'V/wgW0u0NetBSD/earmv7hf ramdisk 08g<  gJt tg@@<@T 08g<  gJt tg@@<@TU gt  `AgggAggg}A.gggAgggAgggAgggAgggAggg AgggAgggCgggAgggAggg $h gggmDggg (08@HPX`hpxx $|gggL$Iggg (0M$ggg8@HPX`hpxE$vggg5K!ggg agggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggaggg aggg aggg aggg aggg agggagggagggaggg aggg aggg aggg aggg agggaggg agggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggaggg!ggg4!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg B!ggg B!ggg!ggg"!ggg"!ggg"agggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggaggg aggg aggg aggg aggg agggagggagggaggg aggg aggg aggg aggg agggaggg agggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggaggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg !ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg !ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg !ggg!ggg !ggg!ggg!ggg!ggg?\!ggg>\!ggg=\!ggg<\!ggg;\!ggg:\!ggg9\!ggg8\!ggg?\!ggg>\!ggg=\!ggg<\!ggg;\!ggg:\!ggg9\!ggg8\!ggg:\!ggg7\!ggg6\!ggg5\!ggg4\!ggg3\!ggg2\!ggg1\!ggg0\!ggg7\!ggg6\!ggg5\!ggg4\!ggg3\!ggg2\!ggg1\!ggg0\!ggg2\!ggg/\!ggg.\!ggg-\!ggg,\!ggg+\!ggg*\!ggg)\!ggg(\!ggg/\!ggg.\!ggg-\!ggg,\!ggg+\!ggg*\!ggg)\!ggg(\!ggg*\!ggg'\!ggg&\!ggg%\!ggg$\!ggg#\!ggg"\!ggg!\!ggg \!ggg'\!ggg&\!ggg%\!ggg$\!ggg#\!ggg"\!ggg!\!ggg \!ggg"\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg \!ggg \!ggg \!ggg \!ggg \!ggg\!ggg\!ggg\!ggg \!ggg \!ggg \!ggg \!ggg \!ggg\!ggg \!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg\!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg !ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg !ggg!ggg !ggg!ggg!ggg$!ggg4!ggg!ggg!ggg !ggg !ggg !ggg !ggg !ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!ggg!gggagggaggg!ggg!ggg!gggaggg agggaggg agggagggagggaggg?\aggg>\aggg=\aggg<\aggg;\aggg:\aggg9\aggg8\aggg?\aggg>\aggg=\aggg<\aggg;\aggg:\aggg9\aggg8\aggg:\aggg7\aggg6\aggg5\aggg4\aggg3\aggg2\aggg1\aggg0\aggg7\aggg6\aggg5\aggg4\aggg3\aggg2\aggg1\aggg0\aggg2\aggg/\aggg.\aggg-\aggg,\aggg+\aggg*\aggg)\aggg(\aggg/\aggg.\aggg-\aggg,\aggg+\aggg*\aggg)\aggg(\aggg*\aggg'\aggg&\aggg%\aggg$\aggg#\aggg"\aggg!\aggg \aggg'\aggg&\aggg%\aggg$\aggg#\aggg"\aggg!\aggg \aggg"\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg \aggg \aggg \aggg \aggg \aggg\aggg\aggg\aggg \aggg \aggg \aggg \aggg \aggg\aggg \aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\aggg\ !gggi!ggg!ggg!ggg agggagggagggagggagggagggagggagggagggagggaggg aggg aggg aggg aggg agggagggagggaggg aggg aggg aggg aggg agggaggg agggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggagggaggg!ggg!gggagggaggg!ggg!ggg!ggg B!ggg B!ggg!gggagggagggagggagggagggagggagggaggg!ggg!gggaggg agggaggg agggagggaggggggbpf!ggg $ggg~$>ggg$ggg$sggg$ggg$gggAgggmggg$ggg $gggAgggAgggAgggAgggAgggAggg!Aggg"Aggg#Aggg$Aggg%DPRk` ']drxHK4s MzY*8w7SK]OP4mQF; Rw3*+FHx*w/NhW%6kwbL;[FSĊ}B0v H0:0[L)DW9Y "*jy9F(I#qL>r|ە)rS3N!ѩ{'+yM!$BWFGZ_GK*k?iskD\-mq:E_:t4jT"c$9 $/ 3 3bkS.V椮)vR+ưX8ky8hsK㒱r5*p%np%9\OpXUxgC_U~\4`OBp nS,wgxRw|H q1CXM{nhRHB2H!25\+`j+pW6FYR4C&0QXWDS6Bt . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4t4 (""\\\sLL\\\NetBSD@ ;PaX NetBSDearmv7hf3D0D 0p@-X#|hL %JIH:LOLT 0I  4F5DO-9F 5FT,AF8F4lwPP(@18@ Kn:f*oB² *IOmQeppG@-O'PNFXO TFkh;k`+(F$AFл J3h3 ,-ѸTOsh+>гh ,$7Fh)h]FH:#a+h+LF+h]Fa FB F$磉#`LNi'K-AFf`s4$LcjjKiF0FOj oȿbjo(Fp`bPH)F cj#OcbKcb 8FO8 СiH#a& I Oaj*F0FADODL:x,-OF5O5N5K@Ԁ`АРa+h+QFAF4 @a"Ф+h]Fa Fz0ZЛB) FO%2jJ"!FOO0 FO)hHFl pCO FO)hPF ]F#a+h+)FFO,I LNiS IFFH XJh3`pG|-pCF-FK"F)F0F`HA0 @FIF >#eA0 I H {zpY@| 0p FFmF@)F0F H1F p h-ApG#sFF `ֱ0FO$h60FO(Y/I$/H O!.B F(HO4h+ $I$%Hh#@c`$HOz(ѷ O"Kp49F~0FO04h-+I$Hd HO0H)Ft($0+ Oѫ'   K-OhFHO>I OF IH,$ F3FjNAF KX`h+KhKhC/ВKh O +@Kh+8ЍLJI Fkh;k`+(F$F, F (0$ Y,8FNrO TI rYoFJEsj#FIF  +N?F[1o"O OLF[F?"FQD(O2(FN`B/$I$$H:IFPFOH( $H.0C)F8F\I"H 8FN,o(FNh@a"@b`$J Ch*ZF,,I$'    |YF(FNB5I6H5K Jzh#JFSFO2YF8FNܸ O F@L)F0F0$h@oKihB (FOбI$H(FN I$H0+?P H1F($G2jB K(Fhh! N~(' |0MF Fj@2iFNC!jHF M0# 05 HO@ I H IhFNFHiFKh(Рm^! '. 9 FIHO( I H hHNFIHKh( F@3'. E FIHN( I H h #HNFIHKh( F@ '. P XIFFH Z KXbpG KXbpG I l4 I dJ I \a I Tw  hhO<oCFO2H#"#fK] x oCFO2H#"#NK ]  oCFO2H#"#6K ]  ?#F "H K]  ?#F "H KK]R ?#F" HJ`d] +oCFO2 H##"KQ F]  KFh[ ?#H" K]  KFh[ ?#H" K]  DIOr-C#BL#FAI88#V#h];JB#CS#`#hX_5H #h4I5J@)C(72I 08FvF .I:F &=!0*F*IF#;Cx'I*F#"IF"hhBIhC#`Ch8FGIK F`! KC#C#`#`LKKIK  #=   3 F `  Q 8KLhMchk`#B#A khc`##81bh;a??xE][ KQKpG J Ip  J Id  kF[ijG bj IZkpCj_ iIG#j(""C#b6##j"G??4h+#jC m8@F-BF F@˸"F pFj.؃k"!0FhGI k0FhGbp1F FF IjF NPk2F)FjjGF4>"iFh N@46` Fp |K-OرVwLFF#m 1FCEr #DI#v V3B\(#RСl'k jG??bk^I BF\HYF(sFFCbkVI x4h+bkRI'FP&2A&2 #0$2 B$22B&2DJVEB&2E #BB723B2#Rc V#BsbCai i-i#iDca.#R=Q@F0C2I" ON23B223BEE2#k 03ak#H0 #k[bk I`i  : ^ p*R*xBxKp p:<!F<F*2Bx3L L  L L  L  L  L  L L L L L L L L L𵧰oL#C "mI N#CiI" N!Nh Oz|dK eq aL UpEwel &q e6d!Esg V#&%#######HJ$ 2 F NN #RQ#C?J >I?Id! 2 F N4#RQ#C5J 1I2Id! 2 F N #RQ#C)J $I%Id! 2 F NtOzq2F+F 0>Ozr#0F)F2,#0F)FOzr2$Jd!t  2v F M'x NMb 7c0d|F F~ N-G*L!jc RkCk3j%&+D jG?? bj IBxO dOk2F!hj[jG(#j6Ѧi= ;h+;;` I 0[պajHF@O + 𵅰4L%j 1QCk#jj DG??bj 'ID#0k"IijG(ki!h[jjG( 5F #Bv#0kI'jiG0 O #BvҢi8F!h5FBBв.F mF J h!!B "JF6!FHP X-OFPMF0+FА8+BJ@ An0+>УhHch"#H####oH ### o"hH#H## Ma@ B1 0 O + 0f0M0Lܳгo$0+FЂK0#0#+`O}K4}K0 #0 yKzH*F2 +hO;;+`0)hB+` 0+AвoвhI gK0 #eIaHxWjsj mg[ C 0+$*QK@2!QJQH (0++hIFNJNH2NJ2 2JFKK<,0;IKIJJH #F2HHDK@3!9JOsE{~IF@F2[FQFF0F2FFIF@F2#F2F IF@F2s#9FF(F2F F 2C# @!# 4ZF:3FH (X+F%9. D q AFHF2  fOsEOry: OsEOrrUxH00+@,0+#H^ $hЦ"40+"HHNBy 1F2KF9FF(F2F FF0F2#3 -JFIFpH $hȑQ h 2h 2 2C# @!#FRHRKj+ xcQ~VDH !2F+FxFHx0 OsFE{01F@F2+[FQFFHF2`F 1F@F2#F2TFF1F@F2#9FF(F2HF Q [F 'HAF0F2 ; >OsFEOrAF0F2 >OsFEOrAF0F2QIo"+F2F@!Pz Hx:>C] dK+F!hF I P&`9F26DB upF Mk(y)F9F0oF$<`OxF(((F8`-t2F3(||M(FT, *F+PKI2(!F(8Bw8030@BF4 D!F(T2h7IF7H\6H]0;0+2Kh6 lF 0#` 0+HB}+)I2( 'H'K\i@0x+?v#gb9hFYU 0;0+Khԛ@IF F21~ N v Pgjh 0 ( p%NL3hh3U3`Uv3h`;3`[Kh D p( h -GF'L#hx . .$HoF(#h||xBN3#`0h'6hF0B FjF(0#!i #"#QFF(F|[ B$h6 F(ں  Kn:f*oB (КmQeppGIMs@-GFܑ&nLء0+S8FFh[ -^!hE򘀶F`hOz  D0QF30(s2fhWIFWHWH0;0W@ 0;0+LKhKԛchUHK"`6{h;{`+8F";hZ:`x绉`+!hB@E0FD`h30AFF(2 hW+IF+H*H0;0+7&Kh 0;0+KhԚ -chUch" Kh˱h8້[2h IF HpHpo@F.ch "U#`F v  ( -OFRMF\hX0LK#`00 8$EO#F`0ѲET,R+O+L;I;H0+QЪh*NвE`4P"$`H:hhh2:`;h;;`3-Kh no hk`:h::`* JhԒD FFF(h+вE0CIH,вEѪh`C00$4 F, (   FxF!+"I0F2h!I*FFHxHxo-I1F+x F!+(2h I*FF HT H! Kh# I:FHFKhl Z OF FB ;h)F (2thIFHHo v-OFF F0F zx'xx$ 20Fs'8F#*iB T20F( 4-hDB(FF(o -AFxF FF!+%I0F2h@ I2FF HHo/&)F:F!F3x(F!+(2h I2FF Hp H! Kh# IBFHd <4 F"$<l Z-O$TNFxpsh;s`+A0F!jEFneBP۴PFOy  D0IF30P2th` ( v P 0 -OFFFF)H%,&DB {:05BI%HD x ^+\ HYF-X 5\(4O500 x00 x00 xr@Ww+#J8Ih# `jFL( ۽0+;J`0+;JS`] ht@+ KZh B)iBHo -GFMFliO !+iB$4 F6FFi+ #"#9FF0FP F,̿4,i$kiBH{o -CFF0HloL0B̿H F FFB (F4()i;F"F@ (-hLF KJh30 H3oa9 Ki" 2 #Da h B Kh30Ka8@iHoh -OsM؁li p;xY2I +"O (7p )(((iiiiiiiiii^.30-.^. \D"0x?.. .@ 300xA2@ (I1 "QFBCF;31h"+3fa0(Cbi F(<#10;0+^ h8:ѽ(FF(M+i;DB<ݳ y IF2 :1hLIFHH0;0#h  i0h;0##hԘYF*i8D/8+i-hDRo NvF.Lq/1QXibBA+D",(Fw09F30F1hIFH8H90;0+#h  0jp;0+#hԛ2x\*rx6/*6 v-G#Ll#CаH!gF oB=030@BF5 D)F\1$hnIFHH0;0+#h 7 0nP;0##hԙ1%(@!"p x +8B!@B0/F7D309F (0r;0##hԚ*Fo/&1Q"ZU0x!XBXAr!+B%+oB$۵F0Oz  D30QF(?m0n;03#h?x?z0!xSU0Yx\)љ[xU=F|B0B!EE/F0GF7D309F(?/0np;03#h?:?<0oZ x1ZU1 [x (H1a+DB!ݳv 1F2 R(?0n`;03#h??13Dp!/ DB`s0++1H vj` HFF0lqCB!ݳw 9F2 (?0np;03#h??10F+D++GQ*ѠJ1h8#@ C` KF1x!+ I0 /! F, H'  7ML0x +:KKh0xP1@ *EH 30 *!n 0x!+0(0,0HR-8u0)F30R1hd%IF%H%H0;0+#h - 0P;0##hԛ#0x -# pR(YQxT hvK-AhL0F E2Pn (x /)!ȲY(1Y).,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,Z,h=fM,tKlQ,m% F+n*p* l* 0 x +MHE0EE1 Sh(ZoWaiF(% F+n*p*l*0 x +1 /(`iE0EEaiF(% F+n*%p*l*0 x +1 (#B3ca(FE0EE!):ah)Hq[x320] Hih (;&F(?r% F+n*=p*3l*60 x +G!i (Y(R(3x 1KN!0F}(@J#1O3`J`E0EE!+НH"1F.3x+Hah)[x320XF(? x!+ђH%F+n*p*l*0x +ݮ xH".PHMDE0EEQ |H!i (ӮGHBHA(ȮG/V/ (F1)F31E0 F+n*p*l*0 x + EEch+? % F+n*p*l*0 x +nSJx+?ݮQIRHFE0EEch+?% F+n*p*l*0 x +C22+?E0EEh 5H*% F+n*p*l*0 x +1 zh8$E0EE`iA(% F+n*p*l*0 x +1 NB?VE0EE` ++Ui vh _x(%`3F+n*p* l*03x +9FHE0EEaiF("Fn)p)l)0x +|B(%B0BBaiFu(xu8(qch HTh.$#iB? BuۮBڨHD% F+n*p*l*0 x +21 0Fw?E0EEaiF-(0"Fn)p) l) 0x +BB0BBaiF( "Fn)p) l) 0x +ެB`B0BBch+?Y% F+n*p*l*0 x +2aKh aKh2"E0EE#ch+?+  F;l; ۲+ x +1+P2+@Kq/O5o[x320Zch #i`3F(?% F+n*:p*0l*30 x +T1 1;3x!+ ,H"1F.3x+1+?8&Nh0F(N?#iB?#1E0EEO%.F0xg*T- *C0: *,0H "9F`@80J08h"+EHb&+` p*)r**-#20x *([x +%ўHһE0x +2+јHĻE30EE2E#20b30 keF0;0+#h  GB ( #b20;0##hԙ=!2R# jIq(yC/:Ѫ2A2# 20xn*;p**l*2aiFV(Y% F+n*5p*+l*.0 x +.1 !$8"B3"0"B"BE0EEaiF(u( ch+?h.#iB?u% F+n*p*l*0 x +Ѫ1 30F޺E0EEch+?E% F+n*p* l*0 x +AE0EEx Q)300 O5%x320[BF(?!ich C73 F+n*=p*3l*60 x +^1;3x!+ ДH"1F.3x+1+?GNHI#W/F0Fr(W#iB#  I(KE0EE1+?2+qch+?  F;l; ۲+ x +kHai `D (0x1;+0$&bI "bM`v(`@80 0h"+ZH.`"Fn)p)l)0x +MKh!ihDBF?B0BB% F+n*p*l*0 x +chh;HPE0EE!ich+?a(% F+n*$p*l*0 x +k 00.2+ϩHE0EEai `DZ(]h"FǻH=ooO5` 0U" +P&@'HS+]pG 0Ix^+0x]+0x]+ +[+Ax.۲+ % F/FK],ъB0 ,"F 0-GF(P/F;xB +6}(B_@B.F6D,01F30"F(;0h2-IF-H-H0;0ù)Kh [+\+FIFFHFH0;0+6( E0?KQDq8ih2`8K/h0IF0Hj0Hj0Kh:`dh:`:*Kh?`?b!Kh+# "YF(F8iZF)F0DVF-z1{C?x#")FHF;(?k0;0;Kh?*?,, #CH v ( o Kh+# "!F(Fa8i"F)F0D-J;i# +O N-OO(CLFCMF0&h;#`?K hKE &`Sa:H h0 `P:FFR o>!hF(,Ji +hO 3+`0FF+h;+`+#Kh  ]"hFB+h;+`+Khԛ&h  XFF!F(:F1F0F( (  [K-OhZN|3h3sh3UH4oRL#hQK"`P RO 0,F30,1, # # | FOl E Z?Kh !3h7J0sh`s`0;0+\5KhQ g R. ܾ"  FXP ;DpYhh`py`hHh`X`4Xh#h`#hX`Chh\h#`\`h ; =?d i ^ + 4 , ( -A &M1; ZF J#+`Kh`JhZ`; :X*уh,`DhhB F FDF + -CF LFFh"hB#hO bh8F PS50Fh`0Z"`d1  "`-t(И IF H H `h  vIFFH B-O]NF FF3h빬IrhK* FGH)FH  ]pCO/#`o Ob)F-No@/?# FI(pCOгhS FI(pCO3hkh[+x/+0(FIH)F  FI3hCF@!F(F.(8~H"F)F@ 4(#FxJvOa~ovOb!F - F(OajJ `b `I(eH)F/!(F0(Y/! F((SG9F@F.Fo-ڧ o(EEB.#=* PIRF๼BB.#=P PIF숹*PBBTBB?3i-si F+pCO@I(!F F'F P)F- S PRF!F- S i+_й\$OX8F+j"IX"F0;0+@FFp8F (0' Y/IHWXx@0Z xI|3h!F(FIB(wi(?􆮖 +F H!F& |rh)F*ocFOc#FIP\1\0I F\\ImmudBt ۷Bu ےllB\1\0I pGO0m FmudBt ۷BuۉllB \\IּO0pG mm u dBt ۷Bu ےkkB\1\0I pGO0m Fm u dBt ۷BuۉkkB \\IO0pG mmudBt ۷Bu ےmmB\1\0Iv pGO0m FmudBt ۷BuۉmmB \\ITO0pG m0RmCBs ۥBr0\1\0I: 0pGO0m F0QmBBr ۥBq \\0IO00pG h0P0+ hP * + *O3B L%h-l+*ch0G#F0pG# *0; -OF-)_O$\FF D2DC:iDCDDD D DP0+ +@pjt\FKH#{ah.+l* ++S ?L& ' ()cj+H#,!9J6L-.-2J!/-xcj0+I#1 2+b!'J-b#JCF!3-X31B4TB@21L$#kG#cchC72+;h˹~\0.+ѻi  [bO3k B8F +𽀵m,Bs ,BA8iB8F1BAh10@_( .pEpF_>NEF   L  Ah+li)BiZJ ! ` i)>+jTJ ! l XF- BFPF -BFF8jpHIF-BF3DBFF ivF(ѵ(jF(ѹ 0YF(`QF 0(Dh`:jJ!F0(D` Fa3jQOsEq- J!l-8j,+?KBsD,!JR-j1+? KBsD18B333bOjVUUU-OFONFOJF!Fk+"FF !F 7h/(FOIk#Ow(FFx.0h(F.*`.&h+[1IP0;+R#nnInnInInn%H\~!j`jMFXFr#sal[\0.+ѳi+"!F(F3l+sk!jPFf9F(FF Fk+)њ!jHFN#sc iD-GFhFI L +((IjF H 0 J`#3H#aO &MFRFAF8FCgxKbmhlC"mCuH+pK`mh3"ian#ehCC boo CCR @!hFR F F й^IHFDj+[b#*++ SKc`l+QK2F#c/8F`i#d18G(΀$gj)X[̤`eoPtc0x̐8FKh<jFHD\ D8 >l\m!J@Av DOb!FHC.hIFHF mBh@AiJT##THKhKhC F Kh F!FH \>j \ K\hjHHuHFHq > h0lKhKhCKh #"2!K#0I H0KLhK*FKh5QOsEq*XF F F0@H)$ ( < D o|@ Kn:f*oB (КmQeppGIH@pC O س_гO I * @O г`O% /  | @ = 9K-AFhmF,#4H4F3Kh۱3Kh+5 #"2/K!#0,I B+H9FD)Kh)KhC40F&KDhC%KhKhpCOѨhD FKJhK)FFKh<OsAq-F F@F9FK0Fhx ( <  | D @ \ hFL"L(F !BKh[4B I2`IYBBwI[bBp4B 4B 8Fh82;C*j Fj h-GF ~K}Kh Fb&h@@@ 2;C0m+#joH0mKh+} "''KiJCS!B0dI &!jbHhJi"kPFi\Kh#:hk[HzhjXHXKh#hajVHh0C_XѪjRKSHѲ3 C##l "k#LKh+g  IKhIKhCf0F>FKhh;EKh3pCOIhjF#&#f`G(-t8J DhOBG(-f2Jh QO4 F M*IjFh#f`#G(-N'JhOBGx-B"JhOBGl(nFIhjF#O3Gt(/!F8F"!I@Fp`jF I#h3G\(-sh Jh@F+m~IhF;`+ GýhZ` "ppG-OFLhAGFMO3JO`#33+a`;h+'JbK`kahBЩi"h+UO0kOr!0FG(`-vJ3Fh ^#`rKkahCЩi)"Or@a0FG(`-hJ3Fh u#`&#``KkaOr!0FG(`-p[J3Fh ZYKka# c`WKhVIhG(-XkiSJh BhGO0#``+0шjpCOji EI_/CIhGx(##+a(i>h(C$#C@ŀ.5.b.$6O@6Kh-*FPFYF,@C@0K=``O##h"#+??-h+##.@o;`'.O`KJh`J`mCIJ+q***OC `+ 0+v++! *m8@!|!+.%Kh+0GU_B-OS. `(KOB`OSOOEF=`UO S*FCFPFYF+uhCO ;`.:hKOs.?|;|!+ KMi+ Lch+ݠhOBiFGt(`` M +#LcbKi #"#h+L F - Jh  O0h|(+  Ki* I O0h(K JIhhu !!NFFF$*F1F8FGD-D F,FFFF$*F1F8FFD-D F,FpFM Flh,Nh1i)FFJ#s`hB`3` FpF#s`l`D,jJh }j FI+ !sFJMlh, FFhBFFN#kbs` Fpsk`3i;+5(5,\h +;;I $l`(3#h"#*l hcs($l`#s`(,4h+ $l`,,hE+,,#kb, h+,h+,h+,h+kj#,I ,Ѫj FI,jJh  KhYi F! I h| I+ - L!P  2K𵅰 * 0MjhB/Jh:*.I ?O0Xh"`i*"*=@!Y`B4݊BOth'"#*),"F3F+hf*)*!@"i`Z` I  hIG(#k`Ot"Z`kh+I +0 !m (O-G FuFFO# Oxh(|9)!h*b F%"I9$BqF Fh$*J) , Jh  O0x`a 0++K! F7LF`h(%5Ki+:+-q[1I p-qR#h'"*  ,(Jh O0``Bc+ڣj+ I"F!h*)*,J1K-`v(F1F+CII#h0G(, Jh # c`+ {!!!!!m"-O]|O|M F:hX *F \vHV20[bSF2#"F#0+:;h+ˀ䁀!0F##fJ V|eK:FV<+raJ;FLOq^JL3FOQ,@YJYI(Fh ]x0ӱRK!0F##HJNJOQ 錨+쌩F F;h+EK!VhCKBF8FV<+ 8JCFLOqL;J;F7K 9O!0F h z03Kj;###J#!HF#J|K 7  A+ FJOqPFdJOQ[FVe猨+"쌩F F~f,j0@ B"d"M"j"!8!" <"!+"L!! -CXMYNYLh+#3`3 0C#i+NKOOh8hAMKMI8hh8h(hIIhFlFhjpCO$#C`iF`@Kh+?Kh+(h(!FVhFp(h(" 0C #i+ ,O2H9h)K8h"`(JO3`#C#3`)O#3;hj3b 0CML+h# h#+`;h۱KHh+KOR%hPOI+F F(FIX * h(+ !Ě!!" 04!(L!#!!#!!-AMI F(,vJh `" Fr(,f|Jh PzN{Msj@+0C@L0#sKtHhoirI8F+d(pI8F+^(+i3+j9F;iH|hHyhKh;+5fHq^O9h@FjbHgbHdaHa@Ap(]I+(9h#[HO40t`KXK"` F MUH@THTH0 QH s+ S+ Y+hi(iiJH#y+HH4OH9h@FDH@A"(6I+(Н0I:FR;+1(B:H$Oqؠ%Fo(.DB5ܻFOL#[+*?<0+%-I al,*I"FH%&Kq hBF HOq$%F$B0I ?O0($(,0+I .HOq H)FiGL#(W( )FH J`V 0/ & X&L!0-OO ;+7 FF+3KJ1RA- F"0+?׮BM+h+?Ү;Kh.#+`B`CXKhB/Hg6K"` F` ¹ F(K+Mh' U#AP%2h)F FlG0F)F F0CM+h+Kh#+` KSQ(A4+?lh+?h KhJ F232,Kh@/*)J[FOyh @I"Kh !bE  $hx D!T U4BIZF S .bBCX)[hsYF0Fj,x#CO0!*+x!-AFDL- #*s&%' h0B@!DAq#h!Fi*F(F+Da0B BA*I  (%K"O7`#Kh#hB+Da'8Fua(26DBr2#h2FF(F3DaKhYi)0F6)(0"hBDa܈x!+ܚ!+L!8 Li#hB ٥i!**vKah8@X8x!+-AFO FL- @$,=iB1F,F&DF"F(D-F#DaO0x!+-CFdFO-v B,8hOyBv 0O,FF"FF*F#D,0f %FO0+x!-GBC̰FFQXVh 1F"hF(=KhiF@FD( *|S8J8h b-v U0T/I( O * O0VLBv@F*FDt($0-fvD&@FDv(T*,J86BBT I(T* J8h  V!*,!,+x!+F8*TTDX(*J+Fh D(*4Jh $J#4`8N,q,!pF0FiFD("KhB CXRhBBB0CXRhBB I2F (F&p%%4 +(tKxHh)! FD(̀ FD()nJCFh Gq F#R)h 2 F0#dKh+$SU 3QJBJA"@F#cF@2 FCC,!)#FPJhPF+)5йzIKhGJ#FIF tFTGW[#9F FD0^GG9F FD&V:I"F O0S @!FCH4I"F FO @$ F<(O (4) o@ao`a @(4*?:3$@@3*F F@Aqg0+K(4F 0C JhC M#7!vC !!#.,0e.!-..!00pG-OFFFF FѤ ^0+#`00CEFEF[0h[f#FBFx3*#` # 8*F!F8FBH)$J/A$*F8F')8)Jh KthhDFFI O0IH hj!F0D' `*D f4F}/.!!!!sF F p$O2O3'n) )D J+Fh F-O0I"F0FC,()2J+F&/!/0Fh F(CO3+` KhSQT"4  3EE#0!-G"]WFO "]$FFF _(O RF(RF0FC( E(Iy#3BDBCXKhKEB T I( /*S/t/-C)L h Z#3&Oh-1$N@Ish;s`+ 0F4CmO03hZ2`x0B-h"ZUi"8F `( hjJEXUFMFciSeaci+ (hca+`ę!Й!/KJhLh+##aCaKhiC@ahc@@V`0 IxO0{( Kh( !$!ę!!/!pFFx3I PO0p "FI(F(X8(+\/+#+T KvB %`f`h`F`aia`//ę!KZi !Q` Jh "b Jhr JhZP$*Yhh"D¸pGę!4!!D!Kh  K M NOh#bhR9F "h)F0F#h!ę!v (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx/-GFN-3j3hWh0hFp`(#3b(O4 F P0; +<%;+;2;;88kKh+Ёm#(qh#"2###jj [I{jZJij Aj WJjUJZO "  m@F'@(4(jpCOe+س_]гO9г_wsh @Bj'sh@Bj `PT0'9K:Hh(F(\si"Z`-q O7г@OLгO#4S3###4"Kh+RS 3RR ##4## AO@b4C()\shJjh_#  ##$ę!!,0J0f00!#0pFhF# M  ]CB FvO@JJJ pp00?K-Ah FS;IBF F FACſV(S 3 #!<|!F@*K*I/F(F F#s#84x4;+c#ؚj FKѲ3 C "Id CFI F^4*I B FR F%# FIF+ I B!F &缚!v00Xn00 S 3#F9S(BH#07F FC&p!x 0?"hF)FhF)F F0@CDFB4F (*O +0 ,08B#FA,78a,W808B+0, 8%)O4BBDF;$(D:ѓBQO0 8 (AqOF305W5Q]pPBD FDO0")2! FADq00 QГB FpDB Ґ0x+@iCO2?oEBpBu[k AaF BF* NFFF )*F FB+0:ղ-APqAq F;0ֲ . AqAqBغAֲ. Aq 0Aa;ڲ* Aq 0AAqO0Fp;D,=&BPO0 p; -O,F@pvO404W4\pPPBD FDO0")n F@Ap04IPГB Kh, I FO2`e F$$,!0-A FȀ!+LF!hi.Kih!` x-) !y'$I1 !q`!y!hO'`x!`!!q!yyC)F0FACa')F0FAC9FF Cx:+ JhBU#3` F*h;FIO4!81O1& pG hhCs"F' B FA3oBoBrF FBxm*)b*k*x*+%x+#+ F)Fpw*ѪBrjaBRBr3 FFBR*!B203DBqڸ-Cx;$I O0FI RFI+{`4 200  `HF'0+,!@F$ Fp=!@F$F(IH0FFh1|11!sFvF@JF` Fp, *30FFK"`>)F2F'#U!IHB 1KhQЂB`0 L!F H&!F H"!FHH!F bC2234-OFdFO YF@FYF F'@F8F0CF (2J;Fh 0F/#cUNF5>-O FF/! h(I0O9FF(pO JF_FM#`0 KOJ!F0F C"KhKh]Y*"JX+ FI `*56V@ hz(<S 3=%)-A yG-U]eEIM]Iaeis܀T1K(` /I 40@` +*K)Khx-*(JYx#``#$K"#K$J`#K#K#KKh+!Hu(ˀK"`#`hK"`J#`J`J`|vC!!,50Ě!|!5,& ! 5KNJKNK"E%`X؀IK(q FIDIOrE%=BK"E`7&KE>H IF'( O30&HF&(4I v#Kh5(E.K"E` ,K"Eu`*I [ջ(K"$KEe,|!5H!D!& @! 5%KT&`h(T#!(߭+h3+`+hBK"`1&!!! !$0! 5! G7 8 0.L!P/7!,Khh`pG!8KhK ILhMh8 KHh'v@#!F(F 8!L!78!vC1FF"2`,FO ?(1*(6,B/![(+̼ox"!/ F4x]-5ѧ!GBGAB;x "Jh*O0/+7`+,*1%F+kx*++9F7 x+#2F F(?-А-ѐ о]ЬEEؿ"E"D!FhDx/+5CF(@o I,O0`h1FBCD;aB8 D0(DB (py}9=9.KFh M,H,L,N-O(F F0F8F@A(:$I'"H&@CBH03H M.+ѝ@$H F.FHV0F`@BF0F%t(`O0!9:@:b:l:::::-O]|K0 EFFF @@BFh%BO9Osi#0 ")F(@Fh LcB٘E LcE𼀳hDF1h LcBҊF+MDO@F ]&*3\*-Hx1  08 B* (R*B F)D LcD\(&( F+QF3I:F hD LcBS+x La+FBF+##p Lc B+x!I[F:F Osi?QѶiE+ si0xI:FH 0x+?l?-@BYF8F%f`# I[F:FH Ld稚!;);L;b;-CFMx"JI ~,EF+xFI2Fp\+55B CF(='"AF*p8FFOcjF9F 7I3FjFS F"O802x(F+F+x38F F\+55BO  `88F F!I*FQKahr`\`@F Mg)P)S)G)8F F3xI2F+p p) s)ciCciCcaciCZhal;<;;!;-AFFFx;I O0 F I%`E`0F& K``hDh(F`Ta"<7<! K M N Oh#"i 9F "h)F0F #di!vd<1Kh*RVD,L-I h!i%A!a(F@(Ih/ah) 3FBRi4` F5#4p0 ``I Uch /"p#c`O5ch/"p#c`%h(F&V`8+\/+#+TO`#aD%*I *!4!D!<<V#F4Kh#i.hy/+di,Kh@ Kh+KhO0 h9F%( KDh+(F\(# 4 h"9F !H!4!F]KFh[y.+Cy.+уy/+˱WI(F꠹*FF2x)Z*,.*,.*  .F : . t  []0Pm.+O0I.F`!F ;0cx0;3D+Oka F;0Kx !31;+a"F ;0cxF0;3`"F ;0cxF0;3`#x !(F0cx0;3k` @0O0 #x &!0cx0;3d"SClskax0x0:"Dd3!FhFAM/hS@=Fx%Nsh[!@=up` !I )#-/\-cx#+4 F8I"F O0h@= F&whW!` F63FhB [h+ `FG% ` "!FIP!;>n>>-AFx#UI /!F#;#2FFF FعII0 (ٸ,GF#.3@I2F ?I# +x##a 3x!F0F('4I2F =/*c* C*M* #iC#am*#iC%I3F o F>#iC#a/;x8F(I:F#iC"aBr  I3F:FF FO0K `ah"FDh`Ta>>>?@??\?x?P!-CFKFFh@=&T!  FI h,#BB FDF#v,F`!? Lch !@!``( IO0`!?BK-OF^h.XX4+I84+DB0CX@Sh8F&^V!F\F LF#BBBB* i, bF( `xU'a##ca9F*@  FBI lO0!h @@B$"4+ ## 4i;a+i h0 F `!@"K-AF\hS8$*-4+);+&B0CX@0F& T!@U 5#EBiBB F+ѽ h0 FAο`!K-A\h&T4OV_]/Fi8h8F-ѴBѽ`!8Lh!LGP`8I O4 F8JKh S BB M(hK`CF&0+h Jh (hA$`!:@!e@!40s@ Lh !@ `( IO0`!@ L#h !@= `( IhO0`!@P" 07@ @B-O[NF3h+B C PO0B0C XPF0CEBCO#CFGFF(Eh+:0AP"F(@BBX"(SZN (IhxaB C`E`B0CP>BEB<i  BE""C("FBE/ X##h a` I *I  ##`!@6A Li !@=a( IO0`!lA-CNiñ%O F@Gi\Yd### hj5B`!-OF-F&KF.@=HF%X!P}+FYEHEBBЛj+0 FPF `vbH#@ FI O`!A-AFKFFFiԱ@=F%T!@jBEBBB(FO0` h F `! pGF!KMFFh{x/+ iF8I*F  MF( xFhI*F , F M@b(F `(3`## ##07Kiab`!AA`!-AMNOilcha3h cjh h:h0C #3### h{ Kh!j h h F i`!!00(0,0@)s¿@9@@!F$%FBSBO8F$D1F F%FpP%5 D-OFLM@,@ЀFLGRXk1F@FT @FL$O #hB.Фi, F(q#"#$z)_2FAFwBLU&`##0S' aC'@ 8#$V#BB &( Jh O0 2F0B&J2FAF$:(B`CXKhQBA # M& Jh  FC&JI hB6BNBnBB`!40/K-GFhF>-I0FM$ F@"V F; F(=@FF `(F```F'@@F%F(`(F1F%(0F(Fv( I O4F@F FI`!BBBF KFFh h@"T @T!h(F%~0ah:F(F$0`h`!pF%)O0BB6.1O/..O /CVTCUTBDEt01TPBD4 FD8"0!&~TO0 p #ST\UTlFF0OpB DB0[(DDK@,-A]\FO\ *F:KD.&h#BD",x/+:4JkF@   (IO0 ]KZ*, CDlD2L?,#DlF7 CDFJkF@   N |(JkF@   @ n(ڵ JkF@   2 _hC&C1C?CpFh FF*F3e-p@(e"@F$F h#(F#`3`pF  FI JCO`!aKhO`!pGOp!0#L#`C_B  hY`ah3!`!`h(̿  0O0!8F'x+"I$Jйhc!` F8Ig"FOqF(F$O4#`O4tC80zC-CNOxPF%h1F(F%xch*FI 4KJI .O09FHF%( :*IKF*FK"`C5CCD!0-AFFOq0F}(O0BB! FU%S #840K;+bK@A@A ` @[K "dFBH"F (l"F<t" !@|u??Dy`" !B`BPBPBK`PBpBK`PK`#h<SC  2)+1)90y($/(5)=#BB4#($84K*K)xh " "$T X`QBC!C#4(4C C(43y /+0qA#4#84(4CCBB($BB!X |hQBC$"猛!!-CVŰF4Z*. -%%%Jh"%TI( TI(TI(TI(,d*|I B%h+5c-wI:F@!O%9Fd"#4WO +G" D/"," #@FIF(MTbI(+ 2# A d"0#\#;+1##0BCX #Ih 0 *F BAr 0 R l DB"D< "D0!%PmB#G\G<=K COS#(xF(<#nF( @#d(#%@F #IFZF({@#)F(#JF(k@( O5(FE8TI( !(4 ++!=DfDDDDD E!E pG pGpF.xcI"0F#vFI0F%fKZhi CCI F"a"FOqF(F,BFI2F O4 FptCEE!MEE-CFFOq0F(O60FBB!(FT%jS#84Yq_@FY@B#./#DG;0K;+ٞK@I@F|IFKD @/`p "dF" ! (|BC ??P" !hB`BPBPBK`PBpB0P)K`#QH1h("tFE@Q#<1 (10("lF1<WG H 06+ 0+٣3*vHH1&g+أK*@#4BCX&ZB1(4G&CC(4*x+IJ#4(4CS(4&#4(4&CC(4#84+h;y/)+`q($4+I BBBR($O ##4F4"FFQ(K&# CCH2+($B B#($4#BB4#($84JVhK+O # #4BCXZB1G& I JK+ F I+ J I %V猛!!E!EEEE-OW}F4+*+&FV;c+<ݷJRh+ d;3DxF3*/*ѫ+cI2F;+Hr + K#1# +7L#0-K jSBH<#H<F0 BAr05YR "BD< "D0!%t8T I( +O 7#0#0BCXSBIhH0  BAr05YR8!FFFFFtC.GFGGRK19<#F(TKH @#(TEHDKO  C% S #sF(T:H!<J!ܰF@TIFYF "F  "AFYF 5Oq)F(#=F(T HOq(O5" !(pj@4 +?+1ji3jU(ZBXSBp(,=M3G!7G=G0]F FBB!hF% S@B I 3`#p K - B"ZbZb,"hhF2b ]0<!8F$oFI"F )F F8@DG-AFx-+Cx+5I0F F%h8I2FF dO07o3F:FAF T F((FF(KB(F FM'ZGmGL h82 h!@pG!pL,FO0p KZh*!F(& !(F.U (p0F稛!3S[K"`KhKhCL#h+I ##`KI Hh )F HI 0@pGܚ!!!!!G8!H?~IM(`PI Fh` 8(h F? Kh+ JIO0\"!@!G s FSkK"`KhKhCM+h+I #+`KIHh H1Fv, F4IF H I rp@pGܚ!!!!@!GG0IFH h G̰H"PF8x/+$IdI F^عiF F?0H&?0&BB*BB$ FLVG<Jh3`pG!IFH  jG-AF>OFF|hBF(?((BB ,BB*pCO$#`F F>(#" F"P V86OR0F$z}>F F>(#" F"zPOR!0F$zz>* F>F(v#" F"ZPlOR9F0F$zt> F>nF(V#" F":PLNOR9F$t{n> F>N(7#" F"P-y/yx> F>N04_1Fz FOFOW:FFO >B j Fb_1Fz FOFOW:FFO >Bj Fe_1Fz FOFOW:FFO >B֮j Fk_1F{ FOFOW:FFO >BN:F0F(k Fi%pQ5_ѷ_1Fy F=FF*FO >RB}i /Fc!IFH  DH hhQhXh?ºpFh4h`h%Fp(Fp N3h33`#h+`qhn Fk3h;3`+Kh+T!!FL%N#h3#`0Fhs56'-#h;#`SKh;@49F!؛!!p$ N%F0Fh+46',(FpZhx5F؛!-G/N3h33`Fi#FF*HP+:1')ѫB &HWh?xD# 3h3h;3`# Kh K")F F"pp&O 'E FGsV?@FYh z3hh eCh;C`+ hY`  phZ`!؛!U!A &U2F /2'!#~HD؛!FF.h$ qh8F#ZF(F(F F5F8 M(F F`D M+hh`+h3+`Ca, $ F80U!-AFF8FM+h3+`F F8F#```@F3h#`+h;`4`+`3KhA*!!pFFhTah(F#8&h$ Fp$hF!h(-G F@%(F=!  F`HFF`IJF% TIF8F  z0hCh;C`+ 2hhY` "phZ`#HF;mO%N2U&U22-CKMNhI+hF+P7@" F#Kxr\ Z[x\ёH#F +`\ЈK'FhK`?\> p2F!F"0 /`/*k* *zHF% a &( \  U;E3' a x=+D 0 F" ?*9*٢:(R 7|*/~*V^*z h2 `$;"q  F F     bxF=*7>* )`*bxF<*=*/ bxF|*F Lcxa&+ F Ecxa=+! F > cx++4' 6cx-+4( 0) .& ,# *$ (F %F "!FF h!BN!!HU|!UFKHhx!UKs[hM.h+` FK.`0FH"xK*F$"` F"F F$hx$h3IxJR\ HL3(F!Fpx!!1UUBNU8FFF#- _iXfm {6E'.2~ t=HR;HO(ѳ??6H ,#FF8#CC3DAa?  @ !CC@?   XA@XCABq BA !BABqBB  BB @@P@Y@CCV!V2V-OFFx %*F F-U G9F. &*FH##F ;FG1FFPFUMFF F(F!F?Vx!"K𵍰#FF#q,F F;F2FF F(F!F (Р +Z9FF F/. TF F F FJ!Tn" rx!8 FMh)+8'!Fx!-OFFFFO O ,q,{,8,;\H,##FLFF$,y",1FHF0#+F F NH7'+عqJH  !D EE'+#.ѹ'OO2"FE&3J8h" 8hF F##FkK F#%#3F9FFHFeP $$##y3F9FFHFSCCn.', JO4$&F$F!E"wVNV\Vx!-OFFFF8##F1+FF F @ F F2  E%"FcF@F FE20F:FCFF F) EFF&FFF--x!H-CFFNh+F F#F Fh+##FU9F HCFFHFU P%%$(F!F5Fx!-CFFP0+F F##FU1FHCFF8F(C!CPO%%(F!Fx!𵇰NF F FaL! CxI+уxN+ F'70 !(a4`aT!hF F#H0(F!Fx!V(-GP(Mh7(L 'K & hh0*x  0;Jp0+k +0+xF;F=FNK+{#hFK(FhFF F H F TU  ,M11!V! Jh@F#F/))`!`!F̰ Lx/+HiF>0& F>0&BB*BB  pFOu(F)FF H FKX` Fp@ּ F#h"+mF#h*FHHp!VpF Nrhr Kha H` dF (F]p`p Fp@!x0V-OFK}MkhchzL #h3#`kh`#k`#h;#`#sKh lh\h"pH XihoH" S lH!F F8FiN" 09F(`jdK@h3`;x/+oh;F7x*Q0KFBF!FF!`h+!\h+!Vh8F*~"!(FZ`$h3I"FF ! -AF F*sL$>Kh3"1FhF$Fah5H 8F A2H 2H )0H1F z.Lk hCh;C`+B P"hhY`*"p hCh;C`+8 B"hhY` "p4H H1F -M`h+h3+` FhF+h;+`#Kh H  }HH1FhZ`hZ`!Z2Z;Z 2DZ!!NZTZXZ8FL h0*xxB%+`h8)F (4S8FL h@x+xB)F `h84LS K"0%h IQ;:0(,۝rh0!-CFL%dd#h3#` 0ChBh;`8h(5|-#h;#`k KhSCd+0F!!!0-CF KO5Bt&h3xF+B:*4F:)тtzN3h+j5` F5`F4F%*i9FHF(5F<:+6k$!0wZ-A&MX+h3+` 0+#h`h;`  F00 K(F#h;#`#Kh e0!1!!@0+@h d -O&|F5F4F@FpP9h xc+E"CЂH^p(v(V($&%zHM4 h*@ՀvHvJc+FuH= F Z! FFH.@1F F'F( Bh *R #xB!FXF (-tYH ]'-6WH W !@TH$ M8F u0hsNL hCh;C`+ "hhY` "p0 h,@FAH,F $\FhZ`/! FH0"!FP) E1I)J1HF )8F %,Jh! F;((H !Fչ hgF#H-"H|-!Hx- Ht H OO~OOC" FO DKh3Z [Z-[B[W[e[2u[Z{[![[[[[vZ!0K-OF\MF0F(hYNlTO,:Њ,؀,:,/ ,%/,/3h;3`+TK +Q#MMMMMMMMMkM@F 0 *4N4hl93h33`px3/H F(:$,O FK#pLj' 0 ;+۲ + 3h;3`++hZ*`3h;3`+ +hZ*`C+`C+`!!11FP-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`'3h;3`+;h+"#caFh[aaNOcihHhBȿ`XhB"3h33`ci3h;3`+;h+焝!!!!7Fx F!+$Kh0 0@+*+ Khh(=;S(x* 0; + n# "` FF dh{x =+ \ Kh-x+ KhBۛhDKh 5 h+ 0 Fл 6. ">9)H+. *ZF qBQF H!FO h2#&rDCJ :* Ҳ * : "+ : ` "F焝!!!Ȝ!!FP1 1EK-OF[i FK G`kh`h`>KF&ZhVh0 0;DE #x+ D`F xɲ)K `(F~&)AO 0iD`lh `h`aTF E#x+$Ё+@F  F0H蠹 F@Fp HLEF(TFF &F焝!!\l!H2 M L Nhhha#hh3#`#ho`;#`+3h+焝!!!8F0)FFH KjD``b8!) FOF";F;#9F`F0FFih`hH(4`&F#hC%`2F6hF#FF5`.F+h+,`F! ȿh1-O' FFFF[غ*Zк?Lк"#xЁ+4#xSE 4[) غ\#xЁ+4"xCx' x۲+E #x+ cx;@& 4#x+ #xЁ+4Bx#xRКB4#xЁ+4;Cx+*+Ё+xҲ*?+[+'FF0F?*@bxB44"xBBx!*^*Dуx-)?s])!*^*5у""x*и/Ё*-bO x+xɲ)@*?P[*FX:) WI(Fx%(FK -x[!FL3F3F"BZx*њx*ШB*xGIR\ B EOҎF()x)5B)x4J 5E>rFF*\*FF+x-+5kx]+2Ё+.\+,5+#1(##(ؿO +F+]*dZE?F45BO F;x+?֮7NFFpFx3ɲ )F &x9p,XpxT-ً)p+F"F)F+pFF$M$N`hF;;+j`h`,b$h*+?+[+3h/j33`kjKoO`hbahhjhjk#kb3h;3`# Kh T+jB"`8h8`Fh(+b!!!8FM8+j`h`x,b$h!-CFF x F1۲ +ؼB4! FO #F&xV*F !F4FU*ѽxb(ي.5F..FB"x`   =* ЂB MB*FF !F+D%"F1FBN-Gvtv F FO#00F ! v 6F0и/ N F-#<=O3h;3`+K&! *-OF#xF-+F +٣! *|K[?+v@+0; +m# "` FpFh+^x =+Y,@Kh>/;NMLx+EЛ] ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xppK&pMԡhBK yc0eO;0+;hZ:`"yp6bK^Lh!h' `^K^K^K}C;`#yp@/UKhOJ!bh,KLW;+x+1#hGM;#`++hZ*`"p#h;#`++hZ*`"p;h+#h;M;#`+d+hZ*`"p:C+`#p3C+`#p-M=x+0 ;+ #h;#`++hZ*`"p#h;#`+S+hY)`xpC+`#pZB*`xp#h;#`+ S+hY)`xpx+ћZB*`xpC+`#pm簥!FP!!JJ!!!01KMLZhVhK3KY;+?$ /0x;0+?𒀗ЃK0 ;+ +h;+`+t#hZ"`"p+h;+`+q#hZ"` 0 ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xpYC#`#pRZB"`xp 3۲ + +h;+`+#hZ"`+h;+`+S#hY!`xpx+ц%C#`ZB"`xpO C#`#p C#`RA*N/Kx+?G+h;+`+#hZ"`p<C#`p6_,KhBZhD00B s;?;h<`0;0+ c;`##p;h;;`030?C;`#p焝!1 1!-CFLFxOh!p'ha0ga#`Kh00;0B#hZ"`p0 h"1F"Fc FC#`p!11!-AF-LFA,H hCh;C`+&c"hhY`&O"pB"HAF hCh;C`+L"hhY`&O"pB hZ`W&6hDhZ`W& hCh;C`+ #"hhY`6hZ`2mBH\H\KhpGhB`0 Kh) Khj3c1 i@ pGh(h pG pG!0Kh2`Zh:Z`pG!-AFMFlF+h3+`0j  0j`bKZhB`h`h$hB`g+h;+`KKh3A$!!!0K-AhN,j3h'i33`@F`D< + +KhiCah#`K$5bhZ`h`h`#hEob#``O02 i+u#h;#`+chZb`xh+3hh#+BF!@F8S"!@F8(8FX3h"`Za2hahSi D!c`FQa1h Ji@ (&!J,+2Ja!h:`*ch;#`+#+p#.x+pK03`h#Kh.pahi!`!F)o0!2 2>\12 L#h;#`+chZb`x<#h;#`+ڽ@1!8 L J#hh`hRhaabhZ`#h`O3 ``#3a0!FLFI#h3#`"!(F8@N3hh(7hi`#O`aa K"``#s`#h;#`3Kh@ !qo0!!F.N!F3h33`8*H)F8툻pCO+#" FP"" F8(F I( F8H)F#" F#P F8H)F F^B8 H9Fn3h;3`# Kh +!^[\`\}\\!FLF#h3#` , O(F}` K^`#h;#`8``3Kh@t!!0!pNM4h+hh3+`(Lif#j˹#h F3`_3h Jh`i`i[hQ`s`+h;+`KKh3p@>p0!!!KhpG0pFNM3hB ЫBѬBHHp0!\8ML+hB80!8FPM+hh(+h`80KhB`pG0$Jh$LcC#LehB %2FE ݖF2R|B 5 b`) )$O30 bhU%b)Ldp/0"Fbhc` !5rO0FRMhB QKhQL(g hCyNH!8 `0'8FP7/GHGK"N 8F80 `0 hAI `E h(`8hB! ! ! 5O! 89hB 80hD"F*H 9h hP0;h5"F$HR8hB 0F8\0h!"Fh h.0h"F h! O3#`! ! `~!!0\\1Yu!\!]F0+fH2K2Hha2LaC10N% !Ow3h33`B 0B(%K(Hha%LaC103[h? ѻB5!0Vh(ЇFH OpO5'; 3h;3`Kh@Qh сBU`p2!I]5rO!]p]!8FM+hB+`Їc@! Fa+h;+`3Kh8@B8!!-OFFF 0hI FO˼ؐQB0+-і0+k0Fݪ IFPhShBE_  ++ +E 9Ѐ F0#00CE@qKrHhrKr@hZCBG'B "-"gJ!yFh bJ !0XFiXFD  Q^YIXFLO !FDch;c`+ F#h7/"`!F|պch;c`+ F#hZ"` "pch;c`+ Fy#hZ"`|"pch;c`+ Fl#hFZ"` "p^+" ".J!O#(J!XF&J!XF(OsB 7 "YF 0~XFbDH@qYF F :7?# 0GF!05rO]] ]]]]0Fp@ӹ ; CCDXh PU4mh-(FB! p$& F+OrB 0-OFFGKHH[h x%+d XFXFCAH+&@JQhB"h"D0۱ Fkx+Ъx:-+++%+3K $i ,,HO)F'KZhSD(K!(Hh3000+ kxp?+QF8FL4F69FXF8(h((F&9KC;Ԕ Z) "R,B4HH$0]]!] ^-G/N0H03ic.M/O+h!hP0F#+H+H!1h OA%H2O yC10CE!Ch;C`+# hY` "pz F+hh"[h*`+ PF 1[hZ`!!5rO,^^N^]2-A'@L=F>F F0s;D+;Hj(p(g(&'%5Khh[h 3H!Fh0KhD/ILCa.H%(FF&y)H-:0;! KC#HX5F# sC8F6XCh;C`+K0 hB̿ # #P`p0B0hB̿ # #Q` O.F(V^Z^!^!5rO^I2KFiH!H@dB F!]JiH#;pG2 pG pG!-GFOM+i+F>\#+a@F;@HN3h33`(VOhp(`C"! FO>D"F82?d3k`3h;3`#8Kh 5N! F3h33`Os02K0+#0#63h0/H xC3h;3`##Kh l F0 F40O QFFr#F"EPFW,`2B03!B *4p@!!!1F?JFFh`=K>J` F F7 :K`/h..8KN0+A0˹7F)F 7:1K)Fh0h@BF*H0h!F }!F y!K60s!F q!F m!F i/K"a.!F !F 0+F(7 H)F7( I H.爣!!!!10!]^^ FF JN js0+ ""BO07"F1-OFF #`jL@FCFwh+#h+(F00! O2OqBؾ 3BЀ0!F0S?ЪE ?  ъEy?  E"3@D@O4O\` 0`FO"4P"90C09($0300F0!#B{00Kh+K60+""Bѹ*{K!Fhv0;0+N Kh+?IEEEє!!12!!!"-GF F F " F(.KN04,N0hF7~B4h7xF F0he@j"F HO| &@0BڽO0C0C0 F64Д0ոД0#0*F!F8F10!]!$!M(F>` M,+hhё xH l(p(Z($$$ K6 "0 D@N+h!7hh8"FF8F+h*`[h+0h!FC^! 12-O$NOF0FFPFF FH!Fn-p-H`oCBH>`, D4C hp$d5UFF-8F ApG, 4S l)F@FDh(F,FH`-ON$M #C0FF0Kh3hHp/r/d/+hx,h#< F7c!HKXO LF(FSJ h"`%"  6x(F@𲀝\)(\+C F6d(@𠀝 *Н)и"h:"`*HPFFsJ%h B)>(gH8(@𹀝%ph"h"h:"`*#PFF-Ѹ"h:"`*PFF F + F + F +xDI0hF:"`*PF0[=J6O h"`Z|rw#h3#`p3K"0hhb" '+L%h=a"h2"`Fp(L :$MO "hJDE#H"FA!h"0h<LV8F " ((F "!F-L%Cf`!!l`o\l!11|J-A&yL FF(@0306rF6p0;0#mKh RkKhh-|.u^r#5F0"5kDw" ,c5kDx" , O <^r#03F3jDw!"3jDx!3ekDOHF,\r# 06kDw",6kDx",LH,FKNKILL#h3y@F#y\ IF74/CL hCh;C`+i"hhY`>N$>O "p)h9y@F*2F:F45,ѽhZ`2H,N1O܀yyB*h\@F45,%L hCh;C`+ ,"hhY` "p*y8F\hZ`)IhF F4y3,ѻ $&U6A8F !F0FC6.K:F H]1bbjO2fCbbbbbbbbb KF $yBѽ@0(KHY\1bb8Fych=U h8@𜼄8-AF T 0F0+р<FFT_e L=` F##qe(FG 琥!-AF1N#sàih*MFa-) Qx)=-)ђx*@% +)2гa8Mc(D (o(;xC,8F)F!)Dih@,a)F!)D)F FKHY]?)FZ%$ K@@,[h+ѽAr!b c1!-A(PMȿ OLFO ȿaOؿa3+q sih#ci#06ѕp/ `@F@6p0+6060+ЕN0F +60N0*3h#b+x-+#F0%K"y23)*ѕ0ai!i#Hi2hM*`ha bw#j+`ci+"ibq "h`FFh32%`aAh*!Zh*3"ba 1!c!(-CHk HhHFM+hBH$OFh+`:hF2:`իh$t;T+C/*;h`;;`# Kh  +y  -c!>c!!(F#@FF/ L #h3#`@ Kih V#h;#`#Kh !!!x0; + "!(K"Xq`!-OFF8F x+A1h) hc4h%?' $F4`3NJ ![OrJHUp':FpCHFJT}7`p8 [x-*\xZ,11`Yx-)ћx+xFxB :+T3hRxh*;,;ѐ:1"F,H@pFx:+"F$H@pFO? %WF#F5`I:FH!FH\xY:, 3 FI:FEѣF33`YFH"O F5h %3n I"HF%(FcTc[c 2oc( F H K( Yyh)!`aYqK;c!!pF Lcj xIi h px-(Xx(aXx-(јx(К3FxBRxF:*[xiah Ha( HVxP:. 2Fb%eb!ccp L M#hk+p+h&;+`+k"hk;c1!BhF"h,n#FZh:Z`F$hD`8FEhkC`+݈ #CCh"bZځ"h`8F !"Jhij`$1F;  pGxɲ)ف+тF3۲ + pGxFI[\pG\?+ pGBNxFI[\pG@ \=( pGBNFKHhk1dpF FFa(Fh(FKhB`KhB`p+x-+kxO3`HKhkkt a瀢!|!d1-OgMF+h?F:xaH`K`J`Nhh2`+rѹ?:xr*3h;3`+O FRKkhRK(hha\D*2`5 FF (F82h:2`*- FF+h3+`?F2h:+*_2` FF +h3+`?FєFF2h:FF ЈE-BFFYB ()h1)`h`C ( Q (p+h3+`Khh`g"@F *^^0J11!1KF Fhi *ўi0F3F (JJ"!hFjhFhDmJ+F!`hF K Jj,KJ#j1dddJdd𵇰F F1Kh*F! F=KhBFOC-%y>(1##`00F`\b0 a)(F(0 Fbb00Fa0 (FPF|(#&(###`(8%u<(>(#&(###'#` `0 (j\`a0j-("``M##FC#*h{( 2)I \(F*`"+!J{+Oh*h2*`pM#(Fz}(FAJ\L8D$h4@ [1}( F '#DOfJR+fFf1!|!BNh1H"F0Dpp9F'F}J\2*hܲ:*`*(KuJ\F*hO= :*`*JDF/@%+:+G#+IO2F'F0 )*hܲ:*`* KO/FР0 *F *h :*`07F0FLHOF%'F,F@F (РshZ  G+9KG@HhT?`0FChFډځON+IZ`HOB /}+"HF''(shhKBш#*`0F0jIChFF`"Z$#*`0\*hF:*`""Zp0FR J!ChF`"ف缥!BNRf1JRcfFPDOK-G0h $i4&F0h *h4D`h3 b0 khhZBZAF F(kh`Fh+0"F!i"QFI0ij``1HQ+(OK0߰h!KKP0 GK h  C BK h #(P8K:M$!F`7K`+`d|"F4I*hj; )3,I)Mi!   2$KF$Kh K`K K`K`+F_0K`K } K` K`Kh+!L# u K K!1!1HQ1!f-GM"+ha#i (%*hSi3Saa(v"dd|+h[j;` O F F`` `$( +hi*  +h F Fp` `" Zi2Za f+hi+ # #F` `` ` (+hjiXH @ #`F+hik`a+hi *j*NIi(+ '#`IK`#`C`+hkai``:*Zi2Za+hky0` (!1`c`+hiZ* nF+ +h"a(( ! & K`0F[& *h #`Fkk` +hk:``/.h3i +Ii<IO0O H+hi*" "ak #FJ;F+hi+.+hi * ! 1fg71k+hF( +hi*! vk 3a+h"`a(Р +! b ( #3`+h &SF` #```! |+ha (1*hSi3Sa#;`+#h+ 0#4F` K0F ( +*h8FSi3SaF F+h[j;`1-AF=MO$+h+h (kU8`F+hi(Oi *\j4`&*. B+J&O +hh:h0FZc>!Hz0Fh/!@FH*h##`;hk#a+h``^c FZi2Za)O0uO #`F+h`k`a10ff-A%"&L0a(< Si3SaF( \"#F# TF`F` &FMFe``4`(>F##` Si3SaM 6VF0F0H51f18!M*hQaa` +h$`(*h Si3Sah+hh+hiHH8 F1f"F[pGChBhKFhpGCh hhBpGh!pF FFch```epsFhF3&(H4i FF F!F(2np!"FF(2`! ! !F! !F 1i*F F3nYKXh8 pG! FF:)]KO3 FF]K3TBpF FF2!F(F3B h(F20F!FFH(F2 Fpg-AFDhF Ol`{h;{`.h(F2 FDF!p! N L5h#h(F3#`+h(F3`#h;#`3Khp@p!!! KpFhp-)F F$hfh.аh(26h!J$h +ܿ3`h@ ,!bF2(2K2Kb , $`d2gfff!pFNh +JhBh ! F2X۬B F2b(Fph+ h +"! F%F2>h+!!8F F`(KEh``8! KFS 0hhB` F@3FF!JFhpGhBh!-CFOhFF;h -;`ܿ#KUh;+ҀB}71FHF2 qK$`~!FhrIFFmHN"!2!  F2-dK0+𧀬Bq"iOr@!0F2ZKV0+5i!0F2CFOr@!iF3~06h F20`HK"`*!h1FFEHpCO F2#`&iOr@aiOr@ !h.;0FN0F@ H*F1FF0Hd - .0s# 0;h;;`#(Kh '')F0F ""(hh*F!FF(F2.FW# F"! F2B")F F(h F20F)FFH*!!ZG1Uhh!,hpF F FHXO0p !FFH! F2AF-ph! F2BF -bh!FFHH@H@jhhp-OFFFCFD#O"I2F8h%!J!K"N-FF3h8h[%I"F8hIO hB BFYFhC8hIF EFQF,h+$ 6-$2hKhNhh^Q8 !MFh28C Ѫh*b ! F2.E8 !R F2&A " ! F2B" ! F2CH+!h8F KhhBphFhBch)FGh2`8!-OF F C 0 #C`FjKh`` 0eKeJ`0dKbJ`h0B^KhB`+h F;+hB FF8 !FFRH! F2(:hFH FIB F2 Fso+jph!F(d0300 +6K! FhBF22Z?F5h* * *.h?!FF(H ! F2< h+ "! F2. "!PF2&h+(RF!F0F0;0#Kh $030:F(Fmh2!2422|!hh!!!-O&JMFhO F;++-+jH 8FF1cH9F  B8Fb`)hp9C)` TI" F#JF!4+hBOL h`#hX}.r!(FzwFXHy' "O2XQG* " #"B$!(F2<0h,)FF0HO2"!(F2(0h)FF'H4#F!(FmX{/8FF8FF0;x0+x+8F<(0BKhBH9FE,JFԿ##Ha |, Mk &&hh"ii2iki|!Giii!KF F)] h;+Y/O)TZChֲ;C`+#hZ"`p+hlx<+ѫh+h!Fl+h+;+(i!F>+ѫh+Ъh FI+H!FH!F h* ch;c`+ Ft#hZ"`-"pI F FKli8FK,hh hrJhB1+K"``8*Qh)Qh x),!" D" K60+,KhK`!!!1FP0J#FH !lHH !j-AFYCh;C`+#hZ"` "pO%L &(F9FF Fk -?-!F@F#5@-ѽch;c`+ F#hZ"`p N@&M'L+h3+`#h3#hx h'`> K`+h;+`3Kh@!!!! KhXshh x)2BpG pG pG!FONF3h+L[h+Gx+%%HKh+J/H-F,U9,E,P3)cjF FH0[+K-_YBYA F0N&DR-! F@<#>,33G#`"iF 12%$+%KN0+%,% K6 zJhb0+%K60+%%FKN *, Ф* ٓ603)ЩB! Ib #R<CBL!!1!(-OFF%їIhuhI(F(I(F~(Okx<p+ OO,EѸ@𞀊H%(@thI F^F(@HK!h(F,F~N{h3h33`xhs!y` F3h;3`#uKh X4@,#0OfI8h&F(@4F,@odN$dO%FZh[hx`H(F4-F8F ,[H$5@-WHVO$lkh{khxc8Fhh FF@F4@,%,?eO$%F@N@O --[h>He(F4F8F ,@F$W5@-,1HOF+Kh 8h(@>h3x-+sx+&,?!7O$IHFF(HFF(@K:hIh=%xDH0CH FFH#"j&jn*jZAj2!!!PPjNjj"2jj> ,,.0300FF O ZhXhMD`! F0;0%Kh.?3?]&?%W?HFI(?dHFF?,?lиO kD0+ H I FF(?z$?(;!vj!!-CFK"`L?'N\#h#hx3h33`kYBYAZ3h;3`#0 ?-ѽC!!!!pF LF#2 2,D2;+!(F#2p!KXmh+(x+ pG pG!-C' L N131#rQ3@+1;1qUh-hFX2(FAFF(FL+hF!!K@ 8 !*pG!8F M\2B ! ! ! \B8!˰#FK`"b!*5X"*12d">K>Jd2`C v :K `j nر6J h3`fF81K ` F1*Kd1(Kh&K%N &K5h`-th,#x+1)F Fu``$;+   1! F"""b>*J#`" 1J1!F1P "@S  CC !!!!"K _!8F Id'!F FH `]8 8BOrOA HL8 M Lh#h3#` H#`k`#h;#`3Kh8@.82!!-AFFFFO- *F1F8F1- FD `h+O0hFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+` hc`` `+h;+`+Kh+3 Mh+hq`F3+`hc``0D `|!!!8E F?C K[iB F8@ch;c`+ F#h*xY!`p82Kiܿ2KYiֿ2FH!FljR]pGKRi]pG2 Osp FFR& ;+@p0Bd#<p@pG-G F'!F8sx+[I0FH3\ch;c`+ F#h!F0FZ"`""pXch;c`+ F#hZ"`""p3x[HI0F7\0FvF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0FF(ch;c`+ Fz#hZ"`'=FkHL2KYi52L FF@@2Fxr+ HH[k>kh-Ah h"xh3xB.K=! FhKh0=!F0F?B#'F4F.F<+#x;/0;0 =*+O ,pX.` F=+@`&F$h!!IKFy F!XDiF0FF(nChZ `0F#a!;Hg`W0F@5O:h2:`iJsq Ch00DGkh`Ѩh*ikh2R"*a L#c#ak`Bkh#k`Kih H$B$TDFB0 ,;h;;`#Kh E $ T5Fh``1k!!! FF=!F 2FH7ܹE8FFFX:*="p"Zp!F%`8F7 FD;<FkKǰh#@#K`G]K`笜!81.L0`F KH-F0 I"#`0 KBF8@H!kk4_b(O!0> h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp", ] 琥!!!1x!kpF MF+h3+`T+h;+`sKh[p@`h1Fc$hp!!7M,hLHHh `#;0>0h xhh"``kh#0Cc`h#a`5L!k%O~ch"h2`Ԡh5ch F/4h,5-ѽ@[ՠhlch#@c``&F!"FF BhiC՘G(h3DhFKFh(F"F!FFرCh2CiՐGph4D gh)F8Fn0=!8FD F$hh̜!-GO hDF>N+xr+ ''0F`9KhhؐܠKn(p(Ѹ$ /(FZO$*Khh-#"F9F(FG!(F0nk\=+ 6&H Ch#C`:F1F(FCh*FPF$.Ch;CC`0 h- F.(F;(H)Fg[!lkF"FF$ FChY*5M)h1)`r#c`,h<,`,Kh+ 1 D[xI8F^ch#c`chCb`ћԠh"h F`$縜!!|J-ANO|@ #heh0m:h@Fhh Fh+Ѩh!#i;@hh0DGkhԨhhk`h`#i+a!11-AOMGFFF(FF`VK'h=U Fv, e, f,&x,O''OGFC/(hAF0Cl!(ܽ@(H|" "l-CFL FH030|;x-+F|xEM(hr*hDIJ0t`3`0`;0#OV %*pHFF(@1h\H^O?@FGs*њx*JНVI(FF((FF(3hB(Fx/+GJ#xh320Z FV(Fȿ- F'h(FN0(F|F :I*F 9H# 7K!h4HQhx+J$y"` "HFEF)&Ix*ѱOBoBB?IHJFsh*!F(F/*0 IXF2hO?QF,,V!(F/Ph"j2nUmv2nAnmXn0n"K#J"v!Kh0=!(F("!(F!!r' oH2o6!c4_bo:o!_8Kh+J#`J`hLKJ`"Zaa`%he KJL`hKJ`~s`8簜!!!!ȥ!122422 28 K$`;-KO2`K`KS[L(F #h3#`MJ@#! (;#h;#`# Kh 8@ۿL!0!1!,!!0pG8F F8+h)F`h3+`$hpF&N F,G#h*h6 D*`+?!!!!!!&!!!&&++;;;;;88;;66h)Fhh)Fp@ȿhkh3Dk`h)Fh)Fh)Fhkh3Dk`dh i)Fh)FpTFHh;FOK,J`pFF@h1J h2 *D `+2 22222622$044<ѽB1H9FK"aHK/F"a\$8F4pa$-W;DA-7;0;$ $ $ $ $ $$/Fohco!HoF+O FF xh\(4Gbxc*%JiCsa0*b xF3<7)ؓB0AFM*ѣx-+x4@G^+ F;?+@C^* ` 2FFh!KIhKh!o2-AFF L@- H9F%##a9F H2F&D,D j#H3u#t!o0!F xRB H!F H K"ah"(~0!FFHoo!Jshhܱ3`&2F` FF FH!F0Fp(F F!pOhh-$&F F1F3`+x"+'+ lx&,Ыx+ H)Ft#;a"`(F@FF(F!o-O#N(-F F3aKhS#S`h%!船J!F(F0їKhm-# =4#FOS+2`0,FkFhBh+ѯ\. F "MF(hCh;C`+ *hhY`$ p%FhZ`%.kx%+ѬqM(hCh;C`+j*hhY`phZ`jI FD#\*+F0.+"ј0*+FZH)F@FXIO6DUI FO40xOعWعBSع%APEH)FX +R#[[[[[[[[[[[[[[[[[[[[E+ػhh) x"+'+@qЋx#H+#;a [0ryco"F1F(F(!20p8pXIVpoFxm~iPF0}hxe(cFO\ O^ rOs0cc"F1F(Fa((+PR,(.&*'(\("(ЙI  h FA2JՌFe cFf n r t v A M" ( O?Zp(@@Xp-"pa b 1F(FDF0;ihqL h"h0@΀#lI Sf!F(FDFm~mO X~_I"PF\:hP}e(x!pOs a2FMH#F)F0mPFII"`hGH2F)FBHb"FF)F=Hhhx3`s`?vFuFaFQ(FIFs e#1F"FZ1FVa!FO# `hhh `h[[RF[F1F(F2fRF[F!F(F(N.B,  Ki p HmRh2Wt! !lp hh/h"-C8OFF #6I  FP #1I " F(?+h*`_h'+HAF"ehu&I8Fz85D#5<"I+! "8F(FHBFHBF!xHAFch3DH b^5D {x?+-+H0#H |p`quuuuv)vFI I vvChsFhhhHpMN)hq FF F)FF Hp@/kh0F 5#D|Vv|pvw-OFF:!F4344IFFx=!F F#;QF(FVc 4I F(a`+i-I F;`*I F(HAF(F,{bl"I F(7`o1I F|{`I Ft AF(Fb 61h) x[E Fb(sh;+AF(Fsh;Dt3h+шNw%w,w2w|pqwI#K0#M0#P0Cl# CCCdk#cc#bpGj#ACBrcc#bpG"r#clBl`3CCdB3cK@CcCCd#c#bpG$@ hh/`#dBj80]F@k##cfF@k##cdFjhK#I/#b#`t"pFFH.! H~\cc d`d Be f 8,".F(F..#bpKBF@kF80#bF@ktF8#bf dH/Y:w808@FH/LCj =kBRBckBcBl"rBbBd"bpGjF@"80#l#SC@s#d#b I/H(I ]tAwI /6(I nt JwI /&(I ot Twh"phF F+x-+5 ##bKI # RȱhԢj* H)F&3h2`[hccH)FCh FG p q]wuFFFF1h9.x-.59hyF(F8h#h##`rhC 6(F@-."h{h" #`78 FhJh@(F b8J8(F$( JD(FT(J<(F<(rs4t8u8FL#h# &##`e`8|!pFL&h6FahH `pDH. H H)F0H)F#hD#`|!; PP) F2Bh:*J!HH JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJH!|!u-OFFFF@F0F)FBFH ,Fٹ HDЅHAFD'H9FD HhM,s i+𸁺j /@)-o6?H-QjW+`ir){]H5h,s{jYzw+k(񐁻i񞁺𩁹𮁸@/k/ʁ?Huh,с(Ձ؁/i2Hh,cP+T@s\N+QQ%K_G0F,GD/O/Rh[dmv,@HiLO%h-@t(F`7H zzzzzzzzUz{|p{zH+8F,@𮀿H<,@𦀻H2,쮸@𞀷H(,段K0F,ݮK0F,ԮH8D ,ЮK0F,ǮK@0F,K 0F,K0F,H-8,K0F,K0F,K_0F,K0F,}Ko0FzyHHyHPyHXyH`yJ 0F,{+trHx,vpK@0Fl,mkK0F`,dUdHW,_bKo0FK,VB\HB,Q;XH9,LVH@D2,ISH+,EQK0F,E H Ki! "CF\h"+I FS!c H KXi! "CF:h"+I F炆!Fh Fx;H)FK #`.O6/!8x/)O0:nSCF0zm30@2D#`H)F!!"-GFjIkH~뢈iH*hKiIiI<#pjfIaHljdI_Hf"kcI\HbkaIZH\bk`IWHX#akJCB\J\IRHL[JH0aoYIMHBVJJ0+VIHH:RJL0#SIDH2NJN0#PI@H*JJ#m#MI=H"FJcmKI9H8OO,0E 1I /HG.$U<+Na9FHFU  Ȫ!-O$NI @F( iB9H)Fi0*0 ( 1I@FX("/H:.I@FN"+H+I@FDFO3F  2BF!H)F3eI@F(F(?O3F ( se!ӊ;׊ߊfȪ!?NԏЪ!Ț!kxqv'I@FF`O3F |( 3fpI@FF`O3F i( e]I@FFhO3F V(y eIxI@F wI@Fp"O3F =(` sf0nI@Fx"OsF )(L p0dI@FxFpOsF (7 r0[I@FdFpOsF (" t0QI@FNFpOsF ( v0HI@F:FhO3F ( g?I@F&FhO3F ( ga+ؘ0+0HBF)F^iB-HBF)F/+H#BF)F)FX  [E,?)F K E?IHF  0H)F"4HB  "1F RF8H(Fp6 I(F K"1F(F S$4"B{y Ռ9Kh@-#`O0l28F&L5+H!F!F Xj;I Fjj9I Fd*k8I F`k6I FZjk5I FVk3I FPH 1I FJJ /I FDL -I F>N +I F8*m*I F4jm(I F.!F'H8l!R99F\!O`5V+9F FB!FH F@,*4/;EQ^epu~Λݛ *Jr~ά-OOFX Fa+cЉk)`,[PF<PFYF6FYF@! ` FcJjhkF jFFFPFFUJ@!XFSI:F F~*{ F!*NKOIOInr+{;ڲ*k+iMhMhhbhMhhWhhhhMkh:FCISFBKhk{11?I FNk)_hh;IF FBhhkBA!F+ |khhKDX D1IB F,X 0hhDkB2!F+ c*H!F)O,Ƹ뉪hk{11#Ih Fk{11 IhI FJIk~!F* !F kt)!F* !F )O+ÿ)Ʋǜ؜F FF & I H!F0B F@,˸2F;F)F F6(pG@pG8Fh`Ȉ؀R[B@[(R[B@[шj\\pbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXemeT BE pR uBD 3l#J1C 1 f# 1 `# Q XC Q Rh"C B8Q 2BC Q #T###QFHFf{I FXuLyI h+"0bhvI | FuIF(lM (h+0oI j hpC_kJkIlH\ 2D0OS4(hYF+0VF0SD0 0+Oq yMFб#F2FF7FKihcFQHvHI(h+03jh( ( yF!( F>Ǽǜ@tF2L hhha@FFih2Hؐؠ,?1#ih-H##g#BA$h{"CS(hr<2F;F??ihH6GHFOrAF(h*0HXFPF P!wd9xd q #tM8@ (-A FIh"(4I" R!i. "(/I""`hxFFh'Ih"+ jfC2s3!I (.I"`h6xFFhIth"+ѷ??I*VMI,(h+0#h jh I H6Jr֡!yd"-CFFM$OY!IBF @FFh48Fh1FG hC+X LMDOch`hBF `0bh I3<!JFRh I!(7 F;Mh I(F舱 I(F( K Ih+ 0 h 0TҢ!wd(7 FMI(h+0 hihH40!d@PIFFHB -OFF F#  3)+ "   *I0FJF+0'I  (y(!IJF0F+0 BM,MFtt $ B&yIHFE)FPFO"C#:F0FAD4ODwp FF ,KB7+KB@}SB F&IF $KBc#3B Fx FJK(FFp@+ F8p@F FH+ FFFHH Fp@y FF H Fpp)Ftcidyara!rbmnJ1HLhDD"AF!u,OmO0,єQ@ueD `Q`A?`.h0`h Ch(<` hh 3h DBO0( Q@ueD `Q`A?`.@2 D8!K !*03(pG!-AFKFF銁<FFAF8@3BF2+ЬiO <ԠE*hD") F<DD$XDgEzHE{+и? F8±HHH!ȱpFe}s+CJ2;B2BBHO5(F }pT" )FjF0F CF 2 H;CI IH\"! F%!Fu<J"h pG!-O}FFO  YH(ܡH }O*P  (Aq)@CKI"#(Ah H!#J1FHE꧳KOYhqFKOsA&FHpyK"*hX2Bb e - Exa") O  !)InHD bK23DiH!?@s! D1F\J*!_H?@s! D1FSJ 1THK2+ }\OIi" F)FMH*/+-2+AF;JDH  F)Fw0@=J>K>H)ȿF0JAFJhx"F+F7HOD1*+|2+ 0+r/1FJ*H6 F)F02XCFF;FZF1FH9F7"F+F/2Cw#2r!Qɲ3 >׊rlOs;TBJBKCH)ȿFBJAF@AHQF<@K2+p#JU"蠑B;2J3K3H)ȿF2JAF 2H2+Q-K2+K #F;%ҝ>0)+#JAF&HZ0)+7JAF"H0QE#"*+JAFH)! xFI KYF"#\KJAFHPFx礲!ֳ&Iw-AFAMF4bN (B1-h F5NE 5Nm1F*F+3HA)1H|1*F1F/Ht1*F1F+HG7h1*F1F'H`1!1F$H@sD*FT1*F1FHL1*F1F?HD1!1FH@sD*F61*F1FH01H*F?1FA)! ƴڴ!2D-OF-z(X F3a0Bd0F%A) t FI "jP вH #)FHF) RT-Kѧh &y C 5C@+KziX+FB[ܝJ2b EuqۙH&0F  ( I Ft %I+FF,F %O2I+FF,F qO&yE? ѧh C W XrF #B? a F ,J E|q 2?A J 3 {J +C]\JFXRBzP[H"F(  q wEz L Bz'F20W -EIO !!By L ByFFO33+#By rG4H.FF*=FF,O2+@.1O &*H2F bC +H;i!~i # #KF*FHEFa EEyF6c +K K'hE+ f W^ H U!v!H2!LbZF [FO BЕ1s8F-E{ Bq F7u^I(FBБ1sQE{ BA &21*јX GEv ڸFFHKPFYFR# vCH +BOEO ##ZEUEBFUF#KFF2 F#*F1FKF?-O2+7b*IF F5FF*F1FKF*˹#R*FKF1F FHI *FKF1F,?EI U PD &!!+QZFlX2[BJEBǀBF(FIFF( F$lKbj !3F FFF8F `0F#`kh````4l`-AFhF F F0F | F5)F2J3F)FF@D<`FFm-O]Ki L h)F (dhI K# Kiѹ Oph +`JOa `0F^#h`+hc$h !F*h O@&,%h$` ;9FF(K%C$ ]`oKi QlK1pJqH hqNBF0FS%BM L(bF`G,R  ww S3h+Ȁ S 3h` ]Bv(FtF0+-+  =!HFE$ D`#4;E$4\FFAH  wHwE 2Li 8~鸹 a 88C 0H\i/k (!Ki[*L *M*F@A 4@#h 4@Th+T?+h+H 4AF~ 3H 4AFtH 4AnH 4Ah !B@q S F3h"(H:j h '( OrBwFHT S3hKpG!KhpG!KhpG!LR F!F  -GFFF5ILch!hHhS!hH~ 9F0Fx-PFw=FHpch{ chSL$h!FFH^ !GG R]pG R]pGHR]pG R} -Gm$FiF@H$@(jB=H0F mr@20F9F(%C$! ! ` J! HH]#!H#J($"K4 G (!0"Ih (K! "$ ^`8!h ! J! F`hF Nki(iG3h8+ 33`"-O $F%FKFBO`FB Oa#(^F(aY+ON O@qi FhO+ FB FEG,F `FH@O,Łsh;hIJK( FIHOuhPN0)h*i)1F9FHAF-h#I$Hx F G(:h>OaF0wH>%,FRFFpH`w+i+o.o+i6gIJF_H%n`h! b0F{hOcCFf\I (08F F(PF 8VKhCFSDEF x;72pՠ  p/B vFPF2:F#` 0B ?;`#0{``0p30 0 TF0F :i 0FhJFQFF l  0+?h1F V H1F8F  @F"=NbD8 Vhzd@hzPP8FRF0?宂EF?h SHFLJ0B) PJH#)iB$+OqB SO h@IAHh*iR2Z`jh`#+`hI k``` #03h;3`*Bri:raLFQ (iFwhw(FwBriBh?h/Fh+{i+8FTF`.?#1FzhhGF(? ?eBF/@FF( ?=EF4Z?hO f-IFH pF6Mðkhch+Q3H FCp@pGHGOqh#h+0)N)M0Fv(H Jkh;k`+$(FF ,kh;k`+#(F (y,"$hJK)FHPhd J+hZ*`x竉$+hZ*`x +Y,n,N,ѤY\B\A":@dB𵣰#OFKNh;`3hFH ;h" F+ !F':hڹF F'yHl#;`-vH!Fr&0F#3h+ `3h+ Z(FF(F' L3h3+cHcH8(F"r9C(F'+':F(F'C;FGCvk|7B3hKH,Cl3hFHjC&(F6C3h=H(FCD7I X@(FC&%D! pC (H|" ԣ %I $H$ D&HH#(FjC&v(F'?&H!"""E4Jl8Je-G FI#F(Os{H; vFxH2)FHF'tBFsHB(Fv!U*Ѫ)lHl"! *{o{O3dzg`##`'8F(`H9F{)|{`#` [H| k|i~#*}#a|#cbk}}ca}"+~a#~a~e#i#b+#Cc!b 0#"C#c1FbvF8H vF3H#iclCcdfl:% $0+#& C' c( e(0** dR"H|--0HF, 3".0B/0bc1 00#2 #c"bc"hZC3F #k"hSCBB Hi&0Fd@,N9FHFR'vCѝI"8FIp"Fع1ù11U+ї1+ ї3S3;3U+ї3+<ЊH I F(fЇK&"hHF;`SS 31K13#kZC3F #k"hSCBB zH8Fv:@Fv79FHFR'C&#k뱗!1#!C!c!c1#!C!c#dckO "hHFZCSF ck"hSCQEBXH cAFHF'BѕA0  O"A0찱akO KHuH  0BIFPFi  e8Fv@Fv(Fvm=H9FW%h ik)F@ ^23D f4H)FC1HAF;cjKbcecmBF+H/jAF 8clF e opCdemB!H:F@sB @sdZK#[OsBOsdH1"#!e#efjotLRRaAU&IazF F hvF$H#k%"h8FZC+F "h#kSCBBH0Fv R1F8F'#hCk8F!"l!"kZC+F "h#kSCBB HR1F8F'#hC0Fv(FNsFFlFhF" B$c+`(h n3fp #o3#g (#mB  K J Fl@2F HR I <0O3 +`K ` Z-OFXF FF XFv0`8HYF5 h#8F DH"FCF DAEB H0hvem8F*h1hZC'>m*hSCB c-O%U FFh4m$ FvFF@xH!F v7%3"F)F J sil xBKxRьx@,NOtB$x(@ƀ%lOr BfopBBd4O3mCE` v @8Fv#`(F opDBx(y y- My-эy--, y,Ly,ьy, ( %OtB}opDByyHyyxx I ((2FQF@Lt1EpF$+mBpkhBыYl`Q`-AFF IFFF0*F1F8F  I *F;mB4X*O30`Z-O"mFFB @O%;mB@FHj j 3FO]hBZ`0V 0+ٜB؈b21QhB ёh,F" FX,٣B b 2 F)FF,HSF*F1F8FH5RhB)2F,УBH"F)F BF)FHH#F)FaSF*F1F8FSYFJFF A :mB!chKE =JF1F8FJ "H e`tX,*d-OFm hF FF_C8Fu}F@fH9F'&0F:F! #lfVci!ipp+pOsBopCB m!OzopLB9L&FFhKEz(FvC+p!pj`OsBopCB&&l!F@F"r((Fv#&2F(FQF .PFvOlY `REO.bEn2f2 px3lf"Cl1n2fFkFn2f1Bp3D`n2fN2 3,m@Fh "#h#2 2BBXF&i  f:F)F@F&PBc-OF FFF%'#mB#kCkJ8'!lKD/^(F$0B' 0# 3+!,0( 9FPF;F2F!FHFCF+ YF0:F1F FE7nBHI (n'c#mBn+ X+JH I ("m#BqXA#d!FHFCJ3oL+4ihO? OBڼB`\&knx05"-OF6РF F^C13D,+mBB  1Djh/nHFs/h{#:F[F YEB2FHF&B"E#:FHF[F zYEB H HS  +2FHF&6BB$Y"-OFFFVF+q+++HI xBlJB@FJA1IFbRF+F`(AB-  H H ;B# #W"-A"NFO/g #c~(F Z;FB7F)F "F$h,F ?",;F"K OpuBh %pG"-OFp 1FF /A+@ mB@ބ$O3%F'F C D03 X0`3v 3F #  z BBОHSO3=FsBD00+* @[#  , BBxH(1#sp 63rxr*lHFFmHmI (L(1"AF#(11 RF'(  cC(1B1"BDDD(1DD#DspIK@!IJIH +GIw((1C(1D3{+@rxQL 2 =F Or!XF {  +K; # !  ( ! ( ! "KB"H:e ;F/FF[+?>H,-@) ;F/FF1{ BB%/ ' :F/FF'<Z""Or! \2{1F^ψB o#O p ( ;3h)!h"'-?Ϯ - =FHF"'AF+FO2 'RF|C%qz ). D3sqzDs 3 \ D O D (9/@߀LZopCB_ѳ}q}CCC_i`g uOrYF #0O3 0\m/@π##r! RF+FAF C?r/ B1BЃHDD^R`C@BFHI (5wDDvDL opCQF@FBuuu_#__- P0B? hC`^|`ñ FHI (߀DD#D 0wwsw`I F(@π_ 1BHFFHI F( 1_v_ 3wL opCB~1su1uh 1FSC/RBڲ B?- ;F/FF' ;F/1BN皹jI 00h+?sFcHb#*P0B Z03 3+ChB?XZ0 tFUHn_FRH=^$PI #F(#spDDD% 3 P_FZ5)FFBHCF@H@I PDDwopCwDuw5wvL BOuuu`DD((I (cP-]/h_+??HF F&HI x_DD7wopCvDL Buwu"D !BHFFHI F 0 1%B(ZnZBoD/FFsH:Or P( t lH*Ch55Sཱ- #CHDDh03h0-P0B d0h]C`Bu`+FFVHCVI -(`+ uww+ -w P#d0B*VFJH&II (_%d`DB Z QF@FO3`_ `#5#' Fq %B$DZ0+P0B?rDZ =F HF#!RFO31AF +FC!D00ӹ   BB ^K2F%B$D$@ ߻Z"-C F1F?NiOCEF@FtF08HAF HFtF(8Fu1HIFH8Fu@Fu+HdOr! clСk)#mB"H5 X( +ShB khC`5 !縹H$I k" P ,F H H "1UyN!8!L5% %5" F%ù %UUu.u*@U8YhZ`F F!h` FYhhX`"F"-CFNFF5F$ FU-28FU%JFi`AFC"-OFϰ F sIFFu(9qN55h5EkIkH& QF ch5 EO d 5jnDB ,$5Y *$%+mBWIXHK hnt (SHM O"xZ*) 45 !1:(hCC@F2#J+ NZ#BBAHjn@F %LknB EnOr!3f t;F6J !#J7 jnhSCLFF F \  ! XP @FC CKvK vlopCB.1#u/1cuL#wL cw21w31wLhC`#T# T#BBHmjn@F %knB eR"\yebO "L t# 5"KpG "KhpG "KhpG "LR F!F  h-GFFF \5ILch!hHhS!hH 9F0F-PFuFHch{ .chS$h!FFH " "GG R]pG R]pGHR]pG R} -Gm$FiF@H$@%B=H0F mr@20F9F%%C "  " `` J! HH]#!H#J( "K4 G %8 " 0"Ih %K! "$ `N " h ! !  `-O] F  .%FFFP%B0`pC_@/!0FbCxr+ #`rJcOaTr!h`FUEP.,4F..O Fl`%zF(b0pCOQ ykhhJOaHFFHFJ%F,. F%( ..#SEZEH F%([t%<, F%O4T` p`.`%.(%O45FO`_hh!%p5F&FhhOr@!%%dNFF a(Xp%t#3 Ft(ڣ"&`'J3F!"!%6IF%<( h+ F6%P" F I F% nI F%( I F%%at$## F ]F F@FpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h`.("`lwhd   lm(d  lcd`p`lSd mO(e`mKhemGemCeQ BC p`" H54S+BE+8#FBT#!A#38 FF8F F#T#E#34+gfXX\\tnh|q|pcZcWRFgJfWBF<\C\BAXXS BB czgfp j $d$(^(,X,cWFH>HL8LP2PT,TX&X\ \-OFh FF44``h H`Fh`h` `H`iHaiaia jb`jHbjbjb kcTS BB D\5KE'L53#T"#XPZR3B2*5q5pOrp F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" PFlF8FhF0FdF.D#$B\5KE D"0BP% = " "T*Jc "(-OqF FMK#BAKH2F+Fa442pSx ИBu BBua #0F)F2@FFFF 34J D\5Bi, CirO~ sDCZF#;n  @ @;iA CAqDL"hi#a:kL0)F `0Fo#"F300F)Fo# Khi Kh "T"T" " "-O FLF!UABJEPIEAҕHJFjEs #j0FQF K h# PFFFF 3J D\5Bi, CirO~ sDCo#X;n  @ @;iA CAq{nEXF  @ C(ajC): s`HJscBF+Fkh[Kh˱ZKi kXO ERHBF+FkhHkcLKkh+Os#Dc sF`6 `  O  vV` FVF^E|ZE%JX h(e(Jh*<&EXF;X I `  OKhr. [HBA  0h B ZE ZFhB B " "TH"@"T"D""\"-CO +KFFKFp:FPC&H*F3FX$L{F;B22k VV s8UH0`E@K%c(Fh+OxOAFF`cF8F`bbbY0`b)FOprc(H V " "T"Lkr#c "-GF`FF0+cKKhkTF Aq (U(UCF80qF(|@K1F8Fh=Kp(FhS"!`0C"@2CO 2FF3;Fv `2(O " Eغ $&O'N'M;h1hB8d1(hrx+hk"H F>77210^"0X5^ 3B*h;h(`d3;`3h*hY1`B#@ "|""x"t""T"8F K Fh. KhS" H*F#F4#BBh8|""6pN3hKMh,hC;+hB 0hr(hr#+`3`pT r"t""K"h pG"-OFH0, FF+ ChGFXF , K*jF(@S0k 30tk;FOqFB$XI1FC#EAK(Fh+3ЕKh+@CE$iR#B#33JC"`Di  (E# 0~K!Fhjh|KBB|Kh[oCE=vKFyJhi(D Q;C O O Oa (FiJdKxhiH ! `I  hIoYE[K!Fh8GEۣiO #a9O Q+OZA+PIIKhi)GS7RhC""*BѕH0+nS jBK $@@A`## $APFE;Hn(FSe0JhF*=xa r.Hl.J!`S' :"穱Z(FGFТi"aS'>KF(F:a 47i YO Ǵ<"T"D"! "Ml"h"n-Oز$] hF F`+# ` F(0CpL_ 1K Oh@(5BOpqۖHh<*q+@.ހ#C)FOr, :kU(Aq%FFF:I3F0Z @ŀ+ 08%@@%DApl[m @p  "B@ CHp"b+P@/1+.^J#G@A`##YHG XH4(,0F+zMKhkhC<MH6MK"`56 -BKhk#b0+z ".k #OsCOyaw *y4Py ;F*FAF FdL+KhZosC 3iDg n+?)F"N!.@0k_j(?f KhkhC/ch FG $] F ""l"nh"T"Xm(9єH0+-w!J#G@A`##GPF4H](tT0Fñh@acH\K"`pNJO@aJl"h"lFh0#+B2+r3OB2y1`l2 8Flhal0<Fx(F( KBs 8 "l$he2BB+r3B2  `8FF F0H Ff-tX-K#BAR!F(F)MF)HT)Kh+6+h`hoph#HD F!H< Kh+FH4+hF FH(+hӱj!"8@FH" o+h+`hFH oi8"T""k "GFFF?/F1FD+J,Kp@OF)Hc'O>h&H>&J1;A11H0+ #  !F(FKh˱IOr(Fz#p@gH(;h+ I" K`fjXn ""T"""l"0F FH# !F(F9x) )H"K+0#p#K-OhPF FC$%&#Bu@#BB7Ȓ F)F0#ZFFJFO hR BsFV! .8 &^E(^F0FqCFH6x+$%F| F)FxF+4EYht!S FBXhq}K F)Fh C `FwI ,\5Bii(YCL|hȡLs̱PF08F ~dK h*+`KzhB#B]HAF0+ZH7# 0zh FTK)FB5zm 0 #&ACq#0C  ;jL;;b4$;40B2$OR;08Kh1Kh#FO  pCO;г O?гO%#3pi[Da#OO8F F)F `KFXF1oQ7ц #3+?[K9FhR#3p Kh8#3p"p"%Td"U O"`"T" ""@"8" Ox#e8"0  Xm   +HH AFXFO[ @POh!(J13A1I$Kh2rp F)F b(?q Oxd808a8baXm   +HH AFXFO[+KPf"X"-O`FKF`h# 0I#F\Bii'MCCsh{MCszN(F0i F tKh+ǀ3h+ǀqKbhB#BnH9F!$X"!jKHFAF9.fKhF*@h9*1*X)XF""X TKh*SIOrXFHFAFq{#pX0+ #  oDJ1;A11,QbhHF9KAFB5{m 0 #.ACq#@ "  #jL3#b4+L$34hBi$3OR`#Kih3hiF i&H ` `3h+?9 !Fi1oQtVd[I"m"T"d"@"U ruT"""8"`"" "-OFsKFFqKP`hOpJX- O!!O0` O|Bss $ XGD XCG ,vڍPZF `GKhk 4)FX$XF# ##T" "F!P0$ $H$H yծF(O HF dIFH sFFFF F<Bx+I3F*F tp~-OFLMF!hch##hH(F1FBFX#h %Hd(F M##r#hkhH1dH^H[O#is#hHD#}H?HJ#h~HCY#h|H<J#hyH5#hwH.i3#hsH%hqHt k"1 DB 2 ###hOzqDT@2 E @@p !RF+FAlb "#^d!  #RF+FRKF:FLHch+# 2ChcRC#R@ P0, Ozjz4 Z J Jz0HD80^Cf!8D-JzH a j  #RH:#iSH6N%i-@ #l+<H(N%l-@ 0 " 'Jn .xJHch+r%%d%aedl(FhNORfhnlon5onFn#p00#0 %ghjBPp#0#z0+(H'K"`l+?h#h$H0"H\(?XH耹 #B"IH!F(?G#hH!%=#0Fp-h9#0Fh-h@@hp.5d"e >@D-OFH0u+zE3*s̀2j8F)FF cJuaJ1\A +q@#[HY[Kh+yZHO PF3j  KE``hE1 эBBh``BBhO W\@"B "\q"l"h "4","Kh @pGd"KhpGd"Kh !pGd"-O=FFF8IFMF@F+h pCFCFF*SIp`"`I"(V "#C#p = I(0"`IX "(V ѣn+ЁHBFKFH.(@FIF&+h;{IOrxI"xK"`wJvJh3054%Br  k;B2JBr OѶOzgKh+VfH2FSFP kBBS;B2_KhKpO%]H( IF@FTK-hhFXk-O,NKHh^kQKOzhH* F#'FKhkQOsJq )F/?Kh32FAHSF@@HBFKFh#0Hp(@ZIFp@F$Kh+J(IOr% 0K_EA O@Kh)s%Kh+orJ3;*shңn+eKjJh[n FXFWHT""x"""""l"@" " " "d"V\"H"d"KhKBFUKFHjIF@F2FF(02Kh+v aKI(5+uBzpӄJh<.zi3 h+Z#Cd{K -hs(F w O C1pKh(qX@ Fz(? hJdM13A1`X(Հ o (@ɀ]K`]H\\H(@Ā  fn+JEu h+JEAu -sۥ !%( 5At 8kC3QDC##2[0Kh+? YFT#F0HQ+0;# FF'HYFy  Kjo  bP4CKh+?e  T+TFHWR+)  394IF F H "T" """l"h7]Kh``O@V  F##pBFKF#Jh3` Sp+h3KhOsBFB@FIFOrF g`gvK*h *F`hd*BРh8e*>Рm9F F##H0d+hdM+G+hbKh+AmhPP/XHBFKF WH2hVK"`#p o`o`n@FIFNK"hB OpC#eF @ ~+hùCKDMh)hZkcOb* 3 D)vѠnNvmFI(4KF` pO h#H09 kKDF*K=j hU ,m(85@%@5D%BplIm@p  #C@ C   ;bP^Ek{h8FGՋ(","\"@"P""l"d" "T"BEKFBFHMKh3H~@FIF_+hFH0+?"##@F#IF## H>( kfI" "I"K -OO MNO*hjB2Qk'0HHDDLTNEpBufX"!K% K K 0$jBmTK`09\Bii LCI TiItHhIrsEr0FF*FF BO *IAy9hD9a1 3A B-#F*FE-CBs2hD;c34C Epup!FoC8F{dJ\5B0j#3hcLCs F0i@F [Kh[Kh*Z+ZYKh.]x@&t00jFd hCU+FRFMIMH#0KKh+dJKx+`00KE=3KE15sbF1BAr2DTIͼ+F3Kh3K`0jB00,QFFd pC_3F'I"F&H#0J3FA1:KBs7K#5HP(@!.K`Ԑp/(y+'İ h!cxFK+ !ՕUU+!KF#TKHh+ #Os#`#q(K"`L#*sӀ h.KFV0dv "Wfl"v"d""X" "#*s)40+@VKx+@UI h#FPH(F h!FpCO ##0P^AI hO YF#FC(#*s"# P@A#' h@A[FF FF,J Q,HL+Kh+H|#*s##0뱢y0B hO wKKFFw0Hq?(K&0;07p H/(F# #`h hOF H&] " "l"! -O|]~xK+5HHK"` 7 HH !O@"#FF8P ЩH;K`H(ЦKh3 !;@cȂ"MK(hZX"!6#`0K0.hBJӕKh*@/hLB`O ,hOB9-hBC != |]H@xHi(Hd(?t! [F{ @@utH0ñ,h4IFF `C'jI:FiH#0VKj++cObJ?h9F9xCbXH(4JK"`A:h:B=#]@A#SKx+;h]PIQHj#0LH?hjxD9F0xCb+Fj)@BOr!T9Kpjh+ OC@#p0/@9Fj;F *F(O 0&cEt *020304### #/@8/$l"W <hX""8"n0" "d"t"(" "$T":hIHj#]GH !hbP3A!\j# *F(O 08cE *|$#P#&#R#(#T#n 3 r9w"ر`KEfY( *Or! 0vgK (h*,` OB@"p /9F&B# #8TB!8 B 9WKP?j+? #BB????#CF3Kh+1K##+s;s#PF\#K`C3Cs;s###JFT{x+UKP?2;C?PCh`D`T" " l"d"pG-O}PCP;@B }0ñT,p<9FFd `C#F`I2Fp_H#0UIQ!: Cx C+TJhSJxSJx+(q2C3C+ѯ'HKPh DKx* hB7FhB#0FAF#(8KC;5H1FM4Hv(?xmX"!F"P +Jh)Jh)3xh&Jh Bih <8FUH0FAF#:(?<K/<0FAFC3C8oxo> " " "," "`)T"d"t""("-OFKPF9FhOsZFBI#F\B %ACCs CsXFQ0 F JKhKh*v+vНKbhB#BКH)F$3jO +UFSD[+e,5й2АK2jhkB,iL3a23B2 DCh3C`)n  "XCBXC#!F(FHwLORitKihcmKhiFi% PlL FHF P+ !F"(F9FW(@/+F:FG/CBsZJh;c3L@RJZF*m", TDK(Fbh9FBv{#n @Kh N+FFC+A@qYD:b2# xC p6J1;A11H0+0 [k[[B2#F!K2jhkB)Dcj3cb4 34L3A Dh2`BBh XF0 J`n5GO "T@"d"U  "8"`""4" ""KhpGd"-OX"!aK'aL#hjB^N3h#h,AFFd xC_;FWI*FVH#3`#hO p%0DF R B7,uA)F F)FF FDKEhFphʱhm##P0xC+Z C KV0opopn` F)FX,Kh#,H"F+F4E F)F68$Kh+$H"F+F1F F+BB  h0n&I"ch2#CI"#I"F"F H+Fu "("T" "%MYa("p"-O!- NO=4h=h#!p 0Kh+Qݣm+$5+ Ђ0+@𖀣HI(@𘀣m+:$@CE2ݸ/+#H$5 2"n@H-B"kAB@򈀅HIF$Kh#.怙03H$u/Fz3#"nAHgK.@𪁔 *LJڀ)^H(]H0+?b#$5"WK1h`ORTKhRKh#F# 0BHO40GHIF_0 -$HX0OH)O %"nAH@5DDD8hDlAFmFx-H-HF(?;0+м!!K"8`&O`OR1hijKih2KhiFi# 0P0KC21FC: """T"U `"`"d"8" "F"5OsO sT#rOr!*ZjK" 'h*H`2X3*рP8$O< k@w>G7@wBp{O j[E|u ")F(\GKh3c  b5HS#4I*}(**FF2͵BB +FB#00OR'K(Lhit&Kih=%KhiFi# 0 =#G#(FF@(ACq0D;c32C@ p_\" "$ "8"`"d"4"N3hG,AFFd [FI:FH#3`0H # 3\Bi+iACC FhOCs8FN2 i(F.K h*+𡀎Kh[KjhB#BЊHYF`0+H# 0KhK 0CJ0hCJhC~ЁKtOh{K0 # 3\eB `p+~CC`hCsd`AF  @"C@;C<8d * C Bs#ZKh0+"##h;.@j;[Eє0+ۀ$+?_2h)FiPX0h6O  # 3\Bii+yCCh8OnCs8F\2HYFO0K0hh{iK.Il(`K!hz3hinKh#i0I\%B JO\%K0hhH(KhCE("6T" "d"`"U ^"8"""D"T""~`"8 "P"@"KhKiKh \5 , ̂NBii+sCL h~nnL|   "L @LkF88D@02#$5+ݡk8F0#j B#jB#+kB#.pѠ!TKB rOK!B @dV0+L53DK5`' IF 0CE=ػ;KB CxBp;2KB CxBp;&Bz 'K' nQFOh}oB9F0FxK+"3OJ ;BKFX\CZT6G.wH2F;FD"8" "TU 4")FFA BLr):b2LԃHBF O  C 23AkBBmщ3+A`nJB S 2C JBDЂPC`n$FIF "#JCIF F@;Z3;R$5+#n &\CTkDJzPuxC@D +݋ DnIB c[X\##A!A@ FX$5+ݝnO D#1FopEK$%BFV# 2F# $2(PBr22Br22 Br22 Br2O L3" 1F(98JhYF5HXhsh;Fh/I*,(gЈ"0F,N8+KORih2)Kih'KhiFbil# 0"Kh+G (FN0F5# 0  > 3(OL O Z+$BFV#p7F#pKFU "$8" "`"d"`""~K`)FꐹzKB jhBTimI rIV(RЂ(FoNkKjhBThm@B 0F# 0bKx+@\KB@𫀙DjhB5qmI(?mVI@c(?fNKjhB5pm@B AIDK`CE CkhCE5sm[]9"6B܀&:HkhBCEvs+n[CE c]9'6O 5r'IkhCE mF[];A  9D H7/ѻ\&HO 5r'IkhCE mF[];A  9D H7/Ѷ @TK`wl"U H" "`-O 8F8F$Bӽ!F@F"g  HF_E 4 -AVL-#h 5@`%#h#*A6rS6 KhC-0+lGKGHS%#hDN!hORiDh>Kih0#h3%3M+h+G2H&!hOR+L 5i#s 5:'Kih&KhiFkiu# 0 F F F A%HK-F 0+ЅK`H+h+Я K` "@4>8"`"d" "V&l"tKpG\"KhpG\"KhpG\"LR F0!F 6 -GFFF5ILch!hHhS!hH 9F0F-PFmFHch{ hchS$h!FFH \\"GG R]pG R]pGHR]pG R} -Gm$FiF@H$@B=H0F mr@20F9F %Cl" \" ` J! H.H]#!H#J"(l"K4 G r\"H0"Ih 8K! "$8`\".h B! !  `pG FpKh+VFH!FH@ "G?$K0јB#KBO0B KBKBKM Lh I J@@B (` ``` #+`#` ``0KBKBKBKLIh@CB KJ ` `##` ``TTT8 |"d"8"<"@"T 8KhKhC\5JBK\5Kh;\5 JBK\5pG JB KJBKP""T8 "T 8hpF ` FChK`j bˆ6q26pp"200000000mekc#l+dmeRH3OrH3L3L3P3P3T3T3:*q*p "2n)F Fp@hpF ` FChK`j bˆ6q26pp"200000000mekc00#l+dmeH3OrH3L3L3P3P3T3T3*q*p "\A\@P"4a`h"44444 5b 5cnRkf0000P5P5H5H5cCnH5H5cc)F Fp@F:L F$h|@, L5+]K]KEhhB[hhBWiiBSPiYiBOjjBKkkBGPkYkBCѐkkB?ѐllB;llB7mmB3PmYmB/nnB+PnYnB'ѐnnB#PoYoBѐooBBBB \\5 ]KpG T"_K-Oh|]Ot7??#WIWNWHOS"F+FihFF $ FiO1\("JI @FFFCH F FOQh(`AF\($07Kh7I 06Kx 5I5K@BhBF3Ha(0/H90$LiF+OORi8h09hi;h0F$I\%B\\5J!` SBSAJ`>hn_?I&pABHH"(R8"H" ""2|"Q "8 P"T"jh"@"d"T^KpkhUC U! Drn@WK)F`FHF$OS#aRKh+Tj 9#3\PEi!iACC FhDMCs(F)ki+0iF;h in0#i02Ii\%B\8h)0+Kh{+Iu*M8h)F(J0hC'JhC9hORi)hi]0iFiJ# 0 0K$pHV=h0\n &.DB(FU+Y?B9hAPFh"""8  "`"""L" "#KJ-OO O3` KFFHEhl^)FFHHF  0!(FH9*hSk[Bd#h+@ʂ7HL( OR)h|(KhC&Kh#F(J# 0 0'K\BF \K[(Q HF(@*G#h+@H(>XOR)h6KhKh`"d"Il"2"8"#FGPJ# 0 0,+h, ,%*@0%45BB1зH+h0e4u#h+@[H( ܒOR)hKhKh#F J# 0 0+h(0+5x)5НHT0++hx"<"(%#h+@%Hb( \OR)hKhYKh#FJ# 0 0)h8%<5lCBB4}H+hblCB1#h+@qH!( ܑOR)hPkKhiKh#F_J# 0 0)h@%D5lCBB4]H*hlC@5#hD+@QH( XOR)hKKhIKh#F>G?J# 0 0#00+@90+0+@-+hL53@'#h+5H~4J)hh3`#L5#P5OWsT5OcX50-F^03H$5+@ n AH@5LDl;D3DDi@OR0 Kih\ KhiFiJ# 0"y`"d"Q`"8"T"X"" 0sH"(`H(KX)0Bq}H+h" #h[zH( OR)h0tKhrKh#F^gmJ# 0 00+?=AhH#h+0B۱C1`H+h #h;VH(!pOR)hPKhNKh#FIJ# 0 0FH#h+CH#h+?H#h+4-[ 0+?cB0[8H9K*F8HFMB F"8`"ER)  B%Hh#h+F?!H`#h+<)HV#h+٭HN#h+ HF#h+KDlC8%O|l1hH\"8"`"d"""D"5zl" "4"H"hp"""|"t"x"""*@"@Op!FkcK`H!F+hJ 5@pKhS1;IphK"`KOh@Fh!F>)@x!FOPNiOyFFHKFhF(@bIiK hB'ЎKh+RHH(FO3O29F F @Fpp!# 0h(F"}H0+gzH(i#[ uH0+prH(r#[kānH~0+xeH({#[B+":*/*@`Ha0+[Hx(@# F#qcqiFBƀTOUHF;h+@KH](@iMHl0+#O #rcrr@F 00 @HN0+#"ct"t@F00s# 0y4H40+?O2O3! F #@F00O# 0g!H0+?x7'i#8F;q{q8# 0o7T"M "x"d"h""H"LBALw "MI7H;h+?Mi# F#qcq# 0/K"`.Kh.K) OrOb`+Kh*H6-h)L 5s7 #"''pY+ɲ.kp03B&!p"H@SHhH%xO ! (FjJK!`F(FjCK`(~lH"JO #p` J`J\I"0" "n"l""p"Kh IpCOس_гOг_ Kh H @OPCO d" "F4Kh4H3I0F6F t0Kx/Kh+.H1F-K p,KxD&Kx+*H1F| (O(M1F8Ft'HHkh;k`+(FIJ ,kh;k`+(F (y, Y,+hZ*`x竉ս+hZ*`x +Y,n,N, "h"D"& ""0:@pF KFFh H2F+F!F@Hi p "Dh2KOp-A$-`/K`/Khk9Fkq,H,KOaaOp @ak^($K9F$NaO @ @af( F( j9FFOpk@F(,(Fj3h4Ean`+`5`]`O 0a,+ѽ4a"" "X"""-OFAKFFhH ;"DRF;PEKF5H"F'MRF!@FP1Hh=FUE "FKFQF@FF(8F AFFKs#"Kh KhB)K(FhIsB) 3D@OsF FF H7KhDD#H h"tyd"-OFFF8PZ3ZFDZ,EK"`H2FCF$HE Osb9FJs# B FHsH0DD0"h"-CFMi Fu3K i3Oh2I#B9F0H#i%0F Pea#i*KBF)O,F.F;kL0B F#*FIFHF 8hkH$L4CsAn  @"C CH@IFhJ0#*FIFHF;h4kD;hPBh"8" "D"d" 0}pG-AFIO hNn ;h "3C;`# CBBK!Fh H{h2F3i{`+Fh^e`a ""D"H"-A F!MF!I,hBdhBHd`  G C!BB$hiF F2 F`Z`+he`#`+h,`\`iCa" "pF FF!X"hFnhFep FhF)$ H0+ J Kh[ H##` HFH(##`H "2 >FpF N Mi3h)h Kh32hi(hp@p ""d"K"`pG("8FL FTBA H Kh Kh #T0BXhH8"bp" "H4-OFF VFFBB ѫ3C F=IOHFAFx;+3I:F FT"YF'pEEOHp7$&KViF$ F!F;FF6/"G,BV3CK1F(FVKiF=#0Ub F?#<79FOb>Zl)m"\%[K-CB}F F@𩀐0+)U h#O`i(`(hOHOb!FLKhLHKKh+:JNL533h OxO)hFOHhF Wq:F3hIFHFiF"2 E[!;3h)hF(h:FiFWp3h)hF020204#k$ \3#j$ 4$bj04#8$j<@$ DH$OR#0L 5L53 #P50"0#"# }T "@"d"\%!KB?ѐ0+; 5004b30304040 5 5L5?P%P% 3WqWp OrOrKpGT-A0Kh+@?J`L h(ڠKhAIKx+;НKh+7МM+h+PЛHlKhKhKh+Nі0+JFOPeMOR1FiKihrKhiFiI h# 0]M& hO)FiMj h)Fij}h B9iB!}H|H9(+h+Х)F hi6j(FjEFnJ#[M`mJ`+h+D`O;h0>[N3h+4gH+h+49hQM#OR0ci #X4,QKihPKhiF]igBI h# 03hKOHNH((`LKhLHKK5M"`OR7Kih8Kih6KhiF*i4(I h# 0hkB۔I! Jax!ZaEr F@ @ۀ B@ǀ FAF\#F~HBii)HCCsyIhPFuNCsW;h@F PoKh+3h+lK B#BhHIF;h FO vs[H h CTYJ0B   `O@D]E  "0LHO|2[Br28hL3 kB\0;02;B220n;0AO3AF18MOR9hi5KihM3hiFi&/H ` F `O  I0&D2BD3h+?U:hAFiM$0 $[$04[4b  $ @ " " "4"T"d"@"U "8"`""KpFF @P%8 iG8 H;CiB iT%0PFaD%@ apl" KKi i@P"0B@"@FiBal"KFh 5p KBBB BB    "^F(-OFq X GFFFAv(=XF1F(7KhNh[iSE"QFy`h1[A1C3i[iKE K"IFh^0a3i!RA!!A!""p"pG-OFFkKMlF$S"0[\OC kBܽ#DJK'FS$ [$0B 'DX$@@HDH$k7R[B48Fn*&](  8d#@ݲ]@Bc#@ݲ#@]ڲ@BIHPFn*%\@ Z\"B  [\"\ACIHy\Fn*"TX"@ \# T[""IHNlFn*"TX" \C T[""IH$y-GF$F) nIIF=n*FTB OX $ +dhV̿C lTIF8oT$!F E(F,O!@ FPEf'AIP+F*F>IC C C F9I8Fv 7I8Fp5I8Fj4I8Fd2I2F@F\0&I"F@FV0,IJF "!0FjHF0 0BtBO# (*#KhkOz"FSFdEFx FO6$$ O<4O`aqJ (FFPYYBOXKB B!H!Khk H# # '$\ " h*۰mK@FBH0ZY0C@ H( K` n" " "l"l""Kh pGd"-OFF FUBгi#a _0kBOrtB 0(F!Fk @Fi *FIF#FGB " 7#FF#$BB-#! FF[EF F^E0#0 *F#F0kB [i+ H ^EBi#a Pj^FF F} "-OmP` F"C FFF(BF ?QEXEFF 3#BB3)##2FHwKhH   H|(K` ( "l"-AOB F !*NFFX3h+ #OsFC(F"#M+hkBSi3@F9F3hCKix)h" i"aOR LiX Kih!3hiFi# 0d" "n"8"`"-GFiFF{PF F;PKhoF8F FFHJHIK` GKhFKhk2+FiRF0F" i"aBPF F9H(ؠ0kBOrtC0(F!FkiD#8F#`"HFse K (F#!F#"CE i"a*F8F#F 0kB[i+ H6 T"cl"d" "l"K-OMFKJF+hFJCFDزr'S6 @QhPxxS+-!8!!$+hQFH#Kh+𺀐H4+hf+hK+hQFH$#+hH# +hFp@O +hFwH##RF "F#]*hkB Yi)>+h#D +hS6 KhC`HQFrYKh+X]H(hAF+h| "#F#+hkB Zi*APHIF?iNKNHNKFhB yCE Hy0BѸ,ˈBCHQF#) i#a@>H>(C8M+h %3JLBH#h 8# #CH +h##CH #h+H H(   "^F "D`vh pG-GFvFFFIF(F:F3F$F8FO`f#TD&O` FB`۽#D# 6P I-GF4FFF%! F@FKJOF#` #q  # #!F# F :F@ mJ# :^FF^: p FFFn2Fg2F`2FY2FRppFF F((*Fmep-AATB A ҅Bt Bt ҅Bt Ew   Akk@P!ABBh-OFF"iFF%@B6K@216J6H"iiBv FF!jF  ]E"  '@\FC1FHFBYF2bh D=Dv#i  '@\FC!FHFC)F#bh!7FGBvF>FVi!@BK@e1JH6cEvF5FdF=F|qE$ 5FF EF BuF5F8F%#kS%kHbk5Bñ K@1 J+ K@1 J H`;ch BhZ`Bh`hg8 jFKh[HjhN# Fb#`k3K@!JH. k@h: "  +jF3K@1JH@mh F@h1 >-OF-FF# -P+ +I+$O<pO<@O<+QJHb1F F Y K@?QJ:FCF(F (, F$2 U -CFCi& F@jFF3K@OQJH01F(FQK@QQJ4DI "FKF8F(#AF8F#kF2F(F(F2 U K-sCFh F N3hBF HKF00hBFKF!F* p "D"l K-sCFh F N3hBF HKF 0hBFKF!Ft p "H" KMxQH.N$O+hmB(hPHH:( Z(hJ2hR[m8FS4Rh4""  ""  hL h@j $ hO##`"7FHh(j,)F0 F"8F FKhñmJh K@"h`B #BB  8@n T"d" "oKsh;+nKԿO@bO`b`kM+h Et`) fHfH(W a)7)5`Hn]H(]Ht)h\LOR 5i#s 5#d3#a3TKihRKhiFi# 0#$F !$p#x3.h e2#F FBH!H@H#9H-)h8LOR 5i#s 5#d3v2Kih>0KhiFi# 0$*hd3+6Y)6ؒaqK+-HH(?k!HL)h#ORa3d3i<KihKhiFmiw# 0$+ FpHF " " "P h k 8"`"d""   I">@ -O-#FFF3 FK  h3SB/F=FѧOIF:F0FAF ѣO;hB(@F(;# F#O3 #!??FF1 gDl-t-b- F 0юI F2 FAF F FV#AFF ;hB Fi  #C+F8mB uI2F F(F5.q FAFUkI2F F1F F1FE6mBmB`I F7FFF.` FB FVIF+s$$#2S+ FFHIS+ F tFAI P F:FcF2[EB FB22B;B2 28$"HF F0?g1F FFFFcF2[EB FB00[@;@0 08$"HFo FZ0?9JCF!XF #I F%###r[FH"L4%c-CF jF FF&PNEBF)F F@*F!FkCc8FCҸ2F)F F6/k#c#-O F FF 3BF1F F^CF ѩKhB4ШI #mb/#A/%L/СI gQ gNO0c/i/ (F0(F (Fe#@4pCO!,FO  F  $h! F3F#C-~I FjB#ѳ{I80 +`b\ $ F( Fj gHr<dI F>NF0F&g.3x/+0F3F]J]IB(#$fF WI FHF!  FQI?HF7g.JI0.2sCOsCI FOr1FHF^.B F^E$#Z ИBB#BREѕ0j$!m#80XF({-O&-FFF7FF RFIF@FBF # TKhCE (FFF(F!XGMI(Ff, A,P,HI NF p, (F0O4 F 'O &#a!(FF(Aџ1#"(FP0I#"(F#VF+IQFOrfpJU#JF1CF#"s#(F#xF(F`CFI(FJF(FCF??(F0F(FO40$$4z-CFFFO BF9F0FF`6KhB!(F!F(F!F(FF.O+I(F(&f,r,нC &IO "I$$! AF(FAFI$ Fv$$!0j1F(FBFI/$$!8j9F(FCF I4 (EaI"j@ FFFF4[jIFH$ I"F H H:F1Fx5*FI@H,@ IjG"#*sF FO0M "(h(qx+S/ Sx$$1 b+B+Sx+(hP(##&DLO2BC;S@۲T#0" -C F'B!F'0)70@ MXO  Dom(\O# ,!F B4paFFB# 0o Bҡ ?a?d1ptpOq B d4p?datpp#8-CFFFFOxOE Ej.7KE' #0F+#.F<+#+#n'@EIFRE8"C{;?Ѵ?ӮfE Ң @:BXB' B\B 5FOt#O3-GF$DF FgC8FfF# TRF#FBPE0F&f0F:F1FB-CF$4Fh'!UJF+FBHEO01jBFP@E48FC4#R<]pG3FS[8hf)FF F%0@pGF04[ H ]pGG-O!FFFXF O0'jI"T퀹&ih a F\B 4+cIJF;F(F Ff8 2$XF ) F (F#!Fh0+4+#(FNIYF$mB4 +#(FGI@Ff+ 6 VAI(F@J@JsVO(FB##"##JF;F(VO##F(F# F(?lV= hcmPFOx b6Bvb $*J!SFiYF(F#"(Fi#(?2{a7#mB('~z  -OFFF\!\F0zI(FO0!JU#B4+sI:FCF(F FfA #pFA\)#32*W6+)dI"#(F#"C(F###"#Y( Ff ԫ4+TI:FCF(F4+OI"#(FzMI:FCF(FN#"C(F##:FCF%(@ 13+$дa̡2aO Bʡ,O O  F ,"",IJF C /I:FCF(F 4Bk$* (F!i$I!1*+#(FOI(?+ha3`I Q FFYF(F0 8D`~-GFF OaFfFHyԄH1F F#Tet@E#!$4###F0FOcqF31FOb FlI F|C F$fa0bI@4$$pCO(В]I$B0ZI$4#XI F?U#C7UIb0QIU#C(OIdF4Os$4U#Cc$$S#@FIFCZ#`EFdU#$t@FIF:F~(Fq FFF F F2I{4CBF.IKF F2F+F F0?h"# F#'0?Z"# FBF?P! Fxȱj#R?Bs F052e#d@'>d@UkF4BB* I0 I F|4 I"F F@d@8!FF(I FH(F8! FF I! F! F4(I F(%4j+ X } -AF jFjFO1YChe F9F a(FBF I(F F1F(FCFIDF  $ƿ$ 0%$O4BEp!)FBpuO AOaOq0jXm j0pG$4jjPm0pG $4jjPm0pG-O FyF(CN#MFp!IF0F2FI&(H FFEF;h#h+FnNEIO0 ZFW&06H#hSCFXW%02FAFPF5#hNME % &  0a$$#Q8a#*N FsF7hI-O08F(2h I(F#*#s2hI & !(!-OF hF# F*OUsڋj k#*s @ BO0 0Fv(0FܠF (Fi+Xi)UУj BQ#*sBBE#*sBB990FIF#kF##FX"AFXFG0F0IF0F"AFG0F0ckQFi0F 80$!m#5 kF(-i"YFF(8!FFFFO0"1FG F_0 4"1FjG FZ0 FzkIY H!-CF F vFCI#O0F$T#HFAF*FCIJFCF F *F#8F1FFFCFFI:F3F/vpFaFR!f!!K-OF Fh'Ill`F8F#"!F[8舱"3+"FIF0FO7QF FD#C C#&h!FN$O3i)FV+8Fj<!-OFF FIFFLH< #:@C )x2F(F)QFYF8F_Ih$iCEBiYEEx(- 4ZRI2FCF8Fa#bcb(-JKS -II8FFKHKS%0$|(CJ#aJF[F0FAFcF(\bCb#AEBaiAi aea c #,FMTA EsE!iMa%ai2h&a2B &L&!a 1ciCahaeaCi,aa a(F I8FK4[ I8F4 F &'8'&T'&-OFFE, u-"F+FXF1FC "FF+FFhCD"F+FHFAF|C "FH+FrFhCD t/_лi+@:hzh*r[QEvy f 2 [ b YKEz_BzZYS,u"F+FQF$CР:ECUD O3O :CeF8F ,u "F+F #C"F+FA3  Dc F ?ikF-OiFFF۹vIXFRdsI4=i qIZ CE3i;a3i_a0F>KFRFD E MDBDEDEu BFWIXFEO4%FEe#A#2b2C F)FPFIFTC KFE RFJ E MD#Bu-Eiɱ8hOyhc Ee -IXF8ag.pa2b22E2BsIEi IAeBq I6a# 0he phAC3i;a3i_a0F-E{DFxe''''T''(.(iBpGipGipGF-C\pF~F BEs ځi! F iU PC Ey c8n𵋰F$ !FF8(F IO0 J !v(ȿ  Fܿ# 4T'j(IF<K"F IH$ I H M NU40F, I&()X)4>;)*"* IO0**    ) *8F FF +2711111'1) *,"$& 8O0: *"+J@!HpK FI*FV      JR#0  )") -O2OCFF@MI0F5%F(FhIJB BGI0F Fdj#P'F"FFECE!4+;I*F#0F #(F$$FzOذF0CE Fd9ACB~%324+ݗ0"+8"HZF@! KBFIF0FAF 0FGC!8H#)F0j$XC"  cC0B8B2 57JR#0*WEV*;*" F*)-OHFFF#O BF9F0FBF|KhB(F $!(FF#C&sI(FQ p, A,f,nI F F s,# (FN0O #jO (Fi#r??4j1ơ J11 4+ݗ1"NIQ2B#LK0KIJF(F!*** *0______________2*;J@!;H9K*A*X6I(F+P3KcRF#(FF  7(F0?l(F0?f!@"t F\# FAF(FgCF!I(FJK 81FH#U"CD3B2 26  $+k*4 *)T"*՜* e*-AF)OEeFl N\N FF(`PI2F FO5#(F FCF I2F FICF2F F2=F9999:-GFFBF8/4 d1HOF1j$$j0j#h(F##&##.a#(a FCF I:F F(F3FFOhFIKF:F F5F92:9O:-GF-FFtJ0F(BFqI GmKhB FGFF F!=HgI Fy(F! F.! F(!  F"! F$" 4 TI4+x(pQIjBBMIF F=+g(] 4;! FFP%2F;F! F&0Ѫ6#" FP9IO "# FF3IAFOr pJU#2F1;F#"# FF FCF"I Fg I F*"#! *ѐ(#!g Ft0?K4+ 4+"#!4o::::;PKOF FF M    :F1F(FCF KhB J#iF F| iF F0I T;\;]5KSB@pG#-OF FF   BF9F0FCFJvKhBX+s F'`i+Ui+RaBBL # F# #??FF1 F -G% FFF.F JFAFPFC/+s F!xi+TO7BBI $KhSE#RU FV-N(.a8 ( (!$I = F0, F, FH CCi`54>6>𵽰FFBV(p @bAH=@U=Hj=H=H=H=H=H#C5HX9HV"j|!F11,$$LBB;10),H,H8x $!8m#jF&iF'H*=#J!'#FJH1+є1+HFH=@IJ( FH=@>>>c>>>>>$v>>>FLpO F F  HcC3! D!"F)F( H#03F0H p?G|]FFF<0F5I:FO0`iB$i^OaR9F-H%jz#+H##$$#'H##$$$J+F!g!!J>+Fa> I">HJJ!>K>H@m#8$!0H4H2 #RH |]0?H?_?F% +?@X@?+? Kn:f*oB (КmQeppGIK@-CF] eJeHeJ bHcHR(FaOF$ F ]#8F # 8F i.1FHF#!#"ji( &jGJ!"3F!EJB3FB"4 AI""P"?HB>H9J!BB9H9H| $O O#3!H(%$!#3(HZ Jm#8$!G"HL"HH #R H$ifH:bOa@F0#1F#i"j  Me?#l?~? +???@j(7@c@+??-GF FF%BF9F FCZKhB!0FVHN50Fl( `( a8 ( #u(JI NF FEE0F00FEE+s0F!xi+ sBB )0Fi(J (Hx'J %Hr%H0FaF/#@F \ #@FV F CiPFJ ; 8#)F#:ji ,?iHF4@5 Me?#l?@~?@@-APF FnFFC 7F+K    h3ScE2FF!K!N2FAF(FCF<I"8FKhBJ;F FT*l*H O09F FM0$ I P Fr0@@i4>5Q+B@+pG#𵉰3OF FF :F1F(FLC(+s Fw!`i+Ei+BvBB<ԱKhB# F#"#3)a8 (!$I  F0, FB, FH i^A54>h `Èˀz rCz ? 0+B/pG{ {S{{zzSzzӈhJ> ]A-CFhF F ڈ z Zz ۉ0sxs+x'F"iF@F#*F F9iBsxl+O&F"iF8F긹#*F FqipC7/jF)F F67.@-G FFxcPD QF F]%(F 7&I"F 6 5  3 2 1  . ( ѝ0 00**+DONF9FFP#c˄QF F  O5A@pFpL&"F@!hF6 hF4G. p@FL%O#1F8F4 =@ApFL#FD F5`ir)Fp@Pp@-AFF4043309FhF$ CC00#@c0 HO~CFI(F F&F2FAF F` I(F FO4 IB I3F(FD FzKBB(BBBXBP K OF FF M    :F1F(F.CFѬKhB#JiF FFpcFJiF F-< I FFiF F0@D\;uI5FFIEK8SB@"FFI/KSB@"-OKFN FOF2F)F FF3 ўKhB НI ?Oo+;h>F($$*ڒK!JHI(ÀHFF8FF(8F:I^(I F(@HFI(Fc|i;+(F(4jOssI"F (}OF1+zКF(mkIZF(dД!(FgI (\Д!(FdI(TД!(FaI(LД!(F^I(DД!(F[I(<Д!(FXI먳!(FVIp!(FSI8!(FQI!(FNIȱ!(FLI됱!(FIIXѝF )F@FP(FAIHF>8F  4z9IRF8F@(6i)5IBFPF8(5jF1IhF~(, FX,J!8)I F(*m*%K!%J%I F(#I"FjRD&5UDkDD"EvAVDFDADDDDDDDEFE E&E MEF(?gF(f5jO h$3j3B >IRF@F(QG\G|GpF" FhF!ah"hFk`hh3SB"FF B J I IjFDCI B $pGP['i\[!!pF-PF!Ұ#.2### C## #@# 0"K,"'K(K)K*K+K,1F(F  Rpi@l[ix[!i[PFxhFM ]HKpFx +EK%%x+h Bx5@C0=I @@B:H A ix J#@;@BO6F.H1Fh`i# Bx3@C0"I @@Bd"H A6 iFHh`i# Bx3@C0I @@B>H A|iOaJ#l Hn  pX""[[[[[[sF J ItxI l"(FF$"pah(Fph[x+ F0h`h $hG*e`kCh/hB(F-OFFC BFwJwI $(F5FrJsIFbh hIFhhnI(F(=ЛVkIF(FF(KhI(FFFFeI(FF>FaI (FnF(2Ѣn:"QF (F0$KJRIPI (FL(Н0+{ѡn)x"l0FZ0knGIF"  ***# FZ kDZ9I #8IJF (AF3I x믱09F>C"l0Fn꘹"l0F!n0bnl)lckB(F h1+#o˱!F(FG0mI-QF "l0F!n0k0Fm0mGP[*ev[\n \ W\\;\m\-AFF$ F8F<F(FF`>1FF8F6F` F$H(F, FAF F(Ix]-AFFIjFFF( +&CFO08FF(А"!Fz"9FkV I0FP0н #FI@F* FeiF0 F@ FFhF0#`O0BF?#8F"FF(F.2(!. FFFBF0#`O0BF?#8F"FF(F2(! FjFIv@#`O0]hpF/IjFF`(-K!-J-H-I FXjFŔ1)I(F"F0 K@1J HI F@B0H \&^\^]pIF@tO5#`(F$pNE@-I (FaFIF I+F0F0 I IjF0FT'FI Fa@^F^[^t^i^𵉰IF8,#`O0 F0FawFI FI3F8FR0 I I8F%V0I FaO(Fc^^i^FPCHHHh]^^ 𵅰  gIF0I p0aFI`I(F0I2%OBȿB Fa  1F8F5xi ^^!_ sFFCF` 1F FG0I*F FC( l :_8FICF(F$0 K@1 J HH) FI a 8v^H]]H( J_ IFjF0 K@A J H` I F0H &_|]H]i_ IFjF0 K@A J H6 I F0H &|]H]i_I#jF3I x%]i^ F IFF0 K@1J HI F@B^^H][F08 (٣a*أWA*أ=#`O0P IC C #V0I  ]i^pFIFFXXFĕ pIjF(FmF-ĕ !hFIFF0FF(F4@B_vi p F!IjFF 0K@fAJHb!F(F0O0 p2* ^BbB;B2@ @e !2DF(F I F>F(F@BC C_|]I]_رL ! !< J H` "FJIH^__bjFIF@O4#` F F"CFIHp$_I F`F J I,m!HONL!(>FHKI"F(;FH3FKlƹm!HJKIDD(F"F H(FF Nsh(FG6hI_p6___`A`pGA`pGA`pGA`pGJF `l `dpGp6JF `Qm `SepGp6JF `m `epGp6JF `Ql `SdpGp6JF aQn `3SfpGp68FFH&0#`O080 +$ A;+#M(Fn>( #,T p6)CK \"JFnpG BЀip6-OTNK @@ D`@Oy0FI DQ DJgI B7I DD@uAvB;L5FD,0Z7IFF'FF%F&FF 0KXxF Bi*i+8@U,BB" B@FG(!@0 0#KEB SEI BA@FG(By @Fbɚ;6e`k b"-O]FF_BF 3FFCFѕJI O IF AF(FFJI0OaJn#kn9FHN"9F$jI$0F 0!уH$"9F$jI$0F0(|H. AF(F70 nJvI()uH#R9X@,h"9F$jlI$0F)@#()gH!(F"9FjbI0F#O 0W `#F(>YI :!#nVJOajz|n#x۹:##nOahn#KJjf#x+!FPF F0D!FPF F0DchAF(FG$h 8I0F ^07I 7H F`[5LH0k(Ft(1K2I0H|AF(FH0I0{@ˀ`@,̀h"AF(FGi"9FHj$IKHI(F0F0BєIJK)FFh"IP[BbPbbib~ibcbicicccc"HWdii*b6bp6cc9NT#9H^#Jb#R2I3HV#R/I.Hwf#R+I)Hmh#R'HX#&H_`#Jgd#RIHOZ#RIHE\#RIH; (P@,?6ch(FG$h0"AF(FG ]!dd(dbW2d=dUd`d-OF FF` )F F0?I:F dFF@9J 9I~ FF4I ~FȐ1KO0 F@F* 'YF8FYFPFP IZF F K0hՙL0hԙM0hՙN0CO06[AF F F(-h. xIhh,:_8Ijd`k"@𵋰FFFI I(FO PIjF(FM    !0@h+I I"0F J I;`;h I"F .eg\"8i(gRgh FFiBI#FF h-CF!I FF0KOqJH2N4h NF(FF8FFȱFHFi"CFJ)FHF$p$(F$`D F( NF0hiDFp` F`5J0hm h\"hsF FIF(K!JH\F FDF(FFNF0hi F` F`5 J0h6O0p i:hRGh\"h-AFI FF(K!JHfN4hF(FF8FFF@FiCJ)F@F$d$$$qd$C 4`O0h:hRGh\"hFIjF F0K@JHI h + KN@CsC `h|]RGh\"IH h0IF2pI F.HI F( I F$K!hFhhCZh%"` IjF Fg0 I 0%0hih0h\"7iis FhFH/iF H M Ni2F8  Hp!F(F4F i^Qhi-OFF~I 0FC BFxJxI P"!FFC   i^oI(FX0+ј"! pjI 0F0dJgIfH@PzeKXh !FdHrxB:ZxB33 [H!FR!`FWI NI(F0SIhFQHDPIJ B MH: JI?) F(h.` F #`O0h F p𵥰FF*FF8#`O0%#+~!(F #ji!F8FCVh c`-GF FFF #`%jXBFaC2s3Fx-#Bx#Bs "#~h"+O00FAFFn #j9FPF^0h(FI{`FhPPD 4D-MOFFFFFE h8 _F0$hj`O0FFļļĜ40 40 0 0 pj(86hkbb`U-OFF@# 7#`O0i)@1j)@ IhF(@"!D-ހ58FF( Ii,KFD/!@FZF#;PC #5# % YF@FF(@ i)@,ɀ " F F"x*O O "#`@F`)-I8F$(tOrYB?mQ)?hy\)cA^ [X\0 X 8F_F(?M(FBFQF  9F(FrF(F`}/?5ri;FIF0?,i+р,΀YF@FF(@OJCFOI h( h(? -2-? "`VRc@F(Os X X0DSպO #`7""O;IO;$N!? F FYPO;+?2kDO;Ҳ^ xX0V:,;+?2kD Fx#x*?!Fa( W<+ #ɲ CA(7<0< ,لhhUi0Uj+u#x1F(F_$JI i"FF FFJI ch070U]]-AFFFF@F((#`O0@FF #ji!F8F CVh c`-OPP%FFFFF  H CFBF!FPF5`hQFhF#G F5tF00c;+- F[#`O0(;  +-O` O0 -OF(FFF#`O0;Dj  #!ia00sIFPF8 0h($h0-+YFPF(( iIaiybh*=C$70h( 0h(H< #FF)F0FCck xk`i+aI Fh#F%j-AFFFF>#`O0 ji!FF@FCWf`0FFF$ !FF_8K`T7`jEjxULjRjJijIHBj1K!-AmxFOrB8< 0JI FIhjF I F00I IrW}mmimIH"m-AF-PI°2"F0:69Ԛ9o &&PI .(F$ !( * , . 0 0𦀝l * pI &&&lHl m."hI(F#`0;0нb0+aH_I(F#`0)0нb0+xZHVI(F #`00нb@)BkQHMI(FI#`00нb@)B`IHP$GI(FF( * , . 0 0(+L ;I(F0@ƀ8I(F06I(F0 3I" F<(@OsB-H\B*Kx+?{(Hv&Kx+&H#Kx+$HDKx+!H< H8#6I,2(F:.2>02$+*0/H"8i(icnninnnni8iiiWo"nnnnnn),.,C0C**+-H xh300[Kx:+* 'H" &H!F&$'i)@F.?<74/?7, 8iyH;H &,HxF HOsB H /h - h -O=P .I C # %t WH]6"8@FFHFI0+СxH0+#y'FIOHxxfxK>XXc^FEݸyyy(yDBPF7FHF0+СxoH.C0mJB^I_F>F , FD .p7(UHi.5؛0+?FPH!Fa?PF  9FIHjIKF0h>KBsBHCJDK`EF?H6T 9=I?J?J?JBѣys=I%HB0+?"zy9H8+5IH20+?!z 1H$/OĠԐ+|`Y T! "D!00"H!"FI ] MF(` IH!D([ k`08?8u"\i M IFF(F)FHI"F(F (Fuu8v h(0TK ! CC !B K`!03 CBKK `tuu(0TKH!0CC !B K`!03 CBKK `tuu(0A#!@C%BF#CL`BK`!0K `tuu(A#ȲC/F۲L`BK`!K `tuu(ACS_FL`BK`!K `tuu(ACCOFL`BK`!K `tuu(A!CCcoF#CL`BK`!K `tuu(pACS_FL`BK`!p(ьheI!CS C_FI` !B۲I`BKK `tuEwYwuK"#Ih@h]y@?-AF!|'FBO@F`)FF()FD(77 FhF]I*Ffd(F] `0Ff8y-A F xn+Kxo+4'f(L%FAFD80F](F'x!Fn+ Cxo+0](=F ](чIFFH Hy-O]F S 4E3F S 3 S3)Fh SF3Fh HYF#QFqڀIFiIHF 8 ` h+@ԀI(F(@̀Ig(@ƀHДIDБI=ЏI6ЌI/KB 8A(F\0 Ng!@ f` h+ I"8F(@ڀ~I  `+:hO@$48 4IFF(@`B$hh#U``00bH  $0@FS$4B b> j0VH2CF(]].@/ h+@\ 4"8F0@[DH ,8I&,?9!P#2B) .I"PF6 # Z"(FYF*!F8FF$Fع&Khk$$H F ]TF #K aZFH #` I3II;F0J OaJ^zlztzzʝzwzzzz"zzzzzzzzB OH8FOfFx)?-) O =!FP`#4;G+G4G+0\F$^H>]]$j0 |~  `h!J0OHNLONOO2F @A 4#h 4h0h+ 4*F8FT?+ h+ =H*FF SF3h< , r! ( "FAF 0(#0L " h (.%I 4 4@4$D48O$.ٮ0+?Ԯ 8A(FZ0H)F(OrB])FF H*S 8@4F(z?s{+{@>{-Oh$ F #^HJFAF \N%h z%VExkWI+BWJ+FWM FVIF()FUH0F0+OKEMI(FNHZ(qhJHJN3h+oBI#FH-QF3h+mQF?H#@H###xB(I#F*F t0rFY( FI@ݿhFZ( FI@Ϳhp|"FBx (I"F >8F F(!F H8@ #x/+ !FH)FH8@ ݼ8@VI (KIKKKKFH bꔍzD7 " FFx (I+F"F 0)8KFF K%*F!F8F I !F| (F8@\k"-OFFH"! F`F8nIH" FDd@MZFAF8C фKh.t28F(S * *(((((((((((((7*(e*m*((((*((((((,(,(, -((-((((((((?*Q*]**((*(*((*((*, *,,, -(,,5Kh 4K"`P2Kh+/K"`i#saDiC#(ha!iCSc&JhC`1iCi#(hD!iCC diCcg!(hFZifcC (hI!iC3biC@iC3 I(h:Fd,FI ?& !"!"!"@AHhA`Bi!aYBiAaaBiA@aBiA!ao~I h)a|I ` zI h)WvI `i!qaZBiA1aD!Bi!AaBiAaD!`D!`ZdI0FdcK`bI0FdiCa`b]I0FdiCa bXI0FdiC3a`bSI0FdiCSacNI0FdiCSacII0FdiCCa dYDI0FdiCab?I0FdiCa c0F#d<iCCi#C(hR!2K` (hr!iC`biC#`(ht!iCb(hw!iC b(hx!iC ciC###0X#ObHF hh9hJF F!" !"!"#!"LRXaku@-C] G%  {H#9F@F*h 80#hK+i )h2F F#sa3nh *F(H,'I;F2F (hi FOa0F2Jf`h # " 2 h@C(лFH#H kkKk kjjKj jci ]i<Ɏ^N!"8F Fp(!F H8@ j#x/+ !FHn)FH8@ I8@VBx**I |AڏF@h#F(F 6O3c`#h"!Xh O0#hhe`i#"!(F F#h(Fii F(:F1F(FChsFOzrF FhF!ZC (`h#2F)F,pO0pGsFF F~#!F`(F##2F(F hJhB`h(ѠhFhFZ`VI*FhHO3Fp` "P(< `0 <pGFFI°B1#>FOR@##" #>#? F!(h[d IF HH#`O0B B@}o 砆 -GF FFFCO0P!m`+MOpDB  BORD #D(h<0(`CDOqPFD4:D0 HF5D, @F01D( A8FII(E(H#`DV (V F IH` "//-OF$ f FFFFF(qZ,u dO6<#`0FZFGE yOO AF 4a@Eq  FDFMFHpXEI[FHEGCF h( FFa WFeFFF FWF砆(pG-AN} x FF!F@FOr\(F)F(OpF"F4$4MNBD#I:F0F #Ch N}( .0F N}A L!D ĕ0FH d "-O["F FFLH@!8FFFPODIC 0Fh kF hF21FDFF;H :!8FF>FG5H F i̠İO3MO O OF0+O OiBFQFCFJF9F2(L0+Fiv;Dkdiij``ka`h4laa$ #ai#sa "^NrEd "dIFH ؑ#-H@#` I  gz 6]ANP-OFF$C 䰀FC  ~NFC#`'F|J@`zJD`yJIF@FC tKh( g8(S 5555555 6)6555E6560hO#F0hh#F0h02hTI ##PI#0hRFdxNI d`3h"JIF\ F+xBI ?I z '##nF7I".Fx /I ,I,z ڀ' F02h%I0h#8Y#Ob8phYFXF 0IZFq aa ,b/& &bgBHo8 d(#!FH ,0I"F [#H#H#H YF H XF H H 8 h Hh H瀓ޓГ7" FF~xB(I#F*F 0rFX6( FI@ݿhFY( FI@Ϳhp|"FFBx (I"F ~8F FD(!F H8@ >#x/+ !FHB)FH8@ 8@VpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h`>82`lwhd (  lm(d  lcd`p`lSd mO(e`mKhemGemCeQ BC p`"X54S+BE+8#FBT#!A#38 FF8F F#T#E#34+gfXX\\~x|q|pcjcWbFgZfWRFL\C\BAXXS BB czgfp j $d$(^(,X,cWFH>HL8LP2PT,TX&X\ \-OFh FF44``h H`Fh`h` `H`iHaiaia jb`jHbjbjb kcTS BB D\5KE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"*!KE" PFlF8FhF0FdF.D#$B\5KE D"0BP%J@Foi\BoIFO7:0S9F0F;((XR BA Xd6S BB F @fhPFki!FkO"1F8F*0'9F0F[p p E 6FE @8eOr1F8F|%"U TT$%"(#TpGP# \C TpGR##FIH ߠ-OF hPn   @$C0)Cx)`#II>x#0h+I(F>t!hXk(bO HF =GD0 p JtI 2@eDBL @r[ CSfd04 @+F#"]hkAoB@iBoB@fDoB@cHoB@`CB@]3B@Z3B$$#iO@O ;O  pgKFhC @h*Fk0#F0FD`" FXFP@F XF)+ OqF0FOr!$h:J\kB@hOzq  hKCOA22$0O30:((?h2@eDBl@r[ CSh0 p h [nt(@+FOxRFCFzh rC2  ծO : @!"|%"pAC\%"T$%"+YIIOzr>thSC  (F\Icd#ddd#c1!hXkPF?h2@eLDeBr[ CSR 2Ln   L Jk@L+FD0 8 X$ $ $ $ $ $ ! Ozr OAh SC D0@0H0L0O30 HP?h2@eDBl@r[ CSR 2  h Xn  @C. A +FC-OF-!FOL- Oc #s#  Kh+L Kh.H K=h$h]C#0 B0%"!"(%"`%"t%"PO;"C@BDA@0F)FXEFA"O10F?FJO1 @,OQOpYMF`(OR!^O1OpYa(НLO2!N#h+@O3,5KhKh4)HR h)HH NJh1hhcZcK BЋH8 hYkK BІH. h:hYkBڂH" hk_}HOR hk?xHO2 sh BrH hpK2h hB0ZBZ\jK\c0FX'E eKXh+cH1Fhm**"$%kVQBdYkO|8eN<@eHBO|Fd De.)F Xe.Xm'B&cFf!( *FEH h9hpk#!FB@ ,@8%"D%"X%"|%" @\%"^F&!"T`(%"`%"{0%" %"O`^Kh+I# h4)hOP ObhObxiKhyihh0+xiOr!Wp0+ݛH0+@hNj0:5U\Bi"iBCEhInEr  @#*C@!CF2J KIfB (@𷁽R0+P#"h0"+:h+jOC F/oL#FhjB@lH 8<O{0GF  "KQEA\%FVI+B%a` D%4<`DEKBD p0C_CKBu@H( h!i , i9K$8I{`ȿ`  h{a`Ŀ@;g)2@"2x0t[KEgx#e  0mH:fxfzn0BHr% kihj Db-O F8 Dl%"h%"$%"T [ht@|%"@U @hREi@JhnZEvq nJFh$5+ ݡi #@n\CTi i3adKh+Od {h[ET{mS 2C {h[EP57XCm@P5?+ @ d  FF0 0F FXC@;Z3;R80  D~O`IFF) IFOPOb 2FF(Ob )hOPf# ;P#K#_ * , :BQF9`#{eO3eJI  h)F`2" Af fH zf @l%"Yh}JB5smxBpijYh:buJB5smxBpij;bhkX0@i3DiOO Qk1Qc1FBi򭀚B"Dh|n&hikQi3DB@򽀎B2hi$5+O2fj $jEOKh#jzkFh!jjPn1Rk!b!/hj!Zk`bBh`iik _OW8D0:Kh+aihi9Dh6NkDci 0o+F(#h\%@5)NBii%rCAhdAq   C #1C K\%BN3h+5B PhOBvrn 1@iBj2Bb5U $%"TT %"ShnSEvqnJFh$5+ ݡi #@n\CTi i3aKh+Jd{hSET{mS 2C {hPSE m7@?*0d$FF "2FF @;Z3;R80  D  zISk3SciZiBZhBvsn6B UiSj3SbnO nD#1FoE +?$B FP#`6@#` 3.OL O +$eB3FP#`6@#`KFB @I 8 z @J k08`!x`0@HOFFEήfiE>D(Fci6 @F "kDBh,H`f\Bii%AC Fk;Dk  id Fv F    +CD1CF E+ Kh+@A2D?p. 3 @U T(%"hKI*FF0I2"\Bii%HCBhqFBrxn  @B #:C@H2 $DDB$3h+hj8CwKhswH + qKhk ; B t#:* 0fKhfI eLghcgbKh+30304040hJkcSCoTIOb`iRMgib!`+hh9FkKKgihJK\5 0+WpOr!|CKhB;F2FW+h+hiZkFhPnHtL  Rk'@Ci1C8jcjB+h#hFZkh!jj1Pn!bRk!!!k`i hiYkI L-)F F A1"0F|CF~f+( 笿TL(%".!"3|%" @K$%",%"8 0%"-G}FFFFJFF(bI:F (`I@FO (O78F }(.WI"F@F CF Vh+QHIF(kk:j`j`#k+ackka#@0+bB0kbclb,f'AIP+F*F>IC C C F9I8Fd 7I8F^5I8FX4I8FR2I2F@F J0&I"F@F D0,IJF "!0FXHF 0 0BcBO# (*#!FHHH!FD ڨd FyFFF2B2"h`-OFKFH!d~%FO BFFyYF(F3C3uD O BWEOpYFVF@@F)"$0"(#"!BڐBژB pG АBИBA pGp Ml(F4.knP 63D.mD0 Fp)"FBBJ I© F IFFhF K0BJ IEx)")""ީ FFKFFh Khs3s K4zBJ IEN)")")"'5K-CFhM+^Ѱo[0M8@mniDFC8f+N FO AFp'K#BFy=$JkihSCB86B3AF0Y<6IF8F MCObkFIFfJhѱhUh] 0B @B 21h%M P F0kFOb)Fn M)")")")")",-GFjLFFPFWkF fJ fI ;CHѢj# !B,6@O@҉J "# #YIWJXhRF+F@!kxZ  "#PI#LJ xCkp,6&Xh+F@aF ,6D0;0#i;#aj6SCBw9JOG9,0FIFFF$&F Gp?A  'J J @&+F8FQF$&0FIFKlV㱴X AF0F0pC O&+FQFpf8F(FGW𨺀"((dSCEB)"AjE-AF:N, 0 $ FB FV~F("F+F@!34j*FBFd (FW^ Fx2(!#(]T  \@  J I1)(FW7 CT,6&h+F@qF(FW#,6:zB2h;`siD)"-Oɰ F!FOtK4Fh0V8ЭI"F >Khs3BЪI2FKhBҩI2F ,oҦIOc"F_٣IO3"FBРI3F"FJhJ-НIRF FnF 0FagIOrFJ`bB & 8a FUFFPQF F oK̿O O # BF$s !|I " XCK XK xD9F!F@0 + #0CB80bKh F!FF : 5PF 1PD B !FJQF Fp1FD5L1FO@F206 69Kw(hZC6K!5J b"I `!b( c /HdUefP #ceKX0R ["I #%dS#cfHKh-=(F(3I)")"Ī)")"EoEEԫ/")")"EQSN>H*")"VH")FXl# V0423 *8m5biOH=Iź!F7I:H6G r&!HF7IFPFX KF&@!Ir%+K@&)F> "#ciIC C C F9I8F 7I8F~5I8Fx4I8Fr2I2F@Fj0&I"F@Fd0,IJF "!0FxHF0 0Ba(BO# (*#IC C C FN9I8F 7I8F5I8F4I8F2I2F@F0&I"F@F0,IJF "!0FHF 0 0BaXBO# (*#;+ٌH"F?@$^+؆HFHB&HJK +F/!x {JOa (?_!nF3sfjF(hpCOvF"F8F1FJC ѧBvCBu_H? #?{Ga>Bp=g ?.FCs-FHD9Fb0SFOsDD-:@phC DB@؀0!F9F D5OpEC .DBJcOsBKB",H O3#p!F@sXCP!F0Ou~ >JJOrB B]KOqBHOKKOrBЫB]O BГB H;0\ /GaO >*QѺ  !FO@.(8 B8F> @Os@@a XT=!!F7F O`OPDFaK?! >DGF=-=H Fг?CӦHӻO BҢH)Fq .РHOrFF"0 " 0ЕJO|F L Bv m'@p@|0!,>)G8!?(F # FBs{Hv U=xbC%IA rC%F OD6mKOvFB3(0F00]"# CHU#x(OH/#IA/"B(FBTH/@v# $@sOrFB(;+#+? @sOrF@HRF##B1=9H)D%6H7K) FF*FAF2HVrFB++##B #I?>A#GG   COH@! !$팋F FT F8F Zn##Z綹ع2b^ H  3I$ !FD ## O## # @#$#2J) F 23K)FKE⁂Khd  3BF~IKF}HyJ#` @[KOsBUBQOEN #6P߬B)F"F6AB :FcH"F!(F^ к @܀KOrBKE@ r+sks, +tktt t+uku"&+%ka+b Hkb#bIb(1+,1k)#p1#b1X1ih13h@ 8IA##B#rilrDCCp q Jqq SF)JOaBB' #+p kp#pB!IT"JU#1"F)FXFTC?BHJFAF+x3+ "x2 !qX`$0#ggfffJOqBJEЋBDKE dK+`SS 31O3z3KEE2)+p#Bٺ * ""T3"E+F(F((#r2[C#2hCRsiP3i3[CB#hC+j  OF+!!6HB !F4H:2HF4A /HF,B.HF& 1"C)HF1D&H&1%"HF HOwHHJNMFB 0F(FHKB 0F(F b+?O m )?EJRRaAϺݺ 09J[bOQ4-SЂhh *d *A0 8  eA K hM N OB`bU1 (0#-@=B'P<#pG@pGTIFH P-C FFFFB Os F(;AFFꐱ}Kh"!@F0h:F!F(FC FTHKhR I"FF Dh+ IJF <ihhs`h:F(0#&ʼsFMh hJ@FH@ Hp"!(h hJ3F@*(0#80#Cxx"x"y#F^KFH]I𵉰FFh3SBF*Fh/4'78F# xMKF*FBF  OEdrHqHqK"!pOaX`2+F"D3`2!+khCWI`N .ձ@ +ih{:+Ask`h hUBEOqDHq;F*F1 @=I k({V#蠡k2H+0IE3QD@0+HYF ԧz;@ ! {*72{F3FBOE(n`{gD (0# <#;2#x1#MbWK2#P<#^H;#8;#ɚ;6e(3#H I; jhP [B( ;D Hj`B13;KBj` D;%X;#ɚ;6e-GFFFF 0  q jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B ю 0  F.9FFHHF x(0#-CF#M -FF(F@ h+HCF:F1FHHIFh?  ?H!!h S0+zh< ICs@@(0# K Lh K*F4I#FFHl <$lnMIFF(FT I"F(FP I"F(FJ I"F(FF I"F(F@ f-C FFxF3 * *NlOx *##p\* Cx+AF8F(F;'*"*+;F;B+1F@FMFyV FKhhSIC h\B Kh ( !\(O OCOC`O0,<$t<$@<$FFFP; F/O`#S`O? F`+HF+h`(Kh3#h'I; h\B^##ty* .(*.*#%(,h)9h21 QX0F È*# #IHh #@#ct=###%#(h!(/#h@<$,<$t<$hhPFMNO FP+hh *3h[S9hO  A L#"`c`y b2 F@<$,<$t<$@$ K : *B ( QppGI$-A F9IFFb(7I"(Ff5I F2 FF(FDB /I/H (+x/+ 'I'I)F F#F!F xj&Op/),#xcH+/*F[/-e+FF+/**s+cx.+1F F&F%Fr*9F(FX=EE=/+1F(F.F4F-O]H#1# 3@#SaKbKSbKbK 3Ob`HHh+TѩJ#3J`L#3[h+3+LOFtFN*F9F0F,0FNOa F2h3hzK3 + F8D"F9 + +#SpK!FFp\cx{1 @ObW%#3XzKyMFt!Fx+F3/+! AOb F% @"@!' CiMkIRk(F0`4/fH)F PeJOa10 P A0Ob^H)Fh5B$@$x<$\<$>RX<$K IF N(: @P?pO(яI BHd A1^ IF (( @ÈԁI BK# z|IF F( FuKhtK"`$ \pIF (׮lKmJmImKbHmK mK mK mK mK mKmKmKmKmKmKmKmKmKmKB (jIF F( @WF(?حKKhch`I; h\Bȭ[Kh#h+? @F(8!F @M1F @XhB ٠h C``F&4(F((Fg `CSF0I:HDF @@F(5I BHFF3J C @@A%FFPFF(YPF9.@I FSOR$H"%f:8,<$x<$#r%<[@bVt<$@<$8SKh[;hI; h\BկKh;h+ IHF(ЪIHF(?| I# 0yZDoObJFIH"fFHF*F9FHF[6FVK"1F F#!FC"#FB233Ih/IGF*C3;D3Q F;(8 F0F8#FFCCB0Ѻ?=B?!h1bEw8FQ 8bFB8F (  ( 7#XIZKhr:F]IYH y D Cy 2 OIFCh 2 DKEDI T6  [E32BH  <:IF ([x/I3Hh3I  "0IF ( ] (IF &IF F(LI#h+ H%`H#h3#` IF z(e ,<$t<$@<$ygfffvZ#8 IF @(,f IF 0F( L I#h H HObI %,<$+?Z# Kxi+ H3#p!@H{ 0<$@$xKFIF"Fp IFR IHLb IHF#IH@HG$G$FIFK:F hh\=%C KhK J K I( FF. I"F H3F(Ft<$K@<$f@-CF3KF3IFh h 3$OO \ A )Kh#F(I)HHF+C%Kxi+$Kh+#Kh{#Jd!e/2F+F0F)FFx{F F.00C0G F2F+F/F*C〸Kt<$,<$@0<$@<$KI:K hh\<$C PCyˆ+"B€? Ft<$K-OB.]]SSBSBO O FBi,FwKh;(FuIFuHV(FCmKh  U F F;F*F(Fv(F JF[F8FVFC|Ѵ0X\CY F9F 9F F8CIKh+0Fcy+ FFI:FFFH HJF8F[FÈFCÀ8Kh+0FjF Fm7I;F*F2H.N(F(FHJF8F[FF@C3h+?e CC3h+?T *F(F-;F"FIZI FN?by*/M F FUiJF[F8FFKt<$#,<$;@l_cy+)F F FK8Fjb[FbbJFlFKh(?J I;FFH>I:FH.0F I;FF H$0F:FFHYG$,<$@ =8K-Gh7I7H7O$&#Bv2K3N3Oj F1F4FCy+,Ic h\Bj|-е00;(FIFFPF(F(Fi,jD mjcy+Ѵ0I Fm3h; Ff9FF@F F Foi@<$@Xh<$G$,<$rt<$K-AhIHM ,j&GF4.,jM#j$@$ 5W$%S60<$L#CchpCO@$-CF*N)Oeh hObIFd(` #Kh#I#H(F2B#c` "a1BKhIH%YDb`I (#EOr0+JF9FHh<$,<$Un>-OFMFFFF8FX#*F840F#FQF MOG#*F0F#FG3F8gP F8\"iFF*,F F8$Fh2 F@QK-OhIHrKxR+ ьKOaH##KJhjL#x#+ чHIHOI FjDxhRIF{H0~I"FyH*烉'J3FI HT0F@<$@#0<$`<$K<$J` *X<$p4=^wH$4<$8<$-AFmFFFFF(@H:F#F?Or@a0F9I2F9H8HDhQ5IF3H m*i0NԀF2h.miF-0F F o/F0FOg:FD0KIHm#hQPIFH 0:F F0KI Hm#hQ0 IFeG Y$@$4<$(  C L#x#+"# F~ F4#+ H"#r@H=KOPF FFK#BqH"F+FsO F)Fzh;hES"qbC"` Khvj O#BB9F0Fvjh<$[$,<$BijB ћibpGiBтiapGF+I!PpF F K#Bq Nrhv3hS"p#BB@j h<$[$PpF FK#BqH*F#FN(F!FrhJ3hS"03*F#FHp@`ZjBB `p$Fh<$B[$_-A!mF 'FkF(FFkFk/..p hAF@i,$ F m5.$j8/!FPF$ F8#p(F/##pF(Cy+H)FyFL/'6*yB H!Fp F)h F !5B|H.. .ѢyF(F2B2"D5J y@F1A1!DN0J0#y+yF(F2B2"D)J...ly!(F2B2"DbJ y@F1A1!D J0hy!(F2B2"DJ@k,<$UT!2^CN@<$Kh(K[h pGTa$-O(L$ #F94#hs(ЩH=Kh+'FFKh35E(@Kh+)IHIH#0M "KxR+K0+''F:9+LьK(FIJKKKH)Fdd)FXF(FLOa `v0ԝ 4 + ` zH)F0SE7 J $ )FmHp `IF#)A bQF(FN `YF3 +)F *F'RFXI(F6)FUH>UJUI(F*(F `Oa0  JKI ` 4 + aAHV@H Dbh(":HF?4J(F6IF0Hv B/IH.IEE *IFFBB\:#IF HH2 IFHa$x<$ <$,<$@0<$@$T61i&<lg$h`<$P<$.jO\<$pbT:N"@9C3h)3)4I4HT+ 2K0+90+ۮ.H#W0)- `=X*sY=BOqA3hKJKI-ȿFH*F= `8+Hg4+?H!#40- `=,<$:@@$^_<$df$-OFLO5 B::h#1FBK)8O)%ch(D+?IF#hF;hB ( 0nHYF;h9!hif-@#Ob5!Z%Ob@F9399393QWKFJFh.98h/O# 5DܩF-eKILHhKK *,*!*"EIGH\GKhCFHE  :BJh"BI2FBH8iF5F5I=Hm=I2H*#:I/H"=h!*Fch!(FC(fhP.IF!HI#*Fhz??-[MFKhI!H#hC J9h`0 +:h)FHIOb(D>3a$ <$T@$D<$dn@<$@ $2Lex<$k$,<$rKFhM+@iNl"BkKBBИB&0F MeMhCeKhdIeH#` Fx(]Kh+ hl ``hh``hd`h`` i\ a`iX`aiTaiPa I nf   k= c`k9`ck5ck1cl-dl)dxrl xx||<60*!hMK+4 $<$Ta$@<$@~hFhF(?Nk#BbBMhCKhIH#`wuq i "c"$]$&W& U Q MIEAOb! F#`22`20caa 0#$00&00  2 d22Or0cKa2#ca0C@S #]Ka=;$ & WJh*Ҁ&hUO.QUIUJVH+ FUI#RRIOHNI oB##:x3\#=#caiNl#B#i2|3 2ch2h2#k2k2#dcccf3H#A1C$9) 8:%I)H#I'H'I!Hr9-;B#IHhI N"h*N*=*;o  # B1k.3I IHa$@<$@~T,<$TZw "l7YF-bi=#9#&#-AUMmTKUL TO+e#+#k`iBQND=3= FLBB!hK+zq-o fl=3=$&0B=N F'8BB=3=;hF6#k`0+a0ka0ala##ckc# #kc# #l+dnkd ##ci`#`L-*IH#= mK##K+eKH#h+?kH IHpd@$<$Ta$`<$h<$$=$-O=# `J   ` n`h+𝀝KiKBМH_H4+𓀙J434 #C@ +@  F ## O T %0B@;+y hvhOI"FF@<$@<<$4<$Ka$[q a$8<$tkJcd5@$1FZF FDIF FF鷹2C F FHKhñHI[F2Fn8F0DJEIFFv#*F!F;FO0QQF F㈙I H8Z IH0[ IH* Ho$"'-o$8FHF`hT Ic h\BI*FH F!8t<$6FONI*F8F8F0hCh;C`+IJ ,0hCh;C`+ (y, hZ`x3h hZ`x +n,\<$:HR Kh{ H(F H( F@pGD<$N1M*FFFKh\v('hN*I;F2FH F*Kh(hNI;F2FHF$ KhS I3F J H- F IV$4<$e@<$W`@ FF(I(H8 F&IF$H0`i#IF H(i0 IFH j0IFHi0IFH `j0IFHayKJ H)FIhIH F@F H) *?S9l|0F%B#OaH#KJH0i5I Fqs$ÈmFI^ FC UFhF hR Fm `p q FBFhFz mpFCy+I2 F-KhF@(C@hN*F Ip@F H Kh3*FIp@Hp4<$@<$@-C/!F@D'O/O ?/+0F'pF`0FB+Fh0F;FC뀄FCy+I#jI F F# CKhF( >hN"F I@F Hy Kh3"F I@Ho $4<$@<$D@FCy+I| F# CqKhF( hNH"F I@F H8 Kh3"FI@H.T4<$@<$k@FCy+I< F# C1KhFN( hN"F I@F H Kh3"FI@H{4<$@<$@-CFx2LF.+ FFCx/+!h-H< 2F+I  h;F"-A!h%H*9!h#H$#J"I hJk I hJ/I hJI hJI hJiI h!h #h[I JJ8<$h #*I 4-CM`/FF "F,( I 0 +;#0B#H+UwH!Fs4T}w$pmFFlF! F#xE*Oa&H)FPF (`#xF+K"Z`O0A+ F8 DB< +#< H!F,I 0  mpw$4FF FF K!FFhlF FBI 1F(F@w$4𵅰FQL`QI PI hNINH~`MI L aII#ih$F(Цh@!0Fh(d#pAKqh?+F0`h*F+H#!i)H6)Ih3(H.'Ij,&H($I j%hxw$PGd"BTQ^ky~w:BLnw-O$cMFF!F(l,`0F*F9F&0""##!"FD D dBPI0FM|FLIF!D(GI>DkCEH+hCHpH0I,OcJOqH,B$OqJH,! OqH JOqJH{$bKFQ$+BsLD.' x] Zp+p"D pB*ݱB#Hp{$}$"KsFhF HOq"`訹H.!AOrH#xkIOrHHpK"!ex- - FJ+FOq H`h1Fp@ Fp@{U|$b{$Dx,,x J#FOqHH@@U{$R-AFFY)F0F,FڽA H*F+F!FHAF"F!FHA C-O$F# "#F"F!D& H d6BNI0FtرLFFF!D (DI.DCH-tFFhCVѸДy BEOx[IԔy0B y9F !L;x`+5;C3D10 ) #hP"!#Ih@IRFXFI n; f+X1 #DB(FOM#`mZe "p$,F "jU2#]#!"]-OF!MO 4 FFFF,)DV\*5O `<F#"2K!F?IFHT HFFCNM F7h{3`70@q=N@A+KF+HZhZ1+. )F FG."HH0&8B.ѽGHĽ1#HF&)1+PF"F)F HG 𹽽h$@UEZ{\-CFKNFFD3h!F',>DI FO2oC#HFG0*Ѵ@ > D"` FbB /H"F)F3h+ 0x+(h+'F1+#j# CoBB?#)F@F,j#CoCB?#)F#@F)FJ #@F#J)F #@Fh$dn-OFcNFF3h!FG'O,Q . PF0SH)Fz%@F FrFF IH"F)Fc3h+ @FFXF@Fh+.PFG0Ѵ@ f'F1+Ѵj#OC#)FHF,j#C&#)F#HFPF  !J SFd! )FFHF,8F ! J ;Fd!")F FHF^h$K-C8KMt}wBEO!/!!AF(F0H)F CF)FD2F@( #8F$<%FhIF8FdUh$|$$-OF$HFJ#L%F!hF F)3h B"8FMIP@#9Fn"hI 6k3`#"YF8FPAh CBAEPF(@#9FH"hI54$-AF1MFFq/Xj2C #CP)HA!S .B;!F@F#K"AͺB>হKFHZh1+. ,!F@FA.FH,N%$B H)FA :0F7h$@UE0% FF#SL0 0*I"F tKjC+F Fc1 H!FHH>$h$>-OCF+F FY K]h!F*FF Hp)HjHd$h$UCJpF F&#f,0 p*I"F TMj1 C3F FC1+K!FHZh&1+ OR#H$h$UEW-OFF/oKh#nH# x (#2 ZC @FKFX SO3 (# #3Q9F$ F(" D0F0 5 FOK P(!![ BLI*F Q-,&F,/F O ZCEݸ 3 ZF+F! j2CN#("1F8F (63P(O D    bE(Q g  0@00Qg@00Qg@00Qg@00Qg@01H9F6#H######## h$_$n Vg-CF`"*x FAF/#JH#X(FKFX ^#O3#F%9FHFU0 F F#CK2B/I2F 0/#C#C  #"F1F$IhjC!F0F3FBF!u# #5BܻO\1H1FODB 8Fv)F#@F5n_$h$ V0g0FF%#U20 0*I"F ZKjC+F FI1H!F. zH zgzg+z;g+;; ;S0+$h$-OMfNF CD3FF3h!FOZ,j FLF ZJ ZI TRF4!\O FHFSIFOS AC@18F h0?Ѵ@ * M.#F`HFvCFE oAFOrdH*j0fIaHOr*oAFOrZH*j^IWHOr_AFOrQH*Z UINHOrt_AFOrGH*ZMIDHOrPOAFOr>H*JDI;HOr(OAFOr4H*J*)F0F80 #AI* Fa*)F0F 0# OcO BF)F0F 0(h +JF(F)F0F0 #$I:F FGF uGE?l8FJgGF*')F0FwOH0CFJF0K JIhGF')F0Fw0?H;F!F Fh$|$U-O8F=!F&`bFB<'?+|7F#;I(F뀱xJ&809`*xBJF'F.# \`"!@$hPoA(,!(F C D, %@. 0 2  FFKFO O3OFLF9/F8O 7+uH)F==!@FF`|I@F(bL,! FF" +tI@F(?ѹpJ)FpKpHFa0+@ނ B"pF$eH)FL~JF FB]H"F)Fx+jh+o FRI@F~0o PI@Fr(5,MI Fj(KI Fd#' GI FZ#' DI FR(ڀAI FJ#' >I FB(̀;H"F)F:I@F6ع,` FZB 1H"F)Fjx+h+,I@F(X,?l` FBF"H"F)FGx*h*Bo@ABOra$UROШUw H+Q֎h$I@F(9,? x*?'a)'&&&&&&&&&&&&)&& & #p"F3FFFfFfFvF&FVvH)F"tHBF)F'''F}*8uDD"`@FNEeH"F)Fx+0h+oBCABOApXFf`XFL # 4@//@MJNH)Fl"`@F EGH"F)F\x+h++q %qXFfpXL +# Ff@F0$^0 Z0B-H"F)F@F"`@FE$H"F)Fx+h+rGL#FfXL# +#H)F Lz/x H)F3?sFflJt/L H)F3}_  : H  /, 3/,/,/حH)F/ѬH)F3/L@cp#I(F (CxJ#(FP908CFvF @ "(/ABVB#30(Y;B#`#@ (# `02hJ>)FFHTp#.!)F "((FOr "pOs# zKwJ8 p0)F1oB#h2CoK)FoH ":#4qjI" F(okz=+ `J8 Bg 1DaH P44OC Ow #(FOs#`RK8 : < > 0)FX"AFZXp4KXS,YoC,`#2F#`c#F0RhJ)FF;Hh2CX2I7H;+0J5J"3I" F^(dѫz=+$J8 B\O D=!HFVF@HFqOO dv 4+ H#4K (Or HF0Or # K"0R/< )F  $U |$   ( D Y (VH)FqOjxB=#<I" FF(+z=+?J8 B 1D+Hk h #4$ KFD@0! F1 Hr1PFF豆hN- JIFH/ѻh"F~ILp0 G#0 9?"#  0 ! FO T'&"JF F>??h"+ hJV!FFRHlBxOH!Fx0+-++.##;3" #S1FD0 Ϲ "# &C '##&0##XFh+@,#,,#"I@F#F#I@F?$ '#FI@F5# &#FX#I@F#'## F,F@Bȱ H!Fb 'U.x |$ $  IF(IHFIFF0G 8(FqOJ:h+*F@F I#0#I"F@F3F(##|$MIFF(FI"F(FI"F(FI"F(FI"F(FI"F(FI"F(FI"F(F I"F(F .k/8FKhIFpF CF H)F` 8"F)F $*FFH0<$f>^mFFOahFS I"F >hF m pmFFFOa&S8H!FP mp&iFT(ZH!FH!FM#C&h Tk`+h  &2F ( ~<$mFFOahFSR8 H!F mKh  hiF ~( <$-HOLMFF@F0 +*hOa FS sH!F.iYF#40F  FjI0F(hYF F dIh8 0Fh`IF(q^Ki ]I(,!(FF#p F,#3p=SI JOK +x3OH(FI秱LK@LJ @EX @&FpFH!FzEK @DJ@>FD9KiF8IP?e;IF.?\F7IF(Fȱ4HKF"F1FFBH F:(U%FpFC^B^A(I#F(H2FF(F$H"F1FO 4+ @(H!FOI#FH2FO  <$ RN]XnEj-O$OcjF!FTCF4pO DAF(F0sB'P'FPO E, FI GI(FFP$(0BH(F  B9FIF(4IFй `SFZFOaF+K `h8 bF&H  7 `+( bFH0+a `JFOaCF#9K `h8 bF H47 `( bFPFedA*<$j|d^Q#FFHF0I_+FFF H( Fp@IJ I FM(1F)F p!-O F- " F 2ܙH O`hCI I j *F  ڍIUEЌH*FQF&,s,x,}OcNK'#C0F0 &+ +/FTFO +F@<ױI"d'h27p8B7h7 p4BRєB +ZbE.F"p"+ǀP2F!C K   xx(9#wH+p,F{K@1𜀼[kм\^м$@%Zxh7p@0*@w/*O+bBx2* ({$(\(*XxB)3_x0/"ٓdEЧ1T$|Dl,7D$|O Ep0hD@H,3x2x(3B#A$ R@񓀼0%w?kWxS/]/\/їxF;cB##p+x+Ob1F(F.F0F1  \$|/\l<\H|Bˤ E\/$/Dў h 3:0*!w/rF{/X,/]/:hdd%e%`%\%+bBݥ1:R$|/Rl|RH,Bˤ Eݎ{bB݈1:R$|/?NRl|RH,B?Gˤ ElbB8eK Hh#+p],/?0]/?'*ȸ$(LJMNO#h(hCFH\KO2`1F4F:FK J Ih< K"@HhVȸ$^Qi_e%\%O$;hBKMh.hCK)`h"I"F hB 3 JxS Hr(.`<`,YhHg\%$ $V@\%\g0 KO2`@H~e%0KO2`@Hle%"0KO2`@HZe%#(LO3#`KJIhe%ȸ$d\%)(LO3#`KJIhe%ȸ$\%J(LO3#`KJIhje%ȸ$\%m(pm#$$Kh`C{-KO2` mp+D+(J (+Xh F(hh,Fxa+/KNhK*FLKJhh;#<$"YhBFћh#0F)F(FH J G(ѧ N#F#e%,e% e%e%-GHMH{KO2` HM(wJ (tK tI$`!FrH8(hpKhlMoNpO"FF(_ dK"gN$hOB3h+=h-@\Kh+@S$h:(8]K*F `TMhWKQ$h\WKhWKFWH)FS$B TK#h[ J)hOKh{MK"`h+h3+`FK4h"x 2h#+`*h*h!F(5K!F:Jh;hh1Kh1KF1H)FB!F .K#h[ )h)d(Kh+?_%K h`h+h3+`K`PP"O aC   P$[HYYJe%$Up$̸$$ e%$e%,e% $$$e% -U)3h+0+hV(K" Hh0UzKhKFH)FUB K#h[ i)Kh+ K"`h" 030Ke%,e% $$$ e%-G(mF#F&&Kh`[qNK$O2` F m+7+HJ |(+ F(.(?K?Ih?K: hh";#9!*)FF-6Kh5K6Hh4J G(ѱ3F2F1F.F-(%@h+(H9F$3&K ZhJE.њh"CF&HJF9FK K(FXh6??#BA$(FHQh"e%$e%e% e%\%ȸ$@e%v1K#CO KK)@e%0UK#CO KK@e%"-CMH]KO2` M(YJ (VK$UI`UK #hHQKh+QKQHhFOI ]!MHhJOBMT#x0#+`9h"+F( ;6K`+h+)t(pFFhI `]H!hJKh)FI*F h(Nh I0FHd##`I0FH\ `O0pȸ$bfCJKK`$e%0KO2`Kh+KHh@Ne% $ȸ$JKK`$e%(p F'M#'Jh[ `$L$N%K!h%J0h)F#Iv#h+"K"I0hhn1h Hx#hKJ!`(O3+`pNhI0FHK"`I0FH K`0F&(Kbh Ih>K`e%4e%ȸ$bfC@$&$$JK#K` $)e%JKK`$6e%LK"FK`#hK"`$$Le%4e%JKK` $Ye%-A F,N(O33`(&L'O#h[ #`("I@FHK#I@FHD `%h9hHձ xhH##`#hhK``Orih@F6K xhKh* FIJ- F Ie%($p$fCbȸ$q$jx$JKqK`$e%JKcK`$e%F$L({O3#` M2Oh I8FHȹK"`NI3h h[B `IJ(h+ FI.3h+Կ##I8FHK`8F(rhI(hJh[ `"e%ȸ$fC$|$b @!KO2`]((JiF0(HYhO(KhKh#KHh HYh;( K"`# Jp J`e%$a $ȸ$6`8\%T% T%8(MO3+`KhK`Hh F 0H!F F8@H6(н8@ J Kx1h I~#+`hH8e%$hX%ȸ$y@ KO2`](( JiF(HYh(K"e%8\%𵅰8b/KO2`(,Jt()K )I$`J!F'H"M%N%O"F$FP 5K`h#x +`+h+h!F(!F0Fc)h(K"`);h+K"h`h+h3+` K`e%$Up$$8\% $@KO2`](+JiF(+HYh( Hh( K" JiF(e%8\%-OF hFIIp I LD F({BKh;BKBHhO-p?OO -'-%-(Ѱh$Y P-#z6KO2`,X FOG1I F0K0O(FFO O ,H[F$p'(HFx&K*F(FF FG|#r)FF;#RF3!FK8FMBxF(FH(Ѥ-,FU#\%ȸ$e%j""-A@MKO2`(X+HJ(C;R#!B#?Ixx|+ (9HB($6Ih5K6I` !F3H/M$1N1O+h+;B3h۹ 'K"`BG &J(ѓh#3KH,;FR$ `F%)hKh{K"`h+h3+`K4e%j5$Up$$"0U$ $pFm@0;KO2` mp! #FQ$ F4,! .H.L/!(F F`AObn'Khk'N F1h1hh;`+ -#KJ Fh0H!FK O2`!F hZ ` "p" FB1F cM H,`#+`e%BMT$ȸ$ܸ$J:M0# 087KO2`0(4JiF;+0HYh(F+,HF)F*HF(F0!F(F, ,*#K#HhFh+HF!FHF F!F F-KO2`h+Hh!F{ F!F Fe%t@@~ȸ$@$p(LO3#`нp@ K NMh 3xKj3x+)h Hp@|JI(h##`pe% T%T%ȸ$p(LO3#`нp@޾ N M3xK13x+)h Hp@OJI(h##`pe%X%ȸ$@KO2`]((JiF(HYh( Kh Kh# K Hhr HYh(K"e%+ $ȸ$*8\%@qKO2`]((JiF(HYh( Kh Kh# K Hh, HYh(K"e%2 $ȸ$9c8\%-Am FFFObhFXo$B HiF`( ?V$ObhFBObAFhF4K"` m 8\%@ KO2`](JiF(!He%l@ KO2`](JiF(!He%@KO2`](+ JiF(+ HJiF(e%h80{ KO2`8 L#B%h#`H%`IhHe% $8C+W KO2`8 L#B%h#`H%`IhHe% $805 KO2`8 L#B%h#`Hl%`IhHfe% $81KO2`Kh+HK@+e%$.81 KO2` L#h!F #h!F e%$!F #0(KO2` Lh!F H Fv!F FHHNF(e%@p8=KO2`p(:J(XhDF33K4Hhd/K1Hhz,K.Hh.H!(,I hF [z{'Khd K&Hh< F)F R!N"I0FFP0F41D0F " FhAOh8GKJ h;#`_)F "e%ȸ$#t$V$(%80e%JKK`$e%;e%JKK`$He% FOF(O3;`(N#3`KHh3h3h"Ih H33`;`6, K"ph"@H%e% e%ȸ$be%d%(7&L %M#%H+`%Kh+h#`0 O3(,+M !J##`(h`KhFK? + F !,`F#H#pOb)h? +Ob!F H JiF(e%e%oȸ$ܸ$̸$`%\%z(8!L!Jh[ `J`(>O3#`8MhI(FGK"`K`MKI(hJh+F F( FHIh+h I(FGrK` I(FGj(J#e%$$fCbȸ$KJh+K#K"`K` $T$e%\$KJh+K#K"`K` $X$e%`$8F F)F F8@ۿJKK`,e%e%JK}K`(e%e%(-GF FF*|({nhAI0FG(f?I0FG(c=I0FG(iO,\Шh*`,Zh#Y%! g!F bF+K`+K`+Khs(J'K)Hhh)I)Jh+ F'I%K`%K`Khs"J KHhhIJh+ FIQF 'IF # OO%&Od%(O0Gt#D$H$ $ȸ$fCbL$P$2"RK`e%0KO2`H"( Kh Kh# K Hh H( K"`# Jp J`e%n $ȸ$s8\%T% T%s F(KO2`pKNh31hHp@(Lhh ")xjjhI0hV#0hRF H Ip@e%\%ȸ$@e%80]KO2`8L#H%h#`%`e% $ -C(BSKO2RO;h+QKQHh(;+MKh#JKLHh$8h "8Yh;h[EJ "DLhchME3%>Mch;c`+V(F (Xch;c`+Y(F (O5JiF(ѩZi2`+c` FCF "K(HhK`#hZ"`x.p .;h"hB3;`Ka"`13;` K=a`#+p5#hZ"`x +Ѧ0KHhi#hZ"`x +e%$ȸ$  $K $@   $$N0zO33`p((J(!XhN??F FIZhKh(-t##e% ȸ$L0>O3#`p((JiFO(!Xhz?? Kh^h/ I2FF(F+s##e%ȸ$ 0KO2`(ѽ@H6@IhH0e%  O2K FW@H2I@hC"ȸ$ -A@O30(( JiF(XhF(H^F`xK*F(F\F0FXD4 Fl"F)FF"FI8F2"F1F8F.8FB8F#0F0FFM"e%-O@e(KO2`(($Jt(!HF(7xK*F FOF0r|#N!FLF;#)F#` ;`#HKRh(FFLe%"4e%@e% $v1(FO FO3;`hI0FFKXI0FFFI0FFA($hhBFJh3*hI$IJ`h ` h I#e%"!f#*!ȸ$2!$$N!-AFFF[F8K:FIAh @hF#c`0F JhF``B=H"hIAhȸ$y! $!-AO2M*`((AmbhAF0h4*:F "6#h+#+`LNO "e%Vȸ$!(NO3 F3`н@7Hh OF0jh8h I@@hF#c`"hI8h#3`e%ȸ$y!!80 KO2`8 Kh3 K Hh8@L#H%h#`>%`e%\%ȸ$! $8<8C+KO2`8Kh3 KHh8@U L#B%h#` H%`IhH e%\%ȸ$! $" "*8 FKO2`8Jh2KHh8@ L(OIh%h"` H%`hHe%\%ȸ$(" $U"]"h;`+ڊiB ( hZ `ppGo-OMXaeKO2` M (Jr(ІK$M/FEуKrhIh)Fph "54}IOBO#w&hO ;iBҀuKh+FF+21 TnLO F+x˹#pmL#hhh?FccJgHh\J;iB5$+ \+Okx5;+x+5YJhjxP1@%# #eF0;jx P1@:B3  FBQ#22R#~Di*5B B FS S fDO;H0K6Hh~*KO2`Bz21Jh)K0Hh0JhZ&Hf   "XF"hh G Jh:0#K hOBHN0#hhS?6B?e%@ $$ȸ$#%h$#$( $$$FhF##``hF#c`hF#`K "`Kh Jd!F KhCH!F$$ $ȸ$x$  Khp Jd!F KhCH!$&$ȸ$x$-AFFFt%hI*FFF2;x ;۲+!2FAF8Fй] * :* HFF2 x ;۲+ !`(F%FpFh F:!0FI2F(Fh##P+"(FI(FIp@0F]F"0%!0F#p I2F(F0FF+"@B@$(T$I$8F@hF#c`h=(F!F(FhF#`8FKF FFh(< :F)F0F ` #h+H#h+ ;\ :Ҳ* C  Hx *3 #`T$W$0x#OFx p%,-Cx[=hZ5`%Ղx 5PW$7$nO۲ W$7$0D p10$0$0 ph-GF FFFnI ZmI"P P#`#0+; 6fI"8F(# `#aI"8F # `獱(hFf `hhb``h^h`+#`SH:FIF@F F'O0/!PF(OPF>F@!0Fh%`+AK"`[+:!F([ <7:!0FpF#;3x&`-1 "(F|+x;x#BOsB%H;FJF)F E(F*FQFFRh+3` (F`` h++Kh-ѥh-ChH+0`(Fq K Mp$$$$$x$$$>$h;`+ڊiB ( hZ `ppG-OL I"$O3FD D@D(@ۀI (F0 x x{H)F$ :# F L O &x+;!F(ЁIFI FF(~I FF|H{H*F!FO ##p +x+-+x+/!(FBF@*@jIz5+(F'eKh.++@,&x6^I F&-(x(WI(FO`RO0!Fd gObF8F2  # *Y # "0 F00+F9K 9H*FmO o(F#@! @K ,K` :!(?.#;&(?n#F",F+FfF,Fc&FFOFFFF + m(й-йuJ#I $($$$$%2%>$R%x$ZlY%%$$HF&,I$-+x+𡀖Ob!FNIOb)FObObGI8FlVODNu eCLOb%h#`3h+[@I8FX P%`t#4$ $"e%%#0$"8\%-OmO4*! +LK'<(Q)PP#=%N$S"< ?@&H P6KI<0KPLQMN<1,SP1R(K0x#IEb}H3A3A3A3A(+A3xMxk,JhKhgH&&bKh[###xN+^H&/!H0##UK`&TLUK  RK8 hC#~##N+@ÀJKKJ&KI`((&HH!(~@#8#;K9L#C(##)&7Hd\6Kh+q5Kh*O4F&FF'F#J#hB#-I(@q+K))+@K#R𤅶??BEsڷ??@uI??BAKh+@[# x$(&&0$','@e%He%4$8e%k'Er' $$j@L&I hK h#RєK hzIOR`wLOrK F2K`*K*N*2+0ъHp*KJ,`*+*x+𯀄H<\(Yx+V$-O: 0`F@FRFIF0FF($+uH#x+YFL F(h$5(|.Zl' $N( FkO #!i@Ci20۹h!`hd ژHkhi,c9F@BRF9F(F.i+ЍHkIFh0i"isi[ (F((FO5#H10/y(|Khk/ = =0 >>tKuL@hB!F@FX4(;oIOBoHpmKhhmKh/Es#/0< F!F F0Ec#01< F!F Fp1ES#1.(?6TI SL h(< PI+((  h(< HKh+1(,4M(FDI)K(FCOBI(F AI(F@Kh.F?N#C0+L=H!hh#;I(F h#$8IN!K6IhF*KhT<1$H-J0IKh8/I(FMP(F+Kh+H(F(](K(F(J)IZrh9F(F6h($J$K)FF`(ȸ$$$$(%$$$ $(VK((t$@e%&( )((($)j>)I)&&I(Fv("+9&MK,FКKh3K*FI4hIBF8FXvKh3K*FI4hI2F8FHI(C(0ьH ?Kh+KHhL (%" h*n5"hF3FmF(Q !PF쀱06 "36x rJ3h20Z O4#F&FF'F%Fe3gFO4%F&FF'FbJ2QFh6(@L2+ ]I4Рȱ43 "~XK)3x+#1(( F OI4o(HMI4i(4x*+044x/*X4Zx**)344x+@K#C?H7 "<F7x-+07 "4.FHEv747 " F7+I4 Ps4FC { w y | (?iO3{x+bs8[I44FQ,)b& $ȸ$])r)))T$)]h)He%)d"@e%)*(*I4I4HI4FHc 3 }I4|I4F(?"(D""FP"rI4( **9лjkHYF r*# *xBdH"dJ CbHbI"*_H @1]KBh1KK?)F<#PFD|XFDt%(FDn+?+KHH#HK*FHIh#K(F[AK*FBIhAH#x|+! O4F&FF'F<O4F'FF&F4e%$$ȸ$@B@$,T$,8$dK,He%@e%0$s" F IF(I" F@#FF F pI FJFXI" F(I2#F %h++HPxC I" FF Fp@$$$$-z"𵅰#!2Hx0Kh++!F3(I  'I 'O'M'NB Kh+3!F:!R#L(+hB #+`!R#_4hdI F"8#x|+ FDM#3`+¿33$$1yx$x$0$j𵉰 FFGI "F0F+h#3FZ8D$e%>"Kh `Jh3`0`$$("Kh `KhSK"IhC Hh3`Ch0!6`$$ȸ$N$h KhSK"IhC H 13 1Ch0!`$ȸ$N$ K"`KhSK"IhC H! J131#@;`$$ȸ$N$$KF "`U Id" Kh0YFFx FH!$.-ȸ$$K $`,J#`J`Khxr+s+I FId"Id"KhFC< H!p Id"$$$8e%i-Z--ȸ$$c-FF0$@X^0Y@<# J h20[aջ O$p)5KBF$$hZ`}1-O+K"`AF IF  @BB  L#hkKE иٸи? G 1kKE йٹй? G0.$x0+\ Kh+?WGS,?_h$$$ad$-A!N 4hdHRKO2` FApGO I#;` AFF0hL1hHv0hKI@F"`@ ;hF;--k G)F t缾$-e%$aT$$.-OPLdM"FF#FiC C C #K x2V (hhCFBF{H9FzKO2`$ 4OrYi FqK`tBFnH9FjKO2`9F # %S!i@CiP@BQFd*FQF0F`0Ki3YHYI3Fhh!`hTH2Fi0i"ici[ (FB((FZ#"iO iKHhv9/'p7epO@F0'z H0/<.+3<1#;>0$ȸ$ 1$0F7MM+h6H5K14KO2` M0@ټ!"A  #"iF(&H:%I"(h(h"K "!Fh(H&K1KO2` l մObiFCf( /( Kh  % " M0$21$e%T1m1$0LO3#!F"HKhLKh+*ГKh+ $$KhB"ѐH(" KhKHh KO2`KJhK)F$! FP~KHhz 0wKhB LHq( ! F4!(VuI utK#R<qH(F9 F3hK#R/eH(F,^M kh3k`s ~ m > FtMH#k`WIhUHu( (PHk(OH!rF  JI @K2I\`XFKhX3EM+hS  8+d #=H)Ffs%K`:K 7IX 6H6K C ؉(pCOK,Ih IK.# 2F+F.)G"H&8 ؉@$8e%%g8$He%$$ $̸$ȸ$12\%\%"$$e%,$@e%ѩj:QEdK2r'KH#(KFH(ᮕK"`C  KO4h+@#Bqb Xs.@ ZeHJ [$C&F;+ VJE ؉ L ىXKh0=4-s(!PH" . # G# $ F 5DK#*s (&h +L:K 9h# ,8hr#Cs##~ 23B2 (F 23B2U hY`x\I#BqK hbK# hH@e%1Xn8\%$e% $22@B2$4e%$$He%@$\%8$ȸ$]2L$j2M(h(,` # # KO2`V ]x Xw +? G| |,$e%ŰJ Ih# FJ g`JK I KJhKhl@ +EцKh+^O2# Jh;#H!V(X}L%#h+O|KO2` 3@Ѓ3@уwL h(~O3#` +@Ƀ +@̓gK`fK``K $iKh+,Kk x-+ +cKcIh_K `Ih+  E(FXI WI K K TI(R x|+N !(g /!TFh+ h + EH| ##p Bı !d /##p(8e%8$He%v1$$$̸$$$$e%,$ $ȸ$12ѩj0(e%>~2\% yJhB!vK@uKhB?ٮ3!~pK#RnH(Ʈx+!hH(fH/ dH!(s\KO2``K#*s |K+M YI((WKK WK`WK` C ؉0 pCOLJ#`KJ`KKh*1JK@3AJJJH x|+! ZFI 0, + BH1R8KK`8K`>K @  9H9K9K8B < A+K4Mh8 < O05/KhE!KhK[h+$+Kh+Kh+߀;+w+OK#RI G ȉ!J)< H%F\%He%e%@e%1Xn$8$j@$$$$+LB2":QEdK$4e%@$\%r' JF ؉ L ىKh8=<-(fh +]ѓK  # G# +@?K#+)?}C@=Kh+?u KBp!???c!F# ##0RoK h&[lI*FF FBiH>( gH6aL Sh;S`+ǀ $AF| />VN />[OT[O#C$ "#B&F Sh;S`+ B? (4F#Bv# "#( hY`x43 8FT!h#  hX;hAs##2-Br3B2 Sh;S`+" F /+ [-G Z h +SK [W hY`x GJ13A1KxYG瀣$D$8$$dKȸ$32,@$@e% hY`x8%I#Bq"K hK# hHFLI h!hH I -Kh+?,   * ) +?3 G. .8$ȸ$222}$pGKHhzȸ$.381KO2` L" hF( HKO2 @`d e%$;3F^IFF F3F"BF8FL hF F8)FA(4Vh;`+ڊiB ( hZ `ppG L#hK H I P0 `#hOaHhK*F"H$"5İ$5L4S H I *04OaHhK*FH$55ȴ$FJ$!F FhϱF5FEмB12,FF!)O0F8W-OFFH8I@FXF0,b O,[1N1K2J 1M)F0IF(hH F! F O" 8 z+F F5W?FCF IBF<, BFYFh^ "F$0FhGCh " FQF|$$5$558W56!16?KpH!x!)$))*!x"F4 ) ))Y!)&F!x"-=& -)&2[!)H!a"x!*Fp!H!!(\-Uxݹ2%[H()(*FV5x2F6-"-2F2[![F"("($]8LK (8 K8#8`$8jFF $838$%$𵅰@LAN(8{JixF#1FR6I6H#OB(ڂ0$8+ 8hhlCF)H(8# "H|HCz3,8H)h "#8F08 8$hh`G483+z# hKB I g I c$k%#L6(-1ypGFI I"F @h89 L#h32 `KhB|#hXBXA]ȸ$KJ-OFhh-CC˰O!2ah8t#as:4 "vA0 8 򏁵@PF1F A0 Q0 8F F 33C@xKJOq h2J{IEF IFPFJK 0DFJ[FFqDOaaPFOaaFPFF q0DJ[FlDj K#Bs NxOF0+3@rI  y0+R(𠁜I |Kh+dJ 1!bDJ;+{K8FAF텋A0 FYF JA0 q D {+{dOd [F4Kh}K*"-:Dh * yKzI DqSuJ[ uJDtH#:FAFFB|+@#ر!qkJ[#0 #Dhc 8t#as:J IKA0 (q8 Ѐ ݍ8A0 Q0 % z/CSO"q-@[% 2 AJd!q 2KD (|'K %D{#*s ۵ٸB|-JOsEs 'JOqF d$KhFA  S! bH!Y@.AXe%8$$he%arL #HO0hZ`xMc& p`nCh;C`+!CР + (,(\( `nCh;C`+B> hZ`xhZ`x)F0`hv4e%]D:e% FOF9F@-.!0F*F!F@#Fp9F0F*F|]d F$$e%-OFNF3x mI0FL`fHh+ЕH1F@+4.!#1l%(+0K(FF(0@e(e (-@aFY (~KIFhF(@RIFF(5FHAA8h8FH`( (n(l8(*S s9Fv(Ьh_IlȱcnB( WHVH`nO0_F(0+8FcnA\(BHBHnC(0+8F:Khc`nP$hZ`x ( (@ʀ`nCh;C`+F.K/Hh#-NYCS 2U+I`nBh:B`* A$I K$Hhhx h 2@ B"p (z`nCh;C`+|BhZ`xi$e%^:\%f8n:::̸$ȸ$:$h;$0J`"ch.IB.K.Hh`nAh9A`):"Cp (n B 10hx J; Op3H9FFO0+Z abi2` (?=)>KHh6$$ȸ$f;J;e% KhF;sI F@1xI" F*hK"`320[K"Z`I F@K"`I F@ K"a I F@(K"Zah;"\%;v{;h;`+ڊiB ( hZ `ppG?K@Nh5hO33`=H(6ѕ;IW<e≮$"0Ue%ľ$< $4e%$$-A FĀ(M0.hO3+`%O;iSO0F "K"HhF H=(H !P(0 "$x3J3h20[.`( Kh;i3#;a,0+L H!h!h + $\%ȸ$<<ľ$he%$-OF|QMx0.hO3+`LLchc'KKLHhvO0.`FfFGH(cEH !#pBH.!#p>H4(2=I";H`ذ:L7J:I8b2#7Icq0#4cp.P FC   (#K"F*Ih"L'I F(O3 ??0;Cђ.` ( 0ch3#c`/0+|L H!h!h pq $\%ȸ$<=Ⱦ$ =ľ$=M=`=x=$e%2!FJH<I H=i%=F F !@ IF @ I2F(FF` I2F(FF(I2F(FF9F @ F5==>OaL F pX% K"-A`KL Mh'h.hO3#`Ht('H !xCx"+0AF#@<x cE" '`.`"*Ѿ"0+3+#0 T%$ $e%Vľ$T% @BFFhFhFtIF E8F)F(H9F2 +x/+0F1FFF(Ft(+]/+ >-O$hF%FB.K4$hB"!F$Fh1F0DoO CCFE? O ;hS%5B8F&  DE;hX3FhBE +  FzFB3 #Pe%ȸ$jF KIhhC 0 н0+P#J``P#ȸ$ht@Pe%(FIH*I JhKhD` hKhD `h+ JhBĿ` h+JhBݛL$D$=>H$P$#Jxh320[O04 "bxRx*J3h20 b; * +R#GUEQ@p]hdF0L#h#AOq#F0)I #h+OS#`%M+h۹#AOq0F+F0IO+h+$OS+`#AOqK0Fz0)hH#AOq K0Fj0!h HpO$g>$>>>-G&d5FO\O ] GBҞB#;p",, <  ЮE5\,М@BDU85-OM,FFF$0:##;U%+ХB4Fp ` c.B,/.-.=%.ڀBc%!Bp@ހ4TM.0+ĀjKkJh+F;/*m..*ХB:U4m.n.0+^Kh;/*ХB:U40d..Yc.WsF;/*ЬB:U4OKh;?0+0/(  x F1(ј0)  109  ! 9$x/)sE3(ЪBc..ѥBRapBL٢~TBJ4TqFO ;sEٸ/);B4`/!Bp+ټ O<9TݕB%9 BT4+"zTB>!4puB 04T K?KVB4pF FFF\%jT% T%$T% pGFFFF1F8FF툹 J"`o#` J"`O08FC\ *F"T,##`>BNsh;s`+ 0F (|o#`3hZ2`x +0K#`>>?-CF OFF8FCsFBFH /IBFaB #H9D;U$BKI J K(hhhhB+`  2`%?5?;?E?$$ȸ$-Od FFFF  $ #CQF@CHF2PI@BI"F0FKh+6Й FyhBi/F:i(Fi CF$z#& bh6@C9ii0jI `@Bb a`fH6 F d "!(FDF_I_H3F" I"F ?2I @ Fb0I"F A@I I b@@𵛰#FFF03 FKh?O#H?E#H{(F (XۋNO(YЊKhnF(FjD4 F~"FFI"F0FD"F)F0F@?{H(F#xH$F F F:!F F oHF(F,!F(F,Z,gHfKO2`$3h*F8h+=bI&aHP"$B4]K]I8hWKO2`?#=(F!F(F?#=(F!F(F? FGI 0hTAHF F F!F F x+7H7F(F!F(F|,/K`/Kh[O4 #` FApG%h!:N$0#0@6OF1h[Br23h+0! . Q t#9s Ozs"!"rC4Lh+Fh#+O4><"(F$(0 # ,h+&h#+DBD(<#`$MbhpGjpGCjC#"!h ]8!20! >F (FR F8#`Cb$&F0!0F>F2F!`Fb(F&#ObOq(FZ FpFh h$`i> `h> F> -OFF FF0+ !d[Br2fC,j,8дBii8F(4F6"F +j+bi#Da.r2F(hQFB vh+zrh#+ulhbhh+\ѫiB`"Fhi9F,b$aLFFa+h0 ##0O 0+P![t#:s-IOxOzs(x(BF!hF?.h+h#+h2ع#b F h#+$hi!F>3(oO86DDl(j KhT0IF F<#`bMbȸ$9$Sh-AFFFO`>F``0 #`#bOc`j#%(Fj+!B5B?ah*F0FD#sUh+D5F`bhp3" #FFPj+j#i+n#ibhY!aTh!iB I`hAF>F(0 +}FFFF1F8FFjC K#`o#b K#`O08FC\ *F"T,##`>B" +FF0 + K#`#ob>>zApG!!H|$j%K!Z0K<13H1hGpG$j%aAK-A°h#KhCKh,@ BL !F!F H! |! xzHwJ1 wHwI !<hGrKrLh!h FkMA,ǀlF#hx@+9kN#hx#bK1hGfHgK*F(F(4 h#hx#hx,+#hx##hZ"`"p11h[hG(3#h3#`QMRI(h@FhPMGN"FOq8FH F)hIHIHkkFF`0)Fx08x + F@HW3008FZ "pP(7O9Fxc8x + Fx)H53x;x,+x +x#Z"pOJ1h[hG FR 3 FK!FFh3Hu%v%,v%$j%B av%^ v%sYJu%\lGAA8s%AK! `v% ITK"`Uv%m!KH`v%,k% Kn:f*oB (КmQeppGIW@-CFM O"(hl1+`&O h "(h ^0s FF H>I"(hos%aB,l%v%&H*! ! CF3ИBH! ! F !F K/!LA F`A" F I H I !FIHI,B2BaT$8BDBK"sLXhI1N[P+x;(F^)FFphI"phK "h0n+H4pu%a=u%Nu%OB HP"iFu Khs K\A F(H!F HzlFaBq%agB4BF K!h F\H!FHZ8 bu%|BB K|Al#x[ FK!FFh> ^ as% K7FLA/! FHAJ# F+FL0!FaJF pFx# + + `F+FK , ,њB10 kx pSFB-AFNFFt2h*rh&Fh !FH$Ff=C<HAS ,-)2D@Fhs##J4^ 2BB-GmFFbL)FbMF h`K"`I`"`KXh_K_I"h h " # 0" h *h 0*""@ +QJ! :PHOI GLOF ^FF#hù" 0+O3#F @#h +*/d"Fx F FFIF H#I<1$K"IXh"J! L+~h*"" @BъMfHmHH^u%<Eu%u%8v%s%aB|q%u%r%CB6Cv%v%p°9HOrF(@6K"6IXh(! ! 1J! F/K0I"hP%,H&F +K<1C (Ha 'K""IXh%J! ! ! Bp FFF(݅BK!h J)F )F ~HT(FBu%<u%u%8v%Ba\Cu%r%s%JCp°;HOrF(@8K"8IXh! D! @3J! FN1K2I"h6%.H&Fz-K<1C n*Haw)K"$IXhh'J! (! ! Bp FNFF@(݅BL)F hP! hL )F )F H(F8Bu%<u%u%8v%Ba\Cu%r%s%JC0LF hI(F0JCchCc`! h J! 0#ch#cs%fCr%0 MF(h I FHC3(h! 0#3s%fC7HOriF(a4LhFNcy#cq0K"0IXh1 #10D#00#01 1 #11KHi1#!1K`1 #12 #2 23Ht@HHiCau%lfCu%b"LI h Z hI"@s%{t zt F,!t@ 8F F 8)FU( 0MGI M0(AH?JOaF;KLA:K,FR PJ F2J!F F C -H42 ,'IObF"Bѝ 03 +IHd,HIHHoIK`!Dx *#Cp H{B8pC[|CaTJC-l%CnCC,k%IHP";HDOr@!L( ` IH@@b HOriF H@KhF!hkz9v%Cv%CBa0P"MI HLHQC+H M0@-(55Or@!>H M0@ JOa5hF J)FhF+ M09v%C,k%CCDD8?P"IHFй HI(8@ I Hٽ M"FlTl1+Kh8@78v%C Das%pP"m I!Hz MHQqBF*H mp@+mIFTF8H1F mp@J5l!jJOahF, IjF F mp J9v%2D,k%9D DaQDvDYDIH DE-O(F K'ĒO5K"`%缱=I,$'J#O1`8J`8JpO3%O5 O4 1IS"HFB+J>``+Kp,I *I (I &I 0$J !$H"H(O!IOK v%$_BIu%cIF&H`zfHH`Hu%HG4v%Hu%#Iv%s%p4I`p%Lt%Xp%-I"-K:``p0+I+H!{n|,'H(H*k'K-O! #H#JRh "! "! Rf"O4&F -0 D OYHx#-DT`jq|!: x)"+x#ZH'XF; PF;"( F1FQHQK"`O4&F2 ";FF jP%j x)О)EH2;% Z x)?H2;% N ;'%  D/?W ?2"P ;%{ 2 ;% G' (/%$8 ) %; , ) %' %/ %J 8#oc(?H !cF3+EB>@D4NONO9O$x%SOmOOO?̮2,QF if QFg B1H-0HHO4&F d,H,H,H,HFvD+ %dO34+ع?H hBH;2 %t+ hBH; 2 +H?d?{ ]POOOOO0P@PcPP-OF O0 ;FO0;FjHjJP %hQhC 3F   "Os`I8#_K% o h   i6F@VH,F/FO5FFFi'F%FFFO21FXF?IHO4U'FPF;W0F;T (FIFG4`G ùO2 QF8H3@FQF iX UIy F !g(.H; !g(1F XF AC BG+O2 i\HJ+O10FC#OcC#_V"1FXF (H4G{NN(cOPyׅPPP-CFHNFF shEHZ#Oo FO3|??" F |??5HDF8C1H;F/HJFHI;CFFK G@@p@BgGG/8"KBv*T2Oc!FXCzs!J kD I, ,."H,H)FC@d@pDtv K#(cPQ0Q?QFQ@p (H pCOK ""[h;K#F;,p$.F"F)F C$D, H+ HJ! 2F$x%LQTQeQ-OFx]-+Cx{Kh ]Ov! ]|,FOO F1F逹0Fv"(F(0!F UH 0CRH!FPH#"(F# 00Or@!8F(FF p(ՀLK5KH0M(F.Fx{"F[F(Fv(F^0(D)F=J0F"M;:H(F/Fxi!:[F(Fv(F:0(D-N)F8FM2FWྃx%׊{ Ĩ%Ly%H&/0%Px%z8άh}%XY͖p}%x}%}%uJ!H\(FH eS(F.FHK0(F)Fe5xK"`  #4#H.(?"x+?*F0Fz}ȇ% L5 Kh+ JiZr Kh+JiZj#5x%% %K!JAx% KJi5x% K!J)x% K!J x% 8KLh+JiZ"Kh+JiZ Khk 5iB#58%%x% %@%pGFK![B@!J׽x% KxJiɽpGx% Kh+ mH%KJix% K!JXi𦽌x% L5J!Z5YJ!Z5 J!Z5J!Z#5x% BKhCCH@ `pG`c8MFJ!Zh J!Z`b J!ZX#J!ZPE8x%  KhK KE4@ F@̨%x%FK5X@0g F@x%FF#XBXAK!Jx% -AFFFFR PB??FH-H!AH)F (BH!H)FB8MLGCH!@B4B<L-"F"A(ƒك aO5MKhb33BpG}%8CMF+h3H!*,`8Xc-OAq N2hbRkh `p 5Fdcd8I p97HD!84H=x1H51J1IW1H.p@/J0IN3 9|!(,HF*HFع)HF'K$%&h&Kp2o%pB! H~I FxI FPI F(I F(H!d(ЦLpp瞃ȄԄ~%&4~%h}% K\pG}%K1F0J FH !)IHu HR@F F J)H F !pP,}%C~%>Bò****+  pG pG pG pG pG pGFx+F(()#B #RBҲBbx@) \*3FxF8( ':F`xa?C`x |`Cx`x|0Cx?Cx|``x @q|C!y?Cx |1Cx`xA|PC`y?Cx|Cx |1C y4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`p}%FKFhh)ݔB 4`B <) x'B F~%B}%I"x@DcB ѡ"c+ !@%` XBXApG pG pG*-A FFF F.8` `0FUF(F7(#;`,#`(F3F0FO1 J)F0,(F(##;`,#%sH,FxIv%(FpI Fl( Fp@HF(x+! 0FKJ1F#FFljiԉމspFH FXd ch"BhIh NhBp0([h21F(F$h((HpGHHԻg %sFhF(Fv!* FR"h#R3FF(F+p FFO1JFh=+FF h:%7L (8B8#D80iF(F+2 8 8%p(L8B=+B(D (BN%8#D3h[scڢBX((F"8 8 8+2 p"vD%x%sFLN8xJ8x8B'phF; 8D2hB8 8D 8hF#+8l%x%pLXB^8^]k. KO2`8B x@ p 0F%x%LN8#Dx3h[sczx8H FnpD+%x%7L8xhF (DKhBF(F8 8D 88x[ 0;B8[x+hFt+8%x%K8xJ %pFM F(F@sB p(+BB KO2` xU;;;%xsF&,xt2F!v(FIF( Fp8 L#x%X.8O2pK`8 %xK"8p ((( (O2K`pG%xK"( ( (O2K`pG%x-CFF(Fh *F+ *# p&1F&AF먱0"+$  F&*FOav(&!IF(F8 ,5дiFB(pCOѴOqCJ FIFJI F@!FHtJ I F8 H!Fk F'0@%'0x= O x(xL#h07#c`#hH#hZH#hH#hXH#hH#hHK@!hL##L H HH%/:FR\gDSg /#NHMhs`@4@FSM(F\h(FW HS,, !@FHFHH%ij1pFKFFX` 0F))F Fp@H%-AF FN3hhF8(FA¼3h#c3`O"F0h9F 3h#2` ۚO(H!(FнA̾H%n+@p,XMkh%+F>+; +p; +R#jiiiiiiijj k +R#ijiiijqjiiiiij/+"7+)hq)`p@>)ip@U#x%F4++ +,L h8h+x #`(F `hFq#aAx"+ixp@x"+i@xKh+Xp@tx!+(j88 FO(bKh+q(jIHp@@ Kh.dF$m1FHp@H%x%Lx%K??h"@ !H Kh M+ LO/h&h*` `KgW/`&``x%̇%@%}%-CF)e LFFDO3FMdd2#00CԱ#Bw#0a0+Л,8 2 F F"F .%}%%KXh8 pGH%KiFH[]pMj#bp@ο7(kh+++ j(hyb7L Fv bpg H%!F Kjq`"bbH%8FrD,DB8 -O#jLe&-hO#`hKh3s[;`O 0C\KhO0);j+Do( (( P;MKh JKhcH*DKh(0 kO  ~:H98+0+e.7F԰Ԑe.@ch+q+o*+-+,+) - -'s9FhHЙ0: M 5HF/+07+0 +)(F(?Ich#;+P(@KH%xx%x%!2FF(BSB <,**+B8F!+ 3BZxw( F7F7F&[K# F'F<`E$hxxBUXx]( g(  5`d(f(d 羱Xxg( (xF3(?+H+F30 hZ`F`XxpG-OFFF ! 6F(J=D?XF+ ;NFO5ً FFH(ڽ@!H%ۋ FFH(ڽ@!H|%K FFh(%K FFXh %7F MFh(0 Fx+h!F( 猇%-GFWKh$$ F?!FF>F0F6M-(F(FqF(FVO4!6F("#(F??0F6':F1F(FF(F4OsEWE0F62xBrxM*Ѳx+*xG* ,<+9F0FB,E*,n*FF.F#x+5*FAF F,D;;xx-OF8$F%FF ,K,JF,J8F!(FFKhO0 &JO;F(F_Թ/ݹ LFMF F)Fֹ8Kh7KhCXе??R3Kh+N2Kh2KhCH#0)Kh+,HS F)F??F FѸ!F(!F( 9(@F;??кE K"O0`O#0&.Wx%%{Px%%@%%g% KhS Kh( Kh+Kh8pG pGBppG%%@%x%-GFFFB#.KhB̿&&F  F)F??F FѺ ѸEGO0U& F)F.XbpFKh+`x%̨%-GFFFpZX 8 Fyo??F F6KhG.K h9(#"F8F+FlFO TF F aoI??F F$%F}%x%-AF FF0??F F AO0P*F#F8Fh)K(FFhB pG{K(FFPhB pG{F @F޿8FMa+hB F(`# IS``#hB Jhh;`5 F8@5i:ah8x%{Ї%KhpGЇ%FN F4hB0! F8F#B5F#vca`+h 5`\`+i,`3#a#h h8F(X$hi2ahBJh3` F{Ї%hpGipG Ʉ 0 FȄ#vpG~pGCi DCapG@ipGhpG`pG-O`F F?? ;O4%F F)FKh+@🀄K FIh hCEs)!O1)F F)F=('FF0A (@8FAF>F8FAFF BzrHCF ( nBnA0 ,a{0+F F@YJhYJhQ @3euFXF!&8FAFF(wNKhe#B8FaAF* ~EKh+?i.?fd (m (k0rO?O8KhCZk?ho AD2FSF6J wk jz mC&{ ,& B Fa$KKh+0 (0K"`F FO oDauiFE0ꮇĨ%%}%%8%ܨ%$%,%%-OFF,w O8F@FQF DFWFsKh+rKh@BOqw FO3"F;FhKhCcG3F(aKhF - - (\ (Z00 (T^EA(F1F((F1FFF@FQF]?F03C  ( )(:6Kh6KhC4 lF/  cz gu0S0FFBXFa KhKh+K"`#BA!(F1F (* Kh+? #(F#1FK(?* Ĩ%%ܨ%$%%8%,%%??pF FB ( (4E KDE4E0(&KEpPcHc-OFF F!FF(F;()ۄ,o#3#F F F 6 F F !0FPKh+} O(F!FF0IH!OJFoF??FFEEEt A(?v" !($kj CD䲼D_/AhDF /p>Kh+L+N@Ibhk h2D+l݂BNMh)Ffm"!F .D>D F0KhDB/N2F!F (=-_(Dlj+hhD9FuF((b+Kh++'+RF!8FH;P#B;m>F:#7FJFCF8%؇%~%%`cx%{$%;h+#RF!F0F-CƲQLFF0P#! 0 .HKhj+ #x00 IbF0d+:FCF0FVFi`2B5Kihsch #hT`-0+Рlj#d3@`:FCF!+ +0Fxb8FAF+ѣlZ#DBd@`HXH#IF#bFdCFd#b(Ѳ؇%8%x%%~%8%Lj+b8(F؇%-CF2LF08 ('#!i`Bfheh0+ im!2H#h" HO #`KihB Kh;Kh0+#h "T"T3#`#h"TTT"3 Kh+и#h "! TZT3T#`T؇%gx%y% y%%Kh[hp@"ppG؇% Kjz Kh+#~ `pG8#B `F pGZhh\ `\pG؇%%K"b"apG؇%??-CFFO0F F(?FO\ и?0 h"U3`-,`h;BP(m8ah4{F؇%%(-GFqFO0F8a(!Ohh<Um (F:0Ah#D3`-лh;,`ѹ?,(1 2; D DBټh h<  F؇%%KB hB Dh2[b2@%KHh*J!`!`%k̇%p L#j+3d+#bpcj&&b]0BH1F,O3@%K!F 39C < K JbbB  ! b3 pGp%@%p%-AF(L%hBpBA*۠jphb#aXh`{(Fx@Fujz#hFEbj!Q`[h`pBB-hj'beBpFFFF'1F(FcF@%VK-GFhF$&??(qML%hB#Bs #EBF F1F-hyB`b2h acEr9q( bFĠEu +FJF F1FPOExi $@%%-CFaTF F-FF??.0BEFH:F+x+m(Fl9H(F7Hx++xF, Fo F3 8FF8F   @F#HQ V4KHF"`a O(FF(PFF0F!D XFF9JSFYF F0F3J HF眏Q̇%|Ss-GFFFFFuF@5H!O5(F1I FytF/H)F.H: F7,H4O4(FS(Ft! P??rHEy!FFBF8Fy! 6 R +K "`9F0 ,4CF9F0綏=zQ̇%-CFFB??FF4 ??FO0 F$%F."F+FDEu BF;F0FJ?? O0a+ H"A+ؠ'H!9 p%ԏ.(?$( '(Fб#??H!^(Hc` #aKh`(H! Kb`Jh:% Jh$L`K`h4Hp%x%؎x%P%J#3 5+pGp%@ nF`mF(FKh#`px%lF F#?? ДNeKh4pp%x%pQhKhKbBTbD?? B Jh$EihB2F F)Fp@ȹ(px%p%%@KhhBH!?O0O1x%K5"h3BC :pGp%K7 Fh5H!0@("(K`0H)FKh+H F K`0@Ϳ Kh+ H)FKiF HhLx%px%0@cD_kK"`tx%Kh+ JhSCJ!JC`pGx%C%(*0 x.+1#I"K`#!H!FIXH!FKO2`K`Kh*KHhI(C\0*  #< HFy{%ǐ͐Kh+ JhSCJ!JC`pG|x%C%(*0 x.+1#I6"K`#!H!FIH!FKO2`K`Kh*KHhIR(C\0*  #< HF| %#ǐ? FF@ F HiF]p(pK`Kh+p@!HF*nF 0Fp@C??F F0FdK(F!Fp@h%Lx%c%F+F + K`]UKiFHhehKF"`@Kh#@H8%%(7 F/0 xm+M+h+!=+L h s+w+L55L5T2A(F `0 L5T L5 L5 KiF HhKS"0 p%<%0KhOpG%(pGF0D,'ؽ@K"H`#H HHHHHH H H F @x%I{ۑM-CF-}F55.4M$ '#F xF10:ֲ .bU" BE$04;,+р,&K`c]%FhFFOx-+0""x0; +FO F0 /.` ##`@B$##`O0.HiF 08C-OFpNpkȱh+ +Ci G#sc Rsk"iF `OFx*\x-(ZJ$(,(٠ ڲ#@ F !V Fa =O O F F0F,q+icHa+(#c!#F F(x++%029(/(z$n(;h+ n$z$Xx-(3+(@3%Ha O O !xF=*hh**4H7L30H#hZ* =)2M`ci G(A[ ! `в O *Fxtc0x +iRF$(x+"QF%焨%%_“x%𵇰#@FFF(FcH-hY$]H=ZH**-x* hZ*1Ae_-ci+-   G@-Уh/jѣh+`+`#ih+;H!g#i!h3T#_O-B--"ih[ `2-2- -"ih&N&`)F!&V&`*F+H!h---!+#i`#`H!PF+ -?LhH K"`C#iih/:7ċ%FhFFxF0; +FO  9x>F709_ +J;+.` ##`$##`O0. HiF "3+PCCKhKh(   pG0%% H. x K"` L#x#i h`h!ciFG$4%{FHx FpGBЁh ;B$0{-O$.MF#FFFF*xR+?/MВF#;`PFnh$5"1hHF#g#, A8(ټ- YEYE 0hFF#F@DBDAh*vh"# `+иF{!HxK" "!"oL#1Kh1J#B1h+h#+O0J131+ L%}%H!lL%hF^]Ffh2F(FF0F!D4 FJ+F!FF8F8F-F~P A0 (F!F ~FA0  q Q0 ~n8Y@8LEeBsD~"J + A1 a  q Q0 ~B8 F.AQp N M2hT K"F)Fh+  5`BK"`pT%@x%̇%pF M4##4 N K2hB3h FZ2`p#4pT%S%KshK"`pND FFt-44(F%̇%T%D)-CFFF@BaA F#0 F9F "#F# F9F02- "QFF.@F-#<)FmDʿ-CtHtFF# 0 F !44F0.8F-#<)Fm-AF F$x F%(_34;F[xn+s+d+U iFhFphFDUk (jFb ( Ђ*I@Խ@ٸF"OF"J(qPѭ)hB!!)ѥ??|NKh+v(p8hHI0+;08(Կ  e.(L9Kh|???a(q9X@1!(M8h8 ?PF#lTF>عAB ? S)a#Y########7###wl%x%8%ix%%b _+?ή?ʮS))####### ##a###)h"B F+`"p??(Qq^Kh|(qYKh*82a0Ad ??xYP uR8a}(qCK8hBKhC@8h8h8hPоCA+rK(q8a(!@FF??F F*sPFIFucPFFCA+rF FQ 9 (E"> H H8h(kHH8%x%Tx%#p%K!hqKhKhd K K KXh KXh Kh Kh9NK"`<%%l%x%,y%0y%x%KhKhKhK9h-x%,y%0y%FF#FFhBvBuڢB dBtF,Fd[eABu4F)FAdQBt1ʹ``pGsFF F9`hh1#k`T FA !Fh`lV F`DB"KI` hұ) X`pF1F F (O0"F!1*(" Y`%%-OFFF*6*3F!   S$0FXHsESE>VE  HRFi# '(#h`hpEEXH|CL0 H%E ! pF`hCHp0  4F%hh@ @h8 K""""pG%K-GFh ^M $#+bKh;P F ??FF PF8F1F FTF0;B$%%d}%x%2K-Og??V-J h,KhQh #O&Kh O TF0;Bܺ1Ok F??F F@FEuڱ??ІBw XF)F+ FO DDFPcHcd}%%x% L&F @H#j [ #b@1%ڟ8Fh@K ` 8h1 (F瀶%HH؃8F FO Ki8BBh  -OFF## 3jPFKh@ 2??МBFw+ Gȿ F9FĿ3 7ZFFFCFF??iKhc,,dBo*F3FPFHFAF~(@_J0h*#ZFF0FcFF*"BC*OLJ h*C FCFF F8FB FF FH F0F*!D61F`l#wa F(F!D")FaltL hBK""`#S``0%-OFSNMhQI,F0/LMHFO F  :FOaXFFp8Fh+w3h F+`#k` M0!+BFYFHFL(0 + + kFx+F )тWx+!FyF FJsh`C``hp`3`ZZxx^*3xBЂ,$*O3 !!F\*33  %)-OFð F CN*,O`фKJL`$$O"FOq(fP-P|KB Fv yHNF(x+<,ـsK(FS$(FF8FFPFF@FLD4! DgISF:FFE@F0aIHFvFHF0,VJhB3` #s`б8\ +T0FJKB FvJ(#3`n Fn (013I!pxFF2(03@Bx F1E3PhFH3 A*x23 P*FF)13I!pxFF2)13IF+*23 RO 0++x+И0+(F((FF@F{h`C``hx`3`  %*/x>%hKhI F I FI F騱I F鐱I Fx! F(     IOV\iFF Fi( ( (H!@g}H!H!bo8K-Oh+eET F)FO !FF,KhL F)F{V FF6I ?? !H!DF=F F)F0+BF;F0FIFiK0FdFF03 F)F\+ +DF=FO4%F%%% IF%4(F O* 4ChBаh43F%: 缶% IF%4(F O* 4C^hBаh<3F%: 缶%KhpG%KXhpG%Khh pG%!HK(`"`ȶ%pG L h "u( 0#0(ѝȶ%F(@(7(/(? pG8+)08pGa+)W8)78FhFFhx?(F5*F?( -" &Ix,[,L[-q pDx^,00KLpx])0x])p 03F/K/J1Ihh[)ѐ.ɲ)'FOFsF]ѤE03L,KJIhh\,"ѐK[0 pFE0 Fn0p\J FB#0 pq F%%J FpFhF F+""p0 JIHh hvd4 F"F)Fp@h *26@h%%:-GF@Kh G $OI fF:F1F(F1g(U1K)Fh0Kh/I"F3F {P\Zxb\3Zx[)ء.۲+  [,<[+ F]) Yxp3,[$,[, Ijcj%chce#jAF8FFj3b+:x#*zxn*a.j @3`cjjhcbD%bjcm:x#*Zxn*"a:F@F%(8F ce#pj3b=F#3` 0 ( %@Faeej##b(hhB`b?kpj3b.#1#pSpae%f% b%gLmchh Ch;C`+ڴ\CСm0 hZ`x@ %-OFL Fm#hhkchI zKJeX3eK"c#f#cfPMmCh;C`+ڴBСmIml&CF@"k IzhZ`xmHE p` (;дzp0۱H~I k쀱{I kXzHp4sH #p0p4m@@EдRnH!k(F#ehHp##fcn#h[h#`#h+hch c+(!k [K F [I[Kzf#cfchxObPHahNHOb6o"k OIzN!kOb(!kOb `(zFF `zCJSFOa(FRo(Fhm@Eд9I(FTe(?BB ^m CXh%fb)I k2e( !kH.#aK\#f瘱nD< + E#`;F0Fn*Fj 3b #`#%mlD%<% D%çۧ"@F.\ I"F y F @F.& I"F y8F F.(I+F"F y8F N F0h. )F# FmF;F)FF0` Fm0hD%])M)O&khB&Kh@>$Khh+5h.I"FF y4 #*hsCX+6h!;h@h I@hXF(OR#F!hFFF F;h!hF 3 ]H%0%4%sFMF(h#I y`+i" h libF2H( h^IF y p H%`-CFAL FAO0DF[ij2B AjbiDba"p&-,\-Qx8h 0@09՘ \*&*Fij2B AjbiDba[i2aBF!"iOR Jh??R??i-j2*DB aj)DbiDba"iFR *F1Di*DF+DH%hFBhFAiF*DFSBAAai a `/*F1F#c`D2D"e`ZU-OJ#L`H!3#cKh-C#d .kh*<3h+яKhshB `k~q(q-h+ bk"!kph8 +рKphh @ `hh*ZhyKhB#` d h+ak!k@h(Ыhh*ZhiKhBgKh`+dKBhhBW*[h+h+bk2F!k@h+VK@hhxBxA:(+~=;>+R#Y33333333 33333 3 3333333333333333!i33  33+ 3M 3 / Y  33%m3lbhB! hYCZdE `fh #"h!sC(i6Px``f`%H%x%̸%#! 1h˹K(ihKhkC ёM!bk k+hk)h Ol+i(k+ek5&kj !0F`#cA0Fbc#zHG#yIwH"@## uH#rIsH"3#lK(ih~#khȎck:hjKB<#03 fHPPxC0s# `I  (ѽ*0+0"!&C06B9hSH@9h$ 9h ;h[9LKhvh+ph.GI"FF y .mFP "!x O$ 8K6hB9h2H9h$ 9h &CDXF.FXF.'Kh2FB9h& HKBF!VDh?XF.0BF9H@KhFB9hVFHH6K I8h 0%%x%N%@Tht@W4%d_,JO hB9h&~H  {K+{IhfSE^Dz DvKhkC rN!bk k3h.k1h 6mH!, #cShIfH#"dH!(Ek+@[N!bk k3hk+?51h /k+, x !28FF8kcc#c !bk8F0k# .?ccc>KhkC 9M!bk k+hk)h wlbhB! hYCZd) `fh "#h!rCki'khjiRhB i %K`%K%Ihyck9FHF#F(#aFkibk5к#i !@ʀ#i!kHhz#Aki8Fj#ihZ9D#WdW0%0%x%N%%6`%$O #iBB "i#9FXFhki8Fjx#i#BB]DO h"9FHF#(F(R9FHN H <Φ(Ϯ H<(>Ɯjaki[hcN!bk k3hk1h nih(B"hC`Bp9D#"XF#iO J1CDhBB2A!#Dh #"9FHF("k+3i3Or@ a*0a0kihdI yki ickBki"]Ii(h+?#`migk+ki3 (iOr@ aha0*i hickBHI"hi(?d"m"CI#CH=N 0 <Ϯ 0<6Ɯ7k+34?-+Joi&kh* 2DB!3x\;f3x\(0K!B #"1F #"HF#@H"! R BE 0F3 K IhKh`%x%0% N%%Z%F$ (HFl1S 0DN H <(Ϯ H<(6Ɯofx%Kh#"I#H1h`~{) Rih̸%%pF FO6Bp#~w+{+s+ciiB(cih I yLcia$h`iC"ifa!h`i -CFF FlF -FBI y$#`@Kh`?I(F\`Oe` DFX/T0FC-Zh`B FF+!*!Т<Ȳ( )h(I2F xB`hQBhBhB:*h+ +x+Х`#0hBC`/ch+g`:!HF<F(#;0B+  HF a\i%hpKpFhK``h)Fh+  #iSBSAh(Fp#iB̿###iB###iB#iB$h%J&"0FMFI*F xTiF 0 I xJObiF F F M0  K : * B² *IN QppG I0;0+ B0Z "ppG1 * 2L!Fh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@%K0hci1k]x](x K|~ɹY}ɱڹ0+h@,F+F ( t)!v*"Zu( `&%Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p%`&-A3L#hZi5kC#h/J![ikM-N%-O3hB.#)Jh*B"hRi( "J!M#"hRi, J!M#"hRi40HA <#h[im)FOh J!M#h! J5[iM9F@F+ѽ`&,%(%8FH`3I  I0"FHHJHOqtM, F8 !(F#p+x3,IHL%sX%H\( r&F"Hx?+Cx۱0MFN! FO0 Fp/!<D Fv(ЀhFS+ !F0F F!F(Fh|#`! x".2+̨IFH dKD |<0BєB4KFIHKh[i1cxB [x;IH@K,IH,؄@I@F Ho,I H"F I@Hc%VY`&`OlupIFH H7F F"` F"#xx<#`O00h"+@0O0 FF*hiF F0I"F xXp<#MU#@Bݨi^XBѢDBȿ"DF! 8 F(F!CF(F"!F 88 F(F!CF(F!F 8F!FY(7 "O1 FF1  K` P3&K $` F%K $` F%K!hjFyp 0q]5K!hjFyo 0_]5K!hjFyf 0M]5h!@JFc ;5K!hjFyh 0>]5$ F ` F $ ` F $ ` F$ F `6 F F `  F[ `  F `  F `  Fc `  F[ `  F  ` !Kh,!F 0 :&!Kh,!@PC ! :&OK!h,!  :&O@K!h,!  :&! S ! L ! E ! > ĺHh ~Hh Hh A  K"`  .&   E $ {  8" h@ D!F4; HhHh 8!F"Hz"!FHzz"""L@ I4; Hh Hh A"HzA"Hz5&9&z"""L@ I4; Hh Hh A"HzA"Hz%&)&z"""L@ I4; Hh Hh A"Hz^A"HzX0.&J2&z"" I H0 I"d  J#IOp88&8& I Hl0 I"d a J#IOp(&(& I HN0 I"d C J#IOp-1&K1&L h( h"O1P :& FN0h)q? OqDO0$ h"F|A6)h0h;F"l(F F:&# `pG# `pG# `pG `pG-AF FFF@0B̿iOiĿ 0ȿB.%KAiC$#S+Ѵ0iB$-aҲw*bҲI7^k2F)F FG0BiA<KAh(1ʲx"+ Ii7@8FiF0FA8mP-OFiFC8`h@ h( FFF !r Fi]AFZFA=+x+kFO2# iCN Bȿ80ъB2R₴Z0 DB@ڴPBAOFBA# GEPڣj:F FSFGF0BѴ0+!K2Fi9FA"iF82FiDJjiO*FBFゴm%u傴GEڢi )[hSX:F)F FSF5_FFpFFFHF0FD*FIF Fp@fȿF)G 6:F=!JOq5;##Di@J@JOqJ@ IHXJ3K@FOqJ2J@ h IKOqF%&'&$&(&(&)&jF)K159A#JOq5;##Di@tJOqJ@ IH(XJ3K@FOqJ2J@ J@ K!h+""KOqF5&+&8&8&9&j!&P3&F )N#'=AEhOq"K:""Di@J@JOqJ@JOqJ@ IHXJ3K@@FOqJ2J@ J@ K!h+""0.&.0&#&i"&l4&-1&K1&J2&j!&P3&8F)81hOq5;##Di8@JOqh@ "hI X3#2Oq@Fh@ B8 <&)  JOqis J@JOqJ@JOqpG4&l&#&i"&l4&)  JOqiL K!hJ@ K!h+""pG-&`&j!&P3&) JOqi(JOqJ@JOqpG-&#&i"&l4&)  JOqi J@ J@ JOqJ@JOqpG.&4&k &#&i"&l4&) J@iJOqJ@JOqpGk &#&i"&l4&)) aJOqiJ@J@c!pG4&l& <&)) aJOqiJ@JOqpG.&4& <& `pG# K`pG H`pG H`pG `pG# `pG `pG# `pG# `pG `pG `pG# `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG `pG# `pG# `pG `pG# `pG# `pG `pG# `pG# `pG# `pG `pG# `pG H`pG)K $`Z F%K $`O F%I"Op l4&I"@ i"&I"Op l4&I"e  .&I"q  4&IObOpv  <&I"Opk #&I"@_ i"&I"@ S j!& K` P3&I"Op= l4& h+#`pGI"Op+ #&I"@  j!& \K` P3&I"Op #&I"@ i"&I"Op 4&I"@ l& F N0h)q? OqO0$ h"F|A0h)h;F", F:&-AFh FpchcJihF(!0F``&0Bܽi7Y3ihpi BY%!6ǿFi7 j8iD j@<##biEi@4#aJ'F`#B7<2*/i3aд)FB<#>~5x@K! l@K!@ eOq _Oq@ X@M! R@M!@ KIH Կp"L%h-:7b(8==IpIT"! I O09O0@ N0hB``0hB!`0h7@ !`+ a J0C/B<##`(Fp%%%8%&x-OF ,bKhB@]iS$@,W#! +@Os>Evj#i FG#k FGi*@D0 P#1O O O `hX   h8x+@yK&WF&`/i*0B@3FO F^E^F !XFT (XFBF -o   mBBF 0 H 0XB * D%uR QDB!I#*>^0 qQ4.I2F,H0KFN iHhXF (BF30B?"ѣ Oc 5P-um8DCF*FQFDVa= I;FJDB 8%~!7pHZHO1i9iO1@T#մ QFCF*F8DD bE(!jKhDp F$@0#oz| -  J\@0P0)D3B"ےI i@SPN(F<(R( C20r1F x(FG BРi@Դ DBD゠0+ݢi;RԴ Bfj&lI FhM(hBF(hB#FF8FCF(bOEAF(hC8h>0FB&FO +FF+ E68h@76"FSK8h@d+F"!8h@^"!8hI8hG 8h@FE@F@28h7' *  +x+q9K[h;D=E80+?6  [R#s"ri0EjB `p3D7D"rB:FBؿ3ؿ[x(c?z(`(x(8a80Bi[? (8?orD(ie[R&&d8%h+?ܮR#9696o6696966666966669ڰ?(??<( >( (O{piиB@0`(F(?YF fdq(?qu(PE?}ڰ?vos+. K[h;q(?VE"`j]F?\@SB8%KiS 0YpG8%(KhBiS pG pG8%-OFFFF*$ PB*F $ FD!m P00S$((K1'FFh/=320[=320[?*>-=D?,FKhKKh@޻ -&T3&H"(H  @(Op@ >-G -PM$O3+`s F(> !FS+h+5B'iF +Y!#]" SF(@ހ F(@׀ 4 = !F^ !F S(,`6qMF!F(h0}( $ F! 5!F 0(h!0g(!F %`Kh+ B+h$A(6ZFh*hX VI2 +(v+h)(k(f '(?q_!8)cF(VB"p"7B.'E<F/FEHOOp EGӹE1Y ((R (!AEE(U!@B1Yk1"BEE(p3U"B2U' H&(F).77W h0G( D#kգnczRnhR1 [h c .&:&+& 0, FObF LIOb Ob `@IOb `t Fȱ ` |FI#F"F D%DDD!F#(F , 0 a 6Z6 FObhFIObhF6ObiF Ob I ( ` 4 `iF  ]6Z0P$ C FK ` F /F Fɲ(;L#h$*!P*hѓ)ѹOp0*]h0CG0#h$h0G#h$ K(>(9"H)(4!H$Fx 9XKMhEf"F!F(hH(h6(hEZiF z#_"Z! Dp! H HG HDl#0 .&:&66&&P$C "K `   FL FR Fɲ(#Kh*!$HFiF S#`"!F F{[#0 .&:&-OFOE D3x3FF+ **O 0F ( [E 3DD6lF F>t" FFH FE Fp& ry7-OF- F F1 "1.BFѰK` F}1 ܲO ̬LZFIT#h뱡I"FNF"h*ѝIHFI"F@#h+I"F4@8CFt(@: 8"F!H! F&#0jI(h@hIhhh 5 1dH ,y xñ z꘱ *hF\HB wXK"`EWK/)F(h{h)hTH.SKP!P`#0 OR75C   C C T UFŗ#QFOpF 2(t3h;@FN0`'z #Z" @B <"8F)F.'H7T-#K h3SBF"FhK `h tr7ܥptbt7f@^7v"7j!&7-&77T3&n8d&-&h+.%#" FB*OrBCKhAK$`<0f @`A:HBPMdh)5IF(F%#T)FH)Z+x+?VR1(F3h#@Fx0`(F I " #0h)F>0hE`1+x{[- ͬ p0<*?OrB?ۭ `d&T3&77T$0#"2%K!" S#1 #IO3M I H Kh H )F! F 0@9R58d& -OrFF(S+!L (HO0#0iOpG3I(xdF0Kh(/J(/I.*I(o*F(O OW 8F(F%0Fg6?F#cU {B(ػ F)#0O50Fѯ=Kh J(I(F F9F(nF(5oXd&`T8k8޺-OF'RK !F.@I"F t'-6)F !0F4F0F5 FOAF('FI2FID3F@FI0FpB x%+@+*!:0:+x'+5<*+0/!PFbF#pPFF/#;@F@C XFn(@hEPF(XFxnI(F7.5x-D'P<iI (F(0#(0*0P#*0 o]M.hm"0FG(hE  !FKFFRHgC=@ (Q@dHOF@b;hBF !F >:h-ˀBp?R >j&?@E@@ƀ;hB@0!8G^ >HE%HCh;C`+򩀮<N3hB=  0h50h<!0hAE|&F((V (@ F( (F-2F ~88U8ht@&NB{.*? AFF( FhE7(F(? D(ISFX?5.?MH>Hh3`TD ^N(j-? OpGI&N0ð@Fx0c.!TF0H"\C0"[HRH"!Ft%s%-GFhVO`FB# F#p_-и/-у k20#)F@F[#1) F+FJF48hF!FFF"CFА"!(F& I"(F/a*F1F FF F,F Fr%pM(F6F0@)FF 0˱) )D<.+(`I@HI@pHpt%q%s%𵱰/I "@0i"F*H*I "@0i"F%H!"FCF*PI"FC   vI FzF F셹MN1"OFH`1F1)F"0F=F"!F0F!ir%%i%r%8i(i%h-O6]yJF 9( vKhuHuIuH @y(1ܡ`$F3x+@F`DFE 6ROs02#"S,:QF0F>1FF(Fvb#QFp0F2ZKh0D[Y sOp")F04F ( FF(F ( 23 P,(F((h(4r! FO4!7Or0h HzJ~I@'ch  F(ŀ$"?`!F"F0rH?1s+@̀1l+@ȀlJ2h32`hH{(@fI꨾F(@݀O9OrF\J#x FZJ#w F Fr(\8# \8Ĺ@OJ#y F.yKJ#z FIJ#} F\8EJ#| FAKBIx* F.w?J:>H9F< FF SF FW QF1 q:C%I;2 >(?HFM8F($I ,X $#X6sKF&>r%88b9h^Qt9h>^Nt%s%r%%%:&8%86E=.@́#[v "1FPIC   YC0 HOA(J# F\6+J# F3IH(F(IF0FdI F`I F\I FXI FTJI FO[7+ÀJ FIEI FAI F= FtI 6JI (@𬀀K?JOq?~HOAO \YF(?OpWF(?qK sJsI(@#z\8nJ  C\8%PE "iH (!fH !#pcJ  ( "`H ( ]H !#pYKx+\8C\8VJ  ( "RH (0sOJ  ( "IH (FH !#p0+\8C\8!(F8+x+\8C\8$9I F<7L?"`3I~ #"F QF FrYF Fnȱ,I Fh꠱+I Fdx)I F^P(I FZ(&I FT(M#:4'iz9%%0Ud:9999999::BFr% :5: ;;%;%;:& <s%<9%}::8f8b:4+?ٮJ#FI (?ЮK?J (????(h$WH43( ؗI"HJ#{ Fx?+ؒI"8(ؐI"J:ďHF< WFFQF  q1:C|I;2\0+?wIwH@FpvKh, !F qIupI FrBxlJmIF8Ff0+jI8F]0#fJ8FfIUfI Q 8F3+<.p_Los^I ;2'4ZI F&c# "O1 CF#(H?PIQOFc!Fc &F` 9F `x1Fz+x3EH|FCHmBѕW5C@I ?J?I =I @ X "XFqx+4 3F"ѕ4SJ@F,I" K@F(Ir~#X6.?`Xr%::r%$=%/=:=%86"b=d&s====:&=BF%=>>t%k>%>>,>Q>KX6 R pGt%(KiHpGh-C)}F F.HIFFN(=є3+93pD# "q%K8FB>>FðFH!F#MK*F0Fq!FFx JK@ I/F*Fc8 CM>l4&h#&>J!5&FJF F@0.& O3( K J` I FF /( FH!J$ ]h4&mj!&,&>K0FX O3C($JKM`KE,F/) "F*F!JFH*x!/*,F JF H 0t%mh4&j!&0.&>h3&*&MmHz꘹I,FhI"H6IH"0 F Mm O3?+$K JIF(K"!H`KJK J!H#&^Nh3&i"&*&l&4&>4&/?p°gNX6+𹀟 (\8[ `Hk(F^H]Kx]H\6[HZK!ZJFYIFVIF TI(F:4#RJ(FRIQI \yűGIF Ft:4+dDJ(FFI<:gBI cBIBHF(5?IF U>I FQ=I FM:I FI0#8J F8IA8J F8I<03s5IF F23I FJ- Fd#I &.H-I.H+\63,H%I+H!(FJ LBp&K(F&I$H I#Ht%8?A?:&b=d:r%N?"_?s%?BFq?0U??99s%?r%?kv?%?@0@%??@pFxF2-,+F;\**(+FD\%+ _."9p0, 02,,02,,02,B;#pp+\*9F+Bp0F9+-G'F FFhCE؇#hAF FlGF"hQ F#G )FOF+h(FG(+h2F(F0G(C(Bs۠Br O0 hS20K`Ch `pG h zrpG tpG-C -FoHO UO Fb!FFF0F( "dx+x++  F]F! FCF*OR##bhF0F_d5JBJBѝ0+ٛB I#F*F YI#F*F S ]TT@Ah-OP'[hFw8F'F@&F(FcF#hZhBh'`%X6IhhlG(#X6ZF`#ZFX QF` #hP":F(F6.&ApFiOp+hzFS "FIF0Fp@̽ hS1PWhF+h(F9FlG(H+h\o9F(FGF!Kh#:F:F#Jkh! SI"6 "h0LI"*"!F$80B; IcIi2`9.&$AjOl m mñ10 j*j+КB ؂kkB؈B, O0pGO0pG pG-AFFF F"I* $ F!F'I8Fb1F-I3F FP F',-  I"F@Fl ;F2F!J(F(6A@DA8Fi F[Fh F#`#8@8-O'F FFFE!8F'F(6&0F'7@F'4`h8 U)& 0Bah# "hR3 EBhB3B01F@FlG 76  !8F'tF(FO   B;#4K"1FOp<#2#:FAF< (FT+ah h1'(chZ `b`@3S`|U! 0B`h# "h R3 E B3B0HF lG h J  3C, 1tr Fh/ *@B(аOpɼ( ))@@Op()@"( KS K(FpGHpGHpGHpG+&8F L )F ##r8 0UI<IH-OFF!0FFFOrhh"1Fhh0Fkh0Fhh۲13+z#$ F{phhIB-F(lh 1$1(1,1#L#1cF F1F0JjcJOq@h+н<h+hhA,F(МIrJ(Ьlh!H3'F\?F4^F^JIFHFXI"FXFXZFIHF^JXF[J"QFHFXFHF[PF^ хI "X40+`"[O{ZF!O HFDP4yI2F FC #8 3qOzssa(3~+@쀹0HBBչ60DNRBEFObI#F67`j'+ZskDl'*bF01((FF;] )iFiSI"^ (QI^(OI2FX(KO4O  x#$3!@Fm6h0F?Kh0B\310[#F:JOq8F "[:,hkh4,`<sk`$FFF|SD (+skDl+s"kDO O ,K4΢#h3!@FmfJ#FOq8FPA@\AhAwAAA}DAQ%AAAhAAOJ !RF0F  4!T"I*#0 x#Br01#F2HBF$ F0I0#Mjp1-Nȳs1 4 5#@F!!7HF#A!  ;#!O K4O #3!PFmJ#FOq8F,#KO 4O#3!@FmJ#FOq8FQ`AA𵅰$FFH"F!D0 &F(FH!D0(F&m I(Fb LF0FG (F&_ !F bF#I 0 ]y# 0I]my-O])FFR٣I@i(LѡIh F(?(hIF(>ЛI.@MbOb)h1,I `b)hOb `1fh0F0Ev]`.]0a0BXahOb)D ahOb)D `H(%chFx)t|Kph.@ر0$(nh0+iIFGFHd0$a.3h%'U"0Fr bxOcG3h"U0FroOcG+@\Ib,AF"ai"HjVIHF(TOT%TF.@h aF( bhJI0Fu(\)Yx3} `! gO SE(F ]8F1ر18F,1L# <Fph0SIFGBFp3h0F0G  wa.$(h0+IFGCF$aNbObah I `bahOb?^"AF.F(T>l\:&X3&Ahb jlK9F0F AF0FIF0FбI0F~I0Fx퀱I0FtX" I%"1F IHF$Ic1Bh#S#Q-CO $ FF@gJFF uF(K;` FR#Y#"#0GF#F;`F@FF8@#;`+h(F0G0@F0G$QB-O]%Or F )F:`B)FMOr~<¨)hN)̿!!F0h:BdHe0h=ULAF O8,׀:Or`"ZJ`O2`" O g &0 ~g `(O F gFO :G E(s :OvP#KmK`oC"2:OvP#KcK`oC"2#!&16 :3O3GF\ D O7 D IF 0FQFO300X?pR#0vz#"O 2#~<*F3 ;FzCF8FO30U P)8FS"p(0F,HyFOp+L"OF"'K`@F ]"F3O pOO `N F%05 3p!8  IQ A"02 8FFKh*"o` .&&P:& "B`ӮEЮª&M`Os# DEھKh+3ªOs$Kh/@K"!Fh#T }1(`0U (h""0"!FHL/h 1^ $,!01CC(,!4R8KCH1#L11#R#$1)h(11)1+@'L !$Y ,0! (q4,8qRzCR#}J$1+πhsWȀR!BA€@𾀢,tKO O  X !8Fl(+hkJHF$1hJ[CS!lcKhH*hbI2QN$1hhK+h$1hFXhC SF!y H O :  bY O300+;@Y/h(?$h0G$IO7>!F0Fz>Fq}1#}1$1c10F,1L#$>F3` + K:(hh((?w s+?q+h$!hR+hM!JCGBuXnC$CB3C:CAC6!nHCB. .&m;"n*SCJ!IMIBIMI;IMI4IMI-mJKM) FFI !?)!B""F!''aCgCBczCBCBCCBCBBBB-ON3h*QeHUfIH)OFIF(F3hI3F@FTl 9hHZ!F FI0h)q/ށx01F(L y|a~윩HFazI FHFF@O zIFE4tI #(k0FaT=FXF%Op!zFF8F%%dI2F F[cM+x!(F6`I FP_I FL^I FH+x#XJ F[IA#ZH#F~(gVJVI F0UHUHTH+xSHRHRI  FR T   Op  [ khC j+km+k +m 3  hB،+hk x"#h#2OcoBFkG+~(O+O km +W +[R#?tO:&C"Dd& D$D?D[DD*D-&uEEEEE4_EF#F)F2F9FBFkC+zO QOKFQIPFd()mKIFlKH@KJKM2F\0FGH CF0FCHF:FF>H0F5F FF 6I1F4I&(K(F&IPFO #԰5k `ObAF$K%IBF F3Fkh[ +RBIcC FIHO `KFrO |KFlKFjN FJBsJk>CCCCCCCMECDDEFECc@C-OF|M,@f,&̂UFU+AF 64,ѪJI6v!60F%F0O4 F MԂLH Hh`HK(lcc H ,eTDO  ZIZFXIZFPKIZF;~Ka``@~Ia~K ;84vKD8F%(F I"PF꨹BFIF Fx 21 \5dQF 0O5O5%O5hF#F#`iFjP) hK"O0r-CsN]F@4h 4CPFC ,{!F &lOI!%('yh0F10F,1L#! QA"0#YB#4vE h #kr (FF(l8F$ '@C?K"=K>IA#2##Fh h%kh+Hkz+7 %0F ] A0,!% X`(?}2h#F", `$)B@#3$!)hQ3B3 h0G4#BR$#jhBуj+kz %qGR$jh0G4#B $X3&tvاFCzP4 @4`j3B hF0G4Bؽ@%;P3pB3$&F$F'F%FshB F9F 3hjFS5IhhlG G50 cpG-CFFh F%F'OUxxOcG  #h bU1Fx FoOcG(I c i@ GhKXBXApGbJF PT!ڂpG%0 `pG hh8F M0i(DX0 10`a18%POFx teh*-",- ~ a +-`A  0214+.5i4,.n 5F%C# `K0`# aKa% !0]}F F4O(r!^0 4T##$0#C4KC# K81C ##F FH F*(F F ]}0%-O%FFF/FhBp!(F$y0`h'POp FO hCEٯB  #hjF9F FlG57#hjFAF FlG(3 0h#XD#Y xK"02hZDmCe3h7[Dd Hh*Tb"Zee e f Zf-AFR!PKjhh+*O|"Li5,)$>rFD ЉdELAD !LDAHAi#F IF(FA+)2BdFF M#HH!0F@ MF(O9F&F F$Y(FOb)FBoIObtoOb1Flo!( F$3 Vn>p@Z ,L,H@[ )HOp%H h;FF7X"1F hCRIF"Os1F$ h0$6F$ d7f n")F hC0 h0 h@ H"! "v Fdp,&rSG@VKpC Nh kh,+D(p++05 F3D A@ C A%F"!F"!-O } FFFc#sIrI :FO@JFE"FlCFhI#n0Feh 2F Ue(F>X]a;+Sx# }VI$0FHF0Fb-$1Bږ056 * +{0a CI:F[F""F?F3CRO(;Jrs2B ObPF_0O9PF-I[F:Fhh+Iht3`h3`+ $I"$HF(hCK`!*O"IF`O"FO\: A!T3-x Ia#h:Fh`XH`Gd@edA%GAG9%`%8 FF! FW !F(F8@ 8-CF@Lr@K`9#?H"%2$*!D Q`)D!DB @  #71D H < L HaF@0FDFHFB8NF<8FHFxB8NFL8FHFnB8F@F8NFf!KJB8FFF88FC𕹃I K K`9#\`9 #%CfJGIZ FiF8p@XBXA& OAJxI gK"!H`KJK@K J!H K8H]ڿ ]-&G4&h3&#&>Ii"&*&OA0LT#C#K#!3(FTKA @0 0H%8HZ W!F Mt,F(F(FI F F8@$YrGG?FR[)F" I*F oI#F $70@pGGG O30( K J L`- J!F H$J!FH h4&%j!&>h3&*&MHiFv< I*x I*@ M] O0 >F HMHiFv0 M] >0 O3+$ F0K JI:F(K"M!H`KJK K J! HS K.&4&$H4&k &h3&#&EHIi"&*& O3~( K! J H K KJ! HK ]#&NHh3&k &i"&*&J#3+ pG\ pG%J#3 + \FpG% J#3 +KD 1C 1pGx!%%0Q#0Xh K) !ؑ D !%KD 1C 1pG% \} 4O(r! 4#HI#!1I16! I81!4FF F FH \} % JF HDAh*) pGBh) )0% $#H#F|  p FUHL#h+I ##`4&iH0HL"MFhF\a"hF@( K+`A0 D# Ip9`/!60(`|H%<&HH FxKh!Fr-&R]pG7IS[H3F) IF )F F FI 0@pG0UHHBF7IS[HF IF )F F FI 0@pG0UHHBFIHxHH HF H@(H;8 I#I-IF( 8I D"@  NFIbH FKJ(FFK i"&#&+&FIHH FKJ(FFK *&h3&,&) F4 F$(NM( BFA"9 BBO10h1O1(h1O10h9(hO190h7 (h70h@(h@@&,&F뀹##h$#IHlHQI8I0 ŰdF"F(F !(F#poKhKp:DjQ IvE0I<&%6Zl };H&:L"F F FH4KhR#F3J!p t $"t!.Hr:,I < pX#H"(K !0Ff&K #2 #"1#1F O1F\R(FO3\2 p0! -p:!JJH"F V J }xI%<&^QeII|HFH0iMpzX8F1Fȱ0FF@8F#,J!1t VpjHt!"rOs K\( $i, F7 F? %I!F@< DiF O3]iF O3]hFh-#hXh("## 8FLch*+ !h)(F~ z84 JK(FFh#&l4&-O/IFЀ_8,O-NȠO =Fİ(FX"FQF /HF(82h[F I %O (KO sF FKI"FS%@XF(ѝ0Py+[D0a#0030 I`&I4&j!&I8m^Q-&O_-OF-F$LV$!F0FF)# F(z$!0F?=FF,;3x+g1F(F_0F.DEE^5K@4J5H   "`@ V+B Z  ;D $!F  "HF` F V*EҤ1F(F%D"FZ+@(F!F_> FD$!HFnF,p8F  J7J-AFFF!FF#FAFz8F)F"F=FG(F#Y FA#T-pC F-$!&oHO $꘱D " F` V+хB p$! FFHS+]pGCFHS+]pG%C@j Op& FP.peFIFF@i#@k BF|K}I}HBF|N|K|I0F,F_v& +;+3(x8 Q+) O3+DkO;x+jL#x+3x+hI `_H `axdI b3F(F c`I"F;F_Kh!\N@g ZSBtSA:F|7O3cUH:( x+ CJ!F8F|7۹JH]Q({GJHK)FGIF FF(F_@ =J8Kh:F!@f O3 3H' 5+3L#x+?b2O;x+?]3x+?Y"I `_ `a(K bI(F%I c"F;F (;F*FI I b ~ `@F(F_%JJjJJ <&JyJ.&4&J>#K%r>J4&l&KKiQM iFH!hF" IjF 2 M]=KM iFH!hF IjF  M]JKsxM&0% + "C(F $8` z"(F?<IT  p bKKt+H"t+K`HK`HK`HK`HK`H K`%}K;&K$@&K;&U @&&<&(@& F!F }K@h ,&p#-P!}  V"3 ! \HdFعpCOWH"xSI"THTITH" F }pOr! NM!"F@A#@AaC"r(ۄB@K@!@J@Hx?I#)i Q:K"p O3{,6,d ) )I.H_}(5$*H@*N"$2`B\`t#!Cl 1@33O3^CF$|m  F8 F t!QKh+!n #&]h3&i"&*&P%K7J%-&`%4&-OFdðFF0qF0IH<.h0FkF0F=#FDJ!`P!Fs0F۹*;Jh3` '*F!!F F#0F#$(hGF( FC+JSh3S`XFkh+%I ,#ICF #F0FF0F#Jh3`I !FyI 0;Kh#I FjhKD !B !/Ji3aj!&><&KK KP3& L%h4&7FCh F# * HJ#)F F#40JI-+ F&L.[>-O@հFHFFKhHzLPJ&O1FD  Sh*+u!`O#p~h*.z(F(h+@!i"hB@  yN-AЌI j( Op I \I XI $S1@ڀF-@؀~I E}HFzH.>갹.BBtHwsH8rI $oIqHbhP;D 1+1&2w;h+L 1+Fchhc)F8F'(9?c``3YK!ph;6.?<\9h#a DYF"hLJ #`J#** FD 1C 1ci3ca7/*"ai>FFFO i6,+>rFCD1 (O ++2*+(aa:PFF UFD 1Ԉ #i%Ichcih"h!F,F -?,YA IT fHF! I-&0L<& %XLLLLM>)M.MMMWMM&h4&KLbK&DL% NOth4 )F U0h!F("F9F %%6 F -O]FfH$DdIFB(J"h]I:F@-O4!FV F ]UHSIF(QHNIF((RJIF(zDIF(D(F,@F8"QF 8FV9FFFXF0=+#IF0F*FOQ:F((F0FlHDFt$hOp@F(O4 &F!Op$R"""\F@-(FFH MM"88 FF4"!F*FF FF@[8@y -CFFF04"!thD6h6p# F#FZkp3BE0Bȱp!h`"F`%Op ckCE pp"!F5lp4B pGh0Fi 00  %hB#h)F FlGP A####5G(+s#h" F#GP8 F@ F FC!F(F*F 8@Fh"j"h@"-A%Fp'F#hB #p'F"hB"ؠh"`hA"ҽch35k՞n.0Fo h+FBbh"3nBhbh]"Vk+F3h0 0FG h+FBbh"3QkB4"-AFF2HCF ZFZF+HV+IFF FZp8FW @FU&IFF0FZd8FW2F"I FZ\0FW J)F FSF FW(Fp.IZXdPLW,I" F8 IZp(IZj(VtF\AhAwAAA}DAMAM M$OcFF!F-CF:F1F0 ѹh(F` F(F  MPNF F'A "F1F(FXB yC ha`" ` h" |d FIzd@ M$OcF!FF-Kh>Kh#0 8Ii-p3Kh2Kh#0+Kh1(KGh#0h$IBѫjpi @  I#F:F0F-2IB ѫlpim@IB&ѫlpim@%E>ODO+&.&NOWIc_IB ѫlm0 [Ii[IBѫln0WIB-ѫl[ns@i`@QI2F#F(FOJ!Op!%GIF0 i-(F!:B *K0 >Ii-ll;Ii-ll8Ii-ll_5Ii-ll2Ii-ll/Ii-ll,Ii-xllZ)Ii-pll%IiCq#JBѫl30h+FP!S+hhdBFiiG+h "hhjS"F\ODObOfOmOtO}OOOOOO-C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hY#hai*Fhho3FGh"İh F0GO1#Op"3#} hh0G D𵋰Fl$"(F1"# S"#FO1]Kh#F)F+Zpl4'x'I F#+v+m#+e 20 R, F FF///#" "+v!F!FlmCehj0 F%Kl J !L"O1 #Op3+F_\l`dXf(F 0bO-O% F!!,F(tOp '% `@ a@, b7O"/$-@$- 0`'%K@!%J%Hp/['0+/D 0 і   5!OpD F#"2 !JM 3"2#%"1#!FoQFP(F F!@ O\O%Kk-C+F ыk+1Fc +++г +! !F()O`%FW !5(aE ˅OpM `@H a@C bOp>K"!F0#M 2J3"2# "#1F(FE F!D-O F h%`h+Fp&(B-ဈh!O O  #3!0Fh#h!h#3!8Fh-@P"F,`#hhh0P"F,#h8h#hhFXhF@@BFg,!+FA B EL ! @ P CM"hCJF C "h !=JF@F- "h !8JFHFD wF@rF0FR(8 F8FJ,O-̿FO ZFF,3ؿ#3D r  -! "F ,RFP!" FJL. *3J !(:HoAh"3k@PFHd+&%AO(Pr-OF- FKh$8FM 8F_eh !@F!F(ІFO E-FOs sQ%=O3BF<@o!S@KSA#1#1F#q.9S90F!C L D P P@ka#SzKa 1"`"¹"3@`rJ 3C,@oC,"#,nJC,[#kK@jqkJkHF3B @a"ZeJ 3C,$E#COpaKBF_KJ#0O3]H#FBbڨj Fb <1X@1p'#j)F000@,nBO O3FEѺ7.I F F(T#h0+a Mh 081P AF #: #H+  HHD0  +#hh#hFXhJF!FOp #hh#hFXhJF!F  F_((FШj -#jb O3b l! FG1t% hPpO}%>F`I@/! F}DCx p>-O?FV`L F !)`!1`_SGW=;Ppkn#+`pZ RI"RH8 #+`.#3`"\%KKBk\JIBgOQ!1BbGIBє *S۩YY TBL #+`#3`,Z2??PF8LG2!FOR[_XY ՔB )*,IR"l(Q # )#R0-S03`!Lo!KB !KBEE$EE #+`#3`LHvIFF F4(Ic]b/+FA L?P%T8 T%%F% 8T@&>-OF- FFxHKO8GF@F9F "\NFF#0&"x*G+.RF[FO@!4&M+.RF[FOC+.хS+.х+*ѹ#0cx+Ъ-OMhF#im5 Ci 2(F OC (9#h FlG&h Kh#BsF F F# *F0Gh+޲`Ҳ F@FJ!-@ a6J_+D!۲ [FOpL OE@"KR h!hF>S v!F=T m!FU e!F.X-M>SqI3F:Ft8F x 0F (F @F cK%h5+sSF+F\Kh#^J!PF:-0+x+,WI*F>#O1( "F#B )FPFr(Nkx+@)x`)@ B#h2a9 FlG((241 B"###h F0Ggs;CFqCOx < CF*FID AqDAD E q  cBA 2CKEFA8  JI[ a6J!_[F0 I[#F .&PP+&P [PPPeI  x bKh#F FPFIF16YKG2h#F F(IFRKVh#F F8FIF(7JK!hhObF>Ob9F>F8F o3F:I:F*M>5I+F:F F3I:FYE B  RIh(T0"# ##h Fh%0G2F+F(c)FV FKE A  a L I HF MO9IFP.&+&PPPp F h#h2S V[BBqb2 p -OVFDFFFEI G hoGhKh$H/A9##GF"0`ѸOOGF&FF#s0XF0G#QCFu IK h bQEA  BEu H aEAڛAEuF F SE Al9 2.& [P+&PPPP0XF`%0G2F+F"f.KFh#FBBzOpFBw @ Oz2 D@L PPp#$F F !DB p0FD-J#!O31!z(CXBXA F2KO1-CLMh9`(U-M+hBhh*1+K$A,GА)1;0h` LM"h9T# FG(F&O hB#h1F FlG  e#h" 1F FxOcG(9hlh`6 F:&&JK(FF@&Fx x/(ѢF]/* F/*RJHOa:K/*J^Q&>F!F@ϿF!F@IF 1QFN(8ڶDhN0h0I*F0hO;h; I*FO8h Fu jF!OIFFH0h I"F Fb $ `d&Q-&"QvFF"FI@F ͻ)QF(!F F@} Fp"FhF Fh"F@I@jF }7Q0} FFQ"FhF(FI"F@!hFr0DI@jF  }0 @Q F,!F@m-AFFFFF0F)Fr0 ICF:F RF0 F(FK$D"` %LQ&8 M4htIF F.F(D8&cQ-CFNOD%(F 9FHFLFF$h IKFF(FF(#h F$B04a&sQFMF4@4!  4"9FF@;6"1F0 D&L4[O#4T- TT.FV;413F9FF (F)F(Q; 4=(F &sQpFF FF)FJF Fp@ 8FF7!FFI*FF @ 8QFO@FO@FO @ۿ@ @ @ K8 pG&0%*F!UH!UMFF H I F8#+` F0@I F#(`簰&QQ D @s-A*L#h(a.K' h$*CF"AFgF  hx0Q##"#G(#h)$rRPBrR#h$h i8(( #h$h0G#h$a :&h#p$B Op ! Bh"Rm*3  pGsj$ Fp6hN#hFXhI+F2F!Op#h F0GF(@!F pG $F(K'N!F'K'J7h&H4` %H "I"F"H!Kh,$7`TK!FJ(F7` F,!KJ(FKJd!7`F(I F@V)F Fh4&Q>QQ& RQR@&"R0R pGH1@H,WR? pG pG pG8F#Q۹ҹOp F8@csuy (3B## 8KP0hFhM    Op-jFOOO ## FD 0Op& pG pG-AF\F F&Bcm+#~AF鰹 Kh$1hmOp{#Bc` ##e `Op6p4&QpPF F Z# N K(`" 0`p+C# @DT $ ! +&.&F IFF\X1F("Hx:F(F!F@ſ& p$"!F#jF!F@]{0Op Mq K!F+`F d*hkF^ I IjF @pI4&ǾbRRR0-GFQ#0} Fh(F0T#0(P>OOra=Hi=IF(H B2F!RF(AFBB (FL)FFFPFF( 0=+BIRFF@F(PFFPFOs@7dF0J CF wh(?p@3+ahOs(y#K$Lh:J"F h= h* h:>#@E2JF&!JF"!o2Fe9FFG Fg&<&$&%&+A& .&PTTd&TT&&AFT-AF1HFU0I.NF(94h<@FG+IF FT%H?F&H~(4 K#J H.t0h8*FI80h"I(FF(F@ /F HH,I*F F FJF U"d&,UUUUJU|UUU!!npG pG-O% ,FFB ``.=-;1 DBt C Ez Ew" C Ezt7BBht .6`g Gg@@51Kh"0pG,B&-OFF Ez #UF F\FF*#gs#"#.w2F;F F)FCp;FG1E2FU DBuF=F4F2 JO \Eu EPF 0FObsE7Br   E  I,I<3BE.wp;FG1E2F|U DBuF=F4F_М *[ *W S@ #BBIBADیBu5Bu:EA\B.wp;FG1E2F,U DBuF=F4F\Eud#3 eEBr  \0%##"#U#( (F)F 0rpGFBh I F@Vp FF/!(F{>FH(F2FFй5Djx`*ٴa:BaBp034O0"H0Yx * F("HF 0FM+h'(`r#BA 0h)hB##" F  ^(д +hB 4#B+a\ 3 4B&#`FFFB,= K#`ppB.+O$Op ` !tb@BBt %$`E%1DC@h;` 532 FV8OrPF!06 #P`08$ N M F!,]#",+`W$0 5+D&Kh H&&-CFF FE0PF-$3FFEܸ@a4ؾshJ6(F  *E  gE43 % Fqh%Jsh JJ^VGH`hVF0K@QJHv@h F@nVazV8FKh ]J#Bز83 2"+ K"h KhB (4Bx2F&,B&0B&-CFFF0't0'CEEt 3j 3 h3BӟB52&VpzV8F Lh !- @8K"=hB7K h4#<(0&,B&0B&KFh (@ K&-AF/LFh !- #*N1hFBя  @FR4eE(3Y(2h4#P!OSC22`J& F   P+F0F@m  J!F8F#' 6'c&,B&bOV0B&F8KFFh k&*F3FB V(VлBNP#F"7C C C !_#sC`a!s+Da. bab0cbX3b#iC#aatBB#iC #a h3BӟB62&F! " F xK,Opa `$ F!Fm-OFDM3tKOqtJtHm#sK@oJn#pKOqlJCn#nK@hJn#kKOqeJH ")F@F0dI@FYf8 8 7F Bcє8 *FYI"Y\F I'FF+ BZ&pQIFOIF(#h FlG:+FFt% ! (MЇO KEi !FMh+À3 O0w!O3:8FF(YI #B+6Os@o!Q#2@QJ2A"#!:F#)Fq,7S7(FC:+HF3P#hQF FlG8-G  :SE،O5O S9Ih0PFlG#h F0FG(E F!h"#bh2"0Gx# F #"#h0G 0C)CF#h FlG" 2F!#AsH5ACFR3D  1#;3 -C 'PŰk FhhoCj;D[h3;+ En*FkGOd*FkG#h"O1hj#hY hk*Fho3FGpFkKĕ#0h####K p0hhlG(pFkK-lFĕ#0h0hho#GEbBBOq1 p0hjFhlG(𵑰%F F.F hB-H-9+6G#h0#iF FG`#hhH#hFXhC*F!FOp:#h1F FlG h* 5* ڛA####6#h039F FGF(F%/#hh #hFXh*F!F@ F𵋰%F F0FF8F K"O1g#S 3BFHc(F ^QY-CD" FF! |! #@F(}SLFŔ 4@Ŕ@F0lGGKPhTxO3FFC     h[kF FG6Kh Th#Bs *F#F#"0 G(I # 1F###Os"!K!K6#2O3"#AF0F " FV0F0[ h0G0 8Fh33O0##\:&.&   Fk#K hh0G@@0  Fǰ(0 h8hkGF@iYh"h&'#h"O1h3#h0s#hhlG0Fa G-GF FD"! `'h#!;h h[j HFF(<8IP"D;hP6HYj"F#B14MĕhE;hQF8FlG Os"(K1F&K6#2#JF#!AF0F /`32 Fq0Fp0s hB h@ G 8qh@F O0h+##0\! ̱  -OF-FhF0G#h FlGWKhTx/xO7FFF@#hhVF@ Fx " F0G(xPC C ## ## ##hi !"[k G#h"0 FGCFS#h FlGF(K#hi*H" F#G? ##(#hkG#h" F0G0)  #hE0 0# 8   # Fx#" VG(%(FO :&K-OFh#(1+@ +h3K@AJHi.Jh\(F'O$OsO~OFCqKKF#>O38#FCF@Lh 8+hl @ O FXh 0h ph&J#! @FbO@B#!HFbС 1FOp  2 ;FHtHN0$1hh0$1hXhPO #C +h " $ & ( * 0+I"[HOq`!Y`@aWHYaVHh(Y22TI b@b#@o3133o O3,GF EKb0F0F+++@$&F,(FG(##z06K" O4 F-+h1F(FlGp#C !#h;+46hB؄@ F8 Kh)H(FF(F@+h0+!(FG\B\A:&%YڲX .&& - 08ry  8B& m1s d&=Y+?!(FWhOhh#1Kh@!Cb@!O 0FtR+OE'O$!(F(F(?W(zaR hR4 Ch(FQ$4 YhB0Fd ,4B$$:&-O KհFO{ !hO2 FXF(k! FPF8@FFPFU! FB (@8F@F,K hS" + 0BY+Nѕ(1+dPd,!T R!`E"sWO ".J[CS!B FbFOpJFIO Fl PX26H@J` C0+(G( 3 rK hB.؆$[BO5 @BPO 0NFXF5FOpD!O !F(UI#H3! Fb"@iTf! XFBFPF> FF8%D 5D(FYFFWXFO *! QFFWPF F   Wt F FB,K@Q,J,H F#"AF232F33#O3AFFB6 O R#Eѹ F8F@F k?(FLF[ vF8B&#`*@20F(*0/+ *OaBFF FH*Ob FO0F|(*Ob1FoOa Fkx(#x/+0 fx&v  FF*3;DDoFIOb Fo*Ob Fo}(F( ڲ.h(F(`/(F F M>>^QOp!\ F(  @ F!< "iF* ( FZ V *@ B+ .-OFFFtF(?иO&(Fu0(Fs8FC+ I" FF(I#FRF~0H73FYFHFtO7fZ>Y-GJmH"F@怜H(fH(a(@߀HObF((`F($I( u(@D(4F(чI(ObF `I( bIF I(ObF `l{I( bvIF qI(tIF F(@qI(}nIF(FF(@kHObF `ZtNKZ\Z[ZYYYYYY> `pG# `pG# `pG# `pG# `pG0ii,!F@BdDKh#*J!(FK,h7 6 !P"FFH F' 0.& [+&&-O@F# h #C 2XchC#k;գk3$%ke 2S +OkK KFF J!Ld %[0hkh0G8' 'Op O3cshBٷh wk3 ! 0BO1c50@F lG (#EE1cmw{B{A +W_Kh#h]K^JFXJ!# O3F +B# QK X  h "O10 ##n + "HFWCKF x >@%+e(q# O,F2KH#3Kh2)ۣ%CBCA #C00hhlG FFC C 3BFUI1/DGKF r3D #kD##cC0+P܀ 2XchBAԀ Bq F &[.&h^Qh+&hK CHFh eKh,!<1 F HFQFr(P#*s##X @+>UI(F^(89FSEQIOp8B"p  k3Y 0 hBB I 0bJ`2 N2p#00D#C0 +9 / 0  8h 3  k"cE#kC#c ;C$GFPO#k 2Xch c!C# # BcC 20FP c`=O Op X ?j@FYFkX ?c#@FYF .&:&.[>-GFFShCE@p'h#0!k(qYdhnJAhlJ!(hY\h[m),mBdJdD &!ThC<@a Lp#HPSCFPC aDHi`WgE%XP0+FE@p HC X-C OgE@/<E9!(q1Op P  [ C1@aCC1CFDEq HFcFF]@K 0iX`chB:>C<APQLPFPC0DA B|۫BqFF^0N0L-g  {Q@Y0DA E{ 0=LE{5`hBnB@p" a + I0qFa` )s!#Ic`00I#00#kC#c##:&.&p#hO3BDjWccPQmA;hmkGhhCDb!hhjCDBZm**kB cj+HhXhAPQCQ`h , *chB82F6/* I FVȱ IFPH S)r T R"T "X *6jhBh 1FlG(h+++# 1Fj#Fu&l QF8FGh+ 2Br  [ BB{ #FQF8FM  l\9)?hEE孨k3୫YAh3A^ ОE| ЭQA`Op  k3­U 0Ah3E 0AA`13A1HPEOp  BB803 P 00-g 1pPD4 a D~p$IcCFKDFPCRDIPY`I>.[-O%-FLhF(Fp& 2B#-u(Dp!F(npFO p70E"ӤDPԬK$\CBTЪK@]QJH603nJk՛k35Sh0pBp" FBnc#k)գk3&ѧpO p4 p" F*n.lhS8IhhlG0##W<[hEp4  p7`0!b @|Kh;OE&hlG BBO3 H$F0B~BEp&VCaAh( xZplh ;B1H # CC3 DC2+rD sEr [J0bj` %Op 0B (`+ sO3 3.@ o [B O 3 D0E5 'Opp#sCk?0F5 XkJX:FL(XFhlG0DkY-j -z X C1@J CC3 DC6072Jpl`{m۶r[[\3& pGD;kZkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504@3h0FlG FFA#0B?p"0 k3{;kxzhS 0+rp 1h Xb0F2"0G(X##yhS #Bq F F#3hjkGa"{m!Fam#bmcb;nb{nb3h0`a0FG?F'3hF"F0FlG;kC 8;cCFrAoH<*FA  3 D 043l2[ BB Ap#p k3@#k@𤀞@񥀣n+lZhEhS8Ihhl"G(S8 hh"G(z h   bhX b2"0G(>,FĖ##)F"h0GFHC*FhlG! C ;B4A #d CC3 D  h   bhXD2"0G(  05bhX+r h     b2"0G(9##ahX#BqF F#0jhkGacmam*bmjb"nbbnbha+?cj+?_#mC"e"~*?WC#eR h   bhXF2"0G(Цk3q#kmщXbh)rg  +chhB&kjGacmam+bmkb#nbcnbhah0`)FFGl1F.G.BB 0BBq6")FGBF*F1FhlG0cccm[j+#mC"e"~C#e705B#p O4BK$Op 0BK p$Fp2 [b2VF#CEdp!0FFp#F O2F!EcO Op EbOhEw$Op0B e; "3c0.!FXFlG` .| Bk5Q)Yhq EwEicd4002XJhCЊk263cp3C( kCKkB k  +hB Pp"  ~k3h.AFlG0 82d0##3hb.##5ce6ep4`BkXKhCЋk3Pp"~74SpF$M(h%(h5Dj+`h!0bO6 Fb%KOqUKF#1 #jc#FHP0\Bbڠj2(Fb p#!F002jj"0 V&; = &-OFX-)1$A#,@b% ,@](!#F!FF0%(F5#0Q##"#GF(0$Q0" FT#G(F%FhB$@1<1@1V#CR#V#Kh-@$,O V! &Ok#3! _J #!s0F#_K! "8F#J_#h hO& O% 2 !h Hh! gXF 2>#h h "h PhZF! g' 7jH,#hh#hXhP")FO # H# #0ZKO #$"`WJ!WHY`"aVJhYa"b(SJYb ٠j0"cOJYc #@o3 6@33o O3GF AKb0F0Ff.?ꮳ+R0TjV##0h0G.@eV!h@#BE@0 FG2F+F !F2F+F F'i%h#h )F FlGP$%#h+  5 e&.!#h FO50G .&p408r6 6 8B&6 6 6 m1:&.!F #h FPlG"  FG( ####&#!&#FB9tI%Op BVO1F612F+F FGlh+?iiKOaiJiH.# g!F#2F;F F 2F;FU !FWFp3l!u#*F.FBC#BI "F(|э 6j +AIF5p4 lkC dhlG( C " hk@;FG"SDld"jp6,3j,,Tm,(FیE~  FBv3p2p$ \Ch%DlkGh C"hkP#G"#DmBey!HF0"0#0$ 08(?h #"3QC>[[$_W 7FF&+l$jFinhlGH2F[B285B&` h #*s|+ pG pG-GFhF-FFh< hP[hbc"+hch`hBCZa+h X(`C P#J`P'O<h hBܽ-(2h{C2^0\0+hhc D `hc(hc0`#i(`+*F1FHF`7A K hBڂpG+#pG& K`pG&8F$1Cx1$h0G F8@ix1S%5b$1hB%MP 1OO2 `#DFF$O< ROA L` Q1@ 5 a382+-O @oOC@' O D2+F*F#3O34AFO0 M 8F hB Q<"1 Fi8#f4d-Agm @? i0coF \\\ \*\FOpFF"FhF.3&4@LD)O`T# 40V;&4H4R&;&px Q #&A P Di O3`P`)1;#cA3G$q?hO #Fc$@hSE%lQFGջ ##$GF  +_*5O ' 0SE0QFXFlGӱi_)i1 `Fc  i2i1 $14`#FcO00h-GxFtFF$O3`)hB@ "nhF\iXB32DBCFRF!~`0(a.<`4pX3&-CFDh,LiF&F'FPhjFTlGh#Bs ,FFX04,Elkj+$۱JIh+#+`(h FF;+<c4b6dbb g R&$CK-O}h# }M$(h D(+h!J#DhIFx)IHKhI I O 0*h|I0F"DSi#&xI0F",#)h !DP0+3ИX.F0 YDRPTJhOFoF#G*h'"DDZDmho#ImGZIF0F  0VI0FO ,#)h !DP0+6ИX0+2F0 QDRPTKhOO FoF#G*h'"DDRDmho#ImG3IF0F  0*h0F/I"DSjj#+I0F*I {0F +h%I#D h/S~+h!I#DhF $+h I#DhX+h I#Dh+h"#DZ`dO;&R&]"]d&]]]v]^^BF6^L^a^t^ChF{+D#*s##` hJ0Ih+ PR&^K-Oݰh+̀$O6%FF D(uKh/@s-𭀺x$1hB4Y&FHF@0eJ! 0 DDKFdp`K 'D`J)FFR1+` "Dh)|VI _hIFlG(84X/Л0cYF Rb DG^>>Z^^lR&ChFsl##` hJ0Ih+ pR&-OO3ǰFF% 0kKhTUF(9hKhȱhI*F|1#$ |Ah0G`]Kh^I",O4 FG$hi*O2O3G(h0G(NKh+hMN0h D2h JI"DkSkhjkk*h5H4-I:Kh(>I*F1h!D l+$(hOoIlF#G1h!D l$h"  o#IlG3h'I #DhED3h#Dl!2!MF((h(?mIhF0(h(?cI"F]кQFHF(h0# 0OX3&d&!_ _;&R&B__{___&$1pF FF phBx1x1S%0FxAD%8 !Yx(PJ C $1I 0# K #3K K u]a _ pR&U  h J+ IO2 K JKT]pR&_ U a  00X>J`k;+إhݱ1{"2OpF (^#10K`0Kh0I*k#:*  ,0=!F Z !F %J %I2h2#K#J#K"J "I2h2 K!J!K0 F{J I2h2KJKK JIcih#KKo&:&d&_R&b ^ n iy PR&r ^ q | 4R&a l m Z R&o I` l 1[ -A%FL")FUK%`hSTI "FQKyh0:qXhhBkD";P! 3jHJ" FH3B(F,AKh+;@I "nF(3=OFy9h0;Jh"hB!41O D"$#hF7#h AF FlGB  BBѷ?GFhCEط?>FOO7&``-G}FFFFJF`F(bI:F `^(`I@FO F(O78F }(.WI"F@FCF Ѭh+QHIFtkk:j`j`#k+ackka#@0+bB0kbclbJxf'AILP+F*F>IC C C FFJ9I8FF 7I8FF5I8FF4I8FF2I2F@F0&I"F@F0,IJF `"!0FHF0 0B TBO# (*#pah-O ]$BFOc@h! $ F ]I 00FO7)k#FFD)1ѕD@k*QРI jkh I (#D0lkN,Alc|,k,J,kNpp,@ԀQF(F;F]F ?" hHh( ՚FC3|(CFFF(kh1F #؀ FDF0Ykh nI## #0#00A "!0F @F #(?Q  BBHBB? Oz#h2hBD HFP #IIM(%@6lE@Q 3 #@I8( #;I *(& @FYF(?)-I@F #(0-ԛ+ՔD Rp!h jhQ 12ZF cFIF #l1Fhh #vhh #70C0@FID< 2AF ZFcF d@abbb+bgbMbbbnbb8FHi F# ###i `SB ii 0+j0kj0j0j08𵹰Fk>EF# 9B&3@B1*F2 hh*F*-#p @B l  *FFhXjB jBCXF"hF1FhFiFD1*F FFhO FbF" EkkEkBLkA&@0` \k ukBuF  0;0 h EkkEkB\kA0*` FFFFĕeF#0# 0F#"# ##'HO0K@(`hkB-@u # BsO#F - K+` F00*F!FC0 L(;ih3`2[b 20C03k+УB " 0b-AFkFF#FB#+i-A; BBL! Fй)Kh;` @3B0#0!"!F04:F#AF0#(0 C01a!a F1)FA4BBL0\3&pFh p#kFB ОB %*K`(F3P-0й#c04#)F{(h;`2[B 20(F7cFh  " FF(-Od]FC ЏK@JHKh#KOqJ P IgF d]Kh J (H! 5F(IO80, xI O* L (UFVF'`p oIXF`F3C+CjIZ(Ms C <0k@08P0+Я4 ;FAF F "!@FP8QF,$//Н`0#NI"~"AFx "!PF7 "!P (BI@ c}>c5$ 0> !X0  0 0$050#D0Oc0pF׹=I(Fwvh#\C F|F(80Fn(FHF;hZk(F #mxFQ`2pb2;hk00+@I(F,(4FFCE0Ak(2kBBk*2kBB !F0Bc"4|dKh Kh8 <&(@&{ {S{{zzSzzӈhJL ]A-CFhF F ڈ z Zz ۉ0sxs+x'F"iF@F#*F F9iBsxl+O&F"iF8F츹#*F Fqi~C7/jF)F F67.$-G 2 FFxPE #`,0.0〝00#r10cr20 00 7"I*F 6 5  3 1  . a ( ѝ0 00**+8ONF9F0#c˅  O0A$pFpL&"F@!hF6hF4G. p$-OF8zF B{'O P-o)ХUBUADaD B^гBV1DBU M MBSKSK%R-E{OO 1.)'D aDBiB(1FB fDB qB s1FB( FR 0@B( F-7/,O0y y pG;hhB, O0pGO0pG2-A4;OB22:F`|$%`fB T"*ѽ.h`.DBO1QA^B~ 4,n6KF B0D3O0pGR&(؃(8 ( ( pG8(4  pG(  pG pG pG pG-G$xFF#F ʱB 4uD$G4-*8""3+ y%.= оСB v#D+F45-"(r` pGFJ+ y)+0@ pG pGJ#獶 2J] vTvy.<$сx?@w9gD`Gx`)`hhh"D*hDBOAO0 yy?@v9>D`Fy`)`hhD9!`!a`O0-pCPFFC C JF0 K#`0F p#(k+BO18hG,# Kd-O{O AFXFf(ڸO0F [br 2 IF XF G( m cs JO|SD  aDgP O~ ̢.{CDO~3^RsDlRsЦ2CFnkb FQF6KO2hR#RE Fs FFFF*FPFIF#F:FF\CD2DLESE6 O IFXF(@3B32D@p BBE  @3 BԿ````4  ;(:&pG-C4 &FFLFO Fx"/)pDEB 2*BO ,!Fi,СABAA1HF!( !-OFF#p 3 E A%JF*uO.FO32EvU BR 42 KFK(E ,CD z `SFJ1A"F 3B Ds  FCE   #Bq (5K c`oFBv(F #BBr"  Y8 Fh;/ * pG BJ # kFJ]e  kFJ]˻ !pG# kFJ] 0F#hMFF3"!")F\ I h^ M0#6!Oc `0{dЀ4\-G@4FFF)53B6KhT)|D-OO MOJN,hOD !  5 #F 4D@FU<  FJ`iO3 d3h sdshCG ѽhR&bO4&8 F KF[h -5-4- H 8 c +R#[   [  [     [ [  [ $HD"HH4&\&R&u&&Lch n`h4&-CODMFFJ !4  D/DHF@@m(J(!F8F6 FO3d KhQFUYh1A,dR&bOV4&KF[h %KD 0Bh F@4&R&8PF F@ @ @ hCh`#`(y`a+y+#iC#a8*+#iC-OFFFO O vyO06  BO , FѸ*+Щ+"#HF3hxa3ia3j+b/#EB -AF dFF#0F"{"hD"B#iC #a2xa2#a(2#b7#b3y+>+{Z*,1991+1;+++11+1++1++1+1+++111B+Ђ+#!+د+"Ю+ٸ++++ ,Ҳ* +"a+#a####8(  @ K@QJHt`d8 Mhh#Op` 0+hx;##p84&pdh%h) p0yPh(FbhNchD#<3y(FJah3R#!bh(F,)pbOK7F[h F  "(F((`xK,@| `$ F0LD!Dch+.F4&R&+#J<] ] 0F %h hjjCX@BѸh!BAA)0 h 0hjBCX@B Ky+8 pG pGpFpuvU B Fp@pCc) F)rKO^qJH~BB LBrOb"2LBr@""d d@8F F@7B(KF=F'h@XbRJBsڢh`h# h3#h9F FlG1 ¹Ob"@BqXA2@ @C"Bq2hO:&@88uF8a@"(F2 F 82F82>CFv,KOdq+J,HO2q SF(E'K`(FnO2B1FOsO?F ``8FFBA3#OsCb`#c#O3iF20(FP222`! F F ~c&d88F Mkh khB K!"D B021l* 84&R&H8 ^ pGb&8h  hjCCX@B%hz0+  bhF(F0 8 -CMF cuFF!"@+FJ!d,d$.(Fxh###(8khCEhAFlG(BBBBѝ AF8kh&*Fo3FGF FF غйJ1F(FLFѹ J2FF(FXJ1F(Fo d dGb\C-AFFrcFC+hiE Kh#` q+i ``B xc p\3&-OF,MF$FF!Or8F.@F Oc!FO8 FD#/ b)F#XF2FMrѵ!JU#BMPF0XF p@"!U#1oU1@F ,M0FF(F2FXF#M:"BBF q Or@(FID HF1"BBбy1*+Е1+*+ѕ1+ѕ1+WF2FxB$ s0PI   E,S"#DBM $Oq F(DFOB )3+1Щ+ 232D2# ++#ER@+#XF D#,H<FF"OFCFv8K@17J8HO2q gF(<`(FO2B1FOs FO``8FF?"#Cb#!`O320 Fh4#F(F0 F$ F ch+"Bs#hjF!lG(((#h F0G~c4d&`2S11111T\BodaqAFF-A y.h,,Ѕ,8B,8Ьi Op `'BD$h@3OAXhAA ++hCD\`7+h8H+h8(h 'B` FwF \ ',%1)OGF82$B тAAAAAAAAA+h9F8Z3Dq4BF2 F4i+?wJ`t2F2 +h43B(2+ѐa.bd-OFFFFFΗ 4 Ėxi +s(C" FF4]T.,FEF03+)БBиO@FF@B `"FA#6B1q F! #FA\aEc()8bN2*ѸКK0p'9A\I/,)КE37/bNEn1*+ $  823NF  $!0F O2D2$iB8 F B^ڸ?mrKF{"O )2") МDDD Et FE~ 2*2#\) *3+PK@TaPJz 1B sڸ?Op q 1D 4 B t" 4CFAF(?.2k @BRF"07F'0E1B&K p"!n(F2BO3 0! g \  , 1)K@laJH*D@A DBOp1?@5e|e`W GdF-O4 F FFǼǜ #+``i0K@JH@%O0K+`#zFO8 F3++ +(-@ )2D4q!D! +p#hchBse CBAVh h  C B A-@8BYFl F2 ơ!D# CB Bp SE s#Oq F(V-?]MKh_! CBpƁ!FBy+F"IF[@B9F8F:Df0F s v yrE?0)*"*@b3B JU"!"!+=#JFFPF KE s  9cC# y IF2+FM[@B*Begde\3& 0JFA^ JE  q2JF"[D[A 1@`Ep`1y+FIF[@BA\E22B sOq @FrJU#r1#1F22 -?I+@OsF1XF"BqFh"2i(#!Bq@`i +(B#` "FAB1q F!2ODYBBOAbBr +F4"qQk<@B,<"p!1%K#O IB yD3+O t!%yU)/ -СE?014)"1?D@ B p-?~@ -AFFxFkx4 )F8F(QѸ h0G#k+ kP"BC v2 0F*F&   " F6  z(# F # ##2F!K )F8Fw(#k˹Kh`h #G c#*s k(hP2Gb!I#`h #G c&-O$m FF !!#OcO4 F $mnIr0H6SCs@"!2Or!Fvc"J!2]K@!\J]H@ vO  Y 4prppqrqq  6O[^OJU"CF"0F*FYF  S*F8FkL@EvB,8F*L&*H&*HFFF@3E(FO(?1pp? A8pFF@3E(FO(?1pq?Aq(FF0F*F8FLDFEBh Or0D*F1F8FL*F0FOsE]EO4d@`tdFR5K@ AJHz)F1FFjCK@AJ Bq#X`4+F@ @0!f~d5fsF0K@k!JH>4O3Ov]#ah6R-CL kh0G8utvU #B`h Fp@P# F(uCF>++O0:FP!*P# FuCF+!KO2h#RZEs FF"FQFXF|*FxkCEE@:0EF0FQF @13h`!"d!*Fp#FGP@:&-GFKFFFO<hRL5E8AOr`FFo-?, #Cb$@3?$%BF;`3hP@@j #BEs җ&MFM+h[3 ўI  +hCK+_(ДI LKh+J )!EJ;+{K@FIF]|A0 FYF ]JA0 q(D {+{dOd [FRzKhuK*"-:Dh * qKrI (DqSmJ[ mJ,DlH#BFIFFB|+@#!q bJ0 X#Dhch8t#as:@ ]:@KA0 (q8 b۵ ]TA0 Q0 c$ z/CSO"q,I 2 8Jd!q X)KD(qkJw; T+{۵@Eq M%JP {! % 3BR _+#d F4FFY@.A&&& && &&si&Qgziiii.z5J9F FBD+ qX0J6D/K *FhC\*N&a]jA FYF]d#KA0 ! 0ȋ{jB?q Oaa FJ9F FDOaa0Fx2 Fh#+8FIF jm@2FiFhTCF+ F- miF F~pF$ FFdF#FaB?aFB?`2bC``ppFFFjFj#ZCF1!"p+DP#T1;T1+DP#\1;\1+DP#l1;l1(F,52;2b.b(F,5x2;x2xb.ttbsF# FFFF(9P1F! FL1nP3@ B@ B B2  FB BB )FB B 0#P#p@pq"FN(0Ц#`H !@I1+ڦ7#OQ(#1#FJ@dUjQ hF@1 IL03 F FP030 գlKI FJ@+Fx!FbI^#jFFHt"x1+03F0 F@ (q"F(0Цv#` Hk!@)#FJ@׻fjm M0ObiF~C ѦHh6+H= M]#I 0hFvwjb#DpFXC%H%!)Fp@T(1D1Bp18\ "TaHVQ=Q-I n; f+ X1 #FJp@[mZe "pj@m h#j F/dh-GFPrj4770D#S00X#C#0zh0q CC0h Xsd{h0Զ@0CCի`>(0D&0 PF(F5FQF(FIF{hC3{`](0Cs0ijp+% p030eTsSC#C KL O(8 F F pPTrCC1hnrSCD#C% psRC0F %u$TsBCvh   sF4@!QF.CK@[1h F%("(=Ko > >0+**~. jF9F@F+j(F&2˱`h`#c`1Zh``"Z`#jKHIF Fl F %Fz`2+`h`kz`f}uk-C "FAOq^0KILH#%IH$Ob5OzqF(FF)F@F7ѥh7+Хh +7H)F}Y# FF0.H  1h5h0F Fvoh 50F)FG(*FO1 F=F2`h `2FPKF"!(r`1h`Zh``*Z`+j+(FCF:Fk F0ѥh7+ F@8 h +ХhV+н@Hk-AFFFFFFp- ٥7#&I `%HAۿ%"B#j+ H ;F'>Em**F1F 0#jñ<#AF* 9FFH)F<#0F9FF H}>PF**F1FA¸kFc-OFhFIFF0F8I"HFOI0FH08A F!FBI0FF(KF`#1@ "L(@1@@1#C@1$ I0F^F(G0C0 FW$40DDEXF}F(𶀂F&FE-&!FvHF lF FcoKqJ4F`pK@F9FKlKBFjJ%O@1DFCC@1O $W&6F|ZFPF$DCO D ;k) N)4)6)&U)JJp) x) n)!J JZK[$& 0=K hEۣB 2FAF %C*D6W*XF(  04(K hEۣB2FAFHF0@1#C@1O42W*XF( `T#`  SYI KhCE=(FRF[F$1F{怅΅lW# j03 ahJK a`!3CE۽"RԱKhCE&W#j R3CE۞(FsKBFh;;F8F> F*F[# [c KDc`F> *F>D8x1pFF+OYJF(4Ђ(x1@SJ!SH.>ѕt1%#NH3Ff0%+HHH FOc ;$dh+9I03H 13h1hlt1+-H%"1FaF>0 dh&H &Ft11F+ ""J#FF(C  "!,jDFIOr(F20 I Ht1+е納ȍlBnKh*hQ`X`pG8&FF)8a5-;eBq8A1h0a P nS8a c`#𵇰F 1F2)F0FjOFI+hB~ hh`B ` D:``ʚ;-GFFFF0.KOq-J.H|,K@(J*KB*KOq$JjL,kD FO04#i"hKEciSEch S`bch`(Fjvhj `c``bF#*kchB hBChCh`D` h!lʚ;hpG-C FyFFF0-K@I,J-H| *'+KOq(Jkѥ#`(F h`hl1B٠l"\X8O5hB'hld3dh2Z`Bh`#h`X`h `3D``Vy"a (``h/%#a#u竎5l$D##F] F0K@JH|Kѥd#` Fh3\O4#`hBhhb""iZh"Z`$*O2`h$uD`竎Hl7F5-ڥ,#`O00hJBBFʚ;4#FFFOzqFF4J(FBsK KC1FMb@BF0K@#!JH|(j Fܱ&hiBgiB'iB gh^w`gh0>`okg`<`lc4Fbal0K@7!JH|#Aeexl#epG0K@J!JH|dCdl-APFFC (K@# 0'K@n!&J'H|'O$DDkB 2FiF v0O0 kS$0;>+٤`4X P(,C@(<$DDkB k"S$04 l8X! FX %0 F,Fo F8#FTC _#a#FC(_b#FC0_cc#ce8F#`3 hXhj%k5lJU82+Z`Bh`?b`2+Z`Bh`4"a2+Z`Bh`)b23Z`jh(F`bcF F@-CFF|'#m۹`0;0Xh#l+alGQK@!PJQH|jh`mf Fh+h*22[Z`jh`0Gck/`k``ecb oB##mF#}l+."hFO Bhh?ShqK`Sh`#i`S``"a F7hc`a3`h+ ;FcFSiC6"u*FhKFIBF Ѥ8h+?}2h@B(?s%h-?oik0>h2[ik.?_-hki+ШiGh30+h+(iG竎l8&FHF|IF }Bc4 F-AF#OmFF43*OaCF2FrAF iFF F m--@- ICFH2FF4BF1F(F $焲R]pGM FFF3F*FOahhF8FIjFF Fl` MR]pG R]pG R`]pG R]pG RD]pG R]pG R(]pG Ru]pG R ]pGKpGKpGpmObiFCF ( lNO4#` F mpMI4#d焲KpGK@  8F M"Oc H)F\x"1 4V#`O08  F 2 F  F3 h F@ FBоCо1C F@ F"!hF "hFx#hIjFxC0 cb$ipF FF!"hF "hFV+hIjFXCн0C$ B I#(hjF0O0 $p iiCjFГl3`002 @0pG pG-AF>PMV#O5`(F-٤7#">FF"&CF"=2ѝ0>0F#C0<# F HK> 1F FF(є> *1F5h F Sdhh F dh"DFB ;3+*$F, p FFT#/x+F" F( "1F(F(:!(FnF(]oB0# !# "c;"`O0p3p")FX!Kh.F;#Z1 R5#oB# "0Ft# c3px.+i+oB#0#! "Z`c(O3 ccO3c:+|h-O۰F F#!Or. OC FH%P Fpd0 љH8F /F8F[+## 0[x+]4F(U=h}+S S%p5B%  (%+yҲ*#l[fi+-+-и&IRF  %##  *> 0D@1JB ] Fa0HQF@ # Fizscd@ FH0#L0clccd%b F#c`{h`d`4|`Ï@0 FF1$hd#`(F0$E ( F0i+dh-AhFFFO4(hqT,`hah0FhSx+ai2 i01i 2F8FcF! $hh(#` iB@h1hpGCj@h0F F"!hF  "hFU I# hjFJC%0 h#IjFi~iFOi /+ i#'DT!h,n#` F Rzh* - -*FhF( "05%"DB,D#iBdhFY0O0 I" 0I" 0O0 30F82@Uh1Dɲ8D!08@U`Ph!aP`Qh _ `!1Q`Qh_!! @Q`0)##S`0-AFF FF0H(FTAF{0F H F 1h"(F1[>HH F 8F 3hFZ2`@#pl0-OFFFFF3x"+"<"+@Ҁ86@π5x%#;%O FE"Ӻ5ܱE ##p1F F3HE٣V7#`O01F F(FkE,1F+\*@rxx*m*0*]b*!*!n )P! Q Q Q  Q  Q Q Q  "+F>F, ", ", "+J hxP1 Ս xP1J 7 ,"!6 69F`FF0*رBF ѝ "!F,(" +F+F?3%5hXFxF2 + +pG+FpGXxCx + +pG?FpGF FF x; 8` (` /!FF! " F# # "3H!FfO0%)F (9F0FoPH1F/#<-8h (`-OFhFFF(?HO&=!\FP9IRF9H*(FO m$p(FF/D(F bPFF(С"8F[(L"@$Pb``XF G@XF FPF~&FXF X #U4:FQF D<0D4W$)FXF(ѹPFF(HlFh% i,'#j`Bi,' fj%Uj`B `j # 355-OF1;FFF~+Dž   0=Hx%0;_ju, ,  , , ,   ), , 7p, ,  3,    ' , OE O [ e 1Eo 5 '; +  ! 1 ; < n x  4'-I(FIF{F *F![(@L"P1[l(L6PZL& @# 0F2Fh$+܀h 4-#4%0C0a-40HO5QKhB !#*FFF %O5縅B0j90#!EѪHO5Ը4%08C0Ǹ7"0B8$#0p "###"#"(FFl,#3p,FЎHO56 80Fn(!Ѹܣ7#`84 #D3; 84D349P%:D8n82FKFAF D0;0F(%\40JhCs0-(x(4(hx4(BR0J`+x6+kx6+0%CC03-a?" F(F 4 I( +)FKH[O5-@40X*Fp%yX4%0#c#04%0#C0- &,!(F\F(F @F uF@(HO5ʿ>p+F$JAF%0p:F1F0F S40C#Cc0)I%tQ%I(F(#%t1I(Fȹ%tQ,`l|JI(F(#%t1m)F8FF(?x (H%Z)Fx%|P4%0C0E=41#%21#4Sd6`&X(?,h+)FHO5}-4T (FT(HO5f-@1 33[hyHO5S?" F(F  HN [`4%0C306#*F!( (ܿ#r(ܿ#r(#cr)F]HpO54%0CC04%0#C04%0#04%0C04%0#04%0C04%0#B"Cc0#-p6HQFO54%0#C04` d4 ``-кX4h l44p t44 4HO5$ (4(F3F0)FHO5?"p F (F H~ Fñ)F HO5k⦒’l"exp FP(FF#;F:!(FF" +oHO FH?8HO5 ^F(>*FCF1FMFh4"|1YP"H(F =O5F6|Z&xv@3`U`%-?HO54%6#6x4%0CC0l@@JeglBPY4%0#30C4%0C#C 074%0##0--?\(FXp2+)FnHqO5h%p24%0C0 4%0##0-?0(FF(#;FXI(FZ8DF4HUI(FR SI(FLPEeghPg`.>wLI0F<0KI0F8(~kGG0W%P%e4%0Cs04%0#c04%0#BCs0#4%0CS0-?ë0#*Fp!?CF&H4%9{4%0C0q4%0#0g%e6-O<>HAFPO5D R-?h, HO5DӔ H-O LFFF F&OY 0@6g.D1H [j+Ѻ HOSLD9FBF(FjOlؐ9F I F H"(F4 I0#BCc0##-O3`6C6 P#^B0C0B0CS0SB0Cc0Ts(t-OF FFF+D$K"`930#xKD10FTJJKFHvBFO ""J)F8Fh"F.(Fm00!q"BAB 0 F~PFO ΅ͅ&l-AF F)41+a1+k1+g"9F0FP @ T `fd6+c` hfl6+ch pft6+cp |f6+c| f6+c X (FA { y1Y7(F p' k1Y7(F b'"F8FF(Km T"0F,6Hd6;d60F,6>l6;l60F,64t6;t6ph6 *6;60F,6 6;6-O=FF2F(aбL#C!D#F#"zA л#BbC3BC#5 0C0 C #+00Or#( 1rD1n,! 0`H_IO2? ӃIH_@F =#d6OO    (P`6FhvO, 2d62`dl6 pBhh$ tpvO, t6 pB]p f&#h6l6p6t6t"&x"66O380F+C =8!OISH 9FyF L c BF!0F#FYFd8D Bx + +<\+4 4D<[OsB0 D",8BF0F$D[  'F!#I yF  +?/UIXF(| (hкXQF$' # (++@AF0FZ#`P&csUu[;F 8D Bx + +<\+O9,##H*F@!I!H*F6% FH&H*F)H*FbofHK*FH*FHs K*F H*FUs,}nɘuF0K@[JHxPp p@s,80KOqJHx8u"F(FFHF(F"! FP 9F(H F8s,0KOqJHx !K@JAeUs, 8F0K@JHxhF!F(F8 s,F0 K@ J HxCm@ h@p)Us,F Fq0K@3JHxpBK@5J"(FFF"!F(F F6cxBД90B(F!FF FHv"!0FF 7O%"FF(?%!F!F0FBР`8F F(P#!"!F0FjcxBF+:є90BЫ!F0F!FHcm0+30#RSOQBB!FHF!F 0 Ѡh+Рh+PFz FDFts™t֙t(K;!J HxCx+Р`/#`  ߙ8t(KQ!J HxCx+РF/#`  ߙFt( K}! J HxpCxc+@h@ &/#`  ߙQtF( K! J HxP@x((XhCXBXA/#` ߙctF( K! J Hx2@x0(XhKXBXA/#` ߙqt-AFF F1K@mJHx "KOqJCx#F p F+сyIC1F FJx0$@yF"F8DA83F"F)hxAt!)8 FF0K@JHx!KOqJCxKx`xkxB*x#xB(F(: *(") D8@ F,((F'( 8 1t=pF(&K!&J'HxCx+Ch+O1 ,"@:@B Р*#O4` Fp"/#FN3x+P!FC C #0#3p(Fs K@'J0pߙtX&IFCx F+0#p|,%F!%u*F78FF! OH2!"r6=x0F#;pvBKOqJHx/#`O0bBXSB"{U=p X&at0 KOq J Hx!K@JOs hC`ߙt{8LMT8(Ft-FF F'OZC;0! O wwO3KO 3LO hB'0K'0LO O hB4 O8")h `VhF O6̳(`O0T;;>+٠7Y  Q@,CA@+٠7Y  Q@,CA@<lk ll3FRfCF)F yh0O4 F0@pGF FFjOV?  *F9F FCFF F&B<K!J +*ќBx*K!JHx6 1B q"W(}z<FC{B"`)C+ٚt-O {FAFF,@qpGLF( 3h@1Y@;I:F F^008FIĐV(I8FPF I8FJFI8FDFI8F>FI8F8F`I8F2F0I8F,%+@ƀ3h@1Z׀ FI:0[TJJ 0𨀳l+JI+ FI F0rl FI0𐀖L F~I0rj F{I0!0FwIF F0tЖL03oOr!M0mI F0^Жt0+@3h@!PAǁcI3h1@^I F00I  FT0;Kl*?+9I FG0$-?&@61+@Y Fr FXCF@R%H'J"'It F0_ 0+Ci$6.}сOw `myt]u6tC׊XFF(?iB`"FNE T FxI 2D0?P"YFtJ FrI80DqI8F(|oI8F(vmI8F(pkI8F(jiI8F(?fI8F(`-?`K`J)FFF^I Fn0? \I:F Ff0?0F%(F>0h%(F?0QI FO0?- ? 0+?0+? FEI2F0?Ϯ F@I3!B06O:F5O3J8I F0Ѵ3h1hG%*2I F 0Ѧ8F%(Fh F*I2Fi0?! F%I 0ъ-9F F50?1ZY*Ѧ O%CF@F(?k F'.6ʛ՛8F h(FCF F8@8FFF **ѳlZ#JI+ F1F(FO40$/0cZiRlB}1F(F0O4 FJ$$4.pF pE< NB"1F FV4 Fl F0D#`O0 -AFhF1BT1F:F(FAF=H F:I"8F"8!FA!3H ;F$pBF*I+Hb$$O.3i {0F069F@F6h(" F^t0 џh+IH# O# IH(OsB I"FF H$u*u(?JBh8 FQFH@ Ԩh@Bٟ`T#`O0 F8!Bؓ F~`!!!Fx$K"uF&F9F; +ѸBХ>"*#` 2F0B*2F)Fn(dh5)FDi F)FFDi`/#pFhF FԞ#`O0Fx+Ѓ)F1x+x:MA8А"! FBh FcgdhZ \c+cxcwh Kx+ыyoC@ghXB+kg`ecm ph8-h0F9Lx+О#Ii`e(-AFxFvuE52E AF29FD:xFF.8x2F!D2 +D2%O0p"FF !CF )FOs2FzF F,F FpPF F D !F"  C|"9F NI P@@u ,ٞ7#`O4 "F(FX F/i pG pG pG)JFQhhz p1O0O3`"I" F3#OBOq#N0IH#@"#Oq<0 I H #""!.0H 稞0~8FQ(hCи(F#18@ſpF>`ư FBОjO5#`(FFpOr!hF "hFOCOS02FD)F`iF H*> FDiFHiiF`LT  <( ~1 KOq J HvLKh++L@B O0粞~TCjFАlCXBXApGM FhBF##gD#M00PF" FhFM    jF IB + ")F FCXBXA 0 8i(0PFT ["!C C"!FI +0 :i-CF<]F1K@!JHvKm#K@!~J}K@!yJOb!8 F#pHF1p31caso`#`-F='hB`hC`FHF7xsmXihC`hC `hC`h/Cso`oDCc`2#j"cC#b#cchP .]5xB Xh1FB ORXC X`*Fsmi"0L-W=E5.Dh /N /F 5ǜhY 1F(F:F*/K?G7=Dh F 5Ϭh 1F(FXo2F >F65D*"!F0O0 <]Cv%IFp(F:F/?G7=D''&UT1-C$"#BFF!"F#!4D0O4 F/(MF(FD!CF(F ,FLE##DE ؞&#`(Fs O4h@/ "F0FVF H "jAF8FE@F]#DFp FIiPF"hFQ kM     h-Os000h "i 0 IIK-F@#jF0Fupi@ih92FcPC #0)C 2""!2*-Gm6FObCF$ (н B Оz#`O4 F m0+ѝ0+€+++w*<,6(F[0@€PhV<O4+*(+9C ѽpF(н 9> :0Kx+++Kh #Zx* [h#  #Zx* [h#P 6" C 1FF     .OsX0;hCI*0yўh+Оh1+;I0+(D&0ke#h1h8B0YmkmB Rh>0+  H8@ 2κ030Ԓ,he3pF F OqFs0`X+ha K0#h+0#pOpp@B0 0cSc-OFðĐF!PFFF3fѦH x; {hVOq4F(d0 `ñ*.h( B "JBљh ћh`#+p(0> kpS+ *p00hs.0..Ѐ#k q"Z?q瀀(OqPFj0oH Os..Tzhsh`ȂbH$@/D,DB ..dЙhBк*@@2C0$00#)@F@5$p$DB.Ѓ<0k<,@v6#p#q<0 0.q;+8##p#cp4KS BB 4(1x:3BM=#;( F x2(1x0D+.&јW0923:B*<#;"1 F120D...D.A#;`#COp#FnKcScYg+.ћ843:B+#;8$1 F812x80D..L.|0 ;+@ˁ2##p#cp04D<0;+@3##p#cp  +@dF7#;#0",2B;O`6,3d&rEc 3FR(? R, #ɲў0BОP .Ѡ:)ټBc ,232x,B&ДBFS( S,#Ҳ|BАPB .ѡ:*ټB0,3 ;03ИW0;+@9##p#cp4$ 73+?Y ?3:BM#;7#1 F7270D0@1Ԙ0՘Z0 :*@ր"FP!cpFBF!9!2FsH!30:BQ#`p#pЙ2 Cpa#p#q+XF .%.4.2Ј #0Y(МV;FB#F !YF`pF F0Z ՘^0;+mt#fp#p4l953:B`ء#;9%1 F9290D6+?:_`4;+A|##p#cpx |66B\FX, B%cx3D+ H W(FO0 +XFX!6cxX,3DDcp0;H Op-OFF *؝#EKBНV#$` F%,F+F/F*F,lB  `+_!FFZBF˼PмQF BБ Eؼ4ѻxGaE]DԱB)F2DF!F FDZF+2F,ѝ#`~F|cSc FFF0Z0#x #pO0#`] `FFi0.H.KBBABFѝXh+%Hi H&9i  H"F(hBC!Fp(FJ H;(h@1E[ 5# #F0P Fs8` H"Fx0F ] 𽴟˟ FFF08+h #`O0 FFF0H+h ` O0 FFF2AKOa@JAHu0 bihh1#` L *: b`)\С`3# *F3F8FO3`:#*F3F8F##a;#*F3F8F#ca6#*F3F8F{#a!F' K@QJhc`i`#!*F3F8F`0 h``#*F3F8FQ02c4pF`m\I"F*e蹝4h+KHh503 " O0p I  H.h+FAhJ yw ? 8#FxTpKF(2F)FT#U FpF4F-OFɰFTI@FRFF(d(hZFQFF(mМ`1FF@EH0FIO Or3F0F6#RF[F(h4# RF[F 5FU 0#0,0+A.@ѝ0-N=@#+JOq8F ,xG$ICF*FHFhGPF(H]I$GICF*FFHF F~;hNdGICF*F`HFNG`P@UeLx-OF%M F%NFURFO, ,52, B%p%B&F,ѽ0F U,XB 3BU,XFU ,tFHFQ6,5#T ,@FT,5bF0F@(*-OFF؝#`) FB1F uP0 B O #DBҝ"#1F u40O0*O!FZF\DGCFIFF0F.0T GQFF0F"0*FF M؝h#` . F]Ḵ,Ѫ(OchG9FF0F0&-=1F(Fu +F@A0 I0FS0 M0#`1F u0O0F02S0[ h# +@F0-OFF+ohPp_0M՗o0 0hZF#AFF(@ST0@؀%P0a0hZF#AFF(VR "EL0FF(݀T;  89FPFz(50hZFy#AFaF(ЅK+%%B700h0  yH0Cc0(F ; +ٜZ#` O DBҜL"#0FF(?p# )!F  O3D T; B  B B O3O <#t0# 3 HFj e 8`IFPF(%s0hZF!#AFF(?KE  Y, *0FFO5e BB BO2! !"bgc(@AO&`A@O& B!CQ 0 F  8!FPFq(5o@Op@ FK枃-O}F0`FFF '4# h*F[FO'0'd _ѕl0+@𸀕,0+@̀#hOO, #h 2CE׀0OO, 3`0 3d6CEǀ#hOO, t#h x"BE2, #3, h`2B 0 Od6CE @FG0I:FF0F0O0 }# h [F*F0# :I:FF0F0# h [F*F0 (i@G{I:FF0F0b@FC GtI:FF0F0Ѽ h GmI:FF0F0ѭ'0?C#Or@! lybI :F0F0/'0?.[J@#@! ,`WI :F0F|0zrm(h5Y,< "P @BO, dBA 0 ZF)FF   h8J1F:F&Y,,}* *!F) 1F: 'J:F h , 3 ZsE20 PB hZF)Fh0:F1FK h  , Π@.w 8FP5 F#d8p"$IF XCF&#2FOq$0 FO4 Fp"! F0OBOq F0PC #0OC0 +h" F 00-G&@Fh$ hdciciai#bhca#ifa8#IF(Fc0 $`jFpFRF1FFHO3#cKd@1@񜀨I(Fd!GHsC `jFH1FFHO3#cK@0 Kd#kZ `j 3F01FFH+ؓH"1F##ck z[ G{' {{zck#k:{{ z#h+;cn+8`jhB4єh00F#k1FF{Ha*B wH1FG{' {{*zkB#k1FnH:{{* zq`jF#k1FFbHK^li+h aii iBxk+u#h+rXKd#kZu 3##`@0ӹ0i OH1FRFi(hOrQFci{0HHQF70h` [񗀡l(F(hDRFIF(F(#`fh0(F@120C@iCaii iB.(F`n0XCF fk&H(FG"K#h+ !K!K!bk KK!kK!"k #H1Fl@_fM͡ è¢@jqxy ٘ ~(F(vD1 H`!}J+FG-) -AF@F "hJ(h+F"!Aw030%v! *[!F #(hAi;(Fccik`jF F(H(FJ2F!(FI(h+F"!&@(F}h&`}ifxcidaif#b03 R(F^ia#3cb030!a"09F(Fcfh0բ-OF`@FF*V(E3 3[hHդJsmH#:F)F:BF"Жh@vO:O (F}0 AF{F(@𺀑H (hKF!xB3Zh*ѷKls#dOzxlO`Fzx(F(3 3[hoJzrHrzgjz sm[@+@#xB3Zh*cKsn+$"F(F(?}$?w<>к??rVJ@+h *OB OB  "  '" ""F 0T>H 6O:3F:F0V"br5JAFba" ` FE""p`Op@""r!"z` F{OrbmCF"FOaF F 6 H h4+1+?+h@1I(F%(h+F"!O 7+?`TLzDCCDCkxJ! Fp&P>`5r h#F"1Fnh0 T6K h1FK 60# q F1FF H F@sH C1F JJx }2J!.m 8FP+h;+h#F J!hjFP FH# F+` # Fd8@8y ãJ!Ϙ p PF1FH1Fk*kH hJ#!+`#F#c Fd0p@30!a"0ܣm J!A FP`6h# 3F FS(C0H i#h@1T,I Fd@v6 F2F9F8H#h@12  H@~9F F%!2F9F 2F9F(a F0K@1!JHs  #hf+` (ah FS F#$p F@KT4J!:U -CF` F hhiBrjBY0F(h3Y {FVIFF'H hiHі@ ! F )F" FF!%#F"!I FdP#"B#"R RC#h!(F h"!K%{ł͗ 0Fh@12=#F!Phih" FPiZ'#+`# F F7 0i FQF FHB F 0@8F0P3 FFȹ H$I Fd8@6 (aH F8@ 28K-GF`6{h@xhP233C23 mBFѸH(GJ+F}D1 23ѰI" 0PmOq (ǀO3`fP#"!i +`KPFd#+e#F90 hQF(#(10nԙ#*F PF((1RF 0b#Cj((f# F{H>P Oq hL {h] F(G#h| ((>  (1"Zp(1  #h(^0>_(ీ*"(1Zp(> 0>)*#* FGHGHFH (GxX F(GU3X  Fh(a+iBF FFhaEzhrX+@ހ H{h +k3 hi F(@y?? *k arEw H dh#3kb+ckkDkckDc਀/ 0ӤcScЁ0CE@π0ȀP-ɀ+h+ŀ`#+`6d0C Fs8[H (G)p?߮w;C hjE FPH30+h+0CE@hjEx FEH F3 h#F:F!c.0:CЕ@ r h9K ! F(G h2K#iaE{hI#3h*:$+i FAF#@0kiAF( FFбHF0ha(?hJF6+i!dah0Ch0 hhK B? #3h+* F(G8(̂} cSc8 PF Hd Fh0 FCh0#d8@48 0FP33[hH\h0Ch0# Fd8@Hh FI himł@Ա#hñ10sdnDhB#I]K]KpGł-OF#F xFPF+ HhkmBCF:F1F FD%> **Z(#j+ :D6۹͗ |Rł* h;3 3i;3ٜI3F"Fx$" FFi 3FI"F xZ 0#"! FD!XFZ h#F"!8 hK" 0 @*h*@𷀅@2ijb jd+H#c h@1;Kԙ0GP#:F1F(>#+`0€nI3F"F x #+e+iBh48F7`h:F1F/a>"@ h#F! F6# h<;F2F(Ѭ3FRI"F x+iBh8FF`(JHh:F1F/a hO @1iki?I Faid+bhka+ian#hYFmhC`i#F3J! 00" F`7WO 0+?r+'I3F"FxO +"I3F"Fx+h+N0 # h:FP#1F(=I3F"FxW#0@Ep FH+􃮿͗  Ǧ٦*-AFFFF hEB "FFHABCB0hE2 "FF H+OOBF@3F9F(FASv-OFHhFsFY ; \ FF1hB0۱hʱ[mBє> **XFX IFPFLCF:F)F Fgdh-CF FFFAB JI JH+F C-! F*F-n'x@+icz+f`Ba+\BX T'½(JDBGӽ OBѽ O=!i" F F  h")T'ýPp!F`p8FFHFB EL F H `"x!D@F:΀ȧp]`Fmh#`hBBiF F9AF3hC H  I(F ]phiF(F,`.m,ڀp" hh( p@ H0++p@m++p@p!]PFO P`X` C   aa0"` ZaX`` `0n "F|C HQ !]  FFh!8F@|i`ih( F|,h1h K O32BдvO32X#280h+Rh7FP50d00>0)3 (B" "* * BRB" 0!DB 0#c C F0@)B"BbO`jz  F Hgjz S0+I h*FK!|0zDQ 8FP#Fh!JEh0+ h!8@8Q -OFLiPͱ)h(knB  [H$ F# FXIkf F0F(ѳiZA)hñihBE| FKH030w Fn3 *0r!+h ++ FX F030s;C F(&Ci=ki a+kia+cj$'O FO /  Bji1i2Fx(њ2@*ٚ7/K! hdl FbXx0Dpq(łI_pG"Fв2[B F*pFٚ#`O0p&F`!=dB*F"tDU0FF(@CO `@@O#oCF#OsXhHh hBhhB0hJI Fh@Bh1h F" F(dh1h F h[h hhb@h"Bh1h F h[h hib@h"BhHh0+@n8 pG pG@ 2O0 ciPiӱ(Дhh *ñ( J0B O0( *XBXAFcSc1-OhF(O5#jpcj YFJFIF0F.F(@րdh;h+їh0+{n3KOqJHrYFh{nh+ FF(O@FznoCg2@{nh#)F90#"F00("F00F(Scj%00 FbF(#xsyn81mynX1g)F FF"FF(?b)FoynxXCXgXB)F0FB+(F58( hF(?f")F(!F@F #AF|0")F!F0Jkx+(Fih88FcF0FF0F@F")F UE9FPF(<  $B +  ЙB"QF爹h BZ`8F<" F+HH FF(?Co<CCgiFO3iF8 Fdg11X"!0FFHAF0FAFEE9F0F"!F(9FYɨը*tĠ?j0aj3 ZhՈh BZ`8F<"  FH`4 2F((HOͺ Ga`2h`"a` B``3h`DF0h% FJ! ~v3hhBѹ0#aai#a0;3!FRF(F-F- FO޸90-GFh O Աi'h.h! RF4CF0F?vcKYFO I="(FpF(LFxF32:*FO<\4  3s3FF(̀C0FHF(F 4MO`F(c#[ ((FO5u.-#"0F#@ OFF,FB)ObIF0F<"0F j +TЙh(FJ`o"O,#OFKD; +ѸQ RF8FF8 DmMF0F|aK`B(F@(FF`]Fo:+?LO \+?D + +O O## FO3<]Lh4#` a``a`&-GmaL#FF#i!ahsx&p#h+6Тh*3"`o' e&F;/*lhWfF(@h(@ ш`.p\#iEIh~f`(O0 mhWBFйh(Ѓ@ш#i`"a]h(FQF(F~>`(Dl*faxDE1@:(#(ai1<\+#ca,\*"ba:*#*pkpoF+"@FpO3:F|F+=`\*?o+gDla|*:*+`&/h8F F)F F8@'-GF="F(d D(@𬀙 #`o F^+ cx:++pe\+cx:+}+{У0 4#˦B0 Ж0 T+/A+٣B, \$ b_١# # # #:L(FdH(FyFd"F4F#xA:++m*O4p(Fw(8`YFd"O:O O O4MF="2Fd >Fd#/A:*в+O4p(FG8` #`o F;p L(Fd3(FKFd#FO4pF#"Xx0+CxX+00$$8"0޲ .١a+ءWB 2 $A+ء7 *`pO0#L`h#`q IH~``8 x&ĸ-CFELFF#h+@JybhOa?Hq8-t##`(F !HF萹`hCh;C`+ڈL (0hZ`x +AFhFq(-&1F~(AFhFqrAF,hFql( "q(x+0B+K"F47Gtx,(  pC+"B  ( pC+"%`* F%x&&&K[h;"FFa(HB( x&&F6K 8Gx& 8%L`h%`6e`8x&F`"F! .K87F Hx&&8+FO*` Ȅ ,`8 F`!F" K87F Hx&&-OFFFFȿ`O̿OO8o0@F4`hBh [(QF(LE!FIFB LEE$0O8U B0 pG pGpGpG pG pG#L`h#`q IH~``8 &и-OFlF0FF0+@TNT PF qH-@#0(F !PF4Ch;C`+ڈ (0hZ`x +P#F1FhFC C C q `-'9F(1FhFq1F``hFq( "q(x+Ѡ`E1FhFq( "q(x+`YFhFqa(YFhFq(YFhFq(?~1FhFqa(?v1FhFq b(?n1FhFq`b(?f:!(_%i%g&n K[h L"OcFF0280( &&F KFFF[hc"+FFFgH %`( `&FK 8D& 8%L`h%`je`8&-AF FFF#F*F! g K84F P  @&JOc0] &-AF FFF#F)F" g K84F P  @&JOc0] &8@P@@@ @@0pG-A4F N# u(F !|'F09+F% +O8FXI-O FF AFWG@?F@D&WKOz hZhFAFD 6CA9FCD QӢB ӴOغ_=#cC ?XFiFFF&FFFF9FF 0F1FF (F)FF F!F@F xCiFizihC(D#@S@aJi30B P#@hiC)D"@b@aka3O30F FA Cc"hBF#F0,ЄB)F|0ј@"h]8KhKIGKz+ФdN&-AFMh3б+i( /iF8@oi?B8GD8FB`Ѯa>Da F0 )j"F D$!F(Шa Da&8? M$?ii#DBӨiDa8 F( &Ch#Fh+pGhhBFh ChBpGFpG𵇰KM$0+ILIKJH&hFFG&hFKGJHIHHG&GJHK%)FFIFJ/z( FEHEI&h/FDHG*CJCK))FAIBJ(p( F@H@I'/F>H?O&h8FGjiF&h0&K'JF8HG(kiF&h&!K"JF4HGiF &hKJF0HGhkiF&hKJF,HGkiF&hKJF(HGhiiF&h KFF$HG`hiF%hK!JF!HGK$h HFFG&N:C0Uh"O= ho|Kk hcpG&Jpil  @@@"S4`uBeO4 D0D bLbTYi DZap2&-OFFs?+@  ј`$0lH} iM&h2BO`@h&fcfd@d lccA9dYaf@f#jh%j@cafY#"g2!a*B"ag1agbo@c`'0CNH "#3L%g(Fg` (FOjc*"cm3em+@ԀB8#c"kciқ#c k%Pl e(@ʀO@F $MXF0F j(?b#;p]m.[A9* &,7PW`o{"(.LSYhw}##r6##&00##%0*#"lkh2B#;k`kh+?3& \i'm;em3#$0#h+;`"lh:B3h+;`"lh:B3#'0##(0##)0##*0#0#0+hFPKQFG?6B#c#k+-#)"k)F8(F#mh+?)#T0&O#$KT0@ pG&p/L%Kp{Dh&mPjBV'#mh#mS 0 5!k0&QKp/{DhX hpGQh$"F2 `#`ڱ4`%&hh*h"`BhO4F+F]h$Q``hhB4Th0їN@"iFh\Kh KjF IG#z &ciBF(ciaCaHC&Nx&-GF9OFF=i>l @ci@"caO3D $0$0&0"v{oB 030D+D3` `;oBO QjHjDa2D2`i2jB !F@F3j!F@FaiBcia{ h!F0y&0K yi @yi FG&0$BKlD0v44&JFopGiiBhpG@h&KpiB lC@nj& DBЛ@ Dihp(j@hF@i&-CF\O;i%B :lCh@ $P%DBy]@ D/iBFZ! Fi`31Ѹ$DJ\@jiC Pka"iCai:i3aB-:hB##;`h)F0FCO0K#L4 +JOt@`C@ AF+8)F+9hB=`Bًi+8W8)FCO P@*FZ!&*F!FhF"FFxwbiZ! i kc#`&ة-CF>NsiBsi;DBn9F F(Ch3*$ F0%Đ-(F)FX,iFHF8kc+`oB0B F"9FFйEFFh 3i@FB,,FB` 0,P#F 0*iB+F-hB4'D-+iBӻB(F)F FHFkc+`EFmh&x&-O 8NFF@! iO=DFpOibFcE!FXF!FXFiSE28DFF8FF1тE  D9F F FE8FBiBFaD,jT !Fso2l@piF(#`O0bXb&-CFVM+nB𑀫nB)F$ F*O3D$44D90!FHF0;0FnOHkjlB&\ipGpGpGHpGHpGK0h3pGhK0h3pGhK0h3ppGhK0h3pGhK0h3pGhK0h3pGhK0h3pGhK0h3`pGhK0h3 pGhK0h3@pGhK0h3pGhK0h3ppGh9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpG`%hF;+`ڌiB (]K` h\ `p]KpGipFN$V4(F Fp4 , LK +KKhG pGLF0 S pG0pGhxK0h@ pGR0O0pGhXK0h30o O0pGh@FFR;BpGFpGF FK0h3pGdK0h3pG`7Fx M K*FhLI+F"FH{0L%FjOT(9 xH+ pG pGHpGJK3(FFpGF ;A,A 0, 3۲B(O0 KhBKhS HpG\KhBKhS HpG|һpGpG pG F H I Fm@Hh IFH{$I o @H;GR]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBЖ#` I)}F`JF 'h"EhFhB x46@d(ݚh J" L` x209*( "`h&FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00W(]h;iP!0xCC@!0pGh`K3pG&Fh FF2BY!QB i"1FM F !@i=C"iYaB#PK}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhF#i(i(LP&`S+B2C,ZjB2ZbBѪicC"DD+iQ-AFZSBF FSA'0ip0iF FG2BҔtu(J)8YB;x\*GZx|*D0iF FGhKiBѣh #`t0+]Дu!bh#hpB5 bE1ٓ\,ѓ|'31#`x|*xBoiF FG3)YBxB[xBBٓ|3i)ѝᱚB! Ft0+  FiRiOA Fc Fi DOA!3OAi Fi FSRi"OA F3=瀣&F%N FF3h+ Os#B-#@\ CTkK52hh* Op 30B#@\ CTKh30B#@b\CcTj"j1M" 8F !@[jbZb Pd`-AF5hBhB,xB lx], On{9Fa2+FROA F;F" FiOA FR)F FRA"OA FOi" F95"OA F@AV+FrOA F?iOA FR2i)F FR"OA F&i" F9 "OA Fi2F FQ&Fz2OAR+F F^iOAR)F F=>?Fe)F F5>F^ F!@pFN$V4)F,4 p , `)KQ<GFpG`F)K Fh+ Os#B%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6d`-OFhBhOkB"I(FFPOA F_#h3#`"I(FFO A#j@"hh1M( ! FO7#j!h`j`@"(F#jiD#c2Bx^)3#`#c#hB x]*3)F F#`l-*fN1Bx]* XB-*[x]+, `)F FR2Bph+WK3m-*[*сBZx:*=* F1BF؀:F)F F+ ! F3#`Bأh #`f#hx-+]+ѣh #`f;Kh"hBx300 W/ ! F#Bӣh #`f2BFYBCx:*@Zx]*=3#`z2"`:F '|F(0+ Os#Eij"(j1Mh !QFXF ZF)F F7kj(bZjb h #`f8&h3#`Bأh #`f#hx-+]+ѣh #`f=! F)FF Fu#Bӣh #`f2B YBx=*Zx]*?yh+#x-*$ZB Yx])?"`-& FFWE?0+5WEݣh #`f0+ Os#B ںE:F7)F F!?3#`Eik"(k1Mv !kk(c #p3kcQF8F(ݣh #`fO YF8Fw( QFXFq()F F  vZ"`x]+􊮣h+#k>#jiBkxCkp/K h+F O|O gE6+j+?kk+(j>D@"!(FBܭ"jh;`#`:0\ AB3F#jO@Q FhOj FpFi(KI h1!I h10Be F#`]#0#0 c` ue pIOQ F p@۹hd`h-AS`Fxi\-@BhBӃh #`K3#hZ"`x@)GuB`[-*-.-𗀣h+@ۀ#hՠo( F"jOA Fl_d /:Fb2B YBx\*[x)+)"\! F /OA Fid:Fd2BYB@x\*@Zx)*@3#`Z.ܵ#ڵݧ0Wt<+BFO`Q F6WWt, F1jBFOA F(#j"Zd.w"OAU@{Bn ! F #jiD F#` c`^#0 #0]#0#00BF*)I"`3FiOA F25iOA FiOA F23F%iOA F O Q F"O Ah #`/K3!! F i+?h #`&K3!Bb\)`Zx{*]3 F#`1BF0x,*-Z"`B+J[xh320Z# FBFݢh "`J"*F1F F2BYBx\)Yx}) 3#`+FOs瀣&h!`#hB YBx\([x}+ ! F)РoFp FA"OA F:"O A! FG{+| F2BFx,*~Z"`J[xh320Zv FBFݢh "`J"*F1F F2Bex})b3#`I瀣&hi3FOA F2iOA FiOA3F2 FiOA F$iOA3F F2iOAi3FOA F2iOA Fii1F FO"OA F]i" F9C"OA+FOs3#`#hBx}) ! F9h #`K3&+-O" FFFG ЅhB@mL F KB FF%!U&0 F P"1F=DV t0xЙKu`!6"O5OahF"" " R""+Dag#B #K32BQ"OahF"KaaaLd``( !hFc`@chIFMFOF NF0XFP xC@_:Kس_€-سo𽀳_׀kB)>Fc#k!cO1#u0]K]K ]K!ZhFxP*F)FhFF_ _kB@)c#k>FD!c)F)1OسOسO xJok-@O3#c%O^гOOXJسOFXF*xJ xCOEгOBгO#jC#bk-@@ !@`cprC_Bjk@!0;!(FF(^Ѧc`k(N#cc0O pB OгOGkB)c!#kD!c)F>FTUU & 8Oг@O-_F5m))D%h!c))DRhbcdV+xG_+B%u#CU~AF!(Ffc0Fj#:@#3B+F*FWWB9`:`B2V# B+ "F'0Bj\E;:FP#B@#@# V#09h3EGGB7ӝB0F`h"F0PxAO5бO4бo#jC#bME##`#ld @0Oe#0#j[!hF@FLR#BV" k+?+"3B8F; F)K Fh+ Os#B%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6d`8FK Fh+) k\A`@8kӱ K4(F$h3(K(Fh3w8 8@od`-OF-F̴ FzBؠE🀜)hO NhV#xBOF ز _ ز_𸀲_ʀ_}"@_B" *@KF0O-ز O(OOjiB[!xJ0  _)P*iBjhhBFJ0 >_);8O@O*iB!xJ0  _)6liirB0 @*@_.Ѧ_ B !xN0(@𤀡_qBqAB E$ F+BE4"wEh("h*iBjh?ajiBjh*iBjh?QhBjiB, * iԸjiBд"xjiB*&xr<_.@\*iBjh?&hB < Ѿ_ . i jh*iB} H2 _)?n(l_.h*?O"R!]jiB]"x * i Q0)M_*D3 "xBDV# xAOK&xFhO ???,Q Ѻd ?!FBDB?hJFD F*(FFR# 3BLDFBF!F(FzKFK&xFDi7C'@iS' B?x!FC'@&xC(FBFz+(F;&xFDKFBF!F(Fz(+hYhQ& xBO? Dr ^h&xFDQ&0xCO>h&xFh!FO(F2BFzKFF(hD*hRhR#`xBO?{ زOвOв`_?9LsOвOвOѫh&xFh(FOC BFq`!FzKFF(NhDH .Į濾h-O%0F @ (FFFVE FP& xCO4<س`_0!س_}س_gг_t6m _|г@_Ѹ AF(WO سOгOcгOHOгO OJسO سOeгO #lOгO8O0س(Oг0O+@O EDC+x,xL% DC B$ Dh!B?e>% @^,xLDC CR!xA DP!xNO3 ,xLDC P#0xCO?4 L,-OFF\0F YFjk # 0o(hF)FhPE(iPEhh@L ( F "hiPE""O6`*BRF ,}(hi } .FOFr@hh~(hoojaD|hhyO qhh\I  9YF(hyFѸla](9YF(heFlJahrg?0p/@_ D w0(vѦ_xBxAB{o9YF(h6FoO4bghh(ho$ .(hibO OGFO OFDJ h0_,r _);8O@O*iB!xJ0  _)6liirB0 @*@_.Ѧ_ B !xN0(@𤀡_qBqAB E$ F+BE4"wEh ("h*iBjh?ajiBjh*iBjh?QhBjiB, * iԸjiBд"xjiB*&xr<_.@\*iBjh?&hB < Ѿ_ . i jh*iB} H2 _)?n(l_.h*?O"R!]jiB]"x * i Q0)M_*D3 "xBDV# xAOK&xFhO ???,Q Ѻd ?!FBDB?hJFD F:(FFR# 3BLDFBF!F(FzKFK&xFDi7C'@iS' B?x!FC'@&xC(FBFz+(F;&xFDKFBF!F(Fz(+hYhQ& xBO? Dr ^h&xFDQ&0xCO>h&xFh!FO(F2BFzKFF(hD*hRhR#`xBO?{ زOвOв`_?9LsOвOвOѫh&xFh(FOC BFq`!FzKFF(NhDH .Į濾h-OF0F F )F F_E F\'0xAOACر`_3$ر_ ر_sб_75 _𙀱@_ѹ IF(ZO رOбOбOa]LOбO`]id OZرO رOOa]) O!бO-8OBر(Oб0O )@O a]E]CU?&\1C!Tx )?qlif\0C`Td+?a[]#xN`]CUa]]CU(M)?J?=FD]`]CU#xND`]C6hf]!\1C!T&xF0D>\&`xNOn0Dhf]#xN!\1C!TQ xAO-OFF\0F ! 2Bkk hFRi@"YF F"o hF:"hFRi"hRE"iREbh@\"biRE""O6`b"hF Ri(SF -y"hi y .FOFq}bhz"hoojhDxbhuO pbh\I  9YF hLFѺfhY*9YF h8FsJhhqƀi 2){ѥ_}B}Aq2 *rѦ_BBBABxo9YF h FlO5fjbh"ho$ ."hijO OGFO OFLIj h1 _-q FIr h1 _.oj?Jhj1 _-r?zr1 *r_.oloof%"12)3_.\"*:"hF Wi:Fh E* :F F"h RiF5F YF hoDFq12 *_-3a+x  h-OFFF FO B F3hO XhP%0xBOвO"вO!#xG/DO N5ز@_Hز_Dв _A]F!xADP'xLO/F/FOBF+F!F0F BF[FFF0FEE 2O𙀲OPвOѱh#xChJQX`4BF+F!F0FBF[FFF0FE 25JF!F0F+Fz0+FJF!F0F_LFk%FJF!F0FzB%F"F)FFBF+F!F0FBF[FFF0FEz2hk=RhR "xBD:F!F0FZB2hiRhR!P%xE DR% xBO=!F:F0F_);8O@O*iB!xJ0  _)6liirB0 @*@_.Ѧ_ B !xN0(@𤀡_qBqAB E$ F+BE4"wEhH("h*iBjh?ajiBjh*iBjh?QhBjiB, * iԸjiBд"xjiB*&xr<_.@\*iBjh?&hB < Ѿ_ . i jh*iB} H2 _)?n(l_.h*?O"R!]jiB]"x * i Q0)M_*D3 "xBDV# xAOK&xFhO ???,Q Ѻd ?!FBDB?hJFD Fx(FFR# 3BLDFBF!F(FzKFK&xFDi7C'@iS' B?x!FC'@&xC(FBFz+(F;&xFDKFBF!F(Fz(+hYhQ& xBO? Dr ^h&xFDQ&0xCO>h&xFh!FO(F2BFzKFF(hD*hRhR#`xBO?{ زOвOв`_?9LsOвOвOѫh&xFh(FOC BFq`!FzKFF(NhDH .Į濾h-OF-Oe"Fh&B@hME"!hB@&j@Ii h i)"i@\*'++hh  Ej)bk*8k8DEv٘0R#0+n= B@ɃB!bi  ;@+(!#DDD,!d#kBۨE8FO RFYFKF({cl+O RFKFFh3F qDqE&~3 xB kB@F(КEF[FF~/cl+C 3 l0 &` 3l"Bb blcCe ZFKFFYE 2 KF>F(F KF(O/Or2Os$ " lB)  8 eF(B =92lX#3 ZFKFa+0(pai*' )F+v+hh  Ej)bk*8k8DE`٘0R#0+X= B@xB #+ @33#k+ۨE8FO RFYFKF_(cl+LO RFKFLFh3F DqE3 xB kB@F|(КEFћ[FF/cl+Q 3 l0c s & UQ0F 3l"BZ blcCZ ZFKF]FYÉ 2 KFF(F KFG(//Or2Os$ " lB)  8 eF(Bю2lX#3 ZFKF+0(nFFm++hh  EBj)bk*8k; Et٘0R#0+l=   B@@B! @;(!DD#DF#k+ۨE8FO RFYFKF(րcl+? O RFKFFh3xF sDqEZ3 xB kB@F " (КEF@[FF/cl+D 3 l0 +?Y 3l"B[ blcC[ ZFKF蹀FYE 2 KF1F(F KF(/?/Or2Oss$ " lB)  8 eF(BW2lX#3 ZFKFx+0(FF6&$ &"&  i[\#0R B,DD [\#0R B,DDf [\#0R B,DDpGpG pG v pGpG pGpG8#MF`+x %`8Oq(FUX( &7FM+xD 0(%`&Fhx[D@(/! F8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!Hv<HHӾ&˾ ( pG pGO-$MPpL0WH0` ` ) I)Ad@P0`0@P@PT0030#W00S 0(9Z0*9# 0   0 9Wp  pP $Ѝ 09d 08 08@pPp `L  0 P@0* $Ѝ\(O@`d@Pp@-PQM@(p,` U00 V Sp0`sЍpw`Sp 0E`e-00Ѝ r000 rp`00VO-M0hw@0h[ PA  22YAZKW  '2 "2X%  2 2V<  2  2 h 2X 11ЍVY PZ, P 1 1Z  1 1Ѝ P 1[  1W PX PV P PЍO Ѓ`ȂȂxdO-@QMĄ00R㸤 p000 `P 0400ۦP R nR a BRrMT1   oRl CPM Ѝ  CPY U000T000 CP[Y U070T070P CPY U000T000 {CPYU000T000 jCPYT000U000{ YCPYN U080T080j r@ DCPY9  ;CP  5CP  /CP_YK U080T080@ CPp  CP  CPJY8 U000T000$T080U080T000U000T070U070 T000U000 ЍT080U080T000U000l BP T BP DTD\L$x~~}}C-PdM0@Hp>S@` G@@@@ `$`(`,` 7"`0P! @3@0 Ⴍp@$ 0 6p@ 6p@  np@`eE  `6_E`]E P\WEPdЍRE00lŸO-1MM @!`D0< "( [p C.F DPٮpWd;@D8 (@I0Sn ȡp ıp Q00$ P %0!p2t0p@ !0嬭 ᑭ 0SP 30S RD@001ݍЍD0S PEPU R5 Pp 0 8D<4! @P 0 0I0 R 0!0h,RhL gH@_1ݍЍV`| |{P{\{L{0@-M 0P Qp@ 'p@ P 0 0ȬЍ0ì Ѝ0A-@@`v. .PP0P 0pp p`p夬0p0jD`噬Vp `D``p`p卬0p0TD 00s0^p@-@PCM4 /a3P6 @@`p@% ` SP8D000gu5 9 C>P@0FF0 0 4EP@70S@ VS 00 SCލp|@@0SE@0P`0` @0 g P@1:D@?00@C0@0x\dwlwp@-MQM@P4SZ TE /2PB QP0s* @PQa P0`pQ @ 0@;qpH L pA ۍЍp)0si/%@@˫10p" +;@P0 @0  P@1:C@?00p04@C0#S/p@ zC00vC@PrCP[p[pd[\P$pZuu@-qP`O-$(pY,PS@`1U+00ï 0i4W0 0 0a4 0R0*00V&{Gp &Cp@tp4 2x 2 BppwkP@r`U@-DM@ P- 0j jB0p #ϠDlm>BRf =Pm PY C@%:P Q X ?P  Q00 R pp!@>P QD>P h ,B,@cN>P QB@M  Q >P  I0.S000S00;0S p=@ 0sS9 TAT@sN>P Q0S0p0 A @N>P Q .S0 0SQ0 >P QA s>P\ Qs0 0   ooo8nnPm(mmA-@PU 7UP7UP!A`FPFqP ``GP 0!Eq1pP 02PO-PM D  I + +pu T `H0ݽ @ݽOX /L0  t/`0   SB  a WgX !0C3Sf  ]ZYf  oPyr~8WC4@21 tQ <>00,1SC(. 0=S 0qS1X"R 8 Z8T =@01S0OX< A  $P XPL QE0qBLp` ?XP`u0 L00 tX0" T `00q!S?QL0͟qaH0X PA&* 3!,!R\ UQ X" RP ^XL0R p |<L 0XPL h` X 1 3@TЍ 6Q<00X2S$R: p~ L Z0 h1L`X Xq SJ@ Ql1,Q qQVh+ 0nP0W: pR LpXP8; 0L ` 1X 0@PkH@(00(0000,00,0HXP0,^0# <P0  0=R%0@Dh02$0SXP"Ex(XP A PPH@pXP hH@fS@ XP E RQ#XP!E RQE# &XP$0(Y 000<P  =RHLL0^X \ 0@hD0XP0S <P  LXR\@0Dh$0XP0$0 0XP0 0$0SXP"x(0XP0(0,00,0(00(0XP 000(0XPP0L dS`0d l0 `0d E00EEE 0wXP0 SQAP  =@0D hfX0\8 #P] p0v> 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00XP0 0 00?0000?0 02 t*4 0?ἀ8 000000000000000 000P 90\0PB 0TP 4 dP 2PPT0SQʴ RNʠ RKʨQH00 0S 00# "0S ES}> 00 0;0pP GvnL؀ `F H⸐00` 00 00P\0Qt0 ApP p0hl dp^\lp`@ RYS S|\pVlXh0SdW`0S\0 Rz{  RR}ڨ70>C 0C0)<2L0P8 5@0(<2@0p0tP@Rfx0S R;g000(, \( ;PJ p0l'l?0   P 0 0 0 R1 R?V0 0 !0`6l7v@ Hp0/ QP 060Rl 0h Rh0 ; 0 qpp`  0qp:0S [PR@ʨQ @T : 00 ߍ 0:\ 0 qp.  ) Q S;P7 RTP\0 P0,P0  PZP S 00@ :\ 0ƴP:0S0000 X ZR0. \ P_P宴 \⦴ \➴ \▴  \⎴00h U:0SP V@(hQ:  @`Q3:01PL~0.`P@& @ KdS`l0 \ZP 2y0v:\i@(I(, Pg /v 0" K0S" P=0Yt 0V05@T !]0T @P0E$0S ,( 6L^7 0 "qp1 pO9#0090S Y\|9 RM<0,"2#[ï sR 9T0090Sr 090 Q  @0E$90 009T009T00ȽQx@-@5 aBpspmTᛡL00P 0 0R/P/ /Gaa  DP 0 H Sp@-`P P 0@ #  TQp Pp /F(aaH  P/j.0 0# /P/$Fx000@-PP Lo>O@ 0" P0 0EA-@P @`pP@0% zP PPA-`X@@P jNpP@0& `P PPDA-`X@@DP H@pP@0& EP PPxDO- MP 0P09 P@ p wP P oN` @% P P0Sp  Ѝv 0p@ T 24  p p 0pSHCA-PpQ `@Q P@D 0DB(000S   <1g@- M`ppPP( -8  U00S@ "80"S" 0p000S0 7/ Ѝ80"S1Ds\0pT000S @ Ѝ1Ds$ B X0@g@0f@-@ @O- MpPW  pp2S`PL P@T Pp G <P P6 0nS# p= &@P00Q Q @P  H^ B" \0A 0 0@00oSpl000S 0.` Ѝ<  #!``LEd.eO-BMM@ph7d 0 0IP:v&PP 0 IPr003y0P0 C `JP@@0 PP p c0P0  0PP p |@P$ hzаD 0 dQ`k`V`} pP  r} >04P @PP0 PapT *ϒQ Ph6 00BލЍP/U `  P pA60ST  P.BލЍ .0H 00PPi p@  Pm!6 P00 0.p!0 0 06L 00 0.žP`60  ! ᳞WEO00 q6 00 0.PPze6 00 0~.PoPmX6` 00 0q.PPaddd))xc4bbb$baaa```-M 0  PЍ-M 0 > PЍ-M 0 ? PЍ-M00 0 3<PЍ_--( 0P    0/ 00A@p@-P-U@p5,,0 ? P  5/p@_p@-P} U@p5,,0 ? P  5/p@@^@-@P 0003/?^@-l@P 0003/?^p@-PU?o@20S 0 003/pX?L^p@-P`RUV00P00@Sp$ 0P5/p>]p@-PnU?o@20S 0 003/p>]p@-P`/@Pp95((0  @p@/D>]p@-P@P p 0 003/p=h]-@-M  dp@(0$003/Ѝ@ Ѝ/=$]@-dp@0003/H=\O-$M`Pؤ@ 0 0(0Sp$Ѝ40 (P@@4/$Ѝ<H\O-$M`Pؤ@ 0 00Sp$Ѝ40 (P@@4/$Ѝ;[!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////p\x[t[[0\T[\[[[[[[[l[\[D[[[[ZZZZZZZlZ\ZLZ8Z$ZZZO-DMP`h0pU@@ 0l0000 S S S 300 DЍ>00p0 S 0pG000!PZ0G" `0` U0SXU Y p00C` 0 <0 P00p(V `@ B@PE PR> 3 4U *$0 0G  000$0P P U2<3 7[`; YI Ih XR3"^P<^P `0U4@ YDX: Q7V `@ BPE PR> 3 4U *000G 0 0000[P $ < `Y `0<S Z>0304p0S000 DЍ PU4@ Y,P U4 `1 `! Y@@ Yd;00-X;00)Y p0 PA  $04(0 008,< FQp0)Q!*AQ S P @0S Q0} FQbQ 0 `30 @210 0[0 X 3 "R Y$0(@ @H0PE 00PS>0304U *00 0G 0000 P`PU`2<0307 0SD 4 P=S @ZA 0 ` 0*Q)P$0(@` BPE0PS>0304U *00G 0 000VP 0P U41!`Z [P U*`0`Z ``0fQi  [ 1< ` L,.[ X3"^ l:.,  @22, 4 8  L Y$ @(@H PE  PR> 3 4U *,0 0G  000A,00P`PU`2< 3 7 R FS 0,0,0S40G, 0800"P, PU0`0,0 `0`, <00@P<<PQ(($U4$FSY@0 0,000S,0 P<R00S(00(0$00U 4$0 @ZP  0*0S)P$0(@ BPE PR>0304U *`00G 0 000XP `P U41!Z [P U4<0 00@Z7  0*0S)P$0(@ BPE PR>0304U *`00G 0 000}XP `>P U41!Z [P U4[1 0S.Y$00(@H0PE 00PS>0304U *00 0G 000G 00RP`PU %=03104 <00,0"PU=030440G 0800%P<0PU`0 X00Sh 0X`:Y$00(@H0PE 00PS>0304U *00 0G 000 00RP`PU_*#00,0, 0[) 0S&Y$0(H0PE 00PS>0304U *00 0G 000 00RP`/PU.*=00PU0# 0%=030403 05PU :0, ,0 0,0 0 #0, 0,0 0 `  0<00 ,00,},0 0yYV 2-M0 0 /Ѝp@-MP`@0 0` 4/ЍpG-PRM^  `UpP*a@/P T1< 0p00p Ѝ80S 1< 0 p00p/0S ЍĠ /0S 0 @< 0< 000@ pp/0S/ 0 / 0 ꠇpGF II(@- @MЍO-EM M aX@PE`p+' xH0P @)T 0 lH@0PT 0 A P  UEލ ЍM/ 0 Eލ ЍE/ 0 L%HH@-`@M pPH'P+ /G0SP 0rS'0rS00P 00 0@P@wЍ0rS\ 0 @jЍ0 Ѝ@u. 0 GPGA-`@#p@ 0P/S /GP @0p S  0 S '@p@-IMM@`PP 2p 0: S p0 0tp IލЍp.@O00IލЍp@IލЍp.@00Bp@-IMM@`PP p 0: S p0 0Cp IލЍp{.@O00IލЍp@IލЍpn.@00-M 0  PЍ80Q 0 080/p@-@P`P  PP u P  p@)PPp-404-0 M  0 ЍЍ/0(--M  Ѝ Ѝ/ -- M6MP8 00  0 ЍЍ/괄(0-@- M@BMP  Ѝ@Ѝ/O-`,M P@RP00:A!0@00(Ppp @PPX P@ @ 0 PX L!,Ѝ4p@-(MP` @% (Ѝp0 0 Ԃ(p@-@`PLpp p@<0< 0p@-(M0P @`% (Ѝp脂(p@-MTP  D @ 00`Lp  Ѝp@nЍp (0@-,MP@Lp  @%8 [,Ѝ0dp@-P\00M   0 @`Lp @o% @0Ѝp|(C-`P,MPE pU@P@0Rt0 0:200U P@0@ bT CL ,Ѝ4p@-(MP` @)% (Ѝp0 0 (p@-@`PLpp p@<0< 0p@-(M0P @`% (Ѝp(p@-MTP  D @ 00`Kp  Ѝp@{ЍpH(0@-,MP@Kp  @$8 h,Ѝ0dp@-P\00M   0 @`Kp @$ M0Ѝp~( Q80 p8@-80@08 880/880 00<P 808808~ p/p@-@0@00S 000 X t PP `00FA.L00p@P,} (|;l;O-M@P D `D30 0qp@ P P00U tpp0 0CY 1ATT00  RG LD@D T]:[ 2 00p0`K K V00 W8 1ATT 0`Fs 0RB K 0 0 B0SH J@0Ѝ V0& 0  J 0 0pHXB0SG 0 Jv B 0w 0 Bp@ 0 B`Fh  BJtZ 0 BY  BJ 0 Ov 0 Im 0 B0S J00| 0 0 08y(p@-@PoJpp p@0RS00 /H0H0p@-@  @PRJpp p@x(40 Q00 0R00 /hx(p@-`@P3JpT T   p@php@-P X @ 00`JpTT  p@pw(1!0O-M0P, 0D`S1H0?0 000 P LP !p s+1r'0 W>@t  , @@KDA|`0@p3  W0 S8 0? P PP Wt  ,0000IC1  00 0Q, 0îЍdw 0 00u(404 0@-00 @?P80@080du@-@?P80@080-M0 Ѝ-M0 ЍO-@iM?QP0ȁqaԱ(0 SP`?`( K͌U BP?( K͌T 1P>( F͌(X P>( F͌(W  PH>( C͌ V P>J( B͌8[ P=( ̌1S P l=^( B͌ 0`3@@@ 0S7800PH0`@P@P@P@P$@P@P0@P@PH(@P@PL(P@P@PPPx@P'( @Q780 T0x100C<0S000C40h0P00800P080a* ,0p `0@W 0g1p W.00 `00V0 `CV, W 0 @ `d少Xh` 0V `Piߍ `0 1Sp ,000q1S D 0|0 0n>p004,0P0 A,00Q 00D 02!!@ H4 , @ B  0S% 00p 00C10@S3 00   0 X  X,000 0S,000p,0W1 0X .P@0Sp80< 080R5180Q0PX0,00@J0P0 001D0C4 0P00X0B 0:0P00003P0X40 0CR0P@,00`0T d!@PX0 p0$0W 0 pTW0T,00` pp封W 0[ P00@0SD@,0pD0 , TH0  0q{0D |I000{=p^O P  0\@ `    0 \` P  0 U a P@  0T c @  0X e @p  0W gJ @`  0V i @  0[ kD @R\,00@d R+X000 400C $0R@pP$,000,0 WH 00` Q ʔD |p 000<p1$0<0 10400C\0 0 00XD40 0CRJ0P @,00` 000T d!@PX20 p000W 0 p%W0T ,00` pp封W 0[ P\0 R0-X 00 0 400C 0R P< ` p,010 0 W,00H 0@ a ʕD |p 000<<p( D00 0 R ,0S> p,00 t4X 0h1,0S+  80 P 0H0 @0T000 @T,00 P @a,0V1B@ T  0 @0Pb$040 SG40 P 00C, 0 [# 00` 0 0C10 S2  0 D 0 0L @ T  @^T,000 @,0,0Z0`01~@ Z  0 @0P 0S< p< ,01X 0h1 0S,  @0 P 0P0 @0T000 @T,0 0 P @Ta 0V1V@ T  0 @0P0`40SW40@ 00C00,p V$ 00 00C10@SA  0 X 0 0T P U  PU0,p00 0 P0|,0Y00 01P U  0 P30P( T40 0 R080000StO-`YMq0tcSA P T3? 00K͌ u0S3?HPK͌Hv0S2?p`F͌(pt0S{t2?@F͌(蘀w0So(2?pC͌ y0Sc1耍?B͌8 萍{0SW1? ̌ 1s0SK1?81NB͌ 80 @DYߍ 00u0Sl HPv0Sw p`yt0S @rw0S pky0S 耍 d{0S  ]1s0S N U<`4@-M@ @ 04@P$( ,Ѝ\(@-M@ @ 04@P$( ,Ѝ<\(X0T 0 DDQ @Q$00?H/[(|(L0 D D 0 R #@ R 00?H/[|(0 A-0D   R #@ R# P?HU`p@V,010 0D C  \(  @T 00$[|(0 008Z(d d0 H?30\ -<@ D \<0@0D/Z|(0O-SH4M 4ЍpP$|   L0!10089|@Pc 0`D0 R P`@0PR0 T <P V@ `@`|O9P! ?3 R #@ R< Dp H0L |" 00( 28 8`P0S R,@PR @P0 9 R0`SU4ЍT `@000  0`Pr @|`Y|(0 00^4W(X0X 0p@-Q0P @PK ppW(0S p@-P@P5 pp/H 0?0- \ @ 00\R  |0D S   R 0S 00HV|(0 00U( 0 0 /O-MpR@l2P0`0Vu T2*PP0LrL 0@2@Ÿ8,匒002吒嘂  $ T X  \ ! ` 0h01 0i010p0jpp 0@z0刲 0匲0吲0嘲0$TX\`hij  1Q0'0 0 0 0 iЍ|00 0t000x000`0\0X0X0T0P0P0D0D0 @000LU$l X (C-pP∂M@ Y`P `2@J0P P 0""RRRdRhR`P"S PPPPSS3PU S pP #pK |0p R\ PR0 PPP(P9 0 PPP(P. p* C#p& p0 P'P  s&c$000S :3S Ѝ|P YRb2SP U`Ѝh0SpPbRpA-Z`p|pP YB92S@ Tge000 R A A O@- M\Q`X+ P@E_ 0 S*01|0# p!!!- Q!!!!> !< !^ v : !' !_ !| !o !* !! !f ! R |1 R 0S8 ЍQ  800 Ch0 T  Ѝ$OD0h 0 S/dG-M0AC@J@ <> ^;v8#5x:2'/#, #)H#&p-#- `_|opryz {@|h}w,|M$ DxA-o\PP p  @ 0^(PU 0(`,ǟ,7O- Mp7 0EJm`&0ᄢ  &  SW[  p p PP pTPIS  Pr  aR$RTL&0 0 O 0  ;0 $QPBPq 0 ;0tp t 0S 4 0 s0 0bR44 $R %5P  0Ѝ p PP' 4P 4$0$ s 00bR% 40 0 !P0S 4 0s0 0lR4S4  40400AR0SW0yS ipP 0@    $ `004S 4 0 q 4QPQ040@Q  000r0  cR$W0< SS p: 3pP 0@  N  $R `004S 0040 s0 0bR $4S4]0"P0 0Ѝ0  ;0p4S  20 0#?cS  |20 0` py L20 0` p 0 $ P 0 s0 0bR 40 ;0mp1 P- p 40 0s440040 s0 0bR44Pl1 $0$ r0  aRCo $4100 p 01$0 r 0 aR$z 00 0#?c0`000`00000e00`00S( ! h0d00D  G,\ d, ,-  0B04 44/O-` TDM4@P8 $Q0h v :Q{#R3Z 300S v 8 0 0P @P`@-@P% HP <PFP0S)[P& mR R@0R0 1BqQ;RS S0 CmSr ;S R0 R S0S PS0C;S q Q0RRR(  O-@0 M uSp`e`Z|P S0ɍ<` 0rr H|"R 3S(0$00 0PK?T0 "TxP X 0SL$$ @$ 0|"44`0T $4X 0 4S0300S7 p0S4 4S. 4S 0D/q @T㌑T2l" 8PW 00@l2Z& L[# `P P v0`J HV 0H5S4S 4S0?o258Yp2=3@t2 P[ 00@t2W>3@x2 P1 00@x2h Ѝ0 D $l h $ <% p 0$0(0`W kP>0@l2Yo bPl2<l2Zn YPl2?;~0l2Y NP<3@x2Z EPx2?;~0x2T ;Px278x2W  0P<3@t2Z  'Pt2?;~0t2T  Pt278t2|200S0X00 0rr G|"R1S0& 4S"VL%RLZ8p2=3@t2^8p2=3@t2Q9 <  , 0 00300- $ Tx Xl h  \lT 0p 0tx"| R3804  P X0 0//2O- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-刑\ Q |pPl0@`P QV00` iPE ,0 R 0"00p0P00 8P C0P  H  ర帰 就帱00S0L{<0 800:l1 @ t A-P@pP P@ `D@D`0 ~2V P@0 p 2P p@-\`P@U 0S1 RU0S@@P0SKp@؂G-l@`pS0 SV0S"Q0S 0SV0A-0M`@@ᠻP. , 0 @S@j @1 J~p † 0|" QU  P*#l [Tۍຽ?8  X - LM  R  ʂ0   Ѝp-`0 Q0@-@L00S :T #l/ -0 0A-p0S :P#CRQ# # `0:@P #Cc## B0:#!BQ##,T0 P-0M 00S ʃ0  8 Ѝ+804  P T0 0//\+p@-Pᇶ|``p@0@ 0SP0P0:3S 8 L40 0<0 :#p +O- Mxt3E hs`0`p0 *PL3B0 (VU p p PQ p   r  `R  01Q @R R6 RV0B S l20 `hpy  @V `  Ѝ R l \  Ѝgp P ` Ѝ@1q lRQ  S7H @x0 ` 0  S, (q 1lRQ     Ѝ6p  q`RBoo000#?c p Ѝ 0X0 T00㝧8  d*HL G-@P c 3`pe 80$ RR a ʌ3S23SyX " R &8' $ЍP Q ` *P  0:# 0`x `  000 000 0<D00\P D (D@-,@@0S,00@-$@@0S00ܣ@-MT@@ 0S Ѝ<  000 00Y0 0Ѝ褣$@-MX@@ 0SЍ F0 R0 0 <0 08@-$M8B82@PQ :3ST03b`ppT0Sea` 0SO1p0S@ M0 0 B0)1`00|PQ 1@ 200 R 8 G 20 0X20o0 . 03,0 ppP`$Ѝ0`00|P @ 0 R0 0 0 0`00@ @8 I200l p@-$MP@ ` :@8@@0@kvV 8Xp0@p@@_v}v4000:3S [ Pv$Ѝ 0 000:3S/IT0T 00:3S 03@-ppP`/|@0< 0@-0 03, ppP`<0< 0@-0030pp^P`p@-@QP0P000 |P t0 1h000*pxP 00 1(000*Cppp00 p@-P *C T |Ppd  10*p@`xPp,  r10*Cp@Sp P0 p@-@0:R P% P PpP 0 J10.p`tP D0 :10p Pp0 000:0S,01/Q%0ϠQ\0CS Q0@-,P Q (0@0C 0 ^ S0U0//Q%0ϠQ\0CS Q0@-,P Q (0@0C 0 ^ S0U0//\ , 0 B0/\//0@-PU,Q (0@0C 0\S0U000@-PU,Q (0@0C 0\S0U00Q>@-\^5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@P@@ N@ T ^Q/0 p@-PU,@Q Q(00C0 `^ S0Up(, 0R S0/0@-PU,Q (0@0C 0\S0UP080@-@@4!80-^\ , 0 B\ 0 ^O-J00dM#dRa&XSUa 3,p0CQB8 ?3 Q:SC0P8p 0  0b,0p/3S/b0 P p#@  p) , 3,  X 0`n0 EdЍ|B 0c9dЍO*/00*O-,M  P0U" `?@Te `$p@ $ǰT*:0`pSO  0 aPPK,Ѝ@`00S S> S0PV$0S-00 04S,ЍO>0@0S A 0Q B20RP 0 P0C0 V !P 00C00S  P @0 C`QO-M000P0S@4P 3S-0S*U> 000  0@ 000@Q k p`@ 彯P @0S 0ЯPJЍDᖶP 00 C40  (ЍP0PLwP0  0 / D0M@ 000S :P ЍЍ/H0MD0 0S :P ЍЍ/400 000S :P /LH0MD0 0S :P ЍЍ/400 000S :P /\- T M P  P 0 Ѝ Ѝp0 0@-0@T J 3$S |B0pQ 7@-P @804 000S :P _/pX PT 00 R0S *P@04//(000 000S :P /L0L 000S :P @-p @/0 0A-0`V* Z 3$SP! #Rp@4S@pp3Tw A|B0tQ I7A-(,0@- @  @YH000 000S :P h/00G-` M pW#   0 ap @cPP  0  Up@ 0 @έЍ@P  P D/p@-JP ~3S P`4`0P⮭3V婭  0s3# S00!0լP |2 $R 0X0S L03 |20X #$03ppppp p@-jP 93S @P4P0@i3Sp@rA-`P[ J3S$sW! P#@P03R4 R)W lAQ , W00p, # \ BL| @ WP3PSSpP4PSfpp3Upp@-@P X0P:|"C0T0XppG- ̀\,P@p  `ᜭP LTL!VW R T VW  @000S8 0ၭ0 0|O-(,\ :`pNPP1PPP0 C CC2NP" U  @D!P P0 @ C|0wxp0@0SY03@8ppP0!@ @ C @|0@-?S0P  p0P0\p( @``& p@`^  00PPl4A-@PQP% pW0!  0S0',%000 R   R   R  P 4 `T `TX *P Q Sp QW02p@-PP X0@:|b0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S 903@0SpX@ '|(@ 8Q 0@0ppp@-@PXa`R X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  @PpL00008P@078@0p0pdP0P 0 0S P@ ?# Q @080///($0Q 00/($0Q 00u/\(\0A-0TPR p`@?dG@ H0(X0X 00 R X@07|8@08Q@0@0/(0 00X(0 00,4(p@-P`0`0@T X0:|20T1S@0?;@0S<000080S@078@0{p (P Q@0?30R @080///Rb/R/p@-PS @ `@?LppP X @0*7|"8@0 8 R #@0@0/P@/0p@-@Px`P` X0:|20T1S@0?;@028000080S@078@0pP0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/p@-P @@0 0p@ (p@-P@ p@p0 Ql0p@-@ 0P00R ^ p@s p@(L0L0p@- @ P#pp\ p@(p@-P@#ppM p@p@-P | @ 00`#ppT0 T ^ @ p@%@t(p@-`@P#ppT T  R @ p@@Rp@-P@00S ^ p@u p@nO-`6:94^P1S00XP P  Y 0 0( 0000 0P0Q00 <ЍXUZ<Ѝ%P 00  T 0S00b , 1 0 0(*1S0P 0  0CS00(00P 0P 0 00@@0S0 0H00010S @ @☦Pj  [   @0CY(P 00 0(0 0帑KY?3$0 2[002K0ST Q 0C (  P 0 0C000T ,S  (0!   00C0<Ѝ@0 0X0X`T0Y`F V8pPV3 Pp<ЍT0Y80  0 000<Ѝ:0@QHd 0aH[H0L 00!0/ R ,0|10 D0K00 0pT0Q 0(00^00Sj H00 L0 弐J 0J 0RZD0 |0pQn   S,01P0Y%`D0|`00pz H P L Q E1SI00 (00Q0 0 >80 [  H100S0P080 N I00(00Q0œ   C( P  00C00 T0R0, 01 080 0000 S0C`C00080  OXO-M@ 0@,0P 1 0T,0`0pW% P @D  0   pT 0  ئP0p  p~000Ѝ4 00 @-M@0@Ѝ(- M0 ЍC- Mp@00`(S,P 0HSOVtN0 r@03@, @P P9 (0 `Hoo 0b000S 0 P 0D3@ 0 P`VS 0#"H078P0P0C R  000* ЍPP00S0UZ ЍX0PXp; T0RpG0 W耟P`W 0 `P p0   T 0S00 , X10|80  080 000 S0CpC8np@-@`PA pp 0p@- M Ѝ\p@-PT0 M@ 0 `" p 0 Ѝp(\0\0X  0 08Q Q @0<@0/6S/(< <0 0001S 00 @0<@0/0(d0M` 00008Q Q @0<@0Ѝ/6SЍ/,0, 00001S@0<@0/l\0\ 00 X0:|20(Q Q @0<@0/6S/0(0 000@/(X0:|20(!R !R @0<@0/6S/0 @ /A-@p|P P`lgp e<000T 000S0( X80  /804 0080  Q/t(T MP0P    RBPP0T Ѝ/((8 0  Q/0Q0 PBPPT //,0, 0000P/P/d,0, 0000P/P/(#3 O-@0 MPU d300SH0PS@PPQP0nPIIIZ pp`IV ,0S 0   1  `FJV@00S/0pS0a!0封[, D | 0 P000Gp ЍTYppGWp  B RY 0  0CI0YP r ЍPaTZP`JVJYpa,0S1   0  ` X Z 0pS a0[, D | 0P0q00p ZPZ0 P0CkZ0JS| 0P0/ 0T(0Q /@-@P`Pp^0A (,, 00^00@UP 0S 0@//P 0S 0@///// ///O-P1!0D0, 0S 1H``?c`%@ p0 @s'W0 8| 0 0Hp@W00C @ P @0@ 0 00(X ?o 2 R0S P/01 //^^-(^,0R0SQ!R@O-M1 A0@000S1蠟, @ p P `0S! S#A 00 `0C``P  (0R0 (000C0T0 02/p 0P@S(0 0 Ѝ$^]8](0A-S$p4@`P(0P@SQ Qa ppQ p 0p(0p(0S/p@-0P`@s (0@SpP0@-0^ 0 @ 0 Q@R\O- M@PZTppHZ1  0 @ B( T0@0 S `+,0 1R@0p @ⴀD R`Dp `|p Ѝ0 @0@ ~00 S RP Ѝ,P ,0P `0V 0 p pG0,0C(p1C,0A0 T`0 0`000Dp4ՠP ,J00 @4 p` 0Tp `0Dr@U   PB  0SQQ 0 0$ PC 00\R R 7@U 0 B 0C G-@P4 pP5 0PUPAP0S%X0#P U 0 `P0V`C ` 00 RF `C`V` p[ t1 $p00S9 0PAP807`P,! R ! P3 ! R. ! R)  R00 0U+Q*P0U `P00V ` `SW Ѷ`x0 @p 0 $pL0XPU0P`W`PEP< (0PD Q P/$ $\/ P/ػA-`PAPQ@P1p0$ VY 10 0 QV$ F 0R U E\pL @10 0 QV$ F 0R U EJp:   0F  Q SC$ 0R U E4p$ 0*$` P0`00BTP @T 80@Tp` 0U| (A-PP0@P@pQ`@@T0* $ P pX00@T  0W@d蜹 P. 0S+ 0@- \#@T\8x ƌ8 t ,@0@PU 0P0U00 S00/Q?X?A-P$@`V0S2 0\-@ 0T `ApB 0S#0^ 0S0pW FG@ 0 0 04@U/80Q@0@080/0A-S 0@ B( P`p0,0,0CA@1` 0S( X @- 0|B 08SE?080$ 8R  R 00S0!R$R R d1S80080080 O-`QM 00pR<[@p]@Pl ူ儰到VP,g PP0d Y4' Z0 `8X00 `0@`F 800  p$p<@ H | L0P T`8 0\ 0@` 80d h l p ЍԝP49  0P=  ʂP PHZpp V00PPʪPЍ@Ѝ@da_@ZXV0@PNLJ@A-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,.PP D0 D0RH0!b pH000$`P@0RЍPЍ@-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ@@HP 0`JUp`_WNVPED 0    PI L1D00S*Y p$`(D0@p`0S00,0UD000@UpC0@aC`Y Ѝ00H00H0t  P PEP` V IPIP ЍP @$|(t0p 0l0@-M @  B0/o"  mPP 6Ѝ0@(H@- @  0M0 PЍ輮P-00 Q08SM$ 08ЍH8 /-M 0  0N NLN ЍO-$ 0(0QD, 0!0s0 S^: 0 "@  t@T,0Q0@t@T<0(00S20 R (Q(,͟  H͟LL P, ,R(  4 ,!0 !8 <  , !  @=$ 0pH D0|0H0000Rp 0H SL0HP10< 8 ,    V, 8 Y Y R `R F Q<08 0,000㓉(0 #I0CYڸ T0D0o0 L R Q0YT@o00PP ` P 00`,0 0S0R0S0 \ ɟ`V 0HX 0X op 0 00 @P RoP0 P ` P0 V  R~  ``$QUD PO A0 S04 ( R(  4  R( Q4  *#r PPQ 0  P0  \(,  r ,P  ,.P !0!!Q@Yڶ000S, 80s js$ `V \V HX~ @0@0 L  LL lL\oɟ`VJF80 aU 0T TDD00 R 0 R PP!YR   Y $R 0E0x 0p   0E j D000$R $ 07  jD000!R@ Gt <000V 0 A B $ P=0 5# X0:d2>p6$ @ Q< `0P8P, ` p u'UP0 @000pH 1`11qWy 00S4  <0pD P 0 5# X0:d2<0V @ 03@0S  V0A 00C0 R d1SCdЍꔄ T VUQx  0  0 p,$$ R 00S0 ?3P D`Fp@pP@`@ 0?3T 1pGW1QEP `p?0D000L00@ 0@0 @  X X WP 0P X R ?(080 w <00 $2 0 Xp`dЍ80 0 @00Cs00S$2$ 0D000h0S(00S2<0 (0 U+0{< 0080@080^7Q00C\0 Qʘ@t* "(1$ 0, QKp! <,\`@VP @ VP  P0@,p, `Q`!J @ <P,Up@WP ꔘ 00|(p'&L$P<(pP W@ P0 @`, A,\,@T q, P@DNP@X "   , ` ^,00,0Q0 0, B4 CRR<0804 00C, 00S<,04 0 @ 40 0 0@00,000 S @`f` P 0, !Yp, 1@S @ YpL `P00 0  0 00S 00 0 0S40C04 R00CQ8( 0 0, `Fv5 @A`i0, \8 p(@0<0 0 ~ 0P`U@0V0S 8Q004CQ0xV0F0<00DPA ` \p <0`pHU0L H2 D| p3$  D0 00@Q4 R1 dP.  +P d1S $ |4  tPp:U U0p` 5`FV 0EPE00EUP'00:  ,0R<0Y0,P 0A040 0 0C 0p% p ,0%80 L0H050@0 0 G40ᇙ p0RWx R  Y Rp RtR)0 SG 0PU`@000P lF@@D ,P lF TP@ P0E0PE0PE 800 00C,0W<0p,p0,00 00R:<0 0,P0 h 0E00p  0E  JD000P4B T@,,`H0,0 000 0 0WڅL 0S 0 @CD0T0 <000pP4Z pQW S4S Y4SQ H5S4  8$`P 0 `[D 00p~0 `N00P  n0D` 0 B00{ b0@ @10 0pU0 @%'oSPb4SG 0 D000M$ :P 10  `C0` D000ȔY  4 0 \toPY D00  TP    `(;$ DP0` 0T0 D000H%RQ#    `;$ DP0` 0HTPO p0SL 4S 4S Y00Q0S8 L5S;  `<$ `P 0 `mD0 00p0 ``D000P  0D` 0 B00 s 00QP00`0` 7D000P  U P h$ =P L0   D000P S=$  80  R! T 4>$ PD0 00$1So T >$ D`P0 0@L5S] 0 0RXT >$ PD0 00LTD`t 0 0L@k0P0PU 0``U @P @0D`0` 0HTZ @0HP@, 8:0@0e 0 IH< x< P< p@-@PM0P`0 R    80x  t000 000 P80  D000! B/ 0C?00  Ѝp x 0 00Dw(C-M@`4P0pሐh l8p\` d0P Ѝ80 800 0 pCB`Po`_PЍw @-@P @TO-P1!0D00S0H``?c`S,, p !@G'T :!| ]p@W 0 R( ?3 S 0S1S0 S x @v 0 00u( 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP @0 @T $0`U V P`兎Vp`0P 0@PUpT` @mT @pp  ! !@-@P@VT R/0A-p,SP` @T @@T0`PS RQ A0@ ", "Q//A-pQ*`@P 0D "! "U0 "! "T^ 0N "! "\^`@WP@-@@@0S $0PC$pO-M:z*0p$P؂  pPt `00^b S`s`aRX@lH\0 04@Y @A@0 @TE Qጰ@@[@T=P i``FF\S0^0  | aR\ d`Q'TQ"  @CP(4 ,4QT S I@0S  \$ 0P00B$0uX@0C,4Q{ @CP ^^ S\ʈ80,40SlthtH`@0,0^ $P, 40@P0(@0S  00 CR( ( pp' : 7@00p(`Y g| `nR`F`V00P0SZ  $ 0P00B$04' 00Q4 70, '0 4(0P0J0 覟F @& $P)0Sl600S00l0S# 0 S & ,40Q#0 l,P0S  0P$0@P$60 RЍ6 0( $0(0\GEe@` % (00 S:$%0CP (00xP0S b$0PC$@%@ 00 0,@(@Q 4000X\ 0Q[Q $ Z $0 0C(@,00  00C S[ pH40,@4 0,0104#0zd4`000P ^% $@$#P@ (@i0 Rv ,U, q  P+ x#  l# (@$@?QWD( , #\ $6 (@  P 0(@$ R  $@ P  @ lP " 20,,40 SN  L2 0$ ܀0B@0S  $ 0P00B$0܀$ 00P0 ! ı 00(`S7A@ 10(`0 V0`F!(`0 xP0S H$ 0P00B$0|,@' A@0S  5$ 0P00B$0 h,@XqXlp DP@L<|<(, @ L `    l X  O-LsL3pHC@0 P K400040c`(,P Zh34@2`0T6"0CS 402P00S00h0S000S200ʔ 0@DS(00S0 0l0S R H" 4204@,P0T0hPr RP0 @P 0( 0CS P1 P1040 ,( ⹮ @ P,Pϑ@1(`0 R&T !P @T 0 R 0 P'  x 00 lP }@T00,P0 0( 0  4@0S\C,PE@D4@SPL04Pk ^00SL004Pe `  l  p\ , \(@- 4 00(, (@- 4 00(,d1d!0O- @ *⤒Y8!O (!0P[& Z( 0S!,p`pGP@0   R    P0 P00P0`SY@TP0,AU0 0 0p W  QTa 0 00 08QD0S0l%R h%R /!R!RtP/P//d` 0 000 0P/_O-`upP2 T5` 80s5 < SD Pr @R !S5 0 40P\`  4 ]0P 4 T400:@ l0 @ l%R h%R 0ʀh20 d"T0s% |20T0,d"d",d"d"+d"d"+d"d"*d" d"*d"@d")d"d")d" d28d20SL\ RnVõpSS Rz_P|SI RPPS? R’VêõS7 RPPS- R_PS# RPP@S R*@S  #Y[=.0 0 C C S: Ql" p" l200 C S! 081: p" l"RU4 1OaLO`PU* 0S X100S H0Y 0H0,  Z000 0 0 00QY'PU0 0 !R 0ʀh2d0 0 !R 0ʀh2%R t5S 0ʀh2_p p1P0Wd PRP/L QK\I4@- 00ʃhœ\ 1:p“ @T" pƒn pƒn A\ "B\ n@T pƒ     /Y01P0G$ 00` PAʀ: h2πS00n200 /@P)#0000CS 00/00/00/00/000000000/tXp@-P@M@&\\ nf Ppf rf0 P |P 00 a(0 GЍp,WpPd-X\\ npr /hV00 @- t0 0S X00081:lƒp<00 RU441 @-00*h"R @!@ R  (1:/n"pB00 R @R  AR DU0 000:d/Sp@-Pl@l0@00:h2S SpH0000Pp00 ~$ @0 0@0pSpP1A-0aP0`S: !03@p @  "0S1H0 h"R+ R  #@ @0780@01M: @/QBo23?|20R1 80AQ:|20t0p1M: @/Qo23|20l20 0AQ:|20h$d0 p0!Q g0!Q ((S p/|0| 0p@-00@00C0S S p0 S P00ptPp04Q0p@-0CS@0 S p0 S P00ptPp0000 0p@-00P@p8Pp@-P @p 0|  JQ S@-\,AQ0/O(0J0P\@-\,AP /0S/p@-    @ BJR@P`,PTa@@@RA  Qp03O-0PQ`$MC@ 巅pP 0 0C Syrp @,010$1S!00A 0BS000(00\0ř ř!AI"R} T 0JI T0 $0$00Y q?3P00 0 P+Pz 0Y0 00 W0(@p  H0 DW T@( "D0( 00C P6$Ѝ$ЍiT0 S80 D 10@ᾋ  B@D T hp`$ЍHȏ$Ѝ& 00C! Y| @ D0 |0p H0I002 Y @T @/T @ @^p N0 00 tJ(p@-@Pppp@D0D0p@-@  @Pppp@,J(O-dM`p嫄60$0PPqy @o0P0s  W0pp40Pp0W000@0@STI6+POP0pPX0@00@D@TG00000PS040/ 0 00pP@0@DS1B-,40T R8 % 040 P$0$0 P I P0000S00U0pE:PPE5HPP0p0C0* 0P0 00P0 0@S4,00! p@呃(, @Q0ر@( @ R 400Q@!0CJ2S X 0IJ X0 $0$04 @0T00 P04,8p, 0@ 8 @ 0 0 P  H 00|00  HPr 00 R0S0?@P5/@TY$Ѝ H\r 00 R0S@0刀0z@P5/@T@ T Q" @-@M R ! R "R pP^  0 0@_Ѝ /@-0QM   S S PpP$@4R @ 5Ѝ>00- M #Ѝd@0<< -M Ѝ(= p@-0B\S@[ ^S:  @%  ,S'Sy cS{e%!E"0 @ L P >b>0 r a00 } 0 p000 % 0   @, ,L !2b{0 r *PUB 00ES941PuP@P`00B 01 00C  ^00 , ,L !2b0 r S\S:S '  00 pL 0 @a % {r <O-M  }~\PP 0H'p p 00R0pp  @` 0,R3Ti 0@\  @0 0 0 Rg  QS%R +0@GSSQPNMLpoIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! > 0 SPf 00Ѝ0% iP@ 0  `fv`00 0 R!.Q R*Q0 00 RZ@0 S\0% p@ 00  00dP% @ @0  d 0 0 S 0@ 0 00000 30 S\@  00     0 0 Sm\  %p00 00%@@0c  a 0 SH\ %p00  0 0% @ @0c@+0 0   / 0  @   0000      <    0@0@D0 00T0 S\R$ W 0`C0@ T0  $ 0  <  l /000> 0 0 0S0\S 0 S0 9, $ | p@-@PM0P`0S PS   0 00Ph 0 Q00QH  < x0 Ѝp0L24 dA-M0@HSD!00@0p0S= `0 V 1N;AƒKa1#cL 0L0 8 g=M%02#cQP 0 pW$P@PW 0fSPЍЍ 00 ЍX1 A-M0@LSH!00@0p0S= ` 0   k<7@ƒCa0#c!01 3>C120BQP 0 pW$P@PT 0nSPЍЍ0"0Ѝ/x O-M0@S!0 0  0000S- Plar*sE3 0 `Ï⊡  -8 ?C01N;A08 g=M0: @P 0S  R p$0W% M #W =W =`P` n0000`@c01 0ƒ120B P0B `@00=$`Hs (0 * " BĠ,bC 1c 00 0#3#cqP $0tS0cS0S|``@m00` 000< `0SX{ T  @ O-p`@P0\ %\0pS sS lS@ 0\TT1DW 01 CR0@CUPsO-PQྟqM P`> 00S040G P l@   AH Y 0  R VG p@T %%T ,  RA*Pg  4 @P@Tp, 40,qߍ@p%T =:T,,P `0 TI 0DSECB@?>=<;:98543210/.-,+P zP" 400P,1S+ 0C-11@ V4 00 `3`,Q*P 0 3hp 40P4qߍ00f0\`!0D]SC2Tf !x~}~z00D 0 7Pb@0A@?S:T;X0Ds R S񏐀E~}|{zyxwvuE9rqponmlkji.gfe5cba`%I@ZLxPQ 00040CxP,I 000VK -00\.00 `\0l ` @:  P`160@00`-00.`OU0-1ऐ1`01@P!R) 0BS11`& PB=&@DQ1VTlZD2QU PE=!TQ10 ~T0OUo !ऐ!PQ0P@.@10Ds Ru-1!ORTPX=P1=1 !T@1Sx -!0C1X0SX 00V!@40` RX*, Ra  fpC 4 P040@ R   ?R ;R  pR %R0 0@a0Ds R A0DS"13 DOS  !ऐ!01Pp!POR͍0S'S ! 0S'S'S@P@0P@Sl00l0 0St00t0ATz @D=PA1P OT=Q1@A夐P@1Sh 0C-11@ST@#,Q*P  P4 @@p1S[ 0C-110S Rf   ?R ;R eRQy  pRW %R0 00     00C2"0OQt͍0S}S  0S}S}Sw@P)AT @D=AA0@a DrQD! 1N`V`SVP <`L`&I0``DVP``>P``9`@oob4P``/V, `(`@%"QA@PQAA DR 3@DP1@-1 1OS 0 'P wP! 400P,C0?oQ2yV0 020vP 04 ,00T` `2,v P 400`, P00@!T00 ~T00R@00H&8`00&@D0Q0VT񏐻^mgaXE3~}|{zyxwvutrqponmlkjihgfe NP00H@00C 0 >00- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/رA-PQM`p@ 0S WB uP 1X' x00 X T~ ЍPPT00g 00ЍT #Tp 0 0 R Tp Pp0S T0  hDO;p 0S R s0r (0 000ST00]P K  p0(0QP K  p00PãT<ལ0๣ t t  8 0R@-M  E0S@  Ѝ0A-pPUP% U)  0S`$V  PR |K@P0DV ҙo ˙PA-PR pQ  0 @`R P0 C C0CP P (&0 ES  uP  0 000Q 0  R0 R  P U Eq0V Q ^`̇QP 0S  0 S oP W0C s0 QS0S  0 S P RQ!V0C s0SPUE P 0$XGPG "( X! $@0"P20nPH sP9 fPRP?oP @20S@qQ:%-tP L!&tPHtPJ$ PP t$Pt tP$0PSU 0V PWPP @?V00SC-P|AMx!`@p 0^b P 000S< `Ѝ<@P ` 0 p R 0S 0P` Ѝ` 0 xP oP`L004@@+@ P *@P괱 pO-M Mp00:S*0:SS@ 0PS:S``"E#P  [ R 0;0  0dAiP 0P:S ۍ Ѝ@ۍ Ѝ$ŸC-P M@M`pt P? 0/SO ?{P  0sX PE P 0 ۍЍC`0P P! p aP40  PۍЍ0P 0S/S zpP sX0 ۍЍC p 0sYW P0L 0 $ۍЍ404 0 $ 8 $ x L G-p`@P  ]0@asT  SP h@Pd@ @ @P PU  $ 0 %%G H-@- M@00 Ѝ@ Ѝ/0 Ѝ@ Ѝ/ 0p@-S @0000p0000  P 000p@-@ssr@rr r0r@8p@-@(PS:pS XrP!pdq @-Q @fRQ ^nR sRQ 0  \ A- `@V pfS@`V P0P0@nS sS0`V@@ 0 0S00@PA-P# P 00`p` ,RR    0S,S@BpP  x t`p`@ G-P@`P P9spWT*nUK sUB fUH0D Y#R= @ qP H0D@p H0@0H0:H @0nUp H P5 sUD fU< L00L0@P@ ZP00pY 00 ,00 p 0S0000  @ QH0 $H00H0H0@ HH0@, ( H0@0H0H0, 0H0$PH00H0갳 O-p M@ Y ` `XP P0( 8000H0 00&pP2 0Ɒ 0 Y`   PX  PPPV S0P@M0@ Ѝ1!0p@- 0 @S/ 0SpQ @\T 0SpQ 00pPUp:`AoobEU@@ \S@@ T0SpPx0UppA-`0p @PPUR pP!0 V0 00pp00000 00 0P{oO-@P0 $M 0\P `p`Z3 | P PP 00 FpBp P ` p 2P/p0P p $Ѝ 0 pp,P0 pU 0(0$0,0 0Y``  R \00mPJ PU0pLp0@W@0H0D0L06 fS, 00 00  ` P pW P`0nS sS Y ``  Ip $Ѝ$EEP(  A-P0p @``VR oPA0 0 00P 000! P0P 0Pn0A-P p@`WR loP0 ` 00P 00 0PfnO-\ML0L $00,0k;080`P ||@P00:PP00PwT PU ?PtPnPN  P U 0T 0$,0P 5 :0H0:0<0:0D00(0 0 R& 0.Bo0#1OR= = @P 0 0pPu< < 00R40 R00 Q$,P ao \Ѝ# ̹PP3 @ p@t ,0 S Q0S Q0TS0 000`40T(0pW#S nPQ (p D@0@ST "p@tP  0Rl  Sg 0Q 0So 0@S S 0p,Pl  '\S  R^W$% [ ^S Rn `[,P0 0/0IS .u 0Pm n \Ѝ0PCu RE C/R{yxwvutsrqponmlkjihgfedcba`_\[xXWVUThRfPONn|x0`pS@ S8 500 @ 0 @`%8`  4 000 TCT00S P PU0 Q 0S; t 0R0 00 0000n0y0 0`pl 04 D 0 00` 0p0 00 00 0 0 04 ‰ 0v/t 0 S00P&0@0`s 00L4 ^<8 T@0Q0PE`TUpPP 0F 0 00 00s0 lPbP p@t p@t; ,0 Sa Q0S Z QF| 0 o? 0P5tP0 000 000 000f0 P p@t0 < 00RN0 R0J Q 0 H.?[R 0@ 0 0 0 0S00'Ps  Z0 0 L  00 0 PF, ", p ?PHp   d T ` P/$P  //0 0@-M@0 PP} 1N;AKLBH gMMl1#c 000%#@B4dT!;PЍ0 P0`0K?//X 0@-M@0 CPG k<7@hLBCNCl0#c "0K20#AB@C1dPЍ0 1P00?//x @-M@0 -8 ?=<;:9876543210/.-,+*)('&%$#"!  " U a  !00 (ЍpP00 P 30 0U : U05!00 P00 ~Pu <30 0U 0"nP 0SH !00 cP00200U 0 UP 0Sm !00 cP00|20U 0 a  9PQ  cP00i,20U 0Z 0"'P 0S  !00 cP00SU 0 " P   rcP00Zڈ10U 0 !="?7D"0JP   ZcP00,U 0 " LcP0000U 0"?7L"P :0S 2!00 2cP00ڔ00U 0"?7L"P  0S !00 G\H x T x  l ( cP00$00U 0"?7L"P 0S !00 cP00ڈ00U 0U 0"sP 0S !00 cP00600 0a U  WP`  cP00$ڔ300U 0 EP 0S !00 cP004300U 0 ,P 0S !00 cP0020U 0"?7L"P w0SM o!00 ocP00p20U 0"?7D"P  \cP00e(20U 0U"?7L"P J0S{ B!00 BcP0010U 0"?7D"P  /cP00|100U 0 ] P 0S !00 cP00# 100U 0 o P 0S !00 cP0000U 0"?7L"P 0SG !00 cP00`00uU 0 pP.  8 @ 4 T  ( cP00400U 0"?7D"HP 0S !00 cP00ژ00U 0y"?7L".P 0Sr !00 cP00?00U 0/"?7D"P@  xcP00D10U 0"?7D"P#  ecP00Lڌ10U 00" P T0S L"00 LcP0010U 00"e P ;0S 3"00 3cP00^L20*0 0Ra U  P  cP00p30U 0"?7L"P  0S! !00 cP00 30U 0"?7L"P 0S !00 cP00#ڨ20U 0"?7L"sP 0S !00 cP00D20U 0"?7D"YP  cP0010U 00" GP 0S "00 cP00ڜ10U 00" .P 0S "00 cP00<100U 0!   P z0S r!00 rcP0000U 0"?7D"P `0S X!00 XcP00 p000U 0f P F0S >!00 >H h l X x H h  cP00000U 0"?7L"P 0S' !00 cP00ڔU 0 "V P  cP0000U 00": P 0S "00 cP00810U 0y"?7L"qP 0S !00 cP00ڜ10U 00" XP 0Sy "00 KP 0S !00 20 a U "00 x30p30h30U 0?G"&"00 430,30TU 0?O"s"00 s20U 0?G"4e"00 e20%0UjX!00 X20[20rU 0?G"G"00 GX20P20U 0?O")6!00 620U 0?G"i("00 (10Z10jU 0?O"!00 10t10U 0?O"!00 p10h10`10`U 0?O"!00 ,10$10U 0?G"3!00 00$U 0?G"l"00 00]00U 0?O"!00 00x00| 4 d ,  (  D ,  l 0 < l ( \ U 0?O"f"00 x00WU 0?G"t!00 t0000r00Z00U 0?O"Z!00 Z10t0UJ!00 J810U 0?O"<"00 "00 >9"00 94"00 4/"00 /I oI "?7L"\1 00]81 00T1 @@0 G]0 h00>0 @@80 1 -DT! @ P \ x 0 4 @ T  T X h l ` P x h p  0 00z40 00[X0 00!|0 00/ꢾ!00 0 00٭0 400Эs0 T00ǭ 1 t00⾭D1 00⵭h1 @@G0 ਭ1 @@:0 "1 00⒭1 400≭+2 T00‭<2 @@0 sxp2 00j%2 00a2 00XB2 00O;3 $00F0$3 @@T0 9hX3 t000E|3 00'3 003 003 00  4 00뿽!00 /+S0@-SOLAQ Q@\Q\P 00 Q P0 +C 0` 00+C03Q Q 00ALL1\1 ^SȠLȠ n! 0+C{0`{7+S0+C0p /P 0S $0S 0S P? @4@P//A-0Pp`8P& , R( 0"0, 4000R40G@BV@1 V @D8 ڵ,0400Gӵ,0400(@  (8/P840, 0S004R000@-P04 R 0    $ < @ S. p T P  +ˁ0P R $ R  R S /0??00S" 0??000CSW0S; 0@8N?0 QO?0(0 S@0(0H8 080t090@5?0U2 0PE@Tx0S :00Q?0HLQD0ʆ;J?0\T 10T :0PE@00SU0 pC0 0,0 SP<@@B0S 0P/S30 PC0W0"1000000 00 0<0? S@0@0R0 GBRR<,0P0US 0S0 0T)<9 0 <0 30 DЍ M R S R  ,P0 PpB0Se 0 00 C0 S 0380U 0PE@T0  CQ1R00S000 00 00S 0S($<,(<0$(00 R 700Q?000g 80B4 R@0,5 00D 0R1P! BD  A B\000D0S0H?0 1UR0070  0P<@@0?/S ʆP<0  @@ ;TU 0PE@0 S  S S @DA?00@T80PE@TULQ{L?0QI H0 @S0 0CR*ʆ+R 500Q?00 pC0 0@P?00 pC0 0ld h ^X0Pr00001p0T :0PE@01p0WU Q 0SU 0PE@T 0S 400Q?0U 0PE@T:D ʆ0@D180+D0]Uy 0PE@T:0ʆ!H0@D80H0;uDpC?0W U0p1Wp!W[ 0  PE0C0000ϱD00CD00(Dpl `R* 0ATU= 0PE@0 Rl @D0ਁ:R $0(00C 8 P 0l0S>0X p0P0tXp0  P 200Q?0/ R=0 U 0PE@T;0H?o20$0S0  $,0r ($B0#22cR0S 100Q?0 0G$Q   9R D Up1p!WR0 D :/ $ R D ;/ ^$ R$0\4 @Dʆ8+aD?㨁@D0kD 0B (8xp<#0#W" 0400Q?0xQ  8@D;D _ 0;??0K?HL0I ] 400Q?0[0@DpSB?0D 0 S40P0;T0G?0U @DZw0PE@ZqUH5威@D00Q?0-8tgx| p⨃@p ^*:l0wp 00r0⌠pZl :@{ 500Q?00@08 (4890(8(:0;D600Q?0E?l 0Zl0PE@ZfUR? 0 0C00S` 0 0000*p8tgx|p⨁@pp41q岠pT*U 0`4`UK PE@1q岠pW0`8Q@D{@D8D I?L0C0 PpCc 88(9b0+@\8@D 0@Dw(J0F?l0w0P 0000< 0@@r0 0`pC3( (0@DR0 S(0!800Q?0FpS>t0φp0P0 X0X 0404P( @900p.SR:@ 3 @00w??@0a8 8(90 pCp \ 00T d \ h P :00p0:00Q?00威 @DpC0 0d:00Q?00SG?0z0 pCp@-@PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-P@Pp` 0R>/ S  P00S   0S R?0P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000@Pp`W6@ RS?Q 0<0 1 B p 0Q#4<00M@0P00cS  B R#2^ S 3#P0S S?R[ @ 0<0 @ R1<00l0pW\V H R 00cS  Q # 2R S 3#R0S  l0Sp0pCp)x 000 0P,04hp??0x p0 0 0 30 Ѝl0Sl0@@@ `눠P 0S $0S 0S P?,A4 BR/A/Q /@o/A-pPWPu@ 0(+`3/PPn 8XF ( 0(3/P00@b  0 Q    +㢬P04 Sp:oSS0C0P0T00C0T0p0X Cp (0 8#ᄬ8Pp0 Cp0@0 0 Q    +cP04 Sp*p0 C p ($03/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?00@C/O-R|MP  080   0 C 0x ^0SCV0pSQpW -0 p p0|Ѝ:0`\`VX@~;JT\ 0W0P0S1Z0@05P0^s00R  0xS0SPRCRT@!V0!01P 0020 P0S|Ѝ|Ѝ0@ ?o2,0%R00S020$0@0(00$(0,0@?o200 0  0 B  400p@ 0SP3:^N $ %30!`P3P'( %!<: 80C1 ( RP@00F#3 0S C 0x $Q Br $ARVG  ` V  ^ F Z(  V F(*xQ B\   L\ R: 0 Q  Rf, %Q  R`4!LAS @@  401 00 ,0!00 , 0$ (0W L 0O-DM0C000 C 02#03/0@S0S20 X>0S S000 00#400 03 0  0#400  0 {0S0c0?o20 Ѝ0So= 000 Ss *S00Sq00 0 0S&+B%l0S0 B8@ B0 #22c0# 0l0S q00040S9Q L0 0t0 0  R 0,0S0Q0Q0$ s0Q0s0R 0s000 00 0#400 00 00 S0 S 00R01 00 00S 0 0 0#40,0S0 0E00Q  P pK 0S PE 0SP  p W *G %0 ,0 SR B00|0S00(0 Ѝ0 0 0 0 0 0 S0 S 00R01 q00 ?0SEQ=X  2Rby0SS@ S  00 # #8 00#"0 Ztp 6l8&`6 &!6ƅ909&tpl0QpGtp0l0 WLt0SX# :Xv 6S \0l S B80 l0\00P0S P X X0S? Ѝ0 0F 0,  QR0 0I000S'   0P P0S0   0S,0SQ9: R,0S  R0 0[00$0S,00  $ 0P P0S0   0S,0SQ@:V R0 B0i00,0S!  Rg  S 0 Q30S0  00#40B0q000SC 0 B040#  #800#"0 }IQ V\ R8 C0 l0\000S*pt0Z(l 8`pR B  ^L 6&p!6ƅp6ƅ909&6Rt0l 0Ct0 l St0 SX S Sl 8`p0  X 0S!0 B000 B00,00I ^ ^  Y Y Y Y Y Y Y I^oᩒ#Y@K`P`0P&0@ƅs0 ƅp0 0 1001  &6`Rt0l 0C`p t0l s\0S B80 l0\000S6^00 040[TpT*X6I &RB \ R80l0 C*0,000}G 3t0 000s B00 0$+0;/z O-@Q$M R0  P "r !#4"  TßP ` p @ * @+0@$z '0t %{0q 1qp Q`!;`~P0#:~)4~(>6"~r !p'P% ` R `@ A$< 0# s R#4!  " "0r0S"$!00# "0r0S"$! 00#0# s R#4! P% 0#s R#4!@PURh RPERU(pR`R x R R#4( p R#( 0Rp'wpq(t'`&v`a'd&.~&.,| ., 0#s01,# p1,4# A  @Q   "Tr !#4"$Ѝ, ,L""a R 0Ppry ~ x Xx ,x x w w v C-PRp cmN P  0!\00#@B .P @N1R C 0 @$'v C-PRp cmN P  0!\00#@B .P @N1R C 0 @$'$u @-@P |p S]Np`@` 0!đQ00#B  Lt @-@P |p S]Np`@` 0!đQ00#B  s 0@-1 S@]N\ C0 @$!0R Ƞp0e Q RMO-鯅RlqPWPHuo@V-B0 BPPP0 0 P 0 P 0 P 0 P 0 P 0 P 0 P 0 P 0 P 0 P 0 P 0P 0 P^0 R0clR" R  Q0/Sq  Hc0   A R,A B@P C?@P @@/R#-qHƒ7#cp c!qQ#/>c0   A R,A B@P C?@P @@// U/ 0`0/1*  ? 0O- MʀPTR& Xp  1R'ʵ?0U\˞ A@`kẠZ @11: W: @ T Ѝ  Zࠁ?0 Ѝ0 O-Z `p 0`B 0B. 0F00 <@ pR  0 q0CR Y> 0 BV0 00000C01 `FR 0΄N @0 0 T00 0s ^ R 800S@BC0 R 00^<ЍP 0=0yQ / !02N[1`Vp@`67#6QZ J0 0pA-@PA^0RP@D+}n@p `0R- R1|Z000^ ^P0T0 S^ S|^P00 P0P0 S+̀Ұ0000Ұ00O-MpW``PPRO10+=Z̀0 0+=80J0+=000 Rp; W2 R6 p>0 pPn0`N Q1ss0Ѽ00#406c`UQPf RpWr 0`P ZЍY㼆`i Yv` !~:|0 cR(r `C 0`PP`0P#4``06`cQfἆv`:0PcQh06vv`0C```!0nU6~ BSr [3s0P0P00PP#406c0CR! 6W W0`P 0`P R;0+=P0aSr8`As0000`#4060cUS QuP`N0 ~PqP 0PP#406 c 0C^606 0P0chQ0v6v``0C``!0aU6q S( N ~P3s00P0 0PP#406 c 0C^6y ἆ<X QuP Br QPh Br 06aʀO-V6MpS㼖w 4P@0040030 0300300"0`0 cy Rwwp 0Cpp p"$ nV~p~p἖6S&0wp0@ 4  ` ฀ pb W zp&z BⰠ pp't pv pgXw&wpaY taN~bpiW vp&v`` I`pp`&d`v pg^w&wp0CS㎀aޕbޅa඀Აir^wwp` Ipp p"$ nX~p~p἖ `#R~ `d0Cs0yb ^wwp@` Bpp`p.nS>sps6pS἖_ 0c Q~P~"F`0CPP``!0aR!6 Ѝp἖8p἖p἖0& 06Ѝu u u tu hu @-6Sڸ6 @@0 #40&006Sڸ&0 0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4&&&&0A-@ s0`P Q!rr  pp pp"$ &b BS10& u0U0U$0Q  00  0 m   *0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 Sq@q;0PP@0@PP#406c 0C^6 S0Ҽ6ڸ0@PP@0@#4PP 06 0C6S S0ظ0@@6 0C60066@PP@@!PPƂ0O-@ MPp,0S ─&]P+(+%0 N. 0R010S@P j600&6 0 1!S*Q  S030#Z0S&0 R5|2 s000 0"$ &0b B\3&s0 R(˔Aq2&s00 00 #40&0b BQ&q0 R2&s00 00 #40&0b BQ3&s0 R@q2&s00 00 #40&b BQ&qXßk>0➢ MΌ & R~ ~ Ѽ    "$  n NP" Q   1 #O0  P0Q;S ;S <SE S 0R  , &] Pj0S  Z R, 0G.0 0R0 0xS0  0LSW4&&&& Ѝ ЍO0 &0p R2 ʱ006N.V k s000 0#406 c 0CP6@~2 &s= s0&Aq2 &s0q2 &s0 `l j g :Q0@-!DƓPV ƓPV @Ɠ@F 6@o0ƓAQDƃ<  !!ѕ"х  f p@-@P`y1r1FP t3i4FP @T @ 000@pVp'@ p@-M @PoЍ=@oЍ@-M @PЍ.@,@Ѝ@-M @PoЍ@oЍ@-M @PЍ@ @Ѝ@-Mp`P @P @Ѝ p <Ѝ@<T 0p@-S P@ `0 C'0@KT @pϗ 0 p0A-S p@P`0PC'0@/T @賗00尗0p@-S P@ `0 C0@T @p藗 0 p0A-S p@P`0PCd0@T @{00x@- MP p 0S p@0@CD'`V ` Ѝ[00 ЍU Ѝ@- MP p 0S p@0@C `V ` Ѝ700 Ѝ1 ЍA-Mp@P `P p ; 0S P 0 C @T@ Ѝ`Ѝ``Ѝ@;T` Ѝp@-@3PVt3i4FPPpp@-@'PJl?o2FP p!00pp@-P`!@P  m @Cp@-@@@-@@@-@@@-@@@-@@%@-@@5@-@@S@-@@m@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@%@-@@;@-@@S@-@@k@-@@p@-P`z@P   @pp@-P`h@P   @pp@-P`V@P   @pp@-P`D@P   @pp@-` P1@P   @ppp@-P`@P   @^pp@-P` @P  v @Lpp@-P`@P  d @:pp@-P`@P  R @(pp@-` P@P  ? @pp@-P`@P  - @pp@-P`@P   @ pp@-P`@P    @ pp@-P`@P   @ pp@-` P@P   @ pp@-P`@P   @ pp@-P`m@P   @ pp@-P`[@P   @ pp@-P`I@P   @r pp@-` P6@P   @_ pp@-P!@Dg>t3GP p0P 0pp@-P`@P  f @< pp@-P`@P  U @+ pp@-`P@aaFP pP U  00ppp@-P`@P  ( @ pp@-P`@P   @ pA-P@ g>t3GP @p7`P  @P`8p@-P@ g>t3GP p0P 0pp@-P`%@P   @ pp@-P`@P   @ p@-@R  @ p@-@"Pu l?o2FP p00pp@-P`@P  " @n pp@-P@P #@_ p@-@"@@-@"@@-@"@@-@"@#@-@"@A@-@}"@Q@-@w"@o@-@q"@@-@k"@@-@e"@@-@_"@@-@Y"@@-@S"@@-@M"@@-@G"@-@-@A"@A@-@;"@W@-@5"@o@-@/"@@-@)"@p@-P`@P  C" @ p0p@-P@P {"@ pp@-P`s@P   " @ p0p@-Pa@P X"@ pp@-P`P@P  ! @ p0p@-P>@P 5"@~ pp@-P`-@P  ! @l p0p@-P@P "@[ pp@-` P @P  ! @H pp@- P @P !@7 pp@-P` @P  ! @% p0p@-P @P !@ pp@-P` @P  p! @ p0p@-P @P !@ pp@-P` @P  M! @ p0p@-P @P !@ pp@-P`} @P  *! @ p0p@-Pk @P b!@ pp@-` PY @P  ! @ pp@- PG @P >!@ pp@-P`L @P   @u p p@-P: @P !@d pp@-P`) @P   @R p p@-P @P  @A pp@-P` @P   @/ p p@-P @P  @ pp@-P` @P  z @ p p@-P @P  @ pp@-` P @P  V @ pp@- P @P  @ pp@-P` @P  3 @ p p@-P @P k @ pp@-P`y @P   @ p p@-Pg @P H @ pp@-P`V @P   @ p p@-PD @P % @n pp@-P`3 @P   @\ p p@-P! @P  @K pp@-` P @P   @8 pp@- P @P @' pp@-Pc@ g>t3GP p0P 0pp@-P`~@P  r @ pp@-Pn@P @pp@-P`c@P  R @pp@-PS@P @pp@-`P@ aaFP pP U 00ppp@-P`W@P   @pp@-P`f@P   @pp@-P 3@P <@pp@-P C@P +@tpA-P@Y g>t3GP @'p3`P  >@P`4p@-P@; g>t3GP p0P 0pp@-P`@P   @3pp@-P@P @$pp@-P`@P   @pp@-P@P @p@-@Q @@-@R ^ @p@-@0 P 44p@PP 0S  pφ 04@- @@ ƅ,P 0R @-P Q Do//@ 4 0S p@-@L`P`PpfP p@ P 0o 0 @-XJ 4K xJ @-P Q @@ a<0< 0 ( b$0$ 0 }J TJ J J XJ I m0 0< @-mJ DJ I A-P`p,! 1@P P` X3lpp5 ႅP` ,  @E3# >3ꤤ`@- 1@P $0 0 0 4A-pP 1@P t0 0 0 7`1PP  P `0 ,0, 0X @H hH G @-@P @ {m-A-M pW $P 0P @P_1`P  0P  ]ЍAЍ/ЍAЍ/ E0 0t G xG F  @-@P ԉ@ :,p@-@P x0 00R0 P!10P Q k! p@Spp p@-@P `0 00R P00P Q I! p@pt P/0 00R /P/<0 00R0/P///( @-P d0o00QP  00SQ !p P/0 00R/@-@P \0 00R  00P Q  00 P/00 00RP///T A-PPM 0/o0"0P R Ѝ R0 p 0 pR0`P 0 S  R D  y`P 1  00\ Ȁ A-@PM 0 00R ЍQP 0 Ẉ pp0`P 0S d P B`P 1000( +$0$ 0 l,[  |B dB A P H0-0/o0"^ R  R/P/D0 00R /@-P o P/D0 00R /@-P o\~ P t0/o0"0\ R RP Q {$Qsf O/0~ $~ P 80 00RP a^f O/p} $0A-SM`"P@U Ѝ0 PwP ]/pP 0 0 0iP S 0 J/@P d0 0 0 @Ѝ4 PSP  8x 0 //p@-PQ& @R 0Q: Pp0 P `0\ \0 wL0H H0 o804 40 gp? @ `? t? @ @? ? @ ? p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ Pp > d> 0p@-SP` @ 0S d@Pp<\P QQ QP>p@Jp@-@<PEPp/>P Q 7P Q>/P  p@) 0p@-SP` @ 0S @Pp<P QQ P/P >P  p@p@-<X@P@(@Q Pp$pP  p@$= < $@-@P@; @--@P  -P0 0, 0 @`/A-PQ@` x @ 0Ls0S(<\)0S% !S%0-S 0F?o2-\0S0S -S 0-S>^ 0Ls0S23 /S `(`  0Bs\00@03<0/R>R  pp@`R  0Bs0S73 00/R>R FU  RRP0/SZ 0$00>S^ Se 0S 0Cs0S`  ` @23 0As0SQ ` @r R00@ 3" =P  R @P  0@s0S<300=P00S`A`0"S0S   0"Q-"Q* Qw`FVt0Sq 0(0u(0Sj0$00>S`d0`000 0`L H0H 0 m `z C  >RJ008 7 87 P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /@- QoO-KM `pPL10 000 00A P @ Q, U QPP0 3/P 00@04/P 00 0 P] 0SPKߍP@0@;/ 0 @E 0SKߍ5 lG-,,@PE aPqP@`p 0Bs0S/<R1  P   P  ܀P#0 S -S0-S>Q0 >SSS 53 @L-L4 P4 X4 A-PRMePp`0 @T- Y0@0W  W[ 0A/R 0CW /RW  CW0 B /Q @C#@ T@! ;@04D .00' 0 R *$ 0 04Xp@  BU D0@t=0@ۍ7? 0 ۍ0 0 ۍ S0Mp Pp Kip@82 @-`-MhP0+@P4 ,p`F pI pEe0RAp#0 `c00p)  G  000cp0PP( Ѝ0 ` c00p  $Ѝ@Z,ЍR,@ЍI,@@- @ @@-c^P 0 0 &/ / . O-IM  @T V 6/ p0 PR @Tu 0 R 2/0P`=^` P0 p 03/V@ 6/T ^T T @T@- 0S1 0 3/P V 6/]@T 0 R 2/0P`^ P V 6/X3 003/Iߍ 0 0C/ 0 0C/ 0 0C/ E0 0 p ;l0l 0 X BT0T 0C/- <- 8, - (- , h- , + D- , + - , + , , + p@-P@PP  P $0SP  R P_+pd]OP P WPP , 0PP+ ] + P0/O-MM(p@ T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT0 00SP $ 0R000 Mߍ R00 0 0K/* ) ( 0/0/@-@@OP 00#0 0 P 0S S R/P/ R0/  @-Z@vxpt 0p@-(M@P |  8h``bP (ЍpD  (P v(Ѝp* ( ) @- @+}X*謍@- @@!"||p@-M@Pᙅ` `0Ps0* 000 Ѝp胅0"Sp@-M@`yP POqp  000 Ѝpe0"S 00 S 0 P:\03#/S 0 P\0///A-P``{@P (M(pP {@P {){W@(0$ $0 밋~& & & 00 S 0 P:\03#/S 0 P\0///-M 0  Ѝ-M 0  |Ѝ0@-M@P0  @0oЍ00@-M@P0  @0bЍ0@-@P ,0 00R /P/0 00R / 0  Q 0R* R0:/- ^ : P *0 S0*/@@/ / LP $0 00R //`P $0 00R //(P $0 00R //P $0 00R //MP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/xP/l0 00R / 00 0  S *0/ ɒ\* /P/|0 00R / 00 0 S *0/ - ^: PP/|0 00R / 00 0 S *0/ - ^: P/D0 00R / 0 S0/0P/|0 00R / 00 0 S *0/ - ^: P/l0 00R / 00 0 S *0/  \* /HP/l0 00R / 00 0  S *0/ ɒ\* /ȿP/|0 00R / 00 0 S *0/ - ^: HP/D0 00R / 0 S0/ḾP/d0 00R / 00 0  S *0/  R* /`P/d0 00R / 00 0 S *0/ R* /P/\0 00R / 00 \: /!S /pP/\0 00R / 00 \: /!S /P/T0 00R / 00 R /! /ᐼP/\0 00R / 00 \: /!S /(P/d0 00R / 00 0  S *0/  R* /ḻP/d0 00R / 00 0 S *0/ R* /@P/\0 00R / 00 \: /!S /ȺP/T0 00R / 00 R /! /X- P M D0/o00"^ R Ѝ R ЍuP/L\ /  JQ\/ጹP/L\ /  JQ\/,P/P\ / Q/S/Q\/̸P/P\ / Q/S/Q\/h0Pp@-MS ` F Ѝp$0@S P0-S 0S0xS {P T ]P ЍpPeP Ao/A-PP@#$@Pp t0,p0P4080<0$P`p @$@P%@4\Pz  @-5@Q m$z@-$@@8 8wzX}}@-@@O-4@T ,p@Dp@Ѥ@T `P煑Q }PZ P PZ  0z 0     @-R 0P< P 4Q ,  D c@0@ 0 , (0( 0 (,     \ p@-M@4 00R<SP,0 S R( 1`V9 P` 0 05P 40, 0C40P0 `ЍpS a0 0D Ѝp$$ЍpR p l0l 0D X qT0T 0D @ a<0< 0D  4 l       p   A-@`,p#PP W 0 !|x,P0`n$,P0`G-@pMP P  `V$'00Ѝ!0 E`P (0S0 0 :P (0S$`V0 0  0P 0S  `P  P X ` 0 |P $( I$0$ 0\  F <\   0 0 @-   t 0 0 @-  @ 0p@-S \  Q @P=P8p {0 0 Ph   p@-0S h`@P`Pp_P p@ 0 0 븄   , 40@-S , 0C40P @j@ <0< 0B/( $0$ 0B/|t   P   p@-@PP0S ,  Q<0  0p@f똮O-p`@40Sb LCP@ P 2P0U"P 1001000`S[00<0 0 00 0SS 堑 # 00R&P P [I P P  P 0  03/P PP 0 S @6\O&, 00C 0S 0PS APx@` \0\ 0J/H D0D 0R/( dlB 8  d @-@@u0,S<SS"DoPG-K `0pXJXP@+ 404 S S> H000,  0 0,0$ 000,0, P  ?o 0 2\0S `P*    0SP```D }@0@ 0.B, (0( 0.9뼪h D G-`P& 0 0R! 4P 4 R @,0Q p,04 P@Tp:80# r 蔩0P 0  Q@-P80080/p@-P@V80080p@Op@-@P 80 0R@ pPA4@>php@-@P \0 0R@ p`P,00S@#:&p=@A-`@T 0p0W PP \000P000e0@S <0 @ 0@딧A-`P 0 0R4 p40S @40S,0@ PPBppA-@P 0`0VpP0S P @T @ <0< 0R/;@@HL   A-`P /o0P0"Q@@T 00R p @P @T z@ 0 0R/댥d   O-@PM 3` 0R PЍ4 00R80p O PP @`P @Ѝ S  P rP2  004Q[ 4[^ , P1 Q  y PYUPE Pl P P!P a 0 ,0傁14 `<0 4 0<0z wP,UF<UHUJ[E  С0 TPP ^ UrP! 8 V 0,S<SSK k PP6, P<00`<04Px00  r[. / ,<Pa! P`,04  `<04 0<0R |0| 0^/!h d0d 0^/*L UH0H 0c/ĤgZtf  8     @ G-@S ` VP p P  000 G 0 0i/ X 0P L- ?o2 ^0S 00 S/@-PP M @1 0R Ѝ`@ 80  Ѝ U0P 4 Rp@ Q(*,S0 B!_400C40<00<0ZXh Fd0d 0s/rP HL0L 0s/i8 G404 0s/`묟( D |  X 4 P/4?o 2 R0S/00 S/00P D- ?o2 ^0S 0 Sm/P/0 000R/ᔝP/0 000R/h P H0-0/o00"^ R  R@/<p@-P@PP fP 0 03/P wP PpPp0S /A-`@P9pP $P pU0P  pAcO p@-P@PP u vPP p z`z`p@-@P -0@YP @-@0P P 0R R@-P0S /Bo/804 40 f$0 0 ^( O- 0S: @`@P1 X3qPp 0S"  0S P X0UUUH#B!0@< .B,? @P0SOOX% X@0Pp#r 1 Z W:<C0PQ. Q QH Q Q <Qh =Q$ g0P Z @Q Q Q Q Q <Q =Q gP @83`]@QRЍZx`Q 0As0S;<Q =Q zg0P @`Q 0As0S"<Q =Q hg0P @4`Q 0As0S <Q =Q pTg0P @}8383083 P`Q 0As0ST<0AS1g0P @`Q 0As0SJ<Q =Q g0P`Q 0As0S;<Q~ =Qz g0Pu`Qq 0As0S"<Qk =Qm f0Pb`Q^ 0As0S/<0ASWf0PQ @83F83 83 830 `Q: 0As0S0<0AS3@fP- @83 `Q" 0As0S<0ASfP[0<SS80S0P 80`Ѝ83 83 `@0S <S`6 S @ 13 0<S S ` 0CS@0S <S@ @ CR=S0 P 0"0<SS0S [ [<S``h Ud0d 0X p l d D p  d $ H \ A-`P=@P d U0 0 0 -pP  op P@qQPp@-P``P@P 0`0 PpXPQp@-`` @P`P  oP@P $0`0 Pp@܎QPp@-P``P@P 0`0 Pp耎@-@P T0 0R 00S P000HP/0 0R /P/0 0R/ḍ0P `o@-^P  ^^Q o/ልPp@- 0 0R@U T x`P  n@pT X T0T 0x @p4 000 0x @ ( ` P/0 0R/<0P D- ?o2 ^0S 0 S/P/@-D@T ?o 2^0S>o踋A-M$PU@`P !0 P 0S6Ѝ 0P ppPP 0 0 0}P7 0R3  P, pW- @P6 0P0 @u  PDp 0  0R0"S | x0x 0 '.Ѝ)@P Pyu0"S 0 d /P/< ?o 2\0S /0SP/pp@-4@4P@PN 00Ip|L$0SH 4 @-@<<T(@@ @@@t>KK@-@P (0 0RPP/0 0R/P/0 0R/0P D- ?o2 ^0S 0 S/ć0S /$0p@-S@ P0 |P 0 uP ttp@4@ @0@pLLL@'@804 40 R =TJ< J t A-PP@@Pp |```0,p0P4080<0nP`p @@P*@p@-@@ @-R 0P< P 4Q ,  <0B8 80 (0G$ $0 븅D h PG-3 pP0`W2W@ 404 SS& 0000P,0 10,0$ 10P+)P* !   PP@ <0< 0( ( $0$ 0( H 8 | h  p@-M@#S4RP,  R S 1CaV1 P` 0 0P400C40`ЍpR e0 0< bieЍpS L dH0H 0< M4 u000 0< D @ T X 0 A-@`,pwPP W 0 !?l,P0`1,P0`00p@-P4Q8 @Q 4 ,040<0Q0<0pPp &0 0P   @- M`V& @Pp P00 Ѝx 0 P (0S T @0 @=P  Ѝ$ B 0  0` $ Z0 0 @- @ 40S 0C40/ 0 0 @- L 8 0p@-S \  Q @PvPp Z0 0  p p@-@P t0`0VP0S R<0  0p@$ ] 0  0 XL  A-`@MP40SO 6P@Ѝ P d10XspP @10041000@SB00 0< 0 0S /0 03/@P PM 00C 0S @ 0@S `PblЍA+1L@8 404 0,!P T~8 4 SG- p&W@ PU 0` 0R 00 $P U  G 0 0F/| d < SRA-PP 0 0R4EpP 40S @,0aN, 40a@T:8 408 p{@-P80080p@-@P 80 0R@ pP0@p{p@-@P 80 0R@ pP4@pzp@-@P \0 0R@ p`P00S@#:p@tzA-`@T 0p0WZPP \000P0000@S <0 @ 0@k@yLp@-P@`80080p@Yp@-P@T8@Q@@pp@-@P 0 0R`PA40S ,0AT 8p@p@ R0 0O/x A-@P 0P 0R Pp`8040S !,0X g,0QP<00<0pPjPD @0@ 0S/, (0( 0S/wHx  p@-@P H0 0R@ p`P=@p(wA-PP0 0Rp@4\ 80,0!aV! \ ,0\ <0L40<0AAD @0@ 0W/, (0( 0W/v p 4 x D  0P D- ?o2 ^0S 0 S8/up@-P@PP ^P 0 03/P oP PpPp0S /p@-`P@P $0S p p@O4 p@-P@PP k vPP p p`p`p@-@P -0@Y 011/A-\@`pP \"1S 0 €  P 10P !`p P 1@0B< <0 d,0A( (0 \h 4  @-@^ P ^(QRS  T00CQNRS"  T  00 Z0 0  h 0@-@R,MP00Q! P! 0       D<0T?o20S00,Ѝ00   - 0    S00000000 0  P /- 0>   \-0 <Ͽ \p@-@P(MP`/ 0S, R00j$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  M P0V00(Ѝp@ R 0S V00 PQ0 @0/@-@p00T0,0-0.L@-@T @-@T000 000S/@-_蜆t000 000S/@-_\t000 000S/@-r_t000 000S/@-b_܅t000 000S/@-R_蜅t000 000S/@-B_\t000 000S/@-2_t000 000S/@-"_܄t000 000S/@-_蜄t000 000S/@-_\t @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^  \#.|.<.0 02#/-0 00#/-0 02#/-0S@-@1/00/T0T0p@-@ P`0S }Ppvmp^ꬂt/@-^-@-e000 000S/@-r^tAo//- M0 vH0 Ѝ- M wDPp ЍQ- M Q Q ,m 0 Ѝ H Ѝ^ B0($/0(/0$/ 0Y.<+ < 0/(/$/R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@Cl P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pg8U%U%E 3 @3C0"!@11@  /  *: S- d S V Sb00Z !=r -  w- S^ >S-00 @Sx00:  r0-00w0-000 SD !S-00 Sx00"0r-w- P8 P2 P8 P0x     Ss00 ! Ss00  Sp00  Sc00 ?00 S&  Sw00 Sl00 S00S00t 0 T 0 - 0 A00a0-00{d00xs00uG-_a`pP8 `P3  &`pP$ 0A0_`@@T ncP0=S AP` AT BU! j`_A;k 0 tzC-PM``"\2X 0D$PTm X`pP ጐP吐唐嘐圐?\p@Z pp 7\p@e $P7  0p@] X0@4S8040p0<S@40040j'4''0'W`<1< 000D000ue`Z'X %j0S dp@ [ [ @ЍOoBЍ@j00 [ [ [ 4y  O-Mp`@ eP-TPm +T @`0 0Tj W 㙙 㙉 p噙I㙉A pǯ  0[ 0 }[ P ! @00Ds \a0DSW0DA0DS70DWUY :Q P S \ 3jP"00 0U00S 0pS 0F0 0 Ѝ0S U0 Ѝ@0` 000XS00 C R @`0 p0 A BRWp pBD0R"\04 0Sp@-@PiT00Pp8tp@-BR"^p@?@PiT00PpO-Mp`@  eP-TPm +T @`0 0Tj W 㙙 㙉 p噙I㙉A pǯ  0Z 0 Z P ! @00Ds \a0DSW0DA0DS70DWUY :Q P S \ iiP"00 0U00S 0pS 0F0 0 Ѝ0S U0 Ѝ@0` 000XS00 C R @`0 p0 A BRWp pBD0R"\04 0Sp@-@PiT00Ppqp@-BR"^p@?@PiT00PpO-M@QHP@@0`U8 PT5 008500S 0:S (50 5W 0 0+ C :R :S?k:i 0S0`  :R 00X! $0 0Ot40h4 0$ P$ 0 S~ = U0P0y C000Z pP `@p @p@`T  ]0Sa 2PQ z  Q Q ` 0@RpT0Sp @@z `S 0RZ0S" 2 00S 0:S  XS0 S2 00+ Cea0JS0S9  00 SP0 S`,Ѝp @ 0U0! V WppP`P`wP) 0 㼀0@ 00D $P,`(p0W PpPpV W dp``p`TPPH``[b00p||Xp@-@0`MP1S ,0S  Z$0S  Z pЍpO-0M @yc`pP 200S 0S 00)  0Sy !y'?P` b0S{ 03/ !PaY0 S 3/ !Pa000   P    @ P x00  o00 UPYX$?UA`pP@T1P!$0 ,0 81( 0 0ЍYa 03/v| P P 0`WЍa0S aQg@$@sa00꼰 @ma !PeaU,0@-S @`T0 P @0P 0 0001 1 00ST:a 0 p@-@0`P1S ,0S  Y$0S  Y @ppp@-@T00C0S0 PTpP--M  L?Ѝ Ѝ/ -- M0 0> ЍЍ/0P0@-$M R P@0S$  S"\  B0!0 00 0$Ѝ00\L0 @0 P 0S$      P 4000S$/00//آ  A-`l!Ph1P 8M00400. H  Q ^  @2 XA\Up  X $@4\pU 0 0 40 30$8Ѝ@p@ pW ^]P` 0 T 0 @2 \p,@p@ N86(Nx58  - M< ЍC-!MM@D!0040 40p(1P0 0<804pz0P 0 0 <8 303 !ݍЍP 00 B p P@T Cn P`4 P8TzP\P @T@ὄ㹄  MLА 0!A- !MQ@`0P0 <( 040 004zP>44p pszP2 P0 p B p 팄PP!@T Cn`4 P8TSzP\P @T@0S x A[\ H0 0 <8 30 !ݍ400J$( Klp XJO-FM M@$ĝ`3 p0YT0d40X (d 0K00;5P0S 0K PU  0 P(00yBP R$ Pv Pq$FUh , Ph(=,;\BP $3U ,/ X "2 0 d4 30Fލ Ѝp 0P1P [P[P: / wP@ @U  8<V= VH 0! 0 00 C0 :Ptt .0$0SP / bw@!0 P  ]00! 0 0 0P00  0 0 0C0 #ng` ||IdHl l l H 8 ؞ \ L ,  x ȟ t h d @-@(M$1P ` p0000]T T' ^@/00 0 0 0 30*ЍU0000 @l@P@00juP 0?s00U00P]P@]P HED O-MMP`@`"%ĝ5 400ܵ0|404 @ 0p P9T`X`\`P0p@@ 58px00@0$0380 v@P!  Pq]00S. ]0=S0`S/`V`X`V `ሀ\P]0#S PU  @{$x4 0 |4 30ݍЍ800C80La]0 @x000004xPR] @P x 4 xP 3 $ UU$ OU0S800C80w  0<0PPp`]8#80 xX  pX0W$0@@pHP00] pPھ0 $0xC  (0P!U0Py0SW SU (PX ,PX 0PX  Pa< R% J0@\d @0  7 <080<0 S  P 80S 0@ 0 <    `OwPᔒ Pᐒ P4v\0S 40xh\8p CC| hB  x ` ܴ < 8 Ȗ l9 C-qp`q000!TM,P@p  t L ! x0P 00 C0 P!Q P,P[P1TP0 *@` P0 0 L0 30 TЍPҀ@ ୽|= << -MЍO-p!1\M 4Pq@0`! Ͽ0T00 |0ሠ倐儰'P 0  C0 嫀P80Q Q,P\PSP<P 0S 0 @| 0 0 T0 30\ЍpUO0  &@PU@ ,0;;   : H -MЍO-MGo#03 Ȳ 0020 g0 0-0P VJPf 1 S Sh d#@ X# Sb  000 S SU S0 R R R R B RQ@  BQRS 0 S1@+S8 -S\QUp @Uo 0SQp 0 M0 0_op`R0+S6 -SH WPPUpw\ WPX Pp@ S S 0QUp @U4 0SVQ9 0 0 00+S_opR0S @S0 PP v_opR0S @S%0 PP`  ]_op`RpP pU4| l0 0 2 30ߍ |WPPi'99t6R"O-`2 ŸMM@0 yP08006N M.0A 0;6PY 0SV ܰ + SR0+ Di 0  0  0 P @ P3H0: S8 1!0 &  !d1 0 8 30P ލЍPP[P 0 `P 100S1 0 &v sP \0S  S 0 0 &0 0 &H0 |0x 0 &0 `Kp5d ,  4 \  x \܌ 4 A-P0M`p 0 A   w~P @T@T 0 PP W~0Ѝ @PP~0ЍPw -P$M h00 @ P !Π0 (0 0 0 30$Ѝ 11-P$M d00 A L !Π0 (0 0 0 30$Ѝl181A-` @Pp BX0 00 0Lq ^aLQWLALQ7L \  R AAQ  R C R ą`0C0 S: C    G-0\@P@?0P R7T!/*0$q. pa ?p??` RS*"" P* U Q0*S *0U000?0Q*00x?R`@0p1?p# 0)0S0 ? S*0:  T:@80 A-P@@`<0@p,00 ⺃@.\@-M0D@ 0@00 0 0Ѝ\ -,Mx$0 0 0 0 0 6P 800 $  ,Ѝ$ 0@-@0M,0  0 (00$00 000_6P ! 0" 00ЍW 0 O-`0TM!8 L00 000000003|t6PPR d@p l0 p@P< 0+S+0S((CP,0 $( VP0 $,$H,0SCD 0 0 L0 30TЍ0  sP - P({W 0 <,, Ѕ *!1 O-IM0p010*StlPPQ \@` 0 `@P; 0+S+0S(P  0   P   0S 0 0 1 30Iߍ P !TP W 0 <*4 $)0/ 0 0@-PQ0M@000 @4 0 @" 0S0 0L @0 0 0 30Ѝ0!PP p(| ' @-FM0 M `@p00d40„!ξPPd@!Ƅ+὾ P V@ѾV R@< 40 0 d4 30Fލ ЍO'&@-Px dMt0@ p`00\00ツ ᎄs0 (0 0 \0 30dЍ*&@&33@-M8@ 4@sN0 Ѝ,L 0P1Spp// 0 0@-PQ0$M000 @ 0 R C0(0T H0 0 0 30 $Ѝ0)>PP % %G-p!P1M ࠐ0 E040$e@P90D W06p;t0& T APP   9T0@To0U@U@  0 0 4 30 ܍+U@UU@ 0 PPMQ߽Jpx@|`pj$#- M 0 Ѝ@-Px dMt0p @`00\00 A0 (0 0 \0 30dЍ=""0 ,0O- M@P\@@0000H"  @0\@9:E\l`@; 6obAP p..pH  - p'TPP`ep( Ppd $0<ϿL獈 gq!h *h .' 2/@)@ tDPpP:a5_ @& @@( +@,`@$ppx@n4O `% "`P`!P `|}`&i8` P.*P P%Pmgq1戠 $@)$@] @$fa0@':+,M eQ !. &p ,,7 ) 4dA`(9% `& " *o  "͌/``((``*   8_n !8``P(**_+$ꏠ,뿠p'* * p' !ꯠl p' .  pp@ "p @7$@$0(O *$(ꏠ4`뿠(`** &)8`뿠ꯠ) ) &`,韠꟠,- `  *a ⭊(` ((`   . p' p'b! p'`& `&p! pjp'p}`&`0` P%P% " ` nP%* _PP0 ! ,0 $P0,@$gq @$@$$ 0#䏠 0#F %O0.0 `0# 0 P-`!,0(@ !@'⭊@$b!០@  p .pjQM0#p"0# `0#! * (0**dA0%0`,0#  n $0*-*0$ 0#a 0P ++ `P.@P%,`P@=*@b!]*@!*@$c1+o`뿠 ` `@"*.*M*eQꯠ D .(* * ` # `. dA*` ..- `0 %$`.0a*.= . $.b! `P`P*,] . .$ `@0`!.c1@* .M ."*eQ$ ```& `&`&䭊 #!dA@@(`  @$ @$0 @$/ @(  %0 " @( $0@$j@$-?@40 ` 0.P0#`P0$ @0#a 0#@ ]o8``*`&b!`,@0.m)(!0# !eQ០  p' 04捃0 p' p' 0" 0,p $$p *8 p0#fa *% ,h aA-| HP P,0+++0b!0`0` a)0(0 ** 뿠꟠<%4P*P@P*&8`? P0P 0*` *P0P]o `aa0  (. 0.$/0 0 $0@ 0,eQ= . .aA Ϡ < * .a.  c1 `  (-` (. .8oP$`4P `  `&`& ba@ *@ " @a "O  0 0(@@%$P@$0 $00 ꯠ0,`A  0(P0#a- `<0#`%!(  P PmP*0b!P( !!؁ "0%0 0%0?S@@h ?I0hS@H"p ` # * 0S@@:p`F A&I@-@ M1`P 00 00R0 0R1130 0~? S pp 0~? S U PE "0 0R1<308 (0 0 0 30ЍHth \h X  0 0@-PQ0$M000 @ 0 R C0(0T H0 0 0 30 $Ѝ0)"PP  hg G-p!MP1M ࠐ0 (E050,eP:0E W07A;t0' T C޷PP!  PT0@To0O@O@  0 0 5 30"܍Ѝ+O@ѷOU@ 0 PPGQ@+pp@|`QK( H - M 0 Ѝ@-Px lMt0p @`00d00 >0 (0 0 d0 30lЍX  3 E7FN v$I2 A0 13L /O-|M8@@P  @0\+L E< @08p,Pd0p'0 (`@p @ 0,phzP P,T `0#dk0@ˎ@@Pc9@' !.@8@g{DhH# +  \.c; PPHklˠ$P )`L ``d`&靇` p`@P+ P%ip@P@Pk@$Pg|@ 0)0#T0a@舌R0 00//@-MP `@ p7pPU0D>S 0!31000 7Ѝ>SL 0!31000F00F00/-p@-M@P@U0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( $ A x =QC #XA\#\ !  +A /qR   /R  +S -S =S0P00@/R-@+"     0000000@- I@@0RuS#WSPX0CSF5 +0Q0R \PSPQP\     0 T 0+S -S0O-LM`臟V 8@(P 0(0`,00040剭/p- ね `{E @ ?tE@T1\7 `000000" 0 pa0HSt_rqpon9lkjihgf,dcba`)HE00EE@`@E@LЍS  "=X  R"   P:0@$`*E $?#E R$ " 0务@`   Y 0 S:$` E@ $?E0S 0"0C$`0X W     X ,X +X@ 0-S0=X00|$00 0P@ X B R񏐖}|d]hwc`S  Z0P$`D )?D RX$ " 0务@`   3 =Xw +0HY?o20S Zq 0W0 X00@ Z$`vD P>nD0S$$0"" Ⴁ@` 0 T000 ~W  z ;xI?vI0t0rW  n |0S 0 S2*-/ +  @ LЍp'}C~p =X  00$`D P>D0S "2 @$`x}$`C P$y>C0S$ 00C`01DsP~C00LЍ 0Xp+P-@ +0B XR R  +0B 0+R XR  -R  X@PPQp-M0  =-p`Ѝ0P P C C C//o`/00/00/00/ 00// /0/0/ 0 /0 // /A-@pe`O2+PK2U PU  0 ֫PL@P PPr[P X000p@000CP53BP,4 ( s 0p@-0P`@T #@T0rS Ppp@P0+Spp@ӫѫȘ@- M@`PrP 00p@0p0 ` @ Ѝ00pߪԗ@- M00d0P0L10 0  <100S8럫p@( P 80 0 00S3000 Ѝ{0 0 @y/fB@7d0 00S d00剪凪RB@ Ѝ( t8t( ' ' ' ss@- M8A@! @0P0 100S58p P 0U0 00S)000 Ѝ?㢫Bx0 00S@ `0020A@ Ѝ${|tdr$rr@1@!0@-Pp M0S) 1@T2 `0`S@% 0S|V00+ 0S$`A0S' ;pP cP Ѝ|>t0@T0S \4AP00@,40 0 B4th qppdG-HM`00 0Pp Jp@ HЍ@ XpP 0  p 2p@  HЍp^A0S @W!0P R@O- G1@00P0 (0 40h0Y4P0,0`  <0000S0` LTw 0 <`T00V0S (04!B3T0h0$02d ``0 `DC0,0@00g<? Ɏ1#00"`V<Ѝ200$020$0~20,0000PGU%UE d@P0L0@P@P|2@TPR0` 0 $<`P0V0 S 0Sq(0S0d < `00$0 0,001#0! `S8 5HR1>O0 0P00R5 S0  (0040810`0d0P(0040- rd0(0P040$;00Z@< > 0   1  PtşO-pl MMM`T㰐D0>(5T002*0*U@@ R R0 0C?o2000 0TU0  S 0E0'0S0000Sj̐d+0 $06 0 @z 03/Yy 0@ 40000,00F(00 3/ P   0S00*  0.S 0S R V: R  R , $0P8 $0* R $0]$0P ( C Q1/ 3 C10 00 P000 0000S 0 P.80: S*0S  $ s00S 0̐@ EY@T $0C 0s00St> 4/P= 0:0! $2 mMލЍ00f 0  00P0: n 0.Sk0SV 0.SeR Rk  0@0+  2/0S  000.S: I $0Pu $0 C0,P' 00=0 R B0Q 0w0 [Z=0/ 000  V4 O-`ppl"KMM \ؔܤ $ 1 //\P @ P\/\   W!1 0 4 30oKލЍR7/\2^*P`W0/\ \@  @PP 0   R  A V/R  * R* R 0 000`  0P& r  R@ (0 3/0S0: SW/00Ɓ00Ɓ^ d0</0P0PO-@`,MP$4M0 +~S, Z 0p$ S  + ?[ -/O]*O O! O/OO  *S1 @s000S ?S! [S!^ Q00@ S000WS 0G Y, R <@X 0Ა@< 0 0R  R* Q Რ@   0p G0 0R/RC00 4ZS *0G, 0;RP4S 00C PIR*0S0;R @G G0Wnx P +@PU x;l",0  2 ۍ4Ѝ@P0D hSp 0]S0!^0000]S  s000-S]Q_ q沰0 ]S0@0 0< 0:  0BXm 0RSjBXg RQd@)0 Q@  0A0 00'Q X;P[@ 0p$ /0PcT*0G, 0;PT 0!^[00  @SIS@b]L$ O-MMQ@P8p`8  @ 340S @\ [\ {\ }\^! N\]\@ \ xލЍ @ ]RRR @ QP+[S0 S]S*SP[0 P{S &,S^U ' B0S00 &0[ 00ލЍ0]SS 0]SS }S^NU  E  B   3  0A- M`Pp 0S0 0+{\ @\ {\@0 pHP  Ѝ Ѝ0}S0S ЍA: 0 @-MP MP`0 F0000 0 0< 0 ; \ ^00  ލ Ѝ; R@B @T \T p\@WIލ Ѝp@-`Pp@PT@DQ PEP@DP t 000p0 S. *S8 ?0Cs\#S 0 P/0S /Q0 S 0 0/@- 0S@#S@3 S S" S 00 S "S.0 ^\S 0000 S\ 00"S 00 CQ S 000 !10@- QMP M0 @ 0500 ,  j#p @EO 0 00P p \0 0 5 30 Qލ Ѝ0D8  0P0S ij ` s 4sG-Mle h` p#S$r9 006P@$ 0S %P @ 0SV90SЍt `p/@0S 004 0   0Sy ltlpp0fS0fS 000S3R0S $ 0000@SX 0oS 0oS0nS 000S3R0S # 000 1P 000S3R0S \# 000H 0P 000S3R0S # 000 0P( 000S3R0S5 " 000 0#S R P@0S00'P@@00Ѝ0 S SD 0P 000S3R0S " 0@00o 0P  0P0 000S3R0S' ! 0 00RܱЍ 000S3R0S P! 000<@ @0S 0 8@  a0P =Q_'  0P00 O0P=Q 0 0@ 0 B'  0P00r|(rqD qqp \pP po DoH 4 n, xn\ n m  m0 A-0` P% gPpPps@T 4P $P 0S 0P@00PP0P8040%@4@L0 5Y0 @0V@S0S0  s' `00C0  g' @7@4@1)@{-ꘪl  4 HT T t @ - M0ˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpFpP VP ЍpbaG-p@`@0S%@@Q0)̀\@@\ 2 P p0 R * p0 p0 aa`a\ap@-p`pP`P_@T T0T0 R@@SpᥝP00H=`l`=A-`Pp@P@:0S |@@r0 R"@`,@N-yP0040@4=__<@-K 00 D_C-`\MPI(@P- 0S8|0V $"  UpЍ  ㋮0P  $ R%ЁpYT  0N꤁|0|x|0R1 0QG Br&Q&R-.4 ꐀp0 Wtqd{ SzڙHv X ^^   l   P P O-BMM5Pu0 %p05 0 0 0 $  G C+0 fP 40 4P P@\ P 0S l400#S \ P 0S 4d44`0`\ P 0S d4`0`\ P 0S 3 0   \ 0P 0S xi30\ 0P 0S ki`30X3@ETcP0L`+ i+@\ q@P 0S /P0[[ ?0P200xS0xS0Sd "X2 0 4 30BލЍhR@P\ ;Pl 0S <200#SE \ ,P 0S 2R0P\ PW 0S 100xS0xS0S" 10 0sS)0wS&0S#|! x1xQ0P \ 0P 0S hD10\ 0P 0S h10  ! 00P00 $[ 0000 00Z/PD ț\h p\[ [L `[([ZZZ3 7 Z  xY8Y YXU X| `X,X XW WWxU p@-hPP0S P@L@@p@`@` 4P@ණVVd  R A-P`0` 4P p@@D/P ZP@0  "C0 ᣘp@0 0/`-0P0 00 0`[0 ` 0ȌpO-M"0  "  lp a @T ` !1 0 2 30\ ߍPW 0  Lp L  `P: 0S;p00Pa`P* @@0  7p@ 0 P 0PpW*P< ">0  "C0 p@0 0/`-0P0 00 0`0 ` 0HO-M"0  "  ߗp a @T ` !1 0 2 30\ ߍPW 0  ῗp L  `P: 0S;p00P`P* @@0  ᪗p@ 0 ᏗP 0PpW*P< O">0  "C0 ቗p@0 0.`-0P0 00 0`G0 ` 0x p@-`H@P@ VPpPpPP $ p@-`H@P@ PpPpPP p@-`H@P@ <PpPpPՖP l 0 00 ZT-H- M0 S0 00 0 00 00\100 M\  0S0 8 00 0 0 30KH Ѝ/-H- M0 S0 00 0 00 00\100 M\  0S0 8 00 0 0 30KH Ѝ/4 -- M0 0e'--M  ?--M  VA-`PdpQp @Q ~PD@( 0000Ac0P R   0// ǟ 7 O-,@-)00 0S@A>%!Ed 2 Cr0b0aR0cR0A1R 00$I"I B``C/)P( L%@  @ `Q0"G-@0D \ͬ ̬LP `L,@0L0D QW ^ࠓࠃ Yࠓ^ S\!:O-p(BP`C$ @ ;P PXY  P @A-`8 41Mp,0@00S9 @200S ^P#P3@,,000R@0  x0 0 2 30ߍPP @@ @寵(@0$0nnXmO-`PDM 0 ?㓤EII@0 00 0000S .4 @p%S P0P R0`S00S S00. E `!bK/) P L@"(@bQ3:  @bQ#3 P-4 !" P0000 00( 0%!E0#a2cK?)P( L%@##(,"@cR3: ' @cR#3  =   0 "!00C0 00@ P 0R PRrR0@ 0@mWpi%0KUSd0ba`_^]\[ZYXWVUTSRQPONMLKJIHqT=B->=<#:87-,+*)(Q4ih".z%1c00000; 0`0Q `DЍ0PP0P000@0(p,@h08 $ @CPp" p9P& P U$0SA $ 0(p,@0$@CPp" U9P PU$0S* $ 0 0`0000V$Wz[0P$ 000 GR. +R -R -0 `40ppS<:^ >@S4R 0c$00 0(00`450 `0rU0[0040000000 @Wa0`^ n144 W400C0`0Q0004c0 `0Wp AW?0 007 0`0P0P0W%S,=W) =0 s`0o WT 0 ;0 P 0p\0 S 00W00`0 00O 0 0I`00 0000 0 07`0000/c0 4*0S`0] 0d 40/"b2#40 0000004c0 4 0dS40v>C 0C40`0  ` b040 0 0PP0P000000C SX`0`0W0S 00$0I!$0P 8P >!P  8P` 00`  00 Sl4 W2# 0 dWb P 0 0 S 0p`0SQWR 0 0`0G00<450 `0  044 400C0`0/000}7 4l4v40 v>C 0C0`0000i40 d40/A!b!b0C 0`0# W0 00  RV 0s 0 p0 00 00@@0v0 PP   B0`b 0$I"I/A!b!b C0  B UR ZR^ R   @T P10(00 0$0 0 `(p,@PW0` 0 `(p,@PW0` `4, E `!bK/) P L@"(@bQ1: 7 0@bS#3  1 0!" A!0  40DSd040ե0 MRn 0P^ @ zR 0 R#^ R z K /o0"Pz[M 0P]lU   L |Խ 0000C80Ϡ< 0 B R&̼ | ̼L|@$@0[o^ oO0@`F_O  0 OG0@D V}080< 0 B R$@ 8`P 00`00S@ c0 TR R3  `@(0 CR}  ABLBq`| \V4JR{!P 000 0c$00(000P400N!S6uSs1?cd0c;S40k<0#- P0P000@V@ B\ NB QM b $ P00> 0(0$ (p,@$`(p,@$`400 @/ R, @( R 00@! 4`0 pp0P 4 P 0000C! ( .$0t0`tp p0 0P 4 P0000C ! ( .$00 0Y#0`  0P 4 P  $ 00(00c$0B 0 0 0,Yp@-P 00M `00,00 @  P00Q Q Q # 0 x p0 0 ,0 300Ѝp ,H㑌 ,H㋌ ,HㅌY|X0@P/ P @/G-X# p`V@P0PES  R D PE0V R  SS0@0D@R@- 0BAs@ @ Q0C@R H"@O-` M8 VPA @P;  3pP< ?001Sp Y Ѝ00PP 0 0P 0 0 =00 @" 0 V0@-RQ M@@ PP TU &"0P Ѝ0: Ѝ0" 0 Ѝ0G-p!|1M Mp0 050?PL` P+p> @P<@^X0pA 00tAl0O⨳00 TAXA\A06qύ$@0ˠP (@ @, -@P |P p `0 0 5 30ݍЍ@!@00!@00{TTS0-  =<;c9876543210/.-,O*('E?$#"m `WQKD>#T 0 p0A0002000N 0@00@D0@000000000\000000 00 00 00 00 00 00cQ`dQ00dQ 000<00 0000 p0000 00I O-P` MV @ p@ 0 H R2\L 00`V 0SS\ 0D   0 T 000 Ѝ S\0 0L 00 0 0  00  ౄꨨ A-@ap`PUh /C=1"#BbaV7 0S$ RP QP0S! 1003/P P $@00V H!P0  $@߮W00 P100S) 3/000PP0S 000S) 3/000(ㆿ000`3/P VPWSP 000S=!PP00008 (ܧ  d4A-@ap` PUh H0#BbaV7 0S$ RP QP0S! 10 03/P P $@#00V H!P0  $@VW00 P100S) 3/000PP0S 000S) 3/000(00 0`3/P VPWSP 000S㘿PP 0000    @A-PPM @g`P} rpQi  00Rc</.#C="#2caqV/ pW PW[ $00Ѝpqp0S`100S006 81003/P00  $000Ѝ``0S 000S. 3/000(oP`0003/P 00Ѝ3/0000S = P0000 D \A-PP| @`Px qp Pf  00Rc</ "H#2caqV- pW PWV $00`qp0SP100S004 (1003/P00  $000``0S 000S+ 3/000(P`0003/P 003/000$0S {P 0$000LSR: G-P0p`00S 3/0Y @IOP  T0 0 0 0 Y @IOP  TT0 0 H H0 0p`P   /LSR; G-P0p`00S 3/00 Y @IP ξ T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  /0A-PP Q@ PP@pl`@P PpW 0"S ~P00P@O-PM M Q`0 0 Q /QE P.00G zPP7pp/Q/ Qq @0/SS.Q8 0E00 0C S$ H/0 D 0B0 0p 0: S-  S/ A/o" R`/QPPqV?00/0000 ލ Ѝ DR .QRV  u/RWp30娐# `0P4 00  R(0 0/Q0#0PVP/0000ލ Ѝ S`P `c!00>0000?0000  p@- `QRMP>  HA@00# P? 00@T' 1`0@ @:T `\ 0 \S 0@ S @ 0:S@:T T00Ѝp\0P dL 0 Ѝp 0 `0|-P :P0SP S:R S0@S0S S@P :RP:P000/@-@A0\  \:^|^00^0S R B|\ :\\0 O-M M7 'pĝ 00D40t4!S S \G@`V 0P 0(  YPP 00S D [ &  ~0 00 P> 0.Pv0 0 ` R0@p`0 S Wp :S \Sp S Spp p0Ti*R0+   P 0 `0 SWZp@ 0#SS  ^ P500S0 5$P0040000= pP 0:RPh P0Rt4< 00 0pX`P/ vV* v):00e00Z  0S m006j:SZ @0T:H @Dᘻ P @P`< 0:R` ` R40 FpG CE 00S:S:0 00H IZ 0 D0 @a ]0<PC00EpT@DpTg$0H@D pGPERP @pP$$P 0S ], TD0A0:(0P#2 0 D4 30ݍ Ѝ0 0 0!&PP@ /PPz @{2@00S0- 0S$`嘻 0SRN @Ꮋ@00    <@z00S00S\S00 R{DA P0S7\S5 00S1 :S000 0 Sc4S\ A 00S :S|S0@A@ @M0S't!D1 0 8 30H ލ Ѝ  @P 0 0 C1 0 Z P *@P  @@PP P  @0 0   0ȨP 6 0 0Pm @j p%d\,% |D "X84 p@-@D`P` P 0 0$0 0p@   X,G-`= r@P d@PP 0:SS   d: p \S0@* QP 0:SS ^S0S:S Q0@0P P@ dP 0Pd:SSQ @0@A0n0S:S 0 Cr^6B C2RBYU?PK<;:9876?432802.-,+*)('&%$#"950+000Cs^/!000Cs\@!@ @0 0 @0} @pz 0 @0v 0 @0r @o @l0 @0h PჸP@ @@ @ @|U@ 00wA-P= `P7 dupP9 0S:S0@@c%0:SS   \0@AdIdP p\A@A p`8pP@`@@@㷸 @ 00p@-@# ^P 0Q 0XS  <,00AaPAs ^U70AAAW0A^RppO-`d pAMX# M0 S ( K @/004 PPQ P4T   {00CS6'43210y.-,+)('&%$"! t 84 {84 {L {0:S 44Ss0S00"1 0 (0 30o K@P( BK4T J0:SS 0&100$ 8$   RBK@; < $0I<$ 0/C0$ 84 $0C 0$C(1BKJP0u 4 R:R0Q1 A R0  0R!010@0M@ P  H{0:S044   00UKPG Ͼ000 h  j < 0 00 h-H-M0 S0@0 0 0 00 00^100 M^ @ 0S0L00 z@ 00 0 0 30KH Ѝ/~,4@-F$@@00 X O-`"2@ P0,M0$00d20 R\ 0A0p 0b YGP Z p P p J  J  PP0 S"3#:   V(100s# T$R , @$&x1t@P@l!00 @妤P0S?"8!1 0 $0 30= ,Ѝ 100S  V0s XpP Ƞ WP 5SX0(, UT00#     PP ! P0S꾽8| | t~ @-M(@;0@@0APЍD  { { {G { // =A z {{ {G+ B`{{ // =A  { { {G { //=A0 A  { { {G+ B`{{ //=AQ@-@0M P 0 0#$ ( ,0T P 00# 00Ѝ 0Ѝ-$M 000 0WyP$Ѝ-$M 000 0GyP$Ѝ-M 0 0 07yЍ \z cz0[z/C- 0sM @Pp0^ `010X0pA00tA呢0O͢P0P0P0TAXA\A \ 0 $@4 (0 0 1 30sߍ躼,T0-  <O-M$0?0`00301S01Y l/0h 0, ( 00 0   pP0(%Ypp + 0S0 R .> 0 3 30 ߍ P0  P 0 0C0 S!0A`0zQ2hPLKJk^~}{zixwvut0r,+*igKb^][w``YCT000`0C0 PD 0S 00 0B@00S0  @DT = P0 * P 00C0S000@ 0D S*v00D00 SL00`I8 @L,+< H  4  BPR (.\ 0vZpC0Pj M1W`` ` Pp!p 0P+@MQ^f\dZYASRNMLKJIH654321A@?>=<;:987654321(/.-,+*)(!  UMP00C0S 000pWP0  PS XR    0 $ 0$        00 0P0 0C0000 S@000WT @0 < P 0@ S0 B 00 R P00S000000S0K >. #RR @00T00C0 0 >. #RR 0 T000C0 S P Y 0 00+ E  `P B RV *P@NU 0U0`P0C0STV H*P@ XRn  B R PAR*P`  P@0@40 Y P:D0U0 S B? RP  Y*@@ @P`0FES 40SF  P 0@PF0C0S 0400Tw: `8<@DV*T T@0 PT0j 0$0`0P  i$00 p400S P0S4 0$`0 00000S  @P B RT *P@+ E `P B RV 1*P @ P 0 @P0C0S IU `P B RV *P@`W(00S H00S0WWp0CSP0 o @@PPMXYiU nU `P B RV *P@0S񏐮Q.0ASK0`P0C0S@ p< jP2V0*@P(UP0`P0C0S @p% SPV*@P0NS0`P0C0S @p 0@0<00 0C  SLP PXU@ @@H0@0900 0%00   $  0$  㰀   +  00y DPu t t Pd a 0 3P 0 0C0 S P `0@000<0@0<000 0@,0^T0400PP@0400D0b T 0%Q0>> 0P8>04`#C00000@ 000@ 0 00@090 0 0o00@0 0`0 0@0Z @40Sn@@@ULP  M ;PJ >PS40cS9 *P 0@PF0C0S0 00 P0C0S0R*P00 P P0 P4`V tP40@0 P 0P0C0S Y*P4`V UP 0 0C0SP0R*P``eSꇰv00D0?L0@a0@P0C0S0T *P0`0F PT* 0@0P PT*`PTXpTP`$0P$0\5000 00S0P0S$T@ 00 0$@P >. #RR  PR  B   P 00E P0>>03SS 0PU0C0000P0002 0S RP PYS Q 0$@0 0000@0 0CP0P0 8PV* @PX 4 ,P4 R*`P  P R*0P00 cRP  Y,*P @Y`T$@`PPP0 LP `V0C0P0P  0S P 0 $@0 0P0 P0PC PT*@PSlxTPX`$0pP$0040 P >@0CIv  f0 帯p P p0S P0SY4Y 0S0 00 0 ᜯp ᗯ>>03SS 0S0P0C0400400S sPUVS*0P0`@0  0 F ዯPC >`0CFvo 0 T 0p- P p R`408>0 BC  Ev 0 嗭pq P"U@DP# 0S0%TU ~P0 T  P@DqP Unr0C P hp U@D`0S0 0X0P S 7Y A-@P`pT0 `PUA-`@P@pB0P0 LPAh2pA-0P7 !@00S5 $0`1S010g C00uP0P! pW@0PA `PS 0 0 @0 C PC0000O Q  Q*RQ) <008 @    BP0IP00`0s0 P ;0?A 0B#@ # B0 P$p@-@P ewPp @-M$ 0@4/@PЍ@Ѝ\0 X0@-M 0$<0@4/@PЍf@Ѝp0@-$̜M $@4/@P ЍL@ Ѝl0@- `@ M $̐ $@4/@P Ѝ/@ Ѝ0@-$̜M (@4/@P Ѝ@ Ѝl0@- `@ M $̐ (@4/@P Ѝ@ Ѝ0@-$̜M 4@4/@P Ѝ@ Ѝl0@- `@ M $̐ 4@4/@P Ѝ@ ЍO-Mp`@@D0PX # 0SP $̒0  ;/0$ 0H@ 4/@PЍ@Ѝ$ (@- @MЍ @-M$ 08@4/@PЍi@Ѝ\0 X0@-M 0$<08@4/@PЍP@Ѝ@-Pp`zt@t0@p@ ᏙU  y@0 qӫ$ |&@ Y 0nO-,MpPP pE@0P0 00Eʿs00H5P`0000  @00! B b<6> @ BUP @ 0Q4BN3L0 vTvtsrqpogfedcba`_^]\[ZYXWVTSR]PONMLKJIHGFQDCBA@?>=<;:9876543210/.-,+*)4'&%$#"! #        0 Dr R R P R \00T3p00 01@000@0@PUI*,Ѝ $R \0M 0 0$pP S^@0?000  P 0J ZS0  0J ZS 0-00l10000 ,Ѝ0\  r  p0\  s  p0\  a  p0\ S00 p0 0p0\  b  p0\  t  p0\  n  p0\  v  p0\  f  p{ @埩0 P^ Y0\  @pl QA-@p`P ᠩP=0D! D?o2]R0S d0T"@=0 !1 U U 0 P0 AhI lI A-p@`P<P_T !0D S (0D,TS 0 ALI&23 $0T"@%0 !1 $I O-p$'S7WM P 0瀁0T106儡0401@0W y @!0P(0 b`0P,0 0S00<0g 980P P  T. (`000P@Tp` U T 0 1 #P0?0S0Y P_P P5%0 b(0@FDA T @! L`ϧ0P$0  0 0080S V L0$ 0C BP$0a  5? *00R  4` '0(0R 00 00 00 "00@\0000 tpT) (`,$@T$ 0 7/P@00$<,:(8<6$3 0 T1 30Wߍ@0SP@PR,00,ƨ 0S 0S0  0S ,0@D 000UM 0p`0 0 0 A aȠq04Ɍ`PPPPPPU PP U* 0 319<80 P*`0P00!S00S0 00 0@80@ SR 00@0P$忧,彧(廧4 ,2p0 G0R 0D 0  [P` 00S`* 0 P0`00@00L$ p $`.0a 0S 00S; 0@@;4qp%,qp"  㥦0P0, 0<00~s0200D@@ 000 0 Ea0 0 =a0 0 5a@[0@<0$0G :0Ѝ]0S \040. SЍv0$0 % Ѝ 0O-4M `0,0(,Pg ( R ,0pBo Rr @P00,0 , 0P 00,00, 0A /R ,0   0 00 $00K0L00000p00S$  0 05000W000p@@ v PP ,  0.Sf  0@P [@0 0,L000 0S% % R R,  B $000S<R\ 00  0 , R0@PS0B0 0H00CPS0P0@u@0,0 0|0 )PZ0 S ,  0 000 0KR\0 00 050S 0.S0 00,00 00/  00 0X {0Si,0 0 XS 00C 00 0,0S (0XS 0L0S,00S X7 (0SXj4Ѝ0@0,0 0[0@pW p?M @,0%<,04Ѝ 0,0 =@k 50540 0(0SV p4Ѝ ,  @/Q  , 0S  \R   B  0SL0S0 \R   B   R00L Rr 4ЍOv(0S@0 p50$0S{0l  Ps  ,0p<%,0q 0p5lgPa 0$0t 0O- MPp0ᠡ@Ph 0P(S,P~ `Pz0UP1S Q3PP]L0,  PR `0L0V{ PPP`V" T0PG  ,w`P5 ,\00 LP05XU0P`P``VXY000P!, RP , 0P 51 Y  ЍPU @ Ѝ?00;@00 Ѝ  ,0 PPX?ep,00,0,0 P PC B @A { 0p@-SP %#L R/@T@L 0Rឡ@T @嘡TP 吡,@ @㊡p(e0 fp` e{p@@dqT @@A-@Ti P,,e5S S%) Rz ` VL0Sw 5S0S@`T`FL0s ,0 @L0S,0 $0@S005` 0BSR@ @D 0R\ 5`V `V`05`V    ,` V`P@,0  @ P@ G50 5$ @T 0   0S00*S,0`]eP|00\p ,00/P Ws ` !00 00@SQ /0, \B ^0  @5#\,0Y! PR ,0<,0 P,0 cp(V 505x,0(dP;(c0@dP* (c@, P 05,0@<,0U0S ,0 cp( 505>@@=|0x x0 )Zp(cp,0<,0+~ 0%$0x 0%$0l v u ' ,' ' R%/@-f 0 A-L>Pp`Z@,0 <5 S; S@T @T V,0``<,0L0S00/S , @  Ncpp 00UdPUc 0 @Ecs x0x 0p@-@P0S 0`00S᤟p@,c(偌(~(|(嘟ĸt(1(0A-P (M`@P @Ppp 0 00@w P' 00CS(  p0 0 0 S0;1:(Ѝ 00?G0?G "00(Ѝ0<x$ $ 0 0 0Q/0S/S/O-Mp`@ P-TPm +T @`0 0Tj W 㙙 㙉 p噙I㙉A pǯ  0| 0 t P ! @00Ds \a0DSW0DA0DS70DWUY :Q P S \ *P"00 0U00S 0pS 0F0 0 Ѝ0S U0 Ѝ@0` 000XS00 C R @`0 p0 A BRWp pBD0R"\04 0Sp@-@PT00Ppp@-BR"^p@?@PT00Pp@-LMpP` @000FP LЍ`0 XLЍC-P!M1M `0p00<0㿜t! @PU h1 0S 㱜P(1   bP( n6s0@R P $PwPP 0 0 < 30'ލЍ u>i?F㨀R 0 P PQPO0SP @EP(̊(0nS8Pܲt8p@-``@@Jap@  P@P p`Pa`p@-M@ bp 0: S  2ap  ^Ѝ 0 ЍЍO-P-$@$M @zH300P0pS?o2p{$10 0x00w e00`@P T *@E PP` @ 00 ap@D P`0S9 0S00 !  pY* 0   W 1V0@JT@@W5ᲛpP`0 `FP`0@ @$ %$Ѝ0 00 0{00S0@p0剛P ? 0000  00 q0 1`V 0 0SZ` V  G 0P S`֜0 \`D`pw0  @<p@-P 府 @T @崜T0 0p  O-Q MP  e`pV1 1* @ 7/P 0 T VK:0 0S0 ЍO-RDM4wQ@ 400008P P$ q T0000(0t4` 0@D  $P0( 0 0@ :/PppV*000k000 R`c,@ `0P@P `U :/PQ 0Y` BES*0p P@0PU* E03/P00 S 4 00ZpE$ pp 0  S ^0* 4@ 0 ,@0( $@ 40, S ,@DЍ$4V  W PHP0P@ ZV 0p'Sw0( 0S 40,000",S00<0 00  0( 0,00S$  C00(0  0$ P 0 00C, 0 0 0U00U0#Sv `:/0P @@p`pS:/PX @Y0V0 S0 T 00T0003 0RP00 R0#03Q0S P0S 0P 00C0C 00000 0(00 000R 00y 0SPp 0Z:0 J 3/P4 00 @PJ$ p'PP 0SIW0 `0@  S` ^0* Y`PP @ ꉐP 0TT:/P@P [00P5P10p1 * @:/Pp [:P0@V0XSZ 0T00T 00 03P0RX0 C0T 0T0@D @3000@ U  00?P @IT @00:/P 0TPP@pE Mᛉ) :/P p PU@0P00 C0T0 T0@D @3P0@R 0 00P R P0 0C0C0  C0P 0PC0000 C0P0 C000<0, 80 ( S1 $0, ,0$ ^P( 00 M$8 ,j"\@00 $0,040$0@p@-@ PU 00S  RQ Qpd0P 0  P  pH0H 000S@-@(孆0(@ᧆDtp@-M @T TPT @TЍp0 Q 0QP `` 0` P 0 RЍpA-M@P`p0S$00;0 0`  ^P- p0 P' 0 Q 0 00CR0 0 U S R 0S$0Ѝ$0 0pP0P 000S@-@(0(@tA-p`@}PPy0 00S (P   (c0S `nP   R0SN(ՅI0SE@脞tp@-M@ 0 !4P 0`PPp@ Ѝp@#0 S@`Ѝp8ŸC-p02 MO0Ϡ8P00051E@`la<`Bdd `d@2aCd0SӤ R@PW6!1 0 0 30\ЍTӣd@D0R /S  R5 U*,!-00Q  P 0S0 QPW 0@d 0 @/0pT @d0 @$U*0SP  PR 0C0d0  0 U*0 SP  PR SPt    O-M,? (/ 0 0000$ S  )㏂LetaEIrI((H,  ᫚ ᪚Bp( Z 0 @00S %SP 0@zSzxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPOWMlKJeHGFEDCBA@?>=<;:9@)Ce/.-H+A)(1 4Q<Q# ~W: Zn D,4< 0 0 30ЍP @DH `8 ϠL<0#lΠb(@l4 ' 4P @4 0 ^A!/3bc0m1#c[n13:0cPmn1013b.c0 mA #c[ 3nA3:0 c2nASm1@  00CL``C@ @r  ^<04H8 VS gS 0800 200 S 0! Z J 0P Q 0      Q0 S0C 0 B900|P/A!b   冄 Z 0 S  R 0Q  @9 B00|P/A!b   f Z 0 S  R  0    V0Q  80 0|P @ Zw 0Zr  R l 0@    0_ c0Q  70 0|P  ZL 0 SG  R A0 ( Q7 /00|P bbR   Z, 0Z'  R !0Q  70 0|P ܃ Z 0 S  R 0Q  60 0|P à Z 0 S  R  1|P(0   D& 0 娃 Z 0 S  R  1|P0   % 0 厃 Z 0 S  R  Z 00ZC000Q  `5 0 0|Pi Z 0 S  R  10 |P$ 0( / bbR   H Z 0 Sz  R t 1|P0   l$ 0 . Ze 0 S`  R ZUPUP00S  ZJ 0 SE  R ?UP 0  P   PP0 S0R05% P|P0P00T00X0 0\00`00d0 0p0E#  Z 0 S  R  000 S 0 ՜ Z J 0R Q 0d00!2 C0C0bSӢ Rӣ?d B1|PR  b0  勂 Z 0 S  R  0z0|P 00x10p Z 0 S  R  04    `0|P 0S0000J Z 0 S|  R v Zt 00Zm 0    1`t d L ( L X d  p @ p L   0   0S7P `^~qp0' ~qp 00P-0$ 0 0S! -R? S10 Z J  S ` QB,1<0(|P\ "`0a!"   威 Z V 0S0 0    O g 0    0 l000` 0S `Pi| P Z 0 S QP0l 00 00 S0 1h Z{ J 0Pt Qn00S 1 Ze J 0R^ QX# c# # N<04 H8 ϠB!l :8YP YP 0S SuXP p@oXp0p@/p@-P@wYPp >p@Y Y0@- MP@UXP Ѝ0`YP 0S0 0YV0 0S /p@-P@2XPp>YP &XP !XP p@X0S S  /0S0/ R R  /0 /! / CR ! / 00/ 00/ 00/0 0/ @-/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1M Ap0 030<>SP7 PY P $!1 0 3 30>ߍ(3@ R/ R  0 x p0S pE0%  0 x 0 x  RP @ R7ghg`  O-IM,M@PJ `$pPI=$0 0S S  p@I=0$$0  2 Iݍ,Ѝ RJ-  RW#  J=000h0} K#0 ?s0x J- 0SjJ= 0 00SN S UVV J=00p+ 3* 0 00嚟0I0,0OP @'0Sn0S  0S0s S0S J=UV0  % J=00piZ\ O < ARPa 0S o03?"R?J=UV0  p`p^pZJ=P0h0 K<0K K K K K C$ 0Pk YJ=00 R00J=  00~mS Sn#< jJ͍0 pp p 00STL2Sp S SJ=00Z0  QP pJ͍iPpfe t O-`$@4M Q@p0DH 00010P0CS+p5('&%$#"! 9QWX000S R  R RQk#3 0 0 30Ѝ30030H 0 D@pЍOkWX7 0? s0<# *wpP#T!0SN0S # ?s0qDwPT QWX00VTDpVT 00 |"0 v [X* P 0Sz "0 vT@@? 00!D vPTp!0 viT 1i #zQbP|0xP p0X! 0 vP030#?W@D p0W0 0 v?P0#S@DQ  Ġ0⼐P0 0pXp@D 0m   nvT00? \  bvǏPaT`(` D x P  $ H X G-`!p1FM 0010% P@p P  RW P Wv`ov` 0@Sp0 0 0 1 303Fߍ0 00ϿP 0 0 0tP Y: /r RX 0S .P 0 B,\h[A-@ 0P`p_0 { 0P p@-MP`P@@P@T 0S  R0S @aP<PЍpP5PЍpp@-@9ppPP<p0. SAA0Cq .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0Rd!0@-$M""0  AS0 0S  R lQ  hQR 0S0\000$Ѝ0\0S S!0S-  R  R R R/S /0S S S S S/@-/ 0  00S S/ /0S//0S 0@- M@PP 0PB@0S0S 0S Ѝ0/O-PM@"PdET 0 ꦌQ PA-@h Md!0 S  > S0  0`V " pP Q 0S @ T S   0 SQRp`Vp h0 0 0 30 ЍP` 0V C 0 C0 1DON@-`QM @PpQ Q Ѝ RR cPP)p0U R R  P0R  Ѝ  R RD0 P 0  \? < G-`@p PP  @   @!O-P-&MM͍@0 ,,D0=<0!\0H08* 0(,  D; \ \0$0,0?s0PS_,l0F0  : 00 SpP00 $03/P = -0 SS00R0@0Sk |Y0 L0D0uPUpE Z7840,'P0> <@X T00`0  Z 0 PEPR@P^00 $0 3/PU @ 0 0SS`PSMSX@0S V+ =0SVVV !VS VL Kp!P0S40S L0(@VH0C00LD00S SH0 C < 0 0SP< 84P[0`E @T u0`Pp|p0 ƒT4 @0  0 (0|x⠕SP <0$r /r 0S S000 P0S< ፃTU LE0Sx R00Q @=h$<0  2 &܍ЍR@00=0SQ  F'VR1!pW: X:40$0L o!PO0`S`V 0  00(%$50 5s 40S7 (@H0C=00.XRC@2-=@P#D0 P@%G0SC jP001 0 fP}^,CBO-@`MpVP 80 SN `P P80, H B CT0 A C0S: S3 S 8P005PP& P$ PЍ0,40P0T000pLp800 Ph t0P B C d1d`0S 0Ѝ0p00p4080(p6P d1PH \0hT\000  "  $ &    J B R!  0 cP 0  p PP0, ! @0004080 C08;0P區0X0d1  d0S^d ` 0 0S (ث O-`\"$MPT2 L@0 H000 0@p6P\ @ @ @T \P- @ %GP @!1 0 0 30`$Ѝ0 SRG SPC 0 @P.0<00S @ P 0S00SQ  ,P  0@P000SPP U@@ )P@ "P; ':( P00\//$ p@-@P@P TpO-M/0P? PX@0x`p020  " $  E    D F Z$ 0S0S p t@T P@P T 00.> 0 2 30ߍ00|0 S0$00$00 5pP$p >$0 P0,0P@(p\ l5<2 L;20\0|0 S   S  Q  RQPP  XPZS|0R0Q0S0 P^㄀S_ 0 P|Q ,0 0S Q0S %M0P40  !P8m 4 0 B  Z0P00[XX 40帠4 <@@P@D`XH 0S0PS  R R  R  `P0  0 :`QQ Q`0S0Sp;0S^ 01@>pS0$00|04CD`8g~00SX\!t0(S P0S< xpp70*@,: ( $*0 , $0 *40Y? 80< T 0 d342 D;2P |0SM0 S F SRCQ Q : \Q^3?oR@@20S Q0P pPp00 8 00`040e?0(0V0@S񏐋0S Y@TWt pYG Z 010 @``0@`TV |0P0 w帠 p 0~@@PP@$TPP}t0S 0S }p t0 0| 0PBP$A 0 gP"| R 00S Rxc  P 0 M0P00 0S PpP,p$`00|@T0 ,p$``⹧, @P1x00x0 {꿂P@0T00T0@{P 0p PO-LMxPta0 `@ C   PP000PD pp R R R0 T@0Pp ((0( P00 U pWpW 00 ጂpW0S 00SU$@LЍTꄄ | G-`MP  `P pP @P0 D0   3 0P <0S0- `ЍpPz 0P z@D@OP <@PJ 0 t O-M 1L臇0 0, '?|5Olň0 0 "` (*6 7D,0 0* p,608Jj0 0 !$u 0"F}Op0 0#(p 0* Fc5   +,p!'D+H뼃 p p'0p #)L4gzOL  "+  \H' 0 ,8"0'Flł 0 0#<0 "O< *@p,yJj  !! #ഹD  " D  bOb% 0! 0 0# 0@ @L= " 4, Q^B˃  #0! ધ 㶩Na  ,  " ]/Mb& 0! 00# 0SD@= " D, 㡨M˃  #! ȫӧNa  , , " Bb& 0! 00# 0֧7L= " , դO˃  #(! ZDa  , < " Jb& 0! 00# 0 O= " 8, ٢oF˃  #! *Ha  ,  + BOb& 0*(6q7H0j 0!4 0# "1=F0ʊ 0" 0#  8=O0a 0*0# D:4J0$ 0,0# ? ;D0j 0! 0#0 `;6O0ʊ 0" 0#p< >K0a 0*<0# >8B0$ 0,0# 7:N0j 0! 0# 0M : " ,@ a *,,9 )M ā  #8 " ۦN b.0 !D*<?A0ꪂ0, 0#e64L0a 0"0# 0D)O4    " *Db- ( ৃ㔋Jl˂ 9p !|Opp0i0[eF 0#08p5``  p " l oHb-` `0p,}doOl˂``  p!meH``00(p 0#0OnoF5``  Dp " f,nOb-` ` p,ccJl˂`` S7Oe00  4p " 0b-0052:=K0 000# 0c˂2 :B P0 P0 !0# +N0, 0# `050LЍ3 E7FN, 0(Iv420A /0A-`!Ӂ000@@hPp0"V>0: V0hV@Hp` L0S@@:p`F Agp@-PM0`@ 00 00 |!7R8 bx b   D 80 0 0 30X Ѝp@9L}L O- MLLŸH2H" 0 P00  p4 0R @  0XS @@rQ<0`Ls00ᳰ T $. 0NrQ)T  0 s0aA0C80BS,!1 0 0 30> Ѝ.R ^W* 00RP 0GS0 S S Y >Q 0@^*0^0 48 <^*0 8<|pP- M_P ЍPP!0@- 0,M S $  @T/o"S R;/o"S R L 0 0 $0 30+,Ѝ0PP P B  0@!0( T $R$B R T0  R ( $Q CM|td A-p4!01rM @`P0X0100^pAtAa0O!b02?O 0TAXA\AsP" 0 hpP 0@dt0P 0` X0 0 1 30 rߍP t003P 00{x 0-  4  -- M0 0 ЍЍ/-0 0- M00 Ѝ Ѝ/ p@- M`@P @x0`0P0000 @X@c0@T  Ѝp  T P1! @-`0M00049p P@ y  L`9p 7@ 0 0 0 30(Ѝ7P@pW @@T PU 0SP@DT?@00L{ d p@-@0P$t(0P!t(P,Pt 0p0PP 0P 00 0p`00bP 00 0p|} 8h T}   / 0@-@ 0 0k 0  0 0 0 0 00@-P M @0s 00P 0 =?o02c Ѝ01 00 0 0p@-0@P 0U0 0pp@-@Ps0PPs(0Ps(P,PpO-P0P[ `ӹPT @000 S S0 S S l¹pPC 00 pYpp: (௹@P q0p00S S S@ 0A S  A▹ @P 0S 00 00rP  jrP@~@d @{ d c O- M`p@,0(Sz: (T^ TppV 00SR 0 RL@D@T0PG 00SC000@D@D0P0S, T0X  0!0J0@PH 00S#0AS0偰0!  0S000    0S& p0@r0ppr(0pr(p,p@ Ѝ rP  (,@(}0  Ѝ0 00@- M@P  0s P  Ѝ00 0 $$ 0 mP Ѝ02p 0$ $/ Ѝ0O-LM`U$`@P0 @@LPH$ppPD 0 @@?P9$PPU 0`Q QB QR Q( 0U 00S} bpP  `0 @0 p R  R/ RY R 0 @U pq 0J[K 0 0 LЍ   @ Q`A@ 0U Pp(  ἐ  A0  ,  p0p04` W G   ` ``@`` @U0@ @qLЍ0@@qLЍ `^ P@Q  QA@ PS ^ QP @  , p 0    S QARQ  R  P P@ @  AX % X X9 p X) T( QX X X0`` *`  `  `   `Q@@   P@U `p?lv 65O-`<Ppjo$0[p@ pPP $p(0,P[P3P#,PWG0-0(` 6QEU%PPV V* PV'`U$Y3W' 0WO #(`(R 8P P4PE2PE1PES0PEgPE:`uP4;P 0 @pW1!030#-05-0%0Y" #(`(R 8P P4PE2PE1PES0PEiPE߼8`uP09P P4 :0 P0 800@-M3p/ @H5p6 P0u0(0 @ |0@3t 'U 60Px  =P Ѝ0~004Ѝ03s 0 Ѝ034n 'QA-p@D P`P0 AS00m / p@-\ ,P@\ \ Q :\ :Ap, 0 p& 0 p$O-\MC @P0( L4 : 0rL;;$`r1-lJ^p1C0 10ᖡa0`   ^0 008` 9P 80 @N4ƌ<ŠaЍ 0 0 0@-S@ 3/@5@-] Qi7nIࠑP*i7nI P@ Np ^ @ `@D@P V% @D BD$ BPE&"PE@D"V%@D BH$ BPE""PE@DQ%@D Be$ B'"^ r N $`P@FPEV%@D BD$B E BD &"A@!@ B BA!" A@%! @'  i Q7nIP#@ Lp \@  `@DNPV%@D BD$ BPE&"PE@D"V%@D BH$ BPE""PE@DQ%@D Be$ B'"\  \ \ , ($`P\ \+ \' \) `P^ ^ NPN `P\ \ \ \ Pvlhd\XTHj lh Lh D 1 !0p@-`P0 000: 0 ## 00Cd.R 0@  0P0: S@C=P P pp0 P  00C 0 BPP 00t@0 s lr G-P\4\ 00@  p0@C0@ @@`@ 0@@@`v`V @@p` p 0@C0G'@@`@ 0@@@`v`V  `0@C0N.@@.S 0`00@000@ 0@@@E0C2S20/.-,+*)z'&%$n"! jc ZNJ2S2V0/.-,+*)J'&%$E"! D6 *%$000 @ @  @0<@afp''g`<@ap 'g 0000pf@00` T 0@Dd`00 K @0H0 h&0ಐ00@D `  0;` 0@- M@ < PU R 080 00yY`1S   ;`1S0 V0 0 zPL0 0 nP9P P bP&0 0 VP0 0 JP0 0 >P0 0 2P0 0 'P`1Sy40S{ < Pp0pW  0R 0XpW 0pW  0R| ,0XpWg 0pWb  0R4 00XpWHpWE 0 PS 0 X`1S   0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P 0 ^0p01 0S0p01 0H0p01 0=wx1p0 3ZjL GXtЍ tЍ 0 (/0 !0  0 0   00 x0 8 LZ Y Y X W xW 0W $U T T T xT T 0U U T T T T pT PT  @-`0 AM@M 0p 0 404007PP0S W@ 80 0 4 30AލЍ.3p t 0,@- M@ p  Pp7`PP 0S <0000 Ѝ00S.S 0S Ѝh4p@-Pt AM `0 0 $ @P 4 ,0 0 4 30Aލpot 0 p@-P@`Q  @Q TPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P 0`W00 ЍO p@-@MP`0S 0 @S 0S@V00ЍpO00@ 0PV00Ѝp\O 0@- MP0 @0@0@T U 0 Ѝ0l0 0PU:H@@ Ѝ0840 P0@ Ѝ0 @0@T U Ѝ0O,0@ 0Pl Ѝ0H @J \I Mp@-@ML `P 0 Q@0P0<00 0. 0MT @D U000T H0 0 <0 30 @Ѝp@Ѝ/T.0 r.m( J O-MP@ 崽 Hp D0` R ЍPt SP -Q0 0 +Q0 0 |30  0R00C<,00d0 0.Q 0 @ Tဆ 㘀@(0 0S #3 @  RQ \ 0 0S #3 "#T$&<'(`0&8 &d((0'<0'4` 0(< p 0(4 000S0`p n 0T0 0S#3 @ \RP 0 0S #3 "#T E 0T0 0S#3 @ \RP 0 0S #3 "#T 0 0X 0 0 0J   IA0 0 0 B    ;4 O-@Q dM0 R 1<Ͽ<  6 0@Q2/!zgO|20\0\]lbPAS0N0P0o<88H<Rο b%sedž |f|}bpA㣢2@0W0jEE0L02H>'3 pA#b<Hp8 d bD #"2g22#c"T X0 |l xl<tl[% H Y J XL ,D P0(H00 0$\@ p LP`84:[ eY dX ddЍ0 @0N\0@R@(@h x  0 0dЍ@Y 0X O 4D `: $C 8) $) ) @-@P0D .R S0*SQA@0T.S 0@-MP0P0@$NO 0v.  00  :Ѝ0B C-`@ MPp䀟@POP @U PP@Wy@ Ѝ W@P@p0 0000  PV ᬿ0S0Y@OoB@#ꄹ ? B C-`@ MPp䀟@Px@P @U uPP@Wy@ Ѝ @P@p0 0000 o P h0S0Y@OoB@#t G A p@-@P_00C0S S u P 0` PVpS`u0 0C0SpSr P 0 /R0@-M@  000!00 !R !PЍ0@-  0S&0@0Q R    =0H04S 0@R Q R ,@0Q Pp@-@@P@0P`0pp 0,0p@X0A PD D p@-` P@0pp0,p@+X PHA- @@P`p0p0 A PC-P0 M`p0sp@ H0  D@ <8 @Ѝ ?2 PxC-Pp0 M`p0Ip@ (0  @ Ѝ 2 P0 00/| P0 00/\ P0 0P8 PXA-pP0 M@P`0p 0 p0Ѝ P 0 07 Px@- pMP` p0p@ (  d@Ѝ1 PC-Px0 M`p0p@ 40  0 @Ѝ 1 P8@- @  M0 Ѝ PH0H 0p@-@0pP p@ꮽw1p8 P$- 4   Pȴ R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-MP(@,p 00`PC0S P0S7@000 0 ``0A 0ЍX 0S0 S.R 0 R.00 0  .S 0 \ \  0 0 p@-P0@S` 奵 00C0p 0 pO-M<@`PP+Y4* 00T/:R- 谟0䠟@  T-  ԫp@0 \  P0 P 0 0000Ѝ 80 P HЍ . D? D? - @-R M @0ASPAA` p00SA0qp0@ ЍD0cP Ѝ Z 00P`= O-MMp/.M͍x(0=<0 -= 80=004 PH+-4 0 D;00 ?0 0=<0 /P 0SP P㯝@08(0A 0 P00=H0 =,0L`P=-0 P0PhP0C0H;0H;$ A$0d 0>0 0 $Po$0 MPfZZ 0JS񏐷}=vs6pj- |na+HvEuX&%~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      I 0 P][ 0S .Ss 0Sp 0Sm00S.S`h0ZD =400S 0 )0C (0 C 0MP5D0 Sx丟@  0D;pD+0S0V t`〠0`pSM 0S @0D+@T 0Z4  0d  0 rP='<0  2 / ݍЍ话8@0(0 0 VPP0 0P0<=D 400S+.d D;0D;T70n 0 3P(0 C 0PH 40@ꯝ8@0(0 0 P D;0B& 4Q06d 09 0 PD; R\6 0 B 0$0S8(0$0D+0(000pCW``W D+  x4 VJ 0 P[Wl  0PP0 0/PHl5W 000#80H5 D0N0C0 . q . 0 0CSW0A0 PD;`0DkV:Z` 0D  P D;x$0F cD;d dd0`00 0 gPD 0d D 0 VPD D 9-0D+ D+d } 0 BPD+0D;`V spD;`V0D; 0d 00a 0 &P(00p,P`C 0 P 0 P 0 P=400SD ,D; D+  D `,0 D;0D;> T2 0Ed  0 PmP:D ,D;b0D;`d 0 0 PTD ,D;0D;0d  0 PAD ,d D;0D;L10 0 P.(0 C 0>P& `D :B PpPF` Ԡ `P/UF 0 0}P 0PE0GS = 0 pP H < << 7 g 8 p5 5 4 4 5 t5 X( n x4  2 2 X2 1 0 0 / h/ |- <- , + + * * * \) $* ( ( LY ( ' ' & & X' ' & % % $ # D#  X" ! d! ,! (  Y  ( l X @ =400SD  ,D0d `D0Dk@I 0 P `D :B pPWxW P `/Z F 0 0P0J 0GW Ჳ 0 Pqap`D D  D P:W 0 0P]+ZD  =400SD;d 4b0`00 0 PDD 0d D 0 P3D;p0D;St*b`D;0D;Sl*0d 00 0 P=D 400S?i+d D;0D;X30 0 qP(00p,P`C 0  PJ0d 030  0 SP'=D400S 0 $0C 2 V5D U5EB!?C0 SD 0 4P=D 400S0$0C D  0 <P D;0B$ PD 1ڲ 0  P(0 C 0PD; pBqW0`〠 `V D;1 Z2 = 0d  0 Pn(00,p`C 0 zPb 0 PZ 0 jPR  0 PJD 00CS <& =D400S0`&0C =D400Sa 0&0C D; D+ D  `}*: :J:D;0D;0㪠Z 0 PU D e*`D D `*D,7( D0`(` 0 dP V5D U5EB!?C0 S3 0 QP%=PD40   0 @P=400SD *`D D *``2 D;0D;\80[ 0  Pp 0D  3P h D;` 0D  P 0D  0P D+0 D; 0PD  0  P D; D L  0Ps(0 C 0Pj=400SD; R -4 R  id 0`00 0 PGD 0d D 0 P6D 0d D 0 P%D;D 0SS(0 C 0*P  0 }P D D `)D;D [)D H[D V)4  0H[D;0D;*7=D400S 0d 0;0 0 MPD`VD$  0RP̠p` J =0 H+0!H - V 00B- H 0D;D 0Sp  0 P(0 C 0P  0 PD (D;l0D;`d 0+ 0 P}D (D;0D;0d  0 PjD (`D D (pD D (p`d D;0D;=0 i-4 R 0B- -4 R(0 C 0QP9D 0S|CV5U5E!?C0 SX 0 Pk#=H+00!HkR- 0B-`D  Hk0D  0 wP=H+00 Hk2- 0B-`D  Hk0D P? 000#80xC D;0B/ 60/0C 1 D;0B/ +00D0Z:@H   0 .P3Z  0 $PD;`DkpW> 堯 0 G1;D010R!}a "3X/ 0;D000;D020!20;D00030;D0S10;D0100;D=0;D 0 PoDk`Dk0S>00 0D;D+0S0> p〰0pS5 0S `D+`V 0[6 0d  0 P8 "3- 0;D000;D020!20;D0000;D=0;D;D;D "3t- 0;D000;D0200;D=0;D;D;D;D,- 0;D=0;D;D;D;D;D;D D;0B, T` lpPWW4 Ȭ `P/UF 0 0QP0PE0GW  0 DP0T,0C )$'PD D '`D D 'P`P2 D;0D;;0Z` (pPWW ī `P/UF 0 0 P0PE0GW ͮ 0 P=H+00mHkἮD;0 A`Hk   d D;:0 0 PhD; 0D;S.** `    @D+@p [ 0 PK 0d ` 0 P=K`p@ D;S: 0 Pr*0)0C 9d 0` 0 P0SJ y`D;p0`SD;0D;> 0d 00 0 mPD  0 bPZD 0S0  0 qP) D;0B( : 0 HPf 0B( -=H+00HK =H+00&@xD; p0D; 0`#P8d `0P 0 `P0 P 0 PD %D; 0D; 0PP=H0 60S{-   B H+0 H;0QPj 0 PbD %fD; `0D; 0PPS=H0 0SJ-   B H+0 H;0 P9D 0 P1D %D; 0D; 0PP$=H0 0S-   B H+0 H;0P  0 uPD ^%D; 0D; 0PLgP=H0 PP=-0 00C0H; 0H; 0MP0 P 0 =P 0 4P`D  0 4P 0 &P(0 ЍEM- (040 1Ѝ03//A-PSp`@ V@0 X :@Ot@PU "Pc( 0 @X:DG-0pW0:@`0T?0)0 ?0 0@T0T?0P0S0 PUT0 $P" P@@!( 0 QA-Mp$0P@S` 0(01$0,0v(`Vn0Sj(0S$P1,  0(0, V.400."P^, 0,0\Y U/  , / , 4TP(0T0(0 S7P$PQ0(00,0Ѝ0F DP/, (` , Q):0,0 ?0, s0Q:$( ,00(0 S P$PU0 "ЍЍ蕮 0 ꍮ( 0 QA-M`$0P@Sp 0(01$0,0w(pWo0Sk(0S$P1,  0(0, W/<0<00%P], 0,0\X U/r ! , /r !,(0 Q0QQ(0 S7P$PQ0(00,0Ѝ0G P/, (p , Q):0 ,0?s010, Q:!( ,00(0 S P$PU0 "ЍЍ 0 ( 0 QC-W`P@SA &a0 <$Œ.?F(q@p`PUSA &aU 0 <)Œ.?1:Q `@DDD`DQ Q@P 0,Q hP>"2d'2#g# C ኡj C0*Z8W@THX 0 @ p0 SP$[ R 0s0  0   00 R@ Ѝ 0W oP 0D ePW  0H[PT @ pM0 OPX { A-`pP0S. @أT$ 0D0 .R T  S\R C@D .R @0.  0T  S\R  @@( 0 $0p@- M@P00 80P k$`P;o0 (0 0 8 30ލpVXx w 0-@-@R M00  =PP * Ѝ@Ѝ/ ?% Ѝ@Ѝ/{VPRp@- `@PZP+P0 ?p@ꏪ00pPRp@- `@P8P P0 ?p@m00pp@-@Q `PPP0 ?p@M00pp@-P@P  p@ p@p@-@P 0P   /0 P   p! 0 pQP@- 0R R    0  0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!  XP m T@T @pJP _긩 0 pp@-PP @8P M T aPP XmaPPhP{"  _ XTP0SP0S}  ^K NM ^J۰N8 ( B"0 1`˟f 0 } XTM M 0+SG GY? VjYQ I ۴k 0AP+C{{ *{0?G0 SVW{P0R 0 `=@0 ۴KZH___ __ s{g `  <0S:0:g `˰0?GT00P0P000D0X qA?A5?000PPf ` D 0P 1 @R iD0@  `㐣#YP kMVV&b@ p`P@ `VT T5@T GG{ {'J{PGP`5FT@GTPF0H۰?C I{:S03X: M۸M M 0+SODP>^P D00CD05^ PD00D0p0 S3 PB01`  z0 `f d+  Fb V&0p jp8P ``^ W T@TknP Ps4PKnP7TT @ `  0%Q0P0 0XŸd0 P 0d0D 0H0p L /[0Pj SB0 S@ +C56@PT0 ? 0S0寖PU00 ZP@@D0 @00 @0 0 XA-P`JL@L@H0 @p 1U  C AC p@-@PỐ00C0S S u P 0` P㲐pm1`u@-@ᛐ 0`00@蚐- M?  Ѝ 0A@ 0 0 /O-Q`M0P 0 Q`\0 0(@PL 3p 003 `00?`P  @ " 0P? S0S S#Y `0S 0 G @ T: @D0S Y@Dpg PЕ qPYp@DY R`A0 0 00ߍ S S0 S S 4PP0  0 0C?o2P@ 00P  W]*@SU @ 0` P0S S S` SQ W3* p`屇`P @0 0X P T:0@DPC^ Zp HW Q ZP pepW@D (@G PP z  00-A{(@ Pk pG0p 0 P6`Agp`xH1H0@-pLM`P,! \ D - @.0 P) V) pp0 0 0 SP @ 0 |0 0 D0 30LЍSPLpp  @ @TG94> `9l= ,A-p`MP`@T) X ``00ɗ  0SP @ 0 ЍX`` r@@T ЍvSP @x8x0S/ 0S/p@-0P00 00Sp0@` 0@00 Rp F``0Q00pO-8#P43OM ,CQd0@hp0410`1`0 Q 00呛/ 0 "2 0 41 30Oߍ [.p 唊P 20@ 00 T .Q Q\.Q M :!s!PF Tw 00:T.T<#@@#4;@T0Q.S5 YT0 IR  0M I [ @ @EP00՜ 0 I @Y2:  Γ0  @@ <:T 0,$P(0000Ζ0 0 p`$Pe00a [l00 0 V4 <PP`cF(; ; : + 7 hʟ SO-\: Mp M0Pp0D50t5( x 0%: 0 Z Z 00)9 0 D5 30bݍ Ѝ)00(=0P0 0000@? 0 00P `@?s0XUS#O +? 00|5 00 P0 X03/P `U:0J?o2L0Z0,0SO X <%P Xt@ T0D00H 00@ U|40<8$0T0>0 P0 08D0-0 X03/P/ @ U:   `pV 0S ,0S X $0S 0H'XS400C0s U X0  L9 @P4 R 0d80P L0R00SJ h@` ZOpA[PP 0 000S !烱 [s /oU" R WS0`Z P<&00X 40S@0 A@H 0SSQڰ\"@UP0S 0 0X0 @C0@0CXS:0 0P8,>@ 80X0C 0X0CS:@@' 00$0 SXXM4 00 pPf0  VH#0pX CR00WUoX0pXp(0=$0 S S S 60X(*P0 0S+X 40X@S0@@ X0R)H08 0R*  ͑X0pXp408040000(0<0M4 00 A pP0 Q  VD0 000R05Q*X``0幔P`X`岔0 CR00pWX0 `pXp0p$#@ |< 0@%> Pb<`ᇔ0@X CR00TӐX0@X@003/P X 0`(D0 0D0< P 00 0C0 %X0 X> 0 P0!410L81sIrX(f)X0P  L @Pt0 #  VV40SX@0@+0Sc@8 `X@A< %T >HD 001Q *0X@@0X PI D0@( 0D0W<0P  00 B  7 p7 H7 p@0SA-@`M07 S2p0 0G;PP: +P5 80 0P別P& 0 /0P<!U Ѝ 00S S Ѝ0p 0< < 0  ŸO-` BM0M 00S0. SP p @0uG#"0 *P @T*X<$ h P 0 "2 0 4 30xBލЍ 0     ! ):@PH PPC 8 0 0@弣PAP 000 00000 00@<T7 0p pIP 00S 0  0pW'   0 k 0  ; 0  ;[ 0  T 00S SIB+ + G-Mp0`%@P0P0 0   0 p`VP&Ѝ 0 JPP A-M`pP@P , 0P (   4 @Ѝ, 00Ѝp@-RQ M@``8P/0SC 0S 0S0sA S 04< 0 4 0 0 0@PJP00 ЍpR R / 0 0 Ѝp0S  0 0 Ѝp0S00  0@ l|& O-DMP $0h t400<00 (p9@P H`@  @:0  `P 8PP , P îPP PP0P@ S S $0 S S x0P d    @  P0S S S 0R*P P  0S P@ ( : PP  0B @ P0 0R 0 0BDB Z  9 I S 4 $ ኎0 I@[$:0 PK@C1u [i `H `  PEgA`Y @5 u[ ``L:J: 0  0H!41 0 <0 30ADЍ P2ڛ0P2     夕 ; ` 0`0 0:: 0 0 @ : 0000Y`00@A`@& p" p@-MP@` 80 00ɠ ^Ѝp<8@-M@ (9$  Ѝ@-MP`@(pP0P0 D0) 8 00 @  WP'Ѝt0@- M|@@PU l@P@@ D T 9 rP Ѝ0YPU00( x!x A-p0M   `  @P 0S  0 C RB0,,0 C.SU 0 Ѝ R0 XR  9S SPE U   R8W<4 0 3?0@ O-P"P2,M @00$00 P c/ 0 x"p2 0 $0 30,ЍP"D2 0 $0 30,ЍOpP`:Q FS Q $0p 0 00 0 `p  GP 0. Z@020YZ$V  0[:0 " WG X0H S# 0sWB 0 P0:YZ Wp@:Q@0S  0Q:@0!.Y0$ XPʟ X?H   p@-@P (M0`  $ 000 0 p  &P* ΉL @0 0 $0 30(Ѝp葓 0 T?l  O-tMP # 03 00l00 P v/ 0 l#d3 0 l0 30tЍD#83 0 l0 30 tЍOP0`@C0 F  p01T0p \ "NT p 0r 0S P r w\P  0pS r| w00 X0S  Xpp000<0ܑj@ 0TC P U[*WT:00= J0  W%P00[0SI@T` 0W00S 0SW@`:00Tw pW0 S,*: 0 S&* 0CR00:@LPX X X00/S0 J P t80S ꣒ 0 +w00  `> T ( O-dM`@ Pp0SM ᎅ(ZE U U U x 0 `㇅Ѝ0` Rz  ?0Z' + ܂`PP 0:/qp 00P @ P 600  0 0 0PЍ衦p p0P  * R + L UZ  0ppP 00 0SN   0 00:/qp 00`P ÿQ <`Vο;X0`v R0垃0i0 l0P :/qp`0 c 00 0`VÿR <`VοpX0PZKS 00 0QS 0<8`ÿL `V0Y" 0006JL`0`f? ` :/qp@ 00  P @ P :600 0`Y 00 NP)0S&:0C0``㐄`ЍP`T 0S  0C`ÿ N`V0Y0 0Q LI` ` @0Q 500 0 00  V`Q`8 0 O-S,MP   0 0`-p$0 0#0 B0S0 Q6 $ R00S 0B PW  5 P  ` pᰉ0 0YZ U  000@PP $ 0SRRV  RR00$ SR P D d00Pp \R T| R]  C$ 0P ATq ^g S$0  㱃P05 0SV1 P, R0# P0@p0PP  R TP P% P, P4 Y  R  -p0Sp,ЍY 6#00\000(W P PP P SJ4 `p@-@0P0FG p 00p0@@@p0TS 0 pp@-@PPeP P 0 03/P Up@op003/P U 0 8p@0/p0 p@ 0/H-M0 3/Ѝ/0@-0@ MPT T T Ѝ0003/P00 Ѝ0 00 3/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 00 3/ Ѝ0 R R R //00/00/ R R R //00/00/0@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0 00@-RP M@ R R Ѝ00P03/P P Ѝ0003/P PP 00@-RP M@ R R Ѝ00P03/P P Ѝ0003/P PP0@-0@ MPT T T Ѝ0003/P 00S00 Ѝ0 00S0003/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 00 3/ Ѝ0R /C-`M@Qp Q) Q PЍ0 03/PP W P:UR X$ ЍC0  0003/P P W*UX P200U URPЍ 1 PpHPD*0SPP[2ppq ;A-Pp`@P  R 0 R 0\A/W 0A/0@-PMSp@`  SW- @ P R`V V V Ѝ W` 00 R D0SPV100Ѝ100Ѝ 1 PpDDo(#p@-P@M`T T T Ѝp0 03/P 003/P 0 Ѝp0 00 03/P 003/Ѝpp@-P@M`T T T Ѝp0 03/P 003/P 0 Ѝp0 00 03/P 003/Ѝp@-M@P0.S00Ѝ@-M@p@Ѝ R? ..R0) .Q -S.S AL#\0A QS' .S 0 .Q AAQ0B Q AAQ0B QS  \0A Q-R 0//0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//"0 0 /0 P$ M 0  0Ѝ/ 0p/0/ 40/ ̠ ( 4 0/O-MpPP^ \\4 0 051E0< j *4p3p OldL8T~IO-P,MX0 lt@h4`p0 0([X= yP @dQ yP @ PQ㕀( yP @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] yPj  HZ$M0xSJ3  000 A P0XY /Rl ]RRQ P0/ $ $ 0 ]R& PR " YXuQ   Z J b"r R ZzA @ Rg .RP`@'0@,Ѝ P` 0D0C  [4:( 0 ,Ѝ 0 ,ЍQ   Z  " \ PXY  P0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYy }}0G-`QQP>*p0S) R5 0@0S/ @S" 0V*T   0s00ᐐ    P 0S00NAT0S@!@A@0Vc( 0 ( O-`V MP3P#VP30 U0p\ @ H @R9 R R% <(00 ЍW@ Ġ[? A @ GRP@R\ 40S @[A Y*@T*0Pཁ0 A\ R!"ɑ 40S 4 00- M ЍO-S,MP [   0S  0S0@Q|p @Q` |0PjTp000[$@00P00C00 0@T @0S @SW  0rr X*PVT p@0T00S 0 Sa*`VY W N YT R0I S P< (00P0S !R* 0G S 0S $0p00 0AT" _@\0P[( 0 ,ЍAT\0S " ! 0SIP4?<00 R`v``V0 S2000R0 ABQ AAX QS R0SY 0R ?0)4@0 0 0 ,Ѝ[ 000H p@-P0 M `00 1000p !@p < 40 0 1 30ލp@3P A-P `0M @(q0 0 100p 0 p0 (0 0 1 30ލk3 D Q:/R/0S/S:00/@-\@3$* 0^ @R R R ( 0 0S0QA^ R! Q 0Q @-A  SAQ  0SLBJ 0 D( 0 N/G-p@`0TS)  V WT™ P@0TS P   0 ( 0 0QSp@-P@` P@⏙P`V  0R p/pA-APUQU@A`pPWڀ1AP̆( 0 Ɔ 0 辆? 0 Q" A@- SBR 0@S A衆 0 蛆( 0 /-- M ЍЍ/@-M@ p TЍR/0-S0 \S  R 00O- M@` P ᥁P-Yb +Y0Yc T @Q C2`pa"OP92`pOP" [)SQ" K0Iq P0aIQW0IAIQ70IT| V[SQ4+0S \0J00 Ѝ 00YXP 0@ \@ AL\T@B@0R"\00 0hp@-@PŅT00Pp p@-BR"^p@U@P᳅T00PpA-p 0rM @P`0^010X0pA00tA0OO00 TA XA\AϠPOP 04 @ $00 1 30rߍ>10 0-  P  -- M0 0 ЍЍ/-0 0- M00 Ѝ Ѝ/ O-QPM@d 0p0S000!R !5  fvPP E``#Q<0\*Q30A !!!! /) P6 0 }0U A pQAP 0@pQ 00S  Ѝ0T @00Ѝބ0 0A-@P`pw0 Pw0 0 Xt0 0p@-00Sh@@@pXPXXP@P'@P P Dx t< Ą p@-P@Ꮔ p@A-Pp`0t@t@0h@ U  )<0 s*  A |9R IF@-@)P0S 3/000S@q A-P p@` F  Fi000 L(@P p@-@P7Ppp@ !P1p@- BMa@0PD`040 E 0PS p10S ` 0T! b P ?OQ1AR00Ӈ@@TJ00"R ˜ 0 $  R    Bx0E0ogf6c`oF? 4x_50@0 0#G4dp00a`"6pr&~b`Ed 0 x0 .0x09n1T90_$0CTu00P?X0Yc 0 w+q  .0p wpVY~c 0 w+a o .0` w`[?pGE$`@DP m1T8?O0  cQ R@ 0@ VY@$I"I BqgqgpCc 0 w+ .0 wr?D 0Cp4I2I( ?B1c@ 1c0X0B03 1I!@ 50.c((H@" <2c S/  0@ 0; d 0vw0i .0ow0lX4,`vc 0&  `w .0Zw``|:\DCBBxc 0 +q  Hw .0p BwppR\@ 000T@ @D 0 S@@ 0 @ 0$ Ѝvc 0 +  w .0 wk<00P<,4P<00PP`{T 0 0@- MlP@0P0OP T0S V 0!"R<0  0 S0  Q00vz 0 Ѝ0 S. 0P0' V 0V? P+v 0PP ΌQP 02%> 09`0OR!" 3@0V  0 R":[bhv 0ePD F>Y02VP0 GP 0V000 PS?S00SPw ЍxP 0P0P 0S V0Mp`p `@PpGTL 8 R Q P P`00 V0=B0CQ 0C9p6V FRll00U"R*P;4Ѝ"R 0S*0Zc! *0P;M@ P` P`00C RWUW֬`㸠 ` PPJ z @6S%V\G;hPJ? 0h6 0 00T0~Y{ )tP0Y`q6S SP0 @S=0h! /O0 BS s\ 6S0EKlⰊON` H}\%0X(" QJ0SZ\0!1S00 0 100 0&@0R6SBGkFLh@n P 0P& Rʽ0 0S)00S&0SF " hr 1P0@  `Fo0}=02?00cS\;9O-@0MP<S S 0S 0 C+0C RS`@VЍ0-S +S `>P p WY 0hS00Ӄ!10 "0n0[Kh(    Y <Y Y 0 I+I RY @Y     R R,R;RQ` .Bd R0S ;R,R R`0\00-l \ 02Ph0c @0lF JF20PhX0c\ @0t c9h&d v bx& l&p&|00+0 @ 0V\hPln@P P en @E0@S>0S; >S``F3`{P</`uP`00c`03&V9` h t b@@h& ᾐἐlpx|倖创 p+nЍH@P 0 l0X00     R R >R B0h0 0P 0,S|0,0P 0S`)L 0 7  $d0@ (400 8b O({̠ b   ))`Lht0@Ovv0`x0pl6p6 |&*(w;Z  W pG0b^ 1:4bZ1 !/ `  cR ( ``0p )Px (,"@ 8@@@@Lu@@ 04` 00 @`S0t"0bS01:0bS010! `0 ` cR c s S R  10@04`8@j0=1@00)<2LP0P8 5@T0(<2@X0<1@40 7 0@\008@(D@Hp @<`(C  Yc ^H,  \a c.[ H࠳^ER(/ ! !c 0 ?@00cST0pWO$  k ,`f00 %7#X cR405:\ cR4 000!V  @R -R 0 +Rd 0PV  V☾ d 0Pd  bd ``0(  0S8<`@D@0L g>f΂0 08<`@D@000GS1ð1sa0s1&000*)p@-@@0S p@ PP H@@P p0 h0@DT@0 0 0  s@C C #"O-@Q MP 0SD H@`P` 0 v000STI0SC `V @qVLg@_p`vbPV`VF|pp h B@@o 0SRpP`[00 Ѝ)0t0 0l1h6l6p60h&Z0; Ѝ0:S P s00"$"!A-`PQP pa nP@@WpPqpQU? qPPTS xQ9 h1h!0P d  0U00]ha PoOP`F U0P0\  RP ePE?1  PE0?P0S0  1 @ PP0  l 0 W@ࣥXH,W00#p@ ? d@-\F<l0 ƒhF 0R  SPur 0 \ F<h0 ƒ 0R Sp/@-_r 0 @-@@`B@[H> @-f@8H@-$@@Nf.@G> p@-P b@P PPp@*rP`0 9p@-PH@@)<e 0 F?(Ppl= p@-PL@`@<e00  Pp= p@-M\`P@`* 0@P 0S V=<;:9q7m3k10/.,+r)('%l#"j QnMLKyi SxuMJ{S VVX0V 0   0Q񏐧 2"00C Q0 B$SiPf u0Sp0V `1!PLp  u0S0V `1!P<p  u0S~0V `1!P,@@p@pz2 p0u0Sq0V `1!P{!  u0S p 0V `1!P{ pY u0SU0V `1!Pf us0S?0V `1!Ppp pz0*S4 0 C @ R00 C R 00B S0** 0B Q0J$R1 uD0SV0`1 !P 5 u50S0V `1!Pu(0S0V `1!P * u0S0V `1!Pu 0S0V `1!Px  s u0SD0V `1!Pg > u0S0V `1!PX p <Ѝ 7 u0S p 0V `1!P:u0SJ0V `1!P- pn  u0SG0V `1!P  u0S p 0V `1!P u0S0V `1!P p] p p0 VO*0P~ <Ѝ@@@@ Yp5b Rpz[ KpT DpM =pF 6p? /p8z R  0" 0p+ @0 V  `1 !0P F   p u0Sk0V `1!P\ C u0S p 0V `1!PGu0SB0V `1!P:$Rz0  P   pu0SO0V `1!P)@J u0S p 0V `1!P p p puq0S p 0V `1!P rp{ kpt  uL0S ]pg 0V `1!Pu90S JpT 0V `1!P 00B S- @0## 0B Q00C$R u0S )p3 V @s  R  0 0p"  V@`1x$R @0O-oM M@X x/H0t? P006000P!R !0{08 0\0c 0S`   Re ?Xp䐍0@0d0>00h0g6@f6Fl00㔐$00`D0TPU @%U PU 0T  `J 0 R 00S0U`h0S @0S @ 0@0S0000PP -= 0 6 30U oލ Ѝ TXP    R0s Pb?RNo`1Rz`O`.LQPQTQfHQ0@FX /΍PL,\Dt0@ˠ8DFPPPWPPP0@0@00 0T0p` @z0%1 0 0GZS񏐧FX_acpHGFEDCBA@icN\~}|{vyxvvutrponmlkjihgfId/p<*[YSjTOPO-M)0 GP 0p%%0 G R$Wg P U000PU`~` <$0 A   S6 0S@q-0z0XB$  000(0 PUXPPR@@T|z{P(@L@,@8@4@W qb@`z(@PL,84%1 S0@R00<0S00000`BV{Q 00QzS0%Q 00QI0$S00 R} ( PEU \( p00  R/S<  0UPPP~0] 0@BT%S<0000J040X0$ S@H01 0 0 H040S00|0 7R10PP @0P0CD0 i0P@0 |0$@S-0z00s80 p p Q]P 0 pw (0@ $00p0  <$0 (u Z# Qg $ (  X@z@S00G00R``V@G$0p@4W`bo$0H $@@10(@s0H 1pzD+0pz0p` 0p*W5 0 G Rp((0 G Ryp`upkr00$0p@/^ bo\W H0$0H0P0- p $@O(p`S <$0 ( Z Q  $ (  P@$ U0$0H @100(0 <0H Xx :%! z@oS0(boPT {dpd`0F(0dSU z@@L , 8 4 p `$ 0  S 1$  / _z0pS 0z0j   i d $ L   l H 8 `  $0`0(00`SH0$ pqH0W(0$0 X T0P( 0CS0(0(@zdpkPP'00{0"0 T0{0SRM 0SJ plp P0 G R00##0 A R$Q  R$H 0!$00" 0H  0Sy0c 0p`s100(0$ <0P * Q !   R%q $P@20(00p{00T0H4 RR R*@ D ( `B8 V`V ژ 0p `R0 S08PVPEUT8 Qp   V \0 bo R `  0S 0(  BRPPUژ 0p PR0H S H0X*XXS`pPP HX0Q P0 S_HX R H$0 0   @BTTڐT`pP@DT 0RP0 S:@DT$Q0 @0 S  Q000P<00 `BV}Vl% 0P p@ P@`FV 0R0 S`FV0Pp@%\0`  0 JS0E Q000P0Utf 0@`` p@` PEU0\0SPEU0@ p 'Q0P  0 S0CQ000PX0 7Q000P X Qbo\` DP00pA0 Sz D HXQ`00JS  P000P H0Vڜ( pP t@P@`FV 0R0 S`FVpP t@(^0`0zP P000P 0 P000P 0 P000P0 P0P4 P0P?4 Q0 0rSI` J?000 0   J kP=Q0p0VS6` J?0 0  00 R+    SE0    \ 00  R  S0PUb@ D ( Q  "P000Po D0p0C0D  HXXP`dp  HX{0\p0SF @00NSW `Wz|ʔ|pP0@0LPB8P-5Sz0l{\0P, p R R bo( dp0! , 00g 0PnR 6 O 0Pp O000P0 @3  QH $ pH Q@.:M (0S $0KN@:J (0S $0HL,P \ R t.8 L4 { `h0 p@, pRXQ XHJ, 0 B0, Q0   S0  FO0P( PBUPU ژ0pPQ0;U@A@TT~ڔP  @DT0Q0S@D T4 ^0@0 N000 PJ0S0  N0P9S0u*[(bodp!0 00 0g0SPP000GpBsUo 0@`` p@` PEU0\0S N000P0 N000P 0{8 (10R0bB+ S- C S)!ھl@ @ cS#/N!b2n00  A A@A00\s00BJ/ 0\0@0`0`0Xz0(0v(0P@p0LP(0O,P8P MN0P(Q $" D(Q $" :SH$01HS`-0z0͵X$ 00 0(0-QH $ H @x  P q N0PWz0@ p,Q0P  0 S000=(0@pOT0PL0,040*0 | ( Q/ $($ Ϡ   S $Ϡ 0  H  QH $ H Ϡ (Yy Q $($  Ϡ  6  S, $g(0H{$0p`Wc4{pzT0S 8  B0S0S S8 0( L0T,(0(0P@p4POzp0 (0 {0 \p,00% `$ P\@bo080{?<0T0(8<8`` 0hYZpH0  H 0S T  S  R\0 QY0@PЃ(8`P &M 0PsH< p{0,00,bop(T dp M 0PT L4000PJ4 00 ERJ/0*00A`0R 1 0p&dp x04 4 L4000P%gS HD 8 Bu Peg (@`` p@` PEU0\0SK L 0PgSH0$pH0p0cSH$$ 01H(Q $$ (0pQH $H QH $ pH pO(Q\ $$  (0pcQI $$  (PYQP $$ (POS! $AϠ 0 ;L 0Pup .L000P z %LPPP r L 0Pj Ld X0Rp 0RH0 H0$P0 P 0 PK000P0/tp 8 @pOPL , ",0 pH0H0S0`W@P{(@ pTL8p@( Wp!]bo080 c0<00WM00 10PM@PP`H   H H$  (H H$ @(H@H$ (H H00HH$  H0H9SH0$H000$ /> p TP  0p@*0  @00kS[P0Q $@($  @AQ $@($   @5Q $S $iH0ϠH0 0e}[ 0  0f[ 0  0eH$  H(H($  Hp H$ H(H($ Hp  J 0P6Pp@d SH0$$ H000 0`0m ,  H0($  H0p 0H0($   H0p 0H$  HϠ(H$ HϠ(0L0,0 @C[ 0  00@00p0 G RFP%%0 A R$Q R, p9  SH0$$ H000 R p$P'R$H  $$H  X0p6 0 X00p, RH0H0 P$ P `(A-`@P@pM0P0 PM\7 A-@P`pM0 PMO- MKU0jp/ nPfn^D  ЍO 1KE a @Y: 0D @0S C BZ0S  U #R   CU&b # 3S RUY *CUR"W , W@p@G0pS.@GZpU00 E000DT ЍU:?C0C01 0 ЍO1 0Sp 0e@ SR 멟P/ P P0SA0D@  R=U0 0U,  sR  Y 0D@ R(U 0U  sR Y0D@ RU 0U  sR 0 0000D@ 0꤆ `zT<O-@-4 kWDM  0Sp00 @P<00PW`QųP0000?G04 @Z  R0Sj R000H 8<@P % 8+ 0@$0+S@\560+C; +p A A{ Z`HXAA 301 ;Z[0H(000X0a00 Z 0C00h,0*`P

0 SA.@0c 0c6b33@:0$0G{+S6L[0(000X Z0 ,0ZJ0PPC0J_oѥRS 0S00[0(0000 0 000pW`P 0SZ00WPPU0 Q1  0H;1!" 0 1 00!;R 0Q ` +( R +J:W {{+S 5AH {P3+C0S20 1 r+S:00s _ K q}K ; R4 `a{+: p 000lJ+t 0U 00 pW0p0p Ն00{00: {{+S 5A 1+C r a NJ

B+S#S0/\S0//P@-@00@ R P@Rp@-@`0P0PR* 0PpP R 0 R VpP0 @! 0O-MPS]PE@1a0p0 03Q V`&:0  @@F0 0[ W00 *0 @0 S 00CX:XPE* R P  gP `000PW 0*!1R 0CX:XPE* R PЍP0.- UM,@00L10M 00 00 00OH 0 P  A gEVEͽ Ĩ@-ܧ@-@-Qp@-P 0@` R K@P  L00pQ ``0`p@-`OP1@P  Lp-M ЍpFF|~pq1hpqpq1`p- M ЍP/> 3D-@"M @Ϡ#90c 0Ѝ0 00/ -M 0  e=p`Ѝ -- M0 0_T ЍЍ/ p@-0@Q r P p0 S!P00pV PP    !(L @0O-M` p AQ P*5[$ 80Sw SP  @P Rs Q)Q0<0   ;S" $W `W `R Ѝ @FTQBQB @Q A [<0 P   5 <0`0 <0 QEW  `V0BoSQ?  `bn <0V :T P ay PP- @ 2 j P!r P   T @@F   2  ^ 0  0@l{` P 0Q/ R  B /A-`0@bSP)p`B @@AT  D0 BT   3`,R0 pg3wp1@V * CQ B   R 7 PPO-` -@ᴯ tM 0 N0 d`\ h P -R-+*)('&%$ 000R00 00B S 00(0Zp@ '#T0pCڜ!"T0Bd@ 00B S0\/ $ EPK00 d`0d00+SA -S 0 00d000C P0Sdd00S 1CP*0Cd0d,000C ^ <,d00C0L ^,@P0Ņ P0`00\S0` \tЍ d0V0XA 0 $\ 00 0S B  S ?o240zTg @X`` X`T<0g1S5[X 0S 0SZ %0hS 0`Hl`00XS PdP 0R R 00I Y iS IS NSd@[ Ph 0d`\0Qd000S\00\0R Z hT nS ` y \0H 0\00S`0K0S hy Ph  l00C l0  0, * ( D& $ 0 l0Rh * 0 00S S S6 h 000 h @ BAR \ *0    P 00  0 b3"  0S (0S 00P0\0P"00h ^   Y B^Td0 0C P$ Pd 0d000C P l`H`VQ  801 툋 `H `  Ph; ` l BY`l` l` ``l`  A@00S0Q,0FY  hR` r<0`000(0, Sl  @00Sh.,0@0000 00 0$ 0S?80 B $ DD@ PP    !Hh0 `P h0   !H`pl 0G0 0@P S p$ 8 $B,0 G8pS BpGp$0p W X RpGJHS GQ4 0SZX @P  pP 0S0S  40PS Y| 0 S #q Z !@0, S0\0 [hj 0Sf 0CQ 0 R00Sm000H000I˰0` 0#l R00S0<0L XT% PN TQ0hSM / h | Ph< 0S A ^=@0, Sh0`0A` YK` l0<00 CoR㨂X Jx l`+-Z10ST vtrp `PQ d`0 `f  L301 ` V&",3HC0 0?CA0CQ^j`0 0:0ላ  :RS:?C0C`:4656:H 200 S  QH w000d0 RO P00V&"K,2HC0 0?CA0CQ^j`0 0:0ላ  :RS:?C0C`:4656:H C 100 S  0S l d00S 1CPd0C0$0P 0 㓗' d@P_ d00Cd0 Pd00d0 00000h \0Oh * PhB `0 0`0+s4 d00 0 $  B1 \000! ` `Pl V瞯< ,x d 0000\00(S  0h 00P B OZ# 00H0I˰ aPh A ^0S `` 0Q00A@P  P0 C0 `"82PP Z$ PPhPh @0 0C@0l00Cl0%#h00 Z 00H0000H˰^0UCZ40{S˸ zL8 S ʋ5a_GvPD\00Q00\0 @0KhePh} l0`0Cl0#IA00h0  0\0M"0h 0 00000p@!0\0 00 H0 I˰0 00040 00c401010,0SN0d 000h0P\0h Sd`0`8@0h0@00l00l0040H 0\000  P 0S00 000CPh@0`0Cl0 PhLLLL0Sʻ$=\ 0tl0 k0,0 00P0\0JA:l S$00! f: 6l0R 0`04X 5S 00  ! \  刋 H }P~ )0S 00H 0000 bH :˸0S $0R0$00   B XSS0 RX 0ӓ! h1\ 40 00hA1! 0㈋ (H N,0C+K`  50` AZf 0S `0h |yP0p,0  0 0C` l0!0\0^ZF0S!0\0T0@ ,R0M pP" FPGl0 h 0C`l00\0Ph;S0!0\020S^0S Z @  000h \h0000,0l0P0\0`0\00S!0\0 0 0#[00Sh0 Z 0S u0\0 3S 0\0@0, S0\0h0! \  R0S(00(0ZPh  `1hP`00`0!0\0l0h 0C`l0 @-00TO- 0R``pp@PO PP`q r"8z *8 "80 W#0G 0CW`E0003aVF@ Xr0"(0A#80A#Y 0U 1 PP d`P    !6D@P@3ßO-0M@p 00S 2  10 `C`0  000Sl  0Sg SB0S00XS 0QZ P@  Q R^T#3\QcTPQ0 ^  \<0QR- U00\0S{Wc* G0V*0F@S3 F\   J0 RVOWM 06S ЍЍT@DPD@ Q09 Q0Q l l> Q:00XS Q0L)ARo^& 0 0 S 0c1# 00Ѝ QN0O0l 1 c0R:v00Q )Q 0x O-MH<0@ 38P00S  0 0P//O B0@0P 0SQ^p`0G PP`0 `0Q DS ^_ 0[ 0S S SL 0`Pb@0@00 00Vp@ !IT Pe q 0@SU0P000`\S S 0p \Pe R`  BaPPd S@0D0CSڣ0SP] 0 0Z 0 RWf* 0TDX @N S0T0@ T 0 BB! Bc0PDP{p00S 0S`CU 0S S S IP@"00ЍRr  BaPP@+P{ -P  @\ ࠃ5@ L^ p>,L pLW[``@ЍPM 0V@0Q 0pS00t LS S80S $000 b@00 0?I"00@@ ~pP D  p212 Qp `o\ `\  ^ B `@W 0 0Si Sj S @00`ЍqG PePi y0`0Sa H@"00Ѝ@p @QC@E wPK 0`Fp 0W@FpT  p 2@ PE1 4@pA0`80Sg80S 000eUU E P 80S800c8080S pT0+  RP!@L80S J80SF  @`V~ \w j 00pdp@^  BR"@["P1 5"@!@S) Pp%#  P /A-9C@ R<ϠP`pl3 ^P W0@00 pU @@PEPU 0 BP @` pT  p0 BP0U@0@-@-P M W@S 0 B0C2S* Q*KU AZBKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ nG0"S1 1  !2R / 3RS/00 |0 c R\0a X0 c R80A 40 c R/hw(+Hw*$w*A-@T!`Q1! !0U l2,p(  U2,0DRA!1! 0R 00000U U0D1 CSB100@-@MS: Q @  R Q y@ЍA-P q 1p0S2 U`eA@T`* 0S00 000AT !0S 0x`e0!@ 0D1S  00r0S 0k t)@ p@-@P00p R pPQ`00App@D `L80 0QApp@@ t(@(0  0#10/sQ#8sQ#4#2#10 0// /A-`P@  100#@Up0p 0S1pP@PApP    !?` (0(R8421S/ /@-@P0@0O-M0[pp  @S0P0= PaU*0 F B  E0 X0 *0Ip0CY0003 0[P^   p0>00 Y 0[ PT@T 06S 0@ЍG-0䁟@p9$A QPiV= @ PU ` 0P+ p@d10S~PP< 0S (1813PU 0C  pPp00Sk`P 0q0i000S x0 d0iV0S 80p (0R0i  %t@o#`#G-P`塢0`@Tڃ0T*P# Zp !pD0 i )  P2.R0@0C`0P003 `PpG P `F-0P1 0^$23\ *G-P@p0@DTH1  0\G*32P =:P  @a P@0 0S 0SQ 0 Ap BQ 3 3 V  0 0S03#V FS B  02NS @0@PpP 0!A-`@ApDPG P 0`0V @*P 0D `V1<P 5561 1 +CP5 6+CV `5C5>#11 +CC0C- MkWPC@P WW0Y`6V0 Y 0 C.I B 50c 0 Ѝ 0P c   2# R YC>C0C01` Ѝ0S0/0 R /@-?@aPM`?@pPP2 ?pP,0 S Q3 ᨭp 0: SXP 0uPP@0 $0,00 ( 0 0ЍCO00Ѝ\PC 0 ЍC 0  ,5p@-@600C0S0 P6pP  B R /@-0rSL wS aS@ C 0 @0S e C+Sr0. SR# 0S0S0S0S0@S@0p@-S5 @X6P00 P! !' 0S 3/PP೼000P @ P 00 `00aa=60`?O` 0p3PCP 0000@-@!R !P 0C 0 0 S /3p@-@Q1P00S3 0  GM 4000S9 0"$0 3/0:s00P.p00P @ P s00< R 800p*W0PRF53P00s0\4p 0@0  0pB0 @0 0px h-Ѝ/@-A@QS S S }B 0 6@@0@6@@0@a6@@0@000 0 0000/4\SA-@M}0C`po$!RᢏP$   (PH ^^(1\{ ₀ R (Q\  0Z 0P Ѝ谀X (Qu 0⃀\` P 0u ^S0S ?^0CP ` A`(Q$! 0$1$( X  R$!$(1(Qs 0( ^\:0  PAp,Ѝ \  0R(1刀$1(Q $q0 lP( P@- 0At @AG-@ !M a50@02/P`p 0 P ` P `pp  P` p0@X, 0P`p00P`P`p p!"00#%`&p'()0*$PP#`"p! '0&+P,`%P$`-p.+p*/00)(012P/.P3`-`567089P:`4p,p321007P6`;p<5p4=>0;:0?@P98PA`Bp?`>pC=E00FH``IppDGPJ= 徐ǐO N ,}>00,1S@-@0 @n>00,1R@-@1  0@[>,U> ,!O-`0@SMM + pPw&@P; Uq    8>0Sv 0 p,>`P'>`Mߍ ᓧPc 0 p '0 VN ^K A/ #pX XX 0Wp  WWtZZ[Z[p[Q| QRQ R R$S Sp  $[|([(,[00S4^0^<#^'+/3p\| \(\Q 0!Q8ZQ"Z$pZY|% &Y()0Y*,-.0p1 2(480QE00@ L ABHG[DY X000 I0;r00& Z#Z! J0/S  0 00P0: S / p00 R I R/?004 <0 0U" -ᨗp#/0SY 0`C0 S00R0F V  Pm/000S ݘp p٘P W/ppGorq똌 R Q0P:Q0Q:'@- l2 @-@@ $ @ X2 p@-@P#+P$  p@莘0@-$M@0 @0[S 0P000 00 0 p 0S$Ѝ0$Ѝ0XP 00op 0S 0    [0Hb0 O-\Mne CTpF @0p`P $4@ (0@D LPt@ F$@ 2,0bG8p<` HP     `Ƞ ! P% @$a .eXdHp`  "0#lʠ b*c:n! P% @$ ae\dL` p`p ``p.p, "  P%0#, @$  <dH ,eX `lȠ ` 0#  pc:. "n , al̠ " P% ` b* @$e\p p` 0#` dLp` .` `! "\<,r ( ,00 48 p<`@DHP$@LP T 2-00b)G p$`(,0P4@8q W0G ,p弁 1 !PO X10C0xX X0H1 0ⴀCሀ !1  P, p p 0Cs 0 각 0H㨀Hx0 !1崀 pf Pp@-@`PP 0 00(0`0Q0(0pO-Mp@,0 01 P> A@D@T. `@s` @T P @DuPP^ 0P 000 10P@ 0V PFuP 0d0P 00Ѝ 2 VQ 10C0S  00`Ѝ Q VP P  ᴑ @P 뼑0 S 000뼑0@ S` 0I 1. P 0YAAS !0s0 0B!GQ  2 00\Q` P` 1@ 0C 00C1PPN a0 S000 F@VTe na 0R? P0F 1P_0P1 010PC1O 0PV @T0* ??`J 6D `08 * Au1@D @`@Dt@@! @ PE10` P1U @D0PEt@ @C1噍000/ P 0@-P`8@(P  0 0 E DH@ DX@ D+0/O-MpP`(@X"$@   \ ?p2D p 0 pP` @   P1 %f#" ," 䶠 % d+ d+ "0 x1 0p`0 094NP@ ` 0 @^ l!!   Š!`,)! !, $ⶠ0b+b+ !P 0 0  @ 0P0@ 0 P0`0 `ЍH`A-@PP# $(paV P80 G CH0 CX0C0(0 0`0$0d0?  EL03? R0h " 08R(@R )@ b"P0 C C CC)8 b" 0A-~a@Pp @f(XR @ 0刁@pG$0(0 $0p. ?WH@`G(?`@``@0@ 0 T   0$ < 00T$0?pW (qs 0$ p p0$0?W@`G?`@`` 0$ @@< 00T$0X 0$q0 00$0`R @-/ ?P 0@-Pd8@(P  0 0 E DH@ DX@ D+0/R @-f/t p@-@P X00m]`\  0P "  p, l6O-\M(Pp0H P,P$@P0P<`L$P @ 8@(P4P pp,P]@<80P0<004@@`0@@(00 ``,00pp$0 0P0 0<0|0$'&Ǡ)Ɍ(0$97 "&97,;4 ";4,000 ' ./(! !, 0( ,$ 4 ) 0 ' +$̠ Ì " !,# ,. 0,,  $0 800P(0403@00<H0: p>I@09<4N @`D0`P(``$P,` ` 0@``  `< H0  H00@D00400 @1@ `pP匡#tp(A禀像8@&3.ࠉ.gfc}a|{d]\[ZYXWVUTSRUJIQPFyGFEDCBA@?>=<;:9876543210/7P 7P 7P$T0Ġ 00hP13Pz 3P 0#0 0qp dЍ@ 0  +0#0 0Vp P) 0 # 0# ,0#i@0Ġ 00P 0# 0#|0p0d0~X0 Dч F0# E0# D0# C0# B0# 0#h3Pn0 00 4|30p[ <0#g G0#b0 00 4p^  ?; *0#G )0#B (0#= &0#0g 0#/ %0#*0R 048 0  0# 0# 0# 0#  0# 0# 0# 0# 0# 0# 0# 0# 0#0P0 0# 0#0P  0#00040 0# 0# 0#x0}l0yd 0#H0o<0k8lH\h(xG- M`p@  0000 0圯୮VJ QP0S EPPL W`A 0S7 9P= Tp8 X 0S: -P8 @V ,! 0SP010PW 0010 T 0@@0 i Q Ѝ WPTU U @ U U \00YY @d @`]X ̋l x H Xp@-00@T 03/@TScPP N00@T 03/@T\p?H00@T 03/@T$pd t 8 @-MX@@P Ѝ 0  pЍ O-PR MpУ ഁ@  `880 S" 0SJ: H 0 Z  0080 S 0Q>0 2 0 0 Ѝ 2  0 0 2 0 @8@ @ Ѝ   P00 0  00 0sP00 Ѝ P   P  000 0@-R M@P Q\   0 013/Ѝ0s/r?  8P10@-@@ T1!\ 0C B  S P @Np@-`PV @1@!T 0N B@n\pSVpG-`P @P0pS:ؑI Y `1`! p| P PU  @TupP pPO-M؁p0PH 00p' PU   @P 0U `1`!  009W0  PUp0  ЍЍA-0P @i P 0 a`F _ P pV @D: P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp40``S#U!*`P840#U:V080pO-@R"|M2P 00t00] 00S80S ``"X2 0 t0 30|Ѝ4P`0  宼P8 0 1\ 40(8 `00 0Ġ p W`9 P&8Y<  J1 '0` !40 4PU 80  P@R88P`0XA@8 0* *J8* "@R:00 S p*P8н&P8pMP 8 ` 0`P p800 P8岽P8o`00j`g$3 2 < O-Mp *08 9$00 20<2S 0| `Vv 0@"4SlSj90Vn ,000`000P . S\ ] }  S`P I \0P0  0CX 0  !>01H0 (0p0S(00S1!R00:X Z \c/ H c/C 0p0S 0 Z0 00p 0SZ0So00@2S708 R,00+ 4P`(‐\ 0,,0(P40{ 0 @ p  (`V: :J&` #470}(7_V04`8X00 S  0 \ V Y P% ` PPX V 00S 8  Q(( Q >P00S#8Q 4Y2 @`@ [+ X`D 0SX 0 PZ【PX 0SPc/ 0 00SO ZD 0 SR@T 000S $0S  !j0 0S 0@T `6  P0 SR @T e000S?00Z【 \c/ H0 SRr@T H00 R 00v"00$4 0 2 30 ߍ p 8Qd0 SR@T 000SN00Z【 p\c/0z@ \w80 S $c`\Pػ((\` X`0̻S4800 QS4800   PQ`0 @ ,A0 SRH@Td `00_X ` E%H"0`P0S(U V`P% V`Pa `8@40儻0 SR1@T 000S00QO0 SRd @ d@` `۹ 0PP ` Z8@P@.@ Xt s@ >@ 0 SR @T J000S@ ;X0 h  \* A-M`@P`@p`@,0 0000(000YPڧЍ O-Mddß@q TA7S`PQqz q8 @3 0d0@`0T ` Q` 200  0S S @0@"2 0 0 30ЍhTŸ <qAЍOT 04S:`W 0 P~. Pp`   `X  TpK`PYH  |T  QX ( Q  ` T 04S`WA p@~ _X` `H`pU`@ T W`@ T~~ @-@0V@p Y ! 1>@pU VYp:q?oT20S` P@c0t 0 ^7%   $ $   0-  “ ƒ;p@-P@Q 0P !  2!0 2pp@p@-@P` VPV p0-P@  P 0S RP0/OP *0?c0 3??oPP0/0/0@-0P \ 0@-S AN  0!AR 000 Q4O-SMw`AP`@pᆁ0 0T> S-Pj $ 0  ! QPR$R PVS)@` 00a000S0 0`  4 S  $3/Ѝ S   0`0 aS0 0 R` 0 0 0   0000Ѝ . 0 ( 0 O 0 0QA 000/0@-S@  R   0 寵0S᪵p@-P@T @T 0 Xpp@TyP`p  0S S/P/O$(0c03?c00 R  0 0 3??oP// R Q@-Q \M@PpVЍA `  P` F `Ѝ2R 0T `@0 0O-0SK P} 0Sz pp`@* 0]T B< B S  l R!1 @ 0 0C0  ` B R T`p@`p@T T,0 1 !3/P`@D0CPS)  T 10 !P0XQRf,03/PZ0i  `@DBX T0@p`0T  6P@<Pt~0S *R *0 00PX @DX<X  Y  R !,03/ PDRi* @ 0X:޳0P3  H  0 Q f0Z0C00000VP 0 T00C000@0C G000=Pu 0@00 0  0 0% p@-P`V @`0@D0T0@T ,0 3/0P`ʼ0@00pD0Spp@//p@-@P|00 V0 PWp>P 00, @A P;p h @0@->R0M@ 0 000P0 013"00 ;P0Ѝ 00S0@ @->S0M@   "00!,3,0 P0Ѝ00@-@wx@wxH-M  0Ѝ$0$-0 M 0lx Ѝ R0 q  Q/S/0 0@-@00S- 0 ,   0 P @P K0 0$0 s0 00R 0  0  0c0  "5| @-@M`ppP` p xP0 :CRo; 0  S L   80(0P  Ѝ ; 0Ѝd "2 @-lM0@R0d000P C 00  "2 0 d0 30lЍ 0`0S pI0Pq D"D Pp0 0R ppKPP0000S$p!@ ^Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00  00 %  n 0SP ` 0j ppp  00 p@bPX   ` lМp@-@0MP00Ta V( 0T1S OX0T1S0`00U TX!\!R Ѝp@\!00Ѝp@ٞ00U\!X \!X0 000S/ t0 0p@-0PUp@0ⷞ00TQ幟0`U TQUP ⫞pX1P0X1ꨟ0T0`X1t th0h 000S/@-@0␞0 X10CX1S @⇞OT10 @„ t0 000S/gX t0 0 0S/p@-@0PgU00 \A\Q X! BX!R p@W`e00OT!尞00p@L0 t\ \0 -4M0 0,008 00 0 ,0 304Ѝo \  ,DDvO-M@QHP@@0`U8 PP"1#Q 5Q /  R% @ @1S 1  S( P  P    Ѝ0\ y100 Ѝ0@o000 0/A-`Up QU @ @E7/P@G-PTp AT P PD7/PX PPHPG-PTp AT P PD7/PX PPHPG-P@Up`L1S @P@E 7/P/@P@ @@;X; 1Q`0000$ 001@00a0@00 0 `PT!R% 00! 00V000 @0 @10a@P @@@@0@ @` `010a1S Do @ 000Q0 @-@"P 0 PC^0 0 R ^P @/ p@-P`@T0J \ W Rp   T0"f \ ` `R````0000000000 0#0 0#0000`001T^ pp@T P `T0 ^00pp@AR /oT"!0#00#00!0 0QT 00pQ  T \0 !q RC/A 0\R#R! R/R00 B-~x` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A``!@- 0(M S $ > \ RSB  RS@!0 0 $0 306(ЍP@ @ B   0!0( \ 0$R0$0B0S 0S ( !0$ R0 H 40 0 $0 30(Ѝ@/ +x  Ԁ|P O-Mp`@ P-TP +T@`00T WX p p  0 0 ?0X  00b 0 0  @Pp P 6 Q P  S  R-!P 00Bs ^a0BSW0BA0BS(70BU%| X[  Q P  S  R!"00"00 0S \0F00 Ѝ@`r00XS00 C R@`0 p0 A BRWwp pvBD0R"\04 0;p@-@PT00Pp p@-BR"^p@'@PT00PpA-`@PuUTp 0S *P@ fp$S _T@p@@XpT@0 0000/ 0<0/0 0000/ 0<0/0 0000 /L 0<0 /0 0000/ 0<0/0 0000/ 0<0/0 0000/ 0<0/0 0000/< 0<0/0 0000 / 0<0 /0 0000 / 0<0 /0 0000@/p 0<0@/0 0000/, 0<0/0 0000 / 0<0 /0 0000/ 0<0/0 0000/h 0<0/ @/ /H-M 0ЍA-`Pp@ @T@'# 000@-Ϡ "M R0# 0 ! P@,  !PЍ  0S RP/O0?c0 3??oP/G-Q `pS Va R@SV Ph 0Cs ?o/o0CS0c0)4ɠCPV   pS' ?o/o0CS 0i0)4ɠCP P ?O00 P?/@0@^Y0VP0B V 00W& 7o 0g09?o/o0Cs! Y 0i0)4ɠCV    V8 0o90@i <04BP)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO 0@-@ P  000W / 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGOZ 0 ///Q R R  // U /Q0 R 0 0S00/ 00/00/Q@-@ S Q \@ 0SQ0 @ 0\ 0 @00Q0@- @% TS00$ L0 P@D ^TNPPU QP00Q S@Q0 0/ 0U0/Qp@-P! S! @Q0C\ S@ `PP `0 U0p PQ P0@p0@Qp@-P`# US  QPEP SU @` `  0U0p`Q `0pS PQ U//q 0/   // R0  S 0Q 00S00/ 00/R Q 0 / 0U0/ 00/0/R - /P00 0S0/s R S   0 /U/ 00/ 00/R S Q0 S00  /0 /U/ S00/R0  S 0Q 00S00/ 00//q 0/Q- S Q R  0S 00R 0Q@- S BR0C  S  @ QR 0 0U00| 0 @-M0@000!00jj00j j4 ,0 0 0 30Ѝl  0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/$ $0 00S0/ t@-@p@-0@ ,ppPs0Pp4 //////xw //O-Pq4M`p@T vP1  A0   A0( 05/4Ѝ詨0S,   ᰱ  p'S㴰0S S9 3Sp0SQ00 W00Y00Z0 0 \ 00!" R 0S@L RTX00 L0 0 S00`p\H/Z/[/O-MP+0QH; 00000;` 0 0 00%SSppS+ 0P p 0HZSZ.XW(UTSRQPMXJ~}|{zyxw?>=<;:9876v43210/.-,+)('&%x#" WR ~YX P$$@ 0pPpP= W# Vp4 P, ^[0ƄS0C\ V0404 R*d 0PCUPE_[ 00ƄPU*Y00H 1!00H S_e  _ 000Sp0-pf 0p0p0u 0SU00@P  U0N PWP0?,9 p pu QU@P  U0N P{ 0H A   0@lX 倐pP0$0pQ *X 00H SP 5%00H S+p0P0` W pp@T* u  0P% 0CpUPe E0 p|5x00pu 0SU00@P | 500< pp 0 0puS< 0 0@0 !00d0 0C E L7 V04 U V*0pp[ƅ`` PAQA[0ƄQ*AQA 0[ 00ƄQ* 0 P00% 0!P%: 0@Pr00  i kdT0* 0P@C0C 0C E L @.10d0Q00 S000D 0@@C E Lp b  0pp00o i 0  0  Q 0x 0pp0 < ppp V00F08"$2 0 0 30zЍ  a  000?0| ppptp` @P000 ' 0 @pp\ppp0 po4A@e E0p00@ p0-00007 0 @p F@0r 0B0U@S  0 K0PU0PR:pT0 0t uPond I`0` 0A-`pP@PU J0PEX@S 8/`upW x 0SS S 0R / 0R0@o/ @-oO-` !p1CM M@P004400@  0 @0 44 30*Cލ Ѝ0`p 4 pP ᝡp 0 dpAL+   0/ꥧ Լ hG-0S0 S,QU) X&p@`V 0`S0P@0 S0 S 0S0S0S RP PU@0@\  0R!R  R R RO-BMMp1 !P _uP U0Hd040/ @PEPU(:0 nP@V: DoAo 0 YPXPPD 80 0 4 30BލЍ| O-AM M @D! 0T`41 00400?0 Q-: px (R5 Ps0_uPU"UPE/ @V: nn 0 00 ~P PU:$ 0  3nPL D0 0 4 30Aލ Ѝ x (RꩦH X O-mMM>x .| 0060 @>T080> 1S; 6 SY`1  8 >@@ X@00x |74 @0L0 >00S/ S2vP⸠`0pS JP$ p O 00DdP0S1Ss4P @`PT00ST^vP`㲐0Sqs`V0@  ^ 0S @ ,D,< hl 4 ` Th0@0v? H0x0T00D0@ 0d SD0X1S0 00S S00\01D 021|0P0ATY0L0S|0$0x0<0@00SAT| X0@P{ H0PPPzy 0;<@ $ P @0P.P  D0@ @0 @ TH D0 H 0 `  ` S L0S40SB < 0 x0 S00L0T`PP*p6 P004/P(*: 0 6 30mލЍ0h0 00d0 o pW A@@PH0Pz !bH0P0 + <`0$ @ {aP q40 PA yD0`S`0c  C`@ 0 0pVG00  P`?e B 0 ( \0;0 00  F &BaPP8 U0I$  QO `1  8 l80 X040Y&40 R 2040v 0(0 90SN0@/,ᐠS?N9c<" aP 0S @0P ᇞ8p'@& 0+ 0 4040P1 Q!  6 $<0P0`1  8 6P0 X00 0 0 1 01 040`1  8 @60 X0sO00 0 0\04KPb80%D pX ʋW@000SA0\0B  0 @000L0040oQ @U`D  1qV$00p 0?u0AWU11v#3 QU1("0#03 P BU Y10 #3P# 00< E@U@  V(@0V2 00U  $0v` ˆ01 00@0P ᒝ8#@,#, 06  (0h00408 H3 X0H08 3@Xg8"@" 0 0 AQR `1S 0  Z P4 ]`!!! QY   L28 @X0 Q 10L RZ X AT vP*`x 0|Pp4/P񏐾?n0+S .0CSg@e0PW`Pp8 d1L @ X0040c _P0qH D t0L0408 0@ X0x0`!`Vy A  Pc4bL D_8_,^]$\\\dZ8YPXXXpXWV4WT|RRXQPQLPOO@N N@;0h08@60P@ ך8P'@p'p 0{3$0+S .0CS@0P Ἒ8'@' 0` P0@ ᦚ8(0((( J꼠ᘚ8L(0T(T </ /MM  00  C R1#0e(6,Ѝ0/M- 00S  R BC0S N 0Ѝ/M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@]P$Ѝ0 ]P0/0$Ѝ000 $Ѝ00@-$MP@]P$Ѝ0 ]P0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-!p1AM M00 40 PH dPPC @ +0UP7 0S4 `  0S+ 00@ IP00@S 0S0S 00@ K@ @߆ @焰ူD ,0 0 4 30AލЍ菟@ J (؛ O-0#,3CM M4p@0`d04401 020$020,00$0D(00 0D000S000-  0p  P?QP0(d400 PM004  !/ S ,h#$ 0 )d4 00P0   0 0 PP P00 #g S. g <,104430BCލ Ѝ0?s0S0Q Q) Q f  #  # f 0 0/?r s0Ͽ|@ๅf 긞x I | FFFG-`\!X1AM p0@040 400 V < 0VP PP U.0$P@0G8ĝ 0  0 0 4 30Aލ PP P@0.S@4 A>PdE0  mfU 4FT DEO-#3BM Mp`0PP0$40uPOf@T: 0.TP@TW@S5.@D2Oo1B1U- d10U 1 #R T4 00i0P0[ 1U0) T 0 '0s"2 0 $4 30Bލ Ѝ0 Q[PN $PH T4 0 0`0 D D@R000& 000SG .SB T400P`0=S 1SA S5 S6 U00[B 0sK0SP0S e00d1PPU>00& D D@R 0 0! 00000S0000   R00S0000< 0!T4 00P]ye00WP<qeQZ딖   p@-@P`ZP p@Mp/O-p0\MP\2@0`#T V0 DCd0UQ#@1* 6 /OpϿ 00R 0 \Ѝ!0-- 0  V X0 F0 0zdP0wpsee0崠SUPP   B RX00 B 0[dP` dddd뺠H\Ѝ0 `F 0S0  sdwd d0sd0S  <H0X L@C-@0 Mp`(P,@D T@,)dXpd0 d d 0@?0s0?0 Ѝ  ,   ==G- p@ᴂ`ḒP E0S@P0WU!Psd @od, ,DGpgdDk @=0O-䱐 MP0S5 @d@XVxVP // P //6G-P`@>V%0V@Q\ 0\\"  p偣 pp p +; O-bM0MP@060b0`+ D fT =0H `W@01%,d!0 d! . 0`1111A05<0P 0ʏ H Jz@p d1 2d1tD P3 `@ `0H SD@_o S\  S S00 Q@0S S\ 0CQS0 C0SQ00000p9p!P 0d/m!F n!m%F s/r$G o t)F l)s$G< s%r&G8 ". ` "$+ 0DOP 2#S;S 0 S$ s5a2GRx 0 S> 0 S 0 S0 o>R00sS#2 S S08( i>R"2 S S0S00 S S SS@@ `0 P_A6P @$@08 0S? e2R&20 S SH00R00S 0`0 S S00 (@c@0S S ,PO0 5 C0 C60h`@B0H Pf\@ RbP 00\@ 00R`0`N00 $S 0d12d1 AU| ᅩ1,|wVAp 0τ`0S [ `0`H@DSH .S0S[ P`.KV00[0S 0 (nP % ,0%004 0 6 30'bލЍ0< S$B T T Yʨ4P0@P0L04,0400Tp PD T T@ TT  ;T RR@T 8$`40 p ;T 0s000@@T d P 0 0( P ( 剁`0L@ ph1PP @@T;T l3P0 0s000@@T;T   P` l!  Y@P@PTpr c8R"2 S S~0Sg00 S S SS@@\ `` ~ _A H P@`0D`S \R?* S S00 Q`0S0000$04OP.P `;1 x#|#DQ xaD@`l~Q\0 SQP P ` -0@剁!@0h13?S01S?4Pl1l 8h!2/R!R/$l!`  `)PO2  {HC_k,봅 x 4\48/ 2L1 //~ 4//+++!1 p@-Ph@l(MP ^ T 000(Ѝpp Qx#r cTV p  X0xTPT $000(Ѝpp)RA-P 00P00S0p `V pP0\\C\ `@`@ ꃃ `` p4l0O-QM-~0P0 p0P0  @(0 0P0 $@@   2T`P {PY$ RO 0 G- 0 !pG0 0#Y_ 0PP i{P0S Y@00< R% 0 pG P0 @T, 0$   PAT #U  @W pG * 0  ?00Qߍ$ 0 0 0CQ* @ 0$ Ԧ0 S @ : @C 0  T:@DpP`P @p0R  ` VPE: 0`$p@ P` R @Dp0U. $ `  T @D:  qZ p 0 0  vvY 0  k 0  |000` 0 r# @0@ 0@-@P @L 0 0 }Ds  <(0( 0@-@P;00r 00/| @-@P @K00|H @-@P00@-@ P 0  0p@-@`M 0 0 0|PP P RP 0  ЍpЍp 0  Ѝp P1P0L!@- M` 8Q0pP0 SpG0S `ep4 Ѝ@@yP 0yP 0S@ R @yP  A0㵎 Ѝh0d `  ੎ ЍDD D 8q H4|!T!!P 8!( 0A-0PU" 7U"P7UP!q|@@``F̌P $ČP 0!E`$1(`P 02~PȼO- Ff M@`0, S0 4 V FPp$@0(RB q0ȖYT0i(1<0 BRO#)16: 5 0(< ܅ 1ş c p0@0('(p4< P( PR ph40SgX% 1S H 40SkH6S (% 4 0S00S S404 RR 4 l,00,000S$0ğ 0000( X B2*3Q Pq Q^P( 0D$ Rp (40$s1%40(8p(LnP4040^# 0(p Ѝ 0Q 0Q*# 0$sx30!8(p04Q(A%01Rx$# 30<!^ ^ w䂟 S:p 0(" <!%p0(0P\4+|20( p2 0(< \2 0(< H2 0(< 42 0(< 2 0(0 2 0  8 ( 쁟00(0(1 0( 긁(0(10( P   x1x00d10wdp (4p Ѝ>p P9p 0s^$spspT4 Z 00K  ఌp%n Ȼ$  T`<$L<\0H4Զt`DHdP1O-0$M pW I*,Q P1+nA!0@ 0 ^O ,@ ^/? 00S@  @ 0}0 T0 00Z @ :P,0 0 0Z@ R 0X$00 $Ѝ踴"p"l"d"|(0 $0 @- yKwe p@-@@`V 0 CQpPaRP P `FP @  p P 0`0p @-@00 R \\  $0!0D0 0@  ( $ T\@-@PL  0S  T0S@P凊@P괱P/0d 00 0Q,0/01P/0(00$ 0/@p@-@P0`H 0(0 P0S  1T  0"00`p贰p@-`0PĈ@P  P忈P 00p/P A- @0S  P p00   ($ 8PP(p`P0ԯ\:O-0T*4M , R{ p44: +^0 ,0 ?0 :p:`I 0@ P^O ^?0P0}0 0 0R0 P `\ :R,000\ 0:S Vf <90 P090y00(9p009000,0 H4 S  !$RHXPSQPOU^ , Q h80( R> X800 R> H( 0S  !R (8p0 p(p$ aGd@(`P 0!P4 R B  B QP70 pHp'  ( \'  X 0 HG @400 p3 0G 0H0C(01@$`,0 S(0$00,00$SaSZ(@CQr @T  B Q$ , R  @ p,p p$ P  JP p  B RS RA 4Ѝ50PP @ `%0 00  t% 00@T:P5B 0P<500,50 P ATg4000C?00 P$ ,p R*#Zq d$`P@(p  P 1 T @ P$$$ `R " @T8 Zc ` $@0 Z (0pp00G3  0$ Tg |# 0$ a1,TC@ 01$000Pj ,0$ z,0$ PY  B , S, b$`,P (vP F0SGBP( 01 (0vPP$ 0 $,Pa1 0$1,P$ y@ P$ja`($ 1ag(@ P$vP 01S(0>l1l!0< ^ς}0S0 00@P +.000@P! /0:\0   \00 Ppp;hPa خT (Ԭ, PTĩ\T8DLL8(@-@PB00 R P !$0000 0@  ( $ p@-l@@`VpPPpdU01pPEP1Sp  (0$ 0p|QA-pAP@T`QV0b@P 0 pPP``p`0(`,` @A-p`@EPP T   0000P   @-@@0/4 00(/000/ᬡ004/ᘡ00/ᄡ00/ 00(/\000/H008/4008/ A-x``PU pqW@P^<0< 0 ,(0 LLK/@- M404 0 $0X Ѝd @-@0`00@@-@Q X00 2 l 0 G-`P@M@pZ 0ҫp TV 00J 00 -00 00 000 0$00ⷥPP9 0 2  < 2R"  "V &= " 2H p+0 00 006qpn W* W+ 000@哩V DIP@Ѝ 00@T0-00nPP  02 2 2: 2( JP)0? 2< 2D1 000100(10 0 10 0100100100%P 0 R00   0T 0 2 1 3/p0SW 2: 2l ~P 2 @0 2@001P,00R <@t0x C-p@ MPQ `00EPEUC\A@E=2 2 X b0 R0S 2 +13/PP"?o2R03SF APA (0$`  ( 2 00P3 Ѝ(0 $``VP Ѝ/P00 Ѝ(0" $``V000`V "V00"?o`213/pP  Ѝ@-`@ MpPQ 00U,0`V( 2S * 2 P13/PPF `P 0 pv 2 00P Ѝ  ЍP00PC-p1P MS-:b V%*AY ݛppY  T 0= P Ѝ 0 2 P`V: Ѝ衃P`W 2< 2 ЍO-MY:*p00QaP@四0p@ X V`F`PE qP0& ̱1PE PU0 2< 2Ѝ0  PE P P  ZЍ 0  P Ѝ"1C-S` M2:rBW R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍP"! ЍG-rMW Rb"*^* 0@0\ U@0 Dh PpY U 2< 2ЍЍЍG-邀@`ᴑP 07 pv`p IpV`F1wv`010 R 1 ^`0!B L\ L| R~ 6 S!2 B!0C2Spp@- @WP ` PP  <pPp@-`P@Q .00T T C 0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-`P4M@Q 00 Vv 2+ R3 13/p* 0 00 0" "0$ 0 003 p`0 9/P 9/P E0  ^ 4Ѝp$  0qp 0 P 2: 24Ѝp`?(0 0,009/P ,0S0S $Q S$0 00S$ P0A 0S?/s0 Cr  0 Ѝ ,  0S, QSS$A A0A⩤@0@ꤤ@0@O 0 1Sp@-PM a@~P8 @0,000]P8Ѝp9Ѝp/G-P8`4"M M 8Yq 0 ?@w^  4R1X<0)%R@ZV`` ? B2< b6<b0 `lpF YP`8T! 0  2 K؍ЍV9`PJ8 8000S "! !^<0LL^8^0LL\ Z0J Q CR$ Ctpp@0@0O 0 †: 9 |O-P ` ~@P H1⫲0p1q  J  0000N`ⴜA40O-S M@0S0040000 P`$p 0D7s!`A B  6W6cM^ V LW0 \U 0 SP r  \  0pS  `s"`fR0  !2!$0Q0A$0U@ 00UY QSQ'QqpeWa 0 ᖣP 00000 pAL0 ЍVDU$DN @ppA W PUi1 PpDD00CD0 0 10CR? wpe0 B Qs0"0aR31pwp!P@A0 0$ 10C0S0gWPX1 A 0 Ѝ0 QpP0Sʅe P1p WD wp D PU PeH pD  BD 0h\PO-P@MpQ %0P峐ീ0Y\[@T0٢ P> @Q 0SQ~ 0P @P0S 0P%@P 0S0 0000SV 0 NP 00080080ЍOmЍ 00008(8540PЍ`00P0 C@0p C @q`9 0  0 峐000H00ಀ0@` 0qP 0P  p@-E> R A`$P@@@0D @Q$0 A3@D@N0!R T00t2 @@lRDAp@I7 O-0 p\M@/WPp 0P$0X 0  P( P $wp0 000 000 00S,pH0 8@0괠\ G  p ||浽0 0J0  0Რp0000@ Sڴ0S3``G ߜJ 0 |P L8 <0p0s00 ,0Cs00 ,00A00Ⴠ$ 000( 000\Ѝ0,40$0`(0@At@Q$0(`0 000000CSv@@ᴰ[ pWwpQb@0@0QD QE[Pu  0  |000@t@Q@0 0pW80S@BAD Z0S0QD Q'0P0@ 0 00F 0000  <0  6Q00S 0g  00H00 000PL0S0 H0X0 P0S 0 `00nF40A@,0A Ts0000L00` 0ՠ0P 0 p`W 00wpS 0,p 000040E 04,p00D00S 04,p00: O-\p? P0`@S@L$P | C{P' Y  0z S40 \ 0 (!S$10$10 10 0S0uP  0P0 S0eP  00S 1$10$1!00O-P@ M Xp0``Fv`O 0V0  1` !H`Fvv` 0 0|s0 0 F` 00`00BPPo X[000Qc Q 1 !rZ  pG``Fvv`ݻ`K00K000 Bೀ0@`@000 0``Fv`W- 0V0 1!{ \`@v` `Fvv`汻0 pW0ps00F`0A`00000 Ѝ@0000 ``Fv`sQ0 Cp Ѝ ᳀ PP @0000 ``Fv`A-0p`@PR"  0\凟U@ :T8 0PX BQR R\ L0Ӳ0R |00Ŵ 0 0Ss /00C00 000UU800C80O-P0( 0S 00Cs0Z@ ,WPI  0S"!@P  0 S 00Cs0 S  p`V S@  0xP@@A-`P 0@T@ Tp Q Q\PTG-@`P 0S 0S  0Q@PS# 0 00ᲀ\S= 0 BS5 P@ \0 ᤞP  0 (!0S%$! 10$10 QᏞP 0 㼐@pᲀ 0p 0 S M10 B\ἐrp lP $1 0 !$1(& 0 O-\?  M0P@`0CpS@L P y xP& 0 0  _P 0{ S0  Ѝ0 0S0P 0 0P000@- M@P p10 Ѝ0O-M 0`0p  @DHPpA  P- X@  0  †r 溠 \Ჰ Lpഠ0  ``p0000S XЍ 0ᯝP @ C0Cr 000P @G-`p"l2(M @0 0$00w?0Rp`2 S?:0JS< 1PP{ 2 Sl1L PV: CX 0: L01|  p(” 2 0„ 2X!P1 0 $0 30K (Ѝ P@ ZP崀 Z r  B0@ 1x ᏸp#  0000`0p 00 pOP202 p   A-p@MP`Q 00 2   Q `:1Q婸0" BK!2 0 0 VI WFEYBAG?0PU: Q * 2 13/pV \* 2<00@PH\0 : 2 I E0P VP V$P 0  ЍA 0 Ѝ0PU Q:(0 $P0PUP`PvP  Ѝ1wP 21 ow@--M  @000 0;hh  0ST000S 3/ :t<Hc| 8 80 0$Q/$$0S/  D<<00 R/( 0S/  L-AF hFF #x /! FD M)h1 J#F I H Fn0khBF1F8FAG5l-AFh F FI ^FEO0EL:F)F0FjCBK@Lh,4+[jF ! # f0L7I B(Рb+7+544444444"4444%(,1"FHb#3#ca`##b#,4#c`##`#3H!#ca6IFHn 2(FCbhC"hC"iCbiCп) H(iL,@j&-OFh FbI ]K$JFFF&F!8F)F*JCKwR()G((Wп !H8 (Q O&X(5Рf)) \!@O gI hB:U" -ђEђx ; `]Kh/,кйWI O&gO dOFF`6&FMOMJJO&&FlU#XFFDIZF h F0?I"F%1F"@FF(Y9I PP : *$?00<<"!F0Fi-8Сm(FhFFG!j$HR]AFOFXF]AFFXFO0FF(ThCI@O@FHl'%PZtv| &-OFL FhOI &].ff)FJF8FRAѧKh/ݢjch*+I v(e(R(KG(+ܿf+R#H +R#s}a( fh&a`yvhs$pm(j,g#ChC6]Itk#i+ ##h+#C?`  c `cX'@BHFYFo HIZF h+###HFHD/  0B,/*0 6I0#H'0hS2H Z  -H 0@h+&J*U&*,pCObhjCѹ/#JI# O Yg:F@FJF(>FFOY8Fd(3 \/)F|'.'P0;+`]1FFH)jH &+a0*kDoۣH\9Fl*j,ٹ)5F/!#PI#  /*,/*/"+OpZDo FH9FFFZFFLJ B O }KhB/)-УhP8F$F3X>PBB%TBB*j9FkHmhpCOq")FHF"jbHY`O0pCO#RpCO*j9FWHG! pCO(س_ˀ_(FeF(I&1FF!O𮀳 Ol+Ё(F5bhjPC ѻ)j9H")FHF<Ѣk4HSco@"1KOq0J1HLq8Fv(!j+!)j:F)HHFF(Ůph+l"I RpCO`#`ZAѣickJ;c+R#/K@?J!pFY(zDb' " 5  J )Ыm8Fh0)j#HHch+??pF;ch+?5pF1HF0F/?pCO#/jCch+?#C?߭U&*0ݭU& I ~U  -GF- FhI ]J!F(F0ЬI RKNh@8LK`90̢H0+0_ԠI"`F ( I .`k#cKdccH"mK@+jUj^00! #m@!OrdO@cF (c"m@ l@aOOrF[h`kG#kC#c(cbksH a00#ica<#Cпj#Cп#mCO !#l`lYCl#ik DG_N#m@^IK62@Bq(FDv(Рj1Dl a(ч1FQHPI ,NI OSKHf`#`0Z +61DJB@#m0 !Bp`i! ###C  tk-@!l(FiG0@h+,I1&mBP 5nnEBrҰ !0 [jGPrOs.ф49F  l   ` -1=++Cq ]HFm00"j6#GPPH#m6214B2223B2#m]62# #2a6)2EB4 C2%m4) I2!23B24 C2 "13A:"1F0 D01GJBѿJBܮVU?j! i 2!iDf2CaaV?ܮlkhG0I v $-OFl]hF:I ]u\LXBF1F8FE !kh#j)C𥀂IXG8-(+.DJM #&047Feccl{@B!(!I `ObOs*@Jck'fl ZUE@π.L&k.H#kcccl(9F l] >hF+&%F@K #lV<ԣlV<0FXl @BS8Fp5  FEс(d9F a `Z"J((@BFjx@A\pIpNoO#āccU(?V ((hp)h0FpCO(hak@I 1J(4l  KQ 0)h:FSH HF 0)h;FJF@F cclЕ8+h0BF.[ШhAFu,,2L,2,.2L.2,02L02 212!@2042 [B4262[B6282[B82:2[B:2E`9FQ6ckBط@E+?ej+?aI tX&-Ah(.hD3& -OFMhFYI \YXOXM&:FAF F~CUK , PI(a i ,yhX)Q i(f(Oh(v(#k`a#``6C;W# F(pCO @BHF*oF  +I| F!%I P0; +rIqqq[qqihj (-j[)FF@F<##a@[ I"FF Ti3kj+?++.R)jhj[F!_HHHUHHi+Ѫm"(")F8F2;Ci i+nh+?y)jHF@iӱP0i+#+h˹i 4"j#hC?](j##`>Vm(N i!f(Di+0h+?<*h?+?6$h+8F ii3)F8F##ah+? h?+?h+љ+? [H)FFPFnipC`O"(F vF8i{)F8F##a#j+?u.r(Fm`O)F(Fj(bO(F jh(F (F(Nh+h?+h+-AFh Ft%I %N['2F!F(FC KhBO 9% DFT@(Fp(O. (!h%HL/&h/!0F 0Cx+3x#C0F (H1F0;Fl p! " O#"  @ tF tF B7  L ! p x(``Oܿ#c`@LI` [(HK8  #(ŀKh++'+шK"% HK"!" K`#~Kh+JzJ6 *uJ! +wKhwKhtK`qKh+ rK"`qKh +.#cKxdlHkI#FkJ(F FF FeL hCh;C`+ "hhY` "_HphZ`+:#MK6 0kGKxSySH(f#OK"`@K0+cAKh+_ r=Kh9K(a7K0S8Kh;AKh?K`v+ .K60+:H5H8K$L ` #1  (v~SKF0+(H#X#x+8x+#M$&FU 41F,ѓI x!`1!!!!!!|J"`2 2,`!0N!`I-GFhtI [sNtK$tO`3h BY#9FPFFPF8EkJIF(FB2hJ(.cI 8a+R#7777777$! (  PI$$MI (KH0JI (HH&GI (EH,У+h3=M#=N3hq+F(@6I'Hع*hh#x320[ F(FF!F#3"1F F a H!F\5KI $(H D{J{P{ Bt @Z{ht@e{t@p{h{{{]wgt{&h| -OFhFnI [M$FF&Fx(`oSBSAJk`K!@F9F,JCKѓK иѤ+6NйGЉI R(%G((*H8 (Q k: : : :E: : : :s: :e:O &h(v(f(!@!O &O O !&FO33,EkhW*+<:!XF8KW*@#x3#+&VI Ft`1F"@F\F(@OI .!XF~(IIXF0FEI F0XFq F 0=I"F hkh ``P0; +CBBBB2BB2B=#"!F0F0FF(h+9(Ip[9F'F%HCF!iG!jPFVp[9FFH'[FCF+ jZH'HH8FZ!2|L2:|p|v|!t& D-GmFFdL`ad5`G5 ad"5`5`d@C5`aH&HF('|NBFQF(F6BѢi*@؀wI" 0F8h7yh)qI2F xoOA6+#9)-15TPj~#/𙀻Bx#55#5#5#5#5NIHF AJIHF@@GIJF0h0h "!?F rh"+2h=I m0h "!?FaZh"+2h2I0h "!?FHh"+H(2h(I#0h40<#|#53#`0##z#1(#j3#b$#g#e#cFI hAB%@AB!I砪!sM&{_ ύ&Z@F!h BI i\Ѵ`iEєBسB # `i@ # `#55/5+''Kh--p5#//h/OJ !!OcZ e^ڈJI 5s PpCO#55?/Hs/-10F#5@F-&0FLpHpKpJOaoK(F22?FdH2FfIF(Oq@F $[J8Fq+%^I8F 8Fz[L #3#  D:F RM  L D nNH2MI(F*FùII h#+ " CH2  >I?JFCF(FZ FB(" 1I2F H2AFOr!H8F[F8F 0FF 2=F zYHHch;c`+8 F`F8F (04' N/^l2l!lysa=Ȫ!g"(@#hZ"`xch;c`+ F#hZ"`x- 0F/0OS00OS0>H1F-50F11+1[2H51H@(?d-J.Hq%(I*H-ŭ'I f(6O#-2I20F(}I #=-?T(FFI*F HOr,HP@ "!FH(0FFPȪ!l!@md?!(-CJh(KZ`,p$NO XV[8F)F iF H`0;`0+ AF $4, X0ZX "p18*!d6-O$#FFFFF  BF1F FCѤJ ,Sl-H!H" l?FQњJI S(2P(4F)0R!DDDwDDDDDDDDwDDDDwDDwDDD'a)B|J#F-d-r- !!!d-A R-S--Q-pI*F fp-}r-Bl-",;V+PF:F( # V+"`IPF 0^I NV+"ZIPF 0WIV+" TI PF 0RIFP V+"FC    "IF,<YF@I"F6&X~E&6BE:I PF 07I F5J5IF(FV+ 3IHFJF1I(F0JQF(FF(F +JIF )I J%I#I ,@𙀒DF'V+HH!F FZK<?Q&k~DKDX{Dfs|D(}Dʤؤ%3X)O 0 %IFRFFn%9F(FXF  ZEۧI F(FhKB=s@3B1F(FO 2FVF"0FFF(FI2FH%FO yaraB-OF-FM#LĢ 222423322O33RF9F0F~CїK(D(@I 3(F/(G18(FHJL9(>$===H`==t=========d============hG==lp===x=======A89(#ka### "#2 xha( [I X#d2t#42p#2l#2h#2d#2`NM$NNjh4U0F, a#2J232D#2AK/!@FF# ;0C:@FJ0;:?&/!HFF#;0C:HF10": ? /!@F~#p0+?:@F0 :J#h 02:I( 0\I 3oҮOc33!&!J 0 KF2I( 0\#BٙI*X2x/!HFpHF HpCO0ayZ/!@F`iCFIH~HI N@F!  yHl@F  : 0XBEWslHiHiIOR@F fIE`H:!JU#B^H @F )s#2#3VKh3SKh60QIOKh3LKhRFh`JIg[+?ޭF42k2# CC"C"C,2;M#a:Hz"92#2#6H2#ki33H.?fW(0+`d2k(h @pCO#d21C3C2Cl3&+ !!d2(h+zO@C:Fd((a\9Fh+RH&!!/9s!Vm !&3ٸ (!Odb.#:'2F:s!f0YF(F:!f0/`wFH6/`(NХjF)hH((i O3+a" (a0)hHHOrH7'\Tk`L7P'?+钇@<"82j!(2锇(e+i`mhv(FYg`(oчI*F d2(i: D0)hHV#1Oq}H)hfV+F@C@ !@P\02T7,2P7OsH7(2L7fJiI 0)hgHaJfI(i 0)hdHg@F9F.@!@1F F`pZHz(i .aWJ !  dSJ !oQJ8agr/3023,2 3(2FM\2#SC#)K1!D RObB\"ZBX27K"Fy()@:h&FhRO#Fa!iOrHF1:(􆭪i/hB'0J:F0@H#+b#a"2*G+@GKZiiBIFl!rdAܹedA!`!!!!Z3d02o,2(2?+"\@3?! 2JB Ca0O@F +(ڸѭKd2+0H+02+hF+`:HF (2:4A: #cR 8Ű aPCF i 0F^F?FщH  ѧK)F\PFJIFG CCFE6 L  8F( @3B 2 3B7/kKo(Of(VhJBsOc\2:?31*?+?⮗0*(خ!*Ӯ!*ή1J #L Bs i3a(?1BzFO +c"2C)(!=Hch3c`#0#0:h#4Im 3K` c#F0I F/H030#0#h3#`#0030030030#0030%"I "& !eE"]`ddh<4h"00h |xF1hH< 0h"QF 1hXFT8F6X8Y9FEFF 9F8FEF1-OFhF$&I j(@̀-!=Y%$F&F'F2v(l(H(*T({KF XF 0u Hm8 (S a5a+`+`Aa;aGa+`+`aFIFfJ(FDAdKhBкY"Q`hBQ`Y"0\JR 9F  2( *`SIFJ;CLK "h( Fx+(OsszFFF {0j"F`XF`??FFh+"`XFEFF.IZF (x+h+?z3tF8 $I H ( B -*1CHPFWFP 7 IF5$0JF)F FG0 F,k &&d)p)Xn)H#(6 L I F F4I F F@"D6-OS}P FFO r!@F dP`p O O8 C      GH(0$ѰI K$h0 :h  2P4ĕi483,H0ўIH0ѝIH@M,WћK.O O I@H@EKhF=F3YF0F?F;ыK(hO0+@i,@f5+@aO ,=њ5 +8 # #`*F CCF @0F(@etJtI ah(F$hzܺ`ܺNJܺAfкC!PFB@Ԁa"+Q#feMd#eMdMdMd+eMdMdMd3eMdMdMdMdMdMdGeMdYeaeieMdMdeW o@! "!R6J Pd+?I G6HFA0KK =.KL 9,KJ 5*KO -M0'K"%+%KN B?%K, KM KH K!M $ o@!% " !(hKd0+t*hI $ KI KB =FF7d"x7d6d7"AI_d`7&dp6KzOT?ǮkܺC9кBLкa{Ml ?S*9eecccccMecccfcceO fM$eMޮm ;(خH0+ӮI0+ήO0+$5+?L "(?|F"h@F0PI#hk;"SCX8)FfFIJJI,F F F1CF&0F]0@JAIp F}a8((8 +.3wKEuKh x+ PEoI lN0hT6hFEfJh3`E#ObIHFP`IHF(_IHF(Ѱh9F(hQF+(2hYFFXph rhPI >bOaq`F JIq >#3h +F A(DF] !8FB=4-I8HHH!JH5HHHHQ]HHHvHHHH$HHHHHHHP`HHHpHH#=hsI(F:# 4pI(F2(mImH##`#443{#4v=heI(F#4hp#"###9h"]HSK`]#O2###9hOrUHCB?J:hQI f;h4@#"##"9h#JH1#oB##"9h#CH| !#O2##OR9h#;Hk$#oB##"9h#4H[(#oB##"9h#-HK,#O2##"9h#&H;0ch=h+I(FTP J+xh320YI*F(FrF&&!"Җ @*]`/nr ,8RzhoBH#)F##"KX`#oB###9h"HK`s#oB##"9h#H4c#c"###9h"zHvK`T#oB##"9h#sH8Dch=hkpJ#pI(F_nI f_3lI(F#@4*hI(F@"eKfJfI >=heI(F0D4CD4`I(F D4C\I*F8h"! (:hVIO2oC#OC9h"PH?PKC=h(FTPLJ+xh320ZII*Fh (Fx =h:!(FPT| /!(Fx>I +x T FlBF@6OE5FHh hC$XHXy/yTP$KI/CqqI4KX#*sO @*@QF FrCFѓI"F,Tp0ѐI"F$4+5F箨"FOa_:F(I"F FOa `bt1FOcJ(8Fa}J}IT>0ThpCOuJwI!$rH!$oJrI !FkJnIiI"mHgO{(F <hL4[h4$1F[H10(YJ_I "[H iIF( IOr4IF8F( 8F IJ PI C`4;#X443+4FI;x2+0#C8JAI䦯AI;L8FX#T4#;I8F84+T46K)J6I6I8Fr(4KO6!Lz*?x2{KS#Bq &I+Jh$X1QC(F# D0@X# I#"Fh%"9L !"b!"ęۙdr#@*_+@i> a(Fp0ѲH!FOYIFOpWJF IĞ!(ItQ2zC"sD$*ݢH:F!F*Oz/sVO0$$4T±+e)j(OEJFs (F:FzBюI?cs+F+O0$ѱ+Ob0$OS$40o$_5|HOR/uJR OrOr0$0$B0$+rOb_rObOR)04$4 4S$O0( 44#0444| 0+ @4+#QJRIRHx#@4,4K$4 *Կ,4 *F1F F {s9ЮB4(FF{h+? !Xhh~F`(d9J#Fd!7M a T(m2I "X 1HOb*T4+M0Fl&HV "Jd!F^ F  H\46HgX @ Pjx ! x`Z"l8 v`)F\(?D" FAI qBcZ O ?-VmI "FvI ջ+6s-OO3-FLFHNm4#FF BFQF8F0CF@ѸKh43#4/8ј"!D<"!@Z&`ȁ4Os44+@zK $[h*ss!@0FF3@kI2F VZ-:C-D=-S%AiiiՃiiiioiiiiiӄiii#yb=--S%iiiii5iiiUsiiiiii"0h`Jx2+?9?5ZI #443(#4##"#QH##1h"KKX`#O2#JH##1hOrCB?2hCI#"#AH#"1h##OR#:H#Ob1h#z #OR#2H#Ob1h#i#oB#+H#"1h#Y#c"#$H##1h"JK`#oB#H#"1h#: H"OC1h,K%"&)"9Er ,8R^j3h(4x+`I O XO U!@!0ыI2F4+F dC#$b t/z2P$#LJ/q tqIOcpJIF0FakJkIJ:04eHJF9F*bJcI8!F]J`I/\I"_H]K> <"TH !0(QJVI"RH hAF( HOr4AF8F(8F0BJ GI @ C4+ 4 AIB1f#C4J=IdCMLR-OFFIxF-+4 F(?ѨK$"`O OFFZF1F(FC9ѠKhBv'>3FS}\(FTFV)W/DDd(X TIF $I FZ(хK"@Z`d+)  #&O DtDO;h ?DdDD4D$D$O XFG(FYF(F%)F FaI .ў(F(R1phUKhb "!QHT=VI2F T`TN[h "!+NHT.PI2FLHT(-7MI+F2F THKJLILHT#HJ#HIHHT!FD! @! <! 8! 4! 0! 06I6I2F!O00th+0HH/Ll!hF%J?F(FT(I"FF  n8 &d !O00Dh+H .H)F FH0F6H <$ {  ^Q/El(-OFMFBHKM(FH鰱(`wh;x-+3`T8F88Fp0T0F0! ~K+`V+8LFFO D+?#Y;pD>V?D;+Ѥ NF`x#:h6I x(?,4I r#`$8h0K` :h/I r#+a#ka;h#0 +~&I P*v#0#a!I8h|(b(:hI8h "x:hI(?I#kb#b#b66<$u&Xf$0U0>X{KJhi t+#kbI (F I (F H `(c~HBf|K>$3`+~r+XR+i+G t+x+N U O V)ObPFFЃ C#+d0bBF;F  LE ki+%  #KL*sj:HIIHvHH jAIDHhCH"#H2a0h3q&1.\(FF;HW80 F#)FC(3C<0C ^")F FOB1F,HFFhh3++h+xg++%LlCX#I$Jh( F!Hx+H+.#h+Xh~FH 2 SS}SzSwStSqSn0 w$M]G-GFh FV툹OL$:F)F0F4CѶKh.v7 S4IF D(CРb++R#mߴwߴߴߴߴߴߴߴߴߴߴߴߴߴŵ0 6#$6#(6#,6#06#46#6#86#<6#@6#D6#H6|$&B<&4 C"<&,&28&qHr4&r<&Z0lJmKmH)FF`U#P6gI(FSs(ZeK #D#xh`IR(8]MOjO W(@M #+p#kpVHSMP&khCT`4FOHPHBQY(Dh1!oFr(f.@@CF@2>HS +x++#.FO 0F45HF(F^O 8`E_l*Jhkxh320Y<#XCKZ`PBDj ۲20ZԸ:$(3x-GFF'ODJF1F(FCSKh-AH(&Рh + +R#myD4D4DD$D:00'V#`"/H1F.8 !+K,J,H+N!0F4(I2F D0d $& <@!F(FBI I2F(F(h+I (FI (I7!FI#33^QH$ {yt Ct U&-GFh#FZHLMBF9F0FC,хKL1 1Ch$C!+@@$ C@O,p%%aTRF(qI x(`(A(;M(Ua+R#-ɾ-------------; h3`434434yGKHJZ`u+h#`131m@33@3g131a131[131U131OД *F)F#(F hH*IF "h 'I^'O#:FF(F@F8(Fh8 3x+AFY0FR.?J.W AF>G>"h"$+?K J`.h$& Ul$@ -CFFIFrFLJF9F0FB0џKLhv-8.I$iLI FX I FR pLMJF9F0FhC:eiK (. @3B#a( t(#i Kh#a%玱#i{?hWu > BFyIzHyIBFwHt(o@(A83(S '-39=IMSYguz(eci+aOsci+Z#ca:ci+S#ci+M#ci+G#ci+A#ci+; ##c`#a#a#ci+*@####`#`(h##bP`ci+Osci+##i+(hI a2(#cb<$ &6:-#j+?ڮchh+Ԯ&i--ͮjI0FXhI0F0gI0F( -e.--̮=-?ȮS% {-W)P h)F(NI*F DD@-Ѐ-i#"jihAMAN(cAF?H{i##"jih(smhW)W)"cj+?( >^W)Y" 0(H J??#H0>OBbFH F$5KHѲ3 C "4#&`j(? i)F F2(1F F.(AF H  Lfy-OMSNFSO FO2F)F F COKhBO9(, D8&U/0F MR(f(O#4O*Oa[ :I* Xd a*(@ `(>pCO@гO5 `jF!(> d ZFOa8FB48F/Kph+H9FD F0!F*PF6 `jF!Q( `jF!IF( H a&v*d$  -OtML%&I R7OghKH8X<8KDX@8KX`XdXhXpXtXXXXXXXXHhLhPhThXh\hxxxBFD8O3l8cHC #8jFF:FB? R I*FF VrzL HN K<~HFFX}IR(@oK"T(XwIF(@gK"XT(qH&cK x`K`J,^Lh8C<x%hHhXfH (dId bKAMJ_K8(BHFM&`h$dhAL%h.F \BFxCF@8L#F"GK|hR!# <-dP(FB ( #C(O (@%hRE/IF*F7.I FR!KTN*I FR K"h(F&I FR0 K"T(X(:!H!FH5 I F(>K"h(8$\$y6t6l666u66666.207@98i"6684D+R#9_?)1W#8Hj#X8T8#z"f8p8r8~8"888"85"8538aX8P8$1y8,8+AF= ,8+М-GFhFpL Xh,:gI1F(F#3p2+"l!߀\I ^-! *(:VI B9(/(-08 v(%3331F:F(FAIKh/V#PFJ+xh320*(F (@I" Xqh@F=OO O )F9HOr=? 5K5J !4 31I /I -I +I (F (I .p0&I&H!%H꘱9"H4k Mi@i IK4FI4+EMi(?>xq%5LKhKKt%KLI@LfaL`+LKl"!&(pM pIO,|ť 1#c1h x'i8F;BF-/*oI4oO#;`M8hlJmK(FF7ܑ. +hx-*+*[xK0 UIF>@F(@F;h+hTK"`SHaxCQHax NKaNH bx LK#bgj'KH!F. hCxع((hF9F@Fk 5>F@FQ( 3Kh;2KhiC1H0M!#  9+h++K+Ih1((H! (h!!(!5?? Kh#crY (Q8x%%,%pĂӂx%4%%i%-OFwL F&hrI Qf`JF)F8F8C*mKbih2CU# 7"A"8h(?W(@"b`K!h#^H((\I tu(`(G(DI(FE(;(UIFFUH` a8(S 999 9#9959O99999UhC`h#s6K.Jh+Fc`#`t##aq/J#cah0"[+JhFX)IXF#YFF"Y#K &h"RhCsKJh+Fc`##"F@F (?=H8#a5#"F@F(?-PF"C"Eig%̸%@Ŧ&NO-OFF IN(ڷI 5F,ĕ0FK@/! F|DJ F#xIh320Q#e#xICFHMSK,@𐀢O&F%FFFDJAFHFC@𦀜Kh X##F@ (I0iij\ `0 0*Y 2(F"F1F###I,", rJ! &#zI:FzH sxH"!#wH"!#uH"!#ӱsHF(5oI8 DbnJnKoI(FnJFmH:F 4"x-*ghx-*abxe*i.Yx,Ui*k*e*NC\JCGC Ds( P( E(?KI(Ā-(Ā#Q8"(S UC[ek )C/G5#9h(H#9h'H;hx^-[x+??+e;hx^.ٮ[x+?ծ?+Y%שJ&hm&ht@%28=BM̾6`&;hx^,[x+??+9h 9hH#O O }#z%x&v$t+`0+ ii*0\0 I0^KIgt-O$FF&FJF9F(F6C/PK -8.J0FN(7,C F#FM  %CIF(5W) 0FFx+-%I .#5K !H0M(F0I &4@F0I6PF0IP= (Fr HLJ+F(F!F F"Fh BMT&-O#$JFOp0FKM`K`K`K`PqKOr!F`|h0@Eh#F@F) UO,ѕJ#MOH5J5J5#(sяIH@Fih(m(_ D(Kf(MC(PЅIH p(Sr(RF9F0FB1i3~H X pCO&+'svHF'0Fx8{+7/0F/lI"lHz%F%hK"`&eKeI>@#0\O8hgF8hg#FiLHIRHnn(nn,B%KH^KI II HI 8hdd'l@CH(@ # 7P F@ P -@$ FPu B߀Pn Pk %F@F P&/H"!F #0%+K`" %)K`)Kh)ŀ ::3.$K" `1$績P3&4&`&X3&#&5&`3&.2%&0.&32f2336!3+&d3&`2&3F}IF@&%4\3&+& .&p%.&-&3&,&(?r %F | (`` F&| K,H &v *H &p % -Q!(FP:(F(?G O #\D#A#p3B #*F!F #O3%CF?$ %o(F $(F%P&P S&6P $9 4H-OF-&LO:F헋ͰOh`f ZFAFLFhѐK (!ݹG"HFF6AڈIJF p-a-b=-   .z-&?ToB##"9h#xHF3"39h#oH;h`6OF3C7 8FF0&#adKX)Fa  0Y]I(F0PF*0P##bOF(sUIpC_(##.-LIJF @JI FHI  2FOqF( "  "IF 0Ft(:I P L(6I4I 9F 2  ! &1F8F"  'I(J3FF(?j%I("I IC)Fb `!FX+X+ I&&ayhht@ihhhhhihhYii3ih$!0 , 40##-1OOGF D1HFSF1FTJJvBKT 38F0@B@1C3@1BHB 0 FSd!h1E#FF FEF(@D1@0BځnK+!nJ F3@@1C3@1V(/M(6(?(4(#aKON8(S %SKOsf8(?p(?mS  9Kh81=HP[5KhH2# /;L'G(-KO#D1'CcD1'g# ##D1? H%#mKOFKF! FD(2D1?8H#]4;k +΅ͅ`Ѓ&؃l )@𤀤H0B)F FD# FFV!EF(FKF! FDF ѓH^3d&`I9# `?0щIHBLa@p+@)FDOOEnONЈ"AB@7AVoKhBOia]jHBBbO\qOYaX ]A "0\I_HBa +?ʭ FD10@!)F00CB$)+P2@1G@B%@1JJB??IH0@IGHBA(@;IBHC3#CCSP2CC`?"jho8F4( $9F`4HB$+0K1J)F/J+! F2;F-JFar)K! 'K"'IAA0I!H8FUCF+9ظj+sNh+nHBC<Okqu@zօ`} kۊFHAAFXF^(Ѹ??YFHAI  ! <8FUX0? 3 c+݌HYFA)h+ІHAи3 +i+`#1ʀCa3 C 0rV#?{`1 ԏ30rV#?j3 `!Fr?_0>`[_HA^2FIF F?o([HA8P#RC"D1!UKAZ0RISHQIRHRJ#FA0A( FIIHRh+BIFHAF`[ Fh+AHAH<h+?z6h +?ta#a`27HOq0 "h+1J)I1HA0H@0 h+*J!I(HAU"FXHI$HA=#HA9"HAk1C J!I!H HA`[@рI " B08HȊ4 kM< aarʋ=ԉ0m1;I " By0DGxPHjD1 CcD1 41#FJ4A-1+? 01J#F0A 41#FJ4A-1 !T0}HAJ 0xIxH,1+ !:0,1+qJqIrH(pHA$A@D1CD1iHnFhHAD1 FC@D1U(FFYIaHG@1Ԙ FV09FV#?R0NIWHV`#V TIV"TRJSJSHTPKRKB0@IOH:!? kOqF0IHAHJ#FA8d!*@1Y\Cs@1h1 FA)I:H # d! Bh+0*ӫa0IT  A F?@1[*H>h!R#BbX PFh1S"Az 3 j+ @Fh1S"j)9[h0> k3@=ԉ$(Ik&C-y ،pE FB&@1^ F?+ph.?`1XԚF2 /PN՞pJQP4I   A_?)FD`p.Nh-?+j;3F"!Amh 0#2FIF@F@3jC0F?0FA('vhph/:Fj 2Rh*?!KA2s`h F`A$ph,OpNB`D7 )  Q/0@-0 tl P ^0wod@0 , 0 010/ lL/p@-MdPP@T Ѝp `H0   @  ž 0 @ໞ`x\0ƒ S&* 0@- "@ R P@ 0\ R^H00"@<0 0 0^$00"@0/p\@-M @)))Ѝ kl  \/\-M 0 p 0 S 0 /O0 Ѝ\ml⎎w,( /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/0*/)-*/=**/'*/$*/"!*/*/*/*/*/////^ */ */*/<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*//7*/>*/ 4T*/ */6 */*///*/@-@J@*/*/*/*/xGxGyxG^xGWxGIxG糕xGRxGxG=xGxG)xG.xGxG*xG白xG[xGxG?xGFxG)xGgxGy)xGQxGgExG܆xGPExG xG#xGrxGȑxGzvxG1xG羼xGxG.xGxG(xGxG矎xG)xG>xGf(xGSxG=xGrxGxGxG/)xG甕xGlxG ..., where is one of: %s: %s not compiled in chmodddedlnlsmkdirmvpaxpwdrmdir-shsttychownchgrpdkctldrvctlfdiskfsck_msdosgptifconfigmknodmountmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfspingrrestorerouteshutdownslattachsysctlswapctlftpcugzipgzcatgunziplessmoretsetchroot=ȏa!H"]&U(Y(*+vC+m.F4/m3!4!4-7ia9u9u9TI<uC DG"NVZ-N1\&`*bi4k:p@tMtHNtZ uguXN#us;uUuUuBC!{)UbE(LM"a;=l%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'%s: %sfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s -> %s %s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory w  A y<I@@ 1@@! B @@"Y:@@,unblock and -DNO_CONV?0`H<TI9oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekprogressskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblocks%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %stotalUsage: %s [-] [-ESsx] [-p string] [name] %s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp file unexpected end-of-file& no previous commandp invalid pattern delimitercannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input filecannot write filewcannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\invalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxES ? interrupt? warning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopno matchnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw.%lld%d %s: %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too longout of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodirxz+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2filedereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdateverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sMODEGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s%s: Fatal error, cannot open %s (%s)usage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directoryusage: %s [-p] directory ... W WWWWWWWYWXXE'XZ;XPXjXX#X X_X^XFX<X>X?XXPATH= s8bt680fjC bdb bsb0c)b bm"b bl0b7br ?b]pGb\nOb bv Wbd"b    EOF reading here (<<) documentQg]gegigmgrgwg{gggggjeggggggggggggggg*g0g5g_:g@gZFg7__LgP&}-+?=8i@iiiiiij jj@8mX_iL_O_R_U_iiabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'!0Xl`!1`lL!1fl!8pl!0~lB!0l̩!0l!0l!0llE %= AK5}WhN{ cKl ^  cO"##0mo"4m` !w9fik8m                  ^n<dn<m=mnA+rn;%"l^xn=bIn >nn >n $n5}" n n oene`>nYoneon5 QnY$MG^~n9#nnnnn >AJnYnWnn5nynlvv onAlias count botchalias %s=aalias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld getcwd() failed: %sPWDOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %s-ewrite errorerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4f0.0Pipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode ELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misused/dev/ttysh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld Done(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d /dev/nullCan't open %slpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(()(...)<>>>>&<&>| && || ! | (if ; then ; else ; fiuntil ; do case ;& ;; () { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)secondskbytesstackcoredumplocked memorythreadthreadsprocessnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPSc, offCurrent option settings%s%c%c%-19s %s set -o default %c%cdefaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenonoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallvixtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntildoneesacend of filenewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)+-%s, +%#xinsufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<<asyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXIT---pUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=[]missing ]unsupported expression when built with -DSMALLeqgt>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'%s %sbreakcontinueevalexecreturnshifttrap:unsetbgchdirecholetfcinputrcfggetoptsjobsprintfreadfdflagssetvartrueumaskunaliaswaitulimittestwordexpPPIDIFS20220122 BUILD:20250404162450Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed^vfv dlvpv)vv{vvZ# v M vxK v s8vyRvXv:G rwUyw/ ~w/ w 7 w+ wW w} %w ww Z2wwIwwC w #)w=wxxxxI#x3x#x3x2x3x3y#tz yy]z y@ y@$y|zz,yxxyxzx zy x@xxxMxxyy wC$wCxC$xC xxn x&x/xXy_y6x>xHxgyPx@Xx@`x hx =yrxyzx@yx ywwwwwwww?z Fz@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sflushrprntdiscarddsuspeoleol2killlnextminreprintstatussuspweraseillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeed%d %d TIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscolumnscookedeverythingextprocinsanenewnlostartrawrowsspeedttylitout-litout-tabsopostonlcrocrnloxtabscrt-crt-newcrtkerninfo-kerninfoechoecrterasecrtbscrtkillaltweraseiextenechoctlctlechoechoprtprteraseicanontostoppendindecctlq-decctlqbrkintparmrkinlcrigncricrnlixonixofftandemcs5cs6cs7cs8-parityevenp-evenp-oddppass8-pass8creadparenbhupclhupclocalcdtrcts-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.userfts_openAIQ@'@W@_@f@n@w@|@@@ @@@@@39őˑёؑޑ @@#(28CJP V\dipw5glɎَ /?RtΏُ׊ œ˓ғ7ٓݓ2;eILʒԒݒ׊ o#"-27;?IOS[_eit'l-29@GNW^glqxŐΐא  %-39׊ œ˓ғ7ٓݓ2;eILʒԒݒ׊ o#"-27;?IOS[_eit׊ œ˓ғ7ٓݓ2;eILʒԒݒ׊ o#"-27;?IOS[_eitchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# unknownline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/tmp//usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXEDITORmalloc-c/bin/shre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashdmrumpdmd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsyesAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tableQquitrounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] jUsage: %s device %s device command [arg [...]] Available commands: forcenonerwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grewfalseArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'Rn˽ s   پ  "7Viȿܿ; W!g#g$p&g1g2x3g4g56g899:;<=@$A8BtCDEFGHJL%M6N=OMP]QoRSTUVW\acdKemfghipqgsgtguvgwx"ANcr6Nh,FLeee?gggg'?Qj]3Riq (0bv-ggafy gg /BUa/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]C@cB@*  ***:@++HP+VZ+d +jnrB|&+returning to single-user after filesystem check rq,%s-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sexec %swaitpidInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbinunusedVersion 6Version 7System VEighth EditionMSDOS4.4LFSISO9660bootHFSFILECORENTFSccdjfsApple UFSUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware VMFSVMware ReservedZFSCan't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s Can't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s ** %s (NO WRITE) ** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors reservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dDIRFILENAME=%s %s=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%s (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ffs ***** REBOOT NOW ***** beleAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSER** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'%lld BAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCKf** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)CAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK GROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODE (CREATED)can't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-:0$L$S$f$q$$$$$ %%(n(|((((((L45h4444444505H5 6`55555*  ***:@++HP+VZ+d +jnrB|&+5+>+Z+m+++++, _, ~, , , ,,-,$-C-V------ .(. D.!#$T.&12\.345x.68.9.9.:.;.<.=.@ /A/BY/C/D/E/F/G/H/J/L 0M0N"0O20PB0QT0Ri0S0T0U0V0W0\0a0c0d01eR1ff1gy1hy1iy1p1qstu1vw1x1112&232H2W2i222222333M3k3}3333334+414J4J4J4j444r`444445 5%575P5Q7h5{555555666696X6e6}6666677$7V7j77777!8U8Z8gn88888 9/9B9U9a999SFH0eCqB5SFU0eCwBrHah!IdontNeedEFIBB(s*K>;BB|nQn- q+BB|nQn- q+BB|nQn- q+BB|nQn- q+BB|nQn- q+C=rGy=iG}CC;Mt?C)CmWC 3KOO4CfyD<#*=(@CJC3Dh&TC\C\ M}-oCC-чHjC-чHCZIчH@CIчHcCIчH$CC2IчH*CS'@ )ѸDdD*1@ )Ѹ D1x )Ѹ%D/Dbackupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdecCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]PriSecEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%jumbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]swap4.1BSD4.2BSDunknownHPFSADOSLinux Ext2RAIDVMware vmkcorePrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'removedab:i:L:s:t:remove[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q] a:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) Attributes: NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5d show[-aglu] [-i index]type changedab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-la:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changed-ao:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXendattributesgpt_arrayGPT_TBLCan't open `%s'backup[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endmbr_arraystart_sectorUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsT]b]q]setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatus+e2:printallmaindo_setifpreferencedo_setifcapszi7fyinnn7\:fnn7_;x;[:hev;]H;fI7c9f7@^:f:f7f7ggg'g3g ?gKgWg@cgog{gg g0g@gggg"g gg g@e2:init_current_mediasetmediamodesetmediaoptsetmediasetmediainstiGiiEii+eii ii`ii@iiiiEimedia_statusmedia_constructoriihhX<hihhX<hihi<iiii <iihh<<hih<paddr_match]A]s[]]settunnelj7j<print_link_addressessetvlansetvlanifkh=*llL=Hl*lsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanrr r#rsethidessidsetapbridgesetiffragsetifrtsIr=Hr7Pr>OrPr=7qx>nqu * 7^#?VrX>\r >[r7cr>brcr * 7JrX>m(>wr) eqeq9 nqnqu ll%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sinetnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflagrc/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLnot a broadcast interfacedescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedmetricSIOCSIFMETRICSIOCSIFMTUifcapsifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATASIOCGIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPdownifaceiface-opt-familyoptional silent familyopt-clonemiscifflagssilent familyiface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandsnonewait DADlist clonersdestroydeletetrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6arpunnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediasubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasteractiveno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0x%s: getifaddrsaddress:link%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tag?NONEAES-CCMPWEP40TKIPWEP104AES-OCB...SIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s8LVlKbbrnfl r€ ʀzЀ@7usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o  0^Μaxޝ9oʞ7iş /%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatmaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %sexpected files per directorybytes per inodefree space %use `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big ...Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device where fsoptions are: Bad inode size %d (only 128 and 256 supported)sector sizesector size `%s' is not a power of 2.block sizenumber of inodesVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: open for read%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s%*llu,%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @=BNC]FiILNOISƴa״bcefh_ikkwmnorsŵuֵ@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp ` @  $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectorsCan't parse timestamp `%s'sectors/track%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'bytes/sector"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u%s: can't write sector %u%s: unknown standard format1601803203606407201200123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()~WSOKGC?;7usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /tmp/option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: out of memory no filename match. glob() aborted. unknown error! cd%s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptywarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d seekI%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY.Fo!MGUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkchangedstexpirehopcountinet6lockrestmonitormtunostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_print` *p U+|  U+  U+ U+  U+  U+  i, - -" U+1 ; U+N S /i  ' ' !! U+  U+  U+  U+  U+  1 U+  U+) 1 U+I P U+o s U+  U+  U+  U+ U+1U+LU+cU+{11U+U+-%%U+ U+U+U+bitmask_scan     %07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%#llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s???%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address boolquad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexNODESTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worlddpswpriority=nfsmntpt=empty mountpoint%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytes1M-blocksGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpfetch_ftpfetch_urlV333sendrequestrecvrequest+:/:3:7:;:?:***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. r+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129Version: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistoutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernamePASS %sLogin failed. Account: Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sAccount:?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. MLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicftp_proxyhttp_proxypagerpromptasciibellbyecdupdebugeditepsvepsv4epsv6exitfeaturesfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepdirplspmlsdquitquotercvbufrecvregetremoptsrenamerestartrhelprstatusruniquesendportsitesizestructsuniquesystemthrottletrace'%s' macro not found. ?Ambiguous command. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s] Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initRequesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandQUITCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't connect to `%s:%s'Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR RETRproxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEpassiveUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpasshttps_proxyno_proxyPAGERFTPPROMPTFTPRPROMPTsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. loginaccountmachineMDTMREST STREAMTVFS Remote system type is %.*s. unixlinux215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEATlostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): USER %sPassword: Login failedACCT %sAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for on[set] ~{[*?$`'"\echo %sfork"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dlink downunsupported speed %ldConnect failedescapeparityphonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraectbdchfesprdletdvcmiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zero%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busyPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5d n r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizehostphonesraiseraisecharrecremotescriptsctabexpandverbSHELLechocheckdisconnectlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gzxxxS- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data5Cannot allocate memoryLESSLESSSECUREmoreVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESliCOLUMNSkrklkukdkPkNkh@7kDhcxndaticlcmsovbbc|^ crsrNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE/dev/nullHOME.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]& There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~\LESSMETAESCAPE%c%s%cSHELLlessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ %*s Line numbers turned offCalculating line numbers/dev/tty (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadshifttildequoteswindowmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by textlabel%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE%lu \abfrtv><@=!:illegal -m option format: %swrite to stderr Terminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set tois%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i.464;B4:&I4R4j!&_4h3&h4*&t4}40.&44//&44.0&44#&4 5i"&5-1& 5K1&)5J2&354&<5D5l&Q5-&X5_5-&i5.&s5@4&|5.4k &5P@&55l4&55h#&54%&54&&55'&56$&6(&6(&&6)&0645&<646&M67&X6f6+&x68&68&69&collect8~@8@t6x@*  ***:@++HP+VZ+d +jnrB|&+NAME=Bc HCmount_disks>      !"      !"#$%&'() str_arg_substget_available_cds*  ***:@++HP+VZ+d +jnrB|&+ edit_fs_type_extEWIc1Lq_oedit_and_check_label *  ***:@++HP+VZ+d +jnrB|&+disklabel_freedisklabel_set_part_infodisklabel_write_to_diskcdt A 1 7 m K E     - U   9 m g   5 1    m 5 Q disklabel_change_geomM 8outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_defaultpR&PR&R&R&pm_from_pepm_whole_diskgpt_freegpt_create_new m 7  % y ͠ s ѝ c - ѫ Q ͬ m   E њ Y # @*TCTCBBBc CqBj$CDd D%D C!:d*cccc@cccFPcccBdUj ddB HCdd!d*d D2dCgpt_get_part_devicegpt_get_part_alignment:L$$f$$ % Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eCqB5SFU0eCwBrHah!IdontNeedEFIBB(s*K>;BB|nQn- q+BB|nQn- q+BB|nQn- q+BB|nQn- q+BB|nQn- q+C=rGy=iG}CC;Mt?C)CmWC 3KOO4CfyD<#*=(@CJC3Dh&TC\C\ M}-oCC-чHjC-чHCZIчH@CIчHcCIчH$CC2IчH*CS'@ )ѸDdD*1@ )Ѹ D1x )Ѹ%D/D` Jf^fvf4&2ffdAffffff ffmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new E  9 E A ݻ   u Ϲ o - = o ) M u ɹ 5 mbr_get_part_devicembr_read_from_diskadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_freemsdos/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages/sbin/halt -q/bin/sh -i -E/sbin/reboot -q <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noexecnoautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 10.1_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.1_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.1_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.1_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.1_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.# Script ended at: %s sysinst terminated. # sysinstmsgs.TERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certsFTPSSLNOVERIFYsysinst: screen too small /usr/share/sysinst/catalogLC_CTYPErelease10.1_STABLEevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mountdist postfix.tgzdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/10.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script fileLog ended at: %s /tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etc/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF /sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/%sCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %sudf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s%.*s%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinstmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICdtbetccompgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c---%c-%c%c: %s %s %s %s %s%s %s %s%s %s %s %s/targetroot/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOs,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdatexdmlvmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%cr%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%u%s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%llu%s/usr%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %s (vnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing cat <%s START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zero/dev/r%s%cumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalse/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.c/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullSec GPT headerv7sysvv71kv8lfsotherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmkcorevmwresvvmcore/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0parts != NULLWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDLinux swapNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************iiiiiiusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading input%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETAKiBMiBGiBTiBPiBEiBcontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump2dhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_geteloop_q_timeout_addeloop_event_add_rweloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionbcdefgihisjklwmnopמqbrsȕЕtuvؕwxߕzyAB CDEFG)HI3J=KDLMMNSO\PiQqSxT}UVWXZ<146ƖЖ|~}!/-64;CHNTZt|^irBzΗ4vԗڗ default_configread_configrt_compare_proto7C 7C A A rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtB B rt_buildrt_deletemA mA sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initdvku~wscript_buftoenv?F\make_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osӞڞޞif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CD@DCread_leaseget_leasedhcp_openbpflog_dhcpbmydhcp_bind> dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceSTOPNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d timed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningkillwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccallback != NULLnseconds <= NSEC_PER_SECread_cb != NULL || write_cb != NULL%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurloption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptenvreconfigurereleaseleasetimerebindpersistentinforminform6timeoutwaitipallowinterfacesrebootnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0link#%dsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbindownPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.clo0%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIASbridgefwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigreading standard input%s: reading lease: %s%s: %s: truncated leasebootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s not foundviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\Br x ~   % = U m b   BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~\p`iķrx~ b@rhCxC~C4DxDDEDEEbEFTFtc/etc/group/etc/master.passwd: (malloc) Error in munmap(): JjhPUPuVvXxZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctupperxdigitASCIIUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist