppu @O@-RM`pVP@W@T@0@ 00 0@` PP P=P ;@8T 2@1TP Ѝ NO-QM@Pp帰U @PL000 @@0 0ѕ@P=00CS@8 a0` L0000 0Tf0 00P 0 0 pP+?o2P0S@ 000` 00㟕@P 0N0S0P ``P` Ѝ]G-QM⠐嬠;0`S6p  9@P000 @@0 0n@P  Ѝ P` e02 00P0000P 00H+?oY20S@ @@O-T/DM 0    $O$/ 0    N  0!. Pq B,n 0   0,p(P$  .0 000@!p. 0 h.  4,p(P$ @.+0$ !00/>.  .00 0 4,p(P . 0!- 0   40@,p(P$  . 0!- 0 4  80@,p(P$  . 0!/>,͟, 84 0 0<0@,p(P$ . 0!/> D40  0<8@0@,p(P$ p. 0 !|, 0   84@0@,p(P$  Z. 0!/>̟ 80  0<4@0@,p(P$ C. 0!/> D0  0<8@4@0@,p(P$ ,.0 400 !h+ 0   80@,p(P$  .0 400!/>ʟ 80  0<0@,p(P$ -0 400!/> D0  0<8@0@,p(P$ - 0 !X* 0 4  80@,p(P$  - 0!/>ɟ 840  0<0@,p(P$ - 0!/> D40  0<8@0@,p(P$ - 04 !D) 0   80@,p(P$  - 0!/>ȟ 840  0<0@,p(P$ r- 0!/>|t D40  0<8@0@,p(P$ Z- 04  !,( 0   80@,p(P$  C- 04 !/>ǟ 80  0<0@,p(P$ +- 04 !/>\T D0  0<8@0@,p(P$ - 04  !' 0   80@,p(P$  , 04 !/>Ɵ 80  0<0@,p(P$ , 04 !/>@8 D0  0<8@0@,p(P$ , 04  !% 0   80@,p(P$  , 04 !/>|ş| 80  0<0@,p(P$ , 04 !/>$ D0  0<8@0@,p(P$ , 04  !$ 0   80@,p(P$  n, 04 !/>`ğ` 80  0<0@,p(P$ V, 04 !/> D0  0<8@0@,p(P$ >, 0 !# 0   84P0@,p(P$  (, 0!/>PßP 80  0<4P0@,p(P$ , 0!/> D0  0<8@4P0@,p(P$ + 04  !" 0   80@,p(P$  + 04 !/>4Ÿ4 80  0<0@,p(P$ + 04 !/> D0  0<8@0@,p(P$ + 04  !! 0   80@,p(P$  +8 40/! 0  <0@,p(P$ + 04F! 0 <8@0@,p(P$ n+ 0!/>㜐 00  0  4,p(P$_P!_Rx_*_,ˁxR2_d8R_;_B_J_ 6RO_T_]_f_p__}______R___  @7+ 00/!8  0   4,p(P$  @"+ 0! 0 0  4,p(P$  @ +DЍA-4AP$p`0S S# S;V @TA )@ V P )@0S)T@D@!h0T@V#`)@\0PU L0S P1T@POOA-p4Q@y0S S2 SPT iPUN i @`V@=T VP8 `PU@M r@T`hPTč`0PU L0S3帍0P@ R@`eTP_@@`OO@-` V@4Q,  `G OЍpp@-P@0 M0`0 0 0VU80< 0 #00  0 0 0 004 00  24 48<0@S. //CH0LP  30 0 0S 0 @0 D R0 0``#00  00000 0  Ѝp@00`O-`ᑿ00 004Q\ 0 S L0 C B  B00#01BuA, p=,xq t0 Q8 0P 0 S5050/S05 5 p :O-QM@`_0KSPYppG WU XR$ 0PH 00$0 00=0P8T() 80` ]$ , ][ 800 00h @00 0 0Oo `#BP@T00 $0 00$0 0 00P $060Ѝ000@-MP@ ֓P 0 4Ѝ0G-@`P,@ЀpĐ`P0W GY|O-QMⴀ`V @P000 @@0 0崌@P Ѝq Z` 000 @@0 0嚌@PQ0,P@G+s* 0` ]0 0000 0 0P`r"0@?o2P0S+ 0000` 00h@PYPP"@k[@PU 00S.0CSP{P @  \ _{ @@xj_p@-80P 㦏@ r\x \pP 0 ŏPP x0 p R ?S Rt 0S/0O-DM(00<P`p!0  <0 a0,P$  @<%<0 SX h10'>\  0< 0a,(P$ %0 01 0'>< 0 0a,(P$ % '0 0< 0a,(P$ %0  00< 0a 0,(P$ %`0  0X00a 0,(P$ < %DЍR>__0ˁ__Tˁ__  0  /0ˁp@-$0@S,$0 P R$  Upt`0@o>0z0@0C0000   0 S pC-@0`Pᰐ1qS2 10" 28. l R R R ' CX0@00P0#*1S0Ap@0 0@0000 2S000000SP ЍCC000@_@-0( R (   B "R    B A^!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GcP0P 00Q 2@=P TPW p W 3V  G"P 0Sp@-@Pe p@//// 0\ CSR 1d 0 1P0Q#7Ó7P0P00d0\0PBp@-TPCr%0C0\0(@T@ 0S 0ABaXp@-0 10@@0  /&_0/000S/@- 0 00z Ѝ߁_e]00/00//O-<1`Q@S20pp 2  _X0=03@P2S  Ѝ00S<<0 9X <0 (0<V 00S 0G-0P@s pp< EY UP;`P WVV `X÷< 0Ge<<0 X<0 A-X0QPcpp `@`  ՘T<@A-P<`@ @V`z;pX# ᱘@;0 "S ᥘV@0 A <m;p@-P @H0c   ㎘0S@C<p0 S pP/00//P/ 00@o/P/00/ /@-03Co00/]Ӆ@-0< <0 4 000  㯊0ЍGRe_Pp@-,0P L@00pPp@-00 P=@P 00pPES@-@;JSP ;0 RP/O-41 刋P㨋X%N@ ap[`(R03/@( Ѝ @P(R 03/@( 0 @O-41 刋P㨋X%N@ ap[`(R03/@( Ѝ v@P(R 03/@( 0 @t/00/0@-003/ ЍC-0`M00p@PUЍ 0R P 0` X0 P 00 000 0@?o2P0SH00S 0 00,,Տ03/P 婑<ˁ]l__@-塑_@-P P d``序PTL嵏 Ѝ (,嫏妏@ˁ_]__C-PDMp1 p`n@T+0400000 ,00(00!0 000'>@$@ @ @0<0!@P<0W0 00PSPDT`DЍVPp@@<ˁJR@ˁA- @M,#(1 000p<`@P0<0A0,p(`$  M!0P  3@Ѝ<     '.A 0 ,p(`$00 00! P P\PT@<`PpqP  PU@@ˁ_]_!_0_f_s@-`P 0@T T0@T  S  0D 0 0 |"P ((ێ$o`Ѝp<ˁ]_@ˁd04!(1<T  ςP P R00@"j !03// 0S(0, 0 (0, "0/0@-P0M0@r000TЍ00 0 @p@-P`@Tp 0SP0 `00C08A@- Vp@-4Q@`0S P0S00C00 0t0 /p@5 \/ Xˁp@-@DP!Fêp@[p@-@8034Q 0DP 0 0F⮪Kp B@-0 @ "P 0S(0341!1 0Rp@-@00C"0!300 P p !A\  Q` V000PUR0(00@@@#p$0P @- /Xˁ 0`0?o s/0co0` p!/0@-@0M 000@0@@@姇0xP 0l00@0@ @@x㘇DP6 06 ((Ѝ0@资0QR_PQ_@P hRPRRx_p@-4` Q[ 8PpT0@  P0P8S+2V`PQp@-@[8"PPp8;0p@ )PQp@-4`8SpP0P @  +V084@p@PQO-04P@ 匡@0D0H0L000000000111 1a   p @w@pD   p^ypp 8 p wq^&  ` qfa@^$ ( , 0 40 @P00P00!!!! !$10(!,!0!4!!!!!!!!!08@ @P]p@-PU 0 R `0 `@P U x {U000000Ppt U0PQ0 0S/0 oPQG-`PPp@U#P0Z00 U00 t  BU @T 0S P x T0p0p@-@0PQp R00  (PQ@-@P`P" RS . 0 000 00 000 00 0 fPP  E2 1"  P0E0A 30Ѝp0Q0@-! P0S0Q@ L >̠ TP00000 00 0 0 00 00 0 00p@-@`P@Tpn 8AG-@Mw04`pP(0 000"!ġ       P0?S$P(P,P0P4  L0QQ 8QQL02 SR0!!!!!!!!0S Ѝ]@-P4a@6 =,10(1T0 41 1 00000110010 0 @Ѝp0D"! 03@0A-4q001P0j?@00104!(" 4!0 & 0`0(0E A10101A-0P`4q /( |@T  0@P 0010 10010-A4"j 1P $P A-@ 0S Pp`47P0 8P0,@H0D"j !03  0SW00S@ x0>S0?03/ 00CS(`R`R`RaRaR`Rx`RT P@G  0 S 0 0000@S P@@  @@O-`0$M0C 0 0 $Ѝ0@001S 0F㈦P(4 T<00p0 0C"03 ԑ Z `( w`P 3P  m!QP!j 1 0S  P  ` P1S01ą`$ 0  0     R @0 0qW ` RP R0p Q2  JpP Q   B t2V `Pl Z& /@P nP5 0" W B\ "RqW`P P R[ 4@T 0 0PSP8A?o22P U0 SPPU    S R P Rp  B  ` P [!P Q ! P zY0` %R011aS!!1! ^]PPG-P4dp@*U" PH1@T' L0Sd ZR` 0  ``]PXP G@T P @T9UЍd0SL`` 0  ``1P XP `0 CSR}h@OOp@-xM@?x ` PYQ0U0000d0 0E~(0$(P pP, 000P0 QxЍp@-P0@1P00`00p 0000p@ ⿄A-p崀`@T$ L0SP0S0SP`PU UVA 1@POO@PG-1`ဓp4A`0S'P\W PKI0SP0S~P30SPP0S G0 h8QU I1O@P0@-|M@t PP00P I|Ѝ07@-P0@60#R00SP  0$100\ P P P $ Ѝ0@A-P`p@TW X0  h@p@-xM@`Pt QP0 0 0`xЍp041 10/O-$1M`p04AtPp\P0  D8噉SHT04j ㇒) p 0RX0"? R (`pap0` 1RRP  P[ 1 ` ^0& ЍO/G2  Po \ |20 |2zЍO YP k`  0*  00  2UPЍOLЍO(_O-p1唑|MS4A僿P0  9l7XO yXT  ,8|ЍO( R (alS  t dO0$! Rp 40堀尐1!` p$O0  ZWphpAo1STP 1`@T 0j/ 4/|ЍqO3_p@-@HP`T0; S p@@!p@{OO-p`P4A$M`0S P R +rU 0 4SZ XP=$!00!00000!00000!00 0000P Pn8J?Z~ 000 000 000 0000  000 000 000iPPP04P0pq$ЍbPPp  T0E⣲03 !! W 0QC p R!` N0 !!  Ru  U  R X  p Q W  0 0?Pl!PPL p402S SO 000 000 000 000OX 㨑=N0HQL1d0S2ڜ01 ZX  ) pP% !0 X?PP0 1P0!#Pom @P]A-`@4Q` 4R{pNm2! !! ! ! !! !0 0F"0Q!V31 $0110102A]p@-@P0d $8d p@ F_?_@-4APP0  P08P0b<   Zឿ!p% :P0`V0S 0 00. O00C0VP08P0v8a7P0/000X tM0XHqL1' 䀟P&  03/`'00S P Mzz?Vd 0 t`庅VP02P0P0 :P0`$㦅]_g_]<]>]C-@1PC|Mp!4a吁R 40p!~|2jX0|201S" H1Sx  M` R`M1嬁p0P  1 ` X 0 8/jY4 nP  0 & |Ѝp@-@ 3414020SS`@P`Pp 03/p@S Qp@_Y0p 00 \ u@ @0.Y0 d00 $ЍO_hR__U __C-Q` xAR0\>0>00XKP9L24b0`K@K7:!#:  : 000@0QO1K巁KPKP KP?a⢁堁Ѝ>@Lq``T>Tx lK }N`PqcKP`K0 40 00IKP!}KP -UPP p0 n` c m]V`gEP =@8.`ˁ@. _T _]?_^H.` __^+^zd@[ _C-@QM@ЍP`pP z@P K NpPX D0a0CQ R P F0@pD@P JP JP 0 J Pt$KPKPJ0y0 cRY P!႙J! &ခ"**p 00JPJ6#:p:00m _]?_^A-QMP@`0p"TDP# 0 x@P(} =@QaT =<W }~}ЍQDPfJPJPJPbJp `}WPJPVJU} =@CJPIJH}w_w _1^]?_^ _ _N^ _O-x@0SM800880S 9MP8 830:ONP>@|?PP p8hBDP0ST D80 0 0S ~?CS IPE'000007 000{0 cR[0 019 0 `, |T I|IP tIPdIPXa|P|L|8s?oT20S I 88}AQڷ0 0R`A*S 00B80 (0PP0 08(0PP H" ~IP \IPLIP` ` 0<# v|V pIo| m|84sP[V ( 0"5 006 #::000040# 5d50YO吕F|8 sPRhrCP5\% +I@P}0I8P!IPUIP PIP4?a:4P^# 1$0$0 X8;CP   008WP `D R 0'CP0 hP08CPUP8CP 8>0P D R{30S {P 8BPD R 0{0h0 3 &|l{H30S ЍPU<T+ H K`P$H2PRdHPHPHH 0 10 6#::`0000PuHrH(```>@ 00KPPa' # TH@PYYHy~JHP~HP |yHP41l?ac~1P<1 JP p3{D10S~  P  000F4! ,qj 8C 0"6 0 8100 00G{8PP8 {{00P.`ˁH.k^ _M_0.uo,_ _]?_^_^_ _ _ _8. _ _>^ _,ҁ _w_N^ _1^ _!_$!_^T _A!_/ p@- @RP` 0|PS0Pp@U0Q0R l R |0 p@|P0p@-}|d!_0@-P0M0@r000TЍ00 0 @p@- 0@SP`xPQp@S l0S x p@xPpP00SD0P 800S,01@o/TJ߁߁ 0!< 04 0 (   !/@`d7@-h@hhPZu \00@0(S D000!S ,000S Ѝ0sr!_x!_!_!_ _G-`pP0ဣ0P& Sp0!D@޿ a ူL  @0@c, ЍGEЍQqO-M` 0uP8p X1@Ѝ 0儰&TဓPp ! @ि '  FL D0@)ֿ( ^X@፿QqA-@<P ЍAp0TP`s ᵿ0p0 80P$ 3TP bЍD00S/p@-P0` D@cQ0 p@TJQqL03"R  R P 2@@-/0#202/P00/0@-8  <@ 8 @0#0<@ 00400040040HPL R 38 004< 0S00400@4 D0S00 4 0C-M @QdcU r@p z 2 p0Q1 0U0C?o20S 0 0 m0S 2S(@U!PP 0P 0 2 2 2x0p R ?S Rt 0 S00@0$#0@0B1S@3Wr@S0"2R ).B22U o 0S$Ǿ!000 ”*  *  „040S R   WG 22 2塾41(0S (103/ * 0PS 22 2r# r ሾlre0S 00004 Ѝ1SpS 0 0 2P2p 2JQ 22 2@0#0 0@0xᷛZ 28 2Uˁ@-$0C0p0]@ @-<0CR0@00p0 28 2@O-pȱȑȁCġRU 0S A#Q |!@0D0@0DI# 2@ *#cVʀ 0! # 0    !?0S 0SpPvs 000t 000 28 2202RH20C2@`ds 2CP/2S @-y/@-$02020@CT@-P@Q0p@- @0B4QS$꘭RRRlRRRRRT0  ?0S x000 R 0 0p@#P08P0000Psx#y 2R 0 0 !p@Xj0 孭`f'0 0 Q!_A- 1 a q@T/ L0SL00` R  BRp  00`0PU@3S ]P0 P R |8Q 8@,T  @.<0  #00 0 0 0 G0`*0 0R `30(,  0$ 0S 0$ 0$  0S 00 $ S0 0 0 0 !020 P0R 0000S 0 0 \0 RL000 Rm00000 0S 0 ćɚ;6eʚ;0 &p@-d@(0, 0S(0pP(PN$0S $$000Sp@~́́p@- x.p0p@Q0}/’\ \#3,0xP6 8@#4g03/p@0/́Mb́@B%_0S0/0C-DM@`p(00<  0 80a0,$@ @@ @P.P00H0000'>a0,($@ @ @<08 DЍ/&_R:&_C-Mp 0@P`` 堐-0p 00 00  P 0 0?oY20S 0S0ńЍ`80< 0S 800< /`p@-@ᣪ@0`0@0`,PU #0 ժ_p@茪`P_@-@PP@SL0@-P0M0@v000TЍ0᭪0 0 @@-gfB&_0p@-`Q@P0 T)0`, dupK)0` p@d0 3/0 00000@000`MbDu@-@X0M 0@0@ @@@ \  00@@Ѝ@ɨ&_Dú@u0SA-@p`è@T`J P@P `JH0V P@婨@0T@SP P0PT TPX0\ P0 X0\ ըU `cJ@@H V P@́@u@-@d倨X0\ 0S X00\ @P0ST T % 寨T@`0u΁Su ,P!00S//u-uA-xMp@TxЍ&Rl00& `吀0S p0StA"J QQ\00\0x Q)t0000x0(0\0\P0 O΁0@-@4M P 0 0S$0 ( @P0S00  00U r 0@T4Ѝ0W0 0000 0@0XP $0P0S 0003/(@ʚ;΁O-@Mq0003/#0 @0S P00$ЍOcX0S9fHL 80<`Z [PP0 U0p`!)R@0&PoP0Xƒ:* P U  0I'W0 0 >'0  8'[ Y 8H05hpP0 @ 0 `R1#e(`6,HL``0P SЍ0 '\00\0ʚ;ʚ;ɚ;p@-PG @  0 S0S@pG@@- 6Pu Q 0: /@-@ 7gP _Ѝ0 \Q\ :/ɚ;0@-@MP ^P0 4Ѝ0Pp@-P P0 @H0S00305: 0&ppʚ;ʚ;@-@ PQ  _ЍO-`DM00  0hpgPP <UWPP 0 PDЍ 0S0 0W@0@C@0 #PP ?o2W0SuPP fPP 0$  0Q 0 (AQ0S 0 0SHUeP ʹPQ( ^0S( 0L\ 0S 0 S0 00 0 PQ ^0Q 0 L\0S 0 Q0 00 &_ʚ;p@-P(M` ]@P0S00 0D@Q 0 ^P@(Ѝp@-P,Mp` ]@P 0S000# @Q 00 ^P@@,Ѝ@- R R S$12S41d01 0^ Ѝ@-0@SM 0Q  00^  &= ^P Ѝ0@-R@P$M 41d (_T U  T]P @0P S:$Ѝ000S00 :0Z&_@B@-0 ЍA-@QP  &0!%`Ap0 %R pW=) -` p`UףP0 S00 10\00 1 p 00 00\ @@S0P S0."? 0A(́@BZ{c /΁?B0p@-0M 00000` 0PU@PP  \0P@0S4!Q Q  ]@0ЍppC-P `0EQ@P XP\ ` nUp0Sp, 0@S((0,0,0p0 p΁΁0`0X00CS/@-@8X0S000S(0S, , " u@-@FX00CS@I0@-@00S &R, l00& 00@D΁A-X0@0CS 4PP$0PP 0S%$0PPs P H0LHPL`QS2PPpX1RB 0S0@ tP@0 00\\S  SH L HLP H LPPP QP H LP0Up0SH0LP PP BRP 0S H0LP 0S 0 @H H0LL0SH0LP P BRP 0S H0LP  uʚ;ɚ;6ep@-P0S H LA  RPH LPL0NHPQ^8@<`0@0SP0 HP80PQPUZ,0@T`0P0H@L` 1ppʚ;@-P8@X0 CR2   R* S r0 RS ^0S 0 AQ0S00  00 %S0 00!Ѝp 0S 0ll RR H0L`00P` Q00 ʚ;ɚ;6eA-@T`PV`S  0bS \e S HL PH LP Q H !L P R 0@ 0xxaS \I S HL PH 0LP Q H !L P  R  0 `p1S J`$V0S( 0S%0S"0S0xA9CHLp P Q 0HLp P Q 0AXɚ;6eQG-%P(04p`V S`CX@ p 5/PPp0SS t00C>SBUPЍ%  $RQ B#P0 SQX  Wp   W  t xW0 W0@ t 0 00⌠A ,[P]@-0 Ѝ@@A-41`P F?o2!R0S0!RX00CS 0S 0SxxS 0{HHL@LpH@L@PPp^P@HL@P0ɚ;6eO-\M00PĀ @?o2!R0Spa`PKa`PG̡̑0AT}`=888$0P0S X 0BQ0*SR#H0 L0 H0P L RP 0 H0LP !p DU 8\ЍAS kH0L Q 0H P0L 0CSP05Qk9 p U@p xP U  0t  00 t  00匀P@@Ϡ0H0L0P #0 RQ @ U U' p T @(HaP H L H PL  QP H LPɚ;6eĬ]C-P`U@4p,M0S U WP ,Ѝ p03P  @410S/p@-@`41PU V @T h00P 0003/@T ,00P 0003/p@zp@-@`Pc0SpG-1C0(qV@@XP`X R00G芞 00 CQ'Q QC400 0C?ƒ10Q0 0 QC400 0C?ƒ1 QC80#)_F)__P>S)_O-`@M0尰paPP(` 0 X G)AX 0" 00 00000 0*Ѝ@T]@-@ @m@-@@ f@-@@_G-@pP@B $`TY0030#T00S dc`M!40Ѝ/0M0000# Ѝ/@-`0F S#*@\Pb ;0 0900@0<< 0QP@TЍpA-@pD`@DTP;0U090E0U@000E-0,M$00 0 00 00 00 00 0 00000000 Q,ЍM)_-,M &  dQ,Ѝ2^7@- P@0000#4000#4000 0 0 0P S  Ѝ07@- P@0 P 0000000E000000E00E0 @ E S  Ѝ07@- h0@b"P!4b4# 0?<00 0 0 0@ T  Ѝ07@- @P X0b" @!4b4# 0%D"D00D0 P D S  Ѝ0l R/4!!?aAx R/00/0@-P0M0@ᤖ000TЍ0ۖ0 0 @C-0@`p\!DM(0 0 <0a0,$@ @@ @P<@<0S+ 0 0 ?A1c00 00< 00a0,0($@@ @P`00X000a0,0($@ @ @P< DЍR>_gffff_TG_`IS~)_@-p0@0PP`M: ? 0` 0 P 00 000000cЍ? ꀸ1`SA-@PHpkPUTr PE 0!p@-0@0p00#1R  p@i3Spl0SpS @0@0@0 P0@0 ֕ @@0 0@0pPꀸ@- 0@ CSR 1SL0P @0+\ @0 ꄩ/ !R/@-@$0 B !@ꄩ@-@Tʕ8Al0S/@-0@; S :#0@踕000000/tA-P|0@`il0` 0p BH0S `P000C S :#0吕A荕ꄩt//00/p@-P$0C0 00p@y//P P  P! // //@-  BQPЍ b000G50S0S<0L 0SI 3/PPE0e0<00<0|!L0.l'4P 0(0S 3/,Y/0S $"I P͋0`0AP0U0C0   S( 0S%Z-P  GP  0R  P 0S0 4S  +0$0ρHρh^,_A-X`P6X A/pL-@,v0p P0@ @A謋hρ@-@<fP0 SP T0 0< X @T@<@@藋ρhp@-40SXQGP`-@4E00(0P `D  @D@p@yI,_ρhp@-h0P0Sp@/`,@4%00(0` PL  @L@p@YTJρh@-@LP00CSP0 T X0,R( X0<0X0T -A@?ρHρhA-P`p@TAp0V0  4 R S   ! 03/,׊0@ρp@-@$P@Hp@hA-Š`p刀H@Tp?x R0L0  P 03/<0Fv,៊ρh{,_G-P `p?@PF 0S0 010SF 10SB ]EVA$GG01,XH#h0 03/D^L\@0噊@ UP`咊V<0yFJ(SF_\ FVS rGW 7/pP 0R  t P0 4S 0S p,_ρTJ,_hHρ{,_`ρ,_,_A- Mp` P !@P 0 R@ ЍU H00S <00S D5/01,GρTJ]2^@-$M@P8 `p0 %$Ѝs@- P`P@P 0 0@ЍpF,_0@-PM 1  G@P 0S0 0$ 003/8凉00\0? hЍ0ρHρA-0`@pTxPP 7/@P0S 0S PU.+PT0p `0T@ρhG-<`JQq80S-僉A0SN`P@TNV0da0PPL?\1@0 X 0)0S 0P2CaT1TG !  =Cr< @@0R:<R0@1``16/Ԡ8X 6/`/0t"#0g> 6/T3/@0 3/@` R0T0  *ρhMb ]#-_3^7^+-_T-_T1^+^$0$$08S 0  &_S ρρp@-@PD庈T 0S 0AT +0 @p@-@G-`Pៈ坈븠p娀U%0S" 0 @T +0d0S\0S #S`0S Ὲ@=zLR+嵈峈@ρHρ L0D+ρ@-@P@@-000 Ѝ`S@-000 Ѝ`S@-000 ЍZ@-000 ЍP0 T B 00 b B0"\ /-L \  QG-@T. TpP"!bIUW :T0 pG PW T0 pT0A0U!O-@MPP 80P6#bP"ᆡ  80P 0Fp 080Y0S:PE pw V    r R:V  Gp 0PBUPP5Ѝ 0 0 0U[? p-_0 b B30 @-J? 00/._O-PM @0@#0pS0D0UPPQ" 0   %? ~ 00 @P"  G 됚!0H00`0@0V RЍ  IU1!pd>X  0 PE p`P5 0 0 04._q._O-RMP`<p W0HЍV ,580R#"  80Q  H) p㛠!0I@ 080T R00C0 @t Y    0 CV1!p0T>Y p `F @ 0 0 0._._A-P` pW:L$0@ `>$0`rb@-@0$@,$7@-@P 0P S #p A  Ѝ0  7@-@P 0P S 0 Ѝ0O- RM`8p/_A-`@MP3 `?0Hp @00:tw! r!07 !P <;8 h1 S$0Z?00Ѝ_U/_p/_ _@-<0CT 0 !0  !0@- ! 0 !@-PDMp@`( 7[G(0 000007 g!P :;7 0`DЍ/_p@-P` 0@`  O(pDSSO-D@0000/p@- R 0@ Rʠ6PQ BP P0 h00R ]Pp00000C00 0C000 0 p 0_$0_[ S# @-0@(M0T (Ѝ@5h034100P (Ѝ@30 00 !0 0 0  (Ѝ/[ S% @-0@(M0T (Ѝ@5p034100P (Ѝ@40  8 0 0  (Ѝ/[G-p`@V4 PPU00C0 0VP1R 0S0 P0p`F0000C00 0C000 0  g[ 0S\* A //@-P`pះ@P0 H@ Ѝ@-P`pጇ@P0 b@ ЍA-@`py᱅PPdy@Ѝyi@y,yT0  @O\ 52\ 53G-`p0S40 0@P202:@P0 S:@@P2S p41 0/::/:/::/:/M0P PЍ/  /M0PЍ/@- @ P P R:H 0R PQЍTVRPA- `pP@T X@0 8/P Ѝp@-@P Pp//// /$/4/Q Q Q  <@o/<9@o/</<!@o/D0/P@/@/H/P/P/@-oP/P/@-oM0 Ѝ/   /@-0Mp00 @0`0wPPV 05/Ѝ@-00 ЍЍ@0_A-pP` P110Q 0PP00V@ @000Q 0P@000FW p 0  0  0  0!VLP0 00  0! \`0ҁ@-@ x@X-0ҁZ0_O-M @ 8PRPQ u`w0ZV 0S 4 44 R@ 0 SJ2 *Q .P 000V 0S000S000 S RSV RS 1S w Ѝ301SVO1SS  R 0\ 0S `P  8 0R TP 3 !\2<0貟 01S > 0  a0S 2 22 R 0 Sllq1 1SS  R 00S P 䱟 0R P 1 !1|<0刱 0Y   010 0f 0!0 S  KS % "+ P P  K㐰0 0P  P 000 00000 0ҁ] L]`0_`]\Z]|0_ p@-@P`v;p@v0ҁqp/<0M 40000P0000Ѝ/ qp/<0M 40000P0000Ѝ/\`@-T0@00@ 0   PЍ  Q  @-T0@00@ 0   PЍ  Q \`@-@7vT00Sڤ001S 000P0\ 0S@DYv@ < R0 AT@Iv0ҁ  \`@-@P@Pu H0D00Q@0\@+v 0ҁ @-@P@Pu H0D00Q@0\@v 0ҁ O-@P' `Ppu0Sڛ 0S/ 00 P$ 0S 00C S@Tlu@h00S\001S V  0P0Eu Ѝp0ҁ  O-@P' `Pptu0Sڛ 0S/ 0]0 P$ 0S 00C S@Tlu@h00S\001S V  w0P0E{u Ѝp0ҁ \`p@-P@ T+u00S001S 000Q0\ 0S @P@hMuPp \ RP !R P<J4L@5u0ҁ\`  p@-P@ Tt00S001S 000Q0\ 0S @P@huPp \ RP !R P<J4L@t0ҁ  \`qpO-MpЍ@A Dp2(10T10 0 010`V` 2V @T% 4/ppU O0000T0 00PU QU 9$@P @00 0;/ 0pS ] 0ҁA-pP`P ^ 0pA/A-pP`P p0A/@- {@P00$0 0000/A-pP`iP p0A/A-pP`WP p0A/@-IP(@-CP(@-@=0P 0S @/A-aP.P a0A/p@-P @Pp 0Sp3/pp$Ppp@jqpO-MpЍ@A Dp1(10T10 0 010`V` 1V 0@T% 4/ppU \0000T000PU QU F4@P @00 0;/00pS ]`0ҁ\A-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`P p0A/@- @ rP@0/@-@h0P 0S @/p@-P`ZP 0p@/pA-pP`KP p$0A/p@-P=0P p@(0/pA-aP0P a,0A/@-#P8@-P8p@-P@Pp00Sp3/pp4Ppp@H/ 0 6/O-PA(0娡M#F0@9ᤡ @Ap`@Dxqa ln-hq d 0\! `  H7/$08<` S, 0(7/X= [$ (0R7B@8 0 @`t P7/8 0i, 0d$ 0ЍO/[ o 0p7/#$\ QĠ<7/Ѝ Th]T0_P_0_0_0_0_0_0_@-[P0Sp@-@`P `ql q0t0p0P0 0T0`\PpX@-@f  AXA-@lP`pqH@T @ U@ 5/@r@-@XG P :0 0f @@-@lq`@qX`XXXuG-<@Y800P$A`Ϡp?  V0* `V p0 W$PO-@8P<M Q00Ѝp(0 S:80S (0 P`Ϡ01 F 0f800x00|0$ 01/ ?;; 0 4;$ X *0X  R$ f  ̠>Ɍ8  X ` :X 0*0 600 ( 0$88 05p@-( \:P80S @<4;$< 80(0$00600<08V5/p@Op0@-@MS 0 0C?o2QP R\7 R4 P@Ѝ008@Q AP"080S  a "!$008S0_"1_@-gM"Q`@! Q Q"00@lpnp `VV@ @pT H@gߍ <# sv 2Q9 3C7CQ% 1Qk 0Ql @1QQf/!@1QV 3C 5CQH 1QY  Ugߍ@aGQ f/ 8S@E/  0 S0;30?`aV!  0S @2  @    *! R@T P@q  gߍ@pEgߍ@G H_ G[ @pd@hd d@edA|dA-0pS<00@$b /o bP c0?o 0cT0 `$0 ." S  R Q $!P%  R ("( R ("( $ R 0x  lW  X V P   0UAQ1_b1_n1_1_1_H1_ ^1_0 60/80S/A-(pPW {{W0sf/@ S  R8S`P  d /o0bCQ b#PQ 02THf/2 P 0R*WEVs@-P *p5 `@<PA@0 @4@  P  |*x  y@P T H040 ,(Ѝp]?_i]1_@ 1_0p@-M0@P0( `FP0P P <2 CP *P0  Ѝp00$0 $P0 zd@hd A-0(M pP0`@P. 0 @P&`'d%0' pp)q ap (@0T p(! * * n(Ѝzd@hd 1_^p0S/@-l0@ 0P 0 P0p0Ѝ]@-`DM@1PP `& l0 00S p0StP p0pS0l0@0 0p0,pP$00004`P0tpt0DЍ00@-mY0 0R 00S0 qm0$ @噼0  00$呼0J00@~P#}Hҁp@-@4Pm00 0 @@@p@9mꀹp@- (l$@$P$`Tp(P ꀹl_l_Pҁ00 0A-@p`P fp`PA@-@<l 0,R(  00  000@lꀹHҁs@-@`0341 `10PP1SЍp0S 000S (僧@O-P14M3$P4a 0S@.1儑儡 0 |00S50 & $➼q,@P pPC 0  @@0@0 @P e :,4Ѝ 0(    ,OPU$0S xFlp@CldP%0 0z?00d0 z?801'qlol @i^1_]O2_G-0p @l$PU 0S   0 Y 0ClTaPP00X `  P!P .l;!pҁ   @- @0 R   $ R 0 $0 00 0@! pҁp@-SP@^0S Q)  B  0S0@@Pp^  \B  Q `P^  0S   p@^ B  R @@0p@-0 00   00Ѝa2_pҁG-PSp @$`3   ,@00(P$ @$ DR@ဠ Gk 0U00 000000Z0p00 $Q0$00$a @Pa2_p@-@Q n k0pp@$ PU00 $O-0AMSF0@ SB:`pP P, 0j 0 00 R  p PPP#k P 0S: 0S   2 PP kЍ 0k#P0 PO-DMPt@`p 0P P0 h0p0c0h0Cl0PPE0Pl000j0 00 S0jPDЍ0PUbS R:lhA  t tl@ (   ,I0i4D8h A<UC DP3P# ZPPU Y (PiU PPE PP@[vZu#3 [3\ Pk t000#R00St0 | v PP lj> R*0P ^$#3$! ^3"Q Y( 04  A [$K [#3 ^3\ 0< l S0P 8  \ Q,N ^Q,RRQ   P \Qdt ^QRRQ  yi#P    ix0P0@-,( $ Ѝ@-00$  0  Ѝ@-($ @0 Ѝs@-@P|y%0ri0```00 #PU0 Ѝp@i #PЍpN2_h2_2_G-@P`pI#`P PU 0BiQ 0zi$ Z#4% P?:0S @C/oo"  0S   1V ,X$P S0#03PE P  0PE 00 PS00``PPP1i2_2_P P @-$//2_-p0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \P1\0L$PBU 0Pi\Pp p@ 0 p@|f~fӁӁA- pM`P\| 0R( p@T0 P E@@P@1T( T@# 00S0 S-\ @[T W 0\#@Ѝ6@P \ӁӁp@-@T P,0,H0[ ^M\ppT]ӁӁG-頁@0MS㠠$ Ppx1 R0S! 5S-@Z@W 00@ [ ` P@U`1[V @0@0Ѝ 0`` e0  00  00P 0 0嵣@PEUP!U @ 0@S 0 ?T0p`FP@Ӂa0XˁQ/p@-P0 @AlP Q QQ  @ 00H0pӁa0O-@Z`0S 0 S 0h0qZ5/T-Z0L0T  R  0S*#u@-@H ,0R:< 40R(SpP p@-PQ1Sp1@S0 1 01Dh<0 00000!!""00040pށ]A-0@xp0M 0`Ot0 *  `PPPU, 0 R  0S" P0St02 0 0FC @ 0P: ,l ( X @PP 0 Ul   PJP0#3 ! 0l r 0S0``10C1000H00H0L00CL00Sp0P 0p0|!@0R2 , H 0BS:<04S8S00R 0S000sO +0Ѝ0S   0S0P0P0h0  0CR0S   0S0P0P0P]7_]7_]7_up@-P`@Tp0S   t0@#7@-@ NQT0S; R!0 0+R +OX N\ `0RX `00`0\ X ONX 00CS0X NtxPNN00QN|N Ѝ0  6ԁ0$ԁԁO-@Q` 1 P`|Pp@ 0S 0>S  T` Ѝ臁 1 3/ p ܁G-0 @0 0 p  (`,(0, P0U(0, 0Q [000C0000Ѝ 0$ 0 0$ P@ 13/P cPV 0 q)P][A-@PxpN@`E~804P"8%< 40R:AFNcp@-@Px`MH0,PU< 40R*p@/Np@-@Px`M0Pp@%NA-`@xPpM? 00+0`@`E0PPp:78AN//\00S /@-X <!t  L  R0S 0p@-PM@MpԁO-PP@4M?d4ЍO/lR` pR cR sR SR0 RS 0S# 0,0,pW4/X0Z0l $ $00 0000000L0 0H00<0 0 4/4Ѝ0`t(L4/X @4/<080804 ,4/P0 0@$4/4/00-4/X 0S 4/ 0S 4/ 0S 4/0SE4/V|4/W P` 0GOQ  0 `$0P ZP4/ 0@4/4/Y 4/̀QȐȠU~  4/`p0W:P4/ r 0 4/p` 4/7_7_7_8_,8_n8_8_8_8_ 9_>9_R9_e9_{9_+^9_9_9_9_:_7:_(:_9_p@-P` 0@Tp @0A-PxpL`V  `V`V@L L@P` D@P` <@P`A-4@c0(P  Q QA$[ V`W, p^0@  1a1 q!1Q<1( >01 1010 G0110S=p0S'L`(RU,2P0@0,2 \01000x0SlldPP0P00@000S0;L\@ЍR݁TJԁ0>:_܁A-`ph M@lPP L0 0H00D0@0@0 0<008000` Ѝ݁A-PhKd0\`(BpTADK101KK10C1@ԁ0p@-1@P ^ 13/p@A-@p000`0S 0;S 0S  ! PU  0RP Q  w(0, 0(000,00000Ѝ $00 $0ԁ]p@-0@0S00S) P`01!000C00aP0A!400C40p@0 KQTA-d0@S h3/00P x`KPЍ000p PQ /K0S  <04S 0— E R :@H B, R:0CP du0p@-@`PJ0;SQ 0@ <0S T0l+0T0J`P`HJT0D0CT0,JU@p0T   ԁ0ԁ@-PG-@JP1S1/R 0,2/ JxP.~J00Jp吐GoOPU Q 00Q 00=U  XGkԁ0]ށԁ@-@@~݁dh /BT]!//A-Pp@`ᘀ010 R BT1 000  00  Ѝ P   0PA-t0@@Pp X0 0 `ሀ010 \ *! Pp0 0 0 Af \ 1:0 DPG-81@PY`10S 00 1 /p0V00  JPZ ]  T T00T00S Z oTrpW \003/Y ЍG0000pW V`PЍTJ߁ۀd @-yI 0 ߁d00S/uId߁00S/Id߁p@-P<gIX@@ 1 @T |T1@IpO@-@P RI@qTO@- 0@ ߁O-p0A?oR20LM(0S0(000p$000%PP/P" 0 P 00 0 09SuS 0 0CSrTTTTTTTTTT T~TT$T,TTTTTTTTTTTT0000S W 0W0#03[0S000 M+6S:@TTTTTTTTTTTTTTTTT|TTT8TTTTTTTTTTT TDTTTT؀TDTTTTTTTTTTTTTTT|TTT 0D0C6S 0JY P0S00c0P0*S 00S00 1!0 0 000C S\00[00  000C1!0 000C S@PP00lS0P00y Pw\u\s0@00000mP 0`@V0-@t` rNS S G$ 0$B0N&b0j0I  @o  @@hFHoP 0`@0s 0l@  @ `@@` H$H`5`$0x0@P 00s 0 [RQ   GG 0@@00T``Y``0 R000X50,000C Y 0SW 0W0#03[0S,0 S0C 00@DT 0@ T0 @`Cv Vt0S$W 0W0#03[0S@`Ft4Z0s   h@P 0 @DS00@ wP 0`@0s0G0 0 0 TC0P* 00@@Cl@@ ` 0`@@@` H$H`\3$0 0`@P 0N 0P 3l@  @ `@@` H$H`G0ANa00 0j0SQ000JB5 05 00  C 0- @` 0Sc(0S02p03/LЍ0SW 0W0#03[0S 00 00C 0 0S M H! 0SW /o0"W0!03S0000S R 00 0,  0SW 0W0#03[0S000IY 00S W 0W0#03[0S@D 00S W 0W0#03[0S00  )]s:_:]d-0@-M P0$@ @ @!800S @ @wЍ0@Ѝ/Ӂ-@-T0341X  1 0S 00 00 ЍЍ/-@-T0341X  1 0S 00 00 ЍЍ/-@-0 000Ѝ Ѝ/s@-P@`0 `Ѝp@-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@߁-@-00 Ѝ Ѝ/^@-@P`00 `bTU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <!1 @P >`Ѝ 00 U00S`C 0S. z,@T@p T @@x 0R#T d  R ! /@!bCQ00 0@!@ x @T 0 0 `ЍG[?@1c  Rp U 0 %2^dgfffz:_@-@ @@ 0 4 00"  |@߁ )] s@-@@-?@-@P0 @ @ @800S @ @sЍ0@ Ѝ/Ӂ0Q   :_:_@-`@P T0 P000S   yIЍpӁ-?@-@P@P6 0  000c3Ѝ0@ Ѝ/ 0S FP P@@-0`Mp@  FPZ0 Ѝ0-@-0 000 3ЍЍ/@-P`T10S A3S 5 l PT Dh#T 21 2@00@00A0S;$10SA000S 1!0Q000 Z$p0 P| 0 pp0 0S d0d 0Q01_T90 `߁߁dӁӁa0:_߁2^+^:_-@-`00/s@-@P`rT 0 ,@e0 `Ѝp@i^-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`pp3T 0 H@&0 `\,$00S Ѝ@ Ѝ^߁-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`T 0 ,@0 `Ѝp@^-@-  ЍЍ/-@-00i Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppP0T00 0 \@0 H0 0SЍA%Ѝ߁^:_-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``WT 0 H@J0 pP$00S Ѝ@ Ѝ^߁-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/A- @T4qToBBP(@B01 010101iA-4a(P!R Ap@1!#880RoB$1 q0$1 20 20)ATB@-`R( 4q@_LB\0  (0Q!@D!!R Ѝ@xBA@tB cP ,B,hB Ѝ ` `kP B@p00S/@-`0`@0S@0D 0 @0D A@0D 0 @0D @4B߁@|0P-  !T LD.!      /@`dl 0CS@-T0 !< 04 ,   !/:_@`d@-`P 0P@-l0@EOoB$0 0!0 00 /@`d@-<0CT 0 !0  !0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P`@ /APp@-@w#A @00/A-@Pp` 00$0@p#0 AA-P@`wp 0S00  0S00 x0SAA-@PpY` 00@000#0 A[A-0P@`xpx00Q ` 0 ? 0S0Ѝ@ @[4T?/0 0 1PS/ /@-k @@00@-2;_G-@R`pp@ 0SP!R PPF Q PQ M <P0 00 0q@PԟTp@-@PV@0S` p@@0U* `V 0a@-@@ 3@p@-`P0@@Tp00-@`0S   0Sa@p@ p`p@-@`P@@T 0S@A @E@pP/0S /O-p`?0S R 1 ЍO%@#@?@Y:@010@P?@T R A@@0 ЍO0 S   ! 0S 0 0P0P??T  Ѝ^;_p@-@0T S Ppx0T p0APdP PpL0`˨P(0A ppc@B@- M@ ᭑ 0 R0 00CS0 R=9 = 0 Ѝ@- 0 ?A3c 0ЍMb@- M@ }0 0S 0  AQ0S00  00 Ѝʚ;@- M@ -0 0S 0  AQ0S00  00 Ѝʚ; \0R*PRQP/$R//</@Bd 0Q P QRP/( Q //</ɚ;p@-P@P@ѐp@-M pP@Ȑ0 `\0`^Z\k` 0 R S Q 0 Ѝ\ S0 C^  0\ 0 0/ʚ;A-qP M3 Bq>T t134AT \>@ Ѝ]J@^>000 `>>0 000@0 0@P! /00B! 0㨀!!3B4a4>T .Pj>p@#`c>!  <0P P@ Oʚ;@- `@P0 00  Q00t0  000 0S0  AQ0S0$0  00Ѝpɚ;6eʚ;@-@^   H0R  0S!S 0\@tɚ;@-@^ 0 R0C? 0!T0R0\!S0C-@` 0M0RPЍ0# pPPYP  R0 AQ R0 \000@XPP 00S 2a/TP Ѝ000 @ 00@- X( b0A*(P Ѝ@- X b0*P Ѝ7@-P@96 \0P Br4  0 Q Ѝ0@00U -,^ :!!<  12X0 0(X 0 p@-@P5`Qp@760SPA-@pP`50 00@6ЍO-s,M@0PXP`$ 0) B5  5  540 L#C8."<pZy?#ßpX0N40 38<p000Td0ar@P] ph 5d0 H0 TpXp弅0F1PT0`@VL0X0P0\0$ \0`0apUP!>pq q,Q02012410Q'5*5V`F&p8!qU.0P`Pd0 h0PS0  0 PSI d0 $SPB m@,Ѝ\J  B(xp0EQP! 0@A 0 P h0 00 0< )X0O< @@ Q P`FpGd0 L4( @,0,@SI$1((0(1-5;_ 0S; 8@pT005 0P0p 0UW000S  X H0 S000PWxH@T8UP00 Z H0 S(0X 0 Ѝ0XL P0RP0 0P0L 0LP0PL0 0ܕ00C0T R 00CS0TZpLPL P0RP0 0L P0 0@ H80<$P PXTpW Re b@-@4!@M8 R@Ѝ0@ OP00S 4004180S/DЍ00@-@DMP @ 6P40$S 00S804000@ 80=O-lM34q0@0D08P80<0/(08 $000/@TX @L P0RP0 0P0L F00C000`h 0S34YP0   H  $X0L ` F 0 0@ H80</00T X```F`/$Vd\P /$\  H 0;/ XZ B @  \   ) P0   K 0  0 L  Z  b 0  +2<_C-M 0`p` @0P 00P 00 0 0@Iw?o2P0S RR! %*ЍC-M 0`p` @ʱ0P 00P  00 0 0@w?o2P0S RR ЍO-!  j 0 03/@P0W0>  @ VTT <@4`0p$40S@  @00( 4 D04%0($PL0/%$($('%%%$@0SD  D 040S8%($#T<@(%T|0@P0S 0AQ 0S 0 g( ,0(, @ɚ;6e<_ʚ;O-P`p(@T 0(  X $$Z $ @ $HV(@  W r$$[ $@T 0( u `,0pG0@0,0$v0@-@M0@\ QP#4!0  ᴋP@   o@ Ѝ0@-PR  `@P PP $!$0 `yP $W$  0PЍp@P/p@-MP@`ᵪP V0 ! 000Ѝp"RS+ P P $#⒪P2U0!}0P  RR   ' $$ vqP2U0!\P!SSp@-,@,P #p@ ]#O-,M`\ s p'  PTXPp [ |UUTUUUUTUTUTUUU P00\T X ,ЍOP 0 P00,ЍO3??@P $0 @P+ 0SP  $ [@P![ 00$ 0 P$ 0PP P ,ЍPP#@P P0T \0X ?  /%>2   4"  R0@`z 0S4#,S  @P  @Pz0qS0p'vw  ⛩@P^ [ /UUUUU $0⁩@PO$ 0RP` 00 0)`P3  Z 0 B%ZRUUU UU   ! PC_oRU PSPS000  ` SPPSPPS, 0P` =P`N@O<_0@- 0@SP$M  P 0 P    $Ѝ0 0 R !//p@-@Q1P0 4aV"P"@p1@0" 0@-@ 0P  P ЍC-@$MP [P 41$d z?0 0?@$ЍP`p崀P`1S$ X*41$d z?0 0x?'V  $V $塨PPPdX<_@B=_@-P04Mp3     41U`00@ P P$ (0"L 0 @ 0H4/@P 0 S tT  #T R@PE@00S 0 @\P0P$4ЍXˁ@-P@`?P 0 0 `ЍpO-R@|M8 %PP 0 @+Y 0,Q@! 0000 1/@P0qlX X@2` @P V & |Ѝ8 `0P!,0#(04!0 0 X/(0S8(0 0 0 @ 04/@P(0  R tT  #T R@ X0B 0 R   @[ (( R LP0[P  ֣@Xˁ0@-0 0Y ЍC-4MP 000 0$03Up41@00 P(03`T 0 @ 0P4/@P 0S tT00#T0S@  T  0h 3 4RP 0PED00S 0 @[X0P4ЍOXˁ@-P@`1P 0 0 `ЍpO-R@|M8 PP 0 @+Y 0,Q@! 0000 1/@P0qlX X@$` ~@P V  |Ѝ8 `0㘱,034100000(0X?h10SH(0 0 0 @ 04/@P (0 R tT00#T0S@  T  0 3 4Q@  (0X0B 0 R   @Z (( R LP0ZP  ᷢ@XˁO0@-0 0G ЍO-41PMp0^P P. @@ P @f P0< 0,p(`$ Gh0 0,1 0'>< 0 0,p(`$ 5h0 00 0'>< 0 0,p(`$ #h 0 00 0'>< 0 0,p(`$ hh0P 0'>0 0,p(`$ P < gDЍ =_=_=_=_=_=_=_ B0 /@-800P Q} 0 p@-@PBoPPVP h(Pp@zZ R00 A-\0P3`4qs00CS@@0$N@T <A-@` -0p PP $ЍJ@P` 0 PP 0`P y `v0P1S!!1! PU020JH(  P  Sp@-@PM TP0-_PP+@@@`?V& ^P0@0@ @@@0  tP|0 @T@^ PPPL0Ѝp80:@0|@]@=_3U^p@-@P`a0P ( R 4 pU  @@p@-pPPM @P Ѝ @P0S00C>S@0`S@ 0S@ xd4100@-@M P P O Ѝ0@-PM @P p@P0`S  -0000Q  @ЍO-@$M4 0Hp0` PP PP<@ 3 P@P   (  , ^ R 4!W$  RR R0R Pz㽻@ D-<*0j/ 0R(L PJ 0W`0" ⭜1 00 00!  FI尡@OpP> @  P $8H1 00? 0@0 <000000 P  Px0 00 pCL0 T# $Ѝ0S@P]vok`rτn0X@Sk/1!p@@PEV/]=_>_o @0p@-P @`M P  nPAЍp/G- p0Pa@POnik` 0 Sr$0SH PU10 c /o 0b4 bQP  S  !R!0C31$00C$0 P 0 iT 40  1?oW20S@   &@)Ѝ!U   0*P @P P0 20;0P"  #P<#(@@- 0000@nP 00Ѝ0@-@PP$M  P 0 XP 00$Ѝ0O-2P MⰰR`0S: S: Y` @@ `P Ѝx2  P `P rjU(`; p 0S{:$ 0REXc00 40h!  @ 1@11ᨁ$0 S`PU Zx0S P x Ⲛ|0 00$0080匰$00$0< A( M VU  I?[ 0V P `P  j P0 #R< # 0S000@@ P0P(`(`d 0  @@O0@-04 Ѝ@-@PM  P#Ѝp@-`0S4A 1X03/L0T `0p<T00 p@$$!p@JO0@-P0M0@000TЍ00 0 @C-$M@`p4CgPP @ \0 0@0 0l00<0p `0000@0 @P 6g$Ѝ]CUA-`4AMp 1PT p@P*0@& (@P! 0  0j?  0 0@P If@PЍ @- $10/10/w G-4Qpi`P1@dW0S P0 o! @@P 4PEP P0P@@G R H@@p@-P4A*PPp&Mpp@-@4Q@P@pP0$P R @@z@s@-@P4a|0 @TQ  @Ѝp@-@|M?T@$x 4Qp` 00d0@ 00$Xp0OMpP@ T E@ }|ЍOp@-@4aP3$1S !@T 0S LQU000L15L1 0S p>QPPG-03p@4P`tU0 !0P RP Rw@P "P qC-`PRp`$M` V000 05@P $Ѝ P0C@P0 4P0N%@hp0p IM \ Mp@ #PV  :<@@V  >_@-`PV  @P  ` 0S  @QЍp s@P 0 fC-@MT;0 p0I S@#* aVP1P @P U 'Ѝ ?@A-`@V$a0P @P ?T034q1`P j@@A@QYT @@-0P@3U$Q4axPP@Ѝps@Q  %e1 0R # j@-00@YP &ЍG-pW@ PP F40`0Ss ce@P0S w@/p@-@$1P 0j⍗ ≗@ Q$1180pcp@-@R 0`$1S 0PS P@pP@L 0@0@////// B00 0CSr//Q 0S P 40 P0@1S///A-@<t03@`P q|0S 0 R0`h'd0P0U TpH_0AD0Q00C0 R0(QO@N0@-P0M0@000TЍ090 0 @G-0@`p @M(0 0 <0a0,$@ @@ @P<@`<0S% 0 00< 00a000'>,0(0$@ @_X00P000a0,0($@ @ @< _@Ѝ>_TU>_SU~_C-M@p^ t0 P`㬀嬐0 V:ᇒT` V 1@`V]Ѝ0`1S 0 + c)>_.>_C-M 0@p` PA0 a 00P 00 0 0 P[?o2P0S@.0S@*ڟ]PU@$ @5pU*0!R0X  H@Pb@$[ @l]Ѝ@-808@ P 3۴  @APU^0@-M 000 00 0p6@P@,P 0R 㸴`0 S |᬴ @ R \@0`80 @@P ~Ѝ@-0 000 0 000@PЍ@fЍ0G-M0 0000 0pPPWa 00R PY|@Ѝ&@P P0x0 x#S X  0@b`V`PU#Q  @0S >P 卲P d}T{@x(a0 S  2#9(Q@NO@0G-M 00 00 0pZP@ d`P HG@Ѝx01043P@吀0S* S@ud$a t`" P L@@@ PUY@TQ  @udV $1S 0᐀09j8QO0"!S/ 00/P /A-L0C\1S`d1P\ATApv`@00@-_O-dM∀T$ X`C>0S @1 0d1d4R00h1lah10,0, 00000(00X\1X10 4  ?? 000T1 0040v3 R `p0尓P$0Sʐ0`EP\ppWt3, 0倣奓 00P 000p0!`000i 0?o S c $0Q<V 20S0`` d1 0 ``*P p$ 0R  R 0 00SW p4T1S0X!00 00S =wp #WpdЍ8<0Y Px <0`1 0 2/P<0 ! RT!8 `  00EP;0P #E`U 003/Z @1`0S#T1EpPY X P0P(0`P r 04 0S "T1S S 0Tp`p0D0D X0L0L0Y 0 `G (HpP l 0H0H pd]]0O-`QM Ѝ@3P3"!$ $ ,R 41/,0<S00:0p>0BrWÂpG2q0bFW UMTYYe Z(` ʱ`U i # Pg (0V  弱 UTYpGlF ( P(P ( P(P ( P(P  ( PV(P  ( PrV(P  ( PdV(P `T p?  P1Y 0 p8  P!0 !0 0 oUQ   oTQ 1  oYQZ p SБ ̑]p@-P@U`0M  `PPP  WP 0P00Ѝp@-@PP4M  AP0D S# *a/b(0 0 004Ѝ@BO-p0EM341, 0 ? S0@3%:a V PᰰP  @P81 00Ha@P @ U ᖰEߍ]@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  PP P  P0(ЍpE/0T!PR/p@-SP@dasP\10`1\A `0p 0 pO-0@SP 0S 0`RP `2T0SST1[0SF`0D 0 0@ 000 !@ !@#88"(@#4<@"$#2>@""#1?@@0D?Sp@!@D cD8B\!s%1&000   5FVU? Ѝ[U  0 h0Y% lР21p ppp p p\0R 0T1X1 X!| R   ЍO P `|]A-`唀p?`@T|@0C0uP@PEPWD 0 F0 f021@& 0@@A@-@( @ p@-@ 0Sp 0Pu  R \1S\  0S00p@ 0@-P0M0@[ 000TЍ0 0 0 @@-0M?SU41pd0@SPT:4> 5`P `@@D@ t V@@ S @Ѝ$`嬼V00S @@0` 00_@P@T <@H TF t T T 0 d0 Ѝ@=0@Op@-@xMP` x x` P0 xЍpp@-P@xM`x b0041d0 0Q0$ uxЍp@-n@P4qeM  I ;  eߍ0p@-M4aP. @P 0@  ;@ T@ލpO-`0A$M>SL0p0R00P4A 0y V4EUSp 0S $:$Ѝ0S[[1S L0  P3 [" [H0S1S 30SX|9 20S 2 ; X0__R>_X>_`>_~Ux_0@-008A4/Ѝ@-(0300004A4/Ѝ7@-@00P000U  Ѝ0@7D Ѝ0!?p@-P@P ;Pp:p@-@P 9000,03/@pp@-L2PQ@9 )2=C 0CQ0CQ20S ̊UĊU|UU|U|U|UU1Q1#30O !40iS01 01(p@03/1Q !Q) Q >'1Q>C/1C  Pp@\1QE 1CQ [?0Q Pp@s0S1::8C81?Ppd0!S0  00!!0000Q0S: R*0 SP0C BS009"LP  s@s@D~f}f s@-@^)0 0h0@^p@-D0T@`^0\,0(@P@U^pp@-0PQ x0@Q l0Q^\0S0 R00^p R0*^0\0pp~fTf@p@-PU @D0`(0P`H0}^p|^pp4]p@-@D0Po^pp@m^p@-P@Pe^bbh⠺p"pA-@Pp ӇN^\00tp00@`0E^00F= 00'`PP嬴寴 @-)0@ hCp$@A\  \ R/ C-0SP2@ p` ^쐟ph\ 0R S( ^WP"P #PSW0S0 0 0 =0 P0S00 S PP] Ѝ\0 W]  ᑊPuAp@-` P@]\0S0S E`]p 0p,O-50S8Qp@ Q1 `P)00夰 0 0(0 aPhչpV]WKK0 a]$+  P2,034500 Ѝ`X]o>_0p@-@PP D0R p``] b_]p pX]@- M0@ P 凾 ЍO-p0M `PP N D1R F@0]$$880S   $0P0S X0 S)KVH0 L0 H0P L RP 0 H0LP `p \ X RPP P(V\YЍUX]ɚ;6e@-@LM`p P P0U(P?oU20S  LЍp@-dPP@d| 00C/(0, | 1R@0@@1B @@VpQ!8 8S0 00C0C0CQ0C0C3+C? R0//p@-@ PP`r p@p@-@ PP`ep@C-M 0P`` @50hp 00P 00 0 0@K?o2P0SЍH B000= S//-@-0 000ٹЍ Ѝ/5^ 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`d@- JPp@-@,P080(p@s@-Pn10@T HP4޸(Ѝp@ DSPЍpA-<1P@4"000000D1 PhP P U D1 _```fh !`F000000000UL!000000D15 !_0 ? R+UUU U$UUܙU U P D00000 hLP U  _?0S00h8PS0C_0p/P/`1t ?Ac1cASA!"R ! ?0~0B?0S?0~0B?0S0? ~ B?01/gfffA-`M   8|pW 8pЍTP8@ph ܀8P8h@Tpp@-@P`\c0P`@P@0 0YP$ 00S pHO-p0`M0@T< @T P@U hPU 3`0 CSR"lZ 0S*" 0 aPV0S Q @ Y 403 ЍOASd3 9_몢 0"TP TPT d d0"T0z?0> TO됒P匲U]0@ 0P04" 8X"N=0S80004 00042 4 080H"N=0SH0@0D 0@01 D 0H01`0⨅ Rg 0CSd00046#50!2! 0H0?A6c0@0080?A6ch!d0T00 TOЍ_Q?_*?_J^8?_@BH'h@?_>_>_>_:_d^E_p@-Z`@`0@1B @ V mj\@UIpp@-@ 0 cOPP <0<n?Pp0SppQ mY`?_p@-`@PV0 P @R00PU(`  0 0000PP0C00@1B  PpA-a| 0R@PHp刀|0SPU  0PPp@-@P$`@pp@-P@Pp V0_O0p5^O-Mvt븁qPUЍ0`!@b@Oo @t!@b@Oo d @t' !@ D12 1"!10CS1!1R10!1 TЮ ~V% V+ VZ "3`V00D00 c0  Z [  E0[ P /OH0 @-#PO-`@pᄑ StM0@!B @ & tЍ< #" (1204!QX0 R D! ,P1 0S@0``$ / 2[ D1 |0 S0V dQp1dp#  XP` p_VG<1% ?0T!RMVP|I D1p`F|0 Sb|0 S-g00h 0 A000p`F000/P D1|0 SwVQu<L OO]p@-Hp@-v̞@P_ R`0 (20/ 8X(`% h  0,?=0111111111111pЛUHi?_p?_x?_?_?_?_p@-@01111111111111S !1R 101! P__/ 8h(ʱ0ȱXƱ`ı±p@v?OH0 6?/O-BDM P L; ⛱ p5 $``凭 0P`|;!<2 ,0 00`(P$  PphH(0 0 0!1 ,0 04`0P(P$ SH0 0 0!1 ,0 04`0(P$ >H00000 0 0!D1 ,0 04`(P$ )H 08@0, @@!0 0 04`(P$ H0 0 800`,@(P$  PpHx0  0p0 0h00'>,`0(@$ <08 GDЍ?_UU_?_?_?_?_?_h_HU?_- B 1"011 S!1 0 !q 0$6Hp@-@PX0U00 00@1B  pP@-@$0  (@脱p@-@P LQ 8CQ > _? = 0>;0p0<07|Q h'\$p@p@-@P ͼ !c/0000`0001S 0PV ( ,pTۀOA-P`p0|@@ @@1B  lAT 4/0 #P@P p@-@0P#PP@ m p@- @$^G-DaP@ H8& 0 4 0 T 4 T ( ,8q ( ,3 $0000S P + 8 < 8 $ < $  R P @ } zU <0SPpm P @14 0 LS 0000?Y$0!D1  L0S81  UP hEP000s@1 t1S 3/P0000  P  9\0 6 V1 C/oS" R   ^VS090DW1 C/oS" R D15 0L s OD15D1G"< P1 S S RQ1 S S R VeP1PC_oSRPU   0 9  7T!U1R%2R1 S S R V@  & U1 S S R 0<0儆T!0B?o2R0ST1 C/oS" R D15D10<0 U  P < SK1 S S R 0S b U@ PM1 C/oS" R# _ 0 R P ,  'Q $0060S0>;+ J L1 C/oS" RP N1CoSQ0 \ P P pS  p0L P P  l@p0; P P V  @ X Z1 C/oS" R #L 00 S   | 1R!i  P XN U_ H1S I1S J1S+ ) U' 0 0830  :/0H1PC_oSRPU  P PEUP#U PE0 S = ]p@-@AK `P i@p@-D1 M2D10@9000 00 P090 Ѝ@-D1@ D1L 0X1SY1SA-`@p(AP P | 1RP 0@1B P U Q XP GPp@-T@P`<?P,00(@@U+pO-0?2cŸ ?B3c 1#PESYL0S800ڈ0)V0S 0  J#P& 0(PX@X!R#U U#U_ `iSQQP 0 S BU` 0PP[B0H SQ00Q00SK |PtUAQ> 0S  R8 HQ IQ JQ  R+p$p"OgfffQMbO-M=@QP`4q/ <=Q+ "=0S-3"=U C=U%0CUl=U Q0CU 0CURD t@19@10=0S( -3$ f=34!1P <Q ek0CQ,0CQ<0S<U P<0S SUUUUUUUUU UUUUUUUUUUUUUUUUUU(<U %40cS KS V0CS{ XP 0 :/^zh{ CP 0  9/ITd;Q \;X;0S~H;0S<;0S P? ;U y 0p1S 3/P %X ` S] 1 0SY X0V $PQ(  ' D:P7 Ѝ:0So0UUUUUUUU9U907 0;9U 0CU 0UTX vD t10S 0RS;d9U \90S<H9U 0CU  09I0CUC000 U (9U 0U0!0k8UO >C0CU .8U 8U0 eDU8U 7U@ 0寧P { ! RX   Qu0(03/38U0 >0U> >C0CUl0S00007U& t7U,Y_ ~P  w :9|000| 0C0;P|UPPbv0 0Z - RT 0H0HS ^PP  0D @0D 0P7H^dP ^P",u,p^Z@Y T ЍO, NZw YDq0S ! S X0 0S00c0Y1 0RX0 0S00J1 0SX  $0|00@1$0\1(0S`1 T,.l4U D1"    2D10R810<1D1  0;; 0D!"0D1 vL1p8P3 pD12D1~PPN 0S" l003/ 03/P  8/y100?qPnt0D!  %<D!080 <0娀P P4 100100@X00X02P0S ! SX0 UUxeyPP 1 0R8qPhPQ Pu a1 0RX0 VPPR0 IkP R vS.+ЍO. Petrt0ht@f@^t Outtt??_@E?_Ct gtt,t nt ot st@jt@wt@tt,@Bt @HtH~fۀ_p@-P@U0  @  @1B  E0%p00sPH/H!/p@-81 - U1@PSPSPU 0\ Pp<0 3|P 03/T1 S S R 0<0l1S l13/ #P/p@-P,0@TpsP @`/@-@PD0@PP  80P  R 00 0dp@-PPkL0@T 0S 408 CTT 00 0p@`@-@P(O$08 TT 00C 0@dA-@7qP/;pPP` ssPQ00|0p @R 0`PQ 00400S  R  0?]`@-$PP d?_?_@-@XT08 CTT 0S 0*0S   /d 8080 1l1S 0 0// 8080 1l1S 040//0 6001/p@-PX0X` 6H001@0003/000lQpA-Pt`P@@@ @L @ Q@P0/@(0, 0 00CR QD1 WP00C0 /@-P0 @"6 0<  $0000P0@mp@-@Q@ x0`"6 0h Q0000X00X0 0$0Pp$p@GO-0lMS 2P"0 & `될@, 0 XpW 0X090v@P@  ,Q,#NvlЍ Y@T 0HY0 lЍOv| R L @ Y<  -@P  u@T0@@ @phdRd #@@P uv@T0@@ 0R0T0S@#@@O-P @ |M0d2db 6X20h00z @U  k LpWO R LQ 8 X⎦ gTidRd #@P@1@! v PWM @Up@@TdR@1d@#~ v P@6 @ D!L"$ L\ "P R (L  0  Y#p@@ R ( 2/ @T Rp0^ = R} @@|Ѝ K@P{G-P81 6,10q$`A@ 0@ 1 | R    X0S $ Y0S@ 0@  L0  S#  0@ T Q .Y @ 0(L@  BQSD1  @x0p@- 6h0@ 0R1 R p@ PH P04} p 0P<]P]p@-@ PP`h0p@p@-@ PP`[p@A-P`tPL @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @@W\p@-d0PQ0A TT 0SlA@OoBU $Ep@T@G-Q`Q3@Thh VT@ ᷐p00SS@᪐ R !q0p@p@ ᖐ0X`㎐p 0, *l0AT T $ "`uv0q0@_7_A-@0` F@PP x0x0q@l1S XPH0@`l1̀0003/D1;D1PUUQp@-4Pp@$\0S@@Ֆp@-@ $DT@ 0,sr/p@-Pl0@"6 0\ \ a1 $T 0$0Lp@^A-\A0` F@pPP84 0101@0@$lJ 1810<10D1K<@1=`1\1l1S000( ,0 03/P @ 0hP \PЍ00   0PP0C0 +T0p@- 6D001P003/@~@epO-P졟`3䁟4q1 610@ a 1 QX  S L0S& pq8L0SP.9P1 0S X   1[P < # XI[ `|r?[ L R8LPHuUl!R 0 03/G-,4( 6 4,0 a4PR"@T 0 X0@0X0D1;D1@D1  0 X0@0X0D1;D1ЍpbvP d3R \3Wk 8>C1CW $<3Wl 0 $@ 04/p@z 0 $p@q0n 2 Rj@ Ypv2W, 1\0CWh||2W" 0CW 0TR 0 00<0,2W0CW20S0S00@0T @0 @00@0T @0 0@0D>SxfD1S0 008V|00D1  0 1W )1W 0CW X0@0X000S81< U1ST100C?o2 @ S8 X0@ 0 0X0 .p0W T00SS%X0@ 00X0`t$Uft_t u wt@pt tttut 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`dp@-P@`ᗍV` UB00 0Pp@-@P }P 0SBt000p@-@0SP  \P 00BSs 00lRQ3\000 0S00000CS000qpG-p@`V0SS 00^H"U PPEVP 7n0 `F0C0 0PU0P0A-P`[Q@ V @@DT @@D50L@0BA\@ ^@\ A\0SpspgR\Π p@-@P0S0000p@ S0C0LU0 BPE0 S00 0U RR  p@-@`0 PSpS 0S P0000`\ 0BSs00aR! 3 C<  !0 0000S000pF@_O-`Q_@p0 S S0S 00078岤 P P PPB PE0UP Zm R A00N \ᡡ:50C0 `F00 0pPU0P0V 0R@ 0030c00 [ 00^@_0PPQ/@P - Q^00@Ss00nR\3 0l S0 -0 ^  0CSs00nR\3, / p@-@  RP 0 BS 0 \0C0P 0CSs 00lRQ3\R  pp@-@P.pp40341X  10 P /-4X  \& `@- @4 X0  P p Q  Q\41P!  SX @ X @@@@at Op@-`d0@341X  10 PU 8i0 ᱓@῕p@p@-`d0@341X  10 PU 8J0 }@᠕p@p@-0@41X  10 PU 0- Ӓ@ᄕp@O-@ 0S0000 000HL;XH0H00v p`F0Sp0P G0 3SH0L RP \0  , Bv R ! 00CS 1 ^A_] B_ B_@-T Ѝ@-N ЍO-P RP@ @ Ѝ0S@PETUT 0S     @ QHLQYUP`C !ZP 00YPZ0 P 0 0SP@PpJ^? \ RU [; #RHL RP \ 1  3S@H0L0S<\H 0P H  0CS300C. R+0 0000 i]00C0@ , B!R \  0 |0000#PZL0 @P> ` 1]00C0 00 R00000 @o]0^G-0P 0p@P: 8  0 0  000HLVH0H0`夀V\PP P  0 0 000HLVH0H0`\n@]AB_/-/-/-//-/-/-/@-@VT-@-A-PUp1p!0@W`DS W c cbPW(0G-p`00 00@PP) X01 0!00000P XI Y 0 000P Y J0S@GЍ-/-/-/-/-/-/-/-//A-@$P` Pą@ p00  [X  %\`Wp  \PG-4pPPP8 `V@P 000 0 `PP@ЍC-pQP`M 2 RP0S PЍ05Y@W  00040"@0P 0  5 0S20@T@ 2WG W" 0CWX P:4US@P PU PH00@D@DT 0P뼖0p @TՖ1P0T900 T:0 Ė@T 0S3 0S0 OIT @P P 0 FPPUP W  4PPiiip@-@PPPU@` %[`PpPp@- p^0Pd00S P/0pDP<@吉80 @pQ&0]Àp@-P`0` 0@ 0AT 0S`0SC@ 00 0pÀA-@Pp Z, 80R) 0 R) *`00<00@0 0$0t`|`p00S0x0 00P0:0)`P@@ A-P@p0`,PVU  A]G-41p!,10RC*Q`= V PP<*P00 /R0S /XPPay@ '`DZy@ y|ʌ0PP 0,`8$0 Pb<@<?$?T@P?]B_@-@P -y00@-@<~?l< 0S \w0LS   ,P 0y4ℌ@Dy@€p@- 0P0CS`@ 0400,0?o2@_T vpp@葕p@-@P 0S 80 341R00 Dpp@-P40@AT ,NXPp@@-0 00 0)P Ѝ0A-0SPp` x@dRTPiP (0S <@ 00 0@P@€0@- @P ,0S@uT p Ѝ譔@@-@ P$0 0\  ՐЍ7@-P @P 0, R( R@   R t #4!Q@ 5T 400S ٔ Ѝ0@h@0@- n@P$0sT@ 0$0(0S j Ѝ Bp@-0P p`8@嶅<0Pᵅ@0P pO-@PDM TP\DЍOlQ @A@A7H1  m @00B,ap0 !@(0 0 <00,p$@ @@ @!"0 00< 000'>,0(p0$@@ @"0\00 P0< 0,(p$@@ @!@PP |DЍÀIV^bB_hB_F)_]p@-@P8{w0  @P rwp0@-`PP @+TP ЍPPp d0XS   @00C@0 `V40040V €A-` M4Qp 3/@PH@P 0 (00 0D1R 0@ Ѝ0 @P   0Q$ p#Ѐ4!0 Qpy@BP 0 @0@0@0!R pq 0 00 803/@P  0 0幔@]DRSP@€À@-00 0 Ѝ䤋@@@G-pP0 M 40)@P̔@P o Ѝ0 (00 01R 0 ᚔ@ D H03/@P$ha P LUZ0@@00 0 P @  @ /T  cP 0`P 0 0 0V @x0!0R:@@1PPS0P1@01@Q00  P@]À@- 0000 00hЍ䤋@@-MP `bPp% Ѝ(  ( V00S  0⑖@P ⩉@ T(00C(00$P @@$ U0 #@0 0@-@MP 7P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0!0@ !0f@ W qqq 0000S 0 2P  0  )000000C000C0$  S$ 01<1&30<0<0T00S7 0S 0 ?o200@0HpW81 [ .pP 00 0S 0080 3/0  ) U P A1Tpp0T@t0S 0t 00900#0pA-pP`@0 0S@0d00T T0T H0'&S!@P2$P @H8@-@ 0 !@8O-ܐܠ`̰PUV DŽ0 00HP0\@P `N@@ p @@D7\0' $`$0 ,0dU p[O-LMPD00p000 D R Y D (Z`t    ""20x0x t20t2p0S@t0p@3040X0404 P }4S @t004L /DP p0S LЍ00 ?o2Z0S 9@00SL t0 0 R800 ZBT@0S 0SP00 R0S  2t0 /  3 Pa@Y2t0 D 0001 DR   Z;8 10R0 D0p 3/0@S000Z1;ò10PD0Z[pZ`qzD0(0 D0S0bt0`(0 0003 R7000S3# RQ- `# ,  , R% S 0!Spx 00(#0@>0H 0P$0  H0`0  n!@P(6<00 $ @0S@@ [fZu;0o Ti p2 0{b W p00K S@C0`H01`B0 @V$06@0<0S,ƪ0!$0H` \p 0L00P4040T XP00 0C0000 00C00 R0000C0 0SK (0p`D(0p(pp,TZ(`t0000  Z p{ [ p p0WpS@@TK w 0[00Sx  @@0 p04/'@(@#@ @p0[`TVI0O-@`'~_@-|0P |@P V/ZI(0,00040@|8 |,|1X/@@h>_B_p@-@P+X){{{0p@ | R4400440(0$80$00<0$08/Q 0$ ( R$ B$ /0R$ B$#R$ <00# 0$0 0/0BS@-@`p P`X0$0X00|X0 0 PP͈X0  ,0 0 Ѝ@/ Ѝ]1M/ ! ! ! !  /7 $0M/ Xp@-1 P@ 00U1! $ (0R0  tp@6|L!: ,L!!00 !0p@A /#|p@@-@10800|@@-@10>0 |@! !@-@{{@{ P4:A-`SȀ@Upʀ 0! # 0  , !|0 ,0Fd0 0!!S0    !/@`d,@-@Q Ѝ0l  R:` <P#4!, i` @-P 00@H 0TD@D0<0RH0,G-`RPp0  ( 0dZ 0 R Y<8 PD @R @ BPS @P P PP 0L00H@40B300\00T0X0G00 GY```0ST0S@L@T@PB_G-PR`0 0pP@@P,  GUPp(0 0(0@QpWT0SPLPT@0@TP0@Q@PU7B_A-@R0 峀p0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@PC_A-`@PpTXU\ 00 0RX 0SUI 01QT0S0T0@U: 0#! RQ&  3SHL0SP0\00<0CR1Q 0G 00080 080@P@0P00@pL@A=~C_@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@pQ/T RT 0 0S`p@-@QL0LPpS  Q QP0 R00S0T@@0Q 0 00000 p@6p@-PL@Q``UQ V 800`0S0C0000800C80Q 0S L`L0SP0  RpT0pPE0`L`(C_@-@@0S87@-@P1 @ < +0D0 Ѝ0A-0Xp@P` U[<S !P  P71S010SP0 R0 p@-4$P 4`0?RL1S(@pP ,!80R 0,1010:01 010 `8@P 00000111010044P0P041418181@1@1D1D1H1H100 P 5001111001.1010.0000003/P -V 101x@-L@Q0L00P0T0PL0SO-p(0pP U[  |@`(0R@P U U(0 vPP 0H@L0BÌ\PTX0` 000P D GD]>C_@-P `@P   2EЍp7@-P@000T Ѝ000@;0s@-X,`0 ( P@\  w0@00U Ѝpw@-P0P@-P/ R/@- @@@A-P`X0@0X0ЍV,@p ;w@000W T =w@#@X0, 0X0xs@-P`Q Ow0@00V xЍp0w 00S/Xˁ7@-@00P000U  Ѝ0@Z Ѝ00BSp@-P@`zPP  $0S0$S0ĕ`pXC_p@- 0PS`(M  z@P- (Ѝp0  S@P0~V" 0;;0@P R 0  R ! {@P  {@ 0 S@ R  xz@P _p@-M0000`P @P 400Ѝp@-Pp`@P @ Ѝ0@-AMP@ fP Aߍ0s@-P`@P  @pЍpO-p`P0P (0S ^&@ Ѝ Հ@P S00PY 00 u 0} !* 4S#@k,u@Pd!401  504DT04U0S 0P`|04 8(040B=00  0  0 1 ::8C81@PPoTP r0000I~3 4?~Y~ յ{40#. 34-@~,034#@@ @_!__]@-Pp`*@P${1%@ @P%0!00$@ K0@1P pPt@X~ Ѝ1$ R 0@4 101 @ 0@-AMP@ OP Aߍ0G-L1p30M4a0$000P 0 @P/$0 (00000 0 @P*$0r,0 WP@ @T (y@P , o( k0Ѝ, z ( t G-Pp|UUpW @0 S0S``F``T@P~P }@O-`RY0pPP Ѝ@ T     R R @ 0yP  hU0pW@@IYW 0JPpaC_O-tM  ᜀ_ 0X  qR R? R(@J`` R7`@P 4 A0$ (P;! RCP 0 0 0$ 8A0 04/ 0@0BPS 0: pP  #P RFUH30` x@P 00V `tЍ 0`   ^%Q# WP |` PAUT P00XP P@U@ @0 R   @hU`kC_XˁA-PM`pf}@P 400000 0<@|Ѝ7@-PO}@P O@| Ѝ0p@-`PV M  V00 R0S@"  }@P0CV 10@0  #  Uw@P <| Ѝp #@-50S@,M[5221P0 4q ` 0@PF0 000$000@P& (00(0 (00(0 1:11:1010 S;305<0@ T 6$ }0 } $ x} t} 00$00,Ѝs@-`P|@P19@ 00003/@ |Ѝps@-`P{|@P 00403/@{Ѝp@-`P CP0p0  vP ЍUP 0 S05 @ wPT00  wXC_0p@-M00000P0` H@P #0@P P{P ={ލp@-p PP`IM  Qv@P0 0000 0@P # 0@P P{P {Iߍ@-`P CP0p0  #vP Ѝ RUP 0LR0  &wPT00  wXC_p@-0M@P` U? 000 00 00`0 0 4,00003PP #0PP 0Ѝp@-P4M`p u@P&043,0$0 S0 0 @P$0S 0@ P T @ v@4Ѝ @PkC_O-PPlM%  (u@PhB00S@c8(8w~P_ ( 80,00< (0 @, Q00(0P2 , 000 %{@PA0DT:0` S;# p0t @s0Sp 2 H0Ku@P :`0P < @X0 S$0 00  H0P #0@?oV20S@ P #TV0`D@ jzlЍ 10@"X0S 0HL@P H0 d00Hv@P`0`0S  p $ HP@P 8(, 8<0RP00@ S00S @P000ɚ;6ekC_@-@0M 0 P 0#܍@-@0M 0P 0#܍G- pW`P_0BS-7U@_PP 0L00 H@$ B# \PT0X0Y Pt`P 3>W@ W ` 0 R $R ÕP`03411  U``pV 0 0F0ERd000  R` RXC_aC_O-Mp 0K0$  $  aM R2 R(@=\P 0S* P0 400"04! 0 $008 P5Q>QFd20SO VPH \ p=A@P s@P @0U \P =P 9Ѝ0@P 00 0 \`R^00S  @P  RM0S @P p04AQ00 0004/0@P0 0* R tT00#T0S  T 0 0$;0|b4 Ch坺W T00S 0@  05"\0I@@kC_XˁOA-`MpP y@P 0 0 Ѝ000!  @x0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` /sP3$00` (ЍpO-LM` $ x@P0P S;# p̰0ts(0S 0 P0Mx0U@LЍ2 0r0P" @p0P  0 D02 s0PPkC_-/-/-/p@-^- `  R0S0000 0 0h 0@@0 PP00@@0P !@100D1 0ppO-P0㈰U`!R `VP R@ R RppG'qZY08/@0傹7@-@00P;000U  Ѝ0@ Ѝ00R0 0S  0Q < ] @- @-p@-@0`PVp@0 `/p@Bp@-@P0S 41d0D0|hHh@0L0@0pp@-@P P Ź@PZ@-@[Y-p@-@TpP0P R  RpPp@ R   R4t Q  101pC_@-C-@M`^hp 0p P 41 Pd00hhh hAh0S 1`Ѝ5hpsC-0`S' 0S$0S P@,0! C0001,0 (00C  @ 0(00M  XЍpCtC_C_p@-P@e Pp00Fp@-@R 000S0S P A-@pP`V pORp0S 0`V`x` 0S  0S 0SD@nA0*6P AJ$@-@5p@-0@SP 0S%Qへ0S 0S PYP0 @Pp0S@`厸00d s?P p0C_@-@P,啷80 S 08  @< @ʷJp@-@PpPႷ 0  p@輷(0 S 000p@-@Pk400C40妷 p@@up@-@`P?= 0 ` 5xp@t1M/  \@-  0S 0S00 /s)/C_A-@`pPP 00S0pO-Jw@Pscs0S 0S: 3 qlPU5|3PxPU>d3hP00UC0SX,34PU (0S 00S 8 R4 S 0 0S  Pl<0880XᾶJH &Yx[P婶    800C000S۶ P00S  4S 80S (0SZ 1P Q@00尶᮶ )    @t_Y000 00(X0X  8  80S00@000000wu t*PU000 ;C_J$KPV0S p@-@T p@P1` 0  0S 6/O-PM0S@i@0%@e@`0@0  4˫p 80`PR 0,0X000`df4%@P @T ,aPOO0@Ὣl@00@0(O@10@0$0 00D0, @0_@P zO\ TM0 0$pajO@00@0Ѝ @O-pDM@0%@(@0@0P)Y I80y`P @ T0,00`e4%@P S \ @00@0DЍF0S&@""_@P9됰[t=@ 0R l)@ Ob008 0 `P @0S $$ 7$0$0@0@041d0D0dHd@0L0@0@0 DD7@00@0@P  `00S p@0@ 0  0Sm/ 0O-DM!2P`p0'>`B` 0`,` 0 08p4($ P0 00!'> 0`,`0 08p4($ P0 00!'> ,`0  0 8p40P($ P 0!'>X ,` 0 08p40P($ P 0!1 ,` 0 04p0($ P0 00!0 ,`0 04p0($ Ps ``$@|i @0`@9P (&pDЍU^0_^C_C_C_VC_0@-00PSWP`. P @ Ѝ0 C  SH$10SD @P0S S S @0R00 @0R 0 0@0 @0R00p0S S S *@@0@ D@@0200S @*@0O-pM0 0CS@U#04Q 0xU`$@0001[ ! r@P $ [Thr R` $Q (@T R 0P0 I D ;Es Z0I   "  S$@ ,U 0  B5Ѝ 0   t s0 74  B4 r q0P Y0 00@(@P/ VO-S4MP`  R%Q@ TppTpWh%@D#2\%0T%$10 000[=0 00S@ҨpP 5  i50@@ !0 SQ 00/ 0S7*#@ pp 0 1tA00 ST[  3 n L  HPp$   D  p\ TX@ T[=  4Ѝ -qP (Q q pp0(2($ ,,0 0n 00$0044夲$ 00p[  RO  R R @@  @X @  r @ P L2  2/ᇰZy pP ,   B  , ( B@G (Z r0!S B R8BX |P< R=/ P@H@ UP  1 @ @  q#P 0  2/+ 0 gP7 JH 10 10S- *R9 i R R(m90D_@> ] D_P P// R0@-@d 40  000R  0 /0@-cMPa/j@Pcߍ0R@-@ j0S R0a/@-@30  R 0  /0@-R@cMPa/ cߍ0P7P0S gkp@-@`P4Pu 2/^Pi]ps@-P` !@P @JЍp00]00]s@-P`o@P0 @SoЍp@-RP00RA-@`p PZ@P <O 2]@]@-P` p!@P0 @J Ѝ0@-00 Ѝ]0@-00 Ѝ]s@-P`Ao@P @nЍpA-@`p\PgO 2g]@\T @@-P` p6!@P0 @4J Ѝ0@-00 Ѝ]0@-00 Ѝ]s@-P`n@P @nЍpA-@p`7 P@Pi 28]@/@-P` p @P0 @I Ѝ0@-00 Ѝ]0@-00 Ѝ]s@-P`n@P @>nЍp0@4SQ@-k0/D_ 0(8(00,8`0P R0z/G- P@ U `D`00@0$V0:Pp y01S ᳯ0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`Pl0p3D_;D_8@ÀO-QM 0|ЍOQe00Y 0p hW01h0#0 0 S0?o2?YR d@ d P@@D 0pЍb}|@Th2`SP W00Z0S@x 4234Ph  10 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HPL#%$%U  0&H & 'L ')4(   iP®U70T' 00S0/ p0  `PH0 h00P0 p00PL0 x00P0K000|@000Jsn#P$Ʈ 0 ]P[8À@ÀÀ0P @-P <P/ 0!< 04 0 (   !/@`d\ P/0 !8 00 (  , !/@`d/P 0%%#3/8| `0R 2"-D | 1# H LH RH P LR P @Àp@-P`@TQ-h00_Qh&h_000X S<@@ @DSd  RL F0SpP!pH8GD_`D_8@-P'30% 5 ! 8O-3#CLM  ƭ ­c0S00   @ D @fPliP$P\3 00L3 XPP PP00#3a0 03 PP PP00a pR࢟ಟ(ZOg V 0 &5<g V2Q" 0 < 00 ,Zg_pv_W0P@"[0   2`  2DL0,00! ! (0 0 00`$ p@p'1圑 01 00` 0,p(@$ @XZ 0XQ!T1 00` 0,p(@$ P @yF 0E 0 0!1 00` 0,p(@$ @y20E 0 0!0 0 00`,p(@$ @yLЍOD8V8@ÀĀzD_8D_F_D_hD_D_PÀ<V~D_ LVD_\D_D_D_V3D_  @-0PhV8D_000V-P@P\^\ l8p@-@听P0  ɬpap@-``BB,ɠ ɠ,ʠ,V L\ 0$000 0T00p`T00T0p@蚬HW@-@P`aHa 0"00000 00 t00 0 E_E_!CeĀO-`pDRDW($0 S*n  a@P9 .000 S p0S eP0$ 0C#2 BS*p@TX@) 0`00+b02 3 00D6A?, @00 0?P0 |@TW 0#0L0R    Na:a30000l0  S   $ p P p p0l U 媫^&@À8Tp@-<0QP (Xa@P :UP00p8@-@``@`p@-@000pa05000  u00;00)000 Q :00`P =>09#900S? ! 0R9ڜ  I S `P 800<3/90` =V0 &%kTa 0S 1pp@|Q t  | x x |000900000 0S"2aw0p@ `xS0000 |  @|    , 0C1p@ aT@ÀÀ8Àp@-@P`תMp@@Àp@-@̪0  f<00 03H PU 0 00p@/0 p@`p@E_p@-K  P8 ߧl0Sp p p0l N  @P  0P >x E4PllpA d0ic1p0寧!P00@À8@-pM(ppP,`@P" 0 "0V060000T0#l20l20SqP V 0 0 0 ЍV 0 0 0 s@- `P @ P@P0 <P @k00ЍpO-0Dp`8 P P @3밀4P<0YlPP@0 b<P P>00 Ѝ gP P 10 fP@ÀA-P`p 0M@P 0 p 0 0(90(A\A @À0/8202/@o/p@-@xPͦ 0$ `S00$ 1D " D0 $0@ 0D000001@  B@ P00P0p@@ĀA-P` $pAT !SR 7/P AR0030#A0000S ЍA-,P@U(p Q* ao 0R01! P $o 0$ S00$ 1D " 0Q@0X0C@0垦)Q A7,H!R01! 0A :\@ĀĀ@-@0MdC`2S D!0,0D2N, 00N   44N 8N8$<<N $ ,@@N(,(4DDN040<  HHN8<8 D$$LLN@D@$L((PNHLH(P,,TNPTPTTT X 4(0 00000Ѝ@Ā ĀP p@-]@L #Pp@ PT0QP3Q/0@-@P|@0S0 $0@\$ D$L P$0 0L0P00CP0T00T00Q0@ĀĀ@-0 \@: ^0:@#77. 2CP/2S @-M/0@-PR@X0\M0 P 0 XSX0# t0/\Ѝ0 0 R/00O-0`M<@ Y001 0AS *)D!000`Ѝ 08 y !!X] 0  0  01PaD!00080i FSD!000~,`VY600pWpXpW D!`000i %2D!`000\o?p$W D! 00 0D!000G@0``Ā@-900iЍO-$M00L 0 $Ѝ(2` 0S*"D!000@ >H0]X P z8 1sU P@V0S% 1I0"0p0@0p01 :#:0 1!c 0  VP U  FD!(00(020 00 0c@P` U .D!000,0S$D!000X {UH0 P,00wD!000ĀO-P2P 0$MS ao@p H0S9 yU@-gT@V0S( 1I0%00ġL001:#:0 1!=c 0 ~V P -D! @(00(0W$Ѝ2AT !D!$00$0E1괓Y@ 70.SY Y80.S 0000S X 0 0CX:00"@ 7L&( 1>@T X0 0000$ yD! 00 0ĀO-Mp80 0 0S:RP0b00T @ 0 S1`0cV`V``V:H0STb)Wu X`(,@ 0 ᣨ 6 s7% 7 V u  P00 0P0D0$0` 0D0]H-T a_W 0 W: .R7 .R4  ! `1W ЍOS(  0P0 $ Q$  L $  L $ 0 0L000$ 1᫢7zD!R 01a@ЍĀ@ĀG-P0 S@pa` Z0 qa Q11 1G0S 0 0 /1M0Ѝ//0S/9@- 00 Ѝ]@-0)  0;Ѝ]@- 0  Ѝ]@-@1 P  PP  ЍO(P S0P   P 0;  ; U 0  ЍxE_7@-c4P @P W;l Ѝ0W@- yD!000@@- nD!000@@p@@-j@-0@ @0 8 00 ,  AU0ЍdWlWE_| p@-0 V@x0341$P@`DP ;P ;P ; 0 000p| p@-@0341$P$Pp@-@OPJ:P :P :0@ V| $00S/p@-@P$$Pp@-@$0P@:,0 R P/20O-@Q1DM 00 @@@0MX1pTa 0 0 @@@M z㍠R0@(0100p00,(p$@ `@ @<08 DЍ E_E_tE_E_E_A-@P0S`Pp0S  ! jPQPW\PQ 0L 0000 0C00S  ! LPxtp@-@TpP`Pz 04R00 0 A2P00p h p@-@`T {N@0 StPz0S 0R00 0 0 8000R 0P0@@p hp@-@Pß00C0p@hO-`40@SPp0J  0SCQ  0RPDS 8 ! O(0 0S1z⏟1000 0PS,ß Np `000000 00 00 00 A 0000S0  @ Ѝ R RQ 00 0R000xt hA-@p`PUddM0Pp `P00S 0 000$ 000 00PxtA-@ `PX00pQ[0S0 R\S  ! 0< 0C0 00C 00 0C0 0pAE_tp@-P @R0`"  0Pp R Rp0SP/0S5:/ P/O-EM@1 `Q41P$ @1200(0,0`V4`88X00,0V@,P 0@,0/00@@0(S,0 0P 8U 88Eߍp<1p@B =Ts@ p0, (p@Wi=0S6 J@  @H@P JUJ0@TJ@W8(80 B=PT P7=  H@Pp@1X! pH@P J0(0T,0S C, /  C 80(P(0810CVS81ӂ@n :@02H00< (L0^@-0 ,0  oЍ$0 41P$0o/Q /O-P@ UMU"@&Z"?`0F0F41p$@ t00U3@00 {@ T F |W@?ЍC-P`M40F000Fp00 0/@P t@Ѝ0 C /  C07s0 0pB@6T8 1 !S X p Z P`F 00 ՜p@-@,؜(0 R @0@p|@-@TǜP00S@ S @R 000p|p@-P8嬜40@Tp@0S 3/@p|A-@`TpᕜH0PU4Ϝ 0S  3/@PPp| B@-0  Q &Q VFP-/p@-@@P0S0 0S!0Sp00Q!#>` 00`00Q \R HH ^V@8X C0\S]&F_E_E_ F_p@-P@@0Sp0=00P 0S!!//O-1[P4 @@L Ḙ<ЍOA _tW^F_fF_ŀqF_F_]p0W^p@-@Pᄛd00Cd0p@辛@ŀp@-|P@xx`V`803/0@Sh h0l 0lPd0@,奛pPh`@@ŀp@-@tUdPUh00 P Sh Rlll h00@03/`p0SP@ŀp@-d3`0XP@Tp@Dk<0S d00d0c<03/d00Cd0h@@ŀp@-`KJ@BPTV @0V001S*p0 P<@p|O-0P0 ЍpA @@R P @"U"P`@U Y|~ ^ 0@BOoPBu@T P@^0U0(@@(0@P X W VU= W 0 |~+ t00U 0S |~ ^0 [  W 0 0 00 t@@^0@TDVY0t@@U0@T |~F_0@-$0M@ P0 P0jPЍ00 S 0S (OA-@0`P^V(@` ^V0S0(0(0(Pp`p~O@ LuO0 000  ,p000 0S0(0  (0(`@-]Op@-@P,Pp4 80R8000804 (P)P@-@<)t0@ O|@-$0MPU @` 0p p 0PP EP $;WH;W;W;W;W0( 0 Ѝ0 R\0 0 0  c( 0( 0( 0 (P0 0S0(0(P 00 0 0 O-`Q,MQP8QpQApPpP 00 Q& RUP@00 0U<& R R R CP PP V,ЍUW0p 0P  P P P0 0 r  0 P@ *P R 01( 0Pp0$1P00(P,P00000 0 0S St~ S  FT 0#P@@ 0@ PW0  PU00P0(`4000 80@40009N(0PS 48 Q8 0 804 0(0U? ꀀ   ˜ $ $ P R Q !   (0 @ P,3341U P Z唘0SϘ0Z`PPp00 00P 0C(pS @WAWtAW BWPBWUr  @ ( Pl0S0SR 0 ^ 0R  0R\ 0@0 0( 05 0S"0S)U 0(   @0( 0( 0,P48P808 4(@4`0 8 04000 ,0S(p(@0 0S 0 (00U0@0 (000 0 PP 0Q1!sr0 PR 0P0 0PP@P0 0Pd000|0@-@T0M 0H0 0@0@@0@0@K$P{Ѝ09W:WF_|p@- 9H0@ oMPP |9p0P00xp@-P@ `APp R04 0A /R' /Q 0B0 0A0070 0R99 R999 00R .Q .R: :0p '  ?p0/@-0@ P G10P@A1T0P  P  P 0P @-$`Ps0 P =/0P 8/00041$@gpW 0 8>p0@0 /RF 0PS P0 U p 0 )/0 P $/0P /0m00卽0S =〃P  0R"  4! ` !`S 0 0 QP 0 S !"P PSy u0LP00 0000S000 0: 00 00 0 /R RPPL z 0`\0Lp 0h0 PP0    +  Q  00}0\PP0 h0 Pr hPg0 00 hP070Sk \Lo.0L0h0-UP0K00LP0L PUP0S R0S 00 K0P L$PP LP K0S 0K0-.000000 00S 0 000 000000 00A 000P 0 000C0_0S .PP 0h0-Ph00S 0 L0SE W-0 .0\ 0凼 0S+L-Lp0S 0 hP h00Sh0S p0h  .PPh000S0^.PP 0p 0#hP -0h0 L)PP-PP\PM FK-tP0LS 0S0`(0*00 P K0S 0K0-P-0000P00XS009_ P  K R K0p-P0L00P0K0S 0K0? 000 00C 0L00<0S0S 0P00$0(7倓0$0 S$ vd200 $0@ ==PP ?LP H-PF-g  ITT p;h  hX0| x0lm$0h 5?P?U Ixx IP,0S60S 41 , 40H,0/P 0 `@R 0 s {R}P` /U 0X 0X 0S h`P40凯  0 S k*(0 0/U  ` `0/P0(0H00/U(0X 0X0S 6P0 SF*80 0/U (  (`0/P080!/U X X7 0S4 DP.44 0 S"*/U  ` 0 |400 /P X R   0l03 rH0 0 S:3 hH?P!/U  X X 0S TPD\ 0 S *,/U (0 0 ` ;u/U X X 0S P40 19 0 S */U(0 0/U80X 0X0S `PP 0 S *(0 0/U 8 8`4 0/U80X 0X0S sP1 0 S*/U 080 0 18`00\0/U80X 0X0S `PPP 0 S D0\*8/U(00(0 0/P 0(`0D070/U(0tXS .PRWBDA0 \L 0 S 805*(0/U\ 0 ` @ }U0 {  0 XˁG_@T_L_G_%_́́_w*^P^G_")^._ˁˁ _*^_e_x4G_/G_*G_^re_R00Ǘ0 ^0   W\0 _G0$ 0 00/S^+00S0 00 .R  .R0/S 0 00_+$0 0 /RS 0PL0>+0P00 00SL L0P 0 090P0S}  SLP K0SG +0K00L0P+ P1+0L0S> P P  Q7   T3P K0S* *KP0L0P*000P000000Sj 0CSP$ 0 00 00C0>PPP*=*U**L R 0CSP K0S *0K00L0P*0000P00~*00 RP R=0K000@LP *L@PL00P000S  0Ѝ P R /PI00SC /U X X 0S (PA@0X$(00S /U X P@?0$ \J 0 S */U(0\0X X 0S /U0X P@?~@-(0M00 0   00   @ Ѝ0@-0M(0000 000000000  y@ Ѝp@-0@P0MP?Pu/PPPo`(00,0P0,004P P$P(P@ 0,0P:48 $0F9PPN804 Q0C00 0,0(Pɀ,.Q .R: :9,0`)0` 0PS <00U0S R 0S ,0 0 jPP )U00P ,0 .00,0ЍpA- 00S : yK0pP`800@  0S P ])@ WP@^.@P O)00EG_YG_A-P@M`b@P P p,pp0@?U4PPP007@Ѝ0 @-DMP p`M@P,@0@00?U4P@P00DЍ0 G-P`ሀ#p@0T00/ 0P0T4i(P *@ n,PV  6/P 00S0P00P0)P07@- 0PF @P  VH Ѝ0uG_p@-P```@ P@姎 @⣎N  ❎ ♎ 0!pŀm @-@r P<0,SN4pnlP @P"p@-Pl" @@ p"@pF p@-Pa"P@ @@ _"@p5 @-@V"@A-P`P 00O묀p@T刎00 0S0PPP@ 0S@ sV P@$ŀp@-PQ` T00S Pp U @ P Tpppp4p@-P`K'@0 R000@00P01@pp@-@%P 0P 0R 00/ 0P0p@B'0A-`@VP p̍ 0R 00/ UP pἍ0000@@@VA0O-pPM0@$'`бБ@Pڈ@0OBAd@5 0P - 0 S  0 w'6 X y,P3 {8P3 " _7 9X U'X) i/oV" R# 00S0ЍX0S(0S 'P %P ڔ00CS^*')'`XVgfff@-@IG0 !!|0x0t0l000, !  ! 40 @P GG_@`d߁^J_ 0 aL0L0,Lp@-P`6 .0P0P0P@0㍍㉍ㅍPP4`s 0 0H0LpŀA-Ppᫌ0`V@  @P h`00 N/ V?U 0WI=.ePd0$0d0ŒPP @@ŀ0,;L 0 ,YL0 ,mL0@-0MS@@VPP@ 0  ^V@P@ VP @C&Ѝ00@-@P0UP !0S S0`@P qp  0uP 8`&VUP Ѝ0uP (`@0@ R/"A-P` 1@S0101p F@ 01$@ 1R xQ1(AqA`A" \ ^ \08 @#8 ŀp@-P-000@ 00律,0$ R @@0@@pŀ@-@P I4娋 0$R 0 ߋ@p-ŀ<7@-P@P !0R!0R Ѝ0@-`p@PP ЍT$ P*R0*T 7@C-sMP sP P9 P0d3qpTNGH3 sr+ <" $$";GS MP3* 4@7T KEЍDCE@@2Po `P PP` D0SO@ 3/@d00Cd0Tq P,R0) 4W7$ PU D0S< d0 0d0$D03/@ ߊd0T0Cd0-HUъ0S# V |DhŊpQ@TP\DLDP04 D DO@hPh0`Dh@0P  $ 00$0$0$0@lP0 `90d00d0 p@P h|F,ҁG_H.H_G_^@ŀH_H_I_1^+^I_2I_@I_p@-P,,`@P,P `Q 0`  @@p@舊ŀO-dM0P匰00 0P`0 {<P dЍ0S 0  9@P 9 3 00 00PM80 ipP` 4 PT0P00L$(0:T$X8P #P E0S # 0"P 8#0  00 0^0A8@#!PM  P쁟ᦉ10S[ L R$pW UNk@ԉ U # 00 U # 00 Z q#Y m#sᰉY0U`# v# 00 E#4堉V.N?P H#0 0U0 tP0404xV*sI_OaI_Op@-P`&\0@T Q   4 Zp@* R R @ŀG-@o`P4 P40 0p@00  80'00' PP) 00 00A0@p4ppV  0P440PP "PP 4 0p0W 0PVx`V <n4D W "I_I_7@-d0P@P  P N?U.00,V? D Ѝ0I_I_O-pQ`0$MP!ࠟ ܰ@P $   [ P N?U.0  V? Dp U lVxBU TrBX HnB{P$Ѝ7^I_I_J_J_@-@WB @EJ_@-$0C00S@߁d0P0S R 0 R 0S 0S/00@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝp@-@H0  9PH0 0S010H00A PA00Q00@@@p"0O-DM 00(00!1@p`0< 0800p,`$@ @@ @ 0'Q!18 P0<0,p(`$@@ @j0 00!018 0<0,p(`$@@ @W0 00!08 0<0,p(`$@@ @D 0!0P8 0<0,p(`$@ P@ @2 (0 T @/DЍO0@01^^K_K_K_O-ptQ`PM@@P 03PP'W $ d@T`@T# 1P P0 D tm0P s 0ކ0PЍ @0 D tV0P03 0 300Æ/ ~ @ @À O-`P0HAM$ @ B2 b0" 61pN㐮 0 00@ 0 O3pPRؠd@T`@T剆)R0t0 D 0P s t0w0pЍ  @)R0t 0 D 0P  @@À A-`00V@YP> 0 P3p@dPU?V 0t  A300, 0&R0S 1P ЍPڅT0SdPU;@ÀK_p@-P@P00CS 00 Ñ"`0St t0x 0`@x000p7@-@000 0Oo Ѝ0O-P`㸀M v 0UЍ':@:@V@ V dA  0OP Pz `0kK_p@-@P`jp@褅H0 /p@-@DP[H0 49H00S0 1 . p@苅p@-l t0@SP Sxxtx0t H0; Sd0S0000p@Y!CeĀA- t0@SP Sxxtx0t H0; S``d0S0St t0x @x` d`0TpS S yOP  0S 0@|!Ce@-0@  R  R / R     + < R Qg 0; 0/O-,MP0S`0Q@`,` p姄0PU W@@hP 'V   0'0` V`pÄ@,Ѝd d帄 >` qd V Bd 0p@I@ŀG-Q-@BMp(1S@ R`  @810z>00BߍP |O?@PPEP 3 ]P ?Ġ Z " 8PEt @yP  f>@P `>@P  [a Pƀ@- @000 0000p0`0P0@0x0|0p@-M`P@0(@0 0`P Ѝp4p@-M`P@0(@0 0`PЍp4P0/]L_@-@aM |q0U d40 H0`0L 0/0 4 $=0$S-! !Q p =L\0 0X0=T00" "== =0 0h0t=`P`0FSX}= 4Ly=aߍt=$]]ʧ^L_L_b^1^0L__L_L_L_L_+^L_@-@P (_=0SX=@/^1^p@-PH)D0@T0cpxPh@d00d0@ŀ0P/p@-P@ p1Fx01000.%/&.%/&  N+VU +# + 1|0pO-p,MT@P`P NX0WV 41U!$1 0 Sc 8?@0P $0<t00$  2[ 8 ,Ѝ$$吰 P1 ! V 8 0S  0 I@P0 Ѝ0 du@ i>dps@-P` >@P 000du@ U>ЍpA-pMpP`@PE?`00\@4@80^04d@P pЍHP0S@00000 00!0$04100" `(0 `+@P {"x)@P 0`F0`@-M4q` P@P 0,00000@004@P r0S ,w+0P][b@Ѝ?@S0@0$0, 00:#:D0@0(@P@)@-P !M`#4q t@P 0,00@0000/4>@P )@T ,.+T @Ѝ@ 0@0$0 00 +8+D 00, @0*@P G-M⨀`P p'@P !@P0@0w/@@P($pY 0+H0SD00 SD0 .R0.S 0t00S`280x00L0 0P0N/L|@P}0d``PSx08x0V +0tS00.S @_S0 .R0.Si 0W@R0T03/@PL0 `@P<U q`PU 0R'S)XD X 0S#YH 0RD@P 0 8 )0@X03/J PNЍS@@UV **0X03/ D*-U )8 ;* $"@@@8 @-DMp` S@P`PP @DЍ0,00000@0.4@Pp0!0S RW# S+R@ , )@@R@, )@,)W@G-1a@3 M4q}3ZP:+ 0<@P, @P'T10S @ B≸0<00@000004.D@P (0S# ,<),(0P(@ q3Ѝt  Z P @RPf0P0$0,( @0P0T0< P0:)@P(S,<xXˁ{M_@-@S@ B}O-5LM@` $ pPt,P p `$p$P *Y LЍA8* $0000x0pYpSpWO |0S00oS  %(p0|0|p0G S*| ` 86P7 0S tV 0 (];P T `p (D4Q (,(9Pf0((00P0(mz(0P0 00 `F |0S 5$P @ 00P00/P 3P4|0 M85 0|004M80|=Xx0S | 60|XB|0S R|~ $0  @002 0 0   0S 0p0 0.P^+PY4[| M8M( 0% 000 01 0! 0 000 |0%PV  p [+ 0 0M80 0A ;%S84a|X0T0U 0 P  V16040w  00S ?|00 0` $P` `p-UV0 cPN  4V600]L])^w]M_M_@- 0 0 0000 wЍA-pPM@P 0@00<@@0H,Do@P PЍ(`P'0 @@0 0P-@P 0 0|@w n@T(Ps{0S Q{s@-P@PЍp4Z{` @00"K@0@004{G-@ĀĐ`0 0u PP Q Z pp X5|0| /!bR 0᝻Z@TЍ ?%ꤜW^QM_@-A-3XMP @P 0p0 S긶WW 4a$$7@P 0 00000 0P  000 0@P $ `7,Ѝ $0R  U7$0  ]9@P$00P@P#$  *7@ C-p0MR`P0'uP 0 3/@uNT T+ du40000 000@S 5@ U@P0/S 5@P0 | Ѝ>@-p0@ @`'PP @ (0 S@ Ѝ@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR00 0BS` d!0 !  F00S03P R30ЍpC- pሐ2P@``V`31P01 0@PP r Ѝ]0p@-0P@0P 000S 0 p@Fp-p0ASG-Pp@L `/PP00S!3 T` TS6 @P00p@-`M 0000 0P(@Po@P T0P00L@$@(0&T$@P 9`Ѝp8`3p@T  Y/@P0 00S030f0@P 0S@3:\0@O-P0!M0#r`4 0000 0?(@PbUPc  a5@PW  a@PG@T0SG  @P  z@P  5P 0S-@+" 0$  @P  0u0X  X u 0 P@P! 0  W5Ѝ-@@@- y Ѝ@-M pP 0`'@P @P @,T @CЍ@-M@ 0P /ЍA-M P` 0p'@P @P@T 00 00@Ѝs@-P@P 0`00@P [/@ Ѝp C-P0M4 0000p0 `?'@P  ,@P9pP @Ѝ0@00@<0w%D@PE(`V@&P$0 00:#:T0> -: S'  S"  S0 0@ S+0  S0P00TS-sr-@,< ,P6V  00 P-0T+S S  ,<]!@P ,< ,d,P0< (@P(o,P0< (R@-@# Ѝ@@XЍ@- c Ѝ@-!  Ѝ0 cC cp@-HMP\0  1 1 01@P+X\@P$0`800 @4`0$ <9@P 0$S@0S 0R@4 ~@$s $HЍp@4 $ 0P P ]]@-; 000c0 Ѝ@- 0;0 00Ѝ0 c 0c 0 00@-DM @P$P0@,P0000^$4@P 0S00,0P  P @DЍ0  ,u @P ,| 0c p0m0 ch@-0S@`@P!20P @ 0,Q@ 0P000 1/@1ЍpC-pM`2PP 01 @ 0,Q !!1/@P  bQ@Ѝ@100@-MA0 0@QЍ0C-pM`1PP 01 @ 0,Q !!1/@P  )R@Ѝ@100@-MA0 0@}RЍ0C-`DM0@`) P UE@P00p,@0@}#4% p a"l"b"m"4p@P $DЍV@ P\P@P @P @0@-0 c Ѝ@- 00 Ѝp@-@M` P@P0P,@@00P&#4@P @ЍpP&@_ @-0 c Ѝ0@-MPP @@0cP ,Ѝ00@-MPP @0cP ,Ѝ00@- 0MP P@00@P ,Ѝ0@00@- 00 cV Ѝ@- 00N Ѝs@-P@0` @P @ Ѝp]@-P`0@P 0 pj@_w0 Ѝs@-P@0` @P T@ Ѝp]s@-P0` D0D0 0@P L@ Ѝp]]0@-0 c Ѝs@-P`0@P0 /@-0Ѝp@- 00 Ѝs@-P@0` @P @ Ѝp]@-P$0` L0L0 0~@P@0 3@ t Ѝp]]0@-000 c Ѝ@-PH0` U@P0 00@ R Ѝp]@-P` 0@P @0@/Ѝp@-00 00 Ѝ@-P` /@P 0 00@/Ѝp@-PD0` @P@0 @ Ѝp]@-PH0` @P0 00@ Ѝp]G-M0`@S11\p @ 0s) 0s0Sp" 0PPp Ѝ0S  )PP 0s"(PP  0RP% P0UPP(0 s` 0 s pUZ0"(00PW q P0PP]]p@-PM`./@P 0 @0@0c e@.Ѝp@- 0  0@0 TЍ@-0 cIЍC-LM@hPP l0S (c)P(0 !R0 1S 0  0D S:LЍ/``0Q*!!?@B@- 00 @0 Ѝ@-P` .@P 0 @0 0@b.Ѝp0@-0  Ѝp@- 0MS@$P0` @Px0S@ @P"@P #"@ Ѝp]p@- 0MS@$Pe.@P0 @ `h0S@  @P  #0 @-Ѝpp@-PM:.@P0L`q 0 0 u@-ЍpG-PM.@P2 0 @+ 000  0- @`@0! 0 J R! B @`pX1P0  6@-Ѝ@p@-PM-@P0L` 0 0 @`x-Ѝp0@-c 000 Ѝ0@-00 Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp~-@P 0 @ 0 @@00PE@0@0S 0 僩00-ЍXˁ@-,0@341!$ p@-P`Mt  x@T0@&0S00P0=!@PRЍp07@-<P K@P@K Ѝ0]G- P  0@J 0S10C 000Ѝp ,P 0  P `D0 0SP 0 P,PG- `p0&J 0 S10C0 ,@P 0  @ PT 0S@ 0p@Tl,Ѝ@@-@(m$0S( ( (0$ @nŀ@-@, g0m,0$ @R$$ ((0 nŀ0S ( #P QS//A-@mxPx` 0S0hP 0Xp +`0S Q R$0""ŀ0@-@ 0 v+#@mŀ00CS0/@-@P $ 600C0E@ A0M0 0Cs00Ѝ/p@-Pp0 0AT 0S P 0SP@p0S000 @A-p䀟3 BT -m`Pgm0S @000[mPU PPhmX0 $"3`U3@ 203  P000 @ŀL03 2S  R R0SQ 0/A-`@P 0S00 p*PP 00 **V LlDPD`P 0$0 l!ŀ@-@M @l@ l!|!*0l 0 ` `0 X 00  ,  $0 $ ЍŀM_M_WWN_ 2S/p@-P`tml BT`l\@ Q  p0S `` ```@` $B"ŀA-p` P0@p@pPP0PPP:l 0 0! Aslŀp@-P@`)l0P 0 1S 01  0S 0 0000p@Qlŀ + ( %G- PP0S0C040S *0SB $*k00"G(l`p젟k3?@T lV @ $!` R   R  R R R < 0S  B p ppp3``?00G)ŀ@-P0S00Հ3@oѠ@-P003@oO-`P@7 PpW@2 ̀zk `d)뼠崐@TW030V@@0U 0S  3R  P $@ @ @P W 00 w! kŀ@-I0@-C@tkƀp@-00S-@ `P2@P V\ kP#@k@P (Wkp @@ @4ƀA-@t`pk0@00L>k Pp `?0S0P0P0]ŀA-@`pjP|k&@TUFT0S0 R @S    ŀG-0 `P;0@0S-5P ,10S00PS00( 0S) (j@p 0S00jpW@0;00S0C0ʌ( 0S (pxj0l0 Xj00( 0 3/@Pp0(4ŀp@-@@P0SSp7@-@P00P1S  E+U Ѝ0P-@- %RA-P`@PpV@(M TT@AG 0P R04/p@-0@S`& j0SP P Q  - `T0SPE 00@0@@Uh0V` p@L!j<0@D00Pp$ U000 S@ƀƀ@-@j00CS4j >@@0@ p@-0 a@-- ƑSj0p P{@T@P0P00 00""00lp]I_ƀp@-PX0 0ATp 0R 0RP @G- P@ᄹ U `D`00@0$V0:Pp hC`P00p!WUP " )W X0S0S'U _V h6g`pP00P1S  Eo)UQU#0\ SRЍ 22L Q003V1P ggVP`P0 0 0oH0 0# UGP g宏|gPYV H0   . b?-H00 0 0 ? @ 00800S@@at Of@zfzfG-P,0`0Q @0@L0S% 0" MKJ   pP  0 = 0p  Y  C L0 I0 0 0 O-,@ 0!@L ( MKJP`Pp Y0FoSVY^ 0S [ Y^ 0`Y@ 0 F00 0  O-@2M0 2Pc0,000 00UP48<40F  L0 000 00, 4@ pP  P$RP[P; P` UQ@F0@01[D00, 00@0P ydyeZ-b 1y 000$20V ,0D000PTK0S? 00S=  "  ) P  ^X00X0>^ , 0P0[P0L (P @ 0&@ P -OY 1P $" Ѝ p@-PP@` ]X00CX0] qPp O-,M\`ကP@`dpP0 0%!X0ЍS@@  @PY 0 0W@0/oS" R@X ,Ѝh04100 0SO-P@1H#DM  l嬑嬡 00S`0@00 00$0040 0S410080 v p0@?:] "v]t0  0p000 `*]" f] V00S 00S @Dh0@DЍ0S  3/P0 S     \0 00 4] ``0C-4MT P    ` Pp0 0$ 0 PX000 00$ U@" T0 0C04Ѝ@-4M`L @  P  pH0 0 $ 0@<00 05 T`4ЍA-`Pp\0  -P@0 00 @VЍ0 001/<p@-@`zPP `a"PP 9p0Q\ X00X00\A-@ M0 P0  P唀X0`"fX0 Ѝp@-@`P\ 00@T p@S\ @ A-P`@\ R   0 RA5\ P   0 R Up G-P8M`@\`pU+ 000 00@T"P04!(@,00 0 " X  / Y 00 ( 0 D, 咖8Ѝ@ 0N_@- @`P DP 0P  P N_N_N_N_(00S/@-@v@ ^XˁN_O-4Md`pXP\o[ 2 00000YS@) P)@&0 00U@! P41$ P00(00 T 2 00 `0@ E  4ЍN_A-`PpX& 2-P2 00@qЍO-P7@-@00PQ000U  Ѝ0@A Ѝ0Qp@-0@ R R p PX `H 0PP CX0^0PSP $0PU40%V Z1 Sl0<T0P0 !0000S#000^lLL[ 80  000*80<03/P  0Rn l$j(0S80S  st" R 0(0S  0R l @0?o2X0$0 V40"&0:D0D 01L0X0 000L00000,0P (0S ,Lt<L x0& (0S PL` 0P0 00SD 00H0D P`S,0`p @8\  0P(0SU 0$04 PXV``,0U`V Ll M00X0$ 0000000400P (0S* %t0`T00TPS 00 0$ (0 \07320@0S  Y0P`0 T06P0$0P `V40P0U`PR0`ӟP0 0`0$``00000@0S606 00P0P0娆0C00S|d0<0 0$P4 0ct0V $0U40+00 1 0@{ 05rt 0SrZsQ 0 Z3p0000000p0Pv 000 岠@0Sf <0S ዞT`Sd0X00S 80S8 0 P0  P /$ 401/P.sPT0S|s ᡢ(0Su @0 sX hs600 00y %6p1g 0@ `0 `0zG P00ld00 Vd001:# P `V op 0 0/  A!t3!00S V 0# . R  T P! @;*"*X S 0|000*sr1`0$ C 00080S|0"^P0 >0 0S#6  r0 80Z r0d0|P倠`F0 $04 RS00V00S< ᚞$ <0  E௝ 0<\) 0  Cp012t 72\ q\PU0p b5PᬠR Q\ SQQPS2< 8P<00P 00 05P(0 0X x0 ?o2"@  D UXWY% 0@ f 0  P0Sdr0P ,0L!~cVm 0D0 0 P (0S@(0S0h0k lVQ_8OO-CMD001@ @ 041$0810009309L0081 0H000L00p,0M0`S L000 IH0  d0SIW ,0S 80< 03/iqPCߍW5812 0 SpQPP) qq`D눐Y `G,00yq0p,0<P 81 80'03/PP /00 0$ 08 81 0SH7 $01 V$00 81 000S 00 <00@`D80 0PP9 " R$ 0 P$ (`,}q#qt6 010 S0 0<0H0S81 000S  P0jT0 0b 0H 0E <1SP PH0S H0  0S0000 0S 3/H0  lP d0SC)q00+S [7H`Hi`V`069W% ,0S 80< 03/R0 0S 00(`,S Zj Sh$夾y(0P0,0T0G0`040 (V `V 80` 0S4`080'8`0P(0 @ p 0(`,0 00h 0 `  01/9v0 )V. `0dS00V#6:X0\030*V 0p\000\ R X A!n\X00CP1   Б\B?1Pa&X  R 0 R"6:PNƠ/ 0X00 000B?*AX000\0 X00X0`0X0S%( R \(` 0C,6`ßIp0X p0P05/Po(0U0 0pPX0\(p0(0S ᜹ 0P$00 @0PD00 R Z  R  *`40S  "'  <0 0 S  0 Sh 101PT0S @`T0SoQ_ R_H@-0 000! Ѝ 0  /A-@0MPb ,0F00 00ZЍ8OA-@0MPb ,0F00 00AЍ8OO-$0p@P`LM 0  00 000B 0 01S LЍ $&/ ^ fo`ox1 32p00 PP000` 0Mo 0S nQ([ ݾ1 0@ & (  6,  ?(#$<8 0(P8 R  !p[q @  ᰿߼PG-@0(MP3 0b=Fa @ 0ZFT0 0T0F ᱚ0000$ 0$@ b62< RW1Q00Wrp @0o(ЍO-0TMPS@$0 <Q$    $  # Q $ R0,00S$0S 08 < TЍO/8 <`#6/P TЍ0S0000C0D#D SX 0 0 00 00000" R0 0 0;;020S#`(030 $` a 0Q2! QP#Q0a po0pW` a7qp QV|QS1VaDH8 40$Pqp D8 40 ?R+`m10000 0`. 0Pu(0 S00 ,40%pPjx!0 00>0`00`0`F,00<0H1080<1 81!&W2:8#1 0(0 000 :#: 000p  8"0 志 ,W-00000C00 000 0C000H <} 04 HZz[Q_@8HfXp@-@PE0 Yp@QEG-P`$0@p3/@PZ@00@800 4/@P 40T00SOj0Vw Sw P$03/@P P 0S9P 0S00S@0SP 00L0D 8/PP H0U00S @@ 0W1 V5 P 0S  P 0P  0S 0S PP 0S P<0 P0 Ѝ0P P P mP@ @SSA-`Pp@ T UW OAO-P @`TU  ;T 70 0 06/@,* ЍG-销@0H?oP20p`PS V TXTYGO-DM,0000l0Ph0t( PZ@ Q`ሠ$0 3/@P0S@800@ ,0( 4/@P80V <00P p0l 5/PP<@ Pt<0Vy l880 R R<PS 4<0S 0S PR8<P PP8p:5tPtp%0S`0 2?0!10S 0 0 Af5r 00ҁ@p@-0@HP50`0@,0D0O5T(p@0ҁ@ PXXXXXXXXXXXX////p@-d 0@P0 .00p/pO-P2MS0*`0@P0 S@@}>u0W*} .0ص d 0ѵ  0.0ʵ1d 㐃+1  0⿵!刑刡ƒ1!0| #! 0 /#1ᐳ+0 @UX0*P 0 0@P 0 0@QX0 㸀娐娠Z@0 S: 0 0C@ÿ2<0+#! ! 0QЍ:;,nmO-Q`0"V0p@P "N 0Gp2 S0^%> X@P9<2#!@TP0 "-p"1!@TP0!!!dƒ @TΠ1#P<++! 0΂p'' ᨁ p 0p !P00Tp0&@TPp@TPpP 00 Tpq@TP0G000P0p?T @.0 @ pô. 0 ὴP@< 0ᶴ< 0ᰴ Ѝ:QO::mnP/G-(p$`P@FQ<0S00$00V (`吀?`aV $'0#$+4P W8P< * 㭽%!  ($0 ^ V (00100 @ D@-0@00$00ቈPp@-@P`-㛵PP`) 1Pp@-@ 20!( :@ @-0@M0!80@2A-P@?| !l`Rp2 WT  T   WP  P %0SX00S 3/0502A-@`PP p2,2p@-0@pP2#@2Tp@-0PS@p 孹0x 0000\`20 $A&20@  Ѝ@߇M^+^0/G-P`l@b2U 1P0ٱ0SG20S0p 0SڤP夐UƱPP }203/62 Z#Z P &00C0Z $00`22p@-@PPpp@p@-@P 200P 00$00q刱p@;2O-M00pQ  (@`TB  0 0: 0 03El 0U0Ѝ0 @00D0 0( 0S<0# Hzi? $0 * *HpptF p2`Px먐嬀Y0:@)RḐ开yRea R0 0000嬐 SPR  \ \0  P0 \耘Xp00p0t00St0  0t@0, Pp 3 0 000Q| 0  SR* @LRWS )p0 0Cp00S  . ) PR)(  ἐ,4 00ΪP004 p4 00QU|Q004 S  P P ! 6  Q R SY OpQ╟P% $2bQ 0 4qQ *)p0 0Cp00S  . _)$)x屨(HQ# 00J7  ) G)0p0#@Pq* \ 05 y00 ^RTpPWY! p )W# $(xd(PpDЍ_XLLcT_*^T_A-0MP00p 004!l0  00 (t@T`p00(Ѝ0S0S#`䲯 (x 8i000 x*, x (>`P 00 0@G-@`PP||0ShP0qW ⮩P UP qn 0 k@LT_G-p@`PjP@T:HPqW 0兩PP@@Lp@-HMP@ P R kPU 03/P   P ,nPLLsU_U_U_XU_ V_O-M00P+`pX'd`V5 `d`@`h0 0'T( {60008000<0@@$0 00(,<08 z@ ~-'Vd00Cd0  ]b'Ѝ  0@O-@M` 8<P=OĀİ0SOЍ0qW"   PP 0RQa Q P T@    PLHV_p@-@LPc`@z<0$4SS p$P 0p]0] 0`( "4`#/O-M :~90000 0 BPP}00 $"44 8##<00$"448#x#<00p48 40 80 < 00`$ "440#4 0 0$"44 0#4 0 048 4 0 8 00 $"448S#(=0#<0P 00 P$0 R(3[ W0G"35(0* 0!0CR 0C3 S 0 V p-l0P0@00S, G{ЍA 0 P  W Ġ Ƞ UU0 Ā0,   Ā,   0 0000$0PP0 #"44!0%"  PPTTXX\\``d dh hllppt1tQ0 tP tPIPx1 QP匨!"44!1"44!1"441 $1$Q 0RP (0 u u  8  u(PP0 l8 d000 0p5P 0 04VP-REwV_MPV_V_t][ _V_ W_O-PpPwuM| P0p`#00 0?@P\0 LcP R R @vX8&  ⶍ,T Q  @3PX0 X0  4,L H@|. zG]v|`P p A10 a<40 ! y@P∣  yuߍ 0v0P 0p☲sᢍ P X ┍& 0K& XG  80 0ԭP060㓺*, t t(0, 0 0S 1!3S$ 8‰?p.0S 7 Q #?0000.[ A00 Z04 Xt P &X⯥P0 t X{t P"X0 ?  Q#?0000Q 00Ps 000X00 0T$j@KR8.a]EW_WW_uW_W_W_ X_]7^+X_]X_V_Tp@- D@^@PP `$PUPT;$p+A-@Pf/p<(00$ R< =: , @ #:0 40, 00`800 s00 s0 H0<0 00080X``00``m0 K(0 0<0`0,0$0@000(040,0A04 ,000+)S_WEVG-1(@!60PP 0S00Gx꜀#00CS$00 08`p$VvW00`FV`!PDZ0W  I W ά00C0#+A-` P &0)`堚@P@ tpC# ULL  UHH$0SP0 s#@o#D-#GP@P`#+tG-@Q@q@ V@YQq$` # a@PU B# 0p000 00 0L?@P/# U PٺU0S 0S tP" VL00L0  VH00H0$0P0 # #+tA-p` @t"P0SPU PP"U `(<"p@-P`@ `P" |⭡᭩_᫩`T ᘰ0S 0 'Ppp@ xX__]=.^@-@hP$X`P巙P 0S 40 0,0`#Ѝp+(QY@-@lP$\`T唙P 0S <0 060(0`#Ѝp+(QYG-a fp0`@|oPP@ 0S9`aV@ "81Y 1Y @40 000p00pp@ Ѝ0@    '"0SY` V:KKT|" 0[tp!W @ @T 0 5tp`嘐+r @8@-0@ (!$P@+tX_lR `0R XT0RP/R-/40R0/P-/}ft,@|f{f@wt@~fvtp@-@L P & 0 pCP$F p,0 6P04!L0\0,0S S 00 008@Tp`0 6/@p@-@P` ᙡ宨 0P6 #::0t $00000@0`0or: 0 p]A-Pp@3A`41d00 0S60S50S 0S E`LP2 Q 50S0 xƁ050(Y@-@BD0S !YP$@2@-@50S0500S @A- pxPPFN9@0(0@P<41`d00pxmP WPPPPPPPP lPlBH 00 0`S 0 , `| 0@PЍ3YX_P]@-(@,000S S 0 BP 0S Ѝ@XЍ-\M0000Q 0S 3/\Ѝ G-`1@p341d006p 0RPZ50Sx%0550B R  00 0S#P> 0 0 0  口P0 0000( H/o6"Q R  R   0 0 $pPP #P 0SPU  P P O-1DM00P`p0 <0 a0,(P$  @(P0$ 0 i<0400 ,00 0000a0(P 0$ zi<0400 ,0X0 0P000a0(P 0$ diDЍX_0YX_/YrE_-YX_O-QdM@0 | `dЍdЍOhQ0 00000p0 `P`W0_YPU@A @TP HY 01H0#0@DT#0P Z 3 #X R+   6 4 8 < $ ( ( <0 , 8 0 D@  RH  H l X  P  p J@ HrT P @D`O-造Mx@P`p %0` s S0l ,1 0(10$10 1H@00Xd 1?o2P0SЍ4YC-M 0P`` @C0xp 00P 00 0 0@d?o2P0S  BP Ѝp@-@P8@T $@DT\pTpPP ,0S(@0 ,0 0TUP]Y_D4YX_A-0pP@TU, `T`1 @DP04Y_A-@dp`P0S$0C(@@ R (0S $0CS `PA=Y_D0S/0@-0 HR Ѝp@-@P T-p\P @y<0@ @I$Q p pX_Lǀ@-<0CT 0 !0  !0@- ! 0 !A-@`XpPU 00`0S 0U0  03/=p@-@P0 0 0 0 00 0 00  p@O-\$,M341d00# 21 2@PU { 40 "0#! ",Ѝ00030 glm`8P[ @D Y Y t7Y7YT6YT6YT6YT6YT6Y07Y\6Y7YH7YsYB  83 @p0K\ 00 :9 0P(00S 8T 0@008 3SH L0SP0\0/000"0 |2@p d2@p  L2@p 82@p 2 @ 4 R pp9 71=n<0C S0! 0nP 00 R Z9  9 @ yP! W Y40S d,1  0000pCp(0/P0 *<(/ N80S 40S 0 @pW 0 0?pP220:00l@h 4/W P@p 2/  3Lǀ" G-P4-,a @T@T $@DTG^\@@DT 0S 0SK0S$$008P0(S KpP XhS<080弻00f<(@LǀO-@$M,00@T $Ѝ`(@DT L <0RUSL (┖o0 0 0 z H0PP9 Vk000pppGxS0 0 Y ``0 [0V` F/ 0 PPP# 0S,T/0 0 0 :`0 0 @T @DSP0P P060S500C?o20T0 qLa0 3/0PPS MbA-@p `PBM 2SJ@ @(@0 0@S  ⳛ02 100 0 0P`5Bߍ 2Y@-0  Q:0 0(0 0QS Q   Ѝ[ 2Y00@-AM@0 0 0 0P00! ! 0@弛 V;Aߍ0A-P`0@ #R-H L R)QH0 P0H0 00BS B 0000S  (  ( 0Sp p䃛 A7 ;-CM       pCߍG-P<pK@|`t PPl00P(P$P,PG0$008P$S( (0 } 0 pGLǀp@-@,00,0PS0}0,P@8PUp`0 6/Ps@-D0@40P0`}0S  Ѝp@/Ѝp080/@-@P P @ A-Pl@`qTHH1x`341d0050S;{05040S +%00000P 尹P 嫹 P 妹P 00P 0000zP> 6QBቹO-@4M3p41`d0050Sxz050PU :W 52CW >0W >C 0CW H4ЍOpt80 S񟗂MYDYDYDYDYNYKYDYDY,NYDYDYDY@NY,80 SoMYDYDYNYDYDYDY$NYDYDYDYLNY7W 0W]0S 00P7W:>p WM0S  ▙Pl7W  ;CW0CW5C 7C0C87W0 H4ЍO,6WE 87W >C0CWP覟 W 6WXoY Q0 W0`0dvt&0䀔Wpp{`0fSX <06W+ #17W 6WP000 RU 0 F0 0A0CS…Q|5pW $pGWP5W 00,*0S0ST%0 R01 5:S 000WxP YY  ޷ 9P ַ  P x u002.0S&u4 R.PP0400 R0S 0 S P00  0  P 0 (00pW $pGP8s0S R0` S R (`V $`FVP 0 B RP9X0 ۖPP+0(S'0SIP CPPP <7Pc0W S %000(pY1X*1P~@?P 01 x1~ P 0S 0 0(00,0 0000(00,000600008000S080<00S<00@0@00D04p0009WU  P0P40M |Hwt@HpB@~B f@pBzBLǀoB@|B@oB@fB@{B@}f|fvtgBBfBwB@BMY_/P/@- ࣗ0`( "4`# Ѝ0M0000# Ѝ/}|/Q02 //000SCQ00A\$ 0\ -^0Q  Q0 8<00 00  /0\ LQ @-0 AS/0S 0 /000S000/AP/C-QP P`@A0pSS񟗗UYUYVYVY WY(VYTYTYPTYPTYPTYPTYVYPTYPTYPTYPTYPTYPTYPTY,WYdVY$TYPTYPTYPTYPTYPTYVYVYPTYPTYTYPTYPTYPTY8WY4VYPTYWYTYPTYPTYPTYVYVYPTYPTYUYPTYPTYPTYDWYPVYPTYPTYPTYPTYPTYPTYVYVYPTYPTY@UYPTYPTYPTY`WYtVYPTYWYUYPTYPTYPTYWYVYPTYPTYUYPTYPTYPTYTWYPTYPTYPTYPTYPTYPTYPTYVYPTYPTYPTYUYUYPTYPTYxWYPTYPTYPTYPTYPTYPTYPTYWYPTYPTYPTYPTYPTYPTYPTYWYPTYPTYPTYPTYPTYPTYPTYWYPTYPTYPTY0UY8UYPTYPTYWYPTYPTYTYPm@P ЍS S S PS S 0STS 80SQ4E< 0@9 0@D6 03   0@, 0@) 0@$& 0C# 04C @d 0 S)* 1 3/y0S01-\M000 0h\ЍG-PP`p@ @Tpp @0F S*10S0ST  10@@DTYYYY,YYYYYYHZY@`T @T  @.0S0S*30S* V@@PT 0T  T @TT T 0`ST@T@T T0 0#3S#YA @T 0 S0 0S*@ @T*A @A0 0P@0 C @TU Y S0Y: @ V/@-@P ` pW T0 003/%@ R Q    0P  Ѓ0S@P Ѝ 0R00 0 傳,G-`pPt P@ ㈐ 0SRpe0 0G/ 8 00$0  @@@G,/@-$@ e 00Y_4A-xP`_0hp 0@TAL 0R00 0 8/D,@- @=0 0d@vp@-:`p@PQR*Q.\  LS0CpQ A`L)]@-@A-000pP `PdpЍ@ T#E00 p Y_A-0pS@` 0S0SA0d @T[0@D0 pPU#A00 +p Y_Q^$0 0!0 00 /@`d03 ! "/03 "  /0M0P@Ѝ/0M0P@Ѝ///////0 00  / /H@o/@- @< 0O-`MpH~ @0DSVS00PЍ\ DQ 0A Q@Q ĠĐ0PU0S  <[P发P `0DSWP0S P  00C ^ R0 Y_d p@-@3X02@b?$0PUp(0S 3/XP@-2p@-@PPp0S00P00C0q2@-@(㼱p@-Ph@Ꮈ1 01  hp@藸C-M 0`p` @媒P 0Q 00  00P 0@ 0 OoWBP@T P 060rЍG-p 0P`M !` @sP0 X妸0 000000@PW?o2P0SЍ@`Y@-@0(A@N@-@e0@t0/ B0QQ//0(P/0S -  0/@-<0CT 0 !s0  !//0@- !b 0 !p@-P@p@p@-A`50S 6PU 4 R040`0,p@?2S 0C8C8_o2RU0rǀA-P `Gr<0@TA00S p3/qX@p@-@P`03/,`D 0S 08 000 0S0(Dqp@Y_G-@d@ <1@P"10U T`@1U@_@00S00 000 w@GISUpp@QWtD =$pW 80S  3/XppW 80S  3/XpǀA-@P(p`E*R'7P00 0 0 wUh004 0  004  @0D 0 @0D h3 000SP0PP0P0A-P`p嶶@T  R    B 弶Tp03/@-%L $0 dY_D0YA-`  @0 @0  P}0p0pg 0t 0pp}0T T@u D0 ЍAǀY_ǀY_]gYY_4gYY_d0-DM000,00(0P0 0H0000<0$ <0< YDЍ䜏YY_IH@-0   Ѝ^O-|0 S4|00^@S4p0`|4DM00p,`($  <0~YP` 0e,40S N=0S/ 8` p# 0p p0@a 0(03 0p0`00p,`$  <0BYP L)x0D#DDcSS<3x0 0000@000S ~_S#S1!~_O@HrPDЍO! 0!<0$   ,p(` YP 0!2$ 0<0  ,p(`XP{0 00!42< $ 0,p(`80XPf0 00!1< 0'>$ 0,p(`80XPP0 00!10 ,p(`$ 80< XP@ <0< $  00,p(`XPg1000<0 ,p(`$  X0PU     '. ,p(`$0 @ 0< XPD @P1S ~?S?11~oS1O@qaPdY<`YZ_Y_fYZ_hbYǀ4iYY_%^Y_Z_4Z_$cY=Z_O-3DM@ l` P@HE 㠵 l( |D1n00,($  p<0-XP@ DЍ 0!<0$   ,(@XP 0!0$ 0<0  ,(XP 0!P00H00,($ P 80< WP 8jY`YZ_Y_EZ_cYZ_@-@P E 忴 l@ q|bYp@-P@S`D Q    K.p@T   R@ @@  :E0 <0x 8RR00R0S 0S/ 2E4iYhbYA-3P` |p',@ `D0UPP Bd`YeYp@-@P\p0p@/A-M~`@~Px@ppT[ЍAv P0(P ~t@ǀ@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@`Y$`Y(`YhbY,`Y4`Y<`YeYeYl 0@o/`YA-P`pD@3PUAD200S7/@P@-@4 00( R @@0000@ d@-@0 0$S   00C0@ @-`pP@M PVP@ ЍT@UP\0pWU  Y0S   @PpPE`?@d0L IǀO-0M0Y5p  0PP,D 0X`@"040 000  0 ό$0(0`0`Ѝ(Y0@-@o0 Po@1,/0A- 0 `   H0D0R@UDp DPU ?D02SH H0 hor0AֆPH0S D0SH0D0H0SH H0 VoHp0 Q  ! H0SD  D0H 0D00H0Qp@-@ P 00`VpP000p@7@-0@S NPP0ⅆ00 Ѝ0p@-@`P5 0 50O1Up0p@n0 L wǀ0S/ L ǀA-M@`P?p0RP00HDPP@?ЍA D.mPD@-3M@03XF[pZD`PPv? P$ 0S00P00C0+`%7`D,0S 3/XPUЍU 80PG-VM@V/ ᙋpW  }? 0@c17 0  3"0 2Q  ! R! 0S Q050  l,Q k8ᑪ䁄刀 2S .B  凪0 2VgRU DPEU RU& DU# 0ZHP E#0 RS  R H0 3/0,PH0 PK.&U$1PU"  P[81P Q8 014  Vߍ40S 01Q 403/0SXP0S    H03/,ǀǀdJZ_l`Y0L uǀA-~`rPpU@' l0S~oPDbP@ 0 R D_T#P 3 P 0S G#P`Yp@-@`P@P A pA-~`-PpU@ l0S~*P3 DP@ 0 0R DQ  #P`Yp@-@`P@P pG-pW0S !S* 1S l Q`~`PȐUl0 S DP@~P 0SP 0 S:V` .P` ,  Dd`Yp@-@`TP@P pp@-@P[P@p@-@`9P@P Up @-DuP00SDtA-@p`P@P i5A-p ~`XS@PTP l0S~P@PP `YA-P`$V  l0Q R@D*P@@ 0S0S "P Q "P  0S*p0   D`YA-@p`P@P P/@-(0pMPL0`  @P  %(0, SS  3/Ѝ(YQ/p@-P@h0}/ P P* 0SC\T) S*G!A0HS$HA@0@S@  S| xd!R01`00S8P P p@i030pZ_b^sZ_xZ_ǀA-`pP40@TA80S 3/X@A-pP@H W`40 p0H0(0DIP@A@!P DC 0 0R D9PL0S Z$D#n@-@h@@-@@|0/0/0/0S/  ǀ0 R0/d@-Pl 0R`YA-0` `00R@S 0`8`0}? >aMCaa4q ].a abEbX]T! 0$ $18!0 㰿 n 0R200 `p00S0p SV 6`p02P0Q:0"PS p`W ! `"0 AЍAL0dǀǀZ_Z_@-@k@A-0P @ 0B \U R ~`l?@dpT  S0@A9l0S +P ~.@`Yp@-@`P#@P 0 pǀ@-Q@M#`@Pp`P@ Q@ 0T0 R0% 0<I@ЍA-0P` @ 0B \U R ~p@|T l0S ąPT0 F S0@A~@`YǀO-p0M#08PQt 6^0Q@ dhP  03/@NT(hrP   03/@zNTrGbP  03/l0S00  P `00PPxGDP  0# 3/M0DgS<'S7W (]0 00000 0YY@ (&T X `V@` PS ~@pPp X@@0``C`Ѝ(6  < PR_0SCD P `#X` Vڐ Pս@P0`FD@ P h5 @ <n~X` ` LVڐ P⭽@P`Fj@D?@4<  K->@*>@%'>1%>N$SP St$#8q (`PI@P/0S$@P4 <P <q@]H0$3/@@P 0S-@ <PP@ 3|`|0@<N03/@P |`3@ M@=0<#S 80#S %'B BS #S #S#W6 0 0 0` 0H@P* (r"S  S "S "S's |"Sx"p"S l$'a S `M BS[ BS30 P@0S-@ P[ p @0  4/@ NT0 0 (@04/@#00#  'pO7#0T00S @qP/  03/@0S   . *{ S#B%B}e Sb O!"'S s[ SX *.l =@=@&iEDF=zixiǀxi ,`Yiiiii{iFi@ui niiiE=Iii7iiiG-Pp~`X@|T l0 S 50S0 0 P80 ~A@`Yǀ0  ǀ0 &ǀA-p`@%PP 00S0P ⺼ !@P !P  ⨼Z_Z_0 ΪdYbYj 巪dYp@-P@Z40x@XPx0D#0Uw0D"0Uv0D 0t0!E'D!E&D E&Dp@-4@Q`M P@1h0Q o0CQ 0Q 3QO PЍ3Q 3Q31 1}0Q0 0000 0ѳPP0@S?P SRp @? ps`P @P3Q 0CQ 0Q2 0CQ00N2Q 0Q XdSB0!   Q S5  !!@ ! @ ! !1  ! ! ! ! ! ! ! ! ! ! !! !! !!,!1<13GPk3 1 Pt1 3 1#>0880R 3.0pPH0@0~< !N D!0/H0L 0/QP@0D  4P#P @_qP 0?S@ Ѝ@ɺSPP iui vi iiiG-| Q`PpM `1Q-@WUHHb0 00 0`0pԲ@P ލ@>4T @eP  0R JDPp1@ e 0Q Dl|@P V14 (0V-@ N41i i][_C-qM@`IP1  03/PRNU+ 0S(  Ԃ ЂPp@0S  r  0S  Ṃ ൂЍ:PpPFx0/p@-`Q@P R 0 0 0 8"7P 000SPPPP000p*R 7P"0 0 0 U `0SP0PP0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RAA@o//1S /p@-3tP@ !P0#3 R`M3  ځR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP$Ppp@-@PPVp0@-@0M0S0@P  NЍ0ϖo1[_p@-Ph@ᪧ1 01  hp@賧@-p0$M03PA0AS ` R R Rd /@ PR R ⫁@ ⦁000 S""4400 #RH L RQH0 P0H0 00B S0 B 00 0S  (  ( 0   rT  00g0 @P. Q* @'0,001   00^000 000000 0 00000 00$6@P #T@$Ѝ3  $0P0H@~`L001 "448#8S 0  < 0"448#80CS=0 0 001   300000000000t0000 00@P @10 ;  { N2@7@X[_@-3A0@S AS S *<2@S 3/4P@O-Q,M0 `# 21  2@P0 40S 00 " ! ",Ѝ0S2200 rpH2X H hX0RUH0X 0 0O 00  R NP000 P0\hB0PPp@-P`@Tp P yP @A-0PXMP- 00 0XЍA/`@p 1#`101"4410 0CH00UL 800(080@`, 0 0 0 03/XЍ\00@-:PL@0 R 00 C0.APAAꫪ)] 00@-40060000 @$0Ml00p0 200%00 %Q 0 00#00PR,R02{l0HLR0`00 P(05/D 0  DЍ0耖YYhY]o[_p@-@0|0DDx0003/HRUHHnHRQp0S  0 Q20C2RDQ/D%00S/ """ " ]00@-8PS0/@R  "\Q0S7/.S,S :S 0S7/@-0C ^ AAQ9S0aCQ 0C70C000@A T AN^ >9QC<aA^ A7AA00 \0S?p@-@0TP T% T/@ ~ ~p@T ~  @ ^ @          R R  R @T \~ P3     @      ~]"](][_@-`Pw@H  `P%0, 0) " 8P 00 0 k~ g~0 024`S 0 0B0@202HT CЍp`@-@HPd  _`P "@P 00CS 004`S  0 2H0C2Ѝp`H}</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Sp4Pp3" p@R1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00S603!P pLPpp@FPpL2!4<01p0 " $"S $2p@ p@F8"Rp0S 0 0 8҃Pvpi1iii2i(#iX8i(i.] 2 @-$2@0$20 #P$20$2/(2S /@-$2@ 0$2 P$20$2G-@.p`(ᰀHU(20(2p02`0H02(Z p@2S,PYp=PxU u H2(20C(2,2S0S,2?02HeW !] p 3/PP  0S0S0 0"p@-@Hj,2&jPU R,U 0S,2?02(20C(2H-U @2S 3/(2Sa㭛p 0S0S0 0"PpA-@p0P` #RH L RQH0 P0H0 00BS 0 B 00T 7@@ )@0(00(00S  z0'  $ ! "$& $ "$ (?Q00@ a060@P4]@-0S 0 P P Ѝ0 $"$# &  $ "$  $"$# & z0C-M 03P 0 SP0\t`0#DD0HcS$H0 0004T 0@D C5 0 T 0ß ( T0 0 S0:0 3  00P  h0P<<00   0:00h(x(0, ɏ 0(0,h傡0#:0# T00S FP `0#DDH$H#  3  0 0ЁP0 0 / P~0S{ `0#DDH$H  3:#:S@1T Tj & 1T (0Sh0 |00C S`0 V   0:0p1T?T  BP  1{H1T1  T 1T1@  ,괿p(0T00S 0@0000@000 0 R  |  Pk4Ѝ  Gd] 5Ȁ݆@D211O-0Q@00`pDM(00 0<0a0,$@ @@ @<@D000< 0a0 ,($@ @ @D 0$0\00T0000'>a0,0( P @< CDЍ][_0Y\^Y[_A-@`pP0S 0Q  6/P Pp@-@P0S| |0 @Pp@-@ @6@/p@-@P,03/ 0&@P@ D&!R @A000p6@/0S   6@ H0600C0/p@-@00`P 6/P u0S| |0 P@pC-@4 PlM`py540"  8pPG 0<S6 0000 04'P60S3 0S0 R-ʼ"p`c &   XЀ \`\  l l h Š   & 4   )P00 00lЍut$p@-@PT0SPPp`HT0P`P0CT0@-F@P Gyp@-6@ @& @0@03/P!ZP YPx00Cx0x0PS L0S 3/H03/p0Cx0 A-`pP 03/@T30 8/`V @x00x0A-@p@TAl0S @ 0QU`0S꬀mhP`G-\@P`pZ@TG00S0 $9/@p@-PL@P0  R 80<000@0,0$0(080$0H0p 0xYYpYY\Yp@-@$P`00@p@i80/A-@`p @TP 0S @ 3 (P0HU D07@-@00T P |P@03/0)P |@ Ѝ0 Yp@-@TP0T00  0T00 H0p@/0@-@M 00 XP |P@03/0Q |P403/Ѝ0(Y<0/@0/40/@0D0///O-餳DM0#h0P 2l`1 2VnP@#V 2!1 2`(#(0%PDЍcO`VU" UP B 0 3/`V V# 2!1 20 R0S ` 03/ P VPX\00 b`X P%0 S020 P5/0PHX  PP5  0w0 0& &&Q9 Q7  X\  &fX   0S圲ph0010`V `FV`ᰲV   +*,Ph0S 0T 00`,][_0@-@@PM@~0 0(0 00@@YЍ0[_Q/ 00$&/@-@0Q   R@  Q#S #h ( X0\ 4PS 0S S//iϖoiXdYL00S @-@3@03,0003/~/p@-P`p @q0 $030|0|0l0030U600`0@>080 H0 0P(05/3@03Wp蘁YYO-p0崯3P@` (P 2 008/2W2 40" 40 A3h(p?0 0 000 4 000 4 hD R Ra ,圭/, R  20S  10S@ 10S 0,01弑帱ԃa崡Xʀ 0! # 0   , !  P: h0 0 0(0 , 0(0 , h 0!!ԃ0   , !, R  00S 00S 0,00@00p0h嫛0 0 0 h嶛7[_X[_l1@`dD2x00S/x@-@P T0 S/,P/0p@-PCP@` 3 @0S@@X5@ @pT5@ 00S 0 0C0 0/@-@ \ 0 C0 0@- Ѝp@- 0@SP 0SP 3/P 0S pA-P`p3@\0 p`000@@AA-pP`@V@D`A-@`=P lpPP+` `V `PPpfP  PP` 00PPP ApP( pFUAՓ[_\_RPG-@  Q R|"pS`G #B'BS 0PS ' 0P  0S 4P+  R!  R ` 0PE 0PP `S    US PU P 0S 0S=  0S000000000S 3/p0S* 0S*  PU UP Qy0S $ Ἣ?oW20SP  Pp: pa0pYU !08i(p@-@P`K {Pps@-`@P@ ;0S u  "U R `Q  `  000^P @0T00  Ѝp@-@ 0S 0 00h0 S@- P 2S@#@ T 00^"]G-HbHHBSDrUʀ 0 ! # 0  .!0Sa $ $  (0,0 (0, 0040 004 80<0 80< $@0D0 @0D (,H0L0 H0L 04P0T0 P0T 8S࠳ࠣ_\p^ 0$0X \0@T0@ RC!PX@_<0@(00@((唫@PyuTYMbQ]"\_O-4SM⬠ &@ pt Q0 I[ @Px RL R 2/ H 2/@  4~ 8rV RRY|YTYYdYYYYYx  Bx 8 2/P2{u 0 4@4/Y 4Sߍ&R [ ` @P&_ `Pp@OP@T`  && &[`pAop`PPTX\ 0  &[`PprX\ 0@@U@Tk x  Bx 8 2/P  & &`P & R & &`[ @ p@&r R WS &Rpڰvp 5 HqHp, $2/x RL R 2/ H 2/ 00 00 :/\&R && & B x  B x  PCPm`O-@0pP 1DM@3`h 6S06=6S060636ᬀS 5  R !5q`DЍ08#8S06đ6đP0SPp  0Sp0 S4T00T06#` V@` 40@`A`%06S)ʲvW&06  p,03/@,4@00@ 4/,TPJ0P0T00CT0{@-@P6S@0 H0!608#86 S06%0 @] 0/03 "  /0S S/S /Su//N/0H00咬ȀG-`p @0SRP@ @P UL yp0Dq!P Pn@00@0pR<@PPPȀȀO-0p#MP 2`1 2s@0t0P D >ጫ@@0S  JzЍ1 3/@ȀA-P@`p  0 400 ,p$@ ` @ 5T00L00 ,p($@ ` @400 4<ЍQ\_Y%^YY_YZ_0 @R/p@-P!A` ! 0RpC-aMPpk@AZ0p " 0` lk0 0000P@``000*0PKЍY- 0S0!Q\ ^010 BS   " 0 S 0 / \P:/p@-|0P@`T   "@PH,p j00 000P`0@x\_0 0R  0S/0 R/  0Q/-   QO-` @ 0 QP0N \ : 0P PUP @@0S 0#0JPPPU @X0 0 0 S(PA 0 0 SP )P  pW 0R  Z 1P PpYp@- 0 BRPNP0@ ` T0Q@:T:@ #pQ p R\:p0-S>"0000( $ #0 0A-@P`p- 00  Q:00 ^ Q0SA P L `0S: 0  000 @ ``A@G-r@`0T@PRz T @(@ЍU EHh DCh0Y`* sR `FV T`T B]i` 0 ` @  oP@0P @  0 0Bi h  0 e@Q`P 坡 U0* PR l  R`FCo0CP 00 0 TPÐʂ\_]p@-@Q`P 0 h0P @puPTp0SpPO-P0M`Q@0  IpP ` @Ѝp0 0@S 0/ Q V Q P  P PXX7@   P QPP0 0000@ 0V `0 0 000 00pS/PUP0S$0S# RP0S000  P0SP0S 0SQPPUV~ 0 S{ p0 S00R0SpPUmf0S0 0 P嚠V V 00 0PO P ;Pp\_A-P@s`P p @  BnPTN  lP@ 0  R?Q 0S  ? T9 R6 R@ 00PSh T0\`P R00#0 P0 QPP(0P,0P 00 0#00#0@T@Q   BR  \R\Q 0 ~Sd!0 S< 0S0S0 0 S0Q00 R Q࠳ RSR ş0Q `U P0P0 RPPQ AQ   0\_P]_3]_]_0A-`pP0S s@PT 0 P 0 @6/P A-`p@0S SP@U 0 @ 0 P6/P <00S/p@-P@ !0P@  pA-@`pp f( `0PX 0 0`0d0(0 0 0P0000 0 ZZZZ0S p@-@Pp0P 0p@/pp@-Q0S   Q S PpP@$XP0   rf 000P:hP`P` @TpP@ 0 00喅y]_]_]_]_A-Pp`@!)M PP000q10S0@@`p@-P@0`S   00F(Pc0S kp@1/1M/ G-`P 0@T UF 0 P<G,!0R"1S RP  lP P  |lP 0SU P 3/P @pP 0 P GG/0 e0  eA-PS`p 0S @1W0 S00 0 3/@P 03/W@ e8@iS9@0S @-ݞ/]_ B000S//p@-@P0@UPP :^N3A"Pp( Ep@De@`@@40 0 P/@-@M \ \S R   koЍ@-@P !0P P 00000 o00SA-p@W 0S `tP0P 00፠0/A-`䀟P`U- p0S   0R0 0 8_03/j0S0C0U@T 0$0/S0P 0A 7Eu]_Z@-@(G-`P @T@GA0 0=8xG뼀80S`p1% (1LL0C(1H4X,@ȀHȀ 0!< 04 0 (   !/@`d\ P/0 !8 0 0 (  , !/@`d@- 0S 324 (`0V0R0S (0yS. x0x$Px 0B~S$(x00Q:xx0xp`V Ѝ@T x_P T@@D@@P*/-/-/ 0!< 04 0 (   !/@`d0" O-H_M1 0$0(0!# 21 2P7@r_ߍ0`S`P 0<<%(PwUp@PPpPXP !$P W 0@700SU x 0 xWPPp7@PP0 0Sp+@Pp34 41d0L0mX x0 L@LQppRpWT0 @|P 0\L 0PR AoXQ Qa0R0t0P0S 0$ST0S 0$S0 ( 00P0 PkX0S P0X@P ^X KXX00CSLZMZNZNZ QZ QZ QZNZT0S  L@R$ R $ 0S,0,,P,0@0&@T @)P0 R0 ( @P ( (<1T0LS  R   00&0@00( @P(0$P000T00X0 p$ 0@P pP0P0@@000$ L$0@P0S P$@ ^PX0S0S;@0SX Sr Sj 0?0::S $0P%P $0PH R R |!$! ;/5 Hr450", 00 ;X F $ 0LTPw EKP0P0<@K@$0P000T00X05 p 0$L@P* P0Po $LV@P $0\ XX\ (, /  X\ {-@ \@UpW01X V 000 W"010 (0S`8AwUpXp p @p@@H]2^C-0@SPDM4 0DЍ4  V0000000H00S 00 00$0H030,000 0 P0S P 0S400@00'$'$(%(%)&&#&#%"0  lЀh0S `0 l h0H0@2@@0 0@ 0P0 @00ut\ P/0 !8 0 0 (  , !/@`dO-QM` 0@tЍO,\P^Mp00P 3u00000l00p0 00t00cx00|0lPUUU*p0S  % 0S lW ER07[@P@0St x00 R: |  BR 3  ЍDP0S U l EP l'P&Y4004 0Up4# 21 2T40,0,@T <00~ODT !p0S "Sn20000Si DSg D 0 0 0(00l0P'|0堰S= [: x0S7U U UMXPV D (0 l;/ [ N[0SD_2 030(0 0 |ҌP|0 |厐0"4 4Z DJZ"ᨐ0000~D1@0@@T ~OD{  P  (0 l:/6  R  QX X$0$0x0U000008800 l0LP$|0S! 0S x R " ,  4   R㸰 R԰8 |aP|08 0|0X$ v[$0 8hGP  0 l3/O H < 000E(P00  U  ESp帰1GS  0! R``B``0Q  F 0Pp W(0S0P0 Ѝ@Y](__a]A-P@`pM4 S  S2 0 !0 qЍA-@PP`@pD0W H0L P0 H0L AS0 `0<0SP@0P8P0R`03` ,41d0p02640h00x0x0PLA@w]^__0@- 0B Ѝ@-< Ѝ0@-  5 Ѝ8000S/-00000 0/p@-@0@P6M00 600P i`$1"Ѝp@p@-x P 0MS`  0S0 0 0 @T  @  0P90Ѝp$-l 0/O-M`p8PPM 405S0(@ M40 S;000050< 0NZ0<0 v  M M M000\@0s0 0 00  00  s 0 Ѝ7@-P`@UX0010P Ѝ0@P 0S 0S 00A-@p`ֈP@P %@-`0@PG0Hl0 0 0 m0S@P< @ᑾPA ^lX0\ 0 X0\ lꐐY MY l80< 0 80< 00S@P  "44 ;C RHl@0D @0 @0D l 4"448#8S IoᩒȀb_-/0@-(0,0@<,00S 0S 3/0000008004000 $ X R0@~ZyZxZP/@-0 H`@G-0S@K@P !448#8S 00S7@P` "44D!;C R዁pܽPP3ᩁGS\0S `0Sd0SP Z0 X0 LP 2F l,F0d0\340S (448C8SSgG0O-xaPd00dM `\0Y/ @P! 051(p E  5   E\P #0? 0#P @d0\@S300E0 00 <00 0E EЍb_A-8pP`@pk!0@@Aykp@-\0 |p^0 RP0 Ƞ@,Ƞ0 00100 p@4< 0 04]b_c_0 "p@-@`P< E  p@O-<`Px2M@0 0 0АDL2U5P0``3XU`@P 4l`< lPP(q00PUi 0S 0 S S Rh  U @$04/)Z@>  00P 0 S S R 000h  0S4pPp + @$04/p@W  0W V hۀ`  p 0ZV  hʀ  `Ѝɀp@-P`PUp@@8p @ Dv0LP0p ɀ>c_Hc_p@-@0@TpP P` p O-$P2M@0p@ 0D!>540@P圲H0 0X0T @Dd0P0< d`P)P00`Vk 0S 0 X/ Rh  ,9 @$04/ZZ@?  ,?00` 0 X S R 000h,  0SDT \ @$04//@Y  ,0Y U h P ,$ 0ZU  h ,P*U 0t`h@S Y  $09/ Ѝ _ ɀO-$M pp@P0 ``P 0倐hS [  $0;/@ $Ѝ  .@ @ɀO- qcVQʀ !  , !p0Tb@p C00  0唀0 0$ hP R %@ !1c000  ! Ѝ@`dɀG-P`ppU U7 $1pb@ b0UP d0' U+  C  C$0h(P 0(0$0 000~ 0< T`00`040<0  000  0ɀ0SlO-0pS4McPP`P@" P |10SW T 0 0S0U0S `` 0 oP $1h ~R}000`V* 0S# 0 S S R0h  ~ 0S  0R } 0 $0;/}L0  ~00` } ᧪4Ѝ/^j]ɀA-d0Pq@M0H 0S S6d1pX1p(@< 1U`J< A00< <0@PᘄPĀ>}ᔄh{~apa@Ѝ`0< 0C`00( <0S `U0P@S  0 h@}T~ɀp@-HDP@`L@T403L0$nt@P Lp@ɀɀDɀp@-$@@P0DL0(up@:ɀ0L03@o/ɀ0 0 0 /@-@ `O-p 0M !P``  @AP0和 0\ Yh0 000000@P?o2P0SЍ账ZO-,`sWʀ 0! #!0     !CgPȐ@T 00C0 00 0S003/庾 n8g 0!< s00 (   !@`dO-dM0!P`@ x "`p1!p0p@0c00@ P ?z 0  p Gk 0 x\g 0`pl!H1 0 0,p($  `<0P P 0  ydЍ 0!<0$   @,(pP8 P 0!0$ 0<0  @,(p' P 0!`0@0X0,(p0$ @ 80<  P Tc_]Z]u^ܦZWc_]_c_c_ZZ_A-Pp`vf@0S 0 0 0 <Azf>lP 0@p 00S 0 0R000☊@-!mop@-`$P @P@pc_p@-@P@D0Ppp@-P`@PU`U00*U-,Z,Z,Z ZhZ,Z,ZXZZ,Z,Z,ZZZ,Z,Z0 P 00 0 0 p@?o2P0S 0 S$ 4 Q0Ѝ 0O-DM(0 0P`! 2 ,`0800P$  @g80 <00!1 0<0 (`,P$  S 0'!0tqt< (`0 0 ,P$  p= 0!80 (`,P$  p,0 00!08 00 (`0 0,P$ '(` `08! 0 ,P $  p` 0 ,00 ! 0 0P($ DЍc_6f_d_ZUd_TG_@- R0R0 <*R9갸ZZZZZ`ZZZZZZ,ZZZZZZZZZZ\ \ 00SچP \ \P00S0 80Q,00S L\00S R0 Rp@-0@P&* R# ZZZZZZZZZP& Z8Z ZYZ ZSZ Z >P  Z7Z ZlP@ߍ0& ZbP  Z.Zz Zz\ {>P Z7Zk ZGP & ZAP Z] Z ZW ZW X>P Z7ZH Z$P Z@ Z@ xA>P Z7Z0 ZZ* ZPZ" Z" #>P Z|7Z ZP & ZP|  ZPvZ Z >Pj ZY7Z ZP_ & ZPY Z ZPQ Z Z =PE Z37Z Z =P5 Z$7Z ZiZ Zd =P  Z7Z ZP & Z|P  Z =P Z6Z ZZ Z =P Z6Zv ZvZp ZZj Zj @k=@P@],]<]L]\]l]|]]]]]]] P0C /-P, 0C C-Q`@PLM 0 6/|0 p10 0耟萟2pC0DPUQ 0#LЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@  6/  00\H0 00A00A 6/i_)]2^P/Q //  00 0  0 00 0  $0 (00, 00  40 80<0/@ @-)6 0 iPɀG-@`T@M PpU:0 =iPp 0PES @Ѝp@P @PɀO-0P`@ 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@2 P//8@-@P0/F/8R0* \ A/Q :@/Q* @-000 0@0  2 /UUUU3333 @-./ 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00. B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S @-a0o @-@oQPO-(p@@@, P`T @-`VPW:/@P WRQp@-@@P@T@ P`Q@-PPPpQPp@-``` P@-@T`PpQPA-`` p@P-W PU`@@@-(0000 0P 0@ЍLZ@-(0000 0P 0@Ѝ`Z@-$0000 0zP ЍLZO-`pPb-  9P@P W  A1 =1W *P@Q/R H /0 BR 0#01,# P`3V P0!"BP"aPU0&"R  0 0#01R,#  `F,,A ,|,Ġ .̌. !!!Ƞ ̌ A!|̌ ! . .,,,A ,|,Ġ .̌. !!!Ƞ ̌ A!|̌ ! . .,,,A ,|,Ġ . ̌. !!!|A!Ƞ!@$ ̌ @$@$ @$$$|̌ $D@ .L . ...@.|.LA!!,Q0 0####40<1.0#,I@-7 ]0A-@R@P `?Rp. R% *R/ P) O[R ^RP`` P\6 ]\F R -\> Q[R: ]^8 R  ^ 3PP0ЍP 00 Rp 0Q  P P P p`0SWp @/o"R0p@- "!A0 @P#.. "P!Q! Q Q "&" p`04`@D8<#<# "TE!1!1("$"[@-@8  /Ѝ@-@P $/@ (G/ 0"^O-@p0$M(`00 00P0$00P2 0@00 y/00pc(#"$c$"0 0 0 05e3#<# 0 00# 0 *   "6f1#f;#0W 0Upi.ɠ,  .@P (, Šb,,. p  &  p'c!c!"000` 0` 0 00 0 0 P0P00$ЍPP`tP`P0 0^A-pP@, $`Qn ?PU(7  08R(#)8 b~. `.`4`0pPDa(!"$a$"  .0Vh b.Ѝ@R )@ bX.8 8 M.0(0G-PR: p@q?p` @g(U': . 0$ 0 @PE 0$ (P`p(4?XG?0%#?R%U  (Qk."P0 P$0d. 0$ Q0 0$  0$ @H< 0$ @ N.  0$ @H< 0$ ?XG T@-@P $8.@ (- 0"0 ^ @@-@P @ ($. P- 0$$P ^0O-P dM@0000tv$0 08<00 $00(00800<0 00(00,0 000004040H0,00@0 X-y ,0,Ǡ Ɍ +W i+Y P,ɠ,0 nj0 ,P&`00 kd,40. 0p0 0#0  "#.0 "#000#?,1 "0 <3 " 0$#0(#00$(P 000#08 , < .!4 ğ ",pğn  # " Tğ$ 0!0# 08ğc> .!  ğ0 ",lȁ # "< $ 0!0#0c>,. ", lȁ # .,x# 0 ! " `3b.00,!D30 0.0# ,3lȁ00" 0#04  " b- *a) ȁ0 00#05 ( |b- (0\a(  <ȁ (0(5 ( b- ppp' pappp' 0 : #R?0V FA#E@P7@-@P * !? 7R8 bx b8   X  Ѝ0@ #R#^0`( a!"$,a c"/G-P`8 p#T0.@``T%0  S+ Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T$-M Ѝp@-@ P` !LN.+ !@ApA-PP@#*`&pP @  cY@P 80@L0X D0XV@P%UPT@yaratcidA-0p34@0P 0PV@PP @ 0*.` 0@P` 4Z@P0HЍyaratcid@-MP@@@`@pT:Ѝ Pp0P00 Ll_l_0 ~yara0 .0 utcid0 .Ql/yara00.Qa/tcid00. / /p@-@|P0PPptcidp@-@pP 0Ppploob@-@`@1@-@Z@E@-@T@Y@-@N@p@-@H@@-@B@@-@<@@-@6@@-@0@@-@*@@-@$@z@-@@@-@@@-@@@-@ @@-@@@-@@@-@@@-@@@-@@p@-@P(0P p P pgntsp@-@`P <0P p_P T OpatadA-pP X0P PM `ᯔ@P  ^ PP@gntsp@-@RP P- pp@-@P+ p@p@-@P p@???p@-@P p@000p@-@P p@p@-@P p@p@-@P p@p@-@P p@"P0/#^7^@-``@@P^DࠓࠃTPP= P P; P^P2 P P ^*:'P0P0 P0P0P@^00P@ :^0:dd0SP O-4MX0`0\0 0@m PU000000 S SE S< P<0`0S0H00 0XP0 [H" @0@ 0pUpSpWU0 `(0<0 P, 0$p p00Sc  FS    :SK =SI *S  0S  ;0C`30 `0`0S0R3"P# Q @ `p BPE0S>03P04U *00000 H0WPPU<03 @04W   P<P00S0U01 040 S,0p 0`00S 0<S PU>03040` 0RP04Ѝ`P' P$Q BPE @ `ppR> 3P 4U * 000000 H0lW 0WP @PU 04`PU 04`0 P<0 0<0 0`0 0C P0bSH fSP L l: b0 B> >" , `  (RV 3 "R Y @p$ `F PE  R> 3P 4U *000000 H0W0PPU< 3 @ 4W` b 0B0"!0# `0` 0S0V 3 "R$ Y @p$0`F 0PE00S>03P04U *00000 H0VPPU<03 @04W` P<R00S$00 $0 00U 0 05`04`0 0C 00000Sp,0 0` R) R&Y$  @`F PEp  pR> 3P 4U *000000 H0V0WP @cPU`04 PU`04 P<R  R$  $  U 5` 4FS,0`0p0C 0 0E 0 0S `0S6PU=03`04X` R( R%Y$  @`F PEp  pR> 3P 4U *000000 H0(V0WP @PU`04PU`04`00CSY$0 @`F 0PEp00 pS>03P04U *00000 H0UWP @PU=03`04(00,0 H0UP`0PU`@0V Z0 0CV':Y$0 @`F 0PEp00 pS>03P04U *00000 H0UWP @PU#0304,0` 0PU#03`04 p(R=S3`0S* 0CS'Y @p$0`F 0PE00S>03P04U *00000 H0UW<0 `P @ 0PU=03`04PU=03p`04`0 0CZX ` R) S'Y @p$ `F PE  R> 3P 4U *000000 H0FU0WP @%PU`4p PU`40Z00=(00,0 H0'UPPU`@0- `<0f ` PFS_0Z000Hj_?j_Cj_00@-MB0@Ѝ0/p@-@P` <\Pp-@-@`P 0\P@ Ѝ/p@-@P E#\Pp-@-@`P \P@ Ѝ/A-@`Pp \P-@-@`P [P@ Ѝ/00/.0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-0KM0 00000 00$00(0 0,0$000(040,08000<040@080D0<0H0@0L0D0P0H0T0L0X0P0\0T0`0X0d0\0h0`0l0d0p0h0t0l0x0p0|0t00x00|00000000000000000000000000000000000000;08 <T`* X40" @0)p" DP" H@"$ L"( P",  "0` `&\ 0#` .d (h p'l P%p @$t ,x !| " `& 0# . ( p' P% @$ ,࠰ !र "ਰ `&ର 0#ర0 .ര (ะ p'༰ P% @$İ ,Ȱ !̰ "а `&ᨿ 0ሰ᧿+0#0 0+ 10儐ᥟ 0#$10兠᤯0* 00)ᬟ p'0墟0 /P% /0?ጠᡯ,! 0 @$ (# 00#`/ቐ?0\0  +0`0#!>\0D0` (H00'c"##=0d 0h #00#"%#;00 (00''800 %00$*5D0$0H8%(00$.)" #2d040h  +00#"#>20 0  #00#960L0 %P00$4;1 00#  "#1,"? 10,0`!0,'#)!7&9mbቝ刐``+40 .ছ᎔̐`%&$.Đ`,`!.&t刐P%x@$\ClP`(pP妚P'ZUQP `( P&P'%Q_QP`+P%|` Y+W,` *`!੬ᆣlca`<(`p'anqሎTp,Xp!z,v ʠ! ,@ ,*ʠ ƌ) D H1 00)0 0,04D0H0 10)010, 04 1 $1D00)$0H00,(0 0 $140 0#,00,00\0d "`04 h 00#80\ 00 `0#<0 0)@00\ "0D ` 00#H0d0 "h0L 00#P0d0h0p0!T00'X00  "0\ 00#`00  "0d 00#h00`0 &l 0 0#p00@ 00#t00 0$x0 0` 0)|00& 00`0 0 0&000.00 00 " 0#00  00 " 0#0 0 00 " 0#0 00 `0 0)000&000!!0#010+00 0  0#010"0 1 1p0!0(010'01`1!0!0&000.00!`!0#010&000$ ! 0# "  ) *1Ss000 000 00$00(00,0 000$040(080,0<000@040D080H0<0L0@0P0D0T0H0X0L0\0P0`0T0d0X0h0\0l0`0p0d0t0h0x0l0|0p00t00x00|0000000000000000000000000000000000000Kߍ $^$^-@-(00S@R ЍЍ/߁@-@ / ?!BC! @p@-P(,E@P 0P0 0p8$^007@-@0Ph冖000S@H<廖T 0P ~F Ѝ0(,8A-P`0pS <@P ` ptUlT` P化T<yF@ 倖G .I[(,8@- @ ' 8%^P 0R @-,0QPso//7^ 0SH^p@-P8@ P {P p@2pMj_PA-pL@P `ڋPPj@P `-@- p$0 0#P@P Ѝ@Ѝ/`ẋPP  $00P V2^@-@@ Ip@-@P@p X0R0% ⎋PP  0Q p@)$^7^p@-@P L0R uPP (0Q p@p$^7^P/ 0R /$^P/ ,0R0/0P//$^7^\ ?o@-L2^0S0  Q 0QU0 /$^7^P/ 0R/$^p@-@PPp 40R PP 0Q.$^7^P/ 0R0P//$^7^A-@PЍPo0 RQ R0 ` 0`ߊpP  D0R S0 ( DO `pP $^7^1^A-@PЍ |0R0 p 0P᱊`P 08 S0p( O P`P $^7^1^0P -?o42 ^0S0 S/$^P/ 00R@- 0Po/$^7^P ?oH 2\0S 0S0QP/$^7^fP 0R0P/$^7^f@-$0pSM Y`PV `0P 0@P 00 0P S =Ѝ  `P  Mj_ 0P/-P-P>P/00//p@-P0@Q Pp0< 0 Ppp@-P@AQpPpp@-@P` 0S <P P p@> P`pp@-P<@P /P P >P p@ pp@-@P` 0S<P P /P >P p@  P`pA-@l`lplPAQ<Q >Q &Q |P]]j_bj_gj_@-8@lP $tP @ J%^mj_@-@P@PEU0S0(0 H P 0B0S>300>R/R )0EV0 S %P0/S0$0(0S0$00>SP0 >R    0P(PR R H L R0->"   0L0S>300=\00SB0"S0S   0"P  C  >R0\}Pz\w<Pu0Sq !Sq0-Sl0E?o 2-R0SdXPT]0@- PP0<P8 &P @aT@mT!@pT2@;T/Q ^**lT'tP";P<tP;P>pToPsP ;P'SU00gT qTuPoPtP;P"Q@- Eo/@-IM@pP`V P0P P Iߍ 0 P  PP 0P5/0 p3/P0 0 p0 |P ` 0 0P0 5/P 00%^G-@,㯇PP8 p䀟䐟@@ 0B0S 23 ẇP&@<R` P   P0>SSS P@@hP @@j_j_j_D@-IM  @00S 3/P0`JP V 6/0  0PIߍ0 03/V@ 6/T $T Tp 00P00S 3/`0@P T 4/003/003/P T 4/ pp@-P^@P PP&@p$0SP 0` P P PP  `P|Pj__P0/A-PJM mU0`0p 0 `` Q-0 @0  4/@P T p0  nP$ 00 0 0DPU00@0@  WPJߍ0 000 003/ 0/0/@-@@螆 RC/A 0\R#R! R/P 0 0#/-0 S RS R RP/$0S @-6@Y.@a[唐@@-@! (M P P  J@]P(ЍHP  mS^j_j_p@- @P}^@p@@- @   @&^ 00 S 0\: P03#/S 0\ P0///p@-P0S 5] @P `b>@P tTΏLF PP I40?@p @.a[@DX$&^@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@$&^ /P/ 0R% 0  0\:R* R0:/-\: P*0  S0 :/@/ //@ $&^P 0R//$&^P 0R//$&^ P P0P 00  S *0/  \ ://$&^ P P0P 00   S *0/ɓ \ ://$&^0P \ P  !R0 * /-!0 ^0# %/$&^0P \ P  !R0 * /-!0 ^0# %/$&^P/ 00R!  S //$&^} P H0P 00   S *0/ S ://$&^ P H0P 00  S *0/S ://$&^0P 4 P  !\0# %//$&^0P 4 P  !\0# %//$&^ P D0P  0 ! /0S/0/$&^0P -?o42 ^0S0 S/$&^P/@\   JQ\//$&^P/D\  Q/S/Q\//$&^0@-@MP 0S"$ R0-S 00 0S0xSU 0000 ,0P Ѝ0 j_Ao/0 P R   //p@-`P ᠃PP@pPH3<@P <ε0 P`000U ᣃHP&^ҍ8$0S @-E3@再.8dl[@- @ u  Hp&^G-`p@PUT` 0` 熁PT`PE¥P@-@ϵ@̵p@-P@@qvPpp@-P8@NP P p@`pMj_0,S<SR=P@0@-@f <0 0C0s@-@P 0U S  .l0=Ѝp1PP`P 0 0uP 0 0C0iPPPHA-p `PȂ@P V  !V @p ׂC-@p M`P Ă 90P0Ѝ0  PP (0Sᰂ0  P (0S$PU00  0P 0 LPYP  SP 0 PP 5^j_y[p@-PP `X0 RV@╴ @P@Vߴp@P&^p@-PP T0R;@P 8000000P00 0p@P&^Pm[Ds[O-`@a0SᰴOhz\>P@ᤴ P pP 00 0EPP p 00C 0 0S.7@Va0 S 00RP zP P ]P P 0  03/P P P5^P&^j_p@-P@P 0 0 0p@@G-@P 0R@ ݳPP`*@ 冡q1  0q 0` 00V:000P&^0P 00R@-0P   0/P&^p@-@P㤳000p@p@-@P ,0R@P㑳@pP&^p@-@P L0R@P`~0S@#*f@ȳpP&^p@-@Pk@ẳpA-@P x0RyPVp0S `ᣳVP 06`P pP&^p@-@P @0R@ P`2 @pP&^ P /o00"\ R00\t/P&^O-@P p2 R0  bPP @MpL`- 0S }0忊7PP :0Q>`P9/ P,U <U U`  Ѝ9P` `~ 8P刊,PP V>P巊U `[P  PZJ! 0P 0p00000000 @! 0 0Q 0 1 p`P&^.dl[8<P@0&^G- `@VP 8V 00p 8P 0 GL0P -?o<2 ^0S00 S/P&^@-@P) 0R%P`0 xP  0   C!: 00C0000TRQ ЍP&^0P/?o( 2\0S/00 S/P&^0P -?o42 ^0S0 S /P&^P/ 0R/&^0P -?o42 ^0S0 S/&^PG-@6 @`TPp P* ᣱ ᠱ0 S @ ᔱ S 000 01 0 01 $0 0P@ @p@-P@P PH @p0 03/P P P@0S /A-pP`_@P $Q@0P@ A?5^p@-P(7@P 0P0 0p &^P 0RR @-o//@-@0P ~9 0SpG-P`@PR  pHWW(G( 0"! 0 Pa#<`P%c?P6  P0 ` P* P P$ pGP匀W%1 ``P R0P&RP xP Wa<``= nP =iP?^&^O-`p P@Q A R;" <Q` =Qb H P Y H[p[[[V U*@V0 W @ " PV0 W @ ! PV U*0@PY+0 <S@D%0@<SS CR=S 1"0S 0CS230Y@ R Y ʈ(0PS@&^A-pPPU@ }`PV@  ` PPQp@-@@ P`}@P`p  `P@ PT}PQPp@-@PP@PP @p@-@P D0R@00S  @P000&^P/ 0R /&^P/ 0R/&^\ ?o@-H 2^0S0 RRQ ? 0 /&^p@-PP @0R  P@ 8}@P ' p@&^0P -?o42 ^0S0 S/&^P/@-@@T ?o 2^0SLo&^@-$PMU3`P@& 00!P( 0S%    00 R|PP  00 0 xP | 0mPЍ 0R XP @T|Pp@PP pU |@i,^?^/P/?o4 2\0S0SP//@'^p@-P00S $W, @U @p$.0[!p@-,@,Pz0 0up!@'^ 0Qj_j_@-@P 0R@@'^P/ 0R/@'^0P -?o42 ^0S0 S/@'^0S$0S @-0@  #/j_00C0/0 P R   //A-`P  |PP@PP4@P Dpp60 P`000U  |(!`'^@-@|@yPG-@" @`TPp P*  0 SS 000 0! 0 0!@$0   @HF@p@-P@@P7ps@-P@ T R {ԭ`5ЍpADAP`@ 0 0P 00C0@@@(!A-p `Pq{@P V  !]V @p {@-@p`P 9P00 Ѝ0H  ?P (0S @0 @P j_T[p@-PP T0R,{@P 8000000P00 0p@`'^t[h[A-P`@R0SᡭAk/PPᕭ P pP 00 0 PP c 00C 0 0SL*P0 03/PPO P Pj_0 /p@-P0@Q S0 Q000p<Ppp@-P@P 0 0 0p@7A-@P x0R@ pԬPP` !@ 0 0`0V:000`'^@-P000p@-@P ,0R@P㨬@p`'^p@-@P ,0R@P㖬@p`'^p@-@P L0R@P`წ0S@#*@ͬp`'^p@-@Pp@Ῥpp@-@Pc000p@谬p@-@PV@@@⥬pp@-@P @0R@ P`B0S 0@Ap`'^A-@P P0 R@p`*0@0S@q 0h 0Q000c@`'^p@-@P <0R@ P`@Np`'^A-P@U `pP<:005 A: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/ R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/A-@pP`P [lPp` P102 P @-@\& P QRS  T00MlLQ R S "  T Ž 00 A-PQ@p`S V @P@V!R)SP V @0C @h@OoV0@d05D?ooL\0ࠑlRV@@@PS=0B V00 W gpo0g0CpG5S?ooL| !0, Sࠑ+@ c0 5̠@  P\O_ 0SPV@ /o?o BR0  c45#̀Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /~-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/@-0k_C-`%4M 22 2`bEz'ay+-ui2 a<묾*a%4> cmrq?ϧO@U~c*3Nˠr떂c8}|嚫QmMal,E^0n P4?< 84Q% (40S#* :4$Q% 53$Q% 5Q0*s&Zt1FSuw gLIf@qP|=0唀% HFs|0@q< N'_TJP_O,ҁ_H.t]^XO_._hW6_sMbO@0A @0H@P`@p @p@@zssp_initzssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846>@>@>@>@>@?@?@4?@ioexp_set_backlight ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_[[ m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    @ ;,d@2h_X_@X`@a@0b@b@Rxc@0Sc@܍Rlsllsrasrror s2^w2^{2^7^2^7^2^7^@2^2^P2^2^`2^7^_M2^2^P 2^2^2^^@ 2^2^P 2^2^2^2^ 2^2^2^2^ 2^2^2^2^2^2^2^2^2^2^2^2^2^2^pP2^3^3^ 3^p3^3^pP3^3^*^T^*^T^p 3^#3^p 0'3^#3^p `,3^#3^p p23^#3^P p_#3^P 83^#3^P @<3^#3^P PA3^#3^- ^2^F3^2^ J3^N3^S3^N3^J3^W3^S3^W3^ ^^ \3^^_3^y2^c3^y2^l3^y2^0 p3^k^00v3^k^00|3^k^003^k^3^k^3^k^3^k^3^k^3^k^3^k^ 3^7^ 3^7^ 3^7^ 3^7^ 3^7^ 3^3^3^2^3^y2^ 3^3^ 3^3^/3^2^o3^T3^0/2^2^p 3^f7^3^3^@3^3^3^3^@3^3^3^4b^4^4b^ 4^4b^4^4b^4^4^"4^4^)4^4^04^4^ '^74^ V5^74^ @5^74^ `3^74^ _74^ <4^74^ @4^74^ D4^74^ 5^H4^ 0L4^H4^ P^H4^ pP4^H4^ L5^74^ T4^X4^ ^74^ \4^X4^Q^`4^ e4^i4^o4^u4^{4^u4^4^u4^4^u4^4^4^4^4^ 4^4^04^4^@4^4^P4^4^`4^4^p4^4^4^4^4^4^4^4^4^4^4^4^4^4^4^4^4^4^ 4^4^04^4^@4^4^P5_4^`4^4^p!^4^4^4^4^4^4^4^4^4^4^4^4^4^5^4^ 5^ 5^ 5^ 5^m^5^5^5^ "5^3^0OR_3^@&5^3^P*5^3^.5^25^^25^75^25^<5^25^A5^p5^F5^p5^ K5^p5^0P5^p5^U5^p5^Z5^p5^ _5^p5^0d5^p5^i5^n5^u5^n5^{5^n5^5^n5^5^o5^5^o5^5^o5^eqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0edeafdfafafdeaeddaiadbibpmzsdep7^7^U2^[2^7^7^_2^e2^7^7^i2^o2^7^7^ŵ^`^m@m@ T_bus_dma_busaddr_to_paddr_bus_dmamap_sync<^<^<^<^<^<^<^<^=^=^"=^1=^<^@=^X=^m=^VA=^[2PVA=^[2VA=^[2AVAt>^[3VA{>^[3 VA>^[3pA>^[3qA>^[3qA>^[3qA>^[3qA>^[3A>^[4D >^<[4D >^[4i >^[4`Rf>^[4 i >^|[4qA>^[4TrA>^[4TtA>^[4TtA?^[4TA?^[4T A?^[4TA'?^[4TPT/?^[4T`A :?^[5TE`A D?^[5TE`A D?^[5TE%V N?^[5TEWV ]?^[5TE io?^<[5TE $iv?^[5TE0$i?^[5TE ,iv?^[5TE0,i?^[5TE .i?^[5TE0.i?^[5TEAi?^[5TE!i?^|[5TE !i?^|[5TE)i?^|[5TE )i?^|[5TE-i?^<[5TE -i?^|[5TEAi?^[5TEAi?^[5TEAi?^[5TEA ?^[5TE A @^[5TE`A @^[5TEJ`A @^|[5TEJ`A&@^|[6J`A4@^|[6J`AB@^|[6ZK AQ@^[6KPA^@^|[7ApAk@^|[7AAx@^|[7A/A@^|[7A?A@^|[7AA@^|[7A/A@^|[7A?A@^|[7AOA@^|[7AA@^|[7A/A@^|[7A?A@^|[7AOAA^|[7AAA^|[7A@AA^|[8A0A,A^|[8ApA:A^|[8ApAHA^|[8AAVA^|[8AXVdA^[`AdA^[XVdA^[?AdA^[@XVtA^[ AtA^[@X/VtA^[G_=^=^=^=^=^=^=^=^=^=^=^=^=^=^=^=^=^=^=^=^=^>^=^ >^>^>^!>^0>^7>^A>^G>^Q>^X>^c>^k>^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^B^B^A^A^A^A^A^A^A^A^A^A^A^B^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^B^B^B^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^B^'B^A^A^A^A^A^A^A^A^A^A^A^0B^AB^A^RB^cB^tB^B^B^A^A^A^A^A^A^A^A^A^A^A^A^A^B^B^B^B^B^A^A^A^A^A^A^B^B^B^A^A^A^A^A^B^B^B^A^A^A^A^B^B^B^B^C^A^A^A^A^A^A^A^A^A^A^A^ C^C^C^C^C^ C^$C^(C^,C^0C^4C^9C^>C^CC^HC^MC^B^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^@;F^@LF^@^F^@qF^x@F^F^x@F^F^x@F^ G^x@G^a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~dB(B BBBBxB$B4B BBdBBBBDB BBBBBRhhU0SlPDB@ ;hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6 -]0] P.]0]  /]1]  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN   !"#$%&'()*+,-./1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }  !"#$%&'()*+,-./@ ;Dy^expand 32-byte k(^DhDlDDTDt DhD@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[jUS_&)ûIt~._dyz,(4y:b,ia /A&"3DUfw̻wfUD3"-  J1AY'A;B'{BP}sՊtS.&J]J]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;QJ]J]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽHJ]J]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTHJ]J]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@J]J]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rD>D?D܍Rt>DR@D0S`@D܍R@ ;CD^j^@ ;4MD^^ieee80211_setmode@P ,    $ 0H`l     $ 0H`lieee80211_media_status , $0H`lieee80211_media_change   $0H`l  $0H`l_ieee80211_crypto_delkeyieee80211_crypto_registerieee80211_crypto_unregisterieee80211_crypto_newkeyu^~^^^^ieee80211_crypto_setkeyieee80211_crypto_encapieee80211_hdrsizeieee80211_crypto_decapieee80211_hdrsizeccmp_setkey$^rDrDrDpDrD|oDrDr^tDtDtD@uDtDtDtDƄ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decap@^DD~D}D@DDD0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsize^DDDDDD؍Dieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_table_initPieee80211_encapieee80211_compute_durationPPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_update^^^^^^^ieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setup^P)F3F2F3FCFlEhEc]EGdE`Ee]pGF\EXEd]F(FpFhiFlEhEc]C,ZlEhEc]؛Z)C,ZlEhEc]؛ZsC,ZlEhEc]؛ZCElEhEc]EEEChiFlEhEc]nF     }E#(D(@AAA==A*ip_outputiFhFhFDmFgFxlF8kFHnFnFhFhFgFmFnFgFgFsFgFmFtcp_outputsyn_cache_respond @@@@@@@ GxGGDGP;G\JGAG=GG?G@G JGJG BGH#GGAGAGPJ=JP4J4RJ0J<9J9J@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!^^^^^^^^^^^^^^&^,^^ ^^^^^^^z^~^^^^^^^^^wsevent_copyout_eventstXJUJhJLiJ,fJ܍RfJRfJ0S@gJ܍RABCDEFGHIJKLMNOPQRSTUVWXYZJJ J܍RXJRHJ0SJ܍Rrasops_reconfigrasops_init@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?ȩ&&`&]]o]]                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~8]ٓ]a])L]2u]]]ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~PX(JJTFJJPNJRRJCE\JST4JNM?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ\K,KXK|XK`XupdatefatsdLKJKKKJKKKNKtKKJKLK|LKU̟]@ ;|VK^. .. uԟ]]0W]|X0]7KL]{Kh](X]X]|K]XrK]X]$}K]dK,]hKH]PkKd](X](X]ܜX]X]X]X ]X(]lXD]̃K`]X|]oK](X]QK]|K]loK](X$]@sK@]X\]ԜXx]!K] K]X]X]gK](pK ]HqK<]4XX]qKt]qK]V]kX]0XAaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:ZKKK\Knfs_sillyworkerKKDK`X @d]X]>]*]] ]]޲]²]]]l]V]8]]]ڱ]ı]]]]] ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  (]](]@ ;\1LM_00]]0W]X0]0XL]0X]0Xh]0X]0Xd]0X]0X]0X]0X]0X ]0X(]0X`]0X|]0X]0X]0X]0X]0X]0X$]0X@]0X\]0X]0XX]0Xt]0X]X]0X]<}L],vL]X]IL]L,]mLH]hmL]ܜXD]P@Mx]K]K]X]vL]0X ]uL<]4X]X4]]0W]X0]dXL]X]Xh]X]hXd](X]X]X]X]X ]X(]X`]X|]X]X]X]X]X]X$]X@]X\]X]X] XX]Xt]8X]kX]0X]|L],vL]X]IL]L,]lLH]lL]ܜXD]Xx]K]K]X]vL ]uL<]4X]V80]]0W]|X0]4^LL]0Lh]L]HL]?M]wL]X]IL]L,]kLH]XKd](X](X]ܜX]X]X]K ]X(]lXD]P@M`]X|] 6M]mL]7M] M]VL] M$]nL@]kL\]ԜXx]K]K]X]vL]|HL]pL ]uL<]4XX]pLt]|uL]X]K]0Xffs_mapsearchffs_nodealloccgffs_freefile_commonffs_blkfree_commonffs_blkallocffs_blkfreeffs_realloccgffs_blkfree_snapffs_freefileffs_freefile_snapffs_isblockffs_isfreeblockffs_clrblockffs_setblock]]]]        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?+NxN|XxN`Xffs_newvnodeffs_reloadTMMXMMM!N,&N ffs_sync ]D]l]@ ;|M^)^Lt]]0W]X0]0XL]0X]0Xh]0X]0Xd]0X]0X]0X]0X]0X ]0X(]0X`]0X|]0X]0X]0X]0X]0X]0X$]0X@]0X\]0X]0XX]0Xt]0X]X]0X]N]X]hN]iN]lN,] NH]TN]ܜXD]\)Nx]CN] !N]X]X]?N]4M ]dN<]4XX]N]V]M8]MT] M]ĪMp]M]M](X](X](XPL]]0W]X0]dXL]X]Xh]X]hXd](X]X]X]X]X ]X(]X`]X|]X]X]X]X]X]X$]X@]X\]X]X] XX]Xt]8X]kX]0X]N]X]hN]iN]lN,]8NH]xN]ܜXD] Nx]CN] !N]X]X ]dN<]4X]V]M8]MT] M]ĪMp]M]M](X](X](XT]]0W]|X0]INL]gN]sNh]gN]HhN]hN]X]hN]iN]lN,]$NH]Nd](X](X]X]ܜX]X]X ]X(]lXD]\)N`]X|]qN],rN]\cN]tN]xN]N$]yN@]}N\]ԜXx]CN] !N]X]X]?N]}N ]dN<]4XX]Nt]N]V]kX]0X]M8]MT] M]ĪMp]M]M](X](X](X]@ ; /NX_^`]]0W]|X0]XL]Xh]X]2N]5N]X]X]X]X,]XH]Xd](X](X]X]X ]X(]XD]X`]X|]X]X]X]X]X]X$]X@]X\]Xx]P3N]3N]X]X]2N]4N ] 3N<]4XX]Xt]X]V]tXufs_inactiveufs_dircompactufs_dirgrowYNYN@ZNZNZN[N[ND[NaNlaN@ ;DeN)^ ...\NN)_F)__acl_posix1e_mode_to_permconfig_devdeleteconfig_finalize_mountroot7^S!_-_bdevsw_attachcdevsw_attachopendisk$4_/4_:4_ E4_(P4_0[4_8f4_@q4_P|4_`4_p4_4_4_4_4_4_@4_4_4_4_5_ 5_3_4_ 4_@4_0TH/T/T/T 2T܍R 1TR0T0S,3T܍Rpr_phinpage_checkpr_rmpagepool_initpr_item_linkedlist_getpool_do_putpr_item_bitmap_indexpr_item_bitmap_put0123456789abcdef0123456789ABCDEF|/-\,T(Tvmem_rehash_startdTTTT TTTT@ ; T]<_@UTUT<_LUU(UPhUUpUULTU@UUUD=U$1U4U8U8U7UxCU?UCU@U>_PPPPX0U/U4UPP@ ;,6U=_selectXpollh>_UUUPhUUpU(VUԌUU$U4U$Uw>_LUPUPhUDUUUpU@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ĔUtUUUttyoutttyinttybgttyopnttycls@_@_@_@_!@_%@_+@_ U UULUUUU UUpUU\U0S U܍R$UUU8UURUU0S$U܍R܍R܍R܍R܍R܍RRhhU0SlP܍RURUUURU0S\U܍Rj sockaddr_copyWARNING: mclpool limit reached; increase kern.mbuf.nmbclustersm_prependm_copy_internalm_pulldownm_copypacket]:V8;V4;V:VV:V;^2IчH[ _|nQn- q+[ _ZIчH^|nQn- q+^SFU0eC^IчH2j_IчHT_-чHX_-чH$T_SFH0eCAW_S'@ )ѸX_*1@ )ѸX_1x )ѸX_3Dh&ǦX_=rGy=iG}X_|nQn- q+X_Y(QYYLYYYRhhU0SlP܍RYYYY܍R0Y܍RYRYYYRhhUpYlP܍RY Y("Y Y YR| Y0S Y܍R$Y"Y`(Y܍R܍R܍R܍RRhhU0SlP܍RX_*Y,5YCYP'Y0&Y(BYH$YP_bpf_mtap_softint_init@ ;03YX_tY_@ ;LOYtY_ifaddrpref_ioctld n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jnd_set_timer^8YU\_@Y\\_Ye\_Y8Yrt_initrt_timer_initrt_deladdrroute_outputrt_msg1route_enqueuert_addrmsg0[Z[ZAZHZ\AZTAZHZ\ZH\ZAZdAZlAZEZEZtAZ|AZp\ZAZAZZ FZ]?Zarp_llinfo_outputarpannouncearp_dad_startarp_dad_timerarp_rtrequestarpresolvemZ yZtkZin4_cksumwqinput_createwqinput_sysctl_setup@ ;Zc_@ ;Zd_@ ;Zf_@ ;Zf_f_ nPl"YYHOYY(UMDJA-^ ]b^]q^]^]"^]I^]^] ^]~^]^]^]^]^] ^]c^]m3^]Q_]h_];i_]U^]xh_|]^t]\1^l]_d]*^\]a^T];d^L]]c^D]c^<]g^4]h^,]?i_$] j^]Gi_]8+^ ]-^].^].^]/^]/^] n^]0^]6x^]dā p t8$̂XĔpDȗ̢tHġl@a^a^Ni_Gi_{^U^U^@^;i_6x^6x^Wi_?i_.^.^ai_.^ri_/^{i_0^i_8+^\1^\1^;d^;d^----d-D-$--,,,,d,D,$,,++++d+D+$++****d*D*$**))))d)D)$))((((d(]]]]p]]]]l]8]]]]0]]X]]]D]h_U^i_A^A-^B_A^@^i_A^i_6x^p^A^}^i_ai__A^i_C_Ni_{^^A^_Wi_i_A^h>_A^;d^B_A^i,^^Z+_A^i_A^.^a^{i_\1^i_A^i,^^i_A^^A^i_A^j_A^ri__A^i_C_; ΔHWIn(l QrYTᯨg?RPQrYTᯨg?RP; ΔHΕ#w.jRmQ3h8UQrYTᯨg?RP; ΔHΌQ3h8U 5,+Kыͳw'F3   0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGi_[ _i_i_ j_,[j_D[j_D[?^$[5^}[j_pj[Mj_Q[b[b[rbmna[$a[X`[`[a[X(j_tcidDn[,n[q[\|[4m[,l[ l[l[l[ yekdn[m[@k[H j_0j_@<j_P,j_atad~[,[~[ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ j_loob[p[[yara[[̍[[[(! j_strtoullstrtollstrtoulCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025, 2026 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALL_C700src:20260913140540-xsrc:20260826145037 NetBSD 10.1_STABLE (INSTALL_C700) #0: Sun Sep 13 14:05:40 UTC 2026 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 @(#)NetBSD 10.1_STABLE (INSTALL_C700) #0: Sun Sep 13 14:05:40 UTC 2026 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 10.1_STABLENetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partitionbad sector table I/O errorbad sector table corrupted: I2C controller unable to attach PXA I2C controller pxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoop%s: not configured. can't map bus space couldn't establish power handler %s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferSharp Zaurus LCDw100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctl%s: this kernel is not support SL-C1000 couldn't register event handler zkbd: pseudo power management module zapmunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus, rrx, %s r%d, %s #%dlrthumb insn %s%s , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d#%s.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]und%s %08x oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-dask-aquiet-q-v-x%s: curaddr %#lx not in range%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botchL%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)%s: not supported %s: status=%s %s: (error not notifiedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed device faultdevice timeoutchannel resetrequeue, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASwdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferrecalpiomodesetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x atacmd_to48: illegal 32-bit command: %d%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitq%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported atapibus at %s not configured ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't create task thread "%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %dcouldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE setsdmmc_select_card: SMC_CAPS_SPI_MODE setsdmmc_select_card: error %dcouldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz error waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenancecan't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dcan't get SD status: %d unknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270Kernel is configured for %s, but CPU is %s : Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostStray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacpxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL unable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendunknown error codepower management disabledinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedno APM presentreal mode interface already connectedno pending eventsunable to enter requested stateAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0DYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaunable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors %s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x detect auto increment bug, try again wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: tx rate %d -> %d (%d) %s write fid %x failed failed to allocate %d bytes on NIC tx buffer allocation failed %s: interface not running timeout in alloc %s: device timeout %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: NIC memory corrupt - invalid packet length %d device enable failed ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s com: unsupported I/O width %dtimeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifotl16c750ns8250 or ns16450, no fifons16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTDesignWare APB UART, no fifois_consoleforce_consolecan't re-init serial console @%lx fifolen: %s, %d-byte FIFO txfifo disabled 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1atapitimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardl%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilinvalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow%s: ctxt %u%s: tag %u%s: verify %u failed %s: ptxt %u%s: forgery %u succeeded %s: buffer overrun %s: tag overrun aes_ccm: self-test passed aes_ccmaescryptoselectedaes: self-test failed: %s AES self-tests failedaes: %s AES is busted%s AES-%u enc: self-test failed wasexpected%s AES-%u dec: self-test failed %s AES overrun preceding: self-test failed %s AES overrun following: self-test failed %s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed %s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed %s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed %s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed chacha: self-test failed: %s chacha: %s Portable C ChaChaxchacha_streamxchacha_stream_xorchacha core 1chacha core 2hchachacprng_fast reseed/usr/src/sys/crypto/blake2/blake2s.c0 < dlenkernel %sassertion "%s" failed: file "%s", line %d dlen <= 32keylen <= 32jA%AESŘOOLJ܈yLblake2s: self-test failedblake2s: self-test passed blake2ssysmonsysmon_envsyssysmon_wdogsysmon_powerWARNING: KERNEL TICKLE OF WATCHDOG %s FAILED! wdogrefWARNING: unable to register watchdog shutdown hook WARNING: unable to register watchdog critpoll hook %s: %d users remain WARNING: UNABLE TO DISARM WATCHDOG %s ON CLOSE! WARNING: FAILED TO SHUTDOWN WATCHDOG %s! software watchdog initialized unable to register software watchdog with sysmon swwdog%s: %d second timer expired watchdog timer expiredreboot if timer expiresswwrebootfailed to create swwdog reboot wq%s: unable to attach cfattach invalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: [%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handledmgttoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %ureceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: free all nodes in %s table %s %s table %s: %s[%u] still active %s: scan set:%s%u start chan %u ibss???? %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup initial BSS node%s %s table, inact %u scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechodynamic_rt_msgICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailablereserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblisttcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachable%s: impossible (1)%s: impossible (2)synplrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttiss_hashabcaggressivemsltremoteremote_thresholdvtwtcp6inet6newrenocubicudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknodeinfomtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtu%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctl%s: %s marked tentative %s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) bcast/mcastmcast/dstunspec/srcsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6keepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxdynroutesparam_rt_msgip6_init%s: packet to an unready address %s->%s %s: off < sizeof(struct ip6_hdr)%s: m == NULLpim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludge%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s RA%s: src %s is not link-local %s: lladdrlen mismatch for %s (if %d, %s packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket addr 0x%x%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' : I2C bus i2c-no-indirect-configi2c-child-devicescookiecookietypecompatibleWARNING: ignoring bad child device entry for address 0x%02x WARNING: ignoring bad device address @ 0x%02x i2cexec,i2c_bitbang,i2c_subri2cexeciic at %si2c_bitbangmii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4xOUI 0x%06x model 0x%04xmiiautmii_phy_setmedia: MASTER on wrong mediano media present HomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDX: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted kbdmux %d: console (%s, %s emulation), using %swsswwsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %dOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux%s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] %/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. msdosfs_rename: updating .. in root directory?msdosfsmsdosfs_sync: rofs modRRaArrAamsdosmsdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inode%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list%s: unknown fs_fragshift %d%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsinoffsdino1ffsdino2appleufs, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s not roundedmissing NUL in namenull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpageuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectudv_detachudv_attachflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainloanzeroloanuopguser_va0_disablevmmpeplvmspplvm_map%s: kernel object %p %p uvm_voaddr_release: bad typevmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressthread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using package allocation scheme, %d package(s) per bucket uvm_pagealloc_strat: bad strat %demergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: Tried to unplug unknown range ractx%s: swapdev not in listswap_encrypt%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d uvnfp1uvnfp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)haltuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptpid %d (%s): %s write of %zu@%p at %lld failed: %d %.*sToo many CPUs. Increase MAXCPUS?cpu%dfdcloseincrease kern.maxfiles or MAXFILESfdfilefiledescfile2dup2entropy: ready entropy: best effort cpu0entropy intrdropentropy intrtruncWARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) WARNING: system needs entropy for security; see entropy(7) entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategathersamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)%s: invalid type (%ld)EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY*fexecve*execargsshould not happensigcode kernel mapping failed %d pspawnlwpwaitnetbsdinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx pserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: built-in module %s can't find builtin dependency `%s'built-in module %s prerequisite %s failed, error %dbuilt-in module %s failed its MODULE_CMD_INIT, error %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEunload requested for '%s' (%s)module `%s' not foundmodule `%s' busy (%d refs)cannot unload built-in secmodel module `%s'could not unload module `%s' error=%dunloaded module `%s'module `%s' declined to be auto-unloaded error=%d%s: builtin module "%s" init failed: %dmod_unld/stand/%s/%d.%d/modulesbuiltin %s failed: %d moduleautounload_unsafeautotimemodunload%s: %dmodule `%s' pushed by boot loader already existsduplicate bootlist entry for module `%s'unable to load `%s' pushed by boot loader, error %dunable to fetch_info for `%s' pushed by boot loader, error %ddependentuse -f to reinstate builtin module `%s'%s module `%s' already loadedout of memory for `%s'cannot fetch info for `%s', error %dmodule `%s' has invalid class %dmodule `%s' built for `%d', system `%d'forced load, system may be unstableincompatible module class %d for `%s' (wanted %d)dependency name mismatch (`%s' != `%s')module with name `%s' already loadedcircular dependency detected for `%s'required module name `%s' longer than %dself-dependency detected for `%s'recursive load failed for `%s' (`%s' required), error %dunable to affix module `%s', error %dmodule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %drecursive load causes duplicate module `%s'module `%s' loaded successfullyAutoload for `%s' requested by pid %d (%s), status %dmod_hookLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for %skern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfMutexmutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: Suspending devices:%s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuefailed to reserve PID 1 for init(8)procplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s plimitplpstatsplcurprocpaxflagsrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x Reader / writer lockrwlock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old panic%s: locked once %s: locked twice %s: initialized crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s %s: unable to remove %s from sysctl null_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicesigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=%s%lluswap dumps on %sparsediskuse one of: %s[a-%c] none halt reboot md0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_locksetrunnable: lwp %p state was %dWARNING: negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLsysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destructionpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone calloutcallout_init_cpu (2)late/%uwait/%utstileturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system %s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrtts%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachlocationev: %s %s at %s in [%s] cfgmiscautoconfdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceWARNING: power management not supported config_attach: allocation of device softc failedFound %s (root)%s at %sroot device %s not configured waiting for devices: done. WARNING: %d error%s while detecting hardware; check system log. detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbacknist_hash_drbg_destroynist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_reseedNIST Hash_DRBG failed self-testurandomarandomnist_hash_drbg_generatecpu_topology_init: asymmetric & SMT?? ureadc: non-positive residureadc: non-positive iovcntdevice-enumerate-childrendevsw%s: block majors exhausted %s: character majors exhausted writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and partition table is fullno raw partition and disk reports bad geometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitdisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table typehashstat KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpusetkcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u %s: [%s] ph %p poolid %u != %u%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p pool item size %zu too large, use a custom allocator(null)[% 4jd.%.*ld] %s: table is full - %s %s: table is full Skipping crash dump on recursive panic panic: autoconfiguration error: mismatching pserialize_read_exit()exclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclocvxchicvcrosscallunicastxcallxcall/%uaio_process: invalid operation code posix_aioaio_listio_maxaio_maxaioworkaiodoneaio_jobs_poolaio_lio_poolefdreadefdwriteeventfdfqabortfutexinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s compat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgplmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsockettfdreadtimerfdttyrub: would panic c = %d, val = %d not a controlling terminal empty foreground process group found only zombie processes no foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreftkstatninnoutcanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_seqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)unixpsemposixsemmaxksemsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadinflightdeferredunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestednamecachenamecache_statsncpurgecwdidirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.fstypesmagiclinkstimestamp_precisionpnbufpllf_findoverlap: defaultlockfnamei_simple_convert_flags: bogus sflags chrooted pid %d uid %d (%s) detected outside of its chroot /../zauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dot%s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... VT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADfiledelaydirdelaymetadelayvflushbuf: not dirty, bp %pinvalid specnode type: %dILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsyncwaitfdesckernfsafsfstchgfstcntfstlwpvcachevnode cache hash%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvdrainvdrainwt%s: holdcnt vp %pvdrainrt%s: cannot lock%s: neg numoutput, vp %pxattr-listsystem.user.security.trusted.xattr-namexattr-valvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad op%s: ACL_OTHER missing layerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_fdiscard: not a device dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_ioctlinvalid specfs vnode type: %dspec_read typespec_write typespeciofictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) %s at %s (%s) deleted raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) %s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fszfsmdidle%s: cfattach_attach failed /dev/randombpfmaxbufsizepeers%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#link#%huif_%s: watchdog triggered ifnetifaiflnkstifwdogsdl%s: could not attach sysctl nodes sndqmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged UPDOWN%s: lost link state change %s %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %sinvalid ifnet multicast command: 0x%lx%s: can't handle af%d %s-ether_ifdetachhooks33etherrps_hash%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_looploifmedia_set: no match for 0x%x/0x%x ifmedia_set failed%s: invalid timer type pfilpktqsyncpktqrenqifqcurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us rn_delete: couldn't find our annotation radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d mZV%[Ag%=C+ˮ{0w-0 jB;rtfree 2route_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %drtableroutend_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintlog_movementslog_permanent_modifylog_wrong_iface%s: source can't be determined: dst=%s %s: %s not ready %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d curtainTraditional NetBSD: Extensionsusermountuser_set_cpu_affinityhardlink_check_uidhardlink_check_gidorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d extensions_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsfssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadtprofisvvideohdaudiouhsorumpblknpfdtviscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pwwancacpismbiosefisht3xtempscmdviocongpioirqcttyphysconptcqmsofconstunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseusbuhidulptscsibusraidugenucomopenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomdmoveriosscomksymsepcomtslcdtwewdcpxapcicpxamcisdmmcbuspcmciabuswsemuldisplaydevwskbddevapmdevifi2cbusdrivechannelgpiobuskbdmuxcontrollerindexdackintrbase%s: %zu bytes @ %p radixnodeunusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs3%ju%#jx%#jostringpropstng<>&plist version="1.0"?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0x%s: getifname%s: getifaddrsaddress:link%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tag?NONEAES-CCMPWEP40TKIPWEP104AES-OCB...SIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s%s: can't read disk label; disk type must be specified%s partition type is not `%s'?SmSSSTpTTTTTU(UHU~UUUUV&VFVxVVVVWWTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector size `%s' is not a power of 2.fragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()܉skc[SKC;3usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /tmp/option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered oldNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptywarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d seekI%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY?Rkٗ+Kk9YMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbatalkchangeexpirehopcountinet6lockrestmonitormtunetnostaticproto1proto2recvpiperttrttvarsasendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspechw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worlddpswpriority=nfsmntpt=blkOut of memoryempty mountpoint%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytes1M-blocksGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpfetch_ftpb/UY]aei***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207Version: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTmoreMLSD is not supported by the remote server. nlistoutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernamePASS %sLogin failed. Account: Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. MLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIebcdicftp_proxyhttp_proxypagerpromptasciibellbyecdupeditepsvepsv4epsv6exitfeaturesfgetformgatehashidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemsendnewernmapntranspagepdirplspmlsdquitquotercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquesystemthrottletrace'%s' macro not found. ?Ambiguous command. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s] Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initRequesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. %s:No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STORproxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandsentlocal: %s %s: not a plain file. APPEReading `%s'Writing to networkCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEpassiveactiveUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpasshttps_proxyno_proxyPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. loginaccountmachineMDTMREST STREAMTVFS Remote system type is %.*s. unixlinux215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEATlostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): USER %sPassword: Login failedACCT %sAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gzh0hhS- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataC]/Cannot allocate memoryLESSLESSSECUREmoreVISUALEDITORviLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_LINESliCOLUMNScokrklkukdkPkNkh@7kDhcxndadbpcticlcmsomdvbbc|^ crsrNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE/dev/nullHOME.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]& There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~\LESSMETAESCAPE%c%s%cSHELL-c%s%s%slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ %*s Line numbers turned offCalculating line numbers/dev/tty (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadshifttildequoteswindowmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE%lu \abfrtv disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for on[set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowednonebad flow settingevenbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dlink downunsupported speed %ldConnect failedescapeparityphonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberhdraecbetbdchfesprdletdvcmcuiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zero%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busyPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5d n r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsforceframesizehostphonesraiseraisecharrcrecremotescripttabexpandverbSHELLechocheckdisconnectlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalecholeparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i8 # "/# / ",6"G"X`""","Ƹ/"ϸ/#ٸ/#">" "/p"F#"",h"=J#OJ"`8"jx"""ƹ,"Ϲ/"ع/"8#x#/# "*,#6//#B/.#collectdhJ,NAME=_~8b^ȳҳܳ"( . $:.2:>DH:T`p>      !"   !"    !"#$%&'()  ya_QkS 1Ly]m ȳҳܳ"( . $:.2:>DH:T`pabr?!eam#e!  1]Y[I-ȳҳܳ"( . $:.2:>DH:T`p9i?C----------------------------------- - --------------------   !"@//tmp/usr/var     # # !# # &1; Details for index GPT part - Qnqv{F8~Z,_:bJD@T?]5q% É1 aqы g! ՚y[% F~ DV @!SFH0eCSFU0eC쬷$Hah!IdontNeedEFI(s*K>;|nQn- q+|nQn- q+|nQn- q+ |nQn- q+'2|nQn- q+@p=rGy=iG}D;Mt?P[mWC 3KOOfbyD<#*=(r|3Dh&dž\ M}--чH-чHDZIчHFIчH~IчHV2IчH+S'@ )Ѹ8*1@ )ѸT1x )ѸR9CCy}meE3w9U[! 5AqѱY  &>MUbmA~ /bin/kshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages/sbin/halt -q/bin/sh -i -E/sbin/reboot -q <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noexecnoautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeNoneokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 10.1_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"headsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.1_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.1_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.1_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.1_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionendblock sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: N, (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPE10.1_STABLEzaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mountdist postfix.tgzdist tgz postfixpkg hostpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/10.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %stmpfsinvalid%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t xx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etc/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF /sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*unknown%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/%sCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %sudf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigdkctl%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICkern-C700etccompgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%zu%llu - %llu %s, %sFATNTFS a-%c %c---%c-%c%c: %s %s %s %s %s%s %s %s%s %s %s %s/targetroot/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi C700/dev/r%saNetBSD10/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sYESs,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c/dev/r%s%c%s (%u)fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%*s : %s%*s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%llu%s (%llu)%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %s%s_%lli@%lliStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1153: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tableSec GPT headerv7sysvv71kv8lfsotherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmkcorevmfsvmwresvbioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequired%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxApple HFSapple-ufsBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsLinux datalinux-raidLinux RAIDlinux-swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapVMware VMkernel core dumpVMware reserved/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal errorNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading input%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETAKiBMiBGiBTiBPiBEiB-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu \%03o --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limit%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap???refusedunknown qtype truncated no address %s(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s failed to get receiving packet informationinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 addresscontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump2.]dhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_getif_discoversplitvadd_environparse_optiondefault_configread_config!b=!cD!dJ!enfN!ghAirjZ!kb!l&ml!nos!pq'r~!s!!tuv!w2x!z!y!A!B!CD!EF!G!HmI!J!K!LM"N "O"P!"Q)"S0"T5"U?"VI"WS"X]"Zx1l"4u"6~""6!|"~"}"""""""""""## ##"3j;!#*#&2#:#D#Q#[#l#j#s#q#y######## #P!#U U )T )T rt_new0T T rt_buildrt_deleteT T McH#&&&&&J.!&!l#!&s#&make_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_opensockets_os((((((if_initrtif_ifa ( PT@P HEPT$ @CD@DCread_leasedhcp_openbpflog_dhcp1222'2dhcp_bind32z0<2D2(/L2+ T2dhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceSTOPNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d timed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningkillwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUID%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurloption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptdebugenvreconfigurereleaseleasetimerebindpersistentinforminform6timeoutwaitipallowinterfacesrebootnoarpnobackgroundnohooklastleasenogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigure(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %saddingchangingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deletedif_missfilterif_missfilter_applydeletinglink#%d - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinfalsedownPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuerastatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zulo0%s: SO_RERROR%s: SO_USELOOPBACK%s: SIOCGIFALIASbridgefwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigreading standard input%s: reading lease: %s%s: %s: truncated lease%s not foundviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\BD D D D D D1 DI Da D} \ D D BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~DD9AD= ADDDDDDDDD \@DDECAD|nDnDoDHoDoDoDpDXpDp\pD$qDhqtc/etc/group/etc/master.passwd: (malloc) Error in munmap(): JjhPUPuVvXxZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory %s%s%s 646tolowertoupperalnumalphablankcntrldigitgraphprintpunctxdigitASCIIUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidfull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist