08Pڼi'&<  'ڼi%RP''`'B. B.ڼi'&P@@<@T 08Pڼi'&<  'ڼi%RP''`'B. B.ڼi'&P@@<@TU ڼi`'B.yAڼiڼiڼiQAڼiڼiڼigAڼiڼiڼi|AڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiCڼiڼiڼiAڼiڼiڼiAڼiڼiڼi$f ڼiڼiڼiRmK#ڼiڼiڼiX`hpx$Ƞڼiڼiڼi(08@HPX`hpxQ$vڼiڼiڼiyR$Pڼiڼiڼi{I$ڼiڼiڼi (08@HPX`OmIڼiڼiڼihpx}[$ڼiڼiڼi$>ڼiڼiڼi$ڼiڼiڼi$sڼiڼiڼi$ڼiڼiڼi$ڼiڼiڼiAڼiڼiڼimڼiڼiڼi$ڼiڼiڼi $ڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼi$`ڼiڼiڼi (08@HPX`h$ڼiڼiڼi$ڼiڼiڼi$ڼiڼiڼi$ڼiڼiڼi$ڼiڼiڼi$ڼiڼiڼi$ڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼi-cz}x`WZueB@MR6;MQf-ėZYZ$q^kg%4LP8Y?T'd1iL]D)Pam=N?H\(OmoUq/!*59KUa\XB. . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELFP4ć#4 (d"d""̖0̖0T ,,"̖0̖0Ptdd7'QtdNetBSD@ ;PaXU|SR ffffUSWVP[Ö>,t$$uPejPjjj,j貹|$0F $u$!BtKj/V{)t@Ƹ%!&!PV`t&uVh|%!hd%!hN1^_`SWVh|%!h%!hN1e 1۸%!&!P0CPrFhN1j fPwh$%hN1 uhN1j 7PjD$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5,V19 u$1^_[Vh+!Vh+!M 5(V1h+!jl wVh+!j, USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S*!@tutD$D$$D$% D$t$@N D$l$V1VP D$D$<\$@|$DD$$D$Hl$Lt$PD$h0V1hs@$D$ @l$0tD$Phj$j D$  |$\$4t$,s$L$)L >QPh-!s D$  L$s()@L$L bQPh-!EL$ D$  s D t 4T)!h.!L$ D dtPh.!D$(@9XUM\$D$T$T$9tt$N9BD$4T)!5(V1h4-! 1h^_[]t$|h,!D%WS$hH-!he-!juUL5(V1h-!jt$|h+!5(V1hx,!3$h-!jhc 5,V1 u15(V1h7.!j4SWVPD$Hw#t$>4*!Wot ub8*!$h,+!WJt N1AQhc5,V1Q u 1^_[5(V1hL.!jUSWVP|$t$7ۧhH+!WV& fu h:(V1u H1)u (V1uhK+!`S+!t (V1hjQ ,V1u 5(V1h\+!Ih/K u3$()!SU:t uUh+!jhe+!j$NPVS)! PLVfN1Ph`.!V5 Vjjh.!蓡)!)!h.!hN1 uj5,V1WVοVt)!}tuVh+!jx)!^_VPΉj PQ< x $9u^Vh ,!jWVοV*!tuVh&,!jmt*!^_USWV\$$1V1 V1xW1 tW1sVj=P轞x<$hijjh.!U W1H F H W1VP3uW1t;#=t%{ W1##=uth0!@W1tttuHt!tcuW1 W1^_[] W1Vh(0!W Whh0!4$hU0!4$h0!jh0!h0!D$L$01V1PjPjt$h #LV1V1xW1tW11PjPjt$hF1!W1W1h]1!ja1hjPPt$hr1!W1W1 tj51PjPPt$h~1!<0tj W1u$1PjPjt$h1!xW1tW1ËD$W1h1!j1hjPPt$h1!HW1W1h1!jW1u$1PjPjt$h1!V1V1ËD$V1h1!jI1hjPPt$h1! V1V11hjPPt$h2! V1V1ÐSWVW1t/ pW1lW1 t5`W1)փ>8F u`W1V1dW1 hW1 V1V1;V1 V1r*jZV1`W1V1 V1 hW1dW1^_[áhW1 dW1 t V1V1h/!hs@$j3h/!hs@$j"h/!hs@$jh/!hs@$jUSWVt$|$6m "SjQkSVWB  u=H1PYW1u,W1b$W1W1/!Ah2!jW1/!1QQP W1y 5W1\W1 \W1 =<0r|W1uh2!롡V1u#V1V13!W1/!1W1HW1/! hQP V1yJ1W1H W1 hP5V1Q V1 V1y 5V1V1V1W1utS1V tW1W1W19xW1r_ \W1t= W1 V1E V1t# \W1) tW1I V1" \W1ujlV1 `W1V1W1 W1t V1 V1t W1h`u;5V1 V1=W1 V15V1VP5V1W W11VhPW1"hBjhGjԟ5V15V15V1V1h{-<0e=W1W1 W1 tW1W1W1W19ss$`W1 tW1tQj QjP_ W15tW15`W15W1P$ xd5xW1-tW11‰1 lW1 pW1dW1 hW1W1W1dW1 hW1W1 W1xPhs@$臜+|W1u6W1j5xW15tW15W1P  t5W1hs@$CW1 xW1tW1 pW1lW1dW1 hW1W1dW1 hW1W1CW1s pW1lW1dW1 hW1W1dW1 hW1W1u@s)t8W15V15V1QP`@W1DW1 W1$W11 W1W1T$<$t$ HW1-LW1l$13L$ (W1,W1D$11 V1t,V1u#V15V1hk2!4T$V1L$ AD$)ʋ$tЃ|1@|p9@|5W1 W1*V11 V1T$1 uK W1$W1I$T$ V1V1)ѣV1 V15V1-V19(W1,W1$ t V1)PQ5V1e V11V1V1 V1V1 t((W1 W15,W15$W1QPVR  tjh0m%j$^_[]5V1h2!5V1h52!5V1hY2!j5V1hs@$j4USWVt$(|$,\$$UhV1j C4WVs(P( 8jUj 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[h2!jV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu8u F ́Ĵ^v$hs@$jVP\9v Ve)VPQ. t1$^ÐSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWVV1 V1t/jhz"j: V1 V1tjhz"j 1t$PV<FȺMb׋ XW1-։+PW1D$H TW1iى tL$ 1FD$|$ 5,W15(W15$W15 W15W15W15W15W1h3!jdW(,WOPWj3 W12W1&W1W1W1@W1W1W1W1W1W1}ouW1j,U肇ƿt@Gj,PhujWV+W1lj(1Et1EF4Ej,V+ƅu$p 4=W1u#=W1W1W1.W1 W1=W1uȨth4!B Ȩ`-H1D$jPjW1)Ɖ=W1u =M=W1ui $X葪0rHPhB#hN1G h;!'h0IHPhB#hN1 h;!N^_[30HPhB#hN1 h8&hN Y1uáY1u tjwGjFUSWVjuƋ|$11K< @u=X1t?jj5(X1H 5(X1 X1$X1X15(X1UjWw A)߉n X1 $X1N F5Z1q0 [1Z1- X1F $X10FPhB#hN1 h8&Mrh;!]1H$X1 X1蠨0FPhB#hN1V h;!'w0XFPhB#hN1- h;!LVS1^_[]Vt$5Z1q0F [1Z1^WVL$ Y15,X19})= [179}> X1H09~vRO9G9~-H0X1~ZX1΋Nu#H0)Ou9~H0RN9H0 ,X1u Y1uuH0^_É1jDjDVT$X1t=X11X16X1t@9uхtX1uh%hK1^SWV1xY1$[1j?8h!D uh Y1uY1utj8I=!j&7WV dY15tY119}'lY1FىDuw9@u1=tY1^_USWVD$L$9tVdY1r=lY1~=pY19 t9|1CpY1Mu9|1CpY1=lY1 9u^_[]fUSWVl$}!uEh"PzUT1h"PÅt*t$Sǀ}!u?S~=V077PUh!"'hN1 h]=!=eS螞x(=Y1uWh2.!hN1 5Z1+t$006PUh!"'hN1ht=!=^_[]USWV |$$WơxY1$$[1D$ [11-xY1-$[19-Y1t\$=Z1t$ gDž~w11Y15|Y1Y6tsZ1PPjJ Å Y1uY1t$ Dž|$$\$9t$utt =!<$u=xY1t!=!9u $[1 uhN1P+9¡$[1Ƌ xY1Ӏu1A9|$t $ xY1 $[1Y1t )) Y1u Y1ut j4 ^_[]j3USWV1|$=Y1t WrGHOHt uG `-Y19}|Y1VY19rFU5|Y16-Y1|Y1 Y1u Y10u $[1F8W辜<1ۍF-Y19~NY1 |Y19wUQt7-Y1|Y1 Y1uY1uhtk|Y10 F蠕03PhB#hN1V h8&9 Y1Y1j2G @utL|Y10 FxY18$03PhB#hN1 h=!Y9-1|Y10=$[1=xY1  )Ɖ^_[]js1USWV|$?!uGhߋ!Put$WI,VPÅt2l$t$ US NjD$8!u?Sy=G0(2PWh!"'hN1h=!{8mS菙x-=Y1uWh2.!hN1 t D$ )@ʼn3֓01Pt$h!"'hN1h=!8^_[]USWVPl$Uƃ=Y1t1ۅtf;l$ `1V$th~;- [1u=$[1t =xY1u8 GWPt$ F x4EEs @6;l$ |=Y1tt$$$^_[]USWV|$\$l$19t[=Y13t UPrUPFy誒00PhB#hN1` h=!61^_[]USWVP\$5[1FEx @u}|~PVq6tjY19~lY1Y19SPgƉY1Y1 Y1u.Y1_tO5[1;^_[]Ë5Y1W5[1V輅 . ,1xщǃ|$uEZ1| /5Y19$~ZY19V5Y1 cÉ5Y1Y1 Y1uY1t Y1W5Z1U  ,$+HPS5Y1D( |$tM1BDžh/=!4萐0q.PhB#hN1F h8&41 Y1Y15Y19} Y1|$NY1Y19͋|$|MVPt05Y1Y1 Y1u Y1umua(/ я0-PhB#hN1 h8&4 Y1t1Y1uj-j/,SWV11M1H M17hM1u8M1@%fM19uM1H M1ÍF=[19~YY19wW5Z1=[1Z1 Y1u Y1t Z10u $[1F Z1C|0],Ph >!hN12 h>!2%M11t Z10Z1[1^_[ 0,PhB#hN1 h8&U2 Y1uY1u tj_+j*USWV\$ D$1tt$h'>!D$ l$1uHD50N1J 0N1;@N1у  (N1Q(N1;=T0|h(N1h3-%y1GD5 | <\t<0N1H 0N1;@N1h(N1j\(N1H (N1\\5tjj Sh,>!Ac tVG,>!)Ȋ5>!0N1J 0N1;@N1Vу J (N1Q(N1\$ !00N1H 0N1;@N1h(N1PF(N1H (N1D50 0N1Q0N1ɋ\$ ; @N1h(N1P (N1Q(N1D50 0N1Q0N1; @N1h(N1P (N1Q(N1Dh(N1Q4 0N1Q0N1; @N1~;ȃ t3 (N1Q(N1D$F9h(N1Q9h(N1P똡0N1H 0N1~(N1H (N1 h(N1j 1^_[]fWVD$L$L$$$0n| $ |r1Y1h>>!t$t$  ot9EtzSY1ǃxtostypfh:Z1먡H1  $)D$|$ta$8-uWY1D$|<H1bY1S Y1DY15$L$jjYgth+jF^1Fh~V5^Vj*^hj^hZ1Uƅux'Y1|$t$8t$0|$t[hN1hF>!u$8u hS>!_-jfu$hN1hE>!~uhI>!--y =Y1th[1hB#hN1} Z1tPhs@$vh(N1[ xt` Z1| Z1x51gZ1QPP M=Z1=Y1hN1hF>!thd>!:,jte%M1Z1h/=!,%M1΃t0hN1hF>! tje515Z1hN1hF>!shd>!+VdQ=Y1th[15Z1h{>!hN1jrjkAPh;!hN1 j蜹=Y1jXdunh[15Z1h{>!hN1gf$j0yjdt$8!$h0hY1{ uh[1hB#hN1 jL$ ɸ!Y1Phht@jx x#$rP0D$ rT0ËL$=Y1t1@ Y1Ql"L$=Y1t1@ Y1Q#WV1F=Y1t9|$ ?!t!hu,"Wtj/WQth?!)1^_Z1Z1[1[1x>Z1 [1 [1[1 [1;t,uQ[19;uZ1빋 Z1| Z1[1t9t[11Ƀ USWVPtU1[1DJ@t t@[1@DJ@t uHH [1~Ã=w$9!=Z1!h?!  !=Z1" [1A1Qptntl  Ӊ [1A˃=Z1FP”^ U [1@߈\$ ̀1ۈL$QuH [1H1KDB@,Aǡ [1 Z1  Pj  5 [1j$1  ˣ[1@̃=Z1t=Y1y=Z16DB@jLǡ[1@1Hptntl   ˣ[1@̃=Z1DB@8!h>!=Z11Hptntl  ˣ[1@̋ [11PptntlN  ӣ[1@̡Z1HQPN"[1@1Hptntl%  ˣ[1@̍H [1 [1 p1Pptntl   ӣ[1@̡Z1PPv [1A1Qptntl  Љ [1AˡZ1PPH-[1[1=Z1=[1 9= [1 -[1[19 9w hA?! Z1PP [1A1Qptntl  Љ [1AˡZ1PPl@ [1A1Qptntl  Љ [1ADB@;h>! 1ЍrЃ sO}j h[15[1vP [1w|8"%[1 [1:o t!gc ptrP  A [1< b=[1Ho1Z1PP9 [1-[1 =Z1=[1 9= [1[1-[1[1@1Hptntl  ˣ[1@̃=Z1F1Hptntl  ˣ[1@̃=Z1h>! 1@[1 Z1AQP2 [1<8{j h[15[1N P0{8"h>!NP0 [1x w =Z1 [1t[10h?!蒴 [1x A =Z1u;.5[1O1@[1 Z1AQP@ [1jPP>[1x  1q1ۃ=Y1Ƀ=Z1 ˃h% [1x  =Z1u-5[15[1 5Z1g [1x ? =Z1uL-5[15[1: Z1@; [1?7Z1-[1x =Z1u , [1IQ T[1x =Z1u,[1 [19QPn[1x QVP [1y F( [1y 1 [1y P5[15[1g [1A1Qptnt lu  Љ [1Aω [1y  [1 [1=P09|PRQ 1=Z1u [1[1 ǡ[1@1Hptntl  ˣ[1@̉[1z !Z1SPhA[1x  1@+Y1Y1uF%[1x h:uL0=Z1t1Z1[1x =[1h[1hB#hN1農 [1x }*x1Hptntlu  ˣ[1@У[1x 'Y1G1[1[1[1@Hptnt lu  ˣ[1У[1x =Y1Y1u,"|$Wtߋ!5[15[1QP'; [1Z1[1x ==Z1uJ)=Y1Y1u5[1Q5; [1)Z1h,?!hU?!h>![1h%[11< *5 [1y qt [1@P  [1@P=Y1h%+[1x )5 [1j 6'(Y$i*t!D [1y u38thPhY1f hY16PBh>!th>!^_[]1۲8j USWVl$tD$9 [11h%]R@PU9t7ǻW=t%O-Z1t$UQPx E?9u1ۉ^_[]USWVPtU1-[1]DX@t tE-[1]EDX@t uM5Z11ɉӍz6$:!7oj h[15[1B {o8"m}@[1Z1;tl1@lN@[1Z1.t [10$)%1ɀ/QPUơ[1:@[1Z1[15 [1^$ tU1@[1TY@t@ uu+$DA@1^1I-tЍ Irmj h[15[1VA $w m8"tN؉^t-t!u*H [1@P ƅx#[1(%>!P^_[]9t%x95 [1}1NUSWV|$l$Z1t 1; [1}hA~I5 [1tPVP[tMǃ=$[1tj jsW1PPPWt$$J0t#Z119uhn?!^_[]ËD$ tU1DAuh?!4Y1SWVD$Z11=Z1t([1;C1 8 [1<; u&Z1| u;.u { Y1StXáZ1tPFPPjq ƅt-9uZ1 Y1;Y1uC*@ Y1u Y1u!u#^_[1%M1jj=Z1t [1 [1L$D$[1 [1~9 1; [1h%BUSWV\$|$Y1SWj t 9 [11 Y1um[CPƍoU}ǃ=Z1t V7F7~\$ [1-Z1Z11 Y1u Y1u u ^_[]jjVP[1 ui5,[1Y1V5([1;5,[1([1 Y1 Y1b[ tU1DQ@t/@[1DQ@t@ u uhS>! 1jP[118!@[1$t [1@PU5 [1([1$[11ɀ: t$1ɍr5[1q4$[1: $uP@ƅtj5([1b<$hw?! Fh0PhB#hN1T h8& 1 Y1u Y1u u^j jSWV5[1}ZY1W5[1ti=[1[1 Y1u Y1} &[1NT$1\uZB0tFB9u^_[g0PhB#hN1` h8& 1 Y1uË Y1u tjjUSWVPD$9 [11@P0t$"4$91S肻ŋs D[19~YY19V5@[155D[1@[1 Y1u Y1t Y@[1sUPZ {;$\15D[1G9~ZY1 @[19VQ 5D[1@[1 Y1u Y1*t @[1f8 t$t$VN5Z1Y15@[1taZ1PPj tLZ11 Y1e0oPhB#hN1D h8&  Y1tUY1uZtCj7e0PhB#hN1 h8&l  Y1t ȃ^_[]áY1tjD$ tU1DAuh?!' ËL$EEp $A8GMi [191[1)@أZ1=Z1t W6UZ11 Y1u Y1u u^_[]jjSWV=Y1uj貽L$ɸ!Y1 [1Pjhߋ!h?!Hy|h?!/CtkPb=Yà PetGWP軔|3/tf/VUbed.hDhup5 [1jhߋ!Vj=Y1ujL$ɸ!Y1jhZ1/USWVPl$5[1'Ƌ=[1[1-Z19ʼn) u)E1u1$Y1E@Y1V}tzP蘹t_Z1PPj DžtOZ1Y1HY1u Y1u[uE6MZ1@Pi1,$l& Y1u Y1ut j1^_[]jUSWV$Y1 Y1th?!ckjP~[1L$F$ 4[19} 0[1VY10[19|BVPd54[10[1 Y1u Y1! [1 u1C1E҃!%=Y1hY1P_Ɖ$ 4[19VY19V50[154[10[1 Y1" Y17 09L$]9Y19|WP2=4[10[1 Y1]9~[Y19V50[1/54[10[1 Y1u Y1yt v0[1 [1 (E [1Q[19\u=Q[1I ( 0[1G (E,$s [1L$A [1 [1y 8[1)9~_Y19VPI54[10[1 Y1u Y1 8[10[1| [1A(EA [18[19r [1L$A [17 Y13/ [1Q[1 ( [1݀ (5<[19} [1RY1 [19|KVPt]5<[1 [1 Y1u Y1S50[1PQ [18[1D$1!P\0PhB#hN1萘 h8& Y1 Y1u!u#^_[]h>!qhI=!gj'jVjtL$Qq p PIH19\0PhB#hN1 h8&n1^V[1t.L$19 H[1uH[1H[1t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h[1דXWV [1 td< uh=!1 Q[1I t;8t7P1ǡ\1t?=[1u6PH\195\1h?!R5\1j{\1tV[15Y1WPc \1t.h'h[1QP5\1\13/zZ0[PhB#hN10 h8&^_USWV=[1 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-\19}=\1MY1\19|KUPtYlj-\1\1 Y1uY1uyS5[1WM 5[1=$[1tsj jSWmeXY09PhB#hN1 h8&1 Y1u*Y1u(tjhRm$h?![1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u[1 u\1E#t[1 uE1^_[]8uP[1HЉʀπwRWj h[15[1S+ 1wW8"uh>!1gu@[1ErUSWV[1H [1H%u,8Xu'[1\1hU?!t18u=]19 \1L1}5]19~[Y19V5\1#5]1\1 Y1u Y1\t Y\1 [1Q[1 u (\t u^[18uT[1H [1 \11< u0=Z1u't Z1| t %M1ى[18Y1\19|NWPt8=]1\1 Y1u Y1uuuw5\10\1M1IU0PhB#hN1 h8&1 Y1u Y1uu^_[]H[1,j'jUSWVPL$Z1[119[1}%Z1ȃ Ehn?!Kl$ Z1PUVPt$$KǸ1$Z1PP]1Y11S̪áZ1tP芬EPPjM Ņtl9u Y1l$ uY1ue$Z1[1+[19}yFZ1@Z1P%Ut$ Pt$$hDž+9 Y1u1Y1uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=$[1tj jvS肮vލD$jPjSut1t$ED$$D$1E $A9T$ 4]19Ɖ $T$~cY1t$ 9V5]1\5]1]1 Y1t$ T$uY1=$[1tjj RS藭T$=]1RSWF 4$D$D$ ]1 $9~bt$ Y1$9V5]15]1]1 Y1t$ uY1=$[1tjj t$(S=]1t$SWE Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu&D$)D$]19~VY1 ]19SQ]1]1 Y1uY1|$~#D$$ D$ ud$th?!$=$[1\$tjj SV賫]1SVPD ]1f |$%C=]1]1 Y1T$uY1ml9}C ]11F9u,$y^=]19}]1_Y19|W5]1#=]1]1 Y1tT$ Y1T$M 0E+\1;\15]19}]1JY1]19|KVP葿t)5]1]1 Y1u Y1u^u`IM0xPhB#hN1M h8& Y1u Y1uu؃^_[]jjfWV]1 ]19|ld ]1j Qh ]1aF tJPPhB#hN1 h8&@5 ]11 ]1]1k]1L$t$T$ = ]1@Q葤 ]1]1RDVu ]15]1@LF5]1 ]1^_SWV]1]1r9 ]1@<u|L19tWW9u]1Z1X0 [1\0^_[USWV=X0=\0=]1t Z1Z1$ [1D$j荣Y1]1 ]1ÍS4R4nr@44v\1L1 [ ]1\1l1sRt6,lmL)1 ]1t)|?wt)LI1 ]1t~l)}L1 ]1,u44vL1Y ]1l1}w4R4Ӆ HA9~R ]14@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=Z1t׫X0Z1$X0\0 [1D$\01 Y1u) Y1u&tj\h @!$^_[]jlUSWVL\$d3hB!)B!tNjt$`hB!SVӛ fttu=h:߃u H1r|$L$ D$1$@!FC!D$PHƋO9rPSt$ < tu;_Յuͅu t$hB!-|$dD$ Du$$1Fl$?uSt$ hB!juL$j QP $;Fl$|1ƋD$8u&1zPU`y!Uhs@$jruD$ thB!j.uNjC=m@!sHQPW{h xs{QPWZh x4$Uh C!Ł =muqB dut\$fCShmWh HefD$t$Shmh=m8@u֍D$Phm8@Wg y?60Ph"C!ӍL$fqQhmWg 3Uh "D$ukD$Php!hC! T$o!hjD!T$C!hD!0N1H 0N1~(N1H (N1 PhC!kh(N1j 豅t$8t$8t$8t$8t$4hC!`t$Ht$Ht$Ht$Ht$8hD!?t$h7D!.t$ hPD!jyPhD!hN1 jxSWV֋|$t D!?tD!VQP JB80N1H 0N1;@N1h(N1j<轄(N1H (N1(N1H (N1>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hD!z$thE!PDu]1hE!P$thE!P~Du hE!jhE!hE!) 衁Pu h8E!jp0D$ u hHE!jpt$,)݉\$D$$D$11D$$hOE!SU輕 c7~+Hr߃8tlH w&$D!h:$뼃4t6맃dtket/1@D$軀=h:umWt$KCXh_E!5h:KD$71@D$$+L$ H1 H1T$uAH1$T$uȋ$D$,jj@Rl$L$ $tL$ $L$,1ۋD$PACEu Sr)St$PʼnD$$I7 U`Al$$T$DtIL$ىL$$U$E L$)QPR6 4$ AEuED$ush_E!h$0u]hE!bhcE!XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh]1t$ t$,QPRut$ 裷yjYs=]1y hE!|$$tQt$(jVjhS蛉y hE!jVjh5]1ry hE!h_E!dǽt$(1CUVSwD$P1UVSw5]1t$,~1L$XAAA @D$HPQSc =]1u'l$hD$h\(jUD! ul$uDžy h"1O~fVS5]11 VSt$V1 |$h5]1el$0fE<u1?u@hWjc u>8>18tƉjjUc tD$68Zt>8tEVSt$b x )bf>8#ThY%|$l$8fE=]1ul$0fE9EjD$LPjb |$@f9fGfG]1G$jVUb tQf|$<tٺtf|$4t?]1L$0u+fD$<=]1ufD$4 =8t$>Nf|$Dt1BuNfD$Dh|$u%j t$bhE!jt$,djoh=#yh#F!PhE!hN1xjoPD$L$jQ5]1{` XUSWVA1K8uSt<։<hU7a ~WUV.` ~)u1x<1ۃ8#ۉ؁^_[]ÐSWVP|$\$WSMƅu]jjجtqƉx jPS ǀ;t$8u< <8"u(G=w(rfljF^_[ÍG=rhh1F!jhhHE!jhfD$0_jjnfP= ]1tD$L$ $QPj XWVt$|$ t8PhF!jm 4F $]1A9tL $]1^_SWV\t$lt8|$jYPW. GYF!Ӄ(Ӄ,T6F60诱4衱8蓱WVd^_[USWV $8 $4 5(]1V9PV0W5F!1WWPփ (JWWSփ _ƍ Wh PF! WjjWF! TVF!h H<Ƹ jPPV(F! hVU- VwE=a==hD$\jPSF! 1Nxr$ S8ǃW蝟0t^SWPN tg0$8 hF!j0h+G!j 1N ^_[]þhF!j۾ShG!j ¾hSG!Vf=bt =buk $}u+Zt$WSVL$ - FYD$t8ShG!#ShuG!WVP 1QQt_0( Lt5,]1tQP%0,tt|@P՝Ɖ4P轝8tg04@tt| r>1A8Љ4DAtt;L5rShG!j 10hG!WV|$x$t,WDWLDWDW8Dx uWnjtw\wXX4=09}5PBt850WVhG!#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,4* t$$jPf8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W襝$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,W( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,u' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP4̀ uCt1t RPL$`QRPVD$tP>D$du ppxjt$d>:3t$3|$ uK$@k,PUdD$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph1K!,hK!|$PQt$ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx t$RhpK!jfC$t&8$\T$XT$H|$RQt$t$VhK!j$L$l$8h8L!h(L!hhJ!݈USWV u|$WT1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu hH!j=NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWP!l1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hBCj,PS+eD$HPhF! |$0hBCj,6SdtND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWh8H!jA^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPhSH! 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ 8]18]1@]1@]1P]15T]1D$D$TH Qq T$T$ t$t$QShM!j謹 11KL$0t.[SPhJ!j腹V5]1[S]14]1t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1h ]jP8Y[8H H;1D$8<9]18D$D$ tD$tD$,]1ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP7N!PD$tD$t$t$8WSP7N!Pj聶tD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhwN!D$8Ph]1Vt$,V'~GD$D$8D$HD$L$PD$LPh]1VD$HD$8L$ $\$(\$(u@,,L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L H]1L]1tt94 S.8,]1T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$PhN!"¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVhN!D$8Ph]1St$,V~D$@s, D$¹tt;<FG;D$ L$?-VhN! QhM!j訲 $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP(;D$DT$@D$(4t$8t$t$t$0|$(WVhM! HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1QhM!je1gD$4$DŽ$߬$D$D$D$@$߬$ F!a111CƋD$|$8D$|$H|$LjD$LPh]1VL$HL$8t/]1ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPhN!b11ҋt$  t<=P]1T]1$T$p$1߬$$$߬$8]18]1@]1@]1DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP"31A1ҍt$dV$Vt$4t$4VWPnD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4s*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=]1$t1J8D$<D$ۋL$؋]1k,L$1T$9|L$$)щL$ Ɖ$D$HPWh*O!W $PhD$(F! yNL$ L$tL$L$8]:u*t$ tD$PhP!j ,uhGP!j謠 uhdP!j蘠 M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$P+D$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPCD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP3D$ t(Gdt;<r61@hft 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWfNJ1 t1t$|$ 9|1t$$Mv]t$FL$|9 |$t$T$$u Bhu:4$BBRt RPَ4$]0hVP ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhvR!j臜T$$BRt RP1RPVWjt$$VhGR!t$$)uk,PdD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`PhR!jX D$,|$D$T|$XD$TPhF! t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$]1 ]1 09|[5]1tFNu ]15]1t5FNHNFy F4VPV]1@]11@j@PVU1@PVF ~4D$F(^$F0^,n#0^8]1 ]1t q4]1^G FtH 7~ F^_[]É ]1=h>T!h7T!hhVT!h7T!hhS!3SVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP ]1H]1N^,H ]1]1]1H@]1P ]1 ]1H]1H4I]1H89t;tprp]140]1t4F ]1H^hwT!hpT!h4hS!QUSWV}]uuu W@t ]11@]11HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$gF!sF!G4$O,50w0VPww D$0^_[]USWVPt$ffF!sF!F4$N,=0~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ jR8p ]1HtƒQ ]1@ ]1^_WVt$ ]1F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdObF>bhjv v!b^_bUSWVPT$|$:%4]1\$ ]1$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4m11ہ=]1| t Ptm1]11t 98t@^_[]Ã^_[]`V15]15m1hVh]1 5]1^ft$ t$ AjSWVt$frLN4F,=0~0WPvv 1F!t\fv4V1AN4F,=0~0WPvv 1F!1;NuN^_[hP!P1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR)x׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSWw$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hW!hW!h hJ! JUSWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPQs3T$3D$M u1^_[]USWV(t$FhxFxF )yF F$|$0tfhj(FljPLtLXt uB\I\$$|$ C$|$4NhX!袊<1ɺPt`tLtt l$,\$(|$0uejDttPDttPDA 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=0lj0l$1 UPQSWVhj/DË}Pw S P G1PWH¹tTt 0߀<$u1 t1 L$QWURPVhj~CNjl$hu PG P E1PUtA|$4t hX!.SSWR1^_[]u C4CHKL1}Mt|$4t7hX!过t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhW!:$  $ V 19tQRh(X! 1@^USWV |$,\$$t$ tCPPt Ttt4RQhU!ܞN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$ÅthU!h(N1D$(u KHKpStURQPt$DljT$t h(Y!蔅u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRhU!^ m1VRhV!G T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhV!D$L$9tQP$$hV!݋t$Ht$nL$tI9ȋt$ tPQ$$hV!衋1t$7>\^_[]hLV!h>V!hhYU!5+hLV!h>V!hPD$L$ $QPj0 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$/W!D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt`|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$WW!nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ W ,@o M|$@ t"D$D$D$$D$$qW!uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$/W!,D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$Dm1uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWRƋD$0T$UWRƋD$0 u$$$UWRljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPRERP R$GW #RPQERPQ$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPh/W!TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPh/W!D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh/W! D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWMNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPMt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPLT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPK|$FV D$t RPK|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPHK t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPI|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP"I$ D$TBL$?ttXLT$BtJ J T$$T$ QPHL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPHي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVFD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv > t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0hW! D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hW!hjX!h hW!hW!h hW!hyX!h"hJ!USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQ襤 ^_[]USWVL$T$ Bm1ulF1GY!Uh"q,$0N1H 0N1~(N1H (N1 h(N1j au q1^_[]VkN1PPh)_!VVjjh`_!C~Y!PY!PhP,"hN1Y!ujUSWV׉΋*hY!U60Y!tCt[PUjhhm1s 5m1)q1t2m1m1WVS5q1P^_[]Uh+!j+5m1hs@$jIUSWV$:$D$VuP臤 9$j uPj ɮ1ɉ\$QSuG Ƌ8蠮8"u11F9Ή$<$`1ɉQSu r ËD$8Չ78"u !t$$Vhyd5q1襠 tbVhw[!^_[]jhZ!7jhZ!.uhZ!$h[!h+[!$p hE[!h][!j{$05m1h "jUSWV}E ph;$VƭFh[!V谭hʮ$V蚭SD$(P5q1OZ#D$0= M$L$A1yyy D$Phwd5q1[ D$tG\$ D$ L$|$j ljL$ NjL$IuɉNjD$ D$|$uhjD$v1111O w+Ow?u$L$A1AAA D$Phwd5q1q  \$tmt$ NL$,D$(m1D$FD$FD$ FD$$~D$(PPWt$,t$t$t$h[!/ KuD$1D$|$Ynhxd 5q1ʝR5m11111VQRP5m1h\!hxd 5q1肝 m1LQhH\!ww ww5m1ha\!lw_G|$9w  jPQ5q1%!¡m1tNSVPh\!Wt$ 5q1 A$9t1#Q:Vh(N1=}SVPh{\!{|كT$;r ZƉ[|$?e^_[]jj5m1h[!lht!h\!h[!hN1N jDQh[!WV$u>$jvW֞ s'Wh{dЀ5q1ݛ t^_jh\!j65m1h "jVPPhtd@5q1萛 $t%t5m1h\!$ ]!u\!5m1Qwm1$$N]!N]!s "QPh']!M m1$$ N]!s "QPhS]!( m1$$N]!s "QPh{]! m1$$N]!s "QPh]! m1$$s "VPh]!^5m1h\!jWV$u^Vhzd@5q1R tH$D$PWVh ^!b$PwwwwVh^!@^_%5m1h]!j`SWVP|$uX|$_h"S裧ƅthXZ!S菧u+1Qhwd5q1蜙 t ^_[75m1h "jUSWV|$0t$,1@`:H1$1ۉ؉D$h>^!WV qt\$te+$95H11|$7wWh|d5q1 D$ ;D$t-i9l$sUt$ƉD$l$묅hhPVN[m1L$ "t#RQPh^!|$ t\ư1P`VvvvvQPh^!_ G;|$ ru5m1h^!9$t1^_[]5m1hA^!jQ5m1hP^!jjP|$u1Phd@5q1譗 m1tQh^!XD$ 0Qh "jSWVP|$t$^h!StDh"S t@hߋ!Stt$',r1h:P1r1h:j/SlF r1r1ShtT$d3D$dD$ tTj/SktF1;tٍT$dm3D$dD$,t>\$At$8\$/Xe!e!h6f! u1\^_[]hf!TPhf!Lhgf!E5H1P1t4P=u'hc!h?f!hf! 5h:hf!j= r1u8=r1r1u~r1uur1ulr1ucr16 r1=r1u thf!-" r1r1t uhg!t=0uhg!1 $)|u D0j=(r1|$\G1PPL$lQPjWKt2t$d6t"1PPD$lPVjWKt50=(r1u4$P50Gu#$=u(r1r1 r1 r1 r1=L1 ɡ0=(r1t&jQP 0uT50h"jhhd1QP0y赛8uvhd1h/! t0d1 P1u0=(r1u_L$dQPy50hp!RQ50h_!1hd1hL!m:h`1hrdAPÍ 50h!mh`1hedA50菍 50h!hPh`1Î $$t(hQP50hz! $$ƒ 1>s1@![Vs ) ȣ1111? 1 111X11\15150=1=`1?w1 1=$1L[V$1? 1) 1>r$r$1 X1\1L1u 00]u1hQPA 0u25L1hs@$k500j50|VhT1u VhEg!8 11hX1t1A1A1ۉL$@1hX11 1h1=r1u#4r118r1 1UUUU)ʹ3333!!сisDr111t!tt1V1cԋ1 ,1011"1‰ 4181@11 <11AhQh(1H i-(1=<1 / ,1ً01P+==w !r%1H$D$ ʀŸw1D$ $}ȹ1yt1t  u<11I $L$9 (111O|$ytyt F9u1H$L$$L$ 1D$(1uh9}!$D$Nj 11҉19ʃ$\$ڍD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Eu9$r$$15 1=$101D$,1t T$$T$r1=$r1uu 0; <17=r1lr1_hq!"ET181uh!<T1L8L$(L8L$$L8L$ L8L$48\$81=0Ɖڋ\$4PVQRV*PSt$@t$,t$4t$11K1Kޅ`1PPPPPP =08hU!z118LFu=r1uRh˃!%tajh!1#!WjWWWP+h4!t҉V1u 1=r1ur1u r11g=r1T1D$tD$|D$hÉ!A811N=t 蹵@ 1~!WhVVWP+9tigfff։f51<1L$ȃjP,D$ u h2Q!j蘸h!71HL$ Ajh~!311D$Z1tB?t=]WSh>! ^1L$ DD 3$ D$tD$D$݃ u1 <11(1|.tq<tk؍}PWh>! 01,1(1t BD$,T2D$ TL 3$3L$ щtT$ <1T$D$,F9u|$~O1l$GVWh~! T$ L D3$3L$ tT$FЉT$9uT$1۹~!VWSSSP)T$ ‰ $DD$R1=ue1$@D$ $#D$u D$ e!1$L$19;ta $Ȣ1=r1ur1ur1u r1=r1t8X1~ hg!1~lhg!]h!4=r1u1Id1 ̔1t hK!4hg!tX1o1e$j*t1 11t 1t3$ D$ 1 u=<15(101,11|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 1|$E9u KD 1D 1D$1DL /X1 \1WQD$lPO{ D-Dr11ۉl$(-D$D$Dr1$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$01 ,15<1Dr1D$t$u~t:t  Iur1 щ $ r1t&=u1օ4$u 1Gr1tiH1Ȩuh`}!h\%谨H1tjt1=us1Ѕ$tNL1=r1u"Ph}!0h`}!Ph}!t H1 =H1uQ#$ts&%ta&%1H1tis1х $t4$P5L1h~!2=r1u5L1hr~!1t"11=u s11^_[]VPD$ L$ $QPAh!tM1H M1~M1H M10hM1tƉ t9tDM1H M1~M1H M1hM1sƒ1Y^hU!jUSWV1=,r1˃y CS t 15111 uY1ɉNVt11@5C CX!tQ!Ph!> h!{1He^_[]SWVP$0;0u+(r1u"QhmdP^ y h4#>11hX1<=P1u;5H1|- Hr11PuhɆ!V=<1~e1(1111 ,101Pt,(18C;<1|h!=Shކ!=$0;0u+(r1u"QhmdP] y h4#=^_[USWVP։j1ɉQPU<> 1O}t#Ë$8uj8"u r1^_[]USWVP։ϋl$= r1T+(1 X1tú "t $76PSRhy!T$7St$hy!D$7UPS\$ Shy!ԣ7PUSh z!輣77PUShz!薣7PUSh/z!~7?PUShAz!c77PUShRz!=7PUShcz!%7?PUShuz! '1PPPUt$(SRhy!^_[]USWVˉ1u= r1h!T$$8$43|$͉)uh "WhN|!ڝ |$Z)uh "Whq|! D$|$1:11 1l$M?>1"1KL$ u}tGE)9H9^_[]USWV,։L$D$DD$~!tD$!l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h5!) $1 1D$HL$LVSQPn^D$T$D$PVSUPR^D$|$ D$@VSPW6^ljӸ1=0ƉT$ L$@PVt$QR]PSW|$LWVUl$lt$,t$,t$(t$@h!W,hM1jdh1 |h"h1)1\$ $t < uC{ - tU1DAu<-j D$$Ph1 D$$\$ h&'S2SK|$(@D$PhY!SL $ϋT$ t։t=t$h|"S t't$h\!S ct$ |$@D$1=0ы5@r1jVWRz\D$ՋD$D$D$D$D$$t$t$D$$  T$Dr1u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th"Sa< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRh!"1V\ƀ1t$Vh`! 5@r1D$,$t$P։ω,^_[]hU!jUSWV΃ twttu!^T$(|$$+Dr1уD$ ;,1 !L$ 01|.|$,T$0 81|$9=41|=r1u|$4u 1^_[]Ë-<1~} ʉ$9tw(1|(tk ,1t( T( (t1+Dr19\$ \$$}2;T$}#=r1u6|$4ttD(OG1nF0!t(n9Չػ}n9l$\$QAuƉ1tt  $tt ^1 ,111 01t$ -<1t$|$$|$}(1] ʀ|(tP ,1t( ;L$T$|L( (9Ή} =r1{|$(t ;(1KC 01,1T!1$t=t ,1 01S!=r1|$(5@15(11D1@1<1814101,1Ɔ1t$ |$(P19@1u85(1N1D1@1<1814101,1(11Ƀ|$(T$3\$1 5<1n (1|+D$Nu (1[\$j5Dr1,1)؋ (1P|$(t$ hhj(1VfǀU@1L$ 01D$,1ƋD$$ȉ54181<111<1u(1=r1h؁!!u*!!=r11|$(9 @1u85(11D1@1<1814101,1(1Ju UPQU <11|$(tD$,1D$01541=81^_[]h2Q!jWV(1t^ tڋt֋|҉tΡ(14 <1 QPV <1ƀ^_USWV T$L$<1@hPh(1O  <1(1~C01,1$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR (1;UjPI fDŽ;UtZF , M ;M;MU;; ,1 Dr1T$)ʉUL$  Dr11 EE=$1 1ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M<1 ^_[]hT!j蕁WV1= r1Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5tU1<tD~t@ uB 1u€πr<r1@^_USWV 0D$Ӌ50݉t$މ$!!jVWt$-F!1Kl$ 00uhUPvzQ5T1Pw ;0u[jVW50E!1Kt?D$H5T1#$SUPF 50V50\v ;0tÉ؃ ^_[]h!jUSWV$0$,1@D$l$D$D$ $1hڋ!WV谤 suMCRj U5h:菻 áh:8=L$90 R8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-H1)1<$L$jhQP4hl1hedAPD =19l$| @f1UjDž\$ t|0N1H 0N1~(N1H (N1 h(N1j jhl1h(N1 0N1H 0N1~(N1H (N1 h(N1j 諏<$ D$tt "tJ!Ph*!DD$f1l1Waf1gdWPVB xnu)D$PhwdVB h!h!(Vu1^_[]Ph!25h:h !j|4 h}!h!jp PhW!hN1[ jQUSWV\T$1< $SD$9d$ՉjRPt$ VB11 Sl$UVs 9 1U\$tL$j@PQB 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4!h!TT$l$ 11ɺ 11MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$1t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf 1ŅtMaQ4!h!=T$ t tuf f1111|$ 11T$ 1 1f1l$E<$g\$ttXaQ4!h$!识 ;B Q4!hR!蒆 <$\$t4!h!r<$l$!F1D4 !$SF<.Ǡ!w40!hL!PhT!S  w$!5h!_<t$uM55h "RPQh[!"555WRPQhn!S衃7h "h!S范 "55RPQh!ShM8tDƔF1Ph!SC F;E ou%jShX!5h:tEP趢ǃuAH1)ރu4t$$V4Nut$(t;^_[]h!jqQPh!hN1! jwfWVt$|$ VWSt ?/t)Wh!LVh!> WhΓ!^_fWVt$ |$7WWVUSWV|$$t$\$WPVS$8$81EFuMjSt$ Wh. %軃uP~CD$3!!D$ jPTu^h#u1D$9Whr!hZ!S3F j/P|4$<Ƌ|$ \$SWBCt\ NuZD$@u>=1L$!B0ePWt$hI!jXo1{<|$\$W4$FWhr!h|!S4$u hHE!j0oF j/Pt|4$4$jtUSWV\$ l$|$t$1E1&11hP!WV h~n3itVn1Ѓa~.btCd 1봃otBs1띃NuSh:111=11mjSh!5h:AtHPEuAH1)ރu4t$$V41ut$(t^_[]h!jmPh!hN1\| jRs$!=1uD$ D$@!1t n#P=1u ӝ%= 1u !=1u $@P0/kh!h\&j mWVPh"Q|t1ƉPjPW' W~t jPeV&EP^_ÐWVt$|$ VWt ?/t)Wh!褮Vh!薮 WhΓ!^_fWVt$ |$7WVUSWV $$l$WVSU$ $ hU3Wh%!uWVhK!jGkD$@tF$j$h(!hV荸V$$$hT!jxjPqUSWV$$$$D$1 h@!SU蕐 $D$D$1G$D$ȃ 1$!N|w5h:Ft|$`N|Z5h:Fx|$Cj$h!5h:؛P臛5h:UFp<$h@!SU VH1H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]h!jiWhd$jGiPhx!hN1^x j@ToWVPt$jWV 9u9t x^_Vt$h!j9iVt$V蓛t@^h{#V^Vt$V菠t@^h$V|^WVPt$jWVY 9t9u x^_VhǗ!jhWVt$|$ VWӼt ?/t)Wh!̪Vh!辪 WhΓ!^_fL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QGD$ T$M⿪t׋E4D$T9\$E0D$Ds h!q-1VWt$ t$P:1@PPVVu4u0u1OËPhh!P[. }D@u hh! hh!S6. }D@PE,CEh. %Vr:\$th. %Vh!, u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5PhJ!+%t9\$t hh!+\$pD$p\$D$D$ 9\$~\$~tSh!+\$9|1} t h¢!s+hW5D1h!躧}4xME0;E4ru0h"!(+},u,D$D E4t hE!lD$T 1u D$D5 t$ D$<$$L$$$E@$D$(D$$A$AD$|AD$,A $CD$0D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$8X$$AP$$p$$$$tD$lD$`$$A`$AtD$xD$tH$$x$$DŽ$|$<S(L$ L$(tL$$|$1F9tShx!(D$ D$L$01۾ËT$||$|tL3L$0 3tD D$ WI(\$tt$1F9tWh!((D$ 1tt$ tЉ|$TB7D7R'tt htD$pt\$1t$T$2:|$D$xtIt$)Whף!N1PBp |$)Wh!N1P#p D$ $L$t$}D@tCW&1@9tWh!&L$G$D$$|$tD$|D$P$\$hT$(T$ T$8tD$X$\$\T$$T$ T$,\$dT$@ÉȺ$L$dD$ L$@uD$ $L$t$L$}D@D$t1ɉD$h|$tD$\$D$8tD$,8$t$D$p1ۋd|$tTt˹)\$E3},|$|tE P|$t$ \$tT$ ltL$U<$uL$$|$t$$t$ \$1ҋ} P$$t$D$1P$L$lT$tL$`},D$hD$tD$\0l$1T$$L$t$D$ltD$`0Mt$  L$t1D$uAAQ 1D$1L$LD$tL$H $L$l|$tL$`$tT$LD$@ u M։ ut$@ uƋ$ș)Љ$T$ uD$ D$u D$pD$pL$@H E‰Ɖt$@|$ D$dD$Dt$T t T$@1҉19\$dىrD$@)D$D$@u|$G1ҋL$(D$8|$GWL$$D$,$u 1$\$ u1PVRt$LPttt4D$@$Xt$1F$ӉljѺʃ ʊ$ˆ t1L$\$|$$1T1}$t$D$t$@t$U$%t$@$D$t$w }(t$D$t$M(A$D$t$wr9v{} uS;$~J$u2Wh!hN1i ;$uhN1jjHhN!@$$D$tD$|0Wh! $tt$SWh!hN1~iuDt$ vh:!wg ~$r-D$ t$$$0hV!=gj Sf}D@uh!ph!cD$ttt$$DŽ$߬$$ڌ$ !|$D$ \$$t!fF T$tT$ uD$(D$tD$$D$LD$tD$Ht$x$t t$t$1‹6t$ uЋL$+D$ut$FF$T$lt$FVF8VUttPFx HIt$41VRtRRP*t$ tPh/W!AQL$xtL$tD$4@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

K K\$t L$Y L$) T$) Qt$Sr VjW t$ uT$BtfD$T$tf|$0+|$‰T$D$1CD$< D$4H4PQ|$HIht|t<7t1ۃË|$71ҍt$4VRtRSP#tPjhWW!}I D$ uD$4r&1ɋT$P: $D$41ɋT$X:1ɋT$P: IH 1B}D@u{1qqqqQ q0q4q8qWFD$(+D$L$,L$ ʃ{1QPWV{thy!j$01F\$D1VPSh!<D$XWVPS(%|$$u1Ʌ|$t1ɉAw1@|$Ph!q<D$tt$5<15015,1t$\t$dt$<581541Q5$15(150PWt$L@ƃ|$4tV4USWVӉ $|$j W\$ Sm Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph!1L$8ɉ׉u L$8t 1@׉׉|$l$ 78"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h!3QPWUt$t$h0! QPWUt$t$h`! t$t$hͪ!j-USWVN11F/WVUh!WVjhܫ!WVj!h!WVjh! WVSh/!WVj+h`1 x1 09|[51tFNu 151t5FNHNFy F4VPV`1@`11@j@PbU1@PbF ~4D$F(^$F0^,n#0^81 1t q41^G FtH 7~ F^_[]É 1=h>T!h7T!hhVT!h7T!hhS!#_Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 1H1N^,H p1t1x1H@1P 1 1H1H4I1H89t;tprp1401t4F 1H^hwT!hpT!h4hS!]USWV}]uuu W@t d11@h11HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$g!s!G4$O,50w0VPww D$0^_[]USWVPt$ff!s!F4$N,=0~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j^8p 1HtƒQ 1@ 1^_WVt$ 1F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpd?nF.nhjv vn^_nUSWVPT$|$:%41\$ 1$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^411ہ=1| t Pt111t 98t@^_[]Ã^_[]`V15151hVh1 51^ft$ t$ wMj(SWVt$frLN4F,=0~0WPvv 1!t\fv4V1AN4F,=0~0WPvv 1!1;NuN^_[hP!@1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSG$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hW!hW!h hJ!UUSWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPA3T$3D$M u1^_[]USWV(t$FxlFlF 9mF F$|$0tfhjRljPLtLXt uB\I\$$|$ C$|$4NhX!蒖<1ɺPt`tLtt l$,\$(|$0uejPttPPttPPA 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=0lj0l$1 UPQSWVhjPË}Pw S P G1PWH¹tTt 0߀<$u1 t1 L$QWURPVhjnONjl$hu P7 P E1PUtA|$4t hX!S^W^1^_[]u C4CHKL1}Mt|$4t7hX!诓t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhW!:$  $ Vx19tQRh(X!  1@^USWV |$,\$$t$ tCPPt Ttt4RQhU!N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$ÅthU!h(N1ظD$(u KHKpStURQPt$DljT$t h(Y!脑u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRhU! 1VRhV! T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$LL$ttD$tЊ 1D$ ut$xL$L$|L$1ɿ8D$DD$ u{0w|$tCD$LCD$T1D$D$D$8D$tD$0|$$|$Dt|$@4$9‰T$D$puD$ 11L$ I,$t$UQPhV!D$L$9tQP$$hV!t$Ht$L$tI9ȋt$ tPQ$$hV!X1t$'J\^_[]hLV!h>V!hhYU!%7hLV!h>V!hPD$L$ $QPj0 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$/W!D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt l|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$WW!nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ v,LD4@hD$D$D$,$D$ G,@o M|$@ t"D$D$D$$D$$qW!uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$/W!,D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D1uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW^ƋD$0T$UW^ƋD$0 u$$$UWx^ljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RP ^ERP]$GW #RP]ERP]$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPh/W!TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPh/W!D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh/W! D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWYNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP Yt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPXT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPW|$FV D$t RPW|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP8W t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPU|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPU$ D$TBL$?ttXLT$BtJ J T$$T$ QPTL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP Tي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVQD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv . t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0hW! D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hW!hjX!h hW!hW!h hW!hyX!h"hJ!!USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p o$A L$H SjQ蕰 ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QPa1 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jD!Ɖ t,U!Ftf^81FFH1|$<΋t$  ر1uN ܱ1NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPU$K\$ tSD$hD$@p$Fx~"1ɋ@ L;H|PHsu"l$\$ ر1{ر1 ܱ1\$L,D(Pl$tttt$T 1¹pt Ѝ t$@F03FHD$ Pt$0KCLLtPQ4$Xtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(1y 1ȱ1Py`PD$@1 1C9݋|$t< u6AWhVd űD$ 1GtPhs@$^_V{1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh!+C< t< t< uh"S脷ƍD$$VhP L$T$\$PQRSD$0PD$Ph!D$@P t$$$ىhи!rC< t< t< uSGz=$<rLjSh!Sh!LShM!h!yt$<L$D$D$L$ oPtXljo 1tX L@uH~vCtTjhh'! VJ$^_[]V1 )UjSUm D$ D$ CD$CD$C D$C$Cl$Uh""V u D$CV~)1$<;obD$D$PSh[!< =USWV$0xjWƅ~F$0h$1jUV~4$hPYl C9uЋ$4h"S迴Ǎ$ىh !$0Swt| uƄ$ $0ph:!QU荰D$$0qhD!QPkىD$PUwPUSj u׋$0EED$1ɍ$D$ $PhS D$PD$PD$PD$Ph8%S[D$L$ T$ ыD$E L$ T$ D $A9L$D$uP|h!h!I}Sh!h˹! Sh!h!gI $02t$t$hv!$@t$Ph! |$W|}~14G;}|V1^_[]USWVD$(}~;$ ~VE pSk $PjVWjS,D$11D$D$D$D$$D$ D$h!u Vu# H5$l!D$>j 5h:P+k CrCr C5h:V;:D$()ry7h:$P/Crj h"Vg ىVSm1P2uE$ ~S4Vf $PhpjSPt$VuVh.! Wh!j&ÍD$LPSIOu $PP@ D$T%=`urދ\$l % r~\r )rW*r rr$P$PP>r<r<)r<XrrM1$PT$ QAA AAAAA h!Qhr r 4r ,r 0%r0B$PPh%r0BVJb o8tSh!\*r6'r)rD$(h!Ph)rmr.r^D$>PkHr<r<0|$$$PWSY?$XAQj2$TPQ; $Ph;!Phr<r r h!h`!jhr V=1jFh!r!r+rprTt$$$PVW{>ލ$P|$xh!PhrS Pt$|$l$P$0h!Ph*rt$hb!~~;$1Fȋ&w ܳ!QPh%!/ G`;$X|΋$\>9r%h!H$`>ߋN8&wܳ!PVh%!̦ `Ou1B$T$$PىPV/Fލ$Xj2WP9 $PhV!Phrq!t!PSh! <1$P;$hS!Shrt$V q!9;$PVh!蚤|$$VVh!聤h`!jhr t$ jB=1S$h!Whrt$ !?cG\$jBh!WhrS\ $d|1$XAA$Pj2PQ#7 $Ph#!Phr< hx!jhr V Vj臜$P$P VP,D$$~$0h!Ph+rW뢉t$$P\$ ZSh!0$P\$;$PPh"!  Vh!Sh*rt$<  09rh!h!$\>$Th,%蛢 V財h1!$X~:$\1j hף#V[ !tQC`;$X|j W~-hV!v$`>Vf`Ouj &$X1~"$1:t@`9uh˼!9u$\Ph@!辡1@\D$,\$H|$PS2$hjV^[ L$,9F Vhl!VhrW h=!F0Ph!<F0Pv,v(v$h!j 5hJ!X$Th!EhĽ!h!hn!#$X~n$1Wȃw1#$D!L$ 7!!&r!! \!!PRh/!h F`;$X|ۋt$~G$`>G8tu #P&w !QWh/! `Kut$hS!VhrPJ>y!t!P*t$1 h$VrD$0L$4$PND$8Fh!Vh(r W FtsSh=!n$PtPhc$UhZ!H$Tt*Mbi)QRhe! j )$XNPShr! :$`$d $jj h #QPjVKyjh#VNZ V$`t$Vh߽!脞$XMbi)QR$\Vh!K$|$|$|$|$|$|VhN! $\uM#1wh!BL$!rc!$PPVΝt$h!11҉4hӀB9u "t#QPt$h!u=1~S$h1h?!V1PQh!9 C uߍ_ j F rt$h!Vh&r@t$V(";$Pt!q!t!RPt$hݾ!Ȝt$USWV`p׉͋$tph!S:c,$tÃr t1C1|L$PVQV Ou vu hu Z$1hoVWU owt1$0 j2t WW F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh!WV Ƈ$L$h!Qh+rUQ9uh`!jhr U5`p^_[]WV1VFF FFFFF h!VhrQĘ^SWV։ϋ\$1D$$jh'%S tVjh!S tBjh#_!S t.jh!S܋ jh"Sċ u$D$D$h!PhrW?h!PhrW)=1t?|$!t!PVh!訙 |$u$4̳!Vh!艙 ^_[$oWV|ƿN1Ph!WI Vh(!W: Vh`!W+ Vh!W Vh!W  Vh!W Vh!W Vh!W Vh !Wњ Vh7!Wš VhX!W賚 Vh}!W褚 Vh!W蕚 Vh!W膚 Vh!Ww Vh!Wh Vh!WY Vh)!WJ VhJ!W; Vha!W, Vhx!W Vh!W Vh!W jVRhQ t^Vhs@$jWVPΉ1WPhPPj PQ՚ u^_Vh!Qj舊t$ t$ t$ gP tt$h!j辊USWVӉύD$(jPOF1t$`FFF FFD$h "V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVPED$HD$PD$P !5F!|$D$ fD$ l$ \$Tl$+D$Ty1`!Phs@$j($PT$D$ +T$(+D$0хyL$XD$\D$\5!D$XuT$hL$l+D$$D$ $߬$!ݜ$ܼ$D$pt$t$$߬$!ݜ$݄$T$xL$|l$x!ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh!j$P耓 DŽ$ <\$D9r<  U{ ׉ u  1=0$tP s$h*WUP#?D $WgJPh5!W= p =1XhN1jjh;!1f$WJPhk&WO=  Uz ,RP3$ $P$P |$WIPhXt%W<  U5 @ h+p pUa($WIIPh!W< R j^-=1t%1I$WHPhT"W2< h!h!h!h!hh!hI!h#!h!h!h!h!hd!h!hB!h"!h!h!h!h!hN1莄P$WYHPh#W; bU*yŃ=1u#1MIрK=1u }8$V+ƹV])uV+W蕮$VVY+DžD$u hP!Xul$Vh"hN1肃 VhN)%h$ PW(yl$`t$Xt$T1ҋ\$މT$̓=1u1MIрs6=1uA}t']h0m%SGthu,"SGuWH(Ņu{D$TƄ ML$XE|&hP$ Phi!hN1臂D$+hP$ Sk ىV1 D$@W'$WFPh~C$WI9 $'hN1jjh!]$WEPh'!W8 j)$WEPh!W8 =1tVhN1jjh!1$W-EPh0!Wn8 6WKThN1jjh!13hN1jjhO!e1ꍬ$U$PDGVD)1;$v7$5<P{3$P[D$$1EhhN1jjh=!l$WK(_D$h)jUPL$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=1 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h0m%S;?t jhH"S1 t ;/u f. Gf./W0>S%>9SWot͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PSi:tH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 50 1H $s-t$$tHfHxt P2)1^USWV=1th(N1jjh!Ijj9#tvƃ=1th(N1jjh!11GNIIˋ^s 1 tVfV(1ޅu1=11WS"ơ1Krk=1tV$Ph!h(N1s ~uV7dV'%V`v v"1F$51vu;11K^_[]USWVPl$1M1t$"Džt.w w!ƅu h!d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=1tW"Ph)!h(N1r W_1l$$ttF9u t G9t$!Qt$h1h!hN19r<$WbWE&F~X|$<th!V_VCbV&vfFt$ t$ t$ h!hN1qEuFufFFV!|$WP`WV&N=11ۈ11|NIL1h1 51ǀ1|NAMǀ1EFNDt$h1h!h(N1p1N1@=11ۈ11|NIL11W4ǀ1FNDǀ1|INOWt41ǀ1|NAMǀ1EFNDVdPt$h1hM!h(N1UpC<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=1#~VPt$hZ!hN1o1t$h1h+!]a >W\Ut$$t$$|$$WX ƃ*Vh!V%]1@KGufGfG1@=1$ WbPt$h1hM!h(N1nUt$$t$$|$$WƀH1@=1ىV_bPWh1h! |$u V[v vY1F$51Ut$$t$$WDUt$$t$$W.PZN1@=1t-ى,VaPWh1hM!h(N1 n؃^_[]S111|NIL1t!h11ǀ1APEǀ1|ONTt!h11ǀ1FNDǀ1|INOt(h1l1ǀ1|NAMǀ1EFNDƀ1t(h1?1ǀ1|MODǀ1ECHGƀ1[SWV=1th(N1jjhF!1=11VWftmxtg 1W sJX tCf{u7=1tSPh`!h(N1l S\S [빃;=11k51tc~ tWuLfth~!W Z=1tWRPh`!h(N1l Wy\W9 륋v$^_[SWV=1th(N1jj h!L1tS11{ t$C$Su[SFuՅu51th!VKYv$^_[USWV=1R1utDh(N1jj"h!,th(N1jjh!51t$G!jj#^ơ81;1<11,׋-1WV]Ɖ׋ <1819sAWV2ÅuWVh!p\ SPh!hN1j c렉1‰1 u`WVÅu hP!%\Cuhf!SXCt SZcSSPCcQPWVh/!hN1 j:K19tPt$ ZU-181;1<11^_[]USWV=1th(N1jjh~!f01jY9T jj\ʼnT$1 1PQ\D$5<1581J\Ɖt$U9\ʼn$St$p\Él$9$\$<1 819ˉs6f01j8DTk D$;81<1rM\$ -19sI<19581s9-1tS 1E9u<1 819\$ <1 819ΉsZWVÅu h!YSCPh!hN1h cWV[Ɖס<1 81911 uU9t$D$ rIWV<Åu h!|YSPKAc9-1u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5<1581fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=1th(N1jjh!cFtVPXfvu݃=1th(N1jj h!!1=11ҹ$RL$QtMƋhtDEt9VP|$ W\1ۀ~UiCSPW+W em븋L$$; 11r^_[]SWV=1th(N1jjh!Y1=1rc11CWS5t:FfN~u %fFfth!VYSvuȃ;11r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh!V ~u,|$ t%h!VRWh!hN1d 1^_[]fUSWV`=1th(N1jjh:!%515151hY!hh0t=1uFFF%)Fu9rV9=1tJh(N1jjh!F 1t(t$h(N1jjh!F 11V9vtRPh!h(N1^ 1th(N1j $ 9̓>t9߁^_[]á 1tPjt$t$uù0WVIAfF=,1|C01)f8151jQh41u5,1F141PVQ\ =01F,1^_ù0QhZ!"8u"h!h!51h~!hN1]jTWVjh0F1t)h Pt 8@ WG^_V81 <1t7#41=@u%o>81 <1t41!=@t^USWV$$$ $jhWVi,41tE1M1 tmjWVS$8jWVS$8t$ShN)%hV߉^_[]USWV|$u h!!>W1u`Ɖˋ- 1UwDžuh+!z>- 1)ً19w؉9vlj<1|$1WSB^_[]USWV։ϋ\$ t;=11rVWh!= -11QPVWX{s LK$\=1t%[$tC1K 1 uh !S9^_[]SWVt$f~th!V9~u(~th!Vg9~ th!VS9FN tkQPDžuh!V)99tt79uNH4~^ SW FtPh!V8.>W111F$51^_[ËAP 9ttЋR9uIHËIH h/!Qt8Vt$V~11^SWV|$t$Åuh!V,8;^ty^C Fs j/WWGS1 1W W FV86P1ɅF fN^_[USWVd=1th(N1jjhF!'=1td|$xhߋ!WJƅu0 0藫Ph`!hN1lI Wha!;t$ f 111؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6pvuݡ1$1؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W[u1$51L$T$9΋$D 1$T$|1~L1\$1 tAD$t$ jjSG19|͋ 1 $51T$|L$<q$Q Ai(1,1QA 11QA1A$t$ Vjj(QF @t3] 0>Ph!hN1G t$xh!8Vh^_[]USWV$=1th(N1jjh!4e1PPU/ Džy0 0貨Pha!hN1F Uh!88D$,PWy0 0pPh!hN1EF Uh)!7$jSzƅu hK!7SVW/ xD$j(PW/ y0 0Ph!hN1E Uhs!{7W/1RrD$l$,1=(1,$1Չ1 9$hN1jjh!jj5151ϣ1jPy1u h!6PjPh0m%HĨ^_[]f01D$L$ ,1(1D$L$ 11=1u t$(6t$pPh!S6D$ L$$ 11L$T$ 1<)1؅~ڋ j5hhb!PhB!hN1>1FhN1Vjh!Vo5V0to=1uf=1ubf$HD$=1t PjE:?Phm50 y"?0 Ph!hN1= ^1FhN1Vj)h!HV4USWV(΃=1|$()1\$@kD$(D$$D$,D$ D$0D$D$4D$D$8D$D$\Åu51h!#$11~3 $r(1Aω~$$19} $O9sۃ<$u9t51h!"1u:=1u1$1 $D$$P6f\$ $L$E1 1 ‹T$t61 t@51h!:"+h1u)111!1^_[]USWV}u11191u.=1!h!!1ۃ=1D$$1T1@1L$L$ 19$$511֋=11 u"$35,1$3=(1 iL$QQ#N1Ph!V// h1Ph!V/ U=1t51h=!h(N1. hN1jjhL!J1D$QPhc!hN1.1=1N1$1 1A $( 35<1581h!hN1(hN1jjh!y=1uh!=1 Wj51 =1tjW#y'(jPW50!ƒ=1th(N1jjh!۹=11@1ɉ 1 1P A1  1>t=1tPWhh!h(N1' =1 11hQV, 11^_[]t1 PUhh!k s-1hh1Uދ 0蕈Ph!hN1j& j`USWVE1f01T1 P1D$?SDžu#Sjj0SDPO/F^_[WV|$ th!WWNƃ=1uhVtRx=1t.u Ft#h#Wt9h%Wt'\$j SW胘 $ 9uy6h!U$~h#Wdt@h%WRt.\$j SW. D$ 9uyvh!jD$PhU512 u ^_[2h!jSWV |$t$ >h#Wt9h%Wt'\$j SW苗 $ 9uy6h!U$~h#Wlt@h%WZt.\$j SW6 D$ 9uyvh!jD$PhU51: u ^_[:h!jUSWVh)$(1hWD$ P |$ |$ D$~P1ۈD$$,,jUhX! tjUh&! tG99ufD$u\$ tR$,4jVho%蠵 EjVh,!舵 4jVh1!p 5\$ D$7f@jh0uht$Vj P51ED$^ރ9tD$j@h:!P ߉tD$PDaryDpriml$t?tD$PvD andfD D$PZDgrowfDnt$V<D defDectsDuVjh!Pd V51515151h!Et2tR}jh!V H}j1h"!Vߴ #}jIh!V躴 t6Wh!sShs@$eUփOut$v7 h!l^_[]1h!j USWV}\$j S51 D$t"NuD$Hj@PjSPhh!j$j$Vjj51F=tPh!vD$D$ D$$fD$t$j VE 0( 9 1L$81qAQQ a A j QV51D$t$ *jh!E p  D$ @L$jhtjPjQ51h!h(N1D$t$H1D$`D$L'Ƅ$0VhQ`51 $j D$tPSO |$'y9D$(ȋL$;,!|"@D$Ph,!h(N1?j uD$$<JD$ D$ L$jhtjPjQ51e^_[]ÄtH<t<u'51h! 51h!hN1Q P51h !hN16h4!9h!jcE 0h!`SWV$1FFJ\$WPS FJjh'WSjV51 D$ t$bjPj!VD$($jPjAWD$8\$jPjSSWV51515151hC!S^_['USWV|$(S"ƍD$ 1\$SWVܯ $|$D$FD$ F\$j SD$44J% L$9u8ȉDG9uډjh0ut$VjP51 V2^_[]ËD$,4h!jQhp!|$ u(1AAPh'PPjQ51q $|$ u(1AAPh'PPjQ51: $|$ujhQ 51谭 uh!jP|$~,D$ 0QhQ51l uXqh!j|$ u,1AAAPh'PPjQ51 $*|$ u*1AAAPh'PPjQ51O $|$ u,1AAAPh0uPPjQ51 $|$ u*1AAAPh0uPPjQ51 $}|$ u&1fAPh'PPjQ51 $HV |$(jVjj51t Nʃ1uPh!!CN]! "tN]!RPh! 1D$t "VPh! 1|$ N]!y "QPh!,^USWV t$4}ty|$8h!S(t:h"St,hߋ!Sthh%St '1̓uh?#wɸt1ۉjVjj517 f ?F$ȈFfFF PVQ51Y 0^_[]Ã|$ u(1AA5Ph'PPjQ51$uV(|$0D$40X|iб1ɉ $L$L$L$ L$L$fD$u$FFF FF vvVVffFfFD$HHf@ jh'jVj P51D^SV|$$jVjj51^1tBN]!N]!@t "QPhb! 1y "VPh!i Ph;!Y1|$ N]!y "QPh!4$^[ USWVt$,}ty|$0h!S褶t:h"S蒶t,hߋ!S耶thh%Snt '1@̓uh?#wEtz1ۉjVjj51f ?F$?ȈFF PVQ51(^_[]USWVhƋD$(1|$|$ |$ D$D$~{ŋD$,Sh!虵tMSh !臵t?Sh%ut1jD$PSA L$9=r1D$G9uD$@@ jh0uhVj P51ȉ$=r%ht$51h0!>$<$r],$1D L Tl| D  PW51hN!C9$uV*^_[]ËD$,4h!jh!D$PhS!VD$P H PpRQhY!a tVhb!N^h !_^VD$P H PpRQhY!  tVhb!^h !9_^USWV$Gh4x!Vh Vh"! r[h4!O yj hD!O,@tPhY!dO, tPhi!IGȅtPh!2GȅtPPh! O W hVbVh!GtPh!$hVjWƅtVh!j t)$1@9}$݀J!E MPh"tjZKAkdT*T$JKL$KL$ KL$L$ \$ KD(B\$ TH\$ KSAL$AKSAL$A KSAL$AKAL$AQB<181!уu+D$T$0141h"ja\aPh"hN1, j"USWVP=415011,9|1C=415019}`s"H-"E9ƉMm|)t6jju uL$&L$9ȃ}  $Q.~1F,MUۉu1;}E|u}E EmubWV"V$pWjyWjyWjyWjyhhV0 x`j"h"P h81蝛 jPV~ jh9$Vn %1WpPWVU V^_SWV։ϡD1H D1uhhH1_H1h%"h"hShߋ!S9tZÉ |"t "hH15@1PhL"SY|@h81诚 Ph"S y^h%"Ph3"jA<|.i< "t#QPh"Sc t Sjj!h" Sjjh"q(1tSPjh%1qhL1ou;hVwjSq1WWVw^_[WVP""=1u' 1u"1u/"u>J!h%15@1Ph"j@j#{h"N=1uh9"N=1u6hhhb"{ xjhl"P V<h]"_Njh"jzh"1N 1u 1ujjB""u/""u)"$=1u D$@4"D$= 1u 7"=$1u :"=1u !=1u n#=1u un#$ 1uH18h"WPV 8Vh="j'? 8VhR"zsj=1u h"jjhL1wmh"4USWVa΀-% plj\$ Cut$BT$ҋ $A|$Lو1ɉQD$PS) D$ D$ 9K8B計84\$ L$3 D$D$W|$h+!SЈDhp&'S躈;h#S褈7h#S莈3h("Sx'h("SbD$t$ |$X趇1ɉQD$PS D$D$ 9؋t$48+聇8|$c1ɉQD$PS L$ 99։D$0L$8z$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh140h+" 1<==1 ڍt$81 D$ \$phjSh1PVT$R*$1BD$L4JD4`L$p$QRSRPV"51 1u1$P#w "Qh1hi+"k 11<=4 j=VR9=1 j=VQT$81 D$ t$ hjVh1PRW(tCD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP3$h1h+"D$49t 8Vh,"k1JD$ $$Qh*"D=1D$t$=1$D$T$,$uWjjVD$,D$\$(V莃GC@D$p9Vh,"豃0!Pt$hM+"|$oQh*"=1D$WSt$h("VD$>1ҸD$ |$\$ Cj"$P ÍD$pWVPSt$ $P12\$ E $1jt$tS7 $1jWV# -蜂0} Ph1h+" B1 1$Ph1h!"'5D$ $u1@t$2|$ Qh)"(11G|$1\$ tpupthH"Q5D$ t$D$t1@L$ ɉ%t("PQ^Q|$t 老8t1j t$ w 4$`St$h)"FQt$hB)"7.|0}0L$ L$ ف$K{8P|$WD$ t@j QS{v D$ ;$|$8tQtUL$4 T$hjRh1QWt$$ |0T$ gL$4D$ 11ɍAD$4tT8`T$ Q$QRQPW/c1 1T$J#w "Pt$h+"rt$L$ $d$ r $3v $tu¸#t("PQh*"|$D$u |$u |$TF1@]%t("Pt$hy("$D$8D$ D$pD$0 ߍD$'D$0L$&L$ 1BQh*"~0Pt$h*"|$L$lj% L$St$h)"{D$$"e~1ɉQD$PS L$ 9t 9St$h)",D$ D$ D$D$0L$0RPQt$,t$$PM-tBD$t{tPD$ |$1jVPM D$h|$t}81D$8|$1jVP D$p!1FD$&|$1VVP D$'1jVP UD$1=1D$44$vVt$h`)" Ph("=1he^_[]4$hg*"ًt$D$t$$t$SW|@9s Vt$h)" S/|@D$t$|b|1ɉQD$PS袳 T$tD$pD$ 9t8u5|8 St$h+*"QhI*" |1ɉQD$PS ƋD$ 9t8t}St$h)"St$h("D$t$։D${L$8`OGL$0d$ rxL$D$nT$e{L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h(" jBj-SPh1hA(" hX("h++"h~+"h1hJ "SWVPD$t$|$L$ $QP67X9w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS(1Ht$L$ltT$d;WuT$h;W(u Q  ŃtD$ppPUOm D$DGXHr P/ oXd^_[]USWV$|0d181t d1/e1Sh1}EtW1މ)ˉESQ|$ Wl DWd1V֩VMxfǀd1/SU*Eu1Uhd1蟩,^_[]USWVhT$D$ "d"1Chd1wD$ CL$;rjt$V ufD$jD$Pjhd1V;t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPWt$h "|$$j@WVPWt$h "jaWVPt$=x0O2Ph!W# 1t51Ph]'"5x0D$$PV5x0 1^_V΅tOvHw;s11 1tev0Ph1hf'"M Atʡ1 1t"v0Ph1h!"' u =1t^j?USWV=1ˋ}1 1 t u tth(N1jVu[D}ti=1|}t j MO؃thD$VuPi t$UtuRh!r{50Rh8%%Y bD$VuPsi tMD$PVh'"& D$VuP@i t+t$ t$ Vh'"]D$ s*P? D$L$ r!QPhG# rD$rIPh""QPhr*$xt$hH#蕮}u h'"肮j 虭e^_[]PhR&USWVP=1u(ˋl$ D$$|$51 1 t u^_[]Åtth(N1jt$WnB܅1| t j $^_[]uCuWt$hz!辭 K4$~DN1ۅtPh!蜭t#=1uPh'"}9t1C뿃u,h'"_'t+ORh!EtuQh!b50Qh8%% IWVD$0L$41|$VVRWQP'!t)L$$<$ug1 1tT$jjvB1A8=1uQh!ht$t$t$ t$t$h$"G^_Qh$"jAUSWV1 1=1|$(|$41 1t{\$,1PPQPSWM t`,$tYU tLƍD$(1QQPVSW t&$;D$u1jPwV aV D$8tPh1h%" ;w1D$$D"Ph/%"Ph[%"Ph%"Ph%"^_[]UWV EMT$ 1|$VVRWQPYt@u|$ D$L$ L$D$1 1tT$jj Z1AP1t!u.=0D$PHfPWVh]&QPhj@$_ t$QPh%"Je^_]Vh$"jCUWVEMT$ 1VVRWQPyt+M|$ 1 1tjjj1A`1u50Qh8%%貨 1$h t$t$s  t Pt$t$h%"o e^_]Qh$"jhUSWVD|$huI=1t@D$$1ɍT$QQPRh%"AdqD$pt$D$(1N\$$S ŋD$d\$ 1ҹt(t$ RRVQWPD$ \$1Ƀt,$t$XL$$9 1 $\$(K1ՃH11D$1D$D$1D$D$ \$|$,Euϋ $q|$,\$]\$\$ ]\$ \$]\$\$]UT$T$UT$}T$UT$T$(Iu$L$HL$ H L$HXPL$Hx L$H$t$X\$(t1E<$tEPh|0Vh%"j\$DS1 1tىjj(A=1uSh! w$w wwwww ww7h%",D$tM(9ʼnd4$1A1AU D^_[]Vh$"j蠘USWV$$|$$u1D$1ɉQQPRh%"ja4$$t$V tfŋ$L$ 11RRQUSPjtO$D$ ;D$*#L$$l$u1L$$jjUi 1A1AU=1tM<$1\$t$Wh|0Rh%"jSL$$jjV G;<$|u 1 1tщjPV=1uRh! <$~/1t h"ttVh5&"ݣF;4$|j t$ Ą^_[]Rh$"j趖USWV$=1t  $D$\$zi1ɉD$QQSP$Vj螧W>U舧t3jzt$SK=$U_i8W$hQ&"{ =1vj襛11ۍL$l$ PSQU$Vtct =19$$D$1 1tT1΋$PjU$h?&"1Ʌ7_l$ 11΍L$AAQUD$L$PUhn&"jdQp$WPUV to1 1t$jjPDH1L$AAQ\$S訙D$|$PShn&"jdW$jPW Ā^_[]USWVP\$(|$$1PPUPSW$P 1PPUVSWXtu=1u50t$h8%%à $ $ r/1۸ "WwwPh&"蒠C ";$rj 蚟1A1AyV ^_[]Phx&"j腓UWV0EMT$1|$ VVRWQPt0M|$1 1tT$ jj1Ay=1uQh!ß1D$ L$ T$$L$l$L$, $$D$T$l$L$(D$L$l$\$\$ \$$&"ae^_]Qh$"jZUSWV@$ @=1t Z$ Vƍ$ h jUX h%V t}1ۍ|$1EdSWV: L$99=z  h%jrƅu$ 11L$RUPQ$8@$8@tIt =1$,@$@1 1t.1T$Ph X1Ʌ1ۅÍL$MPc$@SPUB U$@ tW1 1t$ jh V0$ P"cjPS Se @^_[]Fc8"tD$9t 8uVh&"Vh&"jh&"hs@$j.USWV \$0|$,1PPUPSW@)4$v 1PPUVSW=1ut$ h!>rt51t ttt ttth'"A 9uЋkT ;$tl  1L$D$Sjhy! {t+1:LtPh/'"ћ G,;{r܃TD$@TL$9uj ɚV 1A ^_[]h1h'"+USWV }=1t D$ toh4'"WatcPa1ɉt$QVW萘 T$$9t8u&a8,Wuh>'" =1jȓ11CL$ t$PSQVuutWt =11=1u?=1u6L$1J1ыT$1 u#MUPj h4'"1ɅRaMUPjV tK=1u-=1u$1H3$3|$ uMUjj h4'"MUjjP e^_[]ÉSWVttU1q~FDx@uAFX@ut9vtU10Dr@tH^_[USWVPω11s6tUVh&"SZ Uh@#SI  t9VW 4$Euuh "Ɖ$t^_[]h&"h&"j'h&"h'"USWV\։ύD$ jPj PR 1u0D$F|fD$Y|Uh'"j D$ P0$L$D$ L$/Ph!j D$ P[ $fL tU1/LA .sD$ L<u\$ Sy jPj SQ E9[|$ t D$ PO Vh'"d^_[]WVth΋u\~8tU~4~`N4F8 I9rP 1F0F4F8FXHr P FX^_USWVP\$11hr"]t8t 1Ih%&!P]u 1t$j:1VZ&3#=1W\9rV$9vPx/uBh%&!QH]u X)2=X)2s"t"P]tPPh|X݉}<-,$t<+uuu;Mh&W\t,$kWN1,$4=X)2tt x)2h s"T\1t8u%hs"9\1t8u 1>#hs"\1t8u 1#s"1=1tjh2s"}ƅ~;E3[kDžu;VW}jd}WL Mƃ=1u)}hu h2j=1t!=p)2u=1ujhIs"s莫1FVV=)2uh#5L0#[u}}~:jhss"dffQhjfN95)2^uKh11!Ѓt4)21|ugeu4 ;jWV|$ WY@jPWP̋^_t$t$T tjhs"8jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]Vt$y51511j^0=1t=1t !jV~fUSWV,\$@911tU5626=1u 11Ub=S====,=Xf 1G=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff f:D$1D$ 1D$1d$ D$D$fD$ 1D$D$562#|Pj562з 1,^_[]VPhht@jI t,1hs"Vt(P 1)$t$uǹ5%c~U1t 51^hs"eVtP1ؾP˹7#ƅ1ޡ1yV> tPk=D1t1H VU^PL$$1Aw$,"⹼s"O1(uMf1 ]⹿s"4s"+s""s"s"s"s""YÉs"uf11WV׉t u1=D1u WV^_SWVha%#U&tD1D$QPtD1s"tD1["bH1s"SL1s"DP1&5T1!&X1h&!\y\1`1d1h1l1p1t1x1~ )2D1%|1t :湟" " "t 1g"tlj=1=t)2t8=1u/s"h1^&W1=1u 111 "u 1 "U($1t8u11 "k&1=T1tt8u11 "ߓ"1t8u119$s"1t 8t1@ 1 "11 "s"$VWWh1h1 !m'V5151h1h1$k$V5151h1h1|"k$V5151h1h1I#tlj=1'#b1&⹀'# " "tơ18t,<$1QQP PWD<$WP@$hs"}1j% " "tơ18t2<$ 1IQjPP PWւ<$WzP@$7"S1 (#tÉ1^" "tƹOC!w=P1u "t‰h "Ɖ51>u  2^_[É⹗$'18wVt<0 1=D1u Vr^V=)2uh5151 =)2uh5151 =d)2t!=1|-1Fj F;51|hj51 1^À=1uK=)2uh5151 =)2uh5151f 1hj51I h5151/ hj51 hj51 t$j51 hjP á18th51P Ã=\)2u18th51P j辷h5151q hj51[ V=)21t1hj05 51t4=T11t1hj0 V+$=T11t1hj0 ^SWVD$#0 Éthj51 كthj51Ɖq thj51O thj512 1^_[á1thj51  1thj51 1thj51 1thj51 1ËD$# 0  19uJVD$ T$50! щ щ! ‰ 19^ËL$#0 ȉ hj51 SWVhs"Kt'8t"1tIVsKfG _GMCAPG_TERLESSVWD|WrK[1Cj S7VGVJSP_GVhV3%P# 1=1^_[USWVր9tMτtC11U51W 111U51V ;1|ut$1^_[]ËD$1USWV׋t$$\$l$Et*u(k$ "t D$ L$M^_[]fUSWVPt$ P !уtRPtt jht"jh"t"}l$$|$\$ tStN9uE}㹘$u $ $уt19uE 9u~3M$ujhjt"t jh9t"jhPt"蔴 ^_[]1ۅ IQRPRtfUSWV511H;(L$$9t%H1P3T$ u,;Hs D?D${9tG1ЋO3L$ D$D$~9tG#G=)2t t0x9 }ph j蔸 tP 1HGG7FGF8~FNOG Fx ~%,;Gs[D$ )2~GO H O A$(L$O‰GGL$G_ x 9GD$ ӋL$t$ Ã!уt 9ÉT$1؋1 t?UjVS9!ƒ?1D$0\$tOD0mt$uST$G  )RQ9 ÅT$y,jht"FT$1B"OD1C=1u$0x~OSQPi 51_D$04=1|$ uL$Qhs@$!j1F=)2uc5|1hL$QPduCD$(3 2L$$3 2 uD$3 2L$3 2 t 2t$ =62t$ 519>tOOHO151wx>GO H O AD$DHOG Hy x,G9r$(aD?jh~t"1He^_[]Vt$t=0tjht"50^á0xk=1uE 10#4u.1jht"花Ot 62t0Pi01USWV1ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jht"1@$qQ50f 9D$}1럃^_[]USWV-11|$(1Axt$$!уt9} 1@^Z $uL$1T$1 u/$$(),1^_[]Ƀ? *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$L9}l862+19WV11t[t ] 140!уt RP1Gt 62t^_WV1VVftH19t:ʋz;yzy|ϋ9uOW($ǀ,1F^_S 11JЅt8=1u/u1u04 do"[Ë 1t$( ,1HV1N=1t9t/ 1,wB$(1҉,Ɖ^USWV1tf,tI,^_[]o$(փ|6u/΃?ƃ~9t_1ˋo1 t 1H^_[]É$(늋D$x"  1@1H0V1u1I409t1JQQ 9uZ 1401($, u1H40VVV1!ƒujht"脪^1PPjt$1!1á140SV\$t$ 5|1b1h8j 1@1I04@II Jut)1PPjV0!ƒt1 1P5|1a1u^[;SV51 tJ9tPQP P dž @vv Hu51بuF unc51dž tV\ 11P5|1`^[á1t1ÐVh "jw hy"m=1.tDhzy"S=1hy">hy"2=2hy"^hy"=t8t nj3 1Buhy"<ƅu&hy"<ƅuhy"<ƅt]hx"V臕u6ht"Vuu$hy"Vcuhy"VQt1Bt"!1 tU1TA ruƀ2ƀ2ƀ2@=u1B&x"SWV։ϋ\$t=1ttMO<^wDAut9t3<*u t)t#GjnPujnWtH߀?*uAGrdtku$stuu1@ 10>^_[Ã=1@D$2D$2ËL$=r!=1tP51j h2s'2u 22u2ESC2Ãw@2uQhy"S\$u$2ESCw 2ucSzt S52x\rTr(r rƀ$21؃@2u^Phy"]Ƅ%2y=1Jұ($2@ـ?ɀ"2H $2$2S51j h$2q$2[ËL$x1@ÉʁtTʁt?ʁt*ʁt1@SWV|$1wZSst u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[SVt$ P$-"F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[WVD$L$ =1=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_USWVl$D$|$=1t'~3P&19wKS>~-19s2C,9r9v)CK$GFG0wG^_[á\ 2thD2P\ 2@USWV\$,=1tUT 2tfفuG l 2Ql 2d 2198hd 2v-T 21d 21E0T 2l 2d 2xQ1ET 2=P 2u P 2' \ 21 0t01Ш%=txSNT 21p1PS3H$?"=p 2x 2F!PT 2^_[]Ét$p 25\ 2 \0yD 2D2)É\0n1|$ l9} SWhD2" uԉn "ti vD2VWga=D 2=D2J D 28ue:p 2t 2tP% t 2>D$P.-D 2E˨-D 2E~Up 2 p 2A ǃd 2^_[]p 2}p 2U op 2D 2=D2v!x u2 x E! D 2=D2w/p 2D 2< tD 28 tp 2p 2 p 2L 2 D 2p 2D 28p 2D 2=D2x u D 2=D2ix t^ D 2=D2Ix u>p 2D 2< u D 28 t D 2P 2p 2| 1GPفD2Tt$D2; u C9u0D$0D$AD$ D211҉L$uW~%9sQt$VT$ bT$ L$ tt 1:D$:D$u1Bt$ 1@ < u^11F9rۋt$ 2 2tP -D 2)EjU% 2 D 2)QSP D 2L$:0u)CS;tP>t 2U螢 S>t 2L$D 2 t 2tCp 2Qh| 2/t!ujh| 2Y0 jh| 20 x 2D 2; 2v; D 2; 2w x 2tU uf5x 2DD 2=D2v@:0uhAz"+e]%t p 2 2w p 2*uWV։hD2* 0r HD2D 29r1I~G@ D 219r\031^_USWVD2< w11D2 14֊YAڀЉ r D211\$A$9.uD$PjQi ^_[]øD2á\ 2t @@@ 1USWV|-ljPW(#D$=h"WNeW |$|VhWH jhz"WV VhW 1rcht t t@D$|.sea1ȋ$1 t5D$|.she1ȋL$ell1 t"|$|"u tD$}PUK 0H0VhW芗 xV-|^_[]WV|X0 008hߋ!PdWܞ ~u1OPWx#D$=uhWkPB#hz"WVGc h2z"WV8c 0*h:z"WVc H0V,|^_WV։hez"'tPtO Ody tIHu9G tPhrz"Vb ?^_SWVD 28\$$jLL$ H 2; 1}( $ D 2PmD$H 2D 28uKD 28tA\$$j|$ $ D 2PD 28uD 29v 95D 2w^_[WVD 28L$jƋH 2 19}I9uD 2xt,D$D 2$H 2V艏D 28t1t$j&<$P\D$D 28uՃ^_USWV։ϋl$S$PjW ?)߉ىUVWH ^_[]USWV5D 2D2|$7l$ hD2jWq L$)ΉSUV D$ t$D2wɋ H 2X 2<9L 2D2t$ 1)у|Z~V1\$l$hD2jS L$)ΉjUV |$1+X 2t$9}D2wD2)Ɖ5L 25D 2 @t$D$ H 2)5D 2 H 2$H $~V^_[]USWVP׋\$ l$D$ $u#WƉ tCVW#t0E+WZƉ t WttE1t^_[]WuhD2jP WPDutWEt1@SWVH 2;X 2~_|$D 2hD2jhD 2i D 2)ˉVWS $H $~(H 2+D$H 2;X 2D2L 2D 2^_[SWV D2L 2$ 1+ X 2|:1ۉ|$8tdj\$1+X 2$9|΀8t2t$|$D$j|$D$$8u$D2)ȣL 25D 2 ^_[V5D 2D2tOD 2)Ɗ 0@u\0 D 2=D 2D2"` 2=D2 1@^À=D2t5L 2AD 2\0 D 2b` 21@áD 28t GUSWVPQ $1;t5߉WjUr $)ډju $;u zމ^_[]SWVhOz"!t8ǀ8t1h#W!1tgh%W tUWLh?! 1t7ǀ8t0Wà jSxh\z"Wh0%SPX^_[á 2 ÃX0Phwz"腋WV= 2t7 2qtPtG 2t t?u3 8 2t#p8= 2P蛖 1 2 ^_Qg^_S\$jjX 2 2 2[SWVt$V<O9r+jjYX 2 2 2O^_[USWV  21H@1e1- 2- 2- 2- 29-62t[=1%= 2]j܎ 2 2 u(9tu5|16@a=x)2t(:tu5|1@0= 2u  2= 2u%jthu{"贇  2J賗t h'#艇t>tj)Vm j:h=62eubÃ=62ene 2~D.hiiSfYpto**.!CЃ jS dh 2 2 2 2= 2d\$D$D$D$L$QPƋD$t PuM= 2 2+h1PP51*L~ 2 21҉gQP?1; 2 2| 2 2ΐ<~5 25 2>3  2hV{"1PPþe;1e;1e; 1e e y&T}Sf9 2zjhz"x  21d= 2ejh {"5 =|1  2| 2j' e Ve^|\L$Qhs@$=1jhz" 2 2)2 2 2)2a1; 2 2|n 2 2貎 |=)2u5 25 2;jj 21; 2 2| 2 2u M{{ 21x 5 21,l{ 2? 2C 21ɉ 2| 2 21@POuGjh-{" 21ɉ 2| 2 21@PMPe舦!Ѿe5)2RP =]=|)2t 2teV苎Wz;]1; 2 2| 2 2謌z=)2 2u' 2|5 25 29 21QQPEeM{y| 2 2| 2h2s"He\ 22h[{"1PP þe;1e;1e; 1e e S[a1; 2 2| 2 2Wx=)2 2u' 2|5 25 2/8 2jjP1; 2 2| 2 2Sxjj͊;xD$ X0D$ Phwz", 21ɉ 2| 2 21@P.ejhI{" 2 2ʃ)2 2 2 )2)5 21; 2 2 2| 2 2ω=w 215 25e5|1V/P]V1AD$ D$ Ph{"i 2 2*Xv=)2t5 25 26jj5 2,0h 2 2ۈ Ivjj5 2- BShD$ D$ Ph{"i6 21ɉ 2| 2 21@Pe qt't v11A; 2 2z"| "L$Qhz"}1ɉ 2 2 2Ou5 25 26F 21ɉ 2| 2 21@P.e11A; 2 2z"| "L$Qh{"4e5|1\.h#P M= 2tjhz"v 2)h%1V5D@"Ɇ7tV51~VPGW,1 2 215)2QP6jh9{"*ve)2 1 2 2| 29‰} 25 2)‰| 2.)2 1 2 2| 2 2fVz+Xjhz"DjðD$uj贰P諰USWVP茅躻r 3cD$1Ƀɉlj щ 2 21=62uH9ljD$u21,UUj( 9-62u;= 2 2D$t̺1: 622t8teue^_[]USWVPӉơ 21 r4$0utV4$# 2 21ESWP á 2 2tw1FxOtEu jj^u.SW5 2蝇 á 2 2u!~jh|"st 4$4$^_[]V较,qSơ 2"  t]>!t 2t P~ V 2=1n 2Oh{"PNF<+t< t x1t Q@~ V1x1$~a%/73 2 2PVߐtD =1V#^j#tw$F5 2jl 2^=1u 2VPTjh{"q]5 2V5 25 2f 29N5 2jQPTx1h{"h "R^Ë 2t s7 2 2sh{" 2 sh{" 2 sh{"k 2th{"U 2 sh{"= 2!te]% s|"Qj5<@"WV`wt 11!ʃtT51QP 2tP5d)2=1d)21u -..x/5d)2=11jPPk0 ^_SWV 2߾&t# 2/膶4VJ= 2u V8@t h|"%t u%l &P1PP^_[fD$=1t@WV|$ Wj$ƅ~WhV ^_USWV |$,l$$t7 U[Ɖ,$D$ D$0D$ ÉL$VjD$P NjD$0tEu@D$;D$ v6H|$ D$9Hu߃tD$0t:%u.$@$9|$ seH $P7tO$9rFD$0tW薞 t Wß WD$Pp|$(|$ t +l$$)D$(,\$؋L$9wȋ,$9L$0t9|$,v x uH|$,t+D$  ^_[]fWV 2`0hyjhZ|"m 2$0h}yjhz|"m1F1Vh|"W Vh?|"h0|" WhT|"hL|" ^_ËT$ 2t$xjhZ|"(mUSWVt$$1Ӊj j r D$|$ $3D$,$E< u>EP被utP9~|"tGCGu뻄u C9w EC뤍E}x X8u;\$r$T$BD$BL$ 11H^_[]ËT$ 2t$xjhz|" lËT$ 2t$USWVzYqD$9sNՊe8uu9Etkkt ]}u}gtJCKCC<ty {[uCE9r u#CCtjh|"-Brƹ 2VyjhZ|"iHVwt Ub#1O^_[]4$Vt |t|u۹ 2S1yjhZ|"h빃xu1WV|$D$t P\uD$tPPPƅt)WVy0Ph|"GhVs ^_USWV\$,$1F91919 11Et$tcÈ\<D< 2PotΉƒddrT$0uAruuu-dt($t>P3w߻drΉtD,PAMމ^_[]ÐUSWVt$ \$Z D$P*V֡ʼnPD$X9vpG$11Ʌu2~>9sWt$V* t't1:01F9r':0u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWtV19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@ËD$t5|1P1PUSWV]19|1˵|1tbjPn=|1tM迼tWVW[=1]u"jW1SP袟ƍD$L$PQV t$tƉD$V|D$ |$Pt=1jWM |1D$ 2D$ 2Qjh15|1=1St$:|$t$ ue1t=1t PD$ PVsu&D$,L$0 2 2D$ L$$  2 2x1t P7Vzo 51a1=1t?vi=uW5@@"6u=,.2~D$8Phs@$cWo 1e^_[]h#Vnh|"VXh2s"VBVD$t$Vhs@$(c6n \$D$tt$SP Vpn uVt$ Xn SOn 9W01F$ 2D$D$D$jt$D$xi1C=)2u"nt$G ZD$L$Ph}"ad߃Y6t$v\$S3^t$Vhs@$a6Um j&UV=|1Vh#FtV5|1%H 5 2t65|15 2PV( 5 2l  21|1 2 2 2 2e^]USWV$t$8|1D$tjP |1 $|$VWD$ w1t$D$ t U9Hŀ}mt9Ur D$PD$Pc\$|$1؅t V9sGHƀ~vt9s75|1V-Pyu|$u5|1D$t$k t$;t$t<5|1V;|1t*4$T5|1VP(1F1$t jP$^_[]|11B1j3|11B1jËT$ |1jUSWV׉ˋt$~SSŅ Sett O62t1@^_[]1T$ |1jWV1|$ VUtPf9uV1@^_á|1tjP|11ËD$t jPoSWV\$t jSXSSSt,t1jtt1ju^_[j~V|1tjP5|114Vf^V5 2u5|1h#P^1Vh?}"]V_t P[`[WVĴt$jPOx&P=1u0Phi}"_ǃ`~n$at6du(At'DOuWotRqjh}"j V{01jQQP!¡0u(P20hV0y0Ph}"\Vh ^_jЗUSWVP\$S@jPŊ:0,$u/CtwK,$:0u 8CudىˈEEACuOh}"3>!tVNJt&,$~WVSP uEECCuE$^_[]h}"3>!tUSWV\$$h}"a3>!tUD$l$ k1BD$$׉:0tL$:0tʉT$|$t $tD$t $GEEu<$l$ tM1|$SƃjV}0 0QSPh~"VW'E1GjWKNJt*C,tUV t$CFCu^_[]Sˋ  2uh~"~"t  2PQ61Ʌ[USWVh?!1À8S t$,jU^ tVt$he]%Sh]&UP&V1jP(x P Vd 1Wd ^_[]USWV|$1tXȃ%t#u@9v8Ct78Ct3<#t1 1<%u |1tQP1FCCuFjV褓Ɗtfȃ%t#uJ9v8EtA8Et?<#t1 1<%u |1t Q&PSSCEEu^_[]SWV1=1up\$SǃjWSh ~"WP1%V PVPu Wc 1Sc V|c ^_[SWV$Vg1ۅSSSV !ƒ|$hWV <$~b<1WjS芵 =)2u-u WjSh 9<$sP uP9<$r11ۃÉ؁^_[USWV t$ ƃ=1Vh}"3>!t9#tP5yD$\$h ~"tǀ8u~"WVŋ  2uh~"Q~"t  24$Q} )˃jS0 0l$UQPWh~"SV #Ua = 2uh~"~"tlj= 2t%GVQh6~"Pf GuV4$hn%#QA ZV a t1U9>tt$` $V` 4$\$S`  ^_[]USWVh#tyƀ8trSzteV*W,jU蚏Wh}~"Vh7%UP!WI` h"SS0` h"S^_[]USWVPνdjjd1ljËFHN~ H VoƒtS tN)M9|>,$jUߎWPW_ U5ڃ,$C^_[]USWVP1=)2=1 jȣhz"Ƌl$11@L|uK@-u)Fh#Ux)މ |jh>~"hSVuUj,jUt$VUP W^ tCtK~u1OD$jPW?  uDD$PעD$ 0#Q1^_[]ÉVq1;t݉V[1rDžuËD$ |"1OL$9PVj%Qo1txsu@Fj%PV^USWV=1D$t PhX~"Ɖ| hb~"Qfl$Vt$UÃjS^Ut$VSPYW ] t VA^_[]WV|$ƉWP`#O@ V\ |^_WV|$ƃ=)2t]PVc`1=)2#D$=tuV*jPqVP)h05V0tVjP:VPh0W VLV[ |^_V|$PVx D$XT$\1jPPVb|^ø}~"Vt$V)9vHx/uAΉ^fSWV1ۃ=1t^_[!ƒtjT!Ѓt111 1CSWV1=1uJ΢!ƒt>j[T!Ѓt譢11 uj9T^_[Ã= 2t 2]USWV\$,= 2t 29|$$t$ D$(D$l$1 $t9 )2Hx 9}9=d)2t19-11 t DTWVS1@D$j`S11 u 1UtH TWVS=d)2t謔ӓ1@D$1@D$= 2u h~"L$l$01ۅ~1tΉYWV!ЃtB|$ujR!ƒ1PPTu1@PPTtm1OWVRC<$uK=1 2u)!u =d)2u=)2u 2=)2t J 29\$'"1HPj+T1Ozt <$t> =\)2t 2jK- ^_[]USWVP= 2t 2 \$1= 2u!)2y=d)2t 1'D$9||$(91 ˆT$~_|$ t$1WV=Ɖ!Ѓu|$$t'WVQE|$u赑ƑzI9ut|$tC %=\)2t=)2u 襑jG,^_[]USWVP\$ l$D$$DtW=1uN!ƒtBj}P!ЃtϞ11 u 轢uj%j;P!уtjSURPt$^_[]Åt1HPj+Rt`=1tBQ1u11GVOVWRPWjO!уt녃=\)2t^_[]ʐ1Hf^_[]ӐjUSWVP\$ l$D$$jgOƉ!ЃtSUWVt$^_[]Åtj9O uك=\)2t ^_[]H^_[][1= 2tá)2y=d)2t 1ø'Vt$thV1F95|1u#1=(0tu1Ɂ(0tщ |1AF=(0tH 2vU ^U ^ËD$(0t 1(0tËD$(0tI1(0tËD$(0tQ1(0tЅtË 1(0tá 2SWV|$5(0(0tvWt6ui\$j(j蒃W[F1HF FF1FF (0t؋Fq0@@F=(0t@ 2^_[ËD$t@1ËD$@ËD$L$QP$IH PËD$L$Q$PQI HËD$@ËD$@ËD$L$AËD$@ËD$@ ËD$L$A fUSWV\$(t$$!؃=)2t f )2t-( 2@1҃=1JRQPSV9cSV@62$.vt t62t  U SW SW莘|$9\$$}Zl$|$t$ 62ÚWUP ~ sN)݃t$ 9$|p xl62|$l$Wƃ  $ t t;t6$RPV <62tƙƅ~o=)2uf=| 2u]C=)2u=| 2蒙)މӃ1962蠙 tudƉx)21@1@jPUWX=)2t)!jjRPUW6Xt j*=)2t(<$t" t u62t1Nڃ^_[]Ãt-^_[]骘USWV\$4t$0t$ ޸\$=)2t c )2t:( 2 @1T$ )ʋt$|Љjt$t$QPE`|$ \$SW=)2tK3.ql t u+] t u62tcZ62H%t u蟗ƉՃ 莗ƉUVK \$|$UVt$,$SVt$p62ǃ t(RPW .;t$ D$|R,~=)2uv=| 2umG=)2uUǃ=| 2JG.ON1t$|$,$jPUWkU%x)21@1Nڃ^_[]Ã=)2tjjt$t$$UWaUtj*SWV|$t$!t,WVӓuV$ t tu81N50=0H@ws50=0^_[fUSWV耔tjh~"Bv(GrƉRP!Ӌ 1Itt .L$ 9)E>GPuՋL$;L$|L9^B8 2  (4 2( ED$$ < 2ĉߋ< 2 |$߉9}4 2 8 28(9G)E9uD$)@ 2-< 2D 2^_[]ËL$1wQ5, 2ʗ1SVt$ 1ۃw)V5, 2褗uV50 2著1ۅÉ^[USWV U 2t)15d 25` 25t1CU 2|$t$T$= u[=l)2uR=P 2~0Ӌl 2 h 2ڍXp 2P 2TU 25` 2=d 21;=1P 2сue p 2ӍQp 2t 219ht 2-"ht 2艑t 25l 25h 2$ Ӌl 2 h 2ډ@p 2P 2u$p 2t 2xq1WVáD 2;| 2}4 19@ 2~ 4 2< 2 | 2)X=1tp 21@tÉ^_[]ÉШu-tU豏P 2=l 25h 2Zl 2 h 2ãp 2P 25USWV׋l$uFl)2 < 2 X 29~9 @ 2~=8 2D:0ˡH 2~M1;1H 24 2< 2PǏ8 2 < 2 9uW_uh~1ydSu&4 2< 2PvSP跒5L 2)_uփ 4 2ωփ 1Ƀ_ ΃ uW=l)2si@ 2D 2+X 2 P0( 2|T9}P1J;, 2} yɉы,0 2)81 -T0)Й)չ jlj4$V{# l1#d1#5t1#`1H1G;1hEt$$ t$ Vh(USWVL$D$ʃQP}1H…t$=( 24 2D8OD tq62uf~4 2A-( 2ZuC4 2 (I=( 29rލPIJ9s=( 2t$)\8Oà uRL$ t 4 2t=( 291H^_[]11USWV$P:ǡ@ 2D$W舿Ë0 j50t# l1#d1#5t1#`1\$H1C;1/t'l$G4$Ⱥ UVj u Gu1ۉ؃^_[]SWV|$1u W載1҅ƒ։˅t&v!S1҅SW؉1҃P1҅S`< 2~q 8 2DVPruX8 2 < 2DPr# l1#d1#=t1#`1‰Vnrt"< 2t& 8 2DVPrt 1J^_[V2r# p1#h1#5x1#\1USWV L$Ӌt$(|$$ЃtL 2UjQPVW;t.t) 2 2!ƒt9} = 25 2@=)2ut4 2 < 2$~BPjV蒆 [Pt 4 29$w̃=)2tD$%u 164 2 < 2 $PjU% L$Pfǃ=)2tV5@ 2Sp# l1#d1ʉ# t1#`1;1Et$ |$tPlj D$$1G< 2 ( 29|t1@=~-4 28 2 < 2Gފ]E AO < 2D$@ 21 ^_[]Ë|$wW5, 2$u WZt 1 4 2< 2ȉ$QjVՄ $ 4 2)v %u݉< 2USWV-( 21GWS+ W\$S+ ÅtUtQ4 2$UPV =8 2UWS W1 4$1 54 28 2D$( 21t S1 t V1 ^_[]ø 2H ȁH%2r1H%2%2 2%2h%2%2 %2 %2%2%2%2%2%2%2USWVL$0D$,l$$%2$%2%2t-9Br }$r1z3|$( H%2u$$r%2t :=%2%2%2<$:rBJ jl$(jW%2tC:%2t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?%2t_ )ϋ,$]}%2t%2tV+BJ NF=%2uW-%2MEu$9ˉ|-%2],$ϋ=%2t sKӋ$JHJ^_[]USWV1=)2tDt$(T$$!t3|0%2%2=%2t'9PH }=%2u11CŋE1ЋM 1 u ]}%2EP$H u0\$$)ӉT$ ʋ}E |$+|$$D$9‹T$ QRt1ۿR%2<$OWG ;D$$ $1PPWU62!уʼnڃ $;l$$t$t$ s1ۿ%2}]Mm 9L$$1PPUQ62uG!уtw$} $뽉 $WUQR9l$$)Ë$A=)2u  21ۉ)2Sh"!UQWS711؉^_[]á%2xCH %2d|5%2 %29|jh"v#%2USWV|$ l$1Ƀ%2%2tKC9⻐%2%21 %21 5%2v v[r1IʅI~nVv 4$9ʼn1I1PPt$R62 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sq1Iʅut{kSs 4$9}F11IVVt$Rb62uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$Wh$ÉrƉ$!u1x-9=1~%GW8$É!Ѓu O;=1|܄u<$<$US111 )ȃ^_[]USWV t$ >-uF(}eh%IV@hz"3 D$1ScSqZS@SKSShP!y W%h#?À8t>tkVtmSʼnD$X$UL $ȃ$jPXt$PSh7%t$Ut$g)  S`XŅu>tVhV&!EXUU-) jWNW1FV>VDYD$$t*Ph"8j fa 2t$衾jy>^_[]USWVt$t!Ѓt61U!!ѻtՉj!|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WUmtjh"u1N\$hߋ!S趑bh%Shz"La1SWSz=jj 1KD$$#D$($<$t9l$$T$(ʼn|V|otIËFHN~ ;F~à tQuVSjh"1KtL tGot=ËFHN~ ;F~à tQu VSVܔ1Vj 1GWw<WV_= 2V6<^_[]Ð1I)2 )2uËL$ 1ɅÃ-$t*(2'uIÃ.t/^u>1ɉ )2 )2)2ultPjh~"h )2!)2RAr AwXى%2#%2t6%2m)2 )2)2 1I )2 |1 )2jh2"jh?"1WV D$pr Hw=ىƉW G%2O%2%2|1%2 jh?"w^_UVpu:V #Ft%D$)2$L$ )2(2|1(2e^]SWVL$bte |1=(2u1)2#(2u (21҉)2(2)2)2xpX 9t Ru SWV ^_[ËL$t;|1tjh"1HËAQøL$1J9)2u )2 )2uÐV=1tjhS"0\t$D$tt'uC51;?ou7=0x@jh"뽃=0x%1Qh"^jhu"jh"VRP|1P ^*h1=VD$$L$ t tC8.@L$$VhԠ&Q X0>jh"X0Ph "V譄 V$||P|0tB D$0Ph"XD$$VhԠ&Px >tKjhԀ"5x91C‰)2)2L$Qh"w^ã)2X0X0x1C‰)2VD$$L$ t tC8.@L$$Vh#QG \0>jh6"\0Ph "V] Vԩ||P|0tB D$0Ph"XD$$Vh#P( >tKjhN"5x91C‰)2)2L$Qhd"'^ã)2\0\0x1C‰)2V|$u%t$jVt0Ph|"^SWVD$L$t uw)2p=1tjh"VPHOPj8蝵?t V轵)=!ЃtV莵5)2SWc ^_[ÃD$L$ t tt0PNPȼL0L0Qh"Ã|$tËD$)2P=X)2uhe]%̈WVD$t t0t$8.2l7=tDMtGhuXF0Ph)28.2Qhs@$?Emtwt su!FF0F@.2F<.2F 07z VuM^_D$u5)2egÃ|$L&ËD$Ht1hс"hX0hH$hׁ"hށ"h"h"hZ"h"hÂ"jyMWVD$PtN$T1FPLր1ɀ w1ҍ JЊP@րЀ r; ( 2~ , 2FP{L8,u @|5P0( 2+$ 2T0D$ps D$ stopD$Tab =P0|i1Gt$rVYfD,VI4, 2h""P~ G;=P0|VD andD theDen t$V5T0h "P_~ 0Phs@$D^_à D$t t+uyL$tJQtQytWjh"nà0L$0AAD$Ph>"B%10000 00 ËD$HsjhH"Åu 1Ë )211t$iPh"h )2T} )2USWV|$,1 ()2t&AWjQD$D$1}|$,؍C\$ho"l$,zl$D$ t^E<D$D$ PVD$ P Ë|$|$,t$tb< t^<=wtCt G|$,7SohPh"h )2>| )2CD$SÅD$CHl$o"C D$R1Ʌ3C D$;1ɃD$1҃|$D$ɉ?jUD$4P < t7u@ n=X)2nzxx tT$sUD$,)2j+*gPh" )2Sz T$jSfD$,|$?+ulGPGx1?-u]l$,l$D$ ‰ЋKC|$tWjЃt WS l$,Ex\WۉȀ+u }|$,E+D$H.rD$,jh,)2P: ()2I()2^_[]Él$|$ u D$Ph" D$Ph"> ͉()2ōD$(PhY"uA0h"j*h,)2ËI1Ph"j*h,)2SWV9toӉQ@jPlFljtG\$=)2t <\u ~t F <$t)\tPSlt GFFuD$Qh"Y 1^_[USWVt$(t2\$4L$0݃㿃u4F@tbD$,)2Ph",)2Ph"NSWVt$6 C1ۀ-txT$ ,< v t9K1ݍCЊoGЀ r>t-u!D$tQhDŽ"1H^_[USWVt$$|$7oB€Ѐ vty11PЊDCĀЀ rCكrCgfffKt1)r@ҍHut%D$ tQhDŽ"1JЃ^_[]át)21A=X)2tÐWVh"蓛t8t X)2=`0t*h01FtNFtWWV ~v$u^_SV`01t+T$ `09tAt9t Y$$u^[USWVL$0=`0D$,(`0D$D$ D$D$$D$x1P7U@ ~Drb<-t^|$u;t$u1@D$ D$D$6;t$D$~,7蓙19ƋD$L$D$ $|$t$@t1@`LD$x$@$4|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]fUSWVh)2Set-1*2A AAPQj ^_[]Ët$,|$(l$$1K9*2VWU詽 =1ut1 *2A *2}?*2y萘8t 膘8#uh)2dtOmjI?jh)2dUVVje^]USWV\$'06 SŗV躗,jU5>VSh "UPf^_[]Um F!mF!|$D$ fD$l$|$l$D$]UiM'QmtLE ML$D$l$T$L$5!F!<$$ fD$l$|$,$D$T$ 11҉]fSWVP62t  2Z1 *2WPt>1C4$J$ *2u=K VeWSCuI^_[V50$*2t41@=1Vh$*2P 9t  20$*2^S=$.2t$.2]H\$0=#.2r 0H 0(.2[Vt$tFPFu^USWV\$0l$,11Í|$Gjj SU4)0 O9ىʼnrǃ|$0xG-Wt$8| ^_[]USWV\$0l$,11Í|$Gjj SU蝓4)0 O9ىʼnrǃ|$0xG-Wt$8 ^_[]USWV\$$41ƍ|$Ggfff)0 Ow؅xG-Wt$,^_[]g,Hw @sÃtPuSWVt$|$,.2=1t4=1t+=)2u胰|GDFjF\1=1t{=1trư "PGu(G`1+Hw @rt PEtDE;1|  2^_[j '^_[USWV։1%uGGdtPnt{su,$.E1PDCu,$GPE뜍D$P6D$tJ\$PCu1D$Pv6Y D$t\$PXCuD$PQŃ$,$^_[]WVt$ |$EDj E."PFuE$.2^_WVt$|$ =1t=1t%D)ƃ=1t(=1t*C=1  2+ j g^_USWV\$l$=)2u1UO1GWP芍PW71WPPUV词1 rbjj71=1PVW1 ÅtWG jh"L$t PGL$ 99t V  ^_[]Vt$t P^1|$USWV0]$u} r>1} L$PQjWu&T L$U |$ >uu Ņ7T$ U L$ډT$ND$Hl$T$:uL|$tA;|$ t7t$u 1l>9_:l:u 9t9|$u+\$׋t$l$uGL$N;|$ r11Et8Mt]$ 4 e^_[]fL$tt"u$ 11HI 1I0.2ʋTUSWVD$T$ 150.2|1Gll\G9uTD^_[]SWVD$L$510.2|F|\\|N B^_[á1~Ph50.2u USWV1;4.2 0.2t/1~21B1O\t!u 4FBu11K11KՉQU 1jPu4ƣ0.214.2~PhVҁ !t\|^_[]USWVL$0.21H; t$z|#=1|O1;Ll |C9u^_[]USWV 1~.0.211F1l9޻r G9u1@^_[]USWVL$T$9~1@+50.2A1G1֋l9߻rB9u^_[]USWVD$ 1~-0.21C|l!u4FCu1M 1OX8h^_[]ËT$ 1!Ѕ1@9|IHhq"28.2=X)2,r"tq"P2<.2hyr"2@.2hq"u20h\q"c20hq"Q2 0USWV l$4D62D.2E "C\$ ȃ9~:5?t.\uEE%tf. D$ D$ ^ uE$ŃO $F$p")2uE$ŋ $Fw$Lp"!FwW$p"J!уjSRP2UBtDt LA=)24I!1T#!#PQ ~IуRP1 1=D62D.2Et1=| 25|1Uh#P車`=!0!&!uV1B!ƒt:Hظ u5|1ԫ1u mŊEES5| 2Qу 1IjQRP#/5|1c \ #Q4 bm4 腫ƉG!уRPWVvD62=D.2H8 D62H=D.2wA5|1衪P衫\G n!уRPٹ 1IVQRP萆] 1M5|1#P芣/Fփr-RPgٹ}SRPT !QD$ tMoF׉r4WPٹ}RPVt$SPg! "詩1c5|1@SP#:uȃu&\u܅tȃ.u ȃ?uBÉJu^j50V5h)21=X)2tȉHt08.2 1\1`1уQ0q1^á1 \1 `1ȃP5 0>SWVQNjD62عD629r ЍD62WVSoR ;D62;^_[VQ!уu$x 1H9}FVk!уtt^C^1H62L62P62T62X62\62USWVPt$= 2to=`62te=1tl<$=1|F1U!Ѝ]t#SWVU571H9|5<$u`62=`62^_[]USWV 00D$L$!ȃ0D$0D$ 1H0000=1= 2tt=1$1S!ЍktJU;t$ L$}3!уt 9D$D$}WVS4&1@$1H9|<$t ^_[]c4^_[]Ã^_[]ͭQ62u"5H62tjh&"xÃ=L62t1=`62`62jWVt$ t8P u1Hl62h62t62p62^_V$0t0Pw u$01Hl62h62t62p62^V80t0P9 u801Hl62h62t62p62^USWVD1u- 80t#T$|$1FY1i1 t u^_[]USWVD$(tL$ T$\$=)2uA50-0!t,;0D$0}׉ʉ!1@tp9։щ|f-$01tZ׉։!;] L$M}tM9}| mu.L$(t=)2t|$$=`62^_[]Ã=x62t*L62t P L62hH62á)2|62*`62=)2& USWVU utO:tJH62VQ=)2t$1W=`62=)2u @Q62u5H624u U=L62uLj5<@"MwVH62S=)2u=`62uF 35P62 r)2uj)2u=`62t`62 `62utS1>!14==jhE"jh&"1N`)2tu#؃؃r؃D$ )2D$PP!|$u1QQRP!uu=OW!u G;=1W!Gt|$W1NjWVuSVVEtƃ=)2u7)1u5)2t$t$ѩ 1=)2u j*e^_[] rjhd"USWVP։ϋ\$tWSV y1OGt P Gt"V/}@Pj#GVPf_4$V}1~.Ɖ1CVjUF P u94$r1ۅ11ۉx62 )2uʄuʉ|62^_[]USWV0։1D$(D$$RQS62t 1H0^_[]É|$t$D$T$ t$H|$Dl$TD$PD$\$T$!t 9D$Ll$T$ $u'D$ PD$0PRSDƉ1Ot$T$%1D$ PD$0PRSlD$T$1@ދT$ЋL$  D$ t|$ T$Ћ|$!L$=)2t&)؉1=rWRt$(t$(1 $)D$_>u?80t6H1P1 t62\$t$H|$Dl$ |62l)2ut 1҃1҅…ut=)2|$u$Rt$vPj,!Sv4$D$PL$ Qt$8|$Wv\$L|$]62u5T62ue =X62tZ5\62jD$,PD$4Pt$t$5X625T62 t(jj hpxL$H 80Q62u5H62CuO =L62tDSjD$,PD$4Pt$t$5L625H62 tuHD$HD$t$H|$Dl$\$4$ S 62t$$t$,\$ St$t$t$H|$Dl$뫋L$\ɋD$QD$\t L$HD$k=)2|$u"t$$t$,Wt$t$w4$ W D$Xt0h1USWV0=t62p62l625h62Q62D$u5H62uC =L62t8\$|$t$} E}xRtU1ۋuE} SSWP誶Nu7;]625T62S1HljD$]t62 p62ȉ$!Ѓtp؋u!94$ƄuWl625h62;uT$U |?Ut$ [9ދD$Љȋ$uM( 2@U4 C؋u! ( 2 Iƃtȉ։u4$t$ ] \$\$!уt$! 9Ɖʉu߉!T$t$ t9Ή| L$D$`#P62ˉt$ V1VuVPWS|$xMl625h62!ЃËL$ D$$9uD$$t$p625t62 h62l62e^_[]Ã=X621H‹u9΋]  $}B ( 2 IL$L$+t$4$˹|ً4$t$ 4$L$L$L$ $Vt$t>tT62t$ &X62t P X62hT62 2^k81u+]62u5T62 =X62UWVW-7!t"jjRPWVZjde^_]USWVΉ6tz;~z~}9t"zJh X,$9|ً<$zJJ jt"~^|$9$|L$,$jJ z9J} 2 R ^_[]USWV T$ $|$@GT$D;D$4L$8L$ $L$L$L$1A)L$D$ T$D$4)ʼn)jjXËD$<$ST$<L$K9}rL$,9|$H9 uuND$L$C K$0T$<9}'jjT$DË$L$CKrE뛋t$DD$ 9w ;D$tF@ƋD$)5P62jL$LQL$LQPV5L625H62s t|$@T$Dt$ ^_[]fh0jG 62=*2V|$t1hjGhjyGh0jjGj%1VjYGVjNGjjBGVj7G^C$hj!G 62=*2 hjF 62=*2USWV6262ty1FVWF&$"a1UOUWFUWF ,WP3hWeFV!5 2tF=15119=1u9t$H@1 2t =)2u^_[]j2fP0=P0tPQP P1 1626262WV=L0hv"W{qt|h|"WdqtRh"WRqtGh"W@qtLWO  P0=P0t62621Cwj4r"^_[]ûD$=M1tP*PUSWV 62A I tQP$ 1PP1N62$T$111UD$PT$RL$Q賨 $˃|$ t؉$!Ѓt{T$=)2tt$UWt$ l$|$62kUiNjt$PVU\ u{tG>< t@t<62L$T$B1OjhƐ"@1N^_[]Ë|$ Wt$V  62QA VL$~462A1t2P0t56262F1I1^VL$~562A1trP0t562 62F1I1^á62á62á62t pwn1@USWV׉1EUjSah@UPFSP虚D$F~ |$D$Ft$W'h@jPFWP^F^_[]fjhP!\x 62VPt$jV562 tx#L$uD$u^jSWV<2$D$=@2u VjI<Vj><h624tW1FVj<Vj<h"62I>!k0=62TP L\0t%5?2\0PVgt Oȅu62H" =62$8@h"5<2Iƍ|$PhW F<$$h&'P0u$$8 E$H $5x0Wf$$h"PA0u$8  $ $9t $9,t $9 t$ $9t $Q$ 625?2PQ62D$V$8tq$ $9t $9,t$ $9t $Q$ 625?2PQ62utD$5<2h!KY"|Vj|$t62P |$"tX #QVjv"AVj"1Vj=?21t<2WdPWS. ^_[V1FVt$ m9Vh621=62t&|$t62`f=0t h"sfV$0N1J 0N1;@N1у  (N1Q(N1jPh?2h’"+ t^h?2hhP" $?2x;hVh"* t9h?2裮h(N1QӢ|h?2hԒ"茝505$?2V cUSWV$$$ $Fh."PW-t܍D$P蕥t$4$h9"hV裛若Dž"t$hh072t$ ɇ Ɖt$وl$ U 09uD$ D$ tȀ uWxkto4$hP"eh"5$bh"5t$gt$[9hN1jjhA"0!h=#44$h`"hN1 1^_[]ƃ072/72A072v9 t@072ˡ0$tt$͇1CSt$t$詇j蟇jVh}~"WWS7USWV$,D$D$=<2VaPVW* ,?21FVh4!5<=2ӄ Vh?25H=2 D$ VP5<2* l$jU5<2Ӆ D$1Ƀ=>2ˆ! uϿ1h =2WV h620-h WB5D$VU3D$ T$Nj ,?2jU5<2J =>2Ӏ"\$\$,?2хu$4P(*t tD$HL$ uf=0tGWh!"͙\$D$)É;h0JSD$P$8` 9th" ,?2D$D$ t$D$)Ƌ$0tVPW 9t h" f=0t!j2+D$ T$RPh%" h<2Vjg jh?25D=2貂 t$V3W^_[]WVjPh?2h "% t h62h?2Hrh" }u 626262PhhP苃 x1Ɖ562h"hWʖh"VW b562hԒ"^_USWV1L$\$1Eފ t uFt1\>t t tG1҃Єtt>D><>u^_[]'#1@,?2Ph62Z*USWV T$(\$$t$ 1|0PURS[)ˉ<à uVhs@$/t$|$u u)u%u!1ɃtsQ0Ph"t Dh "% ^_[]SWV \$ hSh<"# uPth" ^_[xEhSh"o# 4$ut t$ej V躁h"뙿 h W050t$S jW0|$WS)[9uR1Vt$4$j螕Sh"V菎WV|$ 50j/V+t@jWh}~"QV^_1@(?2Pj0ÊD$0N1J 0N1;@N1~{у ts (N1Q(N1jPh4?2h’"" th4?2h"PJt:j50P? f=80u5<2Mh(N1Qޙh4?2hL"蚔USWVt$81GWh4!5<=27~ 1-(?2h S/D$h =2SD$U衻 Wh?25H=2- tLtFPFuf=80<2tjQP~ Pwj}2t$4l$0j,D$T$1D$EHM~EHMUQ`ڃÃ=(?2uf=0u0Iڃ% tM 1f=0@ ЈD$P D$ƒ t|f=0Qq f=0uf=0tT$j \$Ct,j Cu\$T$f=0x댉\$ 넻 $f=0tD$ @D$ Ph!"oڃf=800?250jW5<24} 0?2 (?2 u61=>2#$ 09uj˒5$t h̔".j褒ڀ tf=0u j ttFPFujq*ÉU$]t$j6,f=0t'+\$|$f=0%"t^"WSP jh?25D=2z h<2jj(^_[]USWVP\$D$jP5<2 f=801=0?250覑jD$P5<2{ W舑9=0?2ttػ1FU Ph"茐KtMVh625<2- =0?2501VD$P5<2M{ W9=0?2u^_[]WVjPh?2hu"% t ^_h62h?2Hrh"4ы 62u 62Q[h"PtAf=8062"t|"PQhW$Wh"V \WhL"bLh j *0?2USWV$0N1J 0N1;@N1у  (N1Q(N1t$hVh<" 1GWh4!5<=2zx WSk)Wj`)h =2Sj Wh?25H=2|y x>jA'Ɖ׉U!~*9u$h(N1QjEh"x11f=0tj&)RPh̓" jh?25D=2w 1h<2VW2 WV(Wj}(^_[]j5<2貕Wt1SjG(SW=(VVh"fSMUSWV$0N1J 0N1;@N1у  (N1Q(N1t$hVh<" 1GWh4!5<=2v WS'Wj'h =2Sj Wh?25H=2w x>ja%Ɖ׉U~*9u$h(N1Q芑Eh"11f=0tj%)RPh̓" jh?25D=2u 1h<2VWR WV&Wj&^_[]1W5<2ѓj5<2S胋WjX&WSN&VVh"wW^USWVPh"1GWj&Wj&9tDƅtZW9uh "`1Vj%Vj% ^_[]hN1Wjh>#>h"Z1Sj%SV{%-0j/UJt@SQU hN1WVh>#h֓"W}WVPjh##5<=2t f=0t%50>t=D=2V PPVWs 1FVhz"5D=2s |$VW5H=2u ?nu50h" ^_VPjPVh" t=X=2u.5(0VyVh"衉h "P^Vt$j5P=2tVtVh"_h"Ej3WV5H0t)>t$=<2VNPVWr j'j{VhVh'" V0t$0jh #5<=2xr 0u0$0%0t$0t$0f=0tQ0t$$Q0f=X0"t8!Pn0t$000@20t$0j0t$$0f=0"t8!P^WV,|$8V5<2P,h8!WRNt! $#<2 $ <2<21GVW5<2Ү h<2Wj®8^_WV,t$8W5<2+h8!VM1Ʌ#G OWj5<2o8^_V1Vh{t 5<2? j%Vhzt 5<2? ^S\$1u jP4r[ESWV|$\$1FtCWPt1^_[fUSWVl$$1?2?2;2%Phl0hi"t$4U虔1I~1L$$D$=0;28O>HЃ sX 4HЉ5;2jhl0hi"t$4U/߃ufH1K$"h:?2뷃EFh:jh!S> jh!S> h!SKD$QPuVh:h%SKh(#SKzh!SK$_=4;2h:<21@D$<$XD$0@2=?2h:j/S(?2k<$$YxD$ P1PhPjPP5h:( ;2L$ !P5h:h"Q&<2@2<2=h:WI*Shl4%h?2 1@1H1HD$1@$D$~1HD$$H1)t5|$L$(4ho%VIt5<2<2@2<2) VjVjVjVj8;25;2he"j VXV4$jh(N1 N!wd"P_ D$tu1=4;2 1A111ɣX0 0800=0@2t 0=<2t5;2 uW6uB=<2u5;2 u3^_[]xVh!"Hhy"Ahj":h"jt5;2h"!hЖ"h"h@" h"h"j{thN1jj@h"j>zhN1jhh"jzfUSWV,|$@ho jW^1ۅD;2=<2hH;2}u.j 蟁1=<2ȍPUk<2jq<2x3=D;2u?jPTW <2teQl<2Uhs@$D;2WŅ?1GVj=D;2t1O,^_[]ÉVQ$=<2uL$ @Vj5<2J 1Vh t 5<28 Vj1@D;2jhH;2fWVP=;2t 5|;2t$uhj"%ƅh"%t8/u00" P Vh0PQ k%1"9uQPt$ў p"uڃ=;2u%h;2h#t$+ u ;2%h@2h$t$ u @2=@2j:h"t$8 1Ʌuǡ?2u'>/5?2jVr?2?25@2<2@2=;2u ;2%@2Y1ɉ @2?2t=?2u?2t =<2lj:h#t$q 1Ʌ 0@2=<2u6?2t=@2tP5?22D1<25@2j:h_&t$ t 0j:h't$ t 80j:h("t$ʒ t 0j:h(#t$詒 t 0j:hFs%t$舒 t 0j:h"t$g t 0j:hI#t$F t 0j:hw%t$% t 0j:hk%t$ t X0j:hz%t$ t X0j:hh%t$‘ t 0j:h#t$衑 t 0j:h"t$耑 t<2j:h9#t$b t 0=@2u @20=@2u @20 @2tPh!,@2tPh! @2tPh'@2tPh%h$@2h*"t$[ u $@2h(@2hߓ"t$6 u (@2h,@2h"t$ u ,@2 5?25|;2;2t%j,VZ tA1ɉ5?2 |;2^_Vh" Vh"ho"jimttu$Vh"華hŚ"h"yjsfSWV t$ |$6};2~;2};2;2h0"Pl@;2VW8=<21h<2S# <2<2%<2%<2%<2f=2 =2<2f<2<2h<2jS芠 h8=2荁h@=2老hH=2sh jۛ"9;2tϛ"Phs@$x,P=2 x |AEjj5<2Xd xPj5<2@d h"j$u h6"jak1hJ"VWÐ vtHЃ rt+vhV"q;2ō HЉ;2봡H1)ǃG<1tU1DHu0W==r$hhi"`h"jjSGhWh;2C3 ?t GG?u<2;25;2h"j Vu) WjWjWjWjVtuhj"hy"jh(N1yh"L0t <2 h!=<2t50u,u5=<250{50h"j}iPh" WVkƿN1Ph6"W8x Vh["W)x jo=T=2thT=2htj. j+SWV50t>u+t$?2t P Vƣ?20h!Vc<ts>2h(#VG<tah#V3<tSh!$V!<teh%V<t1N1Vh"WGw W>2$11ɺ00 ߈?2Bu^_[ñ1WV,|$8V5<2WVkWVk#NF=<2t L$f=0t D$#$d$d$ wfD$ f=X0t $Vj5<2̛8^_h<2jj踛 SVPf=0tjt$R 800utztD$=;2„u00u1f=00몈D$< t< u>jV5<2z f=0t|$ 7"t "P`u 2 X0tu (0tt A8u1f=0t tU1DAt hU1DAD$jV5<2 f=0D$P7r/h<2jjW USWVt$D$ $1=X=2hc- j D$1CSj{ h<2SW  Vhs@$rh\=2/tWD$ h<2jjә t$j% Uj =X=2uD$ 1;$ȃ^_[]Ët$$4$M1H M1~M1H M1hM1>eȋL$ < U;t$ KD$ V1FVj 5X=2h7"Vh\=2SWVP80\$ 0t%;209u Gt+t' u9tpD$jP5<2 Yـƀ_r>2^?t@آ>2>2 >2>2h>2hs@$pPW1^_[PM1H M1~M1H M1$M1i=t1Ƀ=>2!YXD$_r>2^?<t@ >2>2 >2>2>2SWVT$L$D$=>2ut1<1>21F9uRQPY y!68thY%^_[h "USL$ \$1B1t 9tA8u[VL$=2tSA "8t6u(^@\VPt>2)ƃuf^?݈@=2^VD$Ph"Bo=00;2Ft80_r>2^?<t@ >2>2 >2>2h>2h"n_r>2^?<t@ >2>2 >2>2F t*vPh>2h"tn;2~ v 7^ÐWV1F?2VW5L=2X VW5@=25Y ^_USWVt$jV5@=2Y  uD$41؍oD<jV5@=2X D$< t r֍,f=0t?2t PS9 u0D$y1D$h,"Po?2tD$y0D$nD$jP5L=2W^_[]1f=00USWV1GWjWj&4 VWVj8=2fC<2CfC 1l$jjSW ~}D$tvjh?258=2W ~]?2Bt8StGWuG1GW?2U5L=2=V WUl$5@=2iW 1f=00D$hU5<2/W jƉ,<=>2  A9rWD$PjU f=0?2tyf=0~g|$_r5H0Pt. ?2YSQ;Y~ڃ tZG9r QRpl$!y-f18u!PWjl$UVEh@jf=0t?2t P6jcfSWV0t30^tPtF tFFu҉5(0h"hW'ih"WltRVhW t4=;2tWh"Ijj WytWV5%A0^_[USWV|$h%W0j Wj=Wt@C@uSh$WM0u S6ÉXj?WMt0tO@t8JS??!tOYt@t mtWh"i~5=0t,0Ft = @t lt~vuك=4@2~h7"4@2^_[]SWV΋4@2C!w\C4@2؋ 0N1Q0N1; @N1h(N1j m4@2 (N1Q(N1 X4@2#|>W .أ4@2NI$"Wh#h4@2@4@2N Q1f~ @4@20N1H 0N1t;@N1lh(N1j!ll4@2v Wh"g `Wh#g4@2@4@2N tEPP1-4@2V(N1H (N1!6hs@$8g4@2#|4@2h7"g^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n"L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh$S,uW 1@WljR1^_[SWV01t8ϻ0WPp,t!CtWP[,t Cuމ^_[USWV׉A tS^؃H$"n tWU,tjPu U肢 WMF tQfB t $ith"v*N 1?!9~ t~ N 9tF N^_[]h˜"fSWV,1f=0t h̝"d|$ jD$8@2|$h<@2us50bjW5<2L jbl$ÈD$V't1:ul$B9u|$tjjdD$t$jP1 ^_[]VP1Vhxt 5<2> jVhyt 5<2  j5<2`Wjj5<29WjhL"5<2J R"<0t<3thU"`hl"`1FVlPhf@5<2 jh"5<2aJ V8j5<2Vjhxt 5<2C 5<2L^jh7"5<2J h"<`8@2jh<@2fUSWV $ uh\jh@2 1H@2,A2h"=t "A2Ǡ"hݠ"$tA2$ h"USx ƃw$Ԟ" @2׃Bh:8jL$QPӎ $9bA2A2 @2냀 @2wh:A2` @2T @2H-h:h"U|ſ"8"h"UVWUR u<7t;upC @2KD5tX<=Eh%Uƃt=tU$U+D$d0@<=uEajD$PU耍 L$9! t , K@2h"V,<0$ $ h:!"5h:OA2VP$A2t=G$tjVP#$ @2A2A2 @2}=@2rh%UwUPh"H pjUh$"Vh") Wh"&UVsh<" h !jOWh̥"QWh " h:Ph"jOu*@2 t5H1)~1҅ S|@h3"h%"hq h"h"hh"h"hKh"b @2u8D$Pu h'"9$7"@2 @2y!ǃu hΡ"","t!ϋ @21Ph?"ϐ 8"u s@20h_"誐 s@20h"萐AWh"v.t%th"Y|$ DA2$ $ 4hW uW$ 4h "ō$UhP tʼn-@2=@2A2hPUE @2uY%t0#P5@2h("h@2Pu5@2hI"j@2uG=A2ty@2A2=A2tVA2h@2Q@2u7J$ @2z$u+h@2Pu,@205@2hd":u5@2h" =@2uh"hJ!h0Yhj$$ tD ,A2u$ th "h0A2Pu$ th+"X#8A2=tD @2Au$ thw"P=@5,A2D,A2$ D(A2@25@2h"X@2tpp 0h"jX @2uG(A2 "tt"#8A2"@t "QPh"X A2tPh "X@2uu+ @20Au*hD"N @2 9" @2>"!h@2u Vhn" #@2=u#5@2Cu5@2h"@5@2pCu5@2h",A2tPHCu5(A2hĤ"]jO$ thL"lUSWVt[ׅtf΋8"t#<"tVPht%]uWVh" jO@2^_[]h"h"hh"h"hh"跀rPPPhA"hN1@X@2t@t h@2ЃjOD$t@0h"[1h"h"hh"<D$t@0h6"%1h"h)"hh"D$t@0hi"1h"h]"hh"USWVh["Š1&,("Qh8%%hN1'W0"t*tu6hN1jjhn"hN1jjhv"hN1jjh|"L"t"FKrhN1j ^_[]USWVN19u1Ht$Vhht@Pb  V$PPftхu! $hΦ"赉8"tc D$&<"0tBV ؽ ;$ݸ"D$VPh8%%hN1UD$"uhN1hz"^_[]fL$t11f3QBuh"h"jThA"}WVD$ tRt$tX|$t3fPh"wSfPhɨ"`Sf1@^_h"h"j` h"h"jahA"|}USWV @$ @SFX~ _cf ߃| RQh"%19ս|*Ձ tRQh۩" 1 @^_[]û l$ WWSUPB9tmv h "$ =Ut%tv hJ".RhjU  1$ PPQ^BÉ11 Զx$" 9/9$ $ =JA|$  D$ |$< |$$u)D$L$T$$RQPLET$ L$D$419ع#PhF"Lch Pv tOPSQh"!6$!u$!$!j?PQD t$h"Q+PQhЪ"$ "u!$ "$ "hPQiD th"$ QRPh"]$$j@P$!PB  Pt$$"P( $$ Ѷx"l$$ $8v+)t)+8uHJRQPC t h"Í$  tL$(SUP  l$ M1h$ USt  |4ōPUSC  < ߁WjP N1\$ PPh t<=NýjPU` 91E 8t88u.N1 T$ PPS 9tǃuzp8u~\$Shmdv thʬ"N1 T$ UUP ljl$Shmdv 9=tWv h"2v h"gh"h;"h8BhH"h;"h91h["h;"h: hv"h;"h;h"h;"h<h"wUSWV$F~ 1jUWSP=9u!D$=жxt9wwF̓uv h " v h2"'ST$1uD1Gu<jUPSv<9tu&v h"hK"ҁ1^_[]hPv ho"譁h"h$"h hH"h$"hh["h$"hh"mvUSWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ P D$VUP s DD$st$s 8D$ s <D$tf4$l$4U"t_uhګ"蟀h%hr@$hN1(M "h!hN1 M uhN1j '"D$l$4$sf@8tD4$t$xV萭@SPSV覭 \$$Vt$SK1D$0D$,D$(D$$d$sD$4j@HP st$st$hM" S% Zft$fD$fD$PSU` $T$l$GD$x|$ hhjD$$P \$ $ sh"Esh"Es h8"EshU"Eshv"~Esh"nEs h"^Es$h׳"NEs(h">EsHh".Es,h;"Es0hY"Es4hy"Ds8h"DsXf|$rL$I"fw "L$T$ t$"VRQPhӵ"Bhܲ"h̲"j5D$f=010hjD$$P fD$|$<0fD$ $T$0hs@$qBH$"L$f|$"t"P5BD$=ufD$L$IL$}1|$D$L$ ttU114/Drt#E9uT$ЃDPh"A~|$uj!:jPP jt$t$ VU VhiW u hr"D$(|$ u,$PD$D$,$|$ 1hSW GG?t$>hSD$$PS G$0hSW6 jl$UW wh"6@h(N1Wh:it$V uO j."?h(N1UjWh:iV u Cw8)|$""P$rkLPD$$PQ $<1|$Vh"S?t$kL4t4ܭ"hG"-?h^" ?48~1D=P%>G9uh!#C4 D$4!4"4#4$4%PSWRQt$ht">4(h">444,40k<SWPRQPh"c>4`h"O>h>"B>4\t hM")>t hR">h"#Z4d6|$1A t$t&u/7t$t nu QhW"=FL9Mt$ $t$qV)P$t$RV)h9!oPhױ"hN1?? j56USWV։1hUS jWSk sUPPh t'Sh9iP tV)Ĕ^_[]h)&h"j0USWV׉1hVU jSU }VPP tAUh:iPC uGPhv" 1FSp(Đ^_[]h)&jt/VA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Ph";^WVhq";f>r1D~PhY&;GH9|j]:^_WVhq"z;f>r91D>Ph!_; 9} j:h:G9|h!#.;^_WV$fGjRWW WhiV t Đ^_h"j.fUSWV u }6Oh "j4 h"VWS Hw$"B2 B2ԃBu|1PP5h: B24B2뭈$B2(B2,B20B2B2너$B28B2sjh(N1X_$B2Su|=H1=0B2u,1A AAAQj j% = B2uR(B2uIB2u@4B2u78B2u.$B2u%P #舺Ph"hN1X; 1@!P/h(N1uh "hS"h(N1h8 4N1@t>$@$PhN"h(N1>8ڃ 4N1@ t_  =(B20N1H 0N1;@N1h(N1j$;  =8B2x0N1H 0N1;@N1h(N1j^::=$B2,0N1H 0N1;@N1h(N1jMn:ڃ(N1H (N1$(N1H (N1^0N1H 0N1!;@N1h(N1jI: (N1H (N1I (N1H (N1M0N1H 0N1%;@N1h(N1j-9ڃu!(N1H (N1-tU1DPuW0N1H 0N1;@N1~ƒ t(N1H (N1 h(N1R:9ڃ0N1H 0N1";@N1h(N1j^8ڃuv(N1H (N1^?tЃ@Ӌ 0N1Q0N1; @N1~ ȃ t (N1Q(N1Zh(N1P8AF @t5@B2hs@$t$|9A\0A \0e0vy/th)"h^"jt$ `0Dh-u j=PF2u$Phd0Ol$Phd0lu@>8uT\=pF2u=LF2t@TF2 XF2t3D$ P6k1#$=@txUhd0D$ P6Blu6hs@$j#D$=@uLF2 pF21ۉ  t1ۀ|$/uhd0h".t9Ur|/u (IHr IH9/touɉt$P"F2USWVT$juQ, PD$1t$CHfw?$й"ss 蕍 PVt$ h "^ Pshʺ"^>|$(5`0C,d0)=|5TShd0h"|^ t$V1Ga{DuO|$u C(D$?Cj/D$ P8t L$)@L$D$hu,"Q`T$CS(L$)ʀ</t ~/t/FD$щT$d0)rPhd0h "t$PV L$\0\0=e0vx/u H\0=PF2tD$Phd0iD$Phd0iT$KP3Qt$31 u@T$(3Qt$$3q u.shd0h*"] CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shd0hP"\ 1Gt$#KPqt$1BD$ $"=LF2L$ QP T$ LF2 pF2sHtbffM V2QV2T$ F2t$/D$ !=@8fush"[jSt$ V 1G)=LF2tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=`F2t$tjQ\V2H V2Xu#D$=@=V3V3>/uD$PVW"X$hSWz Wt?$ VPh0%hW?D$PWW"t VQ,D$PWWÅV3WV/PV%t@\$L$/PW%t@L$ Q\$Su)D$ )=|\$=V3u=V3h(N1Wh"hN1 M1H M1~M1H M1hM1É؃t9 t4M1H M1~M1H M1hM1ƒ߃Y=V3u#D$=@uWW%u8=V3u WVV3 PWQVQtW#1ۀ=V3$V3VPWh "~hN1jj h"è9D$t$QVPr Ƅ fDŽ$.$$PQ&U\$4$9|$ t#t$WP$ D$Ƅ fDŽ$.$PQT$3$$3$ $3$$3$  WVhȽ"H fD$L$TTPQËD$L$TTPQUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQPd^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP2^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQPf^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP^_[]USWV |$87覩h "js j轳t7D$Phht@j uD$th0V3V3V3u V3t$41۽h8"WV ( HσG$о"V31V31V3V3V3V31V3V3V3V3V3낃wV3V3^W3O W3@V31V3"W3 W3@1V3V3V3V3V3V3V3V3 V3=V3t V3V3V3V31VV3GV3V31C+V31V3V3V3V3V3V31V3V31@W3V31V3V3V3V3W3W3V31MW3W3rV3cV3V3J1V3V3V34V31V3V3V3V3H1D$=V3u=V3u =V3ths"βtPAh0=V3u V3V3 V3L$$ ȉD$W3 V3W3 V3L$D$ ыV3 T$ L$u1 T$ = W3t ŋ$u|$u|$ t+uhV3j(V3 V3=W3V3tL$t*t,uw kL$t;t=u^r R K@ =V3u==V3t t/ (܋ !ڌ =V3u=V3 t $W3)θȞ =V3u/ =V3u!s =V3u=V3Щ t (W3t1Ap0U4V3 ^_[]蟋Ph\"hN1o  jeUSWV΋\$=V3y t1PSR蠪 ~jP1ɉ=V3tW L݉t$=V3D$WÉL$ CHHf$"ks m PUh "> V3{Dt{T.u =V3tw=W3uL=,W3u%sh"g 1TShʺ">L|$|sh"; ,W3VW ʼnى=V3ut jSW覽 W轱Å 0W胰08u ^_[]jh#&jWVD$ qH1ftYT$zHftIf t$f tf9t=V3uyDt,RQ$W31f Duf u RQ^_fu1@fu1HUSWVL$p~V3D$ V3u =W3D$D$\T$8D$,D$D$L1D$<D$0D$(D$ D$dD$@1D$D1D$H1D$D$D$D$ FHf tfuPߍ^Tv t$l$ՉNk PSh "<l$ t$ 1@F FV3|$pt~T.u-=V3t"fu=V3uFF ~,D$9wǀ|$T$Pl$\$|$`FPPdD$$x`\$9l$ЉT$X|$|߉|$lT$D$$P h\$H9Ӌ|$rډT$H|$$GD$9ȋD$l$wL$W\X9D$ ЉT$|$4|T$ L$4T$ |$T\$h|$$G@ %=`G 9|$\$L$  ȋL$D9ȉD$D1@D$@D$ L$(l$0oD$D$4D$ T$T$lT$T$\$hl$4\$(\$T\$ \$\$<\$\$0\$X\$,\$\$l$|$D$ L$(l$0\$|$<l$XL$TÃ=V3\$|$t-=W3t1D$$phR&j $Ul$ &D$,D$HjD$(p(CD$ t=W3t D$$phR&j $U9jD$(pVDŅtt$ DT$,D$(9щL$l$,U#ʼnD$L9L$L=W3t3h#D$(plT D$\PT$P9щL$P1|$(P0 hà t$ P Ct$,P=W3t +Cl$\UPU@ ^|$`\$L$D$ l$4T$D$dl$D$ D$lD$\$\$hՋD$TD$(D$D$ D$D$ 0N1J 0N1;@N1~у t (N1Q(N1Guh(N1Q=W3tXD>0N1J 0N1;@N1~!у t (N1Q(N1Gu7h(N1QIL$D$ ρÃ0W3T$94W3}`;L$}XD>0N1J 0N1;@N1~!у t (N1Q(N1Guh(N1Q0N1H 0N1;@N1h(N1j (N1H (N1 1D>0N1J 0N1;@N1~!у t (N1Q(N1Guh(N1Q"0N1H 0N1;@N1h(N1j (N1H (N1 e^_[]SWV΃= W3t vohe]%`1TVL^_[SWV΃= W3t vhe]%1TV^_[Ã= W3tATPqh0%  ÃTQhs@$Í` f w5$ "0N1H 0N1;@N1h(N1j@I/0N1H 0N1;@N1h(N1j*0N1H 0N1;@N1h(N1j=k0N1H 0N1;@N1h(N1j%D0N1H 0N1w;@N1oh(N1j|!0N1H 0N1g;@N1_h(N1j/ 1@á(N1H (N1@(N1H (N1=֡(N1H (N1%á(N1H (N1|밡(N1H (N1/1á(N1H (N1*USWVl$(}=V3tE(G=W3t=V3t0DGV31 W3Í9h0} ^_[]E;x0~*P58W3, |M x08W38W3GMt%$Q  Qt $ B$Iu$ h0șƉșD$$t$ƃt$ D$|$1ۋ|$=V3t0 8W3 U(t|$ ;<$}Z;D$}El$)š0N1H 0N1;@N1h(N1j (N1H (N1 MuC;\$r0N1H 0N1~(N1H (N1 h(N1j D$@D$;D$ ^_[]jDUSWVt$F=V3tN(@=W3t=V3t0 @ V31 W3< h09} ^_[]n<Gșljș|$$.1E  E;|$|60N1H 0N1~(N1H (N1 h(N1j 1V(=V3t04<;$}D$)á0N1H 0N1;@N1h(N1j >(N1H (N1 KuGm=0N1H 0N1~(N1H (N1 h(N1j ^_[]USWV|$=V3t_(C1ۃ=W3t=V3t0C=V371F  F0N1H 0N1;@N1h(N1j,O(N1H (N1, +N,0N1P0N1; h0} 0;@N1(h(N1j ;~&(N1H (N1 "(N1H (N1 h(N1j 1W(=V3t04jŋv0N1H 0N1~(N1H (N1 h(N1j ^^_[]fSWV|$V3Wt pSP t81PWVS Vhs@$V, ^_[h%"Wh"jUSWV$UV4(F$$1 |$1 9$)덄$PSUD$PxN tXǃt-tat$P ?tL$T$d$.?T$O$E1 $ ;R1r9vL$?T$$$^_[]SWV ΉRQSN 1t4u t|uHth(N1PjS轂t VP lj ^_[fUSWV$$3豇1h "WQ Wx%$ D$D$ h%SV` mu05h:=tChP $W* 뼃pu D$ 뭃u H1,uk5h:h"j#D$=@u.$VtP蟦 9r*th_"j|WP ty/t AƄ/@L$M$D$SY|/uH9tx/@tj/Sޅt@V L$rSh_"1A $'@PVt$ ]Q ٍ$Ct1@$Mg4$jPPh"hN1jPW3USWV։π=@W3ujVt~VWt9諯8uR\$@SV +t{SW*9Whs@$1ۀ=HW3VWh_!< VWh"؁ w=DW3u=jWuWh"H#D$H=@V=LW3/jVD$@PV)jWuD$1Pt$LD$2x "t8tVh"}#D$HD$Ht$\$ \$D$t$Phs@$}VtVh"k}t$S1VF}5TW3t$t$ЋD$HPWptVh"}$Wntb8-t$Vh"| WBtV|$Wt Wh"H1ۀ=HW3DVt$SWVP׉cjWPo t$t-h "h+"h "h"?|1@^_[%tPh "hJ" jWP}o t$ths"hs"%tPhs"1돸"=HW3u" "jWVh&PhN&!SkDShs@${j~s"jVh&h{"hN&!W6DWUSWV8|0t P|01`W3dW3hW3lW3pW3Ȁ30it$L$"hjV~ |0IVh"0jG|0hhV5 |0lW3hjV |0ϧVh"0jͳtW301|0tW301t~xW3ttja|0tW301@5|0tW301@DGVh"0jE|0txW3tj|0 P4tQ|0h|W3P,xCW3%= ts=`=@5tW3hI"j許 荦5tW3h7"0j膲5|0k|0lW31HPhm8@5|0 1ɅA pW3-W35W3lW3ˋ 0u440v$"=4=4>1jSS5|0{!ƒu蜥8fpW3-W35W3 a1H 00=W3Gt =}r t~=44q˃u#=4tPWUV ~jWUV tw߿(=4u 4~~=0018^_[]111RSWV։ωSw=0D$t,t\$W34$ t$ctjt$}~"1@jt$"1PW4$t$jSVVx^_[h" h"h"jVP=|0x=(4 @4t}=pW3ut=P4tD4HQP~'Q &Ȁ31dW3hW3$Pj 5p4hz"54 54"v=lW3uKh|W35|0u4#W3=u"W3 W3u5tW3elW3=0w=4t0~ jP5|0Z0~jQPSh (4 @4t4=pW3u+54h4Ht)t hF"50hm"jL 1%h"j&50h"0j^_[]USWV1N=W3=0 0uhx"j٤dW3<uhW3-pW3sgdW3W31jWW5|0WxXͽuWURPA)jWU5|0yQu t#dW3@dW3=0:h"Ff@Phm5|0見 x0h"j1^_[]USWV \$$|$ l$(1uu50pW31jVV5|0=x\D$ljT$Ӄ=pW3D$W3W39L$ujRP5|0x+D$T$EU,=pW3u#h "0j 01N ^_[]USWV~=0$(~$$~pW3t)h;"j蔢I1u)1ɍ|$h~W5|0; 0|$fGWhm5|0ډ fD$D$Whm5|0诉 \$h~S5|0迻 $h~S5|0蠻 GfD$D$Whm5|0C 0t1<$uzfD$D$Whm5|0 f $ 411F$$~jQUR|0ы$ʉD$ ʋ$$~) h"b1F|?1jPP5|0螈xg)y11=0|!h"11Fs1o藕h"RjRP5|0Q1yKsh".gh""[hj"Oh"" ChL"0jB 1N50~^_[]fD$D$ D$Shm5|0誇 yt$h "ޔt$hu"0j٠SWV Vht4j诸 y裔h2"0j袠 jVj胸 ywhL"0jv 1N=W3W3=X3=4u5p4hj"趟=tW3h0W菔h0Wyo pW3aX"t" 0"t"QWPA S8 00"tz"P5p4hU"h{"h"h"ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5tW35tW3h"sWh"T5p4hU"Ah{"4h"'h"<=4th["j{50hz"5p4h"ҝh"ŝ|$h Wf|$.|$t+D$5..L$f tW蘑= r@h " h"h"Y5p4h"Fh"9sWy\WhE"W305p4h"P4 ^_[h9"МX3t P2 WJX3t tW31W30h+"j|50mtt$11HfhhX3thX3H\31舐h"0j臜 1Ht$ Yh"0jX 1HVt$VIu,Vh&"0j*^\SWV|$$W* ƃu[1~tHNtt 9 tu/PW t#D$=@t 蚏1N|^_[USWV1F4PH{4P kj bƉ+Ā3Hw> 4SPh\3Q@ 3$ 3L$QPh\3\h\3Cjuh\3[jh\3^uH=\3/u+-Bu"\3P!Ph\3\3P}/ h(N1WVh\3M<4N1@ub33 3 3QP.t 4P(jht4j xsZ1e^_[]֍h;"0jՙ USWV D0x&H0kL09|׋yM1II1̀31PQÅy19}WDu=0h"j.hh̀3OÅy1ۉ9|D0x(H0kLSh̀30y݅u=0teh"j迗̀31E$sVh̀3̀3P- )؍̀31Eh"ji1IkFL04Sh̀3#1ɉ^_[]USWV D$4xGD$ˀ3$1F1̀3SQ291C4h̀3h\3P$ 4Qu*D$PUh̀3Q8 ̀3tu=0ho"j耖t$h̀3h̀3y, $W1CttUtB:x9u=0tFh#"j,Wh̀3Q19uh"j1H ^_[]h"th\3Q<t Ȁ31hI"USWV1C4PH4P yj]Ɖ׃=T4t/50t5hL"0j4 e=4t Rrx7t$t44P(jht4j lzbV1ۉ؍e^_[]Ít$\$D$Ā3Hw5 4VPh\3Q@ 3D$ 3L$ h\3kWeh\3duy=4tSh\3t^$4 04tSh\3h\3Ujh\3Xt@h\3Em33 3 3QP=\3/u+?<u"\3P3Ph\3\3P) H4 L4tSh\3 (4tp4|NPWt$h\3)6Q=$404D$L;h3D$Pl3Ph\38P403t@t=d4u Pl=0t1Ā3Hr@tZ tUh\3l'9D$X;t3D$\x3?uD$Ph\3$Ã|$=d4ut$h\3Å4VSh\3P@ =d4uSh\3/!؃=(4\$C=P46D$4HQPQ H4=L4D$L;h3D$Pl333 3 3QPDy h\3j=(4\$^=P4Q4HQPQ D$L;h3D$Pl3D$X;t3D$\x3OPj P4D$u3D$ 3L$ QPp03x5054iX33 3 3QPh\3ji\$=D$L;h3D$Pl3Pj P4USWVj/h\31Uh\3t>5\3hX3Ugw /tOGhX3WUh\3hu"jjO1N,K|/t1Nuh\3ha"jj^_[]SWV=401F 4t9t71hO"jێmQHb4P R=$4t i<4x t `m#(4 @4t#5p4h|"54% P4ujh\3^t(33 3 3QPu1=$4th\3hxuth\3ly4P(ljgSW, xa(4 @4t&=P4t54h"jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]Fi$0he"0j8u1K<$i<$W$4h"0j uUSWV|$7t6|>/u/1N=4MWh"js 4.|$tjh W躍 V# $= 4 4_Sh="VP֠$8ƅE<$8$S x<Sh="P$艠$ywg0=T4t54;$hG"Vjs15 4$ $gQh&"0js1N^_[É5USWV|$?/tGj/P3ƳUWu/Fj/V3ƅuhW=\4t$$W jWǥy3UW9u%D$ PW)jUPWV/Fj/V131ۅA4t*PW]t1K#D$1=@ۉ؃|^_[]/WVD$t$ $Pyu~ fWhX"0j r$tDP躰ye$h{"0jq$ 1$ 4^_USWVD$Et$$^߅tP~yreWhX"0jpq=\4t<$8$W 1 X4tt)$($u7=4ujT4PF44!UW0 0t%1PPL$H$X$T$W$tJSWy!dSWh"0jpWB$p 1$ 4^_[]WV1uA|$ t$t$W0 t(54^7dWh"0jp1N^_Vt$#D$ PVt%547cVh"0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=0t =0D$PVtMcVh"0jKo_=0u&D$DL$HL$$Mbl$L‰T$=0u'D$PL$TL$D$ Mbl$X‰T$WVAt6b8Nu} u&WVubVh"0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVt%#D$=@uVh"jm 1HjW |^_[USWV׉L$]D$PS/t6St$莉tha0wwS tՃ} tL1@_1=4uTG3D$ 3L$ uKG3D$O 3L$ u9t$h"jUl 1St$h"Vj6m1He^_[]ø#D$=@u%h0m%SatS0S谫} D`Sh"0jl댋D$$u1@Ë $jPUWV}wPV1@xN=4t1A$$3L$ $3$ u*0$3L$,$3T$ uVh"j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $"5p4h"`uu=84tlD$PUuZD$ !=uHhWU ƄD$PWuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUUt$蚅 4$UO^L$ t uu$UFD$y)Q8=T4us<$8$U xZL$ A$9^t$Uh"0j3j1H=\4t2<$8$U UhG"Wji1ɡX4tt1Ƀ$ !($t($t$$5p4h"^jU`xN1=X4=0=0Uh\"Uh*"j7h 1OD$PUx=1$ ?#D$ PU1@=X4u;L$ ($/\t$h"0jh$ PU1@Pt$6UK01 0t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW1x1K=4t މ|^_[]ø#D$=@u5h0m%Wk\1EtXW˛yĉ"$t W苦y54.{"[WU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu544 44L$T$tI AQP DUVP 9t_L$ xZjPUQpMҋT$0y@oEP$ Džt<$\$MQVPO D$8+$T$0)+|$$>hG"jJe*/Zt$8hU"Zt$8h7"0jf1O ^_[]SWV1|$tQ\$1OjWWSLxjh4Sl} y%U"m"\$YSV0je^_[Vt$ xFP= 4t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(} ~H111Ã1T |A9uV$P$(} ǀ$1111틴$(3x$3|$ uUP$(6xLX$3D$8T$3L$4 uF1VVV$(+KxE$($\h"3Xh7".h"j%c # X$(h"0jc1N|(^_[]V=84t4=44t4=D4t@4= 4uh ( $4t01x&= 4tDyh"jhb1N^WV<4tP81<4841N 4t 04tqA04uj1M1H M1~M1H M1hM1u]tN;P0u1tB $49G= |+04xx$4 PW1t-$48j54h$40 <4&1^_SWV|$tR?tMj ̼ tSƋ\$WUH~ </u>ۉ^F= 4t%,4p!hL"j`1Hhg"5 45,41^_[á04t@=4t44=<4u0= 4t'D$$u84tjP5<4C WV= 4tB5 4t;11G~u)uh"jA`6hB#hN1 vu^_USWV =44u%441N<4u<4}$ $ $L$PD784t#HHf w=$ "ph"#"ph"je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$px S 84qh%"0 ph"p j_e= 4t\@PL$QL$ Qpp p09Bx884jjt$t$t$t$ph"p j[_ <41N1 $4"LJ$Ƅ  LJ$LJ$= 4twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G 84 VqPG  84VqPG 5p4h"R1u04@e^_[]fUSWVT\$tl$h=(4P($T$L$X$1V8$V<$H " "t4$tVjQjRD$Ph?"S2 $u2@$%  RPhQ"UhB#^|$x$h\"S،EPD$Phmv%S$Hs Uhc"u# Uh_!S苌 S#X^_[]Sj USWV@L$E\$CD$PSC{3j#9"|"L$QPj@t$Vyue^_[]SWVT|$dT$t$X$hS($WVShk"t[d^_[SWVt$F=u1H|$PX-t6t)G\$QjPS VS,<Gu܃^_[Ã^_[<USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V,4~1F1u,4ht"j9W^ÐSWVL$D$t$|$h:@4tD4tt\^_[#}\1KZ@4teSP_ti:tdx:H19}j h:@H1sPVW hV@4:-u/D4ÈD4n@4D4`S6h"H1=S6h"hN1?^_[f1Ã=L4u1á40h"jV L4t"H L4p0h"hN1虆5p4h"4Ku_sUSWVd|$|j/7p4t@l$xp4h"P躣p4"1C44D$ D$1D$$jh0h"WUHЃJw$";t$$@$d"h:xW3묡0t 040r0t c0P=0"\$4! h:k4 4xW3)"xW3B%0D45h:R0t 00\$@4ttW30e4,4LtW30=44.4 Pt$ * NL$ h: P4$LFtW30tW30tW30tW30H4h:P4xW3$84q5h:[Z 0@K 08h:8-u xtW3D$ =4u \4X400xW3F"(40T45h:WO  44s4d0U\44?tW31@D$ )0 L$ ƒ ʺN1t(N1 H14ƒu 9u , l$D$kL04P4 p4Q&!1$jhT0h"WU/~HЃJS$"P0ƍHw$"4뫅!h:xW304|xW3$m$4@X4ˀC41xW3F""4 h:@Ƀl~mtKotRpdX4SatDeJ1A \4 X4 0 0 0"0\4 0@{peh:tW3SH(43 h: 441ɉ5h:"],404h:L$he. jLjh0Q!w4bl 5h:Vh!CV04@4 D4@5h: i@84X3 4xW3B%445h:9i h:E 4N844L4 $! h: }4H45h: =4@ 4 0%=04(N1 0akG1A11|$<$td4D$tGNutNj]]h"SA1t[h8"SAuEP4H4j5P4S^ 1AL$y#$]1P4<$D$h#S@l$\$th"S4|Džu M11 ðt5h8"S=@u3H4S趶 I 1urL$tP؅uAJjh;"Sv2 uPH4D$t t Pc CP+ىQJ ؉D$1ES#jt$ S 1AL$"1ED$\$t t P h#SU?t WHD=4<$l$S|$;P4,01ɺ G1Fmفt#u41A 00<1A 00!501ɺ.1!# $ 4u 40=rnFr0s9-H1Dh4PMH19}j4NxPH1@H10H19 1VV4b xH1@H19| Qh"j?H 1FPh"V(H Vo5h:h"h"jHjo5h:hJ"hha"5h:h"jG N1Vh/"J)$%50WVex 50WVUx Vh9$)5h:h"0h"jjG!jomh"jCGt$h"jjP$t,(XN8@tUjP$yFD$8Uh"W9<1D$h.D$1$h#U<th"UwDžu JM1tkðtAh8"S;tjh;"S/. tj1ujSðuh#U`;t WS@=4Uh?"l$}$l$h8"W;]tjWB\$rt D$W0|$ td^_[]átW3t8uhB!~tW3t8utW3B!Uh"j E USWV|$e]%UWUV5.NJ00ht$跩tAtZ/UVUW-488ht$vu}9t$hd"0jxE1H1^_[]áL4t H L4hN1h"%jlWVN11FWVhhV"UWVhh"AWVhh"-WVhh"VkUSWVPˉjPQ. փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Q$1>tj,V6Åtj=V"tmj tdAE0H@L4=L4t 4s4uh"j6B1O^_[]h"h1"h"j B4$ ɋD$L$01Z7WV5p4hH"hN1r t(οl"PhV$hN1er !uءN1H N1~N1H N1 hN1j mu^_SWVPωPQt4Ƌ$| tC$SŜ t'ǍCPVW'* DG 4 41^_[USWV$t%t_݊M\tS8uEEh""j@Ej- UEƃjSV t3l$hUVP|WUh"j\@SN $EE<\t:uCCU $AStRC1fGt,PtStgtstp1B ы$J@u $A=4tZ4HVV裟4$t Wh;"ji? 1H^_[]VoVB hY" 4 41VC4$ Wh"USWV\$tK;tFj{ tLNjl$1pSw3G woD$G954t%4x!h"j>1Nh"=4=4^_[]WV54t;11GFu)uh"j^>6hB#hN1 o vu^_USWV41 l$$=4Kt(= 4t!9t)@tB9uKKt8<4CS趩 Dž$ha"j=z$uEPUt?NjCt /C;W2C |/uHC C$#hD"j2=Ct/C1N^_[]USWV|$LJ$4tOwCu kPUC |/uPV3$ t2[u1=4O=4=4 2$=4tW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+= 4tGtlD$@1G8D$@1D$\1GEt$ h"j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh"j59tNjE|$tDD$@t:$t$PVh<"hN1eVh&"hN1e $t+Et$h PV 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh"j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 74N1WVVj2uD$L$ L$$Vj4gVj uD$L$ L$$Vj gVjuD$L$ L$$VjfVjuD$L$ L$$Vjfh"l41x4|44P t4t$,NFF FFi@ |$WVj y|$ujWj WVj y|$ujWj~ WVjj y|$ujWjR WVj> y|$ujWj& TWVj y|$ujWj (D$,WVj   WVj 0=0t%hK"覕-=xW3u4!=0u0Ҧt4h"jRVt$1@P4(4"t"QP/ 4t P}o1= 4tVH jRWfUSWVt$=4t38$/>3i=)‹1@?9 tR=4t3<$/>3i=)‹1@9 tR 41QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=4ujh=j 4#t\u#uGW tjxGj jW 譇 />3i=)Ë 4,t 98t#@u $j t!8h $1(WhT"j9- ht"h!"j!-^_[]USWVP|$1N=4ujh=m 4#t\u#uGW tjxGj jW 7 />3i=)Ë 4,t 98t#@u $j t!8h $1(Wh"j<, h"h"j$,^_[]USWVt$totij/Vlj1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉh"j+1H^_[]1j ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjS CS>tKt^?tYڃCKt6C;C C})VWh"j*S苖 hR"C=4t$4X Vh."jW* 4Vh"441Wh"j** S h"}VQh{"j*USWVPϊۉ$tstU111JDhu.e[YAuۉ4$Åt>VF,FN4A1RE113W1J 4$$<"G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1=4u*jh Ս 4uh."j1(1N^USWV 41Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj Ël$EP2 $$$KCs{ D$C $C1^_[]Ët$ h 3P  1$$CHC1FwCE3˒ S’ S跒 hY"j&1NwUSWV4t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j| tx@ LHDh["jY 1^_[]USWV4CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXjz J1ɉHT$, $$$P HN HF F t$1 H;@u 4-444-4Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@4=4l$T$s}ډD$0! umщjt[4=4 tIjy t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph8"j  hs"j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=4u*jh=6 4uh"j1N^WV4t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(dx t^t$tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<Wt h"jj ^_[]USWV 41Kt$/>3i=)‹/uPV蓑Džj$v tWW0tN$$QVQ4y8~V Q(y,~VIlNF 4F543Wh*"!Wh*"j V Vh"j ^_WV54t~1F4=X4u~ t v6蚫0 0tWWvvvv 6踫=0t v6ά6] VT 54u^_jhÀ=4u1WVL$T$t$ 411H<>u5Guu%P=4t411@^_V|$ |et$>t\jh"P t 0=0t#hz"j|j 01H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPhL"j^_[]SWVh1Njh"S+u3h"Wu!0u94Džu91FWSh"Voh"h"h"V WSh"jL1N^_[USWV\$hSb1N|$1h$UW O$LJ4$<rD Sh4h4   Ph4h4  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ[ 7ˁ 1D$ereRPQ, ^_[USWV $ $Hw.$h" e| Rh"{=4x1ۃd|Rh"Q1l$ hVU $ jdPU$, $$$Hrjtr$@ L$ D /f@ 0 wh="hf"h"h"$F1 $F2 jdPV fF0 $j j0P d4 h4t4T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0Uo $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R t$ h"$%$ $LJ$m9rD$ )yQj0UC 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%h "j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh"WM t1H^_jhE"W3 u(=4u4u4hM"jjUSWVl$hUh1N\$1h$WS} K$ǃ4$Yt"Yh PQ Ǎ A/G<rH )Uh4h4o   Ph4h4G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VP蘀yEtQQP  ƅ(8$VPr~yElQQP˳ 1D$@$$$$$ȃJ-σwY$"<2ǃ$)$Qgtxu"-u~t6h"VL2Džu'0ߓ PVh"jHM11FUW@t5Ë$rt$Vh+"j$_Ft1N1M1t W^_[]fVjhP!xKhߋ!P4t)h"V41u;54V=4thP!h"j 1H1^WVPD$$|$t 4t$@4 (4t"=P4thN1j eP4N15p4h!W[0 4$VW^4 Wj se ^_P4t$L$T$ $RQP04 54XSWV|$1N|54t,\$OPWSxc t;j S1t^_[SWVPD$ $|$t 4|$t$@4 (4t"=P4th(N1j dP4N15p4h!SZ/ 4$WS]3 ~VX Phj$hN1-/ hN1j Nd ^_[fUSWV} u7h "j} \$1hh=$WVbE LtPt߃95H1D$h# ƀ8/h"VKushF"VKua$PVsmtKD$Ph0m%\mt4$3D$ $3L$ u$3D$$3L$ t1PPvƅu j02V?h(N1B4N1@uj$h3!jάPh"hN1- j$USWV$$6h "j 1Ɉ 4 41Ch@"VUC e~%q~3كrtރvt_x4ŃV.PtrكRtwftAi44뒃Wt6duq4z4l44W4I4;uH19|=4u 1Ĉ^_[] D$hy j!$D$,$S I9v9/u؃@]9v8/@tj/S9t@À;.uCt<.u{t0\$u h")_C\$4EHu]j$8u 4P"jT4a$8tӋD$t$ VWj 4tRtD$W&=4uM8tsC8?ti98t_Whs@$Htj PWh "<^ +D$@uD4u;Wh"^4;;=4uWڀ=4utV/tD$%=@t/==4u uW#9W8. 4 4х ˉ4=4u Ő=4t@jPt$& u hJ"7P}u8VBNjGHHf wO$"=4WOwP"{jWV GG \=4uWOwP:GHftIfgft9G =4u P PW}G  Gw,48=4uG ?tow g PUh "[ c=4uO1zuSw7t)4t 78t1-8?t'#8ut/whs@$蛾4VDž6=4u = 4t 4wwxh#&jww 脉 PVh "j{vPh"hN1F' j< 4USWV΀=4uLVhZ"hN1' hN1vM1H M1M1H M101C=4l$$#E=jR)8D$Pu=4uvVhh"Y1ZhM1*Ɖt9 t4M1H M1~M1H M1hM1ƒ1ۃYÉ؃^_[]ÍD$x "ttVG t|$u G?4wkZ w`Z WWZ  4u=4t^_WVt$ 41<4t4VPs8uG'u 4t^_Ã=4t^_FUSWV|$tWBuA)k')41t(l$sWtu tC uމ^_[]jt$ }t@1ËD$L$ pqSWV4ƍ1P 1 4tQ:t @ C'u9 4u=4t5h jVW/~R1ۋph#"p8,0HQPP0Q C9uW^_[h#'WV11 4t)4Q:ujPuFȋ G'uƉ^_USWV|$u \$k1Ej=PvtAQUmjUtGUh#!w6+0HQPP0Q Uh#50q  1F+b1^_[]Vh,"Ptauj4 4t$1P ơ 4H 4@u1^fWVP54tU1DBuF#ut t- 4]$"NF밉jWV\ 44 #j441D>G#uGP4WVP 48^|~u$PPh:#~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ54^_ÊVF|uܹո ѹ Ǹ É)B$:@B#uVPQh#NfUSWV|$,t$(SD=4jLVt:xIuxNt@jLPj V˩1tE@j P踩)=45454"1,=4uƉS^_[]ùj#V=4)u ^54Qh#nWV "|$ |$wh0 l0 4>t'F 4Q 4N@>vuڋ7 4Q 4t @뭅ԯ+h0@P54VrƉRPhj@$J 1 ^_USWV8׉ˋ 44D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPhL!jVjVt$  USWV Ջ\$$St$$tƉ׃=4%up1҉  ډD$$=4&uU1ۉ D$4 4ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$"  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹###wSWVP=444Q!Ɖ=4=0ttxt>u'1ۉSPV Ɖ9u$8t*8u+$t@# t$@u^_[ù#&USWVPՋ\$St$gƉ׃=4uKh$4 4MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljա4HwSjP ljա4uND$4 4N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!TH4 4N"ىWP1Eكra$"ى=4#É4݅~h4 42É׃'1H4 4NLىWP1 14 4NىWPÉ4L4 4NىWPe$É׍Eكw4|$4t;~l-4b1A1Ǎt$WShL!jV jV540't1I1@1l$QPhL!jU jU6 ؉^_[]ù#T#J#@USWV֋] $t$ơ4 4L$ D$T$uPV֋=4Ww,W#8_#}uPW ֋=4ȃ}tً$VPt$ ֍Gw_#;E Qȉe^_[]fUSWV0$1h=#=etuj 40\$h4VS,SCU8@Pvá4)QPSv 4)١ 4pQJVPSe$>jh?!ƅu)h@# >-u~u54u54$>0m%t<.u 1.D8t/ua$Ph0m%HtGPVHt6$3D$$3 $ u$$3L$3D$ 1e^]Shh=$薸t/hh=$胸u 48Ltj 48j754uj=450 0f`540HQPP 0Q 50 0@u1[h#]0aj Ph#Ch#9SWVWMWP'Pu2\$V.8"u6WWPOtVʜ4V话^_[Åu0i Ph#j4tjPh#Y h#fUSWVD$ 0fa1Ƀ|$‰tpыLhn#S$th!"Su 1t$.4NJ]taM\uNEU\rw$"\0u!11ЃwxAunjt$>0HQPP0Q t$.PN    ȉš0HQPP0Q<$t*0HQPPK0Q 500Hu 1^_[]ÁfHh#jf4uJL$ 4jPV=4t 4K1540ppp VPja 95 4t =0ujVV^jpPT$=44u 44D$ $1APV44t1It$a<VPL$T$ D$$PD$44jWVP|$t$D$$4$ WWV׉Ρt0t h09ty u hh03=4(4u%Ph!h|0@ =4t54h!h|0 t*t$ Wh|0& x4h#%h|0xVe Phs@$h|0 0HQPP0Q h|0_^_SWV|$t$\$eSWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$WY^_PT$D$ $1IP>XËT$1It$)Vf8"T$ L$9upu'0fuQh&j h44@^144 44WV|$ |t|$wh0 l0 4>t'F 4Q 4™N@>vuڋ7 4Q 4t 薙 @415v+h0@P蓖ơ4PV 4^_USWV\$0t$,|$WH54jVh jN=X0thƉ؃$1t7=0u.D$0t d $uQVi=4u"W;j=X0u11EgWߖu 4D$0u^_[]jUSWVL$,|$(006̓VP$"Uw1ۀ=0_=4Mjw1ۀ=01=4$=4jwH1ۀ=0=4=4uQ=4tjw1ۀ=0=4=4t  u8V试1tu 41l=4tRUWJj\$0SWH a=4t&WD$,E=4tt$,WK_=4tt$,WE\$,SW=4tUW=4tUWdPh_ #hh05k=4tiwww|- 4@jw1=44 jwa=4t 41V,VL$,=4t =0t 4tu u^_[]PjUSWV<|$P54D$$w=J0tttn454PM$Paho #TGtj P50 Kȅuh #$50l$U tc5454<$t&4$h #50x|$4\$T4-4j wD$ 4u=4tSw454 4u=4ti<$t&4$#h #50<^_[]j54USWV\$;s=J0{454PPho #stj V50$ vh #pu h #^0HQPPV0Q 50l$4ttu ozt=1ۃjUzSl$SPO| tuH4Ju 4u=4tjs%UsV~4 4u=4ttJ=J0tA{t;454PP-h # 50^_[]SWV|$ 4jw)1=0t 454^_[Ë\$14u/? 4ut΅tSw544t"u84H 4K4jw=0tru+4H 441 1@654+USWV1=0t54|$0D$P衎m[thUS, =4tiD$ 4,$\$4>G4=J0 4PQUPlh]!_w T0HQPPL0Q=u 0HQPP0Q 50juw K Sw54=0uZ4t"u*4H 494m"u4H 4 4 454D$P6 ^_[]USWV|$0t$V@O 4jPw* _1=41{t'G4$pWUuuޡ4[tZtT1=4uI=0u@l$41; u{C4Us t=4u =0tʋ-4-4V> ^_[]USWV\$K1t@ 4PSuƋk1OuD$}t1{PuVNw uR 4u=4t~ jW|$x4$jjt$jux WB<$t$3mE1{u Vy4 4u=4ta^_[]Åx W߸0V Ph #USWV$$D$1t$ X4D$$4D$D4D$Ht$05 4$PZ5$4E4L$TIEtH1F\$Tljtw|uG4hSW%( 1ɉȋOυuNjL$Xu ! L$4IEt6t$4NjG4wtjVW' GDžuԋL$81D$ D$Tt D$ ȅuD$ P脈$D$TtH$r4$ ȅu$1ɉL$@=0t=4u|$ ~ $@D$@D$ )$=J0454PP4l$41dz=u)0HQPP0Q9}j=WTƉt>u0HQPP0QFPU 1Ո`1t$TtOË$t)0HQPP_0Qv É΅u$u t(PV50 مt ȋN΅uء0HQPP0Q 50g|$ +t$4~jh"W] u|$$ƅuf|$: L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t  D$$|$ uT$|$<‹$t$t$$t$4V0fD$' fD$D$: f=4t*fsD$= t= u ft/$}u$D$@f%u D$4jUoD$,ED$D$tD$L$\ N=0u f|$t$Ut$4q t@4|$D$D$\t$`=D$,F L$4=4tyD$t;= 4u4=4tNt$\jt$d L$D$HsI|$@ taD$t$,3s44=4<u D$1@ $At:ʉ9-)ЊQ-t uy8‰uD$}t } kl4D$(l4 4<|NjD$ 4xD$(l4= 4 401PPWw s1ɅȉD$LPV4\$lf 4D$ H4$4144 l4L$(l4D$D$dP 4u=4tP$V } 4D$ 54|$tD$1f|$tH 44h t$8C4H 4=t$L$QP 44t$]D$(l4D$D4D$H4h4,4t$lD$ 4|$Lt 4u=4t?=4u 144D$5o$W{4D$ =4h!t$8-5 4t$ Ut$8omJWt$ Ut$8nD$ffD$0fD$8D$D$u#0000@L$D$(4D$lhRD$h4D$ D$P$Wzt+4D$|$D$44=4D$$ X49t;D$= t=' u)l4D$(1l4D$PL$$PQt$u |$ uD$0ufD$D$4,41f|$ˆQP@$(4$ 4 41@`:H1D$40f`4$t$T$$L$t4D$ 40h00|0#|$PtD$(l4,4D$tD$l(4D$D$tFD$t D$f|$t$h{P4=4t|$@ twD$u0F 0)N0|$@tht$Dh&= $Pr~^_[]h #54kt$t1= 4ȍPu = 4u"D$4thB p,ȅul5 4t$ t$,Pt$=4uS˒'h #}h4貒4t$l|$LtNt$d8D$(l4D$D4D$H4D$ 4jPw:0 4u=4tVI Ph #4u 4j4t441݀WVt$tr|$w$"j Wv  $@Fvu;Ftj WP $jpV! ыF @v ?빃^_V t$t8>u3Ft,pɣtF X4QjRp@ ^SWVQTt1OS jjP t6>F1"jjP] tv^^_[USWV|$41GGG =0l$0\$SG{4AjUejUPf uA4=4t{4$ 1CSt$5SUW\$t$$w 4u=4t(Sz^_[]h #}VP4u1PPVPjh 0WtF$Px4t.1QQVPjh 0Wt4@=PATH549 4(0(0^á$4SVj* 48u1^[1ۈ00q5,4thB v 65 4J X4SSQPV4á4ËD$ 44PËD$@4 4144Vt$ |$|v_Ph #1@ 49~1Ҁ8cB4 41^WV154V 490t\Wx 40PjPtG5(4544@4ju54IWx4^_USWV$X4$j/Wst@D$PWB!D$ %=`t|=@t}Ā^_[]ÉjWS tFƍl$UV uD$ %=`uVwjWS_ ƅuWh^q%Wh) #Wh"|L$4x 4V|$|D$ p荅4454uu~9} ~ 44^11@1USWV4h "=|$$WtT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h? #50(14^_[]UWV׉΋ 04uj'4k< 0411D$ T$l$ p#D$ $,$<$\$ D$\ #D$?6u0uFjhc$W衙 %W趣|80uHx.t x0@te^_]fUSWVP|$7j/Vip\$ jVSB Ƌl$$$9=84u0t$(t$ WVp8tf8t \$Vuj7S Mut$(t$ WVL!$ $Aƒrt ~u447jQMPVh "jSWVt$|$t$VW 迢t 賢^_[Ã|$u0jWBC6Qs4(4V聆jUSWVPD$tnt$ t%1;t <:t9tGt$,89-l0}t,; h0t,WSQL$ L$ |9/u 1xAA/D$PL$Q84E9u,;E-84L$Et <:tEL$<:t1ED$(Q; $+ h0AQpr^_[]USWV$1C1D$ 1D$D$D$\$ha #SHw5$"\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ 49A 493t$$1CjWtV@wM$"|$t&|$ t4t=L0x'@ |$u 4H 48uX4PVD$ PW9D$ft $|$t $|$tftjWt jP:.뇉4|$ÿ<4/tPEȃw?$"|$u/|$ u&u |$tf<u t$Um묃4r50&0$@thk #W1@$$$$^_[]SWVt$4<4t5Hftfu95L0| P 9p}Ëu̓4r 4t^_[Ã=4t^_[USWV$G$$("oX4EjWS PoM䃼$$twh #Vh #GPhs@$Z4wHPQ] 4u=4th #sD$Pfh #Y/th #Fh #9GPhs@$ t*0HQPPz0Q*0HQPPP0Q ^_[]ÃPWh #SWV|$tWȊ Bu%iC)ʾ!)!<43tFWPtc6|$tT4W PlƉf@@ WP0 4u=4t 14^_[44Q  4u =4@USWV$$$j/$JhturfEE^X49tth #Vt $j$q1Ʌt@@t`tm$umtisD$ P$ xfE$K88$ u=L0x $u  \u =L0y& u $MƋ$1MtfyuL0YL$$j$P 1OD$VkG84tAPh #zt$t-'584h #yt>/u19}-9j$$PM ƅvvD$ PVx3D$(!D$ =u8=84$Nu$c8tY8t OD$}o$E$\$|$$t$t'50jSfP$h!"'V fEo$T$pƋ$$4|$ÍD$ uj$HfxT$ ufBuω7 4u=4t ׅt"G GfEG EG fEGE fEEĜ^_[]4T$ Éuj$fxE$ufBj 4tbiVvC+h0PhVgj$t3fxu*SVk$=4V$h ##SWVPH#1t8|$P#L$8u%tWP蝗L$ t us^_[SWVPX#1t3|$`#L$8uWPRL$ t us^_[VX#t%`#jPf@NHu^V<4 L0trft fuxB =4r^USWVP\$=X41N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh #ut1<:CG럡L0y x5L01Ʌx $y $Q5L0^_[]SWV4<4>t+fuwWe ߉?u׃4r 4t^_[Ã=4t^_[WV|$D$ 4jP+@ft*fu v fFGF GF GF 4t^_Ã=4t^_ WV t$D$L$ 4fO 0fOP~GWVU 4t ^_Ã=4t ^_jt$itfxupO%1USWV t$811G$1D$h #!ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШP 4:KB 4*#$1\$ D$4$߅u U:=T"t,]X"T"8uUPƓujULƃ<$t0vhB#4$ 4H 4(t|h #j vn_tuh #vhB#$ 484$t0HQPP0Q l4$t%UhB#Ph #+hr #,|$t'}4$PjD$PU51T$(jU4$PfT$HL$ʃwW$8"D$j/U]^jU~苑0l/ PhR(":uhh #4Yuh #Bu h #7t.UhB#+X4 t$|$tJtHh #t$ 4H 4(ouh/$P돡X4D$ FjUD$PK PdbN<$u "|$t #Ph #ShB#t$ct$1 ^_[]h, #%d #ct "RVhO # Vh #f1PPt$  5h0@P`USWV|$D$\$=0t4H 4 h0 4 l0 41ɉ 4 4H 4Sp 4tH 4~44*cH 44+h0P:`44u%Vj`p 44s4UVW4-454x=tE40va54΅u!}b4 42V'44t O4G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t4t D$0 4D$4+h0D$?~uЃtRWT$4$ D$1@D$ wy<  4H 4f4e$!PVtVT$0/>u!y@u=D$ D$4$ 4H 4R4Q=4un4+ h0;L$~[xuUH4Q 4H 44 4H 44$ |$D$5ЉD$$  4H 44S_T$,H 4>~=u|$ D$ RV"T$4| u4 4H 4~#4%^T$,H 4 X^T$,H 4$9Ut$ aWT$44+h0jPHPT$8 U^T$,H 4> 4H 4~4 &^T$,H 48 4]T$,H 44]T$,H 4$^]T$,H 4D$$ 4|$tu^_[]USWVt$,\$(=4t4t$D$ 0&jlZXNF4D$ 41oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=444u(Q9PW4NQP54 4 4u=4tX49t31Ʌt AuQPk!u=47vA 46^_Vt$t"40v54΅u^V54t146PY 54 4uۃ=4t薼144^USWVt$(PW4+h0PVh0Gtp}t  KvA! t?/tO:u= 0tAL$,u8 4Q 4`YO@렃tPW^_[]Ã= 4u 2Y 4h08t!P tx PWWu$h?!ljP/WGD$,tÊ"$< t< s4< w* 4H 4~4XH 4 4H 4~4`XH 4GyAP USWV,L$DD$@L$L$ X8L$@1#L$j=SPFD$(|$$ \$ D$u.|$PS1ۋl$L$4L$+l$ 11G4+h0D$D$!D$ %t$QPt$6L$SL$t'1D$t;u;@L$u44+h0=0T$t&D$ 1<*t<@t1 ws 1D$k ;vD$1|@uB\$ 4H 4~\$  4Q4@V4\$ P4C\$ M1L$\$|$ U|$JD$CŠ"$< u2 4H 4~4 T$UT$H 4 4H 4~4 T$UT$H 4Cu>M u"4h0)£4 4l$l$1\$ul$@ %D$ 8@u =4t1E L$@11|$@t$|$Wt$ \$SVlWD$(D$aC< w2 4H 4~4 T$sTT$H 4 4H 4~4 T$ATT$H 4Cu1L$D$L$I q$t"|$t 4H 4~P4N1G>L$u0L$ QV1>t54R4uhSH 4=4+=h0t$ t$(l$Ut$WVu4=h04)= 4U1G4+h0SPt$ |$t[1@Ftuրut܋ 4 4̀tuŠQ1ۀ؉Hu,^_[]ËL$ QPh? #蟵bLUSWV54+h0D$44D$ 4D$$4D$(4D$,4D$4-p0p0|$0W:P+h0P2tc*<) t` 4H 4~4)AH 44045414^_[ÃЃ wmj PVe@ l8ű$<=tuw~;544b4D$54ØD$D$‰؃AD$$Z|$ T$L$T$|$,"$< u* 4H 4~4?H 4 4H 4~$H $ 4Q4 ?4 $Q$ P4$eØt2H 4 4H 4~4[>H 4L$$S5>H 4۸4$Ø/'"$< u* 4H 4~4=H 4 4H 4~$H $ 4Q4 =4 $Q$ P4$eØt2kt!Zu忀ރlt puԉпɁu 4tg8tbPhs@$7&m=0u = 0u@ 4tA50jPvW: 4H 4@uj%W50 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh?!W近\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th=!jD$P蠑 ] @ 4)i5rOC-`0+9tti-;)t RPh#jl$ UE\$D$POP$t+,D$0h#jSS\$PŋCt:tBuM ,%Ph#jQĐD,ingD,Runn}=tQ l$ ,j SP/ D$xxl$ ?SOl$ ō,@)QPh#o/ h%jQ2 ݍ,P5\0}9t%5\0 PVV}$=D 4~y\$t$1=@ 4tEt*t t.<$u u/S0=< 4u WE;-D 4| $^_[]4M0 hjPhd #USWVD$4\$,tl$0|$WUS ƃuL8=4t4D 4@ 4D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o@ 4D$ D 4$iD$ 9T$tcu tQ= 4t 1=0uL$,uP9tPtu 0P 4u=4t<^_[]Vt$49tP džƆ1z 4t^Ã=4t^ۀWVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV,1۰D$h,#4t$ntpue$4D$˅t(1PPS辌 DjS耙<=< 4u)D$ 4(D 4- 4~6@ @ 4D$u}t!AH Et~1jPƅt<u ED$u 'u G 4$Eu 4t .t111D$u$D 4L$L$ D$ \$l$ @ 4@1퀹tttVu $́H΅2u61$QPj m,$t/u # $͊u+uu U$D 4M$jU9 L$ tb|$tMuID$1rȋi4h""jD$$P,$D$D$ L$ D$u U#D$\$l$t/~Ot($D 4\$l$D$ tUD$ tMjPS; ?jVDžtjuS =0u V 4Ń퀉,^_[]h0#}ShM# }Shc#}USWVP1$1C11ho#/1it"gu$ڃjt puЉ̉( 4t yjPƅt,1t@ 4)i5rO@Ph#H$t#tH~1i0 tPh?!跅11G^_[]Ã~1i4h"0HQP~G ;| Z %PG ;| 0Z;|lhs#w{h#m{D$=< 4tjPot 1+1Ph#8{V1=< 4t. D 4~$A@ 41F:uI}^USWV=< 4u65D 4~%=@ 4Ft W-N< 4l$D 4~"5@ 4HI}4tfiPƋ-@ 4=D 4iPUV7 ~ ;uKuUW l$hƋ=D 45@ 4i 1҉AJw)׉=D 4 4u=4tCy4fdž=014 41B|iP  4u=4tx^_[]SWV\$|$ƅtt.VSt$W\$<$D$ #^_[ B0 Ph#xUSWV|$  4tWWPy*15 44 4VV*y54 4l$t$t%t =0ttttk0hWj,zWj!zt uuUiul1V6gVh%HftOh%h| #w=Vj3uV5\0pptTWj/vWj$vt*=0t!Wj vWjvWjuu< 4^_[]@0p hPhd #MwUSWVt$ l$|$1ۃ= 4t/t*=0t!ttSV^u5X0tEL$ji4DDt QP ^_[]WVD$t$ N L 4=0u=02t=P 4P=P 4~L 4>f@..@.^_WVt$ g4NJujVj& 瀾tW5\0n<u%+@ 4i5rO9`0t jVpt=tu  ρπtt=ttu jcu V 4u=4tt^_^>0? hDPhd #uSVD$L$ =0t1ۅ SPj* ^[Ët$1҅tހu1=H 4u2< 4u) D 4~@ 4:tzt Iuh #yH 41@SWVt$$=P 4,1@:$!$"h#vhg#jv!~ tChvh6#)vh:#v~ thB#v hJ#O#Rvv2h]!v h7"jvhV#v*h%`h\#bFpTh7"G~(wh}"$w > b#tf#Ph#vho#vz#'1#1#}##1#N9tQh""jSy{SW{uF x Ph""jVC{Vv h#=1h/#+h/#v hj#^_[USWV fD$ L 4 P 4l$ 1D$U$u1!" $D"]1x&~'t!=\t_"t $Q\$ \|$ B]ڃ # t#,$$׃߻&!$}D$##} u#$Y%)4$<$zT$tvӃuxu;Hx@u8/UD$PVx D$pL$t 1D$tD$p1ɋd 49` 484tH1 8t:tGt89=l0V 9=l0~845h0WPV* >?#<= 4 V6: fiDle cDhangD ged߉Vrr0HQPPjr0Q D$pL$t d 4` 4E;-X 41-X 4D$PĔ^_[]kfUSWV<1UjW D$hhh UPjY `sisB9u s9È 4j U[ 4j 4h "U h#h 0,$h 4?t$T|$P4 4 4 4ɒhD$PVWLVWz= 4 Àuv=0n$h #4ttQu 44 4<$B=05= 4(ȃu6B 4 44$4u轒=4u70HQPPp0Q h|0pD$P4=4ti$$= 4u>h?!{\"t1Ph#QPP[V$=0u 0  4t N= 4uEt$(Vh$#j{t8t$PFQPV$4="0t =4tj"guD$P4u/jM=0tFhz"qnh|0o*1ɀ="0ˆQPl="0u=4tP0454&l$$#uSWVD$8t^4jPVƅx jVc 4u=4tgx"1=0t=J0tJ01G ^_[11=:0t :01j袋V3V萋=0ttJ0u:0^_[%USWV|$(V11C=4t j1=0u4t0j50jh|0m0P=X0t.te=0u\1Ƀ=H 4 H 4jPk1;tW1R=0uINu=0t7=0t.h(#]lEVr{$u蚈V ^_[]Vt$4jVUx1jP 4u=4t(fj^Vh| #}ft1Ã|$|D$pPiit$ thE#5ft$t$ thE#fWV|$ W.@P• tWPa^_hE#eSWV|$l09~b94؃Ph tr d0 h0l0d0 4u=4t dl045h0>h0)l0 4u=4td^_[hE##eD$t h0) l0h0j hR#jQ D$ d0 h0H l0H 4H 4H 4ËD$4H 4P 4u =4dVt$4d0;t d0P蛤 Fh0Fl0F 4 4t^Ã=4t^cUSWVl0<k4-h05d0 4t|F9uud0PVמ  d0d0+ l0 4h0=l0 4tG90uC d0 h0H+HH x@WSUP  5h0=l0 4t^_[]Ã=4t^_[]bhE#=cD$4h0)l0 4u =4bV5l0p0x'|V5h0Pk N5 45h0l0 45h0^V5l0+5 4sl0) 45h0^ËD$ h0) l0 l0h0+D$ȣ 4USWV(L$@D$D$@t-΍i11P+wDGÉ,$Eu1ۋD$$0 PWh#[Wh#ZUSWV(f11CD$h<#R t!HuStau׉\$σʃŻ"C9t;[ uVhL#|Z1N 4ɉL$|$xtD$ h4'"Q#te\$ 1 waO11ہ̉ځ Љ ۉӊ€A ru1G11Tt$@1ۄnD$ xjWhj"9ىƉߋD$ \$ D$ |$"C L$QPJCsP\$3h#b\$ utt$|$ t$|$t$1N11 uh4'"b+D$@ jPWt$UƉRPh#Yb 1 Pho#%AbgD$x @ #t$C\$SPb|$D$ tMt L$L$|$t D$D$|$FSP@`~unj舱 4]uT$tT$|$T$|$1I1Ѹ1 uh#ma FjPWRCRPhj@$Ka 50] 01Ath#\1@e^_[]t$h`#gWh+!]W 0a Ph#CWt$hs#5WX 09 Ph#WfSV1T$L$t$ |J@u^[SWV1ҋL$t$1@t z:t1^_[WVPt$$Ѓ w,j WV t9t9u1u^_Vh0#wVVhE#lVL$A1@҃Ѓ wAu1Vt$ |$F 4( 0ƁR0u 0j 4 4u "0 ="0=0u't#jtjt00<u="0u 0=0u04=0ut 8-u0(R0u S0R0S0uހ="04u:u6(4 4H 44jP4(44 4t/t_9tZA 44Qt 44ȣ4 48t 4Ax@u 4 4^Mh#TUSWVt$4H 4-t+C11C<-t1Eu{-1E1 {0t$y0t(8Q0uƆR0u z0@uă^_[V(D$ T$P09tu,#RPh}#Ot#Q0t(8Q0uƆR0u숁R0^WVt$ ~t)~tP׏ uvÏ ^_WVD$ uD$p1F4)44=4~- 4Ft7`  41N41ɋu4 4u=4toN1^_h#Nh#N|$u1PjPPd4jQ 48t P 4u=4tN1ËD$Ѓ w#j jP u4 4ËL$~ND$tH  4= 4u 44 4h4h4Qpph#MUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh "h#X J|$:uUD$8@?jPh#X ^jUh#X 1|$D$0)@<Ph#h|0U jh#e1?\$D$01@11T$4*l$Ph""j UUhUh #$X D$EEjUt$0X u0^_[]À|$:uD$8@:Ph#K1L$0L$4KTj%KSWVT$ 4tstm8u'1z:trrD8uAÀ~:u"9u 4Q 4 tf $41ɉ 4D5 4>1t6?-u1t+O^ 4-uta5 41^_[Ph#JPh'#JVD$ X01qqA1Ʌ 0 4/POX0p ]t u 1%X0X0@j* X0 u^qqh#HJPD$0 4/$OXUSWVA'ơX0@tu%'tƃ X0 x,$@D$t.$x+$18uWPctGX"uD$tKjD$p/t6NjpVXWPV賲 E$htX0@^_[]USWVX0@|$u X0A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uqX0@@|$Fu6|$uDX0@ X0Ap8 u7|$uX0@^_[]jjX X0ASWVƻt u j pxʡX0@^_[USWVX0kE1͋ X0x t*0 4-,PLX0@ C1Ƀ8Qs s j1@X0HOH O oKy K9t?U1CSp軲 躬Sh"P= X0HO@ G X0!^_[]WV@t$P X0A uyWE wWh#4"hJ#j"Q Wh/#j"POWuL$Lx4"hm#VhX#jPOWUSWVX0@1u 1= 0tMtݡX0@xuUj @jÉGpjaC+tX0@tj\(pƉ^_[]h#X0t$p0h}#EUSWVX0@$ uX0@$EŃCߡX0@$|"$ X0APUj áX01Ƀx )ȉjCjCUjjj 81VCs9jjN$:jj{Cj`Ce߃uKjljF j0G5jGtX0xJjG B u0X0x,u%@#t@/@#uh'#jÀ= 0tjjj X0H0+H8O U X0p0j@ X0QPI H pGu5X0~ hao%v m|$FX0xujD$ X0Hu X0H L$ qx0j@X0HKH K {@;u.X0x }X0x|$ T@0GjG X0@t(HS u X0@X0x\$\$j X0HK @0CkuX0x ux,uhao%p j@\01ɉH H X0Q0PCAHrAAtejC9t jW\G @:X0@ uX0@$EŃ!ߡX0@E<$t!t;tj XÉ{؃^_[]/ uS\$|$X0X0jbx@ X0QPI H X t\$|$D$C X0APsVL X0jj 5jj,jj#jj jjhao%jjjjWVX0x$G HsX0jpW$ uqX0p(x,u~ X0At8 u @A8 @tHA~րxru\tuՀh|#X0p0+p8j@ X0QPI H pG .PRxX0@F X0t1^_jjVt$&9u^jVVL$1#tA1B1t A#u^uVt$j@ X0QPI H p^USWV |$$tD$ D$$D$l$E1$X0xc X0x0$t $jƃF X0QVI N ~ut. X0I#tAt=t A#u1cX0H u' $uH0 $p$D$0FD$N/unL$yT$$9ugucP0 X0A4FA~րxruwtuՀh=#BL$T$$@ 1}D$8jXX0 $+H8N~L$NL$$N @0FEPuj/vuGP0 X0+A8FFX0@4 ^_[]jjjjh\#L$1#tAt=t A#u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSt#S;F ; 4}X; 4~P 4I;-u{tBuGX0x0+x8j@ X0QPI H xF^_[F hn#lUSWV|$P0D$`=u ?vl$$5h0l0 4G$|$ t u # t19uD $ tC9u?,$ uP0X0HH }՞Mt9t u>u:<$ t=uء$)jWPס |$l$$uS\uN 4H 4c\FW u% 4H 4< FP0#á 4H 4ƈF t=vP0=t h" uP0X0HH 4H 4=h0)FV\X0xP0+D$^_[]USWV$$1҉T$(T$,D$05P0X0r0="t1$|$(fwt$$1.fGo D$j8fO=h0 l0 4=#T$ u T$ ǃ= 4 T$ NjrD* $"="u f|* 4P0GX0m=" f|* uD*f?T!pЃ0,0}, L*="fu 4GrNJЃ|$kT$ @1fD T2fTT3fTT3fTD"fD(Émǃ( 4T$ BD 4GrNJЃ|$T$ @1ɃfD T2fTD#DfDGfD* 葚 u= 4\G諝*Hfhfh 4f|*D*D$$$D$щsT$ f|*  4GBfL Cf|*tD*t 4Gf|*u D* 4G 4Ã{t # 4uE+5h0 4E{u!#n#}D$D$D$1Aftf|*u f|*Wf\$ D+PD$؍^X|'$r@L$ L)T$1fD t$ t.ftfLfTD"fD 4G1AL$)j pËT$ BfL  4G)P0X0@8xt 0 4 0 4$@7ET$ Jf| \`"$}f|  4GCt蝚D$$$D$t$ Pž1۹$$"T$ D*wD$NJD$؃|+4+$@L$ L$1fD t+ftfTT$fTD"fD [$p sNsD3=" 4t$^p sNsT$ 4G2f2$&p FHFðD$D$D$1''T$ uB|" 4GE$Ę{   P02t$o FHF 4G#ljȹ T$D$D$n"f| t 4 4G\" u 4GJf| t 4Z 4 4GD"{Ń'xr 谗it$n sNs 4G1@D$U2 )`2 ƃ<$ ?\u\ g  w h1袓HЃ w&Hw ÃHÃéNu  tU1Dy|$  j}D$D$\$ t 4ErNJЃ|$T$ @1EfD T2fTT7fTT7fTD"fD-ŕ ur%=m = 4 ǁT$ $ 4G?ˀtw 4G 4@݉= t]\t 'u jؑ t =unP0X01Ƀxɉ 0 4$1 4GT$ $4H $4~(4H (4 諑ËBDe"$< u 4GT$ 4 4 G?ɀtw 4G 4x?ˀ# 4@D$D$ L$ }#t. 4H 4lLjG/ #uYKЃ w4 4H 46LjG ÃЃ D$u 4] á 4H 4=|$tO#tp%tk1:u  É\$D$$"W ")AT$ O}L$ 謒1ۋT$ L$ )1#, 9u1ۋT$ Bf|uf|tˀAs@G ˡh00qL$ rNJЃ|$T$ @11f\ T2fTT5\5\t5ftBfT1fT|$ ,"fQ fQ wS 4G ?ʀ 4G  4G?ʀtw 4G 4H ?ʀtw 4@ 4A?ʀtw 4A 4x?ˀ^T$ }D$D$eD$ d4e4D$D$$d4K& 4G?ʀtw 4G 4H?ʀtw 4@ 4A ?ʀtw 4A 4H?ʀtw 4@ 4y?ˀt!T$ j 4AVT$ M??"T$ rD=#r="tf|f|2^ 4H 4 T$ 5h0Bf|uJ؃t 4$t$bǀ>ts4$jjYl$ )GX0L$H,L$$H <$X0pM tΉ$e NuX0xİ^_[]1Mo;- 4};- 4~- 4>u6y1E[&|T$ >y1&&tp>T$ to! ͅVȋ X0y8~0 4Q 4觼@ X0Q8rq8^USWVXӉΡX0@D$ $4D$:+h0l$$U貴4$~"Slj$S5h0P[ 1D$|$p-4 4u=4twP0D$-h0l0 4X0x t*0 4P$X0@ 菄ǃ[~!\u9~ǃ[C tJ$Q u"P0X0HH s`un=ub\tX`tSP0 X0QQ NDt""u$ 4H 4~E\E ޺\@ŋ 4A 4迺@ 4H 4蜺Eh0@|$p~P諷t$jPg D$lŋȅut$ j耷EX0xtH@1D$P0D$jǡP0D$t5 X0At$ D$AEx%X0@t$ Ex l09ًl${ l09~=h0 4t1SUW ) 44U\ $ 4t\$=4\$t X0T$ Q4Nf|u%Du 4Q 4@Vt$+t$ 4Q 4Ӹ@~.F 4B 4ȅ诸AJ։ȃՃX^_[]áX0L$H0hU#qWX<$t 4$[ /X0@D$4jPİjjjjVtQ_[ N^V X0 "ytA50 4t7t u(l445P0P50 4#^USWVt$,|$0l$U辵5l0ô1BW;h0u(VXGl49w&h4WVS U蝵^_[]Áw: t9v$P5h4U tãh4$l4랾#뤾#USWVT$L$ -4謆ƊJ04D$1|$0X0D$|$lWtJD$X0J0Ve-4D$44 "jUԮ\$t$l$=41F54D$0X0$V\$S Vh"P X0A |$t|$t=0u s#@݅u:T$1rIJ$JB J0VVRQ -h0=X0D$J0t$cD$4D$4؅tȁĠ^_[]jL$1jTfL$1tT$9Qt uÉV x41t!T$qt 9Vt 6 u^USWVt$~tB\$?Eu p4tMx PQ' PUW uF^_[]SWVt$|$9t VVW"9uW^_[WSc~ PVh#DSWVt$|$\$j ްKCxp^_[USWV D$$l$ 14$t$fD$À\$t j薰@x45x4]; 4}; 4~ 4Eu9] u|4tX9Xx4t-xt 9_t?SG9t S{ |41tF9Yt? x4tHt 9Y jjS /vP.D$$Ft 9X4t4  >t4 49|AQjSm tDžyju1O tft 5t4jS- Džy/8tu8jjS DžjjW j ɮNFXx 4u=4tup4t$$D$PU m\$t 00|$t 00 ^_[]j { PSh#00{ PSh#f |41tT$9Qt uÉVt$5t4j V u t4|Qj V u8FPj V u$j j V ujj V t^h#WV|$ t;G;t4|.GP`ƋG9tVPWww^_WV d0 A d01F |*1FPWW y w Pegfff  t4^_USWV$$$~4 8n$"n  |4t9i  V x4tQt 9j ] T<(J8x=0tNnjUƍD$PV螹#D$ =nhh_F݃UD$P"oƅtNjjV !UjVw /nhh nhh U ƅZ|'u" 09uu4jjW %9t!1PWVD VU 4uO=4tF?1PWU y v 0w PWVPW 4t Ā^_[]Ã=4tĀ^_[]@hh j w PWUh#VSw PWh#e(1F544zV0Pt$h"8[8VSK844:j0PUh#|$ tD$|h@Pt$ # USWVP;xR|$_S=VSt$ B 1jSSY t!t$$^_[]h #`4$1EUjUjUUUjSj Vwt$  S.V5x44jVx4VO  4t^Ã=4t^U1=p4SWV5x4t4|$t^tCx PjV6u^_[WVt4 |; 4| t4t$ Pj V y2d8t Z8ut4 jjV 9t V+^_Vj 衧tL$ T$5|40|4PH^á|4tT$|49Pt uPM USWV$|$<\$81D$ $D$1F5`:5H1h.#WS( !1 h3#4 Vh#) L0-q PWhH# 10q PWhh# USWVƋ\$|$tWh-!50 "tl &%"ut&PWh8%%50E!u,u 17t3Ph"50 u1}th%50E uttVh#50d hz"50Q^_[]SWV|$1\$t$tFHN V3H">tbh$Wh#Wuo1<4tE4442F 4t jV[ 4u=4t[F@u4&>hun#WHthm7!W6t D$1p@|MD$K}h&Wt8D$D$h#, j50a1CKD$D$u}h#N 0vU11 t=t8<4u.u h# VaPh$%>  GF@uhz"y F@uu=4t1uuޭ1]y1D$S跭t SO)h]%Sj SÅ@|$t<4tW44hB#Ah#<4t44Y h#}S0Ph" ]41tuh9#50 CD$ut]1F4t P1<4t44D$C D$4tjS>؃ 4u=4t :؋]mt hz"11<4t:48u.u h#WV Ph$%   GF@uhz"%F@ut hz"1<4t?48t3h#44VPh"c F@u1^_[]ËE8-uxu1Q1FSWVD$,\$(=4t61B= 4tbu^1Ƀ~7t@tuH1=04 4t1Ҁ9ƒ (u1=0B1ɉσu1B41t)9t`tbփub1^։PjS+ $u=0d1@ָ PS#t^u4u jS01D$ D$D$$K?r A 1@ jPj  ^_[À=0u=4u ="0=01@V44>t8t6? 4r4 4t^Ã=4t^SWVt$u 41ۃÿ4t648t+4SP 4u=4t4=4ru^_[,^_[V1=4u#41A:t2>u 4r^WV|$ 04u"t$=4tg=4u^4WuS =4tӃ<4t>48t2t-44=0tu=4u;0^_WV|$t$ 4uWVj4<rjV褛uƆ4^_á4=4t1Åt8uUSWV41G4<4u@@uu4=4u΋44tã4S-4V0jPVd= t<$tS-4m 4^_[]ù@rA<4tøWVt$ 954t)1Wj;Wj0Wj%54^_ËD$44USWV`D$=4u4)=4t4t D$D$444=4tt$(V耑u 54gt$(Vdu454=4u%=4t?t14PW4Vu54Bji|$wfs 54賚1ۍD$X XXPjSW.\$\$ \$\$O?r p1@ DD$jPjJ r~VPuf50t$WVt$|$ ?t*FHN V>Qu950u V^_50t$WVt$ Nfu4FNtF t0fu^~4 ?NQPF N)N4vݓF FF 4u=4t V N^_Vt$F t-)t'VfxQPR yNFN F^50t$USWVP|$t$j'V]t~thS#V<k>t!h"Vhk1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=0uUWMGHO W]H"WVGHO W3H"^_[]WVh"Qij'V_t)19<>^_hh0oh|0bUSWVD$~@|$l$1SWU t P8tF r)~1H^_[]ËD$)D$4t0tP7 1t0l0 4u =4NPD$L$ T$$RQP XVPt$t$V6k tt$ P4$6 ^hX#aPD$L$ $QP50 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+4+4Pqq h#jhp4Up4SWVP4"C PVw u,$$wtxCGσCGCuh4Vh#8 u*$ 4444^_[USWV1ۋD$t$l$1Tt =t JCtA)k')<4t>7t9^ uSUv t61^_[]ËD$t8SV VƋ4`u4$4 4#t#$#t\&4w4㟉4t$D$$# ^[WV854$|$W<t $D$LL$HT$D=4PQR 54$8^_USWVL$T$tHtA|$9t91#Írjt/9t+1#tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t UڻV袌Ƌ $A$~ C@ $Q$f=t @UPWV ^_[]SVh #USWVD$ èu|$=z0uÍD$PQWc Ƌ@4Nt#݁ uF @PуF`u v<2 F~tuF1Ƀɜ! st É^~(4t4u,4t j 4uk=4tb [r2jXxL$H @ $  $#`uWk1 `u W[1 fy^_[]vv h"# D$@!|$$~L$( t 9-uD$@-=4u0@=4tc@=(4tf@=0ti@=0tl@= 4tp@="0ts@jPh5#=,WVt$|$ 4tw;VP? 4t^_Ã=4t^_WVt$ t|$Wv 6u^_USWVP\$4j蜉ƀ;-u {l$jPS tjNj@F GFGFG0 t uuO tGT$< =uFRQSP}j=SS)UPu< ؉G@5T0轈5T0ht0P/ ~ F1gjt$4uQG L$<=u54H42UjSs $81F FF44~l45l4 4u=4t^_[]WV1VVt$? t/NjHu%Gtt WЃu GO 4F^_SWVD$ ,4t8Q12<08uF=u =ut j=R蒃F^_[1VVP tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWV41tr:1҃Љud4r׍P(ƻ4Nj+t7Mȃu%EttUЃuEmŃd4r^_[]SWV4>tLGu% uw, Gu#W, @twGGg;ud4r^_[SWV|$tfhE#W蘩W9uWhs@$V't*tUj'W轁t8)WPh`#} h]#lGh#ZWhn-%J^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPh9#tUh9#>=uD0HQP~ j( P} 0j)n~=uGuth"~EU0HQPP%0Q ^_[]USWVPd4uh4 h1d4T$ t$\$41<$?tIOt !T$ ttуt݋ h49|QPT$(d4%h4)uF Gt/1Ix t#t0u51>j1ɀ>g1AbPՉI1>?f u%PV'1u%#L$1PV&1t1Ʌȃ|^_1@Ow$"1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$ t$L19{USWVӉϋu4fx@$"$PWg%1ۅD$PVO%r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW$1ۅD$PV$$L$$t$<|$@11$;D$D9t$ aZ$PW!$1ۅBD$PV $,$3D$ $3L$ $$3L$3D$1 dVWM1ۅTVW=1ۅfVW-VW1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]nuQ9-u1tQyt8ytBÄth`#Q!4"t1h jjh"Qh jjh,"h jj h"R;ËD$L$  )VL$D$ 2)u AJ)^USWVPj PV lj8t"ځ8"u 11E9s:$9t( tU1@DQ@uuN9t ڃ^_[]Vht#qVhc#fUSWV׉At 9Fup  ^^9uM1PP~ōPvPU~ LH;NuS #~^_[]ÐUSWVt$(h "jEC D$,^H $x?-Ok-u)sstdluu~xwGWOvÅu"tU1DHt'1Ʌ S~wكh#=htU1DH\ƃ~ƀtVwtVSwVh#jIރ $h'S1Ʌt:SMuu+$891V50 V|-$K$8ʉT$h&W蕤1Ʌ9ufمu$1D$\$ $,}%urU?_Džl$UWu.#|n! $4Phmv% 1@D$l$t jWcj D$PU@ ljӋD$9t-ف8ur1u 8tQz#x "UPh#+ 1@D$\$ $4h# 1@D$F \$ t$PhB#j(4PPPPh##50jWVPΉj WQY 9u=у|=}^_Vh#jQh#\j50jXWV@V 0444&5a;>t&j=W{nt j"W >u+Ph""j@V+jVh#? Vh0hj!' !#VWh # '#t\&VQh# j,h #h# VWh#L^_=4t 1$4,4DX0(41<4D4(49x4t=x4u0h00|00tP 0Vjn154 cDX054 495t0t|0@8@ujq4j4uƀ4@u 4u=4tx^=fSWV|$ tK\$CSW>CP\pAQW1^_[SWV|$t$#$#Vw vVw d_ t"Vst Vw?wܞN@F1Vw q#w 赞N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u#E$H#Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t Ã|$ USWV4t$L|$H40f`|j%v6i< O1@D 0D$(41O\$,t$$>p%>%bD$h0#VE,<*u E5 h"UDʼnE<.u}*u Eh"UDʼnEtt$}EWl$ D$~^F$#׈|$ D$ ӋL$ D$KSt$WPh41D~ ƻr3bAt)BA40T$(4 4D$,t$؉D$ 't"u:Xt%xtPh&# 1O4fD$D$G賚4L$ Q0\$ 4H 4T$ Q D$ 1Ot(t5\$ T$t$D$$t$\$T$ \$t$D$$ \$D$$XӈD$ D$ ׋L$W D$t"Wt$SPh47Wt$Sd40T$4 4 4 4 4Wt$Ph4&St$WnWt$h4 1O|$44t P V蕘Po 4Fl$ wZ$P#a=&t1"u@"*\\t#'u0'btnv fre\qFu`tU1yDku%\ҋl$ y AMπuf^?l$ 뱀^@-Wl$ EsL$T$ZtPRiSt$Ph4tPt$ +44t P 44t Pj 1-4-4|$H\t X]%P0tMMu+^tx-uE-4뼸^tbcT$j-4E-4댋 tU11:DYt 7GuE-4|$UE-4@1L$ 4L$tPRQt$PQt$ St$h4 |$ 4EP 4UjxP踉 /D$ s4|$t#T$L$t'PRt$Qh4A5T$L$tPRPt$ Qh4APQh4yA r44l$ ~\tnF<]I<0uQtU111\DXt7 BuՉql$ |$1<^tW\uXT$jdơ0HQP~bL$z8 1O4;D$(tf8t$$Wơ0HQPP 0Q9RPD$ 0z91O.50d0H#4Ct$h7#-h "VW t$5(4hC#50@ 1@4^_[]áH1)hj#ڃ%u|$Nu1Btt$hT#녁fHh#j USWV ։͋T$ y كDN/~{CЃ$1<0}11ɍكЃvLʀ@0t^C vC w>$# ?$l#."'#Eu uSh#4 4$tU1D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu hw#n4\),ҋ4$u|$ uWh#>4 ^_[]SWVP40t?4֐1ɉQSV( NjrVh#1^_[SVˡ4H 4 u:0Prp~r0 P0Q 밅u4)0HQPPe0Q^[USWVP481t<4<'t<"u._ttWh&#4(1$跏1ɉQUW虅 É֋Um؉^_[]SWVӉQ/ǃArVh#4GPVh4f0 Ƈ4j4Ƈ4^_[V΀:t 9t-Vh&#+8"u3j", PVh "( Rh #4^USWV\$$8l$}h j jht#Uƅu!h j jhX #UqƅH h]PW蔪VW蚪D$<$H $xd|$<tWjt$ y h"s|$@t'D$tPhgtt$l y h/)#Kj#5h:hs@$.1D$@D$u.-D$PW/Wh"j:WCu&j.Wt"h4Wu @>t(<#th4Wu$4=4t D$,4D$0 4jSVP u h,"PY1uhv8W)1HHЎIf $h)#ujPVd |$uXVXu륋xp  PWh "( cxp D$ PWh "D$ 1GP<$5 454pӃ t|$uwhs@$#H1Gg|$ t w!<$Mh#&j肢h)#jF4=4{#tY*#PQPh)#hN1jVt)<#tVd t@ {# 4^SWVP׉t>#uFj PV, t8u$8u؃^_[Vhs@$j迡WVh)#j聡USWVQ f944 84ƒ 844{ 84€ш 8448 844 4h"GTt h4#/Tt8ƿ/#8#PVUttG uVh8#j觠 $$1ɉh4#SU P6$t*#$4kj j5h: ƃuMs8"54@4v h:f4Wj j5h:_ ƃ _%44j j5h: ƃur8"G54<4D4,41A5h:蟟5h:h("Vrtch44#VrK84(4B04(4/4#q8"tD54  9u4rCjh4#5h:hi4##Vh&4#5h:hP4# 5h:h74#jnu h4# 4t 1ҁ‰H484փ954u<94u29494u#849 0t 0(444=<4u\1ɅQdh4# H1=04t)ͅt=84ut 1jhhL4P49 $yhL4hs@$j.=44u1D$(Pt$GNu#D$0=u (4441N1$P+# $$h!O#Qh0%hVV`thߋ!Pq$Phs@$A$44 $=4=@4pL4B=h"tt1@$$Phmdt$ hh4#h|tWWh?# $=4u 4 =4u 4 4$hL4 T04 $$1 uWhPhL4a 1d4h4l4p4tjVhd4: hL4\ $RhSDL4hL4VW0 5,4VWF5 Wrl$t$D$ 1ɉHHD$UD$ Pj  ADžy#l8#BjfEx߉DžV :x9ujUj赐 1|$nh"$PΨ<hjhL40` ^ Wqt $h>#h(N1p?M1H M1~M1H M18hM1rljt9 t4M1H M1~M1H M1hM1^rƒ߃NyjUj衏 h"$>1L4(N1hL4VW4. 5,4VWj3 hL4dtd($Phs@$=$P1@PjUj P!ɨP裩hs"&K>#tǍ$PWhmv%VD$uhHE!Z$Pr$jPh}~"QQƃu W V=WVθA7#4,#PVjt uVh(7#j+G 44G4G4O184t^_^_WV΃=84 84t> 4t49t044#44#9t("9t("QPh9# 5 48484^_SWVB#h$1# 1#VShB#hN1)$"ujVPjj"Pb th6#P1Q1+#$ =uh$ jj"t$ _1$4F"u4$ 1@^WVκ  u1H3 r1P^_V΀=(4u6=4t t41t)PhL40hL4hedAV xk^Ã=4u Jt=44t784t.hL4hedAVp thL4hrdAVY t=4uj薚h(;#jڔh9;#j螔USWVPύAPjh=#h(N1bGw4l0#h+O#Ph!>#h(N18 (N1w(h->#V" w,h4>#V w0h;>#V w8hB>#V w4hI>#Vޢ W4O<W8=#9tQh=#hP>#h(N1賢 "OHtQPhY>#h(N1莢 "OJtQPhc>#h(N1l "OLtQPhm>#h(N1K "ONtQPhw>#h(N1* "OPtQPh>#h(N1  "OTtQPh>#h(N1<$f$1۽a(N1Pjjh=#4wVh>#(N1P茡wVh>#(N1PuGtm#h(N1FGw=BBs3gRPVh>#(N1PwVhU-%(N1PC$9(N1Vj V;8^_[]USWVL$(y(y,y01y4ujh,5#L$01FfyHujh>5#L$0A8u A0A,A8y<uA4A<tK1q(tVhq5#L$,C4# 5#5#jPc1@$$^_[]jh^5#CL$0Ft1q(t'h5#L$,jh5# L$0F49‰4$sRPh5# V`>ÈJ9|6{u;[tVPWh6#D$(ffL$(D$ 1ۉa)D$u!)tPt$h]6#-L$4 <)ǘ΋I<9vt$h6#$N<.”T$9vt$h6#$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h6#{ D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( 44t$(L$QhV;  D$ 1h>#VtG<$h"V 4(1>tYj:W".D$AL$\$h"S: ,1tD$h&Watkh'#WahH?#Wa\D$Phj?#W D$q;4ef4ujh&l$!UCV l$l0#1tUP0 QF0#r܉1hD$ Pj <$Wh>#D$ D$t$ <$}trÉD$h!U t:h!U t/h!U t$UWh2?#  F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhR?#D$ D$4FʼnD$uf5P4l$u D$l$l$hw$W_h%Wz_h?#Wd_h?#WN_h?#W8_ h?#W"_h!W _Th?#W^h?#W^h@#W^Uh!W^kh@#W^h@#W^h@#Wr^h'@#W\^<w ~W|$Wh;@# T1<$4jD$<$rt$Wh ?# D$fP4@<$Why?#4f4jUhT4jUhd4d* <$t$ht$0V{ J21jD$ Pj< D$t4뜉1jD$ Pj D$x4q1jD$ Pj uuD$4J1jD$ Pj uND$|4#1jD$ Pj u'D$41jD$ Pj^ tt$W|$Wh?#0D$41hD$ Pj uD$f41hD$ Pj uD$f4a1hD$ Pj ^D$f411hD$ Pj .D$f41jD$ Pjc D$41jD$ Pj8 D$4; 4sr"jW|$Whv@#W|$WhV@#΍L$$ t$4|$84L$$ L$4t$84rh"V0l$}}+#1ۋ>t.WYLt t uPUW Á$,#r D$tU1MDHu D$"91hD$ Pj t4$h>#D$ \$"r)Ut$h@# h@#D$1ۋD$4ND$4WX4(t$|t%h"V  L$1Ҁ<tʉT$D$< w'<$$p+#L$ L$4<$tL$$L$ L$4|$84cL$$t D$|$84L$416FL$<$C fF|$84L$! L$4|$84t8L$$ D$|$84tL$411A<$D$ hL41D$ ȁ(^_[]4$h@#D$ WVPθWEVL44f4hL4 f4=(4u=44u#$}hL4hgdV 1hL4hfdV yW8t W8uv$=44u(PhmdVn xX50h K1=44u$hL4hgdV2 y :#1G^_ù9#h4# 뙃=0tt$ t$ t$ I aV1HVD$ t$=L4thPhL4GJ ^D$L$01VVVt,uVh:#-t"uVhf:#Vhs@$i(Vh:#Vh:#^h84hmd50& USWV8 $RPh h4Q84 D4v|Pt$h~;# lj D$T$1D$ XƉ 11 ‹l$x4 84494hWD$PH $;D$ "=4t =}t=}uЉD$$;#=H4tȋ H4=WEVuT$tf94rD$Pftt=D4%4$t$Uh;#S D$t=VEW=H4$t=VEW4$t$UVh;#=D4|4$t$UVh<#=4$D$PSt$Ut$VhC<#Y=@4u $hL4S(N1V 5,4SVI SGSt$VhVW-G 4D$ L$D$11t4$hW;#p%8^_[]USWV T$ $11F1Ń=D4|Uh<# QPWD$Pt$|9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=D4tUPh=#  Ɖ ^_[]Ã=D4tUh<#D$=D4tUh<#ċL$T$tPhL411@Phc<#1t"j QP趺 uIQ8"t1H41Yhs<#jJ~Ph<#_1t"j QPm uQ8"t1H41Yh<#j~SWV։ϋ\$+04tItEu041tGtB4x4849w14 1tthL4QA1@^_[Vh;=#j6}L$1=4T$ PG1ɅɉWV84~( WRPh4Qz 849u ^_hl=#uQVh=#j|PQVh=#j|USWVPӉ΋l$|$uj WV EuO"9"t:M";L$ w,O>t" t9ttU1DJ@t1^_[]WV1t>΀9t7h"VsC<t#ƍFh"P1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh A#Wh@#ܽ1۹84؃^_[]ËL$9/up4D$\$A/jPU u$D$ x4D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh># 84!Wh@#841 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uhB#dD$$ThB#Sut]!1#WLPWS? '> uۀ$U-$T14d2#D$XP tpC"uD$TPh#H#Å$T$끹H#d2#j" $eFMu SQЃ {ShB#ph$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h$D#D/$PQh=D#R~$ $u ~ˍ|$@WVO|9t"b&J~PH k$$1#1OJH w@$L1# I#B(D$ D$$l$ CtGtngtbcB8D$D$l$cI#ɋB(D$(D$,l$(BI#ɋB(D$8D$<l$8I#ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=94uHr8jVSW<D$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]PhI#5wh I#(w~USWV|$t$t$h!Vx Gw43#h^!Ph!Vx GPSh!VxGPSh!VxVjjhG& GXtVjj h! GXtVjjh! GXtVjjh! Vj lw(h'!V+x w,h9!Vx w0hL!V x w8ha!Vw w4hw!Vw w!$Su<.Ǡ!w4|3#hL!PhT!Su  w$2#5h!_<t$uM55h "RPQh[!"555WRPQhn!SMu7h "h!S8u "55RPQh!SuM8tDƔF1Ph!St F;Eu 1<1A71Au01<  $jj@PD$PD$ Phs@$"nC9u<$u40N1H 0N1~(N1H (N1 h(N1j s1^_[]hI#jafUSWV $ $ D$-@1 9494 94949494$94 9494t$ hK#USۅ c~!P$I# $94˃PtdT]=h:?1AJ5h:(94뒹 .h:94h "n $94b $94D$,94T$:@= 94lh:D$ Tnt uBxou D$ 1Ɉ 094h%V臛t 94h "`ءh:$j:WC-94tWu2tm94S c$ \W$94t$94t (94H19$ 1ɉL$tVh$P tj/Uzu Uhb!h8%%h$ UiVMDžuVLDž7h$P Ƌoh#W1t(hh%Wo1thL#W]1pV 1QQ$ 4PU7L$9C9$ $ 9tULlj?,$u1QhD$PQVg h494hzd@P" tq$ PhedAW" W V|$ W/D8$9",J#uWU94,$h7 h#7 5(94P Ġ ^_[]hL#jf\$Phs@$j\VhL#jE\h5!h4!ʍD$ PhL# D$ PhL#jJ\D$ PhL#롍D$ PhL#땍L$ Q4TJ#h&M#USWV։ϋl$jܕ VQ UF CCCOK G^_[]hlK#PhVM#hN1ljjbaUSWVP׉΋tAS-.W".4$4(VSߕ Wh#Vt$ Pf W謔 É^_[]USWV|$1_h#S.t$hh%Sy.thL#Sg.u\ 94toU3K.t[u=094t .=094t%94toU3.t [u^_[]USWV$D$|$94 "tW3-t CÅush#t$ -uD$%D$ ,94t L$ mt L$ ^$D$ D$hǓ $$ t$h%hV6e$0|$D$4$L$h%Q蛕1G@΍K9|,SPޓ Ŋt><-u(GD$tj=Vt>FD$ GDL#th%D$Pu|$1F1B,$֋$$$,$D$94tP "tXZ!P$h/L#xe xF1Ë$4h$%\eC9uj kdmt2ƅ|$t t$P 4$E tA710h?L#|$t t$ 4$ ^_[]ÍD$jPV x!L$ȃtuuh#"B묁tlP PUh "跙 끉 $94utD$P$uW$P$*u4 ^>4]á>4tjЃj gWV`%01Gj0hK#WH =>4jj4%0^_SWV'%01GWWSjS$0^_[USWV1>4>4>4>4>4>41@D$ $1:4x:DžW$ t7h$Pi Ɖl$Pŋ$ tUt$hfN##^$ uu&낋D$ t^pfjt$wUw$ Ë$ U؋ $9|ȉ$z\$GD$GD$1Qh$PQU蝝 t,ƍD$Phzd@V! t$VZIS# tU1‰D$H9rHDQtD$=>4t*wt$SV u D$<tQ?1Gj݉ SR GL$G 1ɉO GO>4G8=>4>4\$w tUv#tt6jx U Ft$ވ F t$ψ FD$FGF0wVhxN#hN1] rUh/O#D_$ }L$ AL$ 15>4tyvh&O#[~ twh$%[?j Z6Í$Phs@$؁^_[]h[N#h=N#蚐܋>4Ћ$ t9‹->4҉T$։鋔$ t$ t $9|ȉ$mNu\$>4t 9Ct,PhN# $P u$ȃt1{ $ t#Qw wwhN#eZ$ȃt*t&t!Pw wwhN#hN1\ OtHOKt>4G8=>4 t$w w W C>4H >4{ t t >4 >4I >4;D$\$9>4MŅt̓} t}u鋔$ tV$  $9|ȉ$8ً$ 1t $  $9|ȉ$1\$$PL\$tq>4c8 "t##hN#PhN#hN1Z5>4.>z"t"Pv vvhO#hN1\Z6P;$SWV։ϋY Wss ss҃ >4t~j Wss ssԅuA >4^_[ÐWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉ荭mM PQ4040<8<8D@٬D@LH蹬LHTP虬TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,4040<8߫<8D@迫D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7EVw w2V FwwVFww VF^_USWV\$l$EffEffCEffCEffCu u踪S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuSCuu٩SCu$u ũS$C EDȉCDu,u(詩S,C(E@ȉC@u4u0荩S4C0EHȉCHu G h 5@45?4! 5 @45?4=@4t?4PP5?4?4u$1;C$C(@C؁^_[]PhHS#ʦUSWV Ρ@4X4Y AI?4tbSQP ţ?4~,=@4tiF(1~$V,9l$MDу=@4 $T$fn,A=@4n,fn,F(~$|9}}Uo1>dhT#VŋFN?4tbSQP ?4x @4~,=@4tffOfGG@ Չn,~$N()ǃ~$N(=@49<$D$hP-@4>N,ș)N,)n$F(tehT#V$FN?4tbSQP ?4HT$<L=@4tAf=@4t4f.<$ ^_[]?4@4F,)F$N($fOt@ ?4븋D$L$t$ QPQPUSWV$$$ $$$(h9#SV\1j FD$SVWUhP@؃r_@495@4rPSV Pt7=@4tf%!=@t."WQh(%d WhaS#T^_[]USWVP|$\$s s@=@4tf9uRx@4t=8?4t=X@4tj:D$1PPPs sQs s6O>43C >43K u 0&=@4tf%!=@t."QhpS#胣s s/)SUh~S#E 8?4u =X@4t:yj DhS#8?4thU#ݷ=8?4uhS#u=\@4@4t7t;f5?4D$x@4jhjS#S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=@4tf=@4tGf!@t."PhS#/SVz.=8?4t)1=\@4L L h(U#賶hS#{$p$l tRQf@ >4>4 1VW 0L$@D$DD$ t$|$ \@4pt95@4tʋ \@45@4T$Htt tɉL$LL$QPhS#=8?4uhS#5150PPPj>4>4  50RPjjt:$@4=8?4hU#FD$L$ >4>45>4=>4 tYjj=\@4H@4tt,fI=@4tftfI=@4tfIfHVW51>4>498?4t-j fA >4>4 djjQP >4>4 AQP=@4tf%=@5>45>48,$t$R=@4@4 t# Fjj WS9ݹÉrFND$P9|$P$d닔$hjj RSء )ˀ0^N9whT#訞h/T#Jtf5>4>4150WWWj>4>4 CRP50jj_hS#h:T#1?41P^_[]Ë$d#>4 >4$tҍt$PtV$lSUQP4$SU fH1G@u5>45>4hu,"SUu.$l#$pthu,"5>45>4SUq5>45>4H=\@4@4fA=@4fhS#?4h[T#hz"jj5>45>4D$DD$S t$\$ VS@@PD$PQVSf@5>45>4tfA=@4tfA$l$p!fHG5>45>4mf@5>45>4SU5SUhT# t$p$phT#g> =8?4j p=USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡ@4@4 1WjPQWWRS 9=@4f0 @4ff0=@4twf0 @4ff 0=@4tjf00f"0=T@4t0ȃ=@4t]D$ Yf0 @4f0f0 @4f 0f00f"0=T@4t07D$ G UV=\@4l$$tApQt=@4tRPגA(=@4t1ҋ @4I4-?4teQRP ?4xtt$V/11jWp袣 =@4=@4tf=@4f0@4;x4})}jh0W` =@4E @4A49rE =@4t<$fGj \$l$u6_=@4tf1UVufXUVW! t$$\$$SP8tt$$S>8UVW! UVo#L$$HXH XQSߊUVUV8u8|$$$X=@4tfUVfXW|$$Wf@t$$W=\@4H@4tt,fA=@4tftfA=@4tfAfH ^_[]UUSWV$$1Q @4@49;$$߃9։$PU$T$L1 B(Bn $BjZr1B$J$=\@4pt$ =@4t ɋ=\@4@4L$xtt tɋ=\@45@41L$|1ɅDT t$t RP\5@4UVRPG tE{[|$t}SW"ljUVSWG)SWlj_{[ |$t]SWݎljUVSW[G)SW赎lj?UVSW1G)Ӌ$xX#UVSW G)Ӌ$xX D$4PS $$W$VWVhPWV \@41ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =@4t SWэ @4L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p8/  D$HL$D$ =\@4<$\$T$|$(t$,DpLtL|Dx=@4RSTtDp@4D$0X0vv迌RP豌VFvv蝌 RS茌VFt|tx|$8rD$T$Rl$$D(D,=@4tFB\pTt@4B0FN FNDxD$L|׉L$L$؉D(MU =@4t]RQ @4I0VPҋU EMhɡ@4@0 ȃ=@4t3ȃ=@4EhD,t($@4@0MU EhEhD,=\@4L$ tL$D$D$=@4,$\$ 1QOP\$  t19}#8@#pLp0l$$ ?4ɋD$taVt$P9 ?4x4ƍ$5@4pS @4@0fPt$t$ ?4x5@4Sp @4=@4tf؋@4f0@4B09}+^jh0Sl @4@4B0N9rF =\@4tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL ?4taPt$t$$ ?4x=\@4t$,|$(DxL|DpLt1҉TxT|FN=@4<$09@4QPQ)RP>VF^vv' )RPL$(D,D(D,EM =@4\$QP܈ @4I0)RPU EEhhȋ5@4N0 )ȃ=@4t^ȋ5@4T)FN^FV )S\$L$4$*5@4V0)EM Ehh )ЋL$Ev8QS ?41Ą^_[]Éjh0p. $PhT#k=8?4th7U#h U#ۻF & @4@0 1RRPQ$$t$Xt$XE D$4Pt$ IUSWVLl$`\$dSU& t$1 F(Fn ^nFD$hF$D$pFD$lF\@4pt =@4tɡ\@4=@4L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=@4tf)9F=@4\$tAf)=@4t4f=@4t'fL$=@4fVT$Rt)f~T$JR>>fD>=T@4tq1@1$CD$ƈCCEUL$ q/G9<$u1A=@?4=p@4\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=0?4t Vt$t$Ut$hT#,1Ƀȃ^_[]1A=@?4t1=p@4<$\$ HfUSWV $8$4}tE1ɉM4M019 \@4‹DT 9 @4tRP}M$U(E$f M$E$U( u ^_[]%=uLI@4(9‰|ǃ=?4t<|u=\@4tFNFh1 t\@4tD$hVP |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =@4t RP @4I0VQRPƋ։D$D$ ЉT$t @4=\@4Q8k=\@4L$$tL$D$ =@4t QP @4#8t@DQL!!IT u‹$8U t#DT tE=@4t!RP蚀D t(=@4t1҉EU}@U=}@|$?4EM QPQPh$3WWhCU#聇hgU##uQ{u u @4y0ƃ=\@4@4t:tMPW?UUlCD$T$NQt PW~V ~V h;X#覛t@4?4@ 뛋5@4F8E -\@4T$$tT$D$ =@4t RPv0 I)؉$ʉT$t*DT tZ=@4t RP~$8D t6=@4tȋ$81҉AQSt$t$tv<$8}@ud<$D$|W?4E$8I QPQPh$3UUhCU#薅hgU#8$<t7@4Ht)$|$-\@4Cq qƃ=\@4t0FV=@4|$$tJRP})RP}4FV =@4|$$t&RPu})RPg})FV )FV h;X#肙t@4?4@ USWV|$ \$t@49@4a>4 >4 ‹-@4t9ˉrux9ˉ\$؉jL$QWP ց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$ס?4t`v0WUH ?4@4pxjV|$(WSt4)Љ >4>4=\@4jVPSL4 ?4A^_[]WShV#?4@ USWV$׉νR y@tnVՃ2v vv $<D$$8D$@4p0vv[ $G @4y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQP19rÃ=@4$t$ \$ti=\@4t,ۉ~A1_t4QzT\$F9uۉ~1O ɋW @9uG W5p@4茲t$ D$x7 @4;Xt|$#=\@4t JًL B tmt$v vhX#hW7"WVt=\@4t$$B1ɉL ?4t$ $$Bt$ B C@4;Xt`R5p@4贱T$\$1ۃ=\@4t%JًT tN=@4t#RPxBt/=@4t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tb?4L$AI QPQPh$7WYWhCU#hgU#xT$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=\@4t+FV=@4tGRPw+D$RPw1FV =@4t*RPw+D$RPw+D$ډFV +D$ډFV h;X#输t@4?4@ 1@$5USWV\$41F~3|$0l$,|!@4 @49|)S9у} ȃ^_[]Éދ@4K89}=0?4tOI.A!1‰9)=0?4l$,|$0t!t$4PWUhuU# @4PVWUNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=0?4!$l$|$ T|$0tN# $ND$T$RPWUhU# @4<$\Ttq!qIVPt$ ShU#1$@l$19=0?4tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUhU#@4t$ShU#1Al$,|$0USWVD$,\$( >4>4փσ5>4=>411 J >49>46 >4>4>49>4@D$ >4=@4\$jD$ PL$QT$R[~ց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =>4>4t>48>4T$t>4‹D$ȉ>4>4?4WUS5?45l@4谬=|@4l$$->4+l$(=\@4|$`5?41VV=@4tf%=tjvdv`rVdF`vlvhtrVlFht4ZrTCut49rTCuG9a=?4t< @4(1?4SS=@4tf%=u1=P@4u(x$CS =@4t RPq9Ƹs& ɉ @u ɉ @uG9wt$t$t$5?45p@4衬?41Ƀ=\@4 >4^_[]PSh3V#awUSWVl$|$@4jVUW) 1ƒ >4>4>4>4=>4->4=>4->4>49?48#{H1ۃ=\@4(=>4->41>4>4ډ>4t@>4 ->4=>4Wh) ?4t^_[]UWhVV#Tvh{V#Jv?4t PV ?4USWV l$ =\@41ɅDT =@4t RPo @4Y0މD$ʃQSRV wÉD$4t,PE 1ơ@4$(@4QPt$0t$0'$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ 0@4; ,@4u3P5 @4P = @4t- @4,@4d 0@4 @4Q0@44 ^_[]hV#\tSWV|$t$@4(@4QPWVx&tH 1P1 t^_[WVhV# tV@4tR 0@4~% @446T ;5 @4s@4PT 5 @4T 1 @4@4^SWV\$t$s sǃuG=@4tfL$%!=@t."RQhmv%t s s=8?4tfhZX#@4@4{@t1H1PPQQsHsDs sq SW=\@4t6hhHA4W -hV#荠u7=8?4{놹 @4s s?4H ?4^_[WV|$t$ WVhV# C@495@40WVhV#==\@4RMT$=@4HRPZ9L$0ơ@4@0 T$D$=\@4D$0T$T$4=@4t$$t RPZMt$t$$=@4tȋMD(@4@0T$,‹t$(΃=\@4@4t+tMVRYuVFt$t$ Y7KVRYMQ AD$:MQqD$T$AQ!EL$DT=@4t1ҋ @4q0RP| ƋL$ jWSQӃ=\@4D$ t7~SPt$t$$_NjT=@4t RPX|$)~SPt$t$$(=@4tȋ|$1҉\$$ t/f @4q0RPُ xËD$L$ L$0|á@4@0 T$ʋL$ȃ=\@4L$0T$D$t!D$4=@4t)PQXD$ T$8=@4t@ɉL$ D$ Y#WS9 K;D$=F4D$te^_[] PhX#j|PhY\#hN1 jUSWVP׉΋\$t$US8 M9t 9u^_[]WVhXY#jUSWV Ӊ58?4QW=0?4t=8?4t hoY#X1SW[u=8?4hyY#Xx@4=8?4u<@4PhY#{XCWt hY#eXhY#XXV=@4t>=8?4t hY#X=X@4t hZ#Xh$Z#X/=8?4u hHZ#WX=8?4u hfZ#W3=8?4u hZ#W6=8?4u hZ#W<=4@4t=8?4u hZ#WT @4|$Y8֋T$  SP5@45@45@45@4hZ#Wd,$kdы@4@DWSQP̽D$T$iщډWSUR葽jj RPRPt$t$t$t$t$VD$Ph[#$=0?4 @4+@4 @4@4 @4@4 @4 tQPh>[# =0?4-@4KC)s, @4-@4Ջs4HS8\$ ډD$$+@4$T$@4 $ $ډ Љ @4@4tRQhR[# =@4t8hg[#5@4tvvh[# 6j =@4t8h[#v5@4tvvh[#Y 6j k15@45@45@495h@4tmj @4405?4h QV9^ 5 @4Vƍ=@4t?4PPҞ5?4z?4=t@4t ?4j @4y,t+@@41TtR3 @@4 @4F;q,r@@4P3 @@4=x@4t =t@4th[#SF41=h@4=8?4u h[#S=t@4t h \#SGRtgD$Phe]%2]u1D$t)L$ jQPhe]%h%t-=8?4u h@\#S  ^_[]1USWV@4D$45@4~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B @4l$9؉|5@4|$0G;~,$LHN4H~KT$މ)1@ @49׋T$9|5@41҉t$L1F7 @4@4@4@49S,SދD$4HxL$HD$81ۋjV @4ׁ\Tډ\$tQ!QЃQ SPh?4A@45?4|$D$Xt1NPSWUWʼnFظ|߃\$ <$w4F\@4<$t LX FuWBsT$ @4@4$@=@4tfL$fAf|$l$$j  hX @4@4T$ =0?4t| $=@4t RP>RPh^#l=0?4gq$ʋT=@4t RP>WURPVh|^#($DX=@4tPh^#d?4h^#Eh]#brT$ '|$@@u' T$t$SUt$A @4t$D$, F=\@4=P@4$@=@4tffu$@=@4tfft}SU{$@=@4t?f=@4t/ȃ=@4 $ApfAAt$f=@4t $ApfAA $AtfA1ɉ \B4 XB4 TB4 PB4l$T\$X\@4pt4$9 @4t ʡ\@4 @4$tt4$tʡ\@4 @41ɉ$dtX$t $D$LPt$衹=\@4=`@4t=(?4u,$$@\=@4tȅSUh^#C h _#(p~SUؾ19 @4t1ɉH\H`HdHhHl$f!B=`@4,$(E\=@4tȅƄ$E\=@4tȋ @4I0H111҉,$L$ D$t ߋ @4Y8Om\=@4t͋ @4#8߉@DYL!!ÊIT u,$\$lD`Td t<=@4t RP:D$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9@4H4 D$|$׉D$|$=\@4t݋AQ=@4t-RP?:!Eh=@4tȋt$|$1҉11 ˉl$$WVRPSUh5_#uA=8?4th_#Vh#e#m|$t;SU蕼ƃ=\@4D$|t1$=@4t RP9FV?4=@4tȉFhܽ$|$jj$$$$SU z $A`Id=@4tEQP 9 $plph81$D=@4tWUPVhV^#  $AhQl D\$C5@4;^,T$$L$ LB4HB4׃ƃ=HB45LB4 @49˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-@@4t$| ؋T$(tu3D$1 Kl$@؃,Ut$H ƋD$9\$(s+l$ Uh"]#>jSWUt$@hF]#h^#m=jWsUSWV |$ ow@u Xw VUp D$t|VUhe#w wTB4 PB4ʃǃPB4=TB4|$ |:w whs]#= =8?4h]#mjG $D$|$tjVU¾ @4<)1CVUhc#D$,p p*\B4 XB4ʃǃXB4=\B4 j 7 hp @4tH@4 @49tDy1Y1 t 9u,@4@4$|$ ,@4@4Q1I1 ы|$ t@4$G0W4L$Aڃ]D$ p ph]#J< =8?4t)h_#P1C+?4h]#;h]#h1Ct ؃ ^_[]?4jpj:fUSWVP$T$1B@BI @4`B4@4x,11=@4t>Q:@4x,$kd1PWSQh_#hN1@4@41ۃVU聶tzljl$ t$\@4pt=@4tʡ\@4 @41ɉT$HtttȉD$LVUz8tD$PWbu(C@4;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$`B4ŅtTM1ًU1 u3VShc#w w`B4HPUMpX`B4 @49tmu1 @4ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $O#h `#F9h/T#eh`#ejj聴=\@4@4f@=@4fh_#8h1T#aeU1hPVPVҜ1Bh_#8h/T##et21VWhVWVW莜1 tah_#+7?4h]#du<tf@=@4tf @f=T@4tjjxfh| j50@45 @4UT$1B@B - @40@4  $@4$Wt>E6+5 @4=0@4kdPWVQhA`#hN1@4uF$hd`#vv 躑 @4A1ڍF$h`#cvv 6ǃ=\@4F$ @4&jP2/1 @4I F NQPQPhSt=X@4F$ @4t%QjPSht#hx`#>6#?4QjPSht#hx`#36=8?4thU#J=8?41F$@4 I1)щN$uhS#b-vv *ǃ=\@4F$ @4$Wt jP#.1҉GW1҉GW }hjD$\PƑ =\@4@4D$tt7fD$T@jv$--fD$T@jv$-fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=\@4$tD$\=@4tL$Lu$D$PD$PD$XPy@4;,$/?4$W=@4v@45 @4;4$]|$T{$AhjW規 -\@4=@4tt0fD$T@js$+&tPfD$T@js$+FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=\@4$|$TtD$\=@4tD$L$|$TtD$\D$PD$PW٧;4$= @4;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h`#ss QPTh`#$^t~s sqf@fNCKK CQPhu,"ss oOCK =0?4th`#ss QPCKhu,"QPss fN ?4;<$= @40@44~^1ۋ/uu p]]8u9rۋ= @4/CK tS  StQP HKX9rjj轄`^_[]?4j"ejPh%`#/L$D$@, +A,USWV $0 n8$=\@4ui=P@4t`E=@4tȅtNE=@4t$;@4@4s&E=@4tjPo@E$F0N4 utEh0m%P菘)$0 F=@4tȍL$A=T@4AAhh0m%QT T@4 @4tD$D$L$L$D$ha#v v薉 E=@4tfM9v%}EPha#.Ca#ha#0[4/E=@4f)=@4f=@4fEtf=@4t΋$0 AI 1 h`#QP辈 h`#Z$0 F=@4tȉE$a#PlZEL$fAWQUf7 $)fEPUVD7 =@4tfD$fXWPU$7 $0 G0W4w wmfH$X?4$0 =T@4t>}t8h`#v v贇 h`#Yu EB?4F0N411G9 v vGD$@=@4tȍL$A=T@4AAhhu,"Q諊 @4 T@4 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=@4t2f)=@4t%ffD$=@4ff@4 )fD$1fM$0 A0Q4MT$ tjQkfHD$=@4tfPjUև D$fEutEhu,"Pul$L$Aq $0 JR ωtljhla#RQUW݅l$EMك9v%}EPha#*a#hya#mWD$$0 T$ 3F0V4=0?4hb#N?ڃD$=@4t΋D$p@ =T@4X}$0 ~hTa#v vڄ Eh`#VJ?4Bya#$0 1GPVtXD$T$ F0V4=0?4hb#>ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV2 D$fXSPU2 E$t'$0 G0W4jPAifH1G9$0 .1L$AA EL$fARQU2 $EtMw\}.uVV4~0|Juha# } .u8ha#v v% Eh`#U4$F0V4=@4tȋ @49@4s5ha#juv v݂ha#T4$=T@4E=@4tȃu}uE=@4tȃtb}u\FN U=@4tʋ4$ha#jRQPX=@4t}Eh`#T1 @4EtjP|gC$0 A4y0 b#$0 t=8?4b#=X@4JR u=@4tPjVRQ菁ha#_SƋE=@4tjP1Ƀ=@4t f@41ہ@€@t f @4fG?44$Crv $0 A4y0AI U=@4tʋ4$h_#jRQP褀ha#tR?4zE=@4tjP)Ë@ C$0 A4y0AI $QPQPhRcE=@4l$\$tȋM=@4t1퍜$UQUPhScSh3b#$"Ph)b# %9-8?4thb#9l$\$ ha#vQƃl$\$$0 A4y0| AI KC=T@4taEO9tU$0 AI U=@4th[b#jRQP%GEh`#Pu $ ?4fO4$E  ^_[]ËM PShjb#"ȃ=@4tUSWVT 0@4 @4,=@4t>)"=0@4kdPWVQhb#hN1@4}ww cO W $T$ WGO ƀÄ:1=8?4t4=x@4t+=X@4t"uGO 1F9ƺw1 tbQPc8uS=@4xJ1v6KNj@ $GD$wOG tQPb8u E;-@4|E;-@4=4$hb#b"hS#ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$D\@4pt =@4t ɡ\@4-@4L$Ltt tȉ݉D$PD$PRmu hb#!D$TPv6t$t$~tyD$ _ v6ΜL$QPt4t$t$af@jw wt$t$~t >4>41JQPBafp @49)T^_[]fUSWVT1ۍT$1BS @4x,@=@4t;@4p,kd1PVSQhc#hN1@4@4 @@4<\$11ۃVU衛VUi`$t$l$ \@4pt<=@4tϋ \@4@41҉|$Ltt<8tϋ \@4@41҉|$PdtX 8Džtɋ$L$HQ$O#xtCVUztV=0?4VUh9c#^1=\@4L L tOjhc#s@4tuQ1y1 t6 u_VUUdtl=0?4tHVUhcc#l7jhc#$PxyQ @4PsjhjS#D$P C@@4L$;JWD$ P?4\@4tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$WS9:jS.:e0^_[USWV$d@4p@4= ?4$HPV9=?4u6#$P= t#Vh/!oh]#)jV l@4R=4?4<$8p@4=8?4t hg#Vh+g#茞pB41h@4>4>4?41I t?4 p?4?4?4 ?4 ?4?4 USN ƣ?4US= ǣ@4US, ã?4UP @4WOG?$V$SYd ?4tdu`jV  ?4Jc0 PVhf#c0q PVhg#Z 1Ĕ^_[]ál@4u"$T$LQRjPVDt|$T=H@4=D@41A5]Džt<$@4\Tu nt1@4!=8?4pB4hph#jV跇 p@48?4 pB4Vh=g#K1= ?4=8?4=?4D$xL$ PQj5l@4SCuSho#g$$(ffs1$(j hl#Vɏ VSho# EVh| #?40u hh# k@4 h P5?4 5 @45?42=@4t?4PP%C5?4,?41=0?4t@4Phh#@4tZ|@4u6t2=pB4u!=8?4h#t0s"Phh#71OE 8?4uhh#@48< @4@4B,@4@4J0T$RtI,T$T$ ,$ȋl$L$ ݋,$߉Nu݉|$,$ \@4,?4u@,$\$D$=8?4hi#B,$\$`L$(l$85?4F4$*T$ l$\T$11|1ۉ‰CwD$FD$ FD$nV8<8D$ D@4|$T$D$DSho#hDi#"h@41XǀPh P5?4 5 @45?4R/95@4t?4PP_@5?4f?4 \@4,?4 @4=8?4thei# Sho#hi#"@4PP.=@41@L1XP\hhPkQ h @4W66h 5@45?4 5 @45?4,.95@4t?4PP9?5?4@?4@4 Phi#xhV#!ud@4  h P5?4  5 @45?4-=@4t?4PP>5?4?4@4hi#hi# ud@4ǀh P5?4v 5 @45?4,=@4t?4PP >5?4?4@4@ <:p#J$T$tj hl#Pbx ?4Shep#Shp#$D$0|1MƉ‰w1MPt͋D$,L$H14$ I1)щL$t$L$1t$$jQWt$ H׉σQRWPGhig# 1t$tT1$|$Tt !L$D$ u ?417F9t$uh0h#hh#hg#hg#hg#hg#hg#hm#c=8?4thp# =8?4uhm# t/Gf~?4f@5?42 ?4fA?4fFV1fF ?4If9PQhm# =8?4th_#t=8?4uh#e#5 tK?4f@5?4}1 ?4fA?4,5 ?4hNh#]$?4@fF?4?41Ʌ  @4=0?4tQPhl#u @4!u#18@44@4f>@4<@4@0p9wAu <@41Jf>@4=0?4t QVPhl#<@4SW获ƣ4@4SW}8@4t Uhm#?4jyhDg#USWVϋ ?4tWh US5?45l@41l$-?41J 0n# <$XP#D@4QP\P#VmDh T$RP5?45l@4u-?4tu $Cn##<$=|@4tW=8?4=4?4?4=t=uhn#hn# uhn#=@4t hn#=|@4t?4PP'h 5?45@4A =@4t5@45?4& @4\=8 u`@4ǁ\TT1=T \@4U-@4Eh= |n#1^_[]ÉD$<$ D@4D$ t$΋E4Md1CD@4QPVt$Bt?4p?4x?4 = ?4h @45@4=|@4u=$?4u =(?4t_h 5@45?4 5 @45?4=@4t?4PP%5?4?4?4d@4M,I\Ttu!MȃMt$VPh?4* 1=?4=|@4t?4PP$@4ph5?45@4 =@4t5@45?4$@4\8 u ǀ\T5?45@45@4o=0?4tVhp#@4{hr;ߋ-@4ދM9t+@4QPRho##|9rҋ $Eo#1ChYn#hxn#jnD$ `@4 $?4t(\TtTu 88 \=(?4t(\8 t 8uTT\ËD$L$=\@4P;QP ;Q P;QP;QP,;Q,P0;Q0P4;Q4P8;Q8PH;QHu|PL;QLutPP;QPulPT;QTudP`;Q`u\Pd;QduTPh;QhuLPt;QtuDPx;Qxu<;u.;u ;u\1;\1@À L~.PQWV|$t$ FGF G FXGXFP^_[]USWVTt$xl$tL$p|$lȃ u D$|uWhe]%mUQ=I4uR<sJI41\$|11 ʍT$ ٰBPVQ D>/|)Ot$L$6I42I4$!D$h8JI4$ D$tB?JL$h)PRQSWVD$t$ @495@4r==@@4 @4jSPV)޹0094v t^_[PVhr#GWV|$ wu$`P#1XD$@uPw w Phs@$.=8?4ths#hr#t ^_Phr#躽@4USWV$\TM@$ 5uh`贍h`VP! =0?4t hs#=|@41ۃL뀃=@4t\,L$UPQ DPP~$\, @4L$L$UPQ |$u $PPD1LDffLD@9u=@4t8PP\@4L$UQP. t"PP\L$UQP  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h s#,USWV\$t$=>@4!ߋ,t9Xt6@u|$t&jFt1ɉH HHXh1^_[]h1s#ĺVD$ L$5>@4#p9tыR9u @^USWVt$|$VW/@4!t7^Fu+11 33 1u{ 4@4tqt$0|$,\$(l$$T$I4t9PtjRQ I4(Xxp L$ I4t9HtjQ58@4 I4(Xxp ^_[]WV @41!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$R#$1Aȋ$sY9UP#> ƅxc1GD$ PhFV   8u;V> Whht#jSVQjjS= Gy D$t P谏<$t t$bc1Ox V> e^_[]D$(%= tn=@u$0ShZt#hPPS%cƉ\$1@$D$:\$ D$ PSB$D$jS< }tStN$PhF|@V^  x4D$t P襎U$$JhF V $USWVP1hUU= ƉRP*9-@4t1@fC}+PUUS'G @4;A0u $ytWVD^_[]Ë\$-<@45@4SUqRPX$@ `@4ؔؐh P5?4请 5 @45?47=@4t?4PPC5?4J?4[USWVt$(~Ohol@4tUQՉ 1=\@4L$$t| tWVۥƉt$$H$á@4@05@4QPWVsUC cMhml=@4tUQxՋt$( }@4@0ˉ9Éʉ\$4$rQPUt$]LPDTGlOh|$ wL$,=@4tȋ|$@4#t$,|$ DpLtKTCP|$tUt$?D$Dplt $A T$(B 19tahtt#o?41^_[]Éht#4USWV0t$D$t{#if#tnf# <@41EL$ D$ @4T$$ QPH-1$S#@4Shu#貪1@4%=@4tfL$1QRRPC @4;A0D$x@8@4^FtF^9.x9"׊P:<@4@L$ f@4Sht#é) @4SPhRu#蛩1G=8?4thZX#@hV#6t @4>@41ɉShu#(=8?4thU#нhS#t$" @4QP%$T$1RQQD$PaAá@4;X0t$~~1Ƀ=\@4T$DT =@4|$t RPL$ pL$QSRP6ǍP^wI4$|$1D$D$t1)ÉعF@jPD`r9w<$r$l$T1C @<$9uG<$;|$}@4X0l$ot$|$oh\$ىhY PU -l$($|$ t$ t31T$phY WP $@$9|$|$|$(1L$t1ɡ@4@0)ȃ`T$1ۡI4ـ#hu#蒦=8?4thp#:h`# ع`֋,$L$t1ɉȉD$ օt$ tH @4i0T$,RQUt$> @4;A0l$,} $L$l$l$,@4@0D$Mt$ |1TT1PD$T$ ʃ=@4t RPL$(ωQM D$H 9tet$C9\$t$$hu#D ?44$F4$;t$SD$`1?40^_[]ËL$ ʋ @4f9u Shxu#ԤD$`,t$$hu#蜤j @ @4Ph"u#sUSWVT$L$D$0(D$ X=@4tSUڜʼnӉ OD$$@4@09ʼn} t$t$5D$PSUt$< @4;A0 t$~QPSUYJ~t$4SUWt$T$LtL$A L$ Q5@4t9RPt$ƉT$ t$1ӋT$1 t<$G RQD11 u5\$$9t ;D$t`GPD$ GPWTt RP趛$<$G L$;L$t9ta щʼn$;D$t`1h|v#^_[]USWV <@4$@4x0UWt$0t$0虥Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PRE I4T$4$1B srl$,$ ȈU1wX=@4t >@4!9GX=@4tȋL$,1Phv#ʡ I4L$ $  hv#詡=8?4thp#Qh`#t$D$OPWTP1GTGP^_[]?41USWV|$,if#tnf#<@41@$@4sll$4@4t8@4 L$ =ƍD$1PQQV{9 @4;A0-T$zu D$`1]l$z$Ń1EGpD$hR] D$ Pt$ u&xMt(T$hR] D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWhu#=8?4thw#詴h/v#qt3s ss3st$Vn[E;,$u?4$t{#Phu#`j:USWV0\$T|$HOX=@4t1D$,D$(D$$D$ D$D$PL$Qs tPs+t$OG@4҉L$D$td$PQlÉ׋n11 D$HpG8QhNw#c:OSwe^_[]É1 ЋD$ I4uL$SwRSKWt$8Pt$ t$q1Ƌy 1 t $B8HB8tQPQQIsC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u$3D$<3L$8 OE81H"hy#ܧPhx#|5O4$VIVhx#hy#h hw#_hx#h}x#h hsx#hbx#h|WVt$ F,t@I4thy#KF,Pr1~,>d9~8uv0q^_hx#hx#h hw#_D$x,u@Pt Pqqhw#hw#h hw#^WV΋I01t*N8~2IN8tPQP PtqN0G;~4vɃ~8u^_hx#hx#h hw#h^hx#hx#h USWVEH1BT$x,1h`1MA04$4tOF~|$ D$ڍD$P|$Weu$v vu WS}u 6Mu1NjM4$F;q4vSpe^_[]hw#hx#h$ hw#]USWVP΋I1H$ЅD$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]h>y#hy#h3 hw#{\USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]hw#h$x#h> h:x#h$x#h? hw#[USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]hw#hPx#hO h:x#hPx#hQ hw#[USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]h>y#h+y#hf hw#_ZfUSWV\$$|$ l$t$I4t5p@4SWUhy#/USWV5p@471^_[]USWV\$$|$ l$t$I4t5l@4SWUhy#/USWV5l@4C1^_[]V=4?4th)z#2j5I4Gtah^z#赌h]#WtSI4xL~61 I4 s"@Pt4h~z#. I4I4F;pL|^5I4vj'I4t'x,tPI4PI4áI4t x,tt$t$t$t$P1WVt$|$ VWJ=\@4dtX=@4ts,@4`uau33 u1@1^_WV 0?4t1 I4 @41!`u/aʀs2hlpx1Phz#Phz#h]#蓷Jhz#@4 ǀdƀah P5?4c 5 @45?4=@4t?4PP5?4?4@4!1111QWRPjhI4hhz#h]#赶lhz# @4 ǀdh P5?4茓 5 @45?4=@4t?4PP 5?4'?4 @4dPs+aʀu Phz#Ph7{#)h]#˵h{#!@4ǀdƀah P5?4襒 5 @45?4-=@4t?4PP95?4@?4^_j$USWV1L$ AL$HAL$@AL$<L$ p#L$A l#Ah#Ad#}u ]hډ#WV C k~lt$tu4D$PS\,buD$HPS3# D$ PS$t9PD$DPD$DPD$,PS(uh<0jƉe^_[]95H1ujhd#D$P u1PPD$Pjb95H1t$Dt$Djt$0t$0Sp(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQۈRPt$8t$@t$8t$@WA1u2hS#R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQt ]S5rt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ St$\D$Ph""hVV\D$@w ww7VPh#S 1h?#+h#WfUSWV1L$(AL$$t$@L$ D$ }] h#WS? aLuKVbtit'cD$ Pu D$(Pu  D$$PuY udt AuZD$ 9H1u~]#@1غ$Phzd@ tN|$$tOhT0j1t$ bt$@b1Oe^_[]hT0j11J$THPT$,L$(HL$x1VVVVV]P-T$4 @T$ƋD$(D$8D$,D$4D$$D$# hk#h#V1^USWVPD$@ xTxPl$ 1һt-$m 1K1D513P{#F9uӋl$ $t$XX@X t#1J1<013P{#F9uҋt$Pt$VatUVR1u##PV1H^_[]ËD$P ËD$ P SWV|$ËL$T$D$@f@@f@փ|fp fx^_[ËL$D$@ @TD$ A ËD$@ @TD$A ËD$ @ @TD$A USWVD$ t$hx t11t0Vhk"hN1DD$4C9uNPh#S؏#D$ t " ؏# "$L$Ru0QSh#hN1 D$<r31F4$t0t$h "Sh#hN1 D$@ F9u1H^_[]ËD$j$,(USWV|$(jW+ujWth #W1Nڃ^_[]1VVVjW0 tSӉ$Ճ$ՋD$49L$0t$,s,11Ʌ,Eȉ h=#s,$ʃЃ,$9Չ|ˉ$|$(Wyxt hX#'HP ,$9|ډȃ u hv#$jjjW>$\$S@jPjt$ t$jjW X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWBl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQP@BE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W@ t $p q  H @AQ@A$Q @QHALh#StQ1@PVSjPt$8t$8WJ E1u>4$h#W VDShے#W4$h#W 1H^_[]UWV} uOʃh:|RQPh#VJPRx& $T$W1ٹ|$5h:h# 5h:h!V5 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhd#Vp 1OujV5h:<uW?,VQ>~Ih##Q1$VQ7 t1Ph5#Qi 1O^_SWVP|$1N?u;j S5h:?5 8u1u5h:h!t$ ^_[WV|$1N?t5h:n1t^_h#t$USWV 1O1;B։ˍD$ j P5h:6 уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5h:x(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$P.D$Ps,jhd#t$U$ tjVt$;$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0whN#V;z1t^_[]1;BB  Fjhd#Pe 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0h^#Wm 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Phh#Q 1HUSWVt$|$ t)l$\$$jWUS7 tWUSh#1h#V*l$(\$$jWUS tWUShޑ#V1H^_[]Ã|jWUSJa11USWV\$1s3h%5h: t^1W#$tuWh#t$ 1N## Ch%jD Džu^_[]WV|$ ##Wh.#u^_USWV\$l$t$Uh "V蛻 #!؋##L$ t*> "t"UPVz U#Vz u^_[]USWV \$ |$$tl$4|$0L$,D$( uh<#S 1N ^_[]S1Nt@PL$$9sPQhK#SɍQD$@ XT$ډL$Y jhd#S ׋C0!K4!T$, ыT$( ЉC0K4t$t$ D$(Po K H $YTL$ Q #|0#l4 l$, |$(|0l4|$ QPW" t$$h#W 1t$$hj#t$( WV|$jhd#W$ 1Nu.W5h:~4t5h:h#t$ 1^_USWVl$$\$ |$t$jj h "USjV yD$USWhӒ#|$tVhj$j  ^_[]ÐWVH1;$$,(h#^ $h#"j$,(~RPh# h#:ojV p FQPh# v,v(h0# v4v0hD# F8Ph""hW1WhW#ovPhi#_1$h0jĈh#n1HĀ^_fUSWVD$ $t|$$L$|$t$,t$4RQL$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh#P%1D$Bh# D$_$ӃD$DL$H(X,EPt$@E X,L$H(ux4$t$w7t$Hh#uU1fUSWVPM(,|$8O] D$1h3#uS sujsWVVuutqD$9H11t$ 0N1H 0N1$~(N1H (N1 h(N1j 7C8jm$Wj$P譵Wh#hA#C0K4 tQPh$PPhz#D}vDh(N1j ߾V#h% Vd hy# VP h#DW&1+\#w7] Vw w V0N1H 0N1;@N1h(N1j (N1H (N1 0N1H 0N1;@N1h(N1j (N1H (N1 GtPhL#p h>!a0N1H 0N1;@N1h(N1j h(N1H (N1 0N1H 0N1;@N1h(N1j ,(N1H (N1 $Ow7w  0N1H 0N1~(N1H (N1 h(N1j kEF $Sh#{$1۹.#v6S $<$#v vS \$Whs@$PSj$ Wh""PVNVS褖uhh&S蝋 VSh4# GPh""hVVh#G8$jmVj$P_Vh6#hb#G0O4 t#$QPhR\P\$hz#A1@USWV$$$#ho# Ft hv#h#F ~1ɋӉ13$ @uhĠ#Mh#Fh#?Qh#Ĉ $t hv#~h# h#h#cĄh#LuhusuqVh#oh#&uuulh۠#۠#t "PRh4%Č;8jmWj$V芰Vh""hWWho%#Ā^_[]USWV΋\$$|$ ʉl$͍L$jj h "UPjQz yD$SWVhC#C|$tUhj$.j D ^_[]USWVDt$`l$\\$XT$1 p#G l#Gh#Gd#B0#h#VUF Tt$t7ltytdPD$PS uNtWShu1HVt2jhd#W t9-H1uWh D$PS h0j賿h&1D^_[]ËD$L$Q P QPIHÐUSWV(]1L$L$AL$A} uh/#SWI a~bt)iuRt7D$PV"uUt$D$PVtD$PVFuh0je^_[]Ãluh&"1u΋D$ |$|HV"t;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=H1d1t$t$PPt$V3UfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ A Vh^#C D$e D$$$Fm~ 1B$e KƋ $Qh#Vy "Wh""h$SSh&V Wh""h$SaSh#V wwh%V wwh=$V w$w hk!V g(jmD$Pj$W_|$tD$PhW$VW 0Vt$2 $B$$L$ AA H9t$hT#t$^ t$hf#t$A t$ v5t$9r t$H h#Uehߋ!UPV[q(N1tlS*ah0j V(H h#$1OSt$H 1Ot$G 6h(N1VpVJ1*Uh#$ | V(t$G ^_[]ÅtVG h2#hЦ#h hn#hJ#hh##h#hh#fUSWV]} #D$D$ ho#SW iu5h:tFumD$ D$9=H1uUj]$,(芁ǃD$T$ЃD$,jSt%D$t6hs#h0j@jS D$ tjSmtD$t h#w@h#V#tQ's "hH#Pf )j$P[ h^#Ve h #D$ Pe jhPN\ D$0Ph7#t$ D$0$L$ 11t$ L$ D$Ph#t$ bD$\Pt$ tpt$h#S 1O1PwVE 0h#h#SШVD hצ#S质t$D ֋D$+D$ L$,D$D$@L$$L$ D$HPh=$V# D$TL$ 9L$PD$LL$9L$HD$$4$K =4$K D$ @M$PF$t1PPPE\r!ƒE$|$ 1]Qt$ ;$F;t$ ukh#S軦1Oe^_[]h,#uj-t$h#u苦 hX#h#uo1O1t$b]D$L$$jQPq!ƒBD$;D$w6E$t$Pt$] ;$F;t$vh#t$b hn&Pa P| hPt$-r hT#Va P. D$(vt$(I ËD$1AL$D$D$4|L$L$4|D$D$lPh#S9 P|$l$Phc!S ($Ph{#S $Ph#S $Ph#Sn $48Vh&SK $Ph#S* $Ph#S `$Ph#S ?$Phå#S $Phѥ#S >u$L$4fL$fB$Ph#S $Ph#St t$(G Åt$(G $fǀU1PPPEhn!ƒ[u$t$ ;$4t$8芉 D$t$F fËt$01 |$lD$Ph&St D$lPt$[D$Ph#S@ D$|Pt$'$Ph%S `$Ph=$S{ B$Phk!S] $D$PhW$S tj$$Pt$ ח D$DPh#S D$D9M$ $ȃhL$pQPm t$E Åt$E U$61QQPyl!ƒ~t$ M$$VP 9U]$|$$D$jRPl!ƒ=M$$VPĜ 9E$1SP|$Wl GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$Fljh#MT$0L$4 tH)Љ|M1KIs8/$;/s81$;tyh#Ejh#Ph8%جh#ˬL$(D$, t )|1h#覬Wh8%蔬$;|$tv vSj 莫6D$1P3-@ ^_[]h#h# h#h)&ji USWV $Sh`#U7f Ǿ#󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAH0qL1ATAPAXkiA\#A`i AdѾ#Ah!i Al#Ap Q$0$0 ^_[]ËL$L$ USWVuE X8D$Ph#Vs |$V V &C 1Љً&L$I$1 sD$P%D$D$ t2t$ ^ {uWvpu{u C $\$uoh#D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$ [ E0t!t+M4S9rQSPZ 0t,h-# MHtU4uL9rRQPZ t$|$t%u@uhVMY tIf81tSul|$tDEM9rQWPvZ u@u`VY u@yu@u`VX teEptUt$8ЃtEu8uXVX t, ^_[]h#h#Ah#h#5h#h#)u\u\hC#udSh#j貒 wlhs@$jӒ fUSWVt$sF 1tvt$G t[S01 tCPR Vt$"J tPUWCK uW( S-1 1S 1 W7F ^_[]USWVu]Ph#S t$f1j?1Nt}ǍD$ Ph+$S! td\$ t\hjD$PaX jS\$Sa ShiW2W t$E L$Uf jQh#P^ je^_[]PPh+$t$ u1$YVPt$ t$t$V tPh+$V` u1$^USWVt$t$G t Nj\$ PIb 9vc? c1N*Ƌl$WIb VPUW )SjU>W ^_[]USWVt$t$G t?Nj\$ Pa 9s9Ƌl$Wa VPUBW )SjUV c c?1N^_[]UPht!u t$b1H]USWV@uPhJ#V ] h#V>F tP1a |$ P\$$ShiV\@ |$ jSw_ Ph#u $H V% ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP_ t!Ph#SG Vn% 1He^_[]h%h#hhS#WV|$$h#W>E t;P_ u1V!` jPVsU VhiWQ? t^_h#h#jVhS#`h#jD VI4h0V V I4hgV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh#hV>tVhE#RV`FߋD$t$j7QPh#hV`>tVhZ# V_F߁^UVuPhg#V t3$L$ AQhiV= u hn#W21e^]h%hb#hh#UVuPh#V t3$L$ AQhiVe= u h#11e^]h%h#hh#bUWV}W#ƉPhx-$W tZt4$P<tW@PV\ tGPh1#u D t>V1e^_]h%h#hh#h#h#h# h#h#j荋 hM#t$B tPh1#t$9D HhKs%h,#hh#XWVPt$|$D$PVW t2D$t H^_hH#h#jE hKs%hH#hh#<SWV\$,h#S; t`PjV GWxt\WPh#STtL@xpPhiS5 t5V1W1H^_[h#h #jX h#j| USWV8}D$Ph*#WM u \$Sc1OtjL$D$ x L$, D$0!1҉ƒt$u !L$,T$ !D$0j ST t$Ph#V< D$SU |$Oe^_[]h%hs#hfh#蹺USWVuPh0#Vy tg|$ WhiVO4 t$L$x f D$1H01҉ʉ$T$Hf!D$WhiV4 1؍e^_[]h%hW#h0h#UVuPh7#V t,jt$V 4 1u"h#hs@$)( U1He^]WVPt$V't&ǍD$Pt$V> u Wh#jf P D$L$AËD$L$AËD$L$AËD$L$AËD$ ,0,01ËD$ 40401ËD$ <0<01ËD$ D0D01ËD$H@L0 L01SV\$ ShP0!uCЃ r"CrCr CT01H^[hP0SH?r !T ؈P01ыL$t $O41ÍAЃ r)Aw AwÉS1HUSWV1t$ D$hVPaG H0x,O4t8u^$O4ǁ(O4,O40O44O48O4CNdO4F v/FwD$#iO4Au"hw#1$ī#eO4xu>Wu4D$P1VhVVj V5h:]0 pO49t$:*ƀ$O4l `C Lvms0\0u0gO4hO4rfO4kO4D$P1VhVVj V5h:/ lO49t$taYbO4>cO4OjO4CatTl50+wtz\09t00$ÿx0؉$\0H1 hO4$u =kO4uB=:O4=cO4=bO4u|t =kO4u =3O4uftu^kO4uS$ttH)ŋ$L$ T$ RQL$QWPU%u. u&hJ!h#,5h:h0&jZ| t$PD$P & u h#D$t,DtVPyDžuhJ!h#JW WtS)uhJ!h#WuhJ!h#H0t H9t@hJ!h#$@ uh>#hJ!h*h#襲VWЃ Wj USWV7 0- uhg#h#jK{ ƸP0jmP " "t#jLP0Pt#USWhm#hN1諉@0t VSm##u "WWWWWQWh!#hN1e$V, jRV H01tT$q9t Iu^WVΉhjWA D$Ph#V tZhA$V0 tQPK L$PyRPQA WhiV* u h#bĔ^_hKs%h|#hh#ݰWV h#QK0 t;P K  u1W.K j PW@ Whui V^* t ^_h}#hp#hih#jh#jNy hI#T1ÃD$ 1ɉJJJ JJ BRhiP) t1h#jx $1ɉJJRhiP) u 1Đh#jx QhP0+USWV΅t R<, R* K* 0($D$PN!\$D$1t$$tsVKsD$tVPoKVh+$W trC=eO4D$uCt\=fO4uCuM=jO4uCt>=iO4uLhj$V@> VhiWn( t!$uۋt$$4u=hO4t ~ j 1h(N1s6Wt& H0ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPh#h$VYVUha#J jl$U$V# Vhit$; t$,$t!Ph#Vhn#,$jt$Vή Vh~it$; t$tPh#讂j āꍄ$P$$ j:QPh#h$P葲$t'$Uh&#2UGE}uj:$$h#h$P6$t'$Uh8#ׁUGE}u-804$tVWUmuj|$W$V耭 $$ DŽ$@Vhit$V4: u$ hE#L1@Pl$U%jWl$0U 1@D$81D$ƉPV5xO4蜕 ǣtO4V舱1u xO4$h+&#Z1H^_hy%hr#hh#mWVPt$T$h#V tbP8 V8 PW|tIƉPV5xO4 ǣ|O4V1u! xO4$h+&#91H^_USWVt$T$1h#V5 thƋ-xO4P 8 V7 PWt6ƉPWst>V? ݉-xO411H^_[]hy%h~#h2h#-hF"fSWV|$ t81H>t$|$\$jO@ PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V{5 tE$$PwCt/$F ~G F18 7 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP- Ɖ׃с11E9r y78"t$8tg71H^_[];sC| C 9s} =7"WVN t/t$ L$Ps(,tD$$F ^C F16 USWVuD$ tV} ]CtP7h tEC tP7R u/D$ Pht!7蚷 u$D$1$r61Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$Vt|$,$h%WD$'tD$1{tj/t$HtAL$L$4yyyyy D$AAD$ PQt$ t$ ȏtsË|$D$4t'u#D$XPt$D$4D$4D$ PD$8Pt$ t$ WÅuD$ x41ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxrH41X \$TfD$t7|$0j WP t9t1ۉD$=r3"11HD$$P|$1OL$L$D$L$T$PQRh#V覚 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P蚙NjD$fVSP& sD$ t Pʌ4$W/ W迩<4$uM S]s {te|$t^t$Vt$t_@PW~/ WOtNVsE0 ߉Vu ۉt3EF ^C F1Vt$h#h#h#h# h#h#j^ WVt$tVq1r11H^_Vb t3t$L$|$ Pwt΋D$F ~G F1c1 USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'30<$t@1@>0.1-t P 1GG GG/1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7 t+{0t>-uUs/t>Vs/t)u/ .1H^_[]Ís s(CtP7 uCtP7i t1@뿋C$1$#4v6 !6Z P5  v60 tMtk $t$ 4$UQ'1N^_[]h{# h#h#jS WVO4h0VVO4h>VO4h?WVW^_USWV, $@ 1 8dO4t1ۈ$+$*|$hjW4 WhKiVb l$(EPƀ}u jUX $GL$$*SjQhRPUpu jW $L$ $+SjQhUPWfp1f|$0t,L$f|$ 0t,D$ t#L$ T$QUR$6QPh#e_, ^_[]hN1jj7h#jhIit$  t1h\#jYR WVt$ 09tEttJ WVO4h0VVO4hHVO4hHWVW^_VL$jNt*D$ $uth#tRPhR#cV ^hN1jj#ho#SWV׉1B BBfBQt&jh #P. utU1KDHu|$t$1H^_[Wh:iVT 1h%#jH Vt$D$Ph#VX tPhiV t 1^h%h#hNh#h#jH VPt$ D$Ph]r%V t!D$ Pt 1^h%h#h4h#Xh#j$t^hF#D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh#jiE D1Hx^_[]h*#h#jE WV0t$<|$jWh#V萴t8W t7HfJBRhiV t!10^_h#h#Wh#jD h#jD SWVO4hl0VSO4h@0W@VgW^O4hDNV3O4hRWO4hRSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UWF  Whi$ U $!h#)P$HQPۍ\$4|$fGWhiU t$#f|$*u#=cO4t POfD$(WhiU t$#f|$*u#=cO4t PO|$fG WhiU t2D$*=) Ph#OO=cO4t h#7OfD$(IWhiU> t2D$*=) Ph#O=cO4t h#N1Shi8U |$Dh#N1tPDL@uShi8U t$HuM1|TuD@uD$L|CtU1L$P9Dzty:t|$jQh5#? uVh#N11t j,*MDLxPtT h5#Mv<u hs#Mj L$PhiU tDh#M$t$h #xM h"iMj LPhiUk D$tPhiUO t|D$ D$tTD$HT$lfJRţ Ph##L$=tPh-#Lj K$=tPh#L^_[]Phz#j? hN1jhh6#ÃD$1ɉJJ JJ fBRhiPm t1h#jv? 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h#j#? USWV,$@$PhiV tr$A jjj" xgljj2 xi$-hSWm6 xB$/uE$0uf$Ciu.h#1H h,#hF#W17 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h#ha%h#h#hb#h#h#QL$4Qh{#?J(D$f($-D$](E!L$:!PS E P $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q O4t O4EO4tIAtcAtCAtPA tSA@tBAyAAT$hO4UWt$PVt$D$VPRRh#H,l$ }"E!Ê<)\<$#=cO4`Cs|$[VPWl$Ph#h'#`H#<*<0<2=cO4<$#<t#sQhs@$H#1L; "y #QRPh%"GG%9u<]K%C=Ph#hs@$G=cO4S<$CPhK#vGKPhP#`GK s k t?L$D$FW#PWh8%%&G Nl &܋L$D$(Mu} L$D$D$F\#PtPtPu#m# #!QPh8%%F Nl &D$ŋL$D$(ȉ</=cO4%<C<$#0#=cO4CPh#=cO4CKSRQPh#h0#EC~@sFNuQPhD#E IRQPh:#EMuj>Dl$ L=cO4?CPh#eE(sh"#hs@$JE=cO4<$CPhK#(EKPhP#ECk tAt$D$xW#\PVh8%%D Ol &܋D$t$)E}twt$D$p\#ttu#m# #!QPh8%%bD Nl &D$<t$)ƃl$ rPha#$Dj>:C<$€#$##rQ=PuJC<u;h#hs@$C=cO4yCKQPh#C ]=cO4Pȹ#6<"<# # %#;#E#M#U#]#g#l#u#~##h#hs@$B=cO4<$CPh#B1D3 "t#T3 ׃l3 URWPQ̼#h#qBuj>Al$ <##CPCHÃ)gj :AEŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]h#h`#je4 WVD$(1www ww7fWfGfGwWhiQ6 uhU#1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQb ;l$D$tD...Pg^_[]WhT$Q3 1<$tɍGrD$X1.Ph!S E;,$sGwUSWV։ϋ\$Qhs@$%@W)Ǎ 9~)j<?t+~'K1.Ph!?9t OE܄u j->j>>^_[]ø w#ø!øSw#ø!VPt$ D$Ph#Vۃ tD$P^h%h #hh#tiVPt$ D$Ph#V莃 tD$P^h%h#hh#'iWVt$(|$WhiV tND$Ph:#V& tCD$D$WhiV 1uhD#$1H^_h%#j1 h%h5#hh#hfUSWV8$C y h#h'% y h #jh<# Ct\ML$jQP D$tPh%#`jh<#B 0c1 VPhf  VPUSWQRPhf`$1EVRQUhfBVWhg. 1H\$(C CCVWPPUPP P P PPPPS8VSj& |$www wwVWj VWj V( S( Ws( D$ @ )T$VVQRWP蠱1I9u A8tމ5P4 0tщ1@8^_[]h<#j jjC h#C u8 #jV@t#jh$h!#VhV&!h$ j j USWV`~ZD$=P4tIt@ƍD$H@ L$1jQRRjP袰ut$Vh#< 1t$HFFF FF1G>\$SVja l$ UVWR :ƅZ01OjUj t:9uB$=h&#jV%  8uh 09tttn1VSj VD$$Pj 0vh#@jjjA 1VSjo VU6h#1=0u$=|$ u'1VSj7 VWj+ c`^_[]Ét҃t̓ u1Ht$8F FFV# Ph@#u1/#WVo>t<#D$8x xx8WPVP# U&!{jhI#hl#b $SWR* Wh#j VSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[áP4H P4t$Vt$VzPh#ij VU0VPD$$Ht5t$ I?r*$ !P$Ѕuσ^PD$L$ $QPj2 XWV1N=P4tED$@ L$1҉RRQWjPt4$ hn#^_VQ$ jh#" jV" tPTt^Vh#>j2Vh#)jPD$L$ $QPjP !XPD$L$ $QPj1 jZ XÐUSWV$$D$D$D$,do1H$11D$h#WSN f~/P w`1A$T#5h: D$u[FtR=5h:D$,D$낃gh:8#u(@j L$ QPa $D$8Lh:P&[@$)h:8#u)@j L$ QP D$D$8h:L$QPv j D$ P5h: D$D$8c1Fj D$ P5h: $D$85h:h#8H1<= P4u-P4~q5 P41ۋtVP7uJVhs@$4FtPh#o4FtPh#Y4j o3-P4C 9|?,u)É\$(k <D$jt8 D$Pg8 Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0f1ɉQD$ P4b D4D$8u ?8tz`Xt$7 P4u  P4-P4CPVvt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UPt j6 |$tt$ VUWr8  UW 8C|$$8D$@PWWstD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWkBt!t$ VUW7 #|$$tS9u$UW  RW! $D$utSPW uWhv#1ļ^_[]Ë tU1DQu& u h#̶v%#$(\$(SPh0%hWt$W5 8tUWhL#| u8uD$(PUPh#Uj軹USWV ˁD$Pj VL$ Qh#f#+t$1#Gt6t =P4t#H$t"FwPh8%% G!Ņt G (#rt4H$t"U "t#FUQPh#1tKH$t"FPh#Ht 0hs@$ h""t=P4H$t"FstspPh%#D=P4H$t"Phs@$sds`sTsPh7#slshs\sXhS#=P4|Ut$ 1|$$hVPPh!Pt$5u(|$ t!j VatVWhr# hY%΍z"t\#Phs@$]^_[]fWVt$t-t|$ PWtuP44 1P4^_WVD$ 18nuxou P4Pܚt_1,tu@APkGtCƉ8j,W^1Gt@Gj,PD'h !hHE! WW1^_fWVt$ |$7dz WVUSWVx|$x$xl$WVSU$$ejtU3Wh&!8 uWVhK!j D$@t.D$t$xQPh#hVYVjUSWVPl$$|$ \$11U1@`:H1|$hA#SW1 i~jt$ot%r $Ӄet5gu6 $À $VUh`#5h:m=tfP =뙀 $듃u\H1)ǃuPt|$(W4ct$,VVErEL$ 9$Ap^_[]h!j 蚙Ph!hN1j j`WVt$|$ VW_ t ?/t)Wh!MVh!M WhΓ!ݰ^_fWVt$ |$7裱 WVSWV$D$\$VPWS$,$,njS7Vh% u$tu!D$3!t$!j!0{PVt$ hI!jz USWV\$ l$|$t$1E1@`:H1hH!WV/ ou%jSh#5h:{;tEP.;ǃuAH1)ރu4t$$V4Nut$(t;^_[]h!j ɗPh!hN1 jfWVt$|$ VW] t ?/t)Wh!KVh!K WhΓ! ^_fWVt$ |$7ϯ WVUSWV $$l$WVSU$ $ hU3WhD%: uWVhK!j D$@tY$$QPh#hVUV$$$$$h_#wj]USWVMu1} ]hD$ PV D$ FxD$D$D$D$D$hM#WSz- L~)Hw;$l#5h:Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5h:L$1@D$kjuh#5h:8Pk8=N|45h:1@D$5h:Fp1@D$5h:L$ 1@D$H1H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ RTtuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ W׫W@$N|dže^_[]h!j t$hd$軓Ph#hN1 j WVPt$jWV 9u9t x^_Vt$h!je Vt$V7t@^h{#V^Vt$V<t@^h$V|^WVPt$jWV腫 9t9u x^_VhǗ!j WVt$|$ VWX t ?/t)Wh!FVh!F WhΓ!=^_fWVt$ |$7 WV1^_USWVp|$o$o\$WVUS$$jHSuWh0$k uI.8KD$  =|Q4%D$ Vt$S jHSt$D$@D$ $p QPh#hVPD$tS\$O$oj j ShWt$ P"!tPU0Ph0#Et$ SWh@#Bt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@h_#81p^_[]WVhK!j& jSWV\$D$@u+t$ȏt;SP t7VL1 P4CP4C^_[h !j jcUSWVPL$$T$ l$\$1$1T0֍zhJ#US' @~7M$#OӃ23=xQ4|Q4먀'룋 h:DF@N@늋 h:IF(NnOe h:R0KF ?00O' h:aF8N tQ4O h:g\P_D$ p4t$ N @OPt$(h#5h:02Ƌ$t tQ4t'tOt@tO t=xQ4|Q4 s=|Q4xQ4g@tOy 0sg st1A T$ J shD$V/Q4$fyh/B%V/L$ A$I$shu#V/L$ A I$sh{#V/L$ A$I$sh#Vu/L$ Ah#豂=\R4<$=h:h+$WʹudR4G=h:1A#PPjPP01@D$$h:1!PPjPPjPR4mh:1~#PPhPh<hR4P9h:1/#PPhPjtR4 =h:=DR4j:WAj/W.?yHR4h:(#l$0UU݋\$UW|$Pv |R4xR4stU1DH,WwD$h.$W2h&W4R4W LR4N1#PPhPj 0,XR4 tU1DHWvD$<$4R4h#H1=0_=LR4tVh#z5h:h#j5h:h#Zh#Ph!j Why#9Whs$.D$ =PR4u1=TR4@PR4$1󫍄$,BR4@t$($(h8# j$TWhS umSWh "xR41M |R4|$u0$ PW*u1=hR4xR4|R4|$|$0uq=|R4xR4ǻ$TWSP+ t1PShR4PWQ)xǍ$ PWzhR4ht#ZhR4QP5|R45xR4JףxR4|R41҉$$d$h u>$$MljL$$ PW?t$h^#hR4l$Ul$RQP軬 $׉ȉ xR4=|R41| h#$t/$$T$9‰sQt$t$WPh9#tFtA hR4WPU踱 u5|R45xR4t$h|#|$(F=$PUO uRt$h# A#$=`hR4h#1=`R4 $Vh(Mu Vh#al$VjD$PŠ xR4-hR4-|R4݃=PR4~VUWt$h#|>9|Pt$t$ 7 )̓ }4$|#\$l$ (R4,R4ɋ|$  (R4=HR4 |R45xR4σ|,@σ|1ҿ9  hR49|щ (R4|$ D=`R4EjjhR4 .hR4h#(R4=HR4t,R4HR4t&hQh#m HR4,R4t=|hPh]#D =8R4u1=,R41@8R4=pR4u (R4pR4=0,=4R4t#jh#h#h#4R4=lR4u=0,R4lR4t$t$ t$4Ut$$Vt$t 9t VU t UG =TR49$Pt~E^CtƃhU#!Gj &dPh#jd$8Pa j j j he]% V4$hR4xR4ApQtdž,<tx(=HR4dž dž,dž(Ɔ 00u(jh$=\R4-5V4u"jh$X=\R4,5V4 ,R4N0(R4F4Qt$QhH$=\R4w,5V4F4Ht$Phq$=\R4S,5V4F4 hR49}"QPh$ =\R4+,5V4F0=)hPh$ =\R4+5V4F0=|)hPh$e =\R4+5V4F0N49}QPh!$9 =\R4+0R4V4;,R4|QUUUU)ʹ3333!!сis{09\~\{0\\58R4sXș9}%CX=PR4~Qh\$V4sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$ht$=\R4**V4{4$=hR411F9tA uPh$j_ $Kd=|R45xR4 u։<8=0[ WVh$ =\R4)V4<$C4$8=hR4`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPNjs8ƒPVRW)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh$=\R4'tR4tm V4yxH1҉$q1ҋ8$$)$<$$1C$I8$ pR4=V4_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W1C1 t׉Ë$$QPV$$V49s($$$V蓘É׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRP2ƒ$$$$$$׋$$$RPVQ@2$9wȃr$9‹$֋$r‰$$$$$B1WRQPǕË$Ë$ʃQPRS-)ÍC4$$W$$P$Q_1@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQfj$P$$N0@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh$ =\R4 V4B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=0$_|HL!ʉG41SSjhjPSV4N V4I4QSPՆ V4H V4 V4 V4P44Q5V4щ V4`@#HL 9| Hh 0H< 8R4HX lR4H\ 4R4PTXH fǀ$%=V4O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=05O _(HLJ$LR4$$$t!LJ^F=PR4$$߬$$ڌ$!ݔ$ɊOd t1G0 T$D$\$t$ED$\$$2$ V4$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$m$B=V4O0 9| IУV4V4=TR4u\Tu))УV41VVjhjPV V4uV49V4V45V4jP艂 =`R4G|R4 xR41ظ|(RQh$r =\R4|R4 xR45V45hR4~ ș)dہ|4#GuȹC=HR4tL1$PP$$5DR4V1=hR4VhZN hR41u;1$VhjVu  =V45V4h`VWj =XR4tWV5V4x\V4hhPڀ 1@$=PR4h$&9=PR4|o5V4N,I\Tt~!NȃN׊Nd1 t1WPhG#RR$6N19u1H$Whht@P PPftu!ѡPR4t $ Q$=`R4u$|&V4H,$$DŽ$%$ V4I,$1$ DŽ$1h(N1^V4$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hK$6=\R4Y V4j5V4} 5V4FU $F +$^V4$~J`^p=0uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=HR4uFh$ NlK`ڍOȃ$ډFd;v&h-$4=\R4V45V4F $11ہ~U uv`щSAV4$~!ـ1@ V4Il V45V4F=0Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5V4N uҋV4B8H!tk)D4V4B8)Nj5V4$9sE)ȉـ1B~U uv`5V4F$CHu͋V4B8$؋N9ȉ$J`~U uv`щSV4$~!ـ1@ V4Il V45V4F=0Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45V4;Vs2р1@~U uv`5V4F$BɋV4$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$V4H V4V$P V PV~x; V4up=XR4tV4s4PP V4V4@V4Kd15V4s4V4V4 V4q4jPv V45V4{0 9 V4PVQv =XR4tV45V4P5V4g V4y0V4$ryxtG$\%TuCl$AP$ V4Ou$ց\TtQ!QЃyId t15V45V43 5V4\TG~8^xN`1?9'V4+$~0lj$Ɖ$)ى$=V4$%GlV4V49wߋ$9w$V4$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=PR4} $H$$$~A=`R42$=|j.扄$ "t $CPKT$l$hߍ$󥃼$$tA$ȃ=XR4CX$tFDŽ$PQ 18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$" $pthj$Pm V4\T$$i$$ $$$$DŽ$H0$$_$ V4@$D$@L!! $`$h裷 $l$  V4Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h V4@$D$ @L!! $$$胶 $$h$lV4Hd t1$S6j$$V V4$ȔȐG$11F$t =TR4$$=V440=00w4w+_1V4$`SWPj $PjSj =XR4t$W\=dR4tV4ǀ\8 V4=V4x\hhP"j hR4QPtWV=XR4tV4 V4q4PP׸ 5V4HLNd t15V4v4t5V495V4vG=XR4tV4p4VVx 5V4V4@V4=V4Od1Vw45V45V4V4@4P5V4me^_[]ÿWjVi 1=hR4VW\hs,"Bh$:!j&Чj%ɧj(§V4j 豧j誧j'裧j蜧h$Lh$Bj聧jzjsjljej^jWjPjIjBj ;USWV=`R4ua΋\$=TR4thR4V4St$PV 4׋ hR4UPSt$$5V4 9u^_[]s0PWVh$輭j$袦USWV"=`R4΅ V4uV4H4H V4 V4 =hR4;xR4|R4V4;}FWh  #1I!;HtG#P;Pt;H uV9R_1ڍ_5V4P=hR4Wh De^_[]USWV΋L$l$=TR4t=`R4teUjQ;fp׋ hR4SPUt$$5V4茜 9t?@r0!PWVh{$ j"hR4V4UPQ) ^_[]SI`wD$$#1C:Qh$hN1螭 .  [SWV1ۃ=HR4։ SjQ4e =0@fF F)f ^_[USWV Ӊϋ5V4F Nd t15V4G=XR4tV45V4PP跳 V4yU +y/\$|$y1U =V41=U L$D$uq`|$ G`Ӊ $u щw*l$$#р4l$skPh$hN1۫ =V4V4D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah$ h$h$11҉ ^_[]ÉՁ|$U u L$I` L$w$#ʉـ1@BPh3$hN1 8ʍ 6ʍ   1$5V4$~3%)1@ V4Il 5V4V4K=V4Od$sC=0CNdЋT$ t1҉t$VQPRpl{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRlL$|$ щT$ՉD$ȋL$D$VW|$RP"ыt$ʋL$Vt$QRPjk$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45V4;F8|$}X1Bσ) V4yU uI`1@5V4;F8|$|=XR4tV4VPP 5V4F Nd t15V4USWV$΋=V4G Od t15V4=XR4tV45V4PP胮 V4xU t)h$=\R4(V4xU ‹l$(H $t@\$=XR4tV45V4PP =V4G Od t15V4wV4V4HC, $9r%UQhQ$聤 =\R4VV4 $\D$jT$RPQD$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5V4WV4\TudV4jpxt$0t$ $<=XR4WV1L(ɉL(@ u1LXɉLX@ul$V4jpxt$0t$ 蘱 $,;=XR4trUV胪1tttpTtDpC u1Cu) %% $D l$hVU\ % $D9Pl$V4T$5V4p0^_[]j j WV։σ=0ȃ@PQR\ =XR4t'ȉGffF=0u GffF^_fUSWV$8tW9 ƅuWh!j蓔 $$<$4D$Phd@U tg1OVhedAU Z F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uh$t$J 1 Sh)!U CPh:!U C PhF!U| CPhX!Uj CPhl!UX $@D$t P * 1-Uhzd@$<WY t1 VhedAWX hjUY D$ P$4D$, 9L$`L$9u0$S11:e8tx$0hЯ!=8b$11҉ $ƅ*ŰPEj PUZ ^_[]$0h!jF USWV01ۍD$,ShPSu1NtAljSPSWuWۊ uMU D$t$$$Q1e^_[]fWVt$|$ VW t ?/t)Wh!Vh! WhΓ!6^_fUSWV|$$\$(SWt$(t$(ɬ )jj`SW~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVbW 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$Vj$u Vh# V4V4%V4ʼn߃=V4~VWUt$h#|>9|Pt$t$} )σ}4$ V4-V4uU-V4uY5V4=V4V4@19lj| 19ǃ| V4u V4͋5V4=V4V4ˉjURPsW=V4l$ V4uA@19lj$ $t$u hV4h#jPVW Wv|$wext23$2fs3$ Wh4!hV4hr$VhV4h#} 19ǃ} h# V4t$VUt$  U~ t 9t V~ jʊUSWVӉ $W|$j W\$ Sb Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph!1L$8ɉ׉u L$8t 1@׉׉|$l$ W8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h!3QPWUt$t$h0! QPWUt$t$h`! t$t$hͪ!jk WVdN1Ph $V3 1GVWjhܫ!$Vh$BWUSWVu} D$8jP>=Z45Z45V4%UUUU)3333!!щ%i|V4BvV49ttx900T$u hj|$΍Q[4 [45`4 `4VT$ a4a4ډ`4P…Ƅ) a41f1ҁ‰t$$r=V4V4\$9D$a4T$[41t$$ËT$ u׍؉)9H1D$ 1V4 w D$L$ |$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$  t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣV45Z4Z4 0t$ƺQ= a4D$a4D$ a4Z4D$ [4[41 [45[4D$8 [4$[4([4S,[40[44[4N58[4<[4L[4P[4[T[4>f@[4 fB[4D[4 0fH[4\$P$SWdu 93fWhX[4r 5V4|$t"VQMjVhh[4G 1x[4^4[4[4<[4D$L[4 Z4+ [4 1҃r1I15[4~σRVPW5`4H19w+5a4|$OL$)9r΅u L[4f5[45V45a4V÷a4MVjPD GD$AD$ 11L$\$[4[4tnT[4tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& a4@L[4t [4 a4@ a41Ha4L2 a4D1\$;|$t[4)áa4f\0 a4D1 [4u\$fT1 a4T1fD1L$ G;|$tD$ <[4|$11t$Z4[4=V4~i V4 i{5V4Q5V45V4PRuh $B [4 V45[4PQWh $a4@`4 a41QQjhjPQ$a4= 5 a4jPB =V4uoV4 V41 V5V4 1N1Ƀ $Fu  |$1@D$$=V4|>hI$ =V4|(L$ [4 [41PQhG#PP谆D$$6N1=u1HL$HQhht@P@ tPD$J V4tD$ PT$ =V4uD$ D$ D$D$ D$1D$11T$h(N1 =<[4t$tXT[4tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5J[4[41[4 5$a4D$ hhZ4PA 5`4 a4P5a4Vt$@ =[4=[4 a415V4ǡ a4)؉1t$ P =`4Wjh(a4=@ a4H9|$u_Z45[4 [4)ʍZ9s1Gр(a4B9r)(a4VhP? t$ 1Ƀr!11ƃ(a4Cω 9rωp 9ǿs"ˀ(a4CI 9rޡa4L$  a41Ҹ(a4Pt$ 5[4Vj(a4P ? (a4 `4L$)QhP> u1(a4@ ua4L$ D a41Ҿ(a4Vt$# 5`4jV> =a4tb1=a4t 10Ka4F;5a4ra4L$ D a41h(a45`4 G;=a4r=V4t$|\tX=<[4teT[4t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=V4|$T$T$|ʉj.łt$몸 "|$|$t1A xVWha5h$ h$UhN1$c61B c64c6@$c6c6@c6 c6Dc6c6Hc6,c6 (c6 uCءc6k6 c6k6 c6 k6,c6 (c60c6 ؉+c6 c6D$HT$Ll$H0c6+c6D$8D$85($v?|$ D$ fD$l$\$4l$ D$4Ӊ (c6,c6$whHa5 l6l6 (c6,c6m60c6ʚ; (c6,c66eĉ0c611ۋl6l6D$T$ ؋m6 c6D$c6D$c6D$50c6L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05($$t$v (c6,c650c6=m6|$(t$(|$D$ fD$ l$ \$,l$|$,=0c6ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5(c6 ,c6=0c68a5t 1A8a5y7b5 b59}(l6i-@=B'b5@9ul6e^_[]hg$h$j+ @c6Dc6$$߬$c6+Hc6D$`D$`5($D$Dw\$80a5$fDŽ$jhb6jE D$8 4$|$&D$& fD$Bl$B\$Tl$&t$Tj$PDF SD$lD$lPD$,Pj5b55b550a5E <hc6jy b5D$8<BC97)؉D$D$8 T$\$\$A9b6I؉L$A $c6Iff9u4c6c6c6 c6c6c6c6c6 c6uc6c6 c6c6c6c6Lc68a5 1D$18 8l1A h$,hN1A8a5<1A t$, PVh$>Y ΍T$(jt$>Ph$YD$ 8a5t$؉T$΍T$(jt$F$$h!$΍T$(jt$Jh$bX΍T$(jt$bF$$h$΍T$(jt$$Fft$NfQPht$W ΍T$(jt$؉t$h$΍T$(jt$^؉t$h$v΍T$(jt$z0FT_h$G΍T$(jt$9FPh$΍T$(jt$ ؉t$h4$΍T$(jt$؉t$h>$΍T$(jt$d؉t$hN$΍T$(jt$9؉t$h%T΍T$(jt$X؉t$hb$)΍T$(jt$-؉t$hw$Uh$UPh$UL$lL$AQ D$iPhH$Uh$ h$h&${UNhk6h_$aUt$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ$L$dT$C;lc6u#Phpc6QD$XHL$$ D$Llc6PQhpc6 T$Ҹ$u1G$T$PbTL$r |$ rI0N1H 0N1~(N1H (N1 h(N1j FY(  }T$A{^N2D$ˀ) h$SuPt$,d L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh$=Sh$'S9 |$ sS0N1H 0N1~(N1H (N1 h(N1j X  }KF߉Ήs(T$h$RL$T$؅t%0N1H 0N1~(N1H (N1 1I h(N1j fWh(N1ءLc6;RQPh{$GMb5;b5}0u hR\$'MPhdf#MCы\$1B\$D$\$D$T$jh$j@ 1AhE!WV8Pc6~bTc6Xc6 0N1Q0N1; @N1h(N1j.QPc6 (N1Q(N1.H Pc6by`)Tc6Xc6 0N1Q0N1; @N1h(N1jCQPc6 (N1Q(N1H Pc6|tN=Tc6t40N1H 0N1~(N1H (N1 h(N1j PTc6Xc6h(N1hN1c6`c6 c6dc6c6hc6x8^_jj 1A1=Lc6PDUSWV׉E\$1AM8a5]E uWVh$Jt h$JSh $J8a5t5@D$ 4$\$D$$$J8a5fyuhN1j萁e^_[]UVh1AtD$a5$!$9J$c6D$$>$$JLc6D$$W$Jk6tD$$m$I$c6t9+ Lc6} $~$!L$LD$L F!D$Ht$H\$$$I$ H Lc68a5 k6L$DD$D=c6@|-c64$ `1 8c6\$,D$(\$ D$\$D$\$D$$$H8a5c6 c6 t5+ c6c6L$XD$\l$Xc6+c6D$@D$@5($Dc6 @c6 t7+ k6k6L$PD$Tl$PHc6+k6D$L> QPh$l8a5tkD>L> QPh$F|>uGD>8a5ufPh$E"L> ffPQh$|E ^_[WV9a5u8jjV. t'86 PWh$hhk6C"6 Phs@$hhk6C^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h/$ $t$t$ t$SPh$D UPh:$oD t$t$t$ hF$VDt$ PhX$J!~"VWSc jjVWSU\$u* 1GWWWjWjWjWVWj VWi, u h$j4 jjL, u$8jJ u* j7 j j , t)qtOQ j j+ uu$8t1Aj jh""{ ukWh$jh/$mut$U- V$Q0WWq+ _$t "VPSh8%%W2 SWh$jAV]'=m6u "VPhv$hN1yAjo8fD$tPh%$tqh!$Ph%$hN1h'Spg =(m6uh +$h*$ha%p 1CXm6FLCSS H3 VT$W$$ \$@1ɍP$ $pm61A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12xm6#Xm6L$L$# 1AD$ PD$@PD$ D$<+Lm6R D$ Pj$Tm61Tm61Tm61 `m6dm6׋t$#D$ PjPm6d$zT$ ED$ L$TL$@JL$CTm6"1-L$#d$d$d$L$׋t$m6:m6@.m6"m6m6 m6\$ m6`m6dm6 t hm6t `m61SSPg L$Y\=m6j$)/jD$D$ D$ "D$ "Hm6L$9a|$u qLm6 Pm6ta|$  ‰4 D$=Xm6T$tD$1@D$ h1ۉD$0XhxShm6 atgcuL$m6 m6m6hp6@hp6m6Hm6m6m6hm6 m6 m6tJt$(~A|t1Hm6t|$ ObTHm68n6tPt$ tH@WVh8n6x 8n6=PSVh,$s h(N1ƹ^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV莕+D$  PL1PPWSjVV|$dt$ \$h-$ D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9 1tE 1P{y$L$t h-$h7&$QQhu%PPh,$ C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP#PPh-$P 0N1H 0N1~(N1H (N1 h(N1j L#T$h9t$+[ h-$C L^_[]h($ jh,$j D$t'T$tt h-$h7&$QQhu%PPh,$ ËD$t%u1-$%tu!-$Ph;-$-$+-$Ph"6USWV|$<\$8D$4t$0~u/jUBH u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhN8!Phs@$PWhK"s ^_[]USWV|$4t$0=pp6uMpp6hhqp6jt qp6'j.hqp6ޮt@hPhqp6 t"^tCt0Wv`rhhP%hxq6v ^_[]1w)ȉPjQu SVU fEu jUF WUu&Vhxr6ShY-$hhxq6xq6^_[]ST$D$ L$YttuRPQ9RPQM ,[TQhxr6Sh-$hhxq6pxq6[SWV$L$4D$1Gd$$t$"tZ@:t9rD$PhQ-$,^_[SWV|$t^D$uFD$jjP,t t1Nj0j.V t@hqp6Pu7ut$z P%hVhxq6 xq6^_[VD$L$ 1Ҁ0QRRhhxq6VPt* thh%hxq6 xq6^Au yuyt$Qtu ȃP3p Q+n APh-$hhxq6xq6SWVD$xr6Q4-$Rsr64-$Rtr6ƄRur6.r|I1AFL$ tWWVWh|.$O u;D$ D$ P8WWVD$Ph|.$ tt$IĨ ^_[]hukSt$hb!h%h$Wo Ƅ$ts650$ :0$t觋$QPW  $Kà9Éu|$$P} 1htBt`VWh0$h7%h$SRS tRWh0$<hq0$<Whs@$%bWh0$hmv%h$P1-s6t1^fUSWVl1VVj ~siP2 WD$Pj Ë$9tWSh2$q: tJt.uWD$%7!D$2$ch^2$>w gD$/7!D$2$:D$@97!D$2$#$D$#D$ "$D$WPD$$$ L$um|$ ~-s$x W9rNŃ h2$h2$h7!h7!t$t$(h2$Ph2$$D$ XC<$111҃$t$9w@wo|$ D$ |$7jj h "PQjW詭  ݉) \$Cjj h "QPjSt D$t$LD$Ll$Pt$P F!$\$|$L$OL$D$ D$DD$\$D$3$$3$$Dt$SVPQ8lj SVPQt$PWhQ3$$S<1Fl^_[]Éω |$t$+jj h "QPjV聬  |$7jj h "PQjWN ) \$Cjj h "PQjS }SWVhh3$,D$L$PQ# D$"D$t$UVQPD$ UVPQD$ ) UVPSL$QPQt$Qt$,h3$& L$L$ t$WVPQlD$  WVPQND$$) WVQP.l$XD$X\$Tt$T F!$L$D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h'4$h$Sf\$ =s6uD$$D$ P$P\ 8\$t$Ph14$)s6PU% uUhs@$1@$~#Qh 4$}01@$\$$$Ĕ ^_[]$Phs@$j0 {Ph<4$hN1 jUSWV L$s6$T$t-s6*jhs62 s6šs6$T$1i E$48t!u6$t$PT$ uF$t$PT$ tEM<ǃ h#讒1 ^_[]ËD$ t 0s6$4$݋D$ t 0s6$$ؾs6Phhs6 uhs6hs@$j fVD$t.})zh,7h87$5̛6X $7T "t5T6RPh:$QWx6#5̛6jj6h9$tx61$7^_h;:$hX6t$t$ $7hD:$hl6t$t$$7WVD$ tZ}UuZt$~h8!WCtOh"WrCtBWy7vh`:$5̛6 J1H_1=ܛ61@1ܛ6 ؛61Ҿ"t8! щ ؛6PVhz:$5̛6$1=ܛ6$7^_ËD$uD$L$h:$PQ tvD$ph:$gu<=$7u0=p6t5̛6h:$j D$ph:$Vgu+-71757.$7VD$ L$$7t u]H 6HQ*tsPR t8c=-7̛6t5h-7h:$P $7(^飘Vh:$vPjj$h;$#rV^ËD$tIDuD$L$h 8$PQS t$D$ph&;$7fu-7 $7SWVD$-uD$L$h8$PQ  1G=57hjĴWhw6n t D$1VVt$H ǀ?tx=57tyD$thWh&;$deu -7=57uB=ț6t9=\6\6D$bt57=\6 57VVt$ DžaSj߳57Ԗ$7^_[ËD$uD$L$h.;$PQ tmD$_D$L$h8;$PQ tI|$BD$ph@;$]du8D$phH;$Ddu-7Ãt($7USWVt$ |$.E1ۈ$5̛6jj,hP;$`n% u v1.褔$7^_[]$7USWV D$ #D$$L$ h8$PQ[ L$ ȃ#D$$L$ h8$PQ1 D$ L$$|<$Dh#t$ݟt3$8|t+4$$H$;$ 3D$$h;$0蓟D$1E-57hj菰Uhw6wj t D$$\t$=571D$ H9=L6ߋ!t,";$9t$tu#T$$VVP4t$Q̀57u?=ț6t6\6\6D$$" 57tA 57\6E_t$j讯57$9t4$葒$7 ^_[]SWV$tKjjY6tK~Sj 9uWj01uh;$p1H$7^_[þV] Fujjh#~}$tj/V t@hQW螒 =ܛ6t85̛6V薉 ̛6HQP~ Q Pj |j5t$7h}~"WV8  jWV8 Vh;$%o$7jQSWVPD$D$t&D$t$h;$PV r$7^_[ËD$ph;$^u|$h;$ tD$x|$Wh<$~^W胛PjW臏 uP|$h <$螬 t D$x |$Wh<$+^W0PjW4 1ۃuM|$ Àu*D$p Vh<$]VPjV L65̛6h<$譇 D$$7=57t =17u.=17t#h17hR<$5̛6 $75̛6jj%h,<$hËD$$7=-7u=-7t#h-7hh<$5̛6  $75̛6jj$h;$nhËD$uD$L$h}<$PQ蠺 teD$ph<$\u<=$7u0=p6t5̛6h<$W D$ph<$C\u-7,$7ËD$uD$L$h}<$PQ teD$ph<$[u<=$7u0=p6t5̛6h<$譅 D$ph<$[u-7肍$7ËD$t8uD$L$h<$PQY tD$L$QPh " 2$7USWVh$V $|F$$h1Gh4V M 9}hh5p6p6uhO=$YD$ phY=$Y5p6^VD$t$5p6p6u hf=$X%Ȋ$7D$ phk=$X5p6^Ã|$u|$t荊$7Ã=L6t 1PP)jW=L6t 1PP jv|$u|$t4$7Ã=L6ths=$X鏽V1VVcV)VPD$ D$t}uD$p*Ӊ$7$~ $7$7D$ L$h>$PQx |$1@$7$7j 5t$7D^ƃ=6t~ vt5t$7j V^h5t$7h$7 ~ vthVh(7ֆ zԅ$7^VD$t.uf1=d6d6h68!t"D$ ph8!Vu.t.h"Vc.t$5̛6d6$7^ËD$L$p6tH>$Rh6QP$76ËD$L$p6tZ>$Rh6QP$76SWVt$|$p6tH>$Ph6WVs$71ۉ6p6tZ>$Ph6WVH$76^_[hl>$h$7t$t$$7hy>$h$7t$t$$7USWVl$|$$9~蝃1H^_[]Ët$ ~h%Ww,t.hg%We,th&WS,u1C$1|,vxǃuv $o1FVjD$VjtR|=6$6|$$t =p6t/̛6 6"t8!56QRh>$PtR|=6$6|$$t =p6t/̛6 6"t8!56QRh>$Pvt$j0Vj%1jt$ t$ M $7Ã|$thh?$Ou5=$7u)=p6t5̛6h?$y h0?$Ou-71757蘁$7VPD$ tK}F=-7tQumt$j PvN x $9tBvh5?$5̛6l 53$7X5̛6jj/hQ8$Z/$7$7$7 $7 С̛6tRQhn?$PPhS?$x ^V|$t%5p6p6h?$N5p6蘀$7^WVD$ =P6u5̛6h?$D$L$ h?$PQK tq|$ j=\6t5̛6h?$ x P657L$j qP P6t.57F57 G7u#t57 77 77 G7M1H M1~M1H M1hM1肑< u# P6;457~F9u M1I M1~M1PM1hM1 M1 tu:QM1~M1H M1hM1ِM1у u5̛6h;@$v 1H$7^_NA P645715̛6h@$WVD$ tkfuD$L$ h 8$PQg tFD$jplj!ЃtD$VWphg@$5̛6W1~1H$7^_USWVE{uE Mh 8$PQש t]E jp訸T$$!ЃtI5̛6E xS{P衺PWhp@$V1;C k}1H1$7e^_[]ËD$tuE}$7hv@$/KËD$ph{@$KVt$ hߋ!jVt$tvvh@$5̛6^USWVD$uD$L$h8$PQ谨 D$pεh;$Ðtǀ8u%&!WuVj,U踲UWP.} Uhh@$W#t+hll%W#t h@$W#u7 1Cvtt6u6Xz1H!6P56h@$5̛6f1$7^_[VD$ L$$7ʃuCuD 1tK 1V "tQPj h@$5̛6u^yjpp $7^WV|$ W`tQƋ|$@tPFWծF=p6t3|$t,P6h A$5̛6wWh@$5̛6a ^_WV|$D$ $7uIwЈtAƋ@tP`F6h$A$5̛6 $7^_xwh@$5̛6߿ ^_V|$t.=-7t65p6p6hbA$~F5p6(ox$75̛6jj,h5A$Q^VD$Hr8x$7`=-7t$5p6p6u(hA$F-5̛6jj,hgA$QD$ phA$E5p6^VD$u5=-7t=T$ 5p6p6Ju:QhA$E;w$705̛6jj,hA$QrQhA$ME 5p6^fUSWV@$(@u$,@tw~!$,@$(@h?$PQ tӋ=P6~+$,@X157j US0u t F9u19u2$,@phcD$5̛6Ͻ $7@^_[]ÍD$h@h\6Pcw 57D$@1ɽ $L$99` tU1OGGDA@u\6ȃ$t \u_GGY tU1WDQuViuAG;$(@}/$,@\6)Q4Vv $,@4׀1@$F?tG|1ۍҍBWGDQu苄$(@9|ˋ$,@\6)QtVYv $,@tf踅60tƃu5̛6h=$'5̛6h=$~ t;=L6u25̛6h=$l $7D$@9G=p6t<5̛6h\6l ̛6HQP~ Q Pj j 6\$Smu 6605\6V =d6t'~t!̛6HQP;H~EQh@D$Ph\6 u 胄\6$(@6$,@Pj[븃<$JE1A;$(@t4fUSWV1$D$jh6J t%=L6t 1PPI<$~KD$@$Ahjhh>j Y<$t(=L6t$t 1PP$^_[]Ë|$ \$1D$9}ƋD$j:4Kty6=ԛ6u ԛ6D$ Y$-6t+h#U~t}|tU6<$~D$@$D$<$d-SWV։jhD$Qa jhD$WI tlhD$W tjhD$W! uYt F t8t4h%D$Ut8tjhD$W t ^_[ (11VPP ^_[)WShD$j USWV$\$@t$<|$j hC$Wr |$D$ 1D$D$SƉ$P|D0$D$d H$uV1KPi* F|$Dt$d$`t$hl$dt$lY$hD$d|$p$lL$tf$pOG8>hD$P(t$DhD$$t$؞ $t|$@t$t$@ЃD$;6t|$tt$D$L$d3.$`'.$c.$tW.|$Htt$H\D$H|$Ptt$PAD$P$t$ DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=6t;P譡D$HL$H+6tD$Ej/t$L t@Pt$DhD$t$HaD$t$Q6L$D|$D$81$7$7$7$7$$96t1$Pt$u$\$` $7$7|$py$7VE$h"t$L蚸D$|$t$I$QPTu5$8$<$$$\$` $7$7$7 $7t+t$j5$75$7PhY=p6tPt$HhxE$5̛6蹱 $7$7 tQPhE$5̛6蓱5̛6hz"Pb 1O$=6K61O$*|$pu% D$TQhE$} Ty6ht$hWj =-7|$Lu:|$LD$puuh/D$t$Hh#Muh%D$}D$L$7E$|$LD$L8|$dD$t$hFD$}8P薞$$W(t$<h%Vs 1A$<$ǀ?tvj:W踽 t=@j $QPy ~޻t?$9u3;$u*Ws9$<r$)PWRa t/h%V Džm1Ft$Hh]E$1$t P$$u |$p$$$7 $7t$Lt VhE$t$dSt|$dj%W?t WhG$1$GGG fGH$P$xPW# $u2$t'8t"$tJ?t1he]%WstVhH$ $'(2WyDŽ$t$D[$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB 6JBB D$(PRW$8 t ]q0RtD$(Z$$PV-j j WhSvv t%h!PSf j !PWf =p6t+D$(xt!~BH$tVH$WSP5̛6ìv jv#+ Åx`=p6u~PvvS5x)$P$P$Ph "ykS肖 1KW$PhhH$B Nȉޅɍ$P PW$4h)H$] h1N=`6tJ$t$uP$$t$uPٙ$P6~R57Wh$/ptNu1h@hH$h\6e t605\6ދ$tPhDŽ$$t4WnPjWb $tP)DŽ$$t4WnPjWb $tPDŽ$D$(t P |$D$$h7j0$6<tQhN8$$蒰D$$\t$ Jj6tV=p6tWhE$5̛6 t$$tI=p6D$tPt$hhH$hH$5̛6裩1@t$ht$hhE$f |$dwhH$V̭ #hH$V赭hH$V觭Л6tph"V苭 ȅu塈$7 $75̛6hH$Y 5$75$7h I$VE5$75$7h!I$5̛6Ψ1F&1t$lhH$V $`#=6t"D$$[I$tHI$QPЬ|$huI$LtPhI$W謬 h8$h8$hI$W蒬D$$0$|$Pt1$tH$t"tD=p6$tPhI$5̛6 FWhI$$8W! $$0t-=p6tPhI$5̛6蘧 FShI$W t=p6t5̛6h\#8X h>#t$ 诫t$H1V|\$D$Lt$P5 1ZƉ$$ىD$ $ tU1DJ@u}1O|$||$x1$$L$xD$|D$8L$4T$0t$,ډ$$1Tt$4t$,\$8\$0ډ1߉Vى‰T$$Ή$$P5 1 1J1GtщӉT$4T$,T$8T$01$$X1H$ljÉƉ1L$ t$|$ ً$t$T$D$$$$ˉ|$(|$(I$ J$ (9J$ IHJ$ RJ$w t!7$g heJ$ 6J$F uJ$6 J$" $X$V5 1`j $Pt$0 $7$7$8D$D$\D$ D$X$ًT$ D$t$|$hoթ"w|$D$(8*T$ @ً\$ 1T$(1 $RVwDŽ$8$Pd$$t$(SNjD$D$\D$ D$XًT$ D$t$J$GD$`]j $QP хGƉ$$$8-+@D$(j $QPC Ӊ89.$$$$$D$(8/t$HL$(x*\$u4$j $PQ ƉӅ$$D$(8$$$7 $7\$|$\T$X$$$$JNjD$PtPD$PW趏D$PD$D$\D$ D$XًT$ D$t$\$߉$(Ɖ$ ˋD$X$D$\$$X$$P5 17$$$$($$$ $$$g$$D$8$D$4$ D$0$D$,$(1@$΋$  \$ۋ|$$Z ;Q y6H y6 h?K$5 \$D$ D$8L$4D$ D$0D$D$,T$1@t$|$$L$<$$D$,$D$0$D$4$D$8$t$t Wt Vߋ$$$$$$$t,%t$ht$hhG${ $$ˋ$$H6;D$p|$@hz|jt$hjt$ y66t9tP y6tQ69|ʉ׺9օt y6Q葍y616656$t$jsDŽ$jkމ|$`$t$5y65y65 $ajD$,P5y6G5 \$(;y6Wa8"NF؊ u@;ut tH@D$(h>#Pa-$$u 1É.1ˉ$$8$4=6t/j$PI6։щ ыy6uy61ى߉$$|$`t<$;$$|$$$$$$5ʋ$$4$8;$$Ɖ$|$$t$Pj5y6$L$T$P66$)$$y6T$@R1Ot1$VSW] $u*_#tu'VSW3 t߉$ȉ)u$$P9=$7=t6$T$L6$9=6}#Ή5̛6M2$Pq̛6HQP;H~-Q#6Ρ69=6}Pj#Ћ$$L$T $|$`t)։>ډ׋$$|$y6‹$4$8$ 6ˉƉ$D$@1S$PF$+$$$$+$ى|g@By)QFj$PtF$+$$$$+$ΉЃ||$`t$@$Dt$$|$`tCt$5y65y68 h>#5y6n]M|$`=$@$Dt$h";/Yh#t$]D$8|jjj n$D$@hߋ!PM= D$@|$@DŽ$J%$7 $7 m!ڃt9}M#$H5$7$7$$!;$$=p6t5̛6jj hF$)D$TZD$@(N1x=$7=t66 6ƒ69}%̛6HQP ;HQ#̛6HQP<Q 8tB$ڋ$!t $75$71ϋ$H1 D$h,"P hߋ!t$D$@|$@tDŽ$jt$}D$@Ph;$h8F$VhZF$OaZ"y6)PShmF$,hF$%Pt$HhF$jkhF$hF$B bhK$6 L$D$ D$8t$4D$ D$0D$D$,T$1@މPj ۘt$脛thF$>,ej ct$@,$=j$#$1V$W'B$$$$$$t$@Ѓt$@Wt$C u.5̛6$PKP蟊PhF$V谔 6=6| jj$7x& $7 6$76; $7R166!1\$  $7 $7PL$T$ T$8t$4\$0r\$ p61tt$h_K$5̛6ݓ L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$WhK$ D$L$ L$8t$4\$0ËD$D$,T$1@t$[Pj#t7tt$hrK$5̛6 T$d|$MD$TD$L$ L$8t$4\$0ËD$D$,T$1@hJ$( D$L$ L$8t$4\$0hK$ D$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$hJ$$4 $D$8$D$4$D$0t$,$$1@މjhJ$ D$L$ L$8\$4s$$ًT$ t$\$|$|ljL$xL$D$$$$ω$$$"USWVD1D$ D$D$D$fD$D$0D$8D$4jhD$Q芀 t}D$V~ƉD$j@Pt!t%L$L$4ԛ6@P~ƉD$j:V@!@P~D$ t$D$0|$ H$jPW4 D$4t 8D$t{8tvD$ t8tj;P蚝 thK$PhK$WhL$WrVWh5L$ VhzD$ 1C)1C>l$,|$ $tc?tTj/Wۜ L$9uut$@jhe]%VH @L$ǃuC=X6taD$t$uI$t>thUL$V1Ʌ $t}thUL$U1ɉL$<=ԛ6=L6t 1PP=ԛ6i |$DhPWG |$L$D$L$D$ tD$ D$$=`6`6L$QPq=`6L6t=ut$8t$8t$ Ts t D$,t>D$Pj 3D$T$!tQPh\L$ "D$Pj跓<$l$,|$u'j/VtG1|$t>tFhhk&l$LUF l$t$1l$ --7D$PjЫ9--7*x1l$,1Kd}Z<$t3$DSVWOF She]%W SUWu <$hhg%t$LVF t$l$D$ D$<4uT5\6\6=6C$t8$hP|$LWE |$D$Pj5\66uj/U胙 t@ʼnD$ D$$=6tAD$Pj-?>uP=$7uDhN1jhhL$)1D$Pjd8$71ۃcÍL$%L$0d؁D^_[]1EhL$t PhL$hL$j| USWV օ\$ |$$jhD$Qzz l$t=jhD$Ubz t;jhD$UNz t9T$(.C fCPC fC C 1}Gt$j/U$t9lj)CSRyS\$$UPC { uG<$W&xC Uxj@V|$$tZ{ u ԛ6w@PwƋ_j:Snt@PwG_Ot[uUnj]U/$tYÊ@t<:uL)SUV V~,$}:1j:VtEt$t$VhnG$1ۋ\$ t3tHj PU^ }t $9ut=s fCt$t$UhG$ CC tWt_ukL6KUVh^G$ͻ t$t$VhG$赻 \$ n1HJ3P6(u "UPvC{u{ f]%te]%P.vC1 ^_[]h7G$jx WV։2vvuGvuGF G FfG^_USWVȀ%t u7Qt*5tU1|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdjw\=ț6t<PhH$jdVm~ ̛6Iu1IPVQin jhy6 VdH6j\=ț6t<PhK$jdV~ ̛6Iu1IPVQn jhy61 V΋tPNFtP8FFtP!F^WV΋AtPF~t,WIPjW= FtPF^_SWV׉΋j:SGtDSsP謄tj%S tSh=I$V蒉 SmSh4I$Vx G tu)GfPu G=tPhH$VC h>#V5^_[USWVP։ϋ\$l$ 6<tPGZPUVWj-Z x.1tETw4s,I  $8 u@$PhK$覷 1@^_[]USWVPӉR Hlj4$6Mw sEWSUs 1uCL=ʀw һru$wsME$(^_[]USWVL$d$`1@D$1ɉ T{6 X{6 \{6 `{6 d{6 h{6 l{6 p{6 t{6 x{6 |{6 {6 {6 {6T$(JJJJ56rBJ PRSW~ t u G0$@t0hP.P̠ PSWhM$ $7hWhTz6Z< -7Tz6<$l$\$HWj j UhSww t h!VS< j VU; =p6t*$xt!BH$tVH$USP5̛6w jwd x6ư=p6uPwwVvyWVk UShhH$k #$d$dhE$ $74$蠟 xwwhT{69 GT{64$x $T{6D$HShp{6V D$Hp{6=U{6uD$jUjjVd h"VG K7hߋ!VGK7= K7=p6t5-7hN$5̛6藀 j}^\$WSjUV܍ WShUVˍ -7c$d$dhM$ 1hM$芳  K7t PIK7t PI$7V#j 1L^_[]VD$xuGxuAHyu8y u2yu)Qq@ffqQ1҉Q Q@^USWV81ۍ|$4{6{6h"'j-UD$(D$ h'jUD$,D$D${6D$D$$$$711L$8L$\$0D$t$$ 6<tPTW5 K7莁=W5 K7tr&wW5 K7PtPhW5 K74tPhhh3#5K7Y~5K7Cà u $Ep6uw|$5uprk=6ub=$7t&t uu5-7h+O#5̛6} ̛6HQP;H\˃ PQ $wtU1DXt$7CУ$7$7uss)5 $ ȸdtȃrutU1DXu 1@OuJ t$ tB$T$у)l$t=6s=J\$\$$\$l$"$T$ыl$ދ$L$t$ dڃ( ʹtu-u|$t $7D$ $؅t荌$79L$`L$AL$PPS=p6\$0l$uE5u@=6u7̛6HQP~ Q Pj D5̛6fD$x u@uhD$0H6j~O=ț6t#̛6@=u1Hjhz"Pa {6={6u =0^jh{6 V=0jO=ț6t#̛6@=u1Hjhz"P'a {6={6u p=0^jh{6@ WVP=K7|${6h"'jNƍD$$PW5K7| 5K7h>#) 5K7<6hs=$Wd=1ɅQǃ={6t @w3t.VjINh"N$ҫ $71^_jփUSWVu} 1D$(D$ 6T$L$$7!D$661K$7$7 t6L$,9p6t7}t1?-tWhdN$5̛6w tVhR$5̛6w =6tVu u ~,79-7t jP0}D$ \$\$jh6 hz|jMh5jMD$h#} W; ?|jj LD$_h"S D$|$4t6D$ Jj3=6u$7D$tt$j`LD$tt$j IL|6xP` |6|$ t|$t D$ t$Ѓ|$t t$?D$,t61$7$766e^_[]D$M1t6} 5jh6 Ct$jKD$=6|6xP_ |6|$tt$5?D$j$76=6jlKh"WuD$|$D$ jD$fxtD$XD$0PS}x.#D$8=u$$ $7$7u hoN$5̛6t Sh;$Wh#Y $7 $7ߋ! t^L$$h!8$W9th8$W 9ߋ!u3-7H D$fxL$$D$@щ˅tVWhmv% Whs@$@-7SvD$|$ 66t9tP 6tQ69|ʉ׺9օt 6Qb6j@D$ujj ID$=$7tD6=t6t $7!ȉ'D$$jSPt$2 1-7HsoL$1HfytL$IT$fztD$PW565656E:u h "A %\$(St$uƃ t0ti6 6;L$D$|T̛6HQP;H~0Q#5̛6u 6L$D$L$Pj#"u͍D$ Pt$ j u D$@ @66D$ Pt$ Vt ttD$@ @uj661HjSQPd(Ѕx,5$75$7hN$ N8$u h]E$n} tc6 6;L$D$}%̛6HQP ;HQ#̛6HQP~ Q Pj sD$@ @tt$(40Wh "PD$@ @t/t$ 4048 t hN$$1H66j=|$ tD$ t$ЃD$t$91t$V6=6NPj#2sSWV |$$D$h8$Wv4t D$8$=$7!8$t8$D$,7ƅu=-7=-7 4F95-7t jVuhO$)j$=L695-7t jVth{6hR$t$ jh{6 jh6 hTjD{6h8$Wb3 6|t1@v5̛6hR$Q M5̛6hR$9 j!#$7!hXj D$ $7$7 tQPhN$ \$$SWhmv% j j"D$ $7$7 tQPhN$ Vt$hmv%v {61WWE"W4$j5Cj%"={6SVhR$5̛6Hm4$jCj! ^_[Åu1t P!=6t jI  |$1=6P!=6t j  |$1=6Pi!=6tV K71j J$,y hR$7=D6t $7jxYVV=6t j j =D6t $74$jAVt$hmv% t)Vt$hmv% u=6 j =6{jlWVdH61V#A5575{6$7rt suYT$ T$dWPV% Wh=T$V? ̛6Iu1IPVQR jh6 PhT$j#\ USWVD$=d6p6p{66jjP2 |6؛6tL$jQjhPx 6<<=6w=6j=p6=ܛ6u p6hO$Ɖ=p6~&t =L6u!h G7hB#5̛6j =L6tC$7=$ 5̛6hO$ hdO$1A =6=6=p6=ܛ6u p6hO$JƉ=p6~&t =L6u%h G7hB#5̛6Hi =L6y$7=tT$ wJ5̛6hO$ ?O$tg6hO$=L6 O$3O$t26hO$=L6O$PASV3Q LPSV3Q QEPSV3I1  $$7=t$O$ <$$T$$$VRQPWhQ$h{67 Q$$:$:$:$6T{6D$ff6k=h65|6Q |6d6=616p{6u f6|6t PhQ 6jjP |6=6u(QT$ RQhPdt |6 6Qh6Pm ؛6tjD$ Pjh5|6t D$166 6$6(6,606D$Ph65|6N OD$6j5|6hy hQ$ =6" 6$t#/=6=6=6=61)L$ ׾6󥀼$u DŽ$$j j $Qh$QPR.t =p6=ܛ6u p6$P$Pt$hQ$Ɖ=p6~&t =L6u.h G7hB#5̛6d =L6+6 6tPV6 6656=66SWVRQPhQ$T 6$!6$"6D$|#6D$x$6D$t%6D$p&6D$l'6D$h(6D$d)6D$`*6D$\-+6,6=-65.6/6 66PQjRVWSUt$|$$$$$$$$$$jjhQ$;X=L6[=6N61ۉhdO$ 1A#hFQ$heQ$u 61ɀ=6D$jD$ Pjj5|6-p 1Ƀ5̛6hO$s 1E=6$7=$ w5̛6hP$hQ$ 5|6|L |61AJ6;$7=t+$ w!5̛6hP$W5̛6Q 뗠6<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,PhP$h{6ό , |$ |$|$1-6-06-,6-(6-$6- 6-6f6D$L$  ȋL$$ D$( ȣ6D$ $ fD$ L$$T$(t$\$VWRQPShP$h{6 1-6-06-,6-(6-$6- 6-6f6D$L$  ȋL$$ D$( ȣ6D$ $ f6f 6;X{66jPh65|6_1ɀ=6uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\PhP$h{6藊 \|$ |$|$1606,6(6$6 66f6L 6@uD$ $ ff 6jh\{6h 6P 5̛6hcP$5̛6hO$5̛6h-P$5̛6hP$5̛6hcP$=h6USWVX=d6|6tuP%jjPH ƃPj5|6G t$|6D$fD$D$jP 6<D$T$ |$ Mbt$1PW T$L$+T$ +L$(x@Biy1PjV` u!8t!8#thR$uh?R$蝐 p{6t$4\$8VS5|6jG ǃu+;!8t 1!8#uoVS5|6?G t׉5|6 G =|6t$jWF ut:|$9uD$0jPjjW j V5|6EhbR$C 5|6F |61e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$j $@0j@VtxGp5d:hU$d:?u D$PPPhW$h(N1;1PhU$F 8P* 61\$(ht$Sj t$~$@@FF =`6t 1ԛ6`6$<@VP=`6 L6tȃujUS L6ȉ6t=u9P6PhV$5̛6 ; 56 =L6d6|$|$ t&WWWv$@$@jh6e hj^h>j O5h:hU$Y5h:hjU$L5h:hU$?PhU$75h:j?YPVh "5h:hU$j?9PWhT$j0+ ރ uR40Jt$$D$D ƃ=H6tjWWV0PW PVhV$WV =ț6t>5̛6hX6P K=\6th\6h9#5̛6Z9 5̛6jh@h\6hM1'tEt W=\6k60t&ƅu'=$V$5̛6P /=$~ t=$=L6t`6j 6W^ 68605\6V =d6t'~t!̛6HQP;H~Q~ Rk Pjx;hj h>j ^_Ã=ț6t̛6HQP~Q fPj ;fV5T6u< 1t! 1hl"P|tFuhV$j( 5T6iV$tPhhX6J3 X6^SWV|$1t* 1t! 1WPt Cuމ^_[V5X6u< 1t! 1hOD$PјtFuhV$j ( 5X6 "tPhh\62 \6^Vh6\6l$7l61p$7 6A\65P56:t\6^USWV1|$-$1t}D$$1111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,hg#D$P^t uu ^_[]c9ơ̛6=69"t5W$QhW$P^5 $1t741 6ttPl#PV^9 6uV-jVz[ D$E3Vxtǃu&Vt$h=W$ Vt$hYW$5̛64E|$tw7j h@$5̛64"j 7t$VD t$D$PjW Mr^_[]USWVP h6l$7$t!uLp$7t.u=p$7Ah69! 1 1p$7 t$7A t tu p$7p$7tu$p$71Bp$7 t$7$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5l$7 h6;$l$7 h61tu p$7p$7t$7^_[]WVt$ t8 1t 1VP蔔tuVhW$j# G^_hsW$f= 1u "  1̛6@=u1HPT& 1; 1USWV}uCjh K7B  K70K7$K74K7(K78K7$7 $7 K7K7|$(jW $76 $7 6w+0K754K7G1;8K7)ʉT$t$K79K7s?D$08K7D$(L$, 4K70K7K7=K7D$6D$"6ʃ|;D$L$y =t6`E\$ |$tY1${ {{;{{WSW4 ;{{{ {{|$$PS\$jNU$'w1ۉ___ __$PWj 1@G ____SW|$ S\$4 =t6fDŽ$ $7t$Phs@$hQ,1F$7 $7ƒ\$x|$|l$x!ݜ$݄$ F!L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)WhY$QP3,x$79|ӡ$7tPL$ 4L$ )΅~DQ4))h "Sh5$RhY$QP+Ƌ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)46$QPhY$SW;+L$(+ K7T$,$K7\$0+(K7x@BD$ډL$hT$ll$h|$@6 61G؃D$@5!vqL$`\$dl$`!ݜ$ܼ$la$1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 46$RSt$DhY$QP) $7$7ȃ66D$u݄$|9s0;T$ D$r$|$\$|?؍<)hZ$؍<)hY$QP') N+$7 $7T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh6w VD$ B J1rrJVRV- $^Ã0D$4L$8T$ 1ɉJJJ JJQRP x$1H0V#0j0^USWVh=p6u=t6u }t$XjV + K7~=$K7N+ (K7y@BD$HT$Ll$HL$$D$$5!6 6Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и "t#|$d5$7PRQh Z$hWu%|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ "r#+|$QRh3Z$Pt$$$ų i)s<$*<$Hrr޸t1@D$))kd΍ u_4$571F=6uRL6,=P657Sh$Ouh]$]J 1$tP'R$|$t.WPjW D$tPQD$|$ t&W}PjW D$ t PQd^_[]h@hH$h\6 605\6Whh-7C^ u-71757V5p6=ܛ6u p6h?$軜t>hP\$hG7Lr1ɀG7.)hG7PhU\$5̛6jhr\$hG7L tfjh#hG74 tN=6-7t-7j hw\$h G7[ uh5̛6h\$ S=6-7t-7,7j h7$h,7 th,7h87$5̛6 1H-7-7-7-7-7-76ˌhbA$g1Ƀu 1A-7u ǀ-7u -765p6^Vt$ttU1DH@tNFuh)a$VutQjhA$V tDh.a$Vut9hv%Vut.h:a$Vuu'-7-7-7 -7-7^áK7t PO1K7L6-7-7=ԛ6u ԛ6|66657t PN57=6tP6H6j=ț6t#̛6@=u1Hjhz"P jh6 WV 0jk=L6tpK7t1@=u1HjP 5K7IK7|6x#jP 5|6 |6L6|$ j =L6tDK7t1@=u1HjPP 5K7K7L61$7P8u 0^_Wh\$j D$tP͏t h`$j h`$j USWVt$ \$l$|$WSUE tUT| u;HDO 1 t_$ t_$fO gK9uX M1I M1~M1PM1hM1 M1 tuÅt_$g t^_[]Vt$V;t^Vhh`$j hh-7X t-7USWV=57X6t`=L6tW$twO7PhhK7C j hK7K7tJO71PO7O7tNjwtO7O7t$h56VY |0/thhe]%V hhO]$Vl V5$$P{  p6L$p6$7$-t61$7t6$ t1=6PGt*ߋ!1SSQPVh;$a,"u8$7d$$r t G7$ t1=6PND$p6$$7-t6h"VO7VYO7t2]$75O7O7Vh]]$ؤ  h]$iA 1^_[]USWV,=X6t8l$@11 SjhUƾ tUh28$A ",^_[]<$tދD$0S ,^_[]WVP5p6=ܛ6u p6|$=-7tft$h]$uqj h G7@j WP<  =tU1LO@1 5̛6jj(h]$?ru=$7u=-7u -71HtJ=ܛ6uA5̛6h G7T ̛6HQP~ Q Pj 1H‰5p6^_USWV45p6=ܛ6u p6\$L=$7=-7!t$Hh]$Ғ+j hG7躜t|$j.hG7蠜thG7G74$uYG7519 G71f u>hG7h^$5̛6|  fG720hG7hD^$5̛6[  G7t$1 UVhW^$UF D$(V !у $ p65̛6jj(h]$Cu=$7u=-7u -7tj=ܛ6ua5̛6h G7Z ̛6HQP~ Q 0Pj # ܛ6tUhd^$5̛6C  4$|$5p6=$71Hƒ4^_[]t$h|^$j2hO7 tO7h^$j USWV\$l$jWmkh9"W]kUh^$S Džu&Uh^$S DžuUh^$S Vjk^_[]SWV575p6=ܛ6u p6=$7h#17u_j h G7tL8tGx"uAHt.1Ҁ"ux"u"@17ZHt@r1Ӎ175p6=$7^_[SWV$h$Vb Vi h0m%P91Fta\$SWM t?|$/uH$V9PVS| 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh'P ƅu 4$ 1$^USWVHu\$ $Cj j ShWuu  t !hVW j VS费 6]t/M I9Nt vuvvS jjS| ƃPjSb \$fD$=6~%|$@jWf 6O$Cuu SQ VjP 1D$ PWh &! D$ PWh?#h_$踕 81\$@jPPhSvv thh!Sw 8Sh_$b -D$ PWh`$8$\$=6~N1PD$P] T$@L$H+T$+L$x@BѺMbiy1fD$ PjS< u,/8t%8#tj}ud8AuZku<FD$ t:D$L$ PQhhu4 t\$ ۋEu Y D$ PWhE$0 1He^_[] t$ SWV|$GHO~H0^_[Ë\$1NWu4G `f@u18t '8#ug GHO~막뭅tUSWV|$\$GHO~H^_[]1M;G~ uWS u4G `f@u<8t 8#ug GHO~렉륋t$t oWV|$h!#Wt.h'Wt!t$?tt$ hD`$趒 1F1^_P! th`$j Vt$ Vt$ ! t^Vh`$j USWVHE ML$8t$QPV6k DUt$F|$ |$_ $8f$Cىt KDP@uD$ tU1|$1 ,,C t ^DH@ujGt-Ê tU1DA@CCu 1OD$" 8tU1L$C CDP@uʃ;K}/ K>C<\W O Cj$jfGٍ$'jY| 1$'t$'1T$JAjD$ $$ _EPb7ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$SD$Z7$$ D$ PhW&  hG1$C<\  Cٍ$ j  H$$ j  ÊttU1DH@tKCu$ D$VVD$PV9z Ǎ$$ D$ VVD$PVa9T 94$ =R11@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$Z7L$ QhP Z711 |$ 1 $R78t1BuڋD$8L$ Qj P 8 Ǎ$Pj t$7 ^ŃuuD$ L$ }D$HPQ4xWt$ P $(4$hUt$P辑 L$l$ ȉD$<9 ɽ|$XtU1CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't tU1DQ@tVFu$$  Qσ s[襜j $( PS 腜8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A tU1CDP@t Cu;|kwtU1Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VUE =b7 hh V, EKCDH@uٺk$yG=b7 GKoCDH@uٺk$KfCDH@uٺk$ GQC t _DH@u%ƋD$pW@1҉ϊ@usFCDH@u\.tDH@*Bhxjh$(Pv 1 $ 11E\tuQtA u>AGۅ)=wSVƍ$ jhU uG1,X7t!9}uEpV|*mj X7xt$p@ X7>GWVZt$F1EjhhO72 Å1|$څ,5Tb75Pb7h%l$|$t5Tb75Pb7hj$O7 O711<X7t6 uGp5Tb75Pb7ho$ W߅uFuj7t@PEj7j7P,j7(^_[]R5Tb75Pb7hVj$jD 5Tb75Pb7h5Tb75Pb7hn$(5Tb75Pb7hIn$Q5Tb75Pb7hn$5Tb75Pb7hm$5Tb75Pb7hn$jjA 5Tb75Pb7hk$5Tb75Pb7ho$5Tb75Pb7h6o$5Tb75Pb7hdo$n5Tb75Pb7hk$X5Tb75Pb7hk$B5Tb75Pb7hj$,$P5Tb75Pb7hj$Shs@$95Tb75Pb7hvn$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@uj7_NSFJ1<X7tJ9ouwvSt?G $pS |$698^_[]Ë$@S5Tb75Pb7ho$j' SWV׉HЃ s%j SVh G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S31 uC9j7sj7؃^_[]Ë5Pb7=Tb7SP PWVhkm$j8 USWVP׉΋$1m~ w]$hf$ 1at*dt+fuC j   j j t C$1E^_[]USWVPӉ΋|$)MQ1?t@$M7Et*j @x $ 1$ 1>u)jH1҉P5( 1 ( 15ojnH@( 18 ( 1>u j5O7h(N1u b7P9 h3!j} HGPPhp$hN1 j USWV\$|$t$ b71EtB5$b7WVj Lb7Lb75$b7h1Lb7Pb7Ht8h"p $b7 Lb7I Tb7Kph8#jh,b7 rfHb7"Db7 ...Tb7,b7Lb7@(b7 b7 =Pb7u(b78#uxnu b7  (b7W1 t,E-(b7@J} b7Lb7R)ʉ1ɉLb79‹\$kPb71m1 Pb7QPb7u>#u~nu b7t$b71B C1ɾ8f Pb7@(b71ɋ\$uPb7\$t1A ^_[]ÉWQhs@$j USWV|db7uN hb719u:=b7udb7M1M1Tb7b$lb7(N1pb73!`b71NHQPPdb7=M1P觎=tb7tCtb7SS5Tb7 thtb75Tb7J otb7=tf7tMlb7t=(N1tP9Vlb75Tb7htf7 tf7pb7=`b7t`b7hb7 hb7@hb7Tb7=b7QPrf|$b78t0W5Tb7tb7V} W5b7V< =<W5Tb7$VX} W5Tb7$UA} VH AUv PWVhp$Whtf7 9htf76lb7޻t=(N1t Pƌhߋ!htf7t lb7rH9tt$t$Pʯ lb7H9tȋL$!QPį pb7tf7= b7uPb7Tb7lb7(N1pb73!h"P db75Tb7hs@$ Y b7db7$@1Q5db7PA 5db7h\b7hXb7 ƅttbXb7|0 uNt$@ $@ $QV5Xb7PPb71@|^_[]5Tb7hs@$j 5Tb7h"hp$hnp$5Tb7hdp$jg hRp$hRp$W =tf7uh[p$W htf7j h.p$벡db7@ u:HQP~ QP見t5db7P@ 1=b7t  b7t SWVhb7X1t^h"3 t&Nj@HOW0uW[뾋HWP? W1F^_[Vt$Vt^Vh2q$jS Vt$ D$tVPuVh>q$j+ V^WV|$t$ WVt^_WVhKq$j SWVP\$|$tj7t PD$jPSW PLtj7VPSW tj7^_[USWVPb7jhxj791FD$j7O7j7JBtOz T$R uW|$+;A xj7|j7j7ыR L$y th|$ Pb7)щ;HT$7D$t{T$A xj7|j7+j7. Pb7;H@ xj7|j7|$toj7u1ۉPb71;APb71;AT$t1~T$ j7=j71ۉ__ WjWSQPD|$t4JT$B8 Pb7;H`j7T$j75j71~>~ VjVWQPwD1FT$1j7=j71ۉ__ WjWSQP(DT$t tCsBtt$u Pb7;Hrj7xt$tPb71BtȉÅQJA7$ i$=j75|j7$=xj7FPj WeV @) |j7QPW  O7Ҿ5=j7 j7R҉Y = 5Pb7h2.!5lb70 u 1Pjhz"xj7S1P5j75j7)1Pjhz"j7S1P5|j75xj7S%1Pjhz"xj7S1PS =j7 T$xj7=|j7GPj SU ƅ j7D$4)أ|j7j7 5j7j79aj7j5j75j7hxj7j5|j75xj7hj7 4 5lb7rj  T$xj7|j7D$<=lb7(N1=, 111 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;5, 1r5lb7jjh3-%K5lb7j$7 5lb7j ' 1-RL$ tKQD$ ;, 1r5lb7jjh3-%!K15lb7WjS Kt$ tsQ9tejPhj$"S tQF;, 1r5lb7jjh3-%J1j$)q$Phq$5lb7" Z;, 1r5lb7jjh3-%kJ1t$ D$13Phq$5lb7з F9ut$ t$L$)4, 1F9r5lb7jjh3-%I5lb7j$ 5lb7j lb7@ @9  ֡b7 j7u55lb75|j7j5xj7I=j7t5lb7j F n jhxj7Y j75 =j7( 5lb75|j7j5xj7.I=j7t5lb7j 볋5j7j79j7+xj7T$JQj7T$ut Q;P |j7T$Ij7D=j7yBu%hh r^ F 5|j75xj7P蹝 ;|j7 jhz"r虝  _ T$=j7ujjh "hj7 j7D$0|j7D$,xj7D$(j7j7j7xj7j7󥣄j7L$(t$, j75j7L$0 j7j7j7j7=j7_ |j7QZ=R19xj7 @ xj7 |j79r j7֍j7@PQj75j7 F@+6vFt P2 uF6^_ËFp vhs@$j& USWV ՉL$j7j7щT$Љ$ tU1j7E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B j79r7 j7P5j7j7j7j7$j70D$SPt$VB it}ŋ4$L$]\4$L$t&uE\j79r+j7P5j7ƣj7j75j7F1C4$j7j7\$D$ j79ȋ$r+ j7Q5j7;j7j7j7 ^_[]USWV`}$111D$hq$u W肾 uu5h:>ut0Gtgh:;uh:$8u H1ȉL$91t*V(t@T$?D$D$t Vlj|$\$ |$t?1h%Sm t+8ttDGhq$j" 1E L$3* th0m%h u3hs@$j tD$PWs uhq$ۃ|$ tt$ uhq$뼅tt$X uhf$렋Cu/h#J$tjhq$VV̕ VeSP QVhq$ 1%Phr$hN1 j UVQjt@t $e^]Vhq$jՖ WVP։i1ɉQPW\ V?t$8ti1H^_i8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pV- Cf{~a11C403t?L$qPYt+{|7u!47_3L$1qP D7EC9|^_[]Vt$FtKPF tvP~v F vvvF^USWVP1k<1~41$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ùh hUSWVPk<11$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùiGi8j)jhN1jjCh$4jm V1=j7O6VA t* jjj VV趁5:舥j75:腥k7j5:@k7jPk7t#1ɺ1A<.uj71 1@^USWV D$0f 9k7Z k7,I fEE!f ufE(Mt!U1f~ t @9ufE,$MYtE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? tU1DAhN1j) W耾@$r$MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$r$E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuLSA=m$ 5:5:1QQPSHt$V5:65:Hb1U)19}1ۋ$p$)ŊEt9}1< ˊEE5:h$1VV5:袃UVj5:萃Vj5: 5:!5:s1= lU1DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&hN1j( bxu+=j7 j7σqt$V`VVt5:IhN1j ,$,$fUuE 9|)BfUhN1j ,$T$4xut EfEuGza|1x(| E9}ED ufMhN1j !}Eu)uE t uP觷u̺f;}]D; jtPD; tt$4UЃF4; ~ttt$4WZu-E tuP u sE uusEk7,Et)uE t uP誶uϹEtPEEf~3M1tRMEGЃ9|׋E4t t$4UЃuPrEE tP9rE ^_[]"Ot$5k7t$t$h~$hN1 ZN$@ t$St$t$ t$UPh$'N $A It$U5j7t$SQPh$hN1腖 $j{ USWVT$qЉD$ q`Gud$ T$T$ $P$ǽ)j P&)1Ƀ QWl$ U|$ WD$pS~tS;tNt$Cj S&)؃ QSVWD$p~t G}uo $ $l$Atl$|$qKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCA G΋<$9Ƌt$ufth$VSw||$Gu1PPw$|$ GL$G)VQw  wH ^_[]D$L$k7 fAËL$1x9 k7~k7USWVl$0.k79}=k7DP5k7AǍ PjQK =k7ۉk7t @tFj-k7EtU1\Jك@to@uwt uDZ@t< ty< =,k7u =(k7tI5 k7rtj 5 k7(=,k7uj 5 k7k7k7(k7,k7?=,k7u"5 k7rtj 5 k7j 5 k71,k7(k7k7k7,k7 (k7f)k71ۈD$uk7C5 k7qt$L$4 5 k7$r9Ƌt$|25 k7rVUUU9}j 5 k7|$uCj 5 k7KVW5 k7Y E߃ @ Ȣk7k7=,k7uW5 k7:qt7j 5 k7v%5k75 k7PU(k7,k7k7k75 k7# ^_[]t$Phs@$VPt$D$ L$ $PVPo1A4$^h "t$t$t$t$USWVP|$ \$$l$(t$5 k7 k7k7D$,$VpUP1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW:j5 k7n1ɉV,$E|$@t[D$@8tRD$u:h%5 k7St$@5 k7Sh"#5 k7SWt$Dt$% h#%5 k7eS4$/5 k7nD$ 5 k7n5 k7(o‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US5 k7RS5 k7nthl &US5 k7S/)PS5 k7 5 k7(5 k7zÃ~0L$ZD$  z" L$X1)<(x1 tU1~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP QtRD$(υ~] $9I\$)RPQ KOuLuH|$@tAt$t$D|$W" W,hN1j* D$z19Dzf tN;L$$} tU1DXuhN1j  $9A)RPQ $8GED$t+)j Pt$5 k7L$k7k7D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P! 4$G0^_[]h "t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(5 k7Gk5 k7'k$tKۋ|$,;SS+|$0L$Dȃ19AD$LD$Ut$HPW1t$PQQc Źt3;|$,t.D$DE9}S*Ń1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j PStC@j P=uL$$)݃} 9WUQS5 k7軃ƅ|$ ŐV|ƅtV5:4$5 k7PW5 k7IPWE1PPW W=D$E|$ GWUPS5 k7Pŋ= k7V!PW7= k7VHIPWnE5 k7Pk7k7#WUt$ Sh%5 k71$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIVͻ4$tWV謃V?WʆUP?W?^_[]h "t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUPF1B4$SWV]^_[]h "t$t$t$t$USWVP|$ \$$l$(t$5 k7ݺk7k7D$,$VAUP14$SWt$(^_[]h "t$VPt$D$ L$ $PVPu1ɉ4$ ^V5 k7uf5 k7f^fUSWV $$$ 71575@77D%57W蛍87WVP s$Ft(=p7tvvP_ vhp7 B>vuɸ7X7777ha%$|$ h%SUx e~o~1pMrthCID\7붃fi5h:h"VFb PhWM \$h"W D jPh>#< t \$Sh|$W u4 3%s$W/%PWVbS t }u몋}tED$th"S <=u̍4@h"P Fh6 %Ve0t$VW F7h7h7h%5h:ҋ `SD*$$$ Dmh:$.w1Wh; %ju#D$=uD$h|$d}YhQ % t41W3 t@ < uFrW W jh!#hzV$O Z;5:4cǃ5:1c1FVVPWxd7zt5757@ 5d7hDY EVjVjhEj5:&&nhh7OD$D$@V蛉ljD$ V茉D$1Åj2P  $t|$ o u*t$ 0m%n ut$ %n j|rjUtc1L$ <:B G@9u1PPPPPjPPj jUVPx4t(jt$WCWW11V|$ t$~144ؘC9uWʘVj tPjjVhy"ڄ Z7j 7j"`7=7t j֡ jjwל.0k71 ^_[]Ét$ ho1GQWP PhB#hN1\ VWS =hN1jj,h%jS hN1Vjh"%VdS V1FhN1VhEh%VBS UWVV h?!PYb !|["=7t>V荙Ph %W[ 57E57w%7=h7t>VEPh %W[ 5h75h7/%h7=0k7uhN1jjh %e^_]Ã=l7tá7tt$P?[ j$R jR h?!tPFa t he]%5a ZjhIw h3j)USWVB L$Q#  P. Ń j h%UL ~ uF t$|$ WmP WfD/UWO Wjŋ>7Ptn,$n ;nu:FUWˏt^FPv賏tFljFn ~D$P 4$ UV S, ŅS ^_[]ËD$L$I41@fUSWV1t$7jAV迓t$t$ t$t$4$jVP;=7P莝t$Vj &>hj]jYj݄{jVf ȁV Vjj^4?157y7VPX~Bjhy7jPWyjhx=\7VVNu%7ǀ$jhxupcx7Phs@$jX jtO7)tTPCu2PKu#PuajhxP輚^_[]Ë$l$ D$jP辋tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UFG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U#tG9uVfVfSWV1t$t$t$ t$t$4$57jV!jr4PVf8 7$*tKuKt!Pуt7$P7L$$Q1 tXD$t$VSVx)VOud %uo %t*V@^_[À)ujh\qu Vst5:u1WW5:W 5:I5:uSj 色9;xhj_jZjA]jVWJd %o %}C'USWVο$WQSb  Whz %S WSUF  Whg0%Uw S1tGUt0VVVVVVVVVVVh!h41PP-t USw^_[]SWV$SQV  Shz %V SVW  Shg0%W WUt VW^_[WV1t$t$t$ t$t$4$57jVtkjo4PV[5xG7*tD$$tL$PQ\t$ViLtV訕^_ÉWj U?t1hj`PP~u{=fUSWV$$$$1EQt < tEBT$BL$ Q>D$l$1@$4V9D$pPt$VG Z$DaD$|$ $%t umtU1DJ@tiOGPXhg%dj D$(PW#~ L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5tU1t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8utU1DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV| \$ 9tOL(tu(D, $ $ rt04 Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW] 57t@WPh %VKN 57577sh,"h %N 7t*W蘋Ph %VM 57P.5d70tPh"h8%%j[#1e^_]Ph %hN1M jD UWVVg =h7t>V1Ph %Vۄ 5h75h75h7whߋ!h8 %M h7t81hH %W茄V藊PhS %Wt 5h7O$0Phl %h8%%j[,1e^_]V1hhPhTPjjPj jjh.1h4xjP٪V^hN1jjh %7tPjjh %j(C SWVD$x1|$7th7 P1; PyPVh "Wב^_[USWV$$$L$$QPhVH $h"V $D$W&v1K4$o 1G9r6|$  WUŋ$(\5F4$xo ÃugD$ PVuH|$dh"V+K $t:|$G=7tVh %h %PJ 1KS1D5$$t 4$ 4$u7tVh %h %P)J 1ۉ؁Ĉ^_[]UM$$$1KB USWVu ED$l|$(PVWt  ED$8D$1ۉΊ<'t  j Fj'VWu VZ ljt$ t$PSR D$ t$ )VPhz!L$QP h %Vf t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/WvV tWD É@/ W1 É|$PD$d S ND$+D$D$ .t Vt$W{ tS Džu]D$T$L$;ȉD$Pt$ }SD$L$Wt$t$ h %P 뒋D$L$T$;t RS |$\$$h#W` tf h>#PW|$W*WdFD$ jjD$4Pt$0V* 9uL$,ȃttbtuV|$ $j$h %V 7t VPB Vj3 l7c %t$, t$ , 7t P7L$,ȃ\$tuht$-,1&1tthNjt$,1hM1Ye E@L$utuL$(T$0Ét$to|$ SDSDىÉ; :thPjj) :|$t19ut hz"H(=1CD$ 0|$>9}<D$hP(I=Dob|$u9Mx{;5:tV7DjPi|$ۋ|$t hz"'h3P'bM1H M1~M1#hM1< 9Nj|$taj ;5:t V`|$ t E%u15:15:3j5:Skat$(.{twP{uW {D$td$8u-e^_[]D$t$ hx %j0 Vh %P6 1S) 1FV) Sjh%( VS{E st$z) $ D$pL$|PSt$(d t$ Z7t*t$h %P> 577h7t*t$hB#P> 5h7hh7hk&D$ 0Ku.h %D$ p3ut$vY t$e s h7>Et`8tVP+ u%t$V6胝 6h % j:L$1Ph % USWV։5:1@P5:ZQ5:$_h<1PSU% @9hPm$9hPS1CS}% 9Whs@$z9h9$($FPU^5:W@@)VUPRQ5:ZtcjPt05:胫PV虪5: PV1PPV贴 V+^^_[]hN1Sj+h %Sv3 fUSWV-1@=4k7$hx%Pjq hfD$1D$ $ $?$V9$VWePWt$ b VWJG|$%v$tU1D$WPWt$  uD$L$DAu >uD$ |$O 4$ ))ht$P FD$ |$$ ))Ƅt$7v$(v8 }? jSo ƃ $NfFJu1ҹhoRRRRQRRQjSD$DPju4D$D$D$ D$ jtoD$ Pt$誘D$ p 4k7 )) hPh8k7 14(v$jVh8k7 t1GuD$(Vh%j@$S^6 1PPD$0PD$XPS t|$Lub4,v$h8k7h8%%h'jQj"D$L1QD$PPQQSp Sh%s1=8k7su=9k7lutU1 :k7DH$D$$Phe]%T u5$nfsu( $D$1@D$ |$$tD$$D$$i jvh1Wt$TVB j!W|$0W2 iW&]hhd%QChr7PPj=r7 ht7PPhh,"h0%18 Ph}%j)o h%Woh-%W oh%Wnh%Wnhr7h%Wn =t7t!ht7h%Wn $9h%Wnh%Wnh%WnWh!%jrnh8k7h%h DŽ$ho7VVj~7j hh%V( o7defa1ȋ o7ult1 j hb%ho7~( o7manu1ȋ o7ual1 o71 o7none1 o7 tlf=o7 tb=o7t`ho7h8k7hr%jtCh8k7h%Sj~$$po78l7hhI%FOhGfh8k7hI%hV%hL [ 8 8l7hH %D$ Pj3 ~ht$ ht<7xz1ɀ=7/7QPh0%hhh7b# 1^ËL$1Bhd7WVt$=4k7u jG7Wj τu1@l7<{57[1ɀ=7/70%QPVWh7" )1ɀ=7/7QPVWh\7" 1^_Vt$V dЉh7$^WV D$Ph<7 u:$nfsu-Vh<7h7B Vh7h\7/ tWj Ń1F?t[h7hb7h"%jPu>@7U%h<7VWh7! h7VWh\7! 1 ^_SWV=4k7hU8l7u(h m%O\u9hs7h^%U=7t h%践=r7t h0%衵|$h8k7hk%hW hߋ!WѶƅBWPh|%j[hl#V[=o7tho7h%Vw[ h!%jh[8l7uGWPh|%jI[=o7tDho7huo7h9o7h%V#[=8l7tCh%Th8k7h%huo7h9o7h%VZh!%jZh,"h%ӵDPh%jZ %SWZh-%WZSW}Z=;m7th;m7hH%WaZ h9o7h`%WNZ =;m7tPhs7h9#W-Z h:n7hB#WZ W: h!%jZh%Zuh1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#t "$%\$t7ȉL$7 T$wXD%D$ %D$$`v$ "$uht$$P %Pt$h%t=uD7L7qQPh%u#$#d D#t $D$ . % $T$he]%RcT$ D$L$ 1@D$h%;T$^%D$L$ he]%RuD7#t$$D7 "@t3% "y8% "t@%T$( "tG%T$ |$$ "tP%L$, "tW% "tc% "tk%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h %t$D?@غRPh%t$>ClE;F{Pp\$CPWy S|Bt$0|$4hb轕L$0QjP2. P7W?BtVhq%t$t> SB=p7u#D$@p7@@htPfhs%\$ S+>h%S>h%S>=p7thp7h%S= $ 1|$@VVPWh%x ;w "r#t#Qh%S= h%•h%赕h%訕=p7t h#%蒕h*%腕1h!%WG=Sg We^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ Lw$h3%U辢 U`uh^%h3%U藢 U9FjV91Ktljt$b!hB% G;W$G%G wb!GhT%ׂ G ;W${$%C(s4C8Lw$hf%譂 C<{@%CDsP$sTLw$Sh3%U̡ UntlShx%U谡 b!UQ F;W$F^ FSh%U| FLw$U F ;W$F$^(F48ih^%h3%U7 Utl^%Whx%U b!U跁 F;W$F~ ^Wh%U FLw$U肁 F ;W$F$~(^48+4$iƷm۶|$9>7h%蚙tzh[N#ntiD$h[N#Pj菘 ?Wl$UVt$t$>6=Ou4$=7Phs@$h 1PPv#7)t5Phl4%hU 鋔$ 1$ 91APڐuDFl9Ɖr:7Phs@$hR 1PP"%99ƻsRAklT421GWWjjhUt8RVx L$ $ g|$8jh\h%h%hh%) L$T$jt$oËL$T$jt$XWV׉κ%jujWFh "Vh"脔 ^_Vu71ɾ 9r^^VD$u7tU@8xtlIuAH1FVVjjhhu70QRx tjhu7j tu7^À=u7tjhu7j u7USWV 1WWj &iP*SPj  t$ átU1D$1/dev4$D$iƋ1N/ u1FSt$$P /dev uDL$DAt|tER|$$t.jVj t tU1L$Nj4$D$/devG4$D$M[1O4$1O1V$: ^_[]USWVPD$tPpP11OFtFhe]%P]t.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T%w+%Phvv!h0%VYn ^_[]Vt$D$QP^Lt(D$t%t!hJhPQwD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$57.@ujP2D$1҅D$t 9tL$BuT$ЋT$P]1hPPhgh;jjAPjQQh@.1w >i4WP[w 7M} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@hPuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPm0D$1҅ӅtwU0t\P,40U t5L${|$P=$tL$ST$Dځ8Nut/$E t$-6Ёl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W.ŅjW.{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ D$$@$;E tL$ A;L$tI1۸hSSh3Shj t$pT$,ȉ04jj h "RPjV› VSh$ht$ }G8@É؍e^_[]y7=}t'fy"y7 y7NuEt FuXt1€1ɾy7( Ӏu A'w'y7 ' Àu A&r  uȃsƄ\$,04t$jj h "RPjV褚 $PVSh%ht$yD$L$a!jPD$T$AjP{D$d$jP`t$,04ڍ\$jj h "RPjS W$ePSVh%ht$ < -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ h9%q Y|$he]%u !DžtohLw$6 tkDŽ$v/rDŽ$/dev,$$VuPf D$/devf@/VuPf Q褃낋E\tu xt@@AED$57$ttt$PуuN7덬$WPU[e t$/devfF/7WPV8e [S \asTa9aO$CQPUd {PWV7$t(tt$Pуt Nj57,$1D$0$h@hP5tt$G7PUtTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jWÅT$-t WVScc $WD$pV  l$ Uh%Vx ǰD$hh%WŮhL#W诮tyh#W蝮tghZ0$W苮tUh%WytCh5n!Wgt1%D$tJ%tD$VPSb VWSb Uh%j DžED$4$v PS| t"vhs@$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=7SWt$t$$1PWt$t$|$u1@G7s70%VPWSh7 esVPWSh\7 1^_[USWV |$ faa@D$:$1C "=@7th%j@7VrPWh8%%hXvD$PU%BD$h757h %j誙x@7rW!7u7QWh7Vt$D$PWh!%ST$'D$D$ =mdt2Vh<7h7藛 Vh7h\7脛 1$hVS藙 t$t$t$D$ {7jVVgF ~;Ƹ PV?D$i jQPVNkt{7Php7 u`~*=@7t!h%jW1@7Pjn)D$Wj>\$tt21ۅ1C؁ļ^_[]hQ!%h?!%hhr %3 USWV|1ۀ=p7t}hp7hs!%jǕ ue@7!%0%7h<7VWSU- h7VWSh\7 VU|#N@1 É؃|^_[]ËD$L$I1@Ã=@7th%j*@7Vt$ D$t PnVjR=m5d7d^USWVPWj%=1F?tih7hD7h;%j谔uL@77!%\%h<7VWSUh7 h7VWSUh\7 1^_[]SWVPVj<>u1@;7^%h<7VWSh7 h7VWSh\7 1^_[ù1@t {7It1ùtA{7t 1ùD${7Au{7ËD${7SWVHhlhy1$hWV0 /1WSChWWhWj65{7WjWPVWI4SPh;V|JL^_[USWV|$1i*t\,tW{7tI1r rr2+u&1q,ur1ۃ+݃r @뜃|$tB pBB^_[]USWV|$D$L$BJ +uQ={71۾&-{7B+t#,urF{7tu{79u'Cϸ{79t0{7{7t{70 5{7|$QKjVPh%W!^_[]WV|$t$ Ntȃuhe%1ke%o%-te]%jjPWV^_USWV|$=7t h7j;WWG7u7l$}QWVh%%hU 1PP" ơ7t3Ѓ<PUuu#D$=ueߋ$$$t7Pijۉt{uht%j|$t]PUh%h]Z$t7hhSjP2 jP WAV8jUh%h V VtP$t7Uhs@$h"i jj8h5d7 1@|^_[]Ã=7t=7tUh%jw C{71$t7Vt$h[$VߝtV7t \7h7^t$-7u7USWVt$,V踜D$j$t$Vito1\$l$t$GSVhVVj UP L$Vtu(;D$0s"L$44WL$|$)L$OGj$W(iDžuD$@PDžj$t$0h|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$V  1D$44U D$44舛$D$D$ j$S`hŅm<$t$ >tV\$S VA$|$);\$u ^_[]h %h %hhr % SV5/11*t.T$ /19u9t {7t q*u^[V1ɍt$QQPVh% y1t1^USWV|$(1$PPWVh%貐 $D$(1PPWVh%y Z$LF1e$Pj%}4$>$Tw$hwe9$U=ehxLhh!%#ehy2hU eW5d7D$h>jU5d7M w$PPqhVjU5d7%V1t PVW *WD$ PSt$5d7,M 5d7)5d7Sjh"%@ j D$ PU覼 Uh0m%c D$(SSWVh%͎ $j'q h0m%fMuQ1AtCjVl u4Vh!%"1ɉtjVH uVh"%j+ D$(SSWVh%+ u$~h%jTȁĐ^_[]1USWVhh!%h7tPjjh%e1777777/1*u D$8/1ڃ9t{7u@7Q*uD$*u.7719hbjo /11@|$>Z{7M 7L$ 7L$j5:05:貙5:=@7th%j胈@7776P57h2%jaa7Wj 0D$ttRN1ҋ+t,t *u oBrg{7uƃ{771{7uAuVD$u,D$ 7D$71@{77^* 7F77QR575757Ph9%h` jj/`5d7]1{7tvhF%hu>h&_t$FVj&/~th%j轆h%j讆h%j蟆1G{7{7th%jhhe]%_L$QPVu{h%_$QP4uYD$3$L$3$ t?h%h;%;ft!hE%jh;%h% a1=@7th%j誅@7]$1L$VVPQh%蒉 }t|$ th%jTIjS"e^_[]1F]VD$FVjb-F^SWVPD$$h,"h%iat@Ƌ|$]1Ph%S9 4$WV VL h!%S^_[USWV-<21ta1F821t&U78d1tUhs@$h] 111Fo u1tjh1@1^_[]Vh%]t$hPV誇 hh 7VǶ x( 7ƀ 7h)%Q9 j/P~^@%%7^SWVh2%]7hPV/ VF 7K57^K $7(7PVh8%%hW jWh" hVej< 1hhG%WWhjHj j j jVWWW94ƣ21WP'+21V1:W jjdet$5$7hn%WV& h%[$WPS SN SVTj jjd1@^_[UWVjb WW W |$ hPW蜅 j W\tZ7 $7tV(!RWQPhV%h he^_]1PPj~ u <.=tShs@$t$t t$ hSi ut$ w t$k 4$t$ 4t3h*Ut$FVj$~t$t$t$t$б1Ʌ,jQ#D$t PND$t P=Whs@$h-aU jjM$T5d7_1N^_[]t$ c t$ X Vϯ11N4$ t$ t$t$4$VD$FVj#F^SWVPD$$h,"h%Wt@Ƌ|$"T1Ph%S 4$WV6 V蔎 h!%S]^_[h %h%S) %)1ۅt%!t%! 1ۅÉ[USWVhl#hPnB D$1Ʌ$l$h=#U{ ti\$WPS} 9s?hhe]%S = =w%hVS< =wjS t@h=#U u4$1jV 1Ʌȁ^_[]4$1AVt$Vb1|TsrLc1f ^Vt$h[$VtV<7t 7d7^WVt$ D$wǃr9t\*tSPQjD0 V5:0V5d70V5:ҢV5d7â5:赉5d7觉5: 5d7^_WVt$ V9} u.>vx0Y$PVWh2 %hN1, Y %^_WVt$ 0PpPGt$>FFVjG F^_SWV=/1*t/t$/1GtPV[t *u?É^_[USWVj$t$ KR1ۅtKƉ|$\$FUShSSj WVs $Vtu;D$ rj$VRƅu1؃^_[]VPT$ D$t$4$?0VP ^USWVӉϋl$jUtMƅtPt$Vy SQOVUP tP׃SV^_[]VPT$ D$t$4$3VPv ^À=(7ua(7&!7 %7 %7$7#7%!7SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW"$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQPx $LL $UT4L$ L8L$T$T@Lƽ$$hVWUDr uD5<w |5L Ku1PPD$P1 )ƍD$Phd@Vq |$D$|PhedAVuq V躤f$1 GaD$P$,hb!%t$V~W 1PPVa $C]su PUhh07t$It.17CD001 571 u=07tZF9|4$ˣja$,h+%$0uV EPP茯 jOhX7D$4PJ D${O1ɳ$$uƒrL+1Ht$,D04$3t$$,h+%uHV EVPh$P2V EtE @E w-G$9@  VҢ؁^_[]1D$L$I@P{7wʀu{7Au{7 {71USWVH$`$\1$hWVp E jShWWhWh5{7Wj jPVWW$4SP4VH%1H^_[]ËD$1ɋ+t,ur{7A1ËD$1ɋ+t,ur{7A1USWV ։D$ $E1$ |5 D$$ ,$D$!%aT $F!%u"%D$$!%"%u;"% F\$$7 \$\$$&HD$\$$)|$=7=D7=7$ <$D$D$_"%Zn<$q|$4$D$ 7D$0%NS |$D$ 7D$D7D$"%=4k7u$DyD$1Ƀ 71\$21C|$D$$$9$D\$$({|$!<$D$7D$21}=71 "|$l$ D$D$F"%$ kljl$4$+ K=4k7u $hxD$|$D$$.$9$ D\$$' |$u1=b7=7=7$ <$D$D$_"%l<$t|$4$D$ 7D$0%Q |$D$ 7D$b7D$s"%$juLl$ t$<$D$%%i$ \$<$D$C%%i$ط l$4$ܩ > ^_[]Á=51ftp]%=51PFSWV|$ty$7GO4VSwtRVR1 t{So5$7(7Vh75 7h %hS蹯 jSh"y fG21~"PCptVyVS1^_[ËD$ 7Ɓ7 <7fH @7fH1SWVt$ 77V~)S4:Q#l F<7F@7F1^_[ËD$L$01vSWV1ۉShPS$ KtD$$Ph t Vv8Vu81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6eu61^_ðt$hzd@t$  SWV$1ۉShPSW^t/S$SPW3V)y u81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=71SWt$ t$L$ T$rD$T$SWt$ t$qD$ ׋`7t$ t$(6#%L$\PSWt$t$,t$RPPQʫ $71WSt$t$qD$T$WSVt$qqÉ֋=`7t$Ht$HÍ$PWVSt$t$#%PPPQU $VD$`Pjhs1@USWV u C(D$|$8hjWIf wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@Ǿw$|$D$u$x$B x$B x$Bx$QP׾x$B@ tu ǾXx$pЋ$+L$L$8L$9Ǿx$HQQQQRPRPjD$ tjtU11҉tDH@tӉOGڄu܅tEۋl$0t/t)h#SD$ jL$ tEH/uj#EH@EH`L1^_[]/EHjSP_ EHHLSWV t$ vDhR&WSj 1WSSPPjjh= S9FDNHA`1 ^_[ËL$Ahh0USWVL$Ayt~܋\$;;tlHu\$klT$<ư\8L$A$0;N @4$v9D$F@ F5 7le^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ| 94$ukGllPw^GX FPv8t~C $i)ىQRPe 1D7D77kfD7 D7 4$~Efn'  V)RQP fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jP(L$ A$W t׉\$ A Ou\$ H7fA |$tAkfAA  1AA tAfAA  A AofAAe) 91jEVVhKhqhrjJVjVQPh74C(OL$<@C,SP{,BD$$4D$+{tR[L11HD$Cu5{t/t*Che]%P\uF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0#&ƋEp&PVjWWUJƃu4UtU-ƃuEtDjUуƃu:C(C,SP{,1s$=C$10s$"C$s(\C(1ۅÉ؃^_[]h #%h #%hjh"% USWVt$ kFllPvzNj\$FFi )tkllklPRQ ,$kl11CPsNj$ /L$s)RQt$ = 1/D/D/D/ {l$ }$Ffs$fCEfC S USى1M1^_[]WV$|$hWP t,1HhWWPjjPh?- WP1^_USWV7t$ 1$Ve/} V$T$GD$ pjVD$D$ 1ɺ<t$vt5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$tt$ Vh#%D$DP D$8D$ D$8t$XjVt$(1IQjFj QP D$89D$ t P诼V$PF |$YtZV: MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ7}] aVt$ 聺t$u؉e^_[]USWV D$ 8t$8L$j QPU} $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQP@VGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋71щT$1)΋EM M1WRQP'@ljT$1Pt$uu @)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VS?D$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$hG#jVy C `L$rL$DPhh#%uL$DPhm#%jQHy D$D---D$D$s`7CjO SjPw ƋEx tjP SjPV 1jQ SjP: ÍD$ tSWVh#%P( SVh#%P V)W S7D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`hG#j$Pw t"?tt$ Wh#%D$LPH D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t P&$PW?{{ t|$uuxD$t HL>@D> >jhYV> wE%rhD N+$uR1jPPPh9,hPj jjj%VjM4x!t$PaWuV 1@^_[]h#%h#%hh"% WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ x$N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; y$tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh@#jS_p t$]E-fEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuB6uKl$Hx@D$ J$D$1QQWPjV 1Cx19l$1C؃0^_[]SVt$ t;he]%V5t)h%V5th$%V51ۉ^[7t "WVD$L$ t/uu?/u68%%8%%t0%/tPQVhh7*m 7^_Vt$e7t "VQ^Vt$A7t "VQ\Ph%%j3& ^WVt$ 7t "VQ$P)v 1y 487tVh%%Po 57&=h7tVh%%j$ 5h7u3^_r7t "WrFhVjPU PhB#hN1)o 7tVhB#Po VDje WVt$ |$7t "WQ PVh%%j$^_tËD$PPUSWV$77t "$VQ$UPV( Tt "SWt|$UPW' WVh%%j;$^_[]USWV$77t "$VQ$UPV' t "SW|$UPWd' jVp u 1$uWVh%%j#^_[]WVt$|$ Z7t "WQuVPm ^_USWV\$S1ǃPtOƋl$GWSP@% 7t "SQUt$ h&%%j"tV 7571^_[]á7t8t7t "Qh=%%j" u57衧7USWV=7tt$oVU0t?t]oVU0u17t "UQhM%%j"u%7;=7t؉W1^_[]USWVt$|$=7tAj4jjá|7CUWPA% CUVP3% |7^_[]É^_[]SWV׍$jhPjQyx8ƉhjS# jWS$ Sh{dЀV! V-U^_[V=7u|757tT77t "FPQhM%%j Vڥ뽋|7NV,V轥5|7u7^SWVt$|$\$T7t "SQoPhs@$WV_^_[SWV|$t$7t "VQ3WPσ1ۅVh_%%jg ^_[t$h@t$ht$h}t$hk1Ʌt$h@P1Ʌt$h51Ʌ1=7fVhd1ɍT$QQPRh%%P# t4BIOS3L$T$1 tUEFI3T$t$ u ȅ7h^ÁPj(USWV41D$D$D$ 7()$tv $D$7D$ L$,1$ 1D$kT,0 Ut$,G|$ T;|$,D$u1VjVQeClǡ7HVjHDVVQ?7$wOʃD$$&;DHDH1PPL$8QPjhP81 xt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hj膐u t1@t=7t@u.1}hwju tEx &%rti&%tW&%M u@=Uu,>t'D$ L$7;\M`|ˀuK(Ѓt tu tPjtjWGƍD$(PV$1 $$QPV4G $VHH9$ul$`=u]tP$PS $5fǃU'VGWhs@$h&% uce^_[]SWV0\$@1҉1 F FFF =7tjP4D$VjRRS/<^_[USWV7(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$h&%jt1e^]USWV8=7EM 0~klP1ËE E8؃lklQSPO ߾y$󥡄7$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C^_[fL$1SWVPӉh*%hߋ!P|N tǃuOWjj1hj*%M=7th*%oPhL*%WM h*%SPhL*%t *Wjj(h*% Vh*%WM W8 th*%h.*%Pjxh*%Ph$*%Qjyh*%P3\ 7t 4$Vh>*%PM 57z 4$jhE!V' 1ۅV#؃^_[ËL$1Bf7"Vt$=Գ7u!w v̳71;57s 7k4ȃ(^Vt$=Գ7ueN1w|$P^ËL$1WVt$|$L$ ȉ1<ɉ^_WVPt$j Wt$y 9tthn1^_1B^_M=Գ7uD7ËL$USWV|$=Գ7u1t$USWV D$ =Գ7u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ ho+%hW+%heh+%*o USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]h\$|$ $T$ tuR|$Nj\$QPSWG L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$7u Pm7D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$,z$d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uthu1Ot1L$D1 L$8ɋT$]t"9tjQPw T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(7u nk7D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$uD$ D$iousD$fictO4uQG4 t51ҋ5tU1D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuD蓼 l$(Ph,%U hߋ!U> [Ɖ$Uh,%ju D$Ph,%Vlu wXw\w`h-%VUuPwdh-%V7uwTh+-%V&u f1ۍ{aE4X{$WuWuWh6-%Vt E< t<uEMPWQWhN-%Vt$<I3-%9|z"PVtC9z1h!%WztV D$PD$Pt$\$4Shs-%h]-%WSK 1(^_[]h7,%h,%hBhO,%h,%h1hh,%h,%h h,%h,%hh,%h,%hh+%d USWVhjp{1O1ۍD$ShPS$49z9+ōF,PhedAU l$$4$0$($<$8у|1҉$$萹 F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$t98t4 .jPL$Qe D 9D$ u D$4$L,$F n$9Љ} 1F$F )ЃF n$,$G9t$e$$$h-%jP6 r=t31>t9>u 9>t0uk9uVuVtOVtU#1@19$,|;ЃVtt$#؁^_[]USWV@D$1PuRhjm;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^dtz$u苶 FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h7,%h-%jg6hO,%h-%jh(hh,%h-%jih,%h-%jj h,%h-%jkh+%z_ D$T$ L$DrRQP ËD$Djt$ P@ USWVl$j/UzD 1NtbNj\$)CDWPU uHD/t(t+t!u GF "u^_[USWVPӉ΃=Գ7ui"sv<̳7 77tx(9w4Ju1AQP kã77H 7k4+$1 4+VhR&jR1 1D+ <+ hm\VPh*%jWf1 1D+'<+(D+($D+,t+0^_[]V΃=Գ7un̳7) 1t(@"u7t 79t 4Hu1^USWV|$4L$0Rt$`VQW%3 ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=7u X7~V19|(1@@89|~@w1A^_[USWVP=7|$(L$111=tz$"\$uӀt0t u@tӋ;{$tPt$(t$(t$(UUt$0҃|$(u8څu1u&1htz$t$(t$(t$(PPt$0{$ 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVjnhhtz$hd7 d7e7r11KjiYƃwD(|$DtGCuޅtH=7P+Y7t)1ɀ<t $|$AuVki^_[1V 7t(71t ҡ7 7F9r7P#i^fUSWVPt$d1hS4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$h8%%jQQWRjjh-%l,1^_[]USWVhu}WWPHD$T$7L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv7@u ǀ@>1t$(F F>D$,Vt$蕈|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W/4D$0F;trԋL$4T$B9rwP$3|$4r!1FD$0P3F;t$4rD$0=0D$p۷D$6ͷD$v辷D$  "1ۺL$#PWVSh0RQKt$kPW "PShPV%7VL$'Qt$t$t$ t$PPhg$h9$ 7$0$7$pFt$uD$D$\$(1t1D$pT$xPRVу t\$8CfCC,ffC C :CfCCH=7rC fC*C,VG1ۍD$(hoSSSSSSSjjWPh 48Pܓ@,t$VW˅WߔFuQ1K5H7lbt PZbt$蚔5H7@b1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h.%h.%hyh-%F USWV$(E]0ƋEpljl$E@ t P׬ "PWVSjh]1U57|$ ww #%t$R5`7RPSQV U57w$w b l$45`7RPSPUn G\$skh4SjPD PVX7j!h/%V VD hq%L$5`7PRUQ h身$5`7Pq%PUS h菫PSD$Ph'/%hhL7 1҃9Q7A \߉$4EPWhW#j$WJ hWhL7臕 Nw@EƆ7 Ft3N$t.1@Ƅ7-H9s Nr,7$EBL$ ;QUL7Vh9/%W Vh7W h9$jİ^_[]USWVX] E81h "PPPPh>/%PPi 9_ vSL$QSWPL t@D$ tWD$8uN \7uh  \7D$9H*h "VhX#EpFa+D$8u RPt QPVW҃71VSt$t$ D$$VSt$t$u L$8QRPt$ t$h>/%Ep`D$V9p1h$YQVu WPTtY$UtOwGD$VP^ )vVQj PW W@ )Q$YQP H LCF;puD$VPhs@$Ep` e^_[]USWVLt$`T$d\$1*kvs0C41GPjh91  9u vEL$QVUPL 1hPPhُhюhj6Pjjt$(SP4ōt$ VPwUކST~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 5H76T|$.H7L$`ʉAfAD$ 1Ƀx fJ1O SS1L^_[]USWVpU t$01^F4jj@M1AǾL|$D$ǃ@|$SPHD$ $7L1OًP|T$|$`1 |$0jP4D$DD$ 7|$ 9ϋ$|$1HPPVt$t$WRQjD$L$4t&t u$Ut$ t$ h0%jt$2AW $ ^_[]USWVՉfD$/D$jh0m% D$5t&跔8t譔SPh0%hU1 VSU/ 991j/U  t5ÍD$9tK9vH8/t@Pj CߍD$ PWD D$%= h$PW FƄ$/u&̓$QPh8%%hUI /h$PU> hh0m%U& e=@uW x*|$VW$P 9r>V ?K 0|$Wߺ W6. 01Ĉ^_[]hUK t}/u }$$tcD$U W~ Ɓ`|$tVhe]%Us| 9=VWU[| 9%|$W x(Wi7\ >1F1SB 0jh$#j SWVύD$ PQA 1xVD$)tOjWx@ljj PW W u $=rɁ uƉĜ^_[USWV hljPhW@j, \$hjS jh0%pD$ƍD$ PhW@V߸ t$1hUSҹ ,$|$tWPx u-`7D$C E,$ !u1L$PPPPh(jPPjjj!Qhm4t$t%j聐t$VW_Wn6Vp ^_[]VD$@t(L$ 4@Ƽ|$VhW1 Fd71@^ËD$ `7fH d7tPPQQQh0%j߶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj ^>D$48T$y:D$ػ˺G$L$~D$<P t3 "D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$ "t$DRQPh03%jV( D$ T$Bj57QP  "tl &t$DQRPh03%jV D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5`7t$h8%%jt$hVD$XP1WWjjj0,7|$4D$07L$QW<W,D$DPVo~ljӍD$DPV7 |$߉څu D$$H؋Pٸ"D$<ho%t$ |$,] {t+[1he]%S t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#Pt$h8%%jt$hVD$XP1PPjjj0胔,j D$DPV D$׋D$@ttU1@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j57PQX |$ RPhG#jW ;`7CV興SjP! jPPhg7蘳 V 5(^_[WVt$ 5:P5:9~$uFjP_.F$1O~(1hg7QQhzhOhRjFj WjPv$hh7e4F(x;F,VPWv(fv$c4F(F$~,v$A4F$1^_USWV4ˋA@Pjq$ɰ C{$t%K0 u G \fG lJu\~$fG G5G G G,G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QP4d+{$4^_[]V$j)ۆNv811Fu >tlIut5t.j+ j,L$PVha%jPQ 'u tEj,j+хL$jPPQ hz"{j*誅L$QjPz6 h9$Tj-胅t$R5`7Ph$jFV j.^h\~$PVh73%hhh7^ İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j57RQӸ L$RPh$jQ G<(\(|(Pu#]j#衄L$>PSWh#%j&Q%j57SWt L$t$>QRPh03%j&V $F|(,u)|$haAPhV3%j(WN <$1e<(Ou*?D(Ltۍt$hPWhS3%t$t(Tt(P?PWh$j(V 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPhb3%v:t 4$0|$|$upd^_[]1؍L$>PWhL3%j&QP  $L(4RttD(8tPQ҃lj$uFt(Tt(PFlj$FD(Lt&hȂt$PWhS3%j(V 4$h袂VjP lj|$D(dphqPVh[3%j(W} *USWV7$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá7H1WjHDWWQZơ7$1$ 7@u <@TX uDHXT=7tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W W "WRPPQ21ҍD$*W Q "QRhQPD$$W Q "Q1Qh0QPݜ&)ߋ70D$pL$$QL$.QL$QPt$SPW0 70NjpL$$QL$.QL$QPWSSj'h0 h9$^0o|$p\G$DŽ$$T$0<$tT$@BfBBffJ B BfJB"B fJ*B,0=7r~(uB0fB:B<>@1L$0hoWWWWWWWjjPQhr\4t8PG\@,$PS3NSG]$X(؃u 7TXK$H~$V1OD$|$\$0ىt$ t$ WD$ PeShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VP.D$0VP.VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u he]%P2 T$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV57/R t@D$4D$8GD$|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!a L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Ohe]%D$ P> t5ho%t$ ) u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$VaGT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$07)ދ7\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQtt0\$4ISJ tt<1^_[USWVGD$57l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 179ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDXAL$D$~@ 1ø11OT$LhoQQQQjj PWWSRh649tBƍ|$WP{(V7x#9}7k<4LE1UЍe^_[]USWV17T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=7t*=711M<t9\@u 9DDMHEr=7tO\7D$PP1ipt$1t9 :ut$P9t:,@uލEpr=77J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@7D WV34UP%V/4SUT$$ BD$4~#l$0XH1G4)t)t w9׉|hjS1H^_[]h t$(UT$, $ WVL$t$D$ $$xh>T Vmxh?Tv4Xxh@oTvu)y8u.q$t"y8uqxu Hu^h#h>5%hm h4% D$x8u@h#h>5%hm h4% V 87; 7tD7t99t‹9u€72t 7^WV΋$tRtt%47o SWW&7uR7$t?7t6xuhZkGj0t VVb 7 71H^_[]USWVD$ T$t C@757tA$txuPdž$ytƆyjh]5%藚=7\$1ɡ7L$iɐ $|1 $kt 8e 8 8M$Ѓ 8QPh0%h$P詳 =7tAt*GL$xQP{ tuƇy1u87y1LPTX) 7 $ف887ǀ,ǀ<j\$|SPp 87"hSPo 9=7t 87 87ǀ7W87WjPm Ft 7rL$AE\$ 7t>yu)79tЋ9u70u1H|$57,1C1҉T TTCD g k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D g $k 7$08h%t"Ph%%Ut$%V辠 PV$ P 7$t8ntyPh08%Ut$%Vw PV$ P 57$,8Usg t4Uh[%ht$%V' hV$ Pa 57$,88U$g t4Uh'%ht$%V؟ hV$ P 57 $X8l$~4Ph78%hU蓟 hU$ P L$ 57\8~~PhC8%ht$%VM hV$ P L$ 57`8~8PhJ8%ht$%V hV$ PA L$ 57h8~8PhQ8%ht$%V hV$ P L$ 57l8$~pPhX8%ht$%Vt hVU L$ 57p8~1Ph_8%ht$%V5 hVUv L$ 577 878hf8%ht$)V hVU6 7t$PUhp8%h+WD$7ts $|$|$ u^ 0D0<4t|88uL$81ɋT<|Dtsu|$ $D$@¸Ѓ=7@D$1HD$$D$1i8 7$P57\$ "$x 1ۋWSPQL $($0}U$W Wc |8/tWc fDŽ/ 7 $< R\c P$PWV t $L|$$t0|$t)$Pc t$ c 9Ǎ$vl$t$؉\$C$;X |$O|$\$@|$5D$tL$4= 7,$Vb  PVh0%hD$)P9 5 7. "t"PS蕔 >tiD$Pt>Sh8%hVT$\$  7$DL$4L$0 70|]t$V赙Ph0%WS 7( ( PQVh8%WSt$\$ CCa5 7.> >,>(>$> D$)Pt>Sh8%hDS$$(t$,t$(r 7t P_4 71`7tWWh6%CTWht6%hN1赜 7t8Wht6%P蝜 71Ntjh&6%P聜 ^_[]1N=7tt$h4%jPeR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ 7V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$I$ytP5ptYWtDžtFE tWPV u WVYjVSs E t VPV1HPPS| ƃx70^_[]h#h>5%hm h4% USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4|$jP8 D$$tI5%hm h#h05%h h4%3 SWV։ˉׅt#GC@CD GjPSlQ u/$jt$hPVYC $$$$D$@{tUh܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP> ɌQkd)Qh5%V# ^_USWV$hX|$hPW!@ $$$${hP VPh5%{hQvvPh5%W[hR|1~,t[hS_1~0W[hTBǃ4VI uhX#V0FT~Ph"hW shU[hX1~`{hVvXPh5%WF\~Ph5%hW躁 shWmFd~Ph""hW蕁 shYHFh~Ph""hWp shZ#Fl~Ph"hWK sh[WPh5%V/[h\1~pPPWh5%SJ^_[]USWV$@1N R$`T$ $ 1jWWVVjjh]|Gl=Ol7,1۹^WS<S1,G,10G041jWWVVjjh_i 1`G`aX"b\cd dhD$4h""QP 1PD$PPVVjjU D$P x1pGp1^_[]1wwVt$F~|F PxF t1@1FF^SWVT$1ۉZBr 1Bl@Zp`Qkd)Qh5%V ^_[Vu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_hu9%h^9%hh8% SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F$tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$ܸ7uhIܸ7s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IV sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW. .Vw$$$$@21^_[Ã!t*Wp1@<QWPV/ rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Ph:%Q D$D$uPh:%jwt1ۉ؁^_[]E@USWVt$ $=7$WhC<%jP 1t t^_[]Ë ظ7 ÍD$TWhU<%Pj1~jDj舜tD$$z"Vt$X]Vj]D$(D$`C\$\C D$XD$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h"W ƀ8tt1tCuVL$ D$ j jVb É$qj jVa t#D$Zj jVa D$T$C\$ \$D$|$u\$uthhtPvL5W&߅uv^_[ h<%h<%hh8% D$ph<%j iSWV≠75Ը7t^s踚3讚t#$t$j(PV 4$l_u9hm|$0VPh$jxWY WVV &t Ĩ^_hP#hG9%hh8%' USWVσ≠7u hA 1t0?t+̸7t!-Ը7E WP6! tt/|$thh%SA !hvS, u4$$$$$St$h;%j ^_[]SWVD$Qt$Rh;%Pj hz"t$L$jh$P uWhz"jL$tAt$h"W诃 8tjt$2hz"jYL$ut$r1ۉ؃^_[USWVӉ΋|$|$tBh;%S h;%S h;%S h;%Sv h<%S` h <%SJ h<%S4 \$h"S誂 ǀ?t(׊#Є$WP uE F@j`WV -j(W tj)P t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3h""WUL WUUjU< H>wѻPD$x0h""SUK SUUjU H=wˉ7DD$H1Ƀ|1M1҉$PVRUW 1Q\$ SRPE 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á7to.7Vt$ 7u U. 719vFt=N7wu1w7x8^ËD$Hs-s D$.h#h=%hhU=%u Vt$ =7u-(t;u2L$ rȃsd$$tu` 81 x8(8^WVP|$t$=7uG-j PVz =v1t-h{t 7t4Ɣ7^_Ë $9u։^_-=8t8ù^-D$1ËL$T$t$ h3.WV D$$s1!t$ T$L$7GWh- ^_SWV L$T$ D$$t$,|$(;sCShh-^_[ËL$T$jh -WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh;>-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh,^_[]VT$L$D$ NFA0F VhM,^WVT$ D$(L$t$$7OGA0G Wh҇,^_USWVP} uD$Phd,D$Ph2F,1\$}UM;t;Gs} Shl4%q} ~Sh7%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW{ L$D$ T$VQPRt$Vh9%h$PE $L1QhPjVfx`WhydP D$V43|$t;jWS \$;MU}h=%h=%h hU=%q 1e^_[]RSQm Sh%RQKE ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS/x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSVS )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H7)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV6G )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt %hThU=%l T$;}uhD$ $>%1e^_[]ËD$ ML$0t/4t$9t PL$}t$ 4D$4tDD$8tT|$t,$9G}ƾhjjV D$$|$T$$D$ 1ɋut&t!t@uh#h>%hlu|$ËD$Ɖ$T$19} +D$*USWVx]E |$8 tH@ u~07L$)1҉B=w Aɉuu1H>%|$11N1D$D$ wBt%h>%hhU=%_ USWVt$~0`t40014crEuSTr0ȍj@jP 1 V^_[]SWV|$0t$(T$,01ɉHHH HxPh1\Ät?D$L$1 u džV,t2t$t$QPR1@?%t؃^_[USWVP]}tG,t Pw,|U w0D$PQ#tC\$t$htz$wSVt$t$w{$G,x(t$1U1t$4t$0t$,t$(t$$t$ t$t$;M ӻ|M 1JRRRRVPSQjD$\PW,D$8L$SU @$\Cǃ1:k0hWV D$4WhPW$X(mD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(tÉ|$U(Y#D$0jPUQt$(1 Ⱦu#\$,hPt$ Q W?i|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,P" PϢD$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhj_tFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14eFuUet$D$l$x Ptn{ C K$;}sL$4QjSPL t_D$HtW7)1ɉAw Puu2S"j@jP fdžUSd1ۉ؁4^_[]h/<%h.@%hhU=%Q USWV,D$D D$Hhj9^Ƌl$P\$L|$@,$WW F|11Kn^؃N$F Fdž?džjh>US{ @džPWwt%D$ D$D$D$F11,^_[]h/<%hu@%hhU=%P USWVhED$$11@D$|$ t&1ɀ8>@,19Q蛨vPW D$vP6 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h]@%hA@%hxhU=%9 USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]fUSWV0$H$D715,85,85,8D$D$ D$1D$hA%WU& pu h:,8e~ft$lt*zD$ƒbtCeubD$벡h:D$ ChjVV5h:hA%,8,8zVhVV5h:hv$bD$Vu=H19}4D$$D$l$ t%1PPU D$yUhs@$IL$ tHt$(UhA%V= h"6.uRhA%fD$0Pt$o #D$8=$$ ,8,8jÍt$0ShV3B u UPV UjD$0 ,8,8Sy hA%t$(I1|$Py hA%k y hB%vuWjt$1St$4$t$B%Sh"PPSt1hB%t$t$4$t$5,85,8,8(N1|$tN1,86N1tN1=l$u1HL$(Qhht@P PtL$* ,8t$7uhB%lʼnPyyh~B%TVj D$ yh5B%@$uBL$$4jP4$t$V6l6hJB%jPhKj K j|$WUt$o x>tq1.SPt$  yh 19u2,8,8)uE 8t1FVh\B%1FVShjB%V5t$ D$D$L$D$ L$ D$|$tvD$ PƋT$ уƉǃtωÁtt؉D$ u 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj UYFL$ɋD$tP V P h "PVhB%hN1 j V jV藣 jR VP>^Ð=X:1u *X:1,8@=u1HP\1;X:1USWV}uCjh,8J ,8,8,8,8,8,8,8 ,8 ,8,8|$(jW 5,85,8,8,8?X+=,8,8@1;,8)ω|$$\$ ,895,8T$s;D$0,8D$(L$, ,8,8,8D$,8D$$D$ =,8EtQ1$w ww7wwVWV  7www ww$PWj芣 M$)1~~~ ~~$PVjZ 1@F ~~~~WVW[  =,8B5fDŽ$ ,8t$Phs@$hQ# 1F,8 ,8ƒ\$\$xT$T$|l$x!ݜ$݄$ F!L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)WhY$QPq ,89|ӡ,8tPL$r L$)΅~DQ4))h "Sh@%RhY$QP Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4xA%QPhY$SW{ L$(+ ,8T$,,8NjD$0+,8x@B‰L$hT$ll$h\$@,8 ,81F؃D$@5!|$vqL$`\$dl$`!ݜ$ܼ$la$1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4xA%RSt$DhY$QP  ,8,8ȃ||=,8,8݄$|=s4;T$D$r(|$$\$ ؍4)hZ$؍4)hY$QPi ƃ}u 4)hz"QPC ơ,8@=u1H$VQP< e^_[]+,8 ,8T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppu%hGY%Q 8t 8#u$SjV tGtV $1E48FB$)Ex t$7@[hGY%hjY%, hGY%h5Y% 7hGY%hXY%\Q^_[]$Vj$\(t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSgtXVhhPhEÉhP2tVh}P3E1H^_[USWVp $$$!19L$PVO1Hl$UT ƃUf VD$PWW tb$UtM$lt $lPU t$jWtu)$5j4'WU 1Hp^_[]Ë$j-UP L$jlËL$jWSVt$ t P닆t@jPC |džY1ۃ1ۋt;jPC /dž5 t^[V V 1u 19^SWVlT$|$$VPC1Nt/ǍD$PL PSWn t W|l^_[USWVӉjh0jO ǃt{jjjV L$ Fx"t "wx"tŃY% " "t Y%؉ "t0m%|$u "SQRPhY%jhVX ^_[]USWV$=~豽 71Ha~B11ۋ$4V> <(Gs@ ,PVQ胱 C$9u1$WQ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u) jj-ƅuƋNtHNO N uFF9sSPm.tOF^ St$P蠰 ^GFGF0wGWhw @1vV3VM31H^_[WVt$~GuG$O1@G$GD$GD$ JPRv j tOt%HO hY%hY%KVj7NF G8~ ~uFjv ? t^_hY%JWVpΉjL$PQRp jjP txPjW tdjjW tRPjW t>D$|PWV t(Php >u"hvY%JhvY%JWp^_WV$ hWv ] Hw ^_PWV: ^_USWVl$%} ߁` r^5 tS1r 5 u$U[^ts t;1t% t&%U< su^_[]USWVt$<@`ځ% |0ty@ !ȉف tV!<t !ف tVy]t ع!ȉ`! tvu1%r u s^_[]SWVPt$HË<%5@u^|8tW+%.V05U>$-%@Vhkj>#<5@x!-tr PhY%hN1 jP4\ u hY%G=j4; 4dž4SGxhY%ZFj>8 t6t8u:U>$5?$ g>$1Phw`%E $ g>$1PWhs`%E^_[WVt$ h!HF<r%|8t7 uh`%WC㋎@ @<^_j=^_USWVD\$\t$XFpt+NMT$PQhj@R uh#Z%ED$n D$SPU6Vt)ǍFtۉ,$t1j@SP荫 SUhJZ%D SUh8Z%D 1KNދl$Xu]1Ct'LHWt$ P!` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFD~ uC t<>@u,uVr'F@ ȉC Xt7T1Ҿ<1uCD1T1XB9r ~ jTǃXf@KT1ɉHHH HrF>rD&>C5F $PP w_ǍCWt$P蘧 ;)QjP& h`%Bu^_[]ËFUSWV |$8t$4l$ 1ۉ1VT$Xti1TJ;LtP<+DD$j D$PjWPt$ t$ hZ%>TL$,WT$XF9r|$,  WhZ%D> $t$߉G u!W6U$y WhG t W,$sA u;s1QW$uG Ph[%=T$t uW8t W^_[]V΋ttu=RV-tt'L$hQxPPha%<Ĉ^WV|t0t$ 9t!x t u fu;>t @u^_à PQh&a%< Vt$~ t^ËD$T$ F P~ tމ^USWVϋl$ t47lLtX  $ t27=u#hQa%/< hQa%<^_[]V>uYhca%Q;~LtVS?tt NHt "tsZ%PV^WVt$ >~Hxw1>tЄuOF$uItV>u hka%N;jjAV > u hka%/;^_HvF$ljjV= ZUSWV|$$\$<$|$ L$PjQS@WP@Ǎh U|?Ãx l$ tC PhY[%9G$C$G>C>>+ك**PWQ W|?t[ƃx t Ph"[%99[%9FNtTHNUhB[%9艪 1Ov 1OOWt#QW|JV:1V\$ G|IO9|A t-Uho[%8HLk$"l$ 1G~!D$PVt$$= { t S^tHPtQPV P#:V ^_[]SWV׉΋A Pha%b81B`%tPVʜ1VWW/~ >ujT0^_[USWV $ D$PQhht$h[%h[%7$1Ph[%71F\$ MbihS$(/ EuVh[%p7u( 87t  8 uF띃tVh[%A7l$$ d`UW==Ƌ|8t* SV{<uSj$( ҋ>$ GOtHONG P|)<uDGG|IO9|A t1HL!پWQjjt->lV|:U|S: |; h[%6 ^_[]Vt$N Q|Y;tNH9HHu^v$QPQ ^7L$USWVHL$dt$\tV\$hWQ;;D$t9<$ڀr/! 7 Vh[%h "_5T$1|$`F(f9t(~ tωӍV QPRh\%4ڋL$tf~(^>8u(F*4$QPω ~ tcF D$F*|$ <UWSPωT$P\$ShA\%W4 <PUt$WdPSh^\%44T$ V>t*4$QV$ H^_[]USWVt$8|$0.h{\%Um h\%UW |$,h\%U=  h\%U'  \$4U: ǃt1F\$4D$84 GF9uW $D$4U WUt$V踙 ,E |$4t91FߋD$8D$ P讣 Wt$U~ EE F9t$4uʋt$8<$rjh\%G8Vl @PVWv$H1D$ 1D$0Hj ljŅu<$t$81EWh\%T2WTH1l$]1D$$D$ UhE%h\%Vt$DJjM,4tL6uoD$ ʃo%kt=nu1@D$벃Nt2Uu@렃pt+xu D$ 냃{1@$pe\r[D$0@!؃ H1L$49t$,Wj)c|$,?@L$4D$|( $D$} tfH1D$D$9}-] D$pD$8tS5 tt$7@Fu݋D$;$ut$ Uj/ D$ $muD$D$L$jPD$8p  D$,|8tp$ۃ t^H1D$D$;$}-o D$pD$8tU} tt$3@Fu݋D$;$ut$ Wt$8u tuD$,?1D$D$D$,?1M^_[]莠 <$H1t$49D$,|01t[vD$19}1L$84D$0|4t6x t0 t 1xD$@D$;D$4|=|$,=H1HT$PVt$< D$19L$84D$0|J4tD$@D$USWVA|tb@@8tVֽ t8 L$ t!! 鉐1G@8u^_[]Vy t\΋t V1t>V Ѓ с u VWVv^WV1PPPVv>LHPjVH<@@t @ sfyt ‰<@WVE^_USWVP$|8D$ \$9}$w ŋD$4V1 tE9u݋D$ 9t9 uR<$t}ha%Wt$UVW WW79t:G t$_WD$$ Wk)D$ )^_[]USWVE 1|$ |$}|/ph\%V: h{\%V$ t$@hWVI dž8\%\:11N1$@41CSD$P9+SS9,Sj19-|$@]L$t$D$D$D$$\%t\%VhE%Qu S>~?u8$uA4t 6uD$뙰D$둍Hw$ C%D$ ui$B%D$a%D$Mh:$x<$5h:T $D$a%D$D$a%1@D$D$xj D$D$a%D$ $d$d$1@D$ D$ D$ x%D$jD$ D$CD$,9H1t$~t$*$*u $$H1)$$W=v1WWWS9!VuD$PjSD't$ ph(c%E D$,9H1uH4$WAH11WWU 4Q9u uD$Pj|$PWC,D$t <t7<hYc%E $`\W h;c%D 4$hdWM hHc%D plWo f$^$$||$@$.hc%LD hc%hC%h\% hjc%$D 1 $|$t@$  u% Ѝ|$@$$| tD$@P'$|@$|L$,9 H1ur%uk$0dV Rx"|$|$@t "wx"|$th0m%QVh@]%j+Wz $2 "PPPh@]%j+WY $ $|$|he]%uhJ!hZ]%%l$jj k $ WhjhXC%vVv$g|$]W裿pr)Pt$h]% % t$SZxD$ttܕ 8t h]%@%]r轕 83W~ D$t |$|$ $ȋ$|<%$ Љ$|$H1T$QRM 4C $8$|rW2A D$1 hJ!hg]%ڔ 8Vh! hJ!hv]%$D$ D$hc%@ 1$8r(u#H1QjM 4 $8u*$|1PQQt $8F$@u h]%(#u SWJ  h^%"$|$ щ$|$WhWjj$,'t%Wh{$@$(}hJ!h(^%h&#wD$kbSh]%Y"1|$0w7GjWyD$@P謼FduD$dSh]%z"AhJ!h^%- 8thJ!h<^%1"$|˒ 1豒 8 $|$$hhc^% u!j 8thc^%hJ!hr^%! hh^%o u!2 8th^%hJ!hr^%p! Wt$WhJ!h^%h^% $kt(hM1hߋ!h% u h^% $|rB$@ щ$|$WRPhJ!h6_% D$0Pjh0j0tB$mtD$$Pjh0j/t]* oh"h&R <$D$1C<$|$@$~u WuhJ!hT`% D$ t PkK $$L$tCt)QqtrqpQ!$PdDŽ$4$W8$$t P譕 $(*$0Wm$$t!jP$$C $ʵW! W ;$$ ;\:1t P$P@1u he`%m$b$S@$t3$tt'L$jQP轲 uhJ!hY%]$R|$G؍e^_[]WPh^%C ?$|$҃ ց u蕸$|$r:1r H1M L$QPW $|$\_%r H1U  " "tf_% tm_%VQRh]&aW|$@1D$khP蛐u h_%!Wh$$($u($|r$$$|L$ $PQW"$$1~O$4P!t x u_%_%$4PG$$9||$ҋ} tփz Ru$h_%PD$@P$~Nh`%hM^%{t$|$@jD$0L$4$tPTWh$|$(h$mvjt$, t$lt jt$,u h3&Dt$$t$(ձO$ Q $h _%_$D$0L$4$tQpWh$|$($mt4D$$L$($pQ2Wh1$x$(F$ S$ &D$x hJ!hD`%hJ!ht_% hJ!h_%hJ!hJ_%$lh(N1hߋ!h%O h^%hJ!h^%D Ph_%!$|$0t!~ t Wvu拄$L$ QPt$HV $~@t VD$1t*1G{ tSu΋[uً$||$@$  $r8$1Ʌt z uR|$@$ |$@$ u@u0$@h'`%PD$@Pf't#%@tD$@PhkQj$,Y4$D$DP0$0t$~ tVhjj$,v$S^ WVt$<rDD$ tN@tCt;D$ jP4 u!ha%hY% j^_Ã~+aqjjjN ̓Bha%ha%ha% 1mhb%h b%ha% DRh b%@ha%ha%ha%d 111dhG%ha%ha%E H+`1BWLP/ ha%ha%ha% 11G1>u PnWhb%ha%ha% |0|vPh(b% ]VPt$ jP4_ tw+jPhb%hb% hb%$@u Vt$4$ ^V$hV0ު thN1Vr  ݅ 86uhb%^t$at觅 87t 蝅 8 u莅 8Vthb%USWV׉΋th11jVtKN t$WPQ6/ t/3h3 t Whb%G1F ~ t1j^_[]WV΋Pt@~&TtPAPTdžTXt@~&\tXAX\_dž\ht@~&lt7hAhldžlt6tW",u싾Wdžt6tWo",u싾Wdžt6tW/",u싾WUdžpt6ttW!,tu싾pWdžp^_Vt$h]b%]j= ^Vt$jP蜧 t6u&tAVhP(脂 htb%j ^jPSWVt$jW tguV?xL)t2džVh)7ҁ hb%j ^_[WVt$ )1GPRc tu/hb%j]W^_;ub|tDPQKth(N1HT t-0N1H 0N1~"(N1H (N1 1_h(N1j Ϳ VhPfSWVt$~>t=D$|$ffN(ffOfuj S ȉG_1_F*N>QPSHt F>)^_[USWV$tt xhVg%PW t=wM$t 8thVg%hs@$hL$u&hg%xhVg%hhjg% $$t~>W1ɀpL QSP ƍl$ hUPt$ QU~ =wfD @PUhhVg%Wёhg%hh%<p{>,$fEC(ffEEK*S>RQPr C>4()wpua4$D$%1ɍ\$ QQPSh>h%itt8|$%u1j%Shh%= tfSVϷƃC4$-1xĐ^_[]ÍF Phg%6 |t {>u[[pt hg% ~>t$fF(ffCCN*V>RQPq F>4)mC Phg% $USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$@USWVt$|$$\$ l$tLL$ t 9htMF@;FHvjPvD7 t)FDFHF t1Pt8QP3m| 1HctX Hu>Fj uۉV tNpFhX L$ HL$(xH@F1^_[]hh%hh%hIhh%hh%hJhVh% 1PPt$t$t$t$1t$t$PPt$t$VD$ttT$ t"tt$9Qt# uj{  ]{ 1H^Åt"y t1AAI1@taaAH@1@hh%hh%hhVh%0 D$ xx xʚ;vz 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y$$t9_u9Gt0?u~,tOu#N0$jDžu1HrOtqHOl$poL$O _D$$G$GF$t9hwu9H wF(G8~(HOH9x1^_[]ÉN(hh%h2i%h hFi%h2i%hhWi%h2i%hhVh% L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP$tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~(E~0}/n0@ϋL$ u1^_[]hh%hh%h#hVh% D$tL$HP@Lhh%hi%h7hVh% D$@LWVD$ tL$T$t$|$x4p8PteND_t-O1ۃ fYt fyfA%_tZ_^^_;~ׅuFu PvvD4ǃut 8CtPHf{t7tCtsЃ{tCtfxtC tsЃl띋OtHON(wWF0G8~03FPe^_[]s 1+hh%hH`%hhVh% USWV ύ\$SjjCƋG|$1ɉىT$ 9ڍT$RT$sӉىD$ T$t$+r t$y" tD$ʚ; 11D$T$z$T$tUʚ;+T$T$ _)ús1҉W_w +T$stK_t$ w W ?u G D$T$BD$L$Je^_[]fPL$T$ D$$PXUSWV ։ϋ$ =d>1t:l$ }, ESVhU藪 tp L$PQ5d>1˕W`>1s>|x| @t,'\$$N1SVUӱ Uj `>1 s SVW ^_[]PL$T$ D$$PXUSWV։q $VhUϩ S^PUh "W^q ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXád>1ËD$d>1SWVhS$ $ 1OtFƃ ||t &p +D$HPh>1Phs@$Qf h>1^_[á`>1ËD$`>1@P V\ hjh`:1hN15`>1* jVP  |$t~o V1H1@^ Vt$tNVVV]\VP*jVVO6^^SVt$ V舂1Kt=jhj*) t!jhj) 1ۃۉ^[( Vt$t P蛔t P臔tV s^ËD$t$t$t$` WV$hjWa F jPWc Whi` t D$F$11HĐ^_SWV$hjWa C jPWBc WhiL` 1NtF$$T$ !fD$f9t hWhi` t1Đ^_[ËL$A$u1ðyHutUSWVTt$h^>tv l 7 l V1H11ɅtX $BD<IG9uލ|$$ ^ F>L$jPWVK uF>*PWVn` 1T^_[]VD$0tVajVv^USWVt$t$l${ 1sC {Ht/usKStjWRQPsVjUn$IKhxuP uf@ sQjWPUVt$,Vjl$0U  Ot$1P& ^_[]ËL$1t$VD$0tVZVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjVM^ Fjŋ$@Vi $1WT$ȍD$l$C txuD$ Psqt uCutF L$0QP\j tًv\$~;1$D$0Pt1j tF9u19D$$"$@ЃD$X1~11\jT$4R4C t GX9|X`~11djT$4R4 t F`9|`D$ 9D$P$~11TjT$4R4賅 t FP9|P\$ "\$9|T$ۋl$$\$u9t $t$0u $V$`uVhi%t$ 0|$w$P5D$hjQNj$G jVPi] CG$C D$ t$jVt$dV@] C yQPD$|P[ D$lD$ @D$pVhi$Z D$m@L$ AGA<<y4$<$4$D$0P$0lg Xh~,$l1D$0P46g nE9uD$t$0V$p|l$wVhi%@$]4$w ɺ@r <t.<5L$ 1@ut$hi%11@fG(t$ FG>W*$VTPRt$Y $>@utWHyt^W}fG@GȉGDW#|t GLGDw sW{GHGMO9Et$hj%W$AD$l$t$0<4$t h_%h#U1t^_[]h_%USWVt$t.>t)|$ jVWZ w_ jVSY rPd 1N^_[]j:S0 t/@1UQhQQj QPB G8mtd (G8GjSPwY O t tU1DPu:pKCu1l$PVhVVj USCB G0Et=it.u1@1QVhVVj VPB <$ O4G4USWVujt$\L$41VSWPTRjt$\t$ VSWUS4jt$\t$(VSWUSjt$\t$0VSWU|$Xfj=\$\S WǍpj hEn%SC jj hQn%SC  jh^n%SB Ejhn%SB jh~n%SB jhtn%SB jhqn%SB jhn%StB S4$jhn%SYB jhn%SAB j hn%S)B L$PeL$T$t$XVi'1Kj/V uD$|$P@jPD] DL$@r@ L$@r@L$T$t$XV&1K;j/V uD$|$P8jP<̲ ,<L$8r8 L$8r8 |$XD$P4$X\t$X&\cD$P@S|$X D$Ps<$;\:1t Pq11jt$\ (ƉD$Vͳjt$\U t>th%VuM V$ǀD$P z|$X L$PT$Xj&"d D$X|$PjP hl%hm%D$Xt$PjPq~h1j%|$X/ D$P$Dzt$X  $DP D$Ps|$X h"t$\VL t$1VWjWWWWPm L$P9>#t$Xh2m% |$Xp t$1VWhWWWWt$t) L$PA 9>t$XhQm%< |$X+ $Cl$D$4|$t$ $T$X\$(S\$$S\$4SUt$`Pō\$ SWV!$6?mjt$\D$ 0USWVNG jt$\t$(USWVM) jt$\t$0 D$Pt$P1t$X"džD$X# 8 j/P 1|$Pt@j/P tƍt$X9"t/F1V"{ |$X t$1VWjWWWWt$tj L$P9> t$Xhmm%~ L$P3)‰T$5jt$\p h\j%|$X& j,t$\  ƀx D$X9l$Ps%ƅ4|$1WShSjSSt$t+' ,9hm%Et$Pс|$Xt$X4t$Xt~4u L$Pр6tT$Xz6 @T$P|$Xt$1VWjWWWWt$t评 L$P9>et$Xhm%h |$XD$P;4$PTt$X T|$X 1Kt$X~l$PGt< t< tGG1L$1VH@jPL蛫  LL$HjH {< t< uGGc|$Xt$PP蝽t$Xe P/hl%<|$X$C D$(t$ \$4|$ $T$XPVD$4PD$$Pt$`VSl$ UWD$$P>$Ɛjt$\V3u7D$0cIE 8t$Xho%11IT$P  eD$PUD$PEt$P# Ɔ1HFPFTFXF\F`FdFhFlh hP8 fFPfFSfFVfF^fdžƆD$PffL$$>l$Pt$Xtut hdo%F|$Hy V M@UhJo%D$P |$XbD$PD$PD$P|$X'$>t$P9,hlo%l$P\`l$Plp* E$ |$X.E$$(1|$Xl$P$ń~|$Xct$XnE< < ED$PD$PD$PD$P"D$P D$PrD$P b|$Xt$XV@ $l1|$XD$X@l$PHt . %@D$PD$PD$P@D$P|$X$Cl$(D$4\$|$t$ $T$XUl$$Ul$4Ul$$Ut$`PSWV$6?mjt$\D$00USWVDu8jt$\t$ USWVDujt$\t$4USWVDt$Xhl%fD$Pl$Pdh$1D$X+u31L$0|$X_D$$KN ? 6CL$XyG*< t< tGl$G΍l$1USjSSSSQ} 9]{ɋl$t t C OGuh p%0 D$P D$PD$PD$P |$Xt1t$P6jt$\8`5Wh{q%G D$PwD$PgD$PƀWCQho%V5? à \$S |$P(Qhm%SPw jVB@Ht t u@j/V AL$$|1|$P# D$$|$rN|$XQ1j:W, l$t2At$1VUhUUUUQT{ 9.[hp%! j=W ED$E@1h t XH@t$Xhm%D$Pƀ11# vD$Pf1t$PUD$X.U$ lD$$L$y(d$D$ $D$ D$0D$ D$Xt`T͉|$E|$Xt.t2f9}u,8eu'$8EuD$08EuD$8Eu Nul$P|$TBjRQm ƋXHR‰TXf||$XD$D$ DD$ DD$ DDl$$$j/U GVho%VT$P343Uhl%%D$|hl%BƆh*n%D$Pǀuho%1K$lzVhPq%gh`l%ID1DDD DD.u hm%%  1|$1WSjSSSSVx 9t Vho%)ƅt Et< t< EE14D$1\$P|@jPxY  xt|Q|T$ȉ|>D$1hE$WYhx%W1ghKp%Wh#W&h!W9h7x%W hBx%Wh#Wjh,!WTh hNx%W96h x%W#7 t$ hx%Whx%Vh!x%Vh(x%Vh0x%VR hc!VS hfx%V~M h_x%Vh> h $VR/ hXx%V< hkx%V& hx%V ho%Vhsx%Vh|x%Vh+&#VVhp%1  t KC  t {KCWh:o%Ɔ bt$P1$ƀp3ho%@ttC< t< HCuhTp%LJhl%D$0*LJ%Ɔ1L$PN@t$P5jP ]4eh%|$\W7 t7h%W7 t%h\%W6 t# hlq%V6 thqq%V6 @D$PttC< t< [Cuhmp%ƇpGb< z< rGhl%W)P T#1$SUj tUhn%1C CC$f8l$1USjxSjSSWq $D9]$ƃWhn%NttC< t< 9Cuhp%zƆWL$P1V Y5F4D$PVvL4 7ƇpGt< t< CCu1؄  H@เƇp11jU ÉD$=hq%sӃ4 (7jVt,l$P4h$"hn% 1FW؄t tG tBH@h3p%1K؃<^_[]ù@{< tj< tfC@߉4ыD$7*5*64`hl%` CR{< < Ct$l$P L$1S ttG <$WVP CUP ؃8L$QP t$PWSPB T$XjG SJiljjUCa{< < Ct$1VWhWh\WWt$(n L$P9>4$hn%=l$1Vt 1K4$bƍ|$WPlFWP_8UPPD$P4$VP QL$PCo$j/t$ tC 1ۋD$PWt$j u7td|$1WVhVVVVSl L$P97tSUhn%tC4$hn%=1G GG@dD$PƀYMCI=6 @/@(!  t$ %|$t u$Whp%t$Zt$1D$ s$t %@uhp%(suhp%tF1tC< t< Cuhw#W2t)Wm Åu"A1rWhp%1ۉL$ |$0t<$L$ D$<$L$ t*1ҋt$$90D$0u e{j< t?< t;C1Q\$8ǃ,1ۋD$$t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$0uQAj,QPE t(t$Qk,1҉T(T$T T!hl%üSo5V$D$$D$ FD$F^ t8U, ljD$FWUP0! >)QjP 1FFL$TT$`r|$\s72yUSWVT$΋|$$WW, ?"u z"u6JG2WjfŃw;l$WVf1|$(u?t1@tF1D$9$h;l$v\u5_Oуm~0s_nr#$ t/F,0b1Gtxt$ D$15tU1DVtCT<1Gu|$D$t$ jjD$ P jti aGaD$1Ɋ ր0u T Auˀ|$tSjjD$ Pc t#=|$Ft tF1$9ŋt$ Ń|$(uEt;l$v* 71M^_[]USWVՉϋRF j=P ,$|$D$ V) 1ۉ\$t.t(D$ 1WVS D$\EuV4$ t5ƍEjPt$ n 4DL$hq%Uhq%hq% |$$t#4$T tzSqD$r%h3hLr%h>r%h5hq%裆 D$tHTlPR h t%hr%hhq%e Vt$t#1PPV t@Tt$ V0 ^Vt$t$Ơ^hr%har%h[hq% SWV1SSQ t&WV W賘SSV| Džu^_[WV|$ t^Ǡ1PPWU tPWe hƅthjV ^_hlr%腰1hr%hlr%hlhq%> D$t L$tHTh t%htr%hh!s%htr%hhq% Vt$t61tpT^h!s%h}r%hhq%˄ WVt$D$ L$zVP 9tV\ 1^_ËD$HTt1Pt$ hr%hr%hhq%K USWV\$tF+1PPU t.jVU 9^TuVU V_u^_[]SWV D$4tdHTtn9ty|$0uIǐPWu t5Ƌ\$8PW Shr%j WW KV ^_[h t%hr%h hr%hr%hhr%hr%hhq%G USWVJ׉ $N<D$SPW wV D$o8D$DSPU URËGTUs%t Gtu8W0tCV#t64$Uhs%s tFD$Pt$Uh\s%Gt "ts%tu hr%轫Gt;D$TuG9t;D$TuWV  t߅PiGTWL$ Q O|tp@|$u'OT;HTuG8 $8QPL$L$4$L$zQt$  4$+u^L$jyCWD$Pq WV 9#W hr%螪WWD$ P  OT;HTO88PQ{YtGX $XPQL$Ax;GxU=u 8Vt hr%ŐjjUl jWUV Gt ;D$TG9t ;D$TWUF WV ukGTL$tIѺ!! t=Lt%Wj2u! 8t 8t hUt%$WQ߅81SSV tLWV WU 9t! hr%ΨWSSVC Džu1VD$PVD$ P D^_[]t$ t$ ËT$11;T$ tэ HUSWVPՉ΋BTx tt /<u$UhtEPXt1^|$x0'tt%G|E|GT;ETUWGttEtuGMQP]upG8M8QPIu\Gx;Ex$UV tb@tt EtGT;ETu8M8QP1Wjz0u 8t$h.t% 1$UjE0u 8th=t%˦1ۀ<$tWVb W؃^_[]ËGx $;ExtUj/u& 8t ht%n$=h t%ht%hhq%#{ fD$t%@<t <u ø /1ht%ht%j;h_t%z D$t%@<t <u ø /1ht%ht%jQh_t%z D$tBHt*t u#xÃxu x uxux) /1ht%ht%j}h_t%:z D$t>Ht4t uxjhhL%PC  /1ht%ht%hh_t%y D$tEHt;tu&xÃxu x uxuxg /1ht%ht%hh_t%uy USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^ Wo1=u!GB9r1ɍ|$0+ /1NjB1ɉÀthAu_1ۀ=-8uD1FFFF FFGF-8SVrVWguH-8މ^_[]Åt 1u19[:Rt1ht%ht%hhu%ht%h'h_t%x USWVPt$F<t<u^$ $ l$)Vƃ|/1WhPC s /1NZ΅t(ٸF|$$)|PjV 1=-8u-8t$9u-8^_[]h)u%hu%h`h_t%w SWVt$|$~tuVTt1WEu;^G8u-8rt!1ɀu,r)É!rPWV;@ ^_[hiu%hbu%hhuu%hbu%hh_t%Jv SWVt$t~|$\$C<t u#17Ct3KكWVPQJSKWVPQI ^_[CPh-$WV!J 1t߉hNu%hCu%hmhZu%hCu%hnh_t%u D$tL$tf Hht%hu%hhu%hu%hh_t%Ru VD$t&L$ t/fqPp QPI H^ht%hu%hhu%hu%hh_t%t V$|L%Phu%J u^USWVD$t$V1Ij0V1|$/ooo WV5tC%t-1C XC%I?r 8   DE9u֋-|C%t/11C xC%I?r    DF9uWt$Vl 1ɉt$\T$\RVQ2P{MV@t  81I $ȃD^_[]WVP|$D$L$ $QPWVO tWjd t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjPs tbL$1tHhv%hu%hM8| /IG?uWG9rD$^_[]hv%hu%hhu%r USWVl$t$|$t1ۅu>t7NHsZ%t& "tÉS1ۃ1Ct:tVtXtSh.v%t؉8txt@HtPt؉CjVt.VMt!th6v%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ TtPVO 1H^_SWVD$1tQ|${t 1N4~0jhCv%W uW诸W& G9rЉ^_[USWV |$ 7u >l$$UjhYv%U \$1ɉK UPWh^v%豚1$S.t^DžtnjSW  8thw%h"9hHv%ܚ1HzSlt$hw%h "谚 tG11CGt0WM ؃uhHv%hsv%k?Ņu1 ^_[]Ë$tu%tPt$hw%hw%,=nf|$Q趨PWhw%hw%@USWVӊB D$ L$$t W{ *QP_NjD$$?@uMhl#k v%tQhv%W 0 Phv%Wd |$ t$hv%W? }D$D$hv%$U t$ h.v%U U |(6h6v%U 1>hca%Q h "$U 5hsZ%U h`%Up  h&UZ h9[%UD h`%U. 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSEȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Phv%W K4L%hv%W -?$@D$o|$L$ uMD$@tBL$qPSh@%W?@%D$K|$tSh@%W迬 <$tBt88t/Slt"D$ pHpDSh@%WO|$ tSW)5D$t7t1Phs@$W D$0uWp WWpǀ|$ WD$(P D$#tw%Phv%W: xKHZ%t$&tRhw%W CsDhw%W )CLPh)w%W  s$h7w%W jS膢PhBw%W {Lt;CMt$(spPhhV tVhKw%WQ {ttCtPhUw%W0 tr?@MǀD$(h8L%PP |0ts~ t!Vt&PD$,P9uvhw%蠓hw%蓓1OĨ^_[]D$D$D$h`w%W? t1PPt$0V tc1PPV 9th (N1H (N1 Fut$0N1H 0N1;@N1h(N1j \> (N1H (N1 Fshx%9 Fsho%8 Fsh#8 F sh!8 F x%x%x% x%u~'x% uu/x%@ulxcAx%r]b!rRMx%rG $ ruƉPV8J1Iȁ ^_[]h!#V볃t"<0t sVP#_ $0tCr2 WV֋Aruu t,1G9v T1O s 1)։^_1ryt9wSWVt$F~ t~1WC,;^ r~(t~$1WC,;^(r^_[t$t$t$p' t$t$t$t$'t$ t$ 't$7 USWV1hS$$' t?=t8SjU&t%Nj$PASEt SP.&^_[]111USWVD$ D$D$jR1NNj\$$1Uhjy} Uh0j"g} jVh@hP05uhoy%hay%0{$jVj@h4uhoy%hy%zD$j Pjj"41u hoy%z^_[]WVt$ t PPWSbdž|;b^_USWV$4$,8C>$0hjV F@C jPVi fF $4FFD UWP iFF K>*QSP iw 1O^_[]SWV׉jjj菤 t!hWVP S-1H^_[WVPRQ ~u~uF $uG*SVP tu 1^_[]ËD$fx(t1ËL$ D$fx(uD$ V1ËL$ D$fx(u D$w V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$ hWS |$jjCƋ$(h@hz%FljPhqB@Wf f<$f|$ jUS ShlBW( txD$PhpBW tZ$$VЃuBD$PhfB@v t(D$FP8F u+ hz%naFt PVH1Ĝ^_[]USWVt$fFtV)vv v AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ < FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBPy ^USWV L$@T$ 1H^_[]Ël$ |$ $9;l$ tWj ? L$tu!s^+9ED$tSUD$ P ݋D$1PehVPhs%Wu au>hPh$%WO $P3Wjc> 1Ƀ HJ "USWV$ vS$$AKtGu4|$QPhW1Nt8Whs@$SP u!" 1t 1F^_[]0PgPhs@$Va 1Ntҿ9tB$Uj n= t$48gPhs@$U u$j-= HVPL$ u:t.BSu( PVjps t<$r f1^USWV(t$@1ۅ1@h'H $@D$E_l$u#D$$Pjyt$  t "2EoD$$Pht$  ~%T$L$ s" 81KW(1ۉT$$\$ s 09 t$@ ʼnBD$ t*VRD$P迾 1HȉD$L$ D$11ɋt$@\$׋T$9t $;Qt $;Q utD$D$EtD$ PU׸EL$QPƸ8L$QP賸Ut$@辩t1CT$$9׋l$.u1#"t$@1Kt$@l$t>+@h t$ Vh~%XX D$ETu)D$$Pj!t$  t L$EPD$$Pjt$  \$L$1D$ D$~xΉt$@ËD$D$ PSeCL$QPT؃8L$QPASt$@L9r\$؃(^_[]Å+D$D$ CD$VyŋL$D$ 9t$;Jt$;J utD$D$EtD$ PU藶EL$QP膶8L$QPsUt$@~\$l$9Keȹy,tt1ɉuʉT$SG1KUSWV$4$0D$|$Wj4$@ t |$t1ҋ$,$(Eu E dT$ $PaPVhz%S51I/ދ$0$4Wj$@U t|$r $,84$GPaP$0Vhz%W轶S'GPVh{%W蘶$0$4|$WjU $,t|$w1Ћ $ Q`PVh{%$45$4#]SY`PVh-{%$4T$ }ltE$u?ClhPhhWWVhB{%$4诵{,t=u8C,j@Ph@hWWVhQ{%$4j$0t1W>C,;r鋆`t%\1WC,;`rttp1WC,;trF $'1|$TPÀsE,$0;rT$`t|$\9tʃ,Ju$4|$WP$@Z tt$Ph(Vt$$@$@$L0 >}k|$`$0PDL$L$QWh(Pt$$@$@$L0 1I1AT$`\1|$$8L P€rM$0 $4WPVU t.t$Ph(St$$@$@$L0 E,T$;`r1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P3|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ V t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$  { V1(^_[]ËL$DtD$L$tPVQX D$ƅu0 SWVD$ L$tT$$w .11t$|$X+9sۿ "11T$(|$t 9t,Nu:^_[WVt$ t@GL^_WVF\t$ 1WpC v\~\^_VF`t% jPC v`F`^SWVjh0j>P 1NǍ\$PSPhWtrjSjjWt]jSh@hWtBD$$1ɉ $L$ L$L$D$fD$DtD$jPW( t WF^_[USWVt$+VjUDChu'PtVhZjDD^  r%s{%PSh{%RXPShc{%L 1Bhx ^_[]WV΋tF>rD& GT| tB9tt9BTtI䋆tÀ~>r QVh%oL ^_ËD$PPpR L$1Bhx SWVt$tgw]Vhj[C^ w$3WPSh4%?K GLh% ^_[USWVhuD$G$D$GH L$t0w3GGGG G _G_1ɉO OuG_T$SP-D$@tGH{%_0MwA SPh|%J _0G8 9=\$8D$<l$8 P%|$ D$ fD$l$|$Xl$ D$XG8M PQh<|%IJ w$Uw(;PSVt$h{%IG0GH{%Ep w$cUPVt$ h{%I G0GH{%z1HG8G4q w$&UPVt$ h|%fI K\$0D$4l$0 P%|$D$ fD$l$|$Pl$D$PG8G4tc;G8\$G0D$(D$,l$( F!|$D$ fD$l$|$Hl$D$HG4M PQh{|%H CG0D$ D$$l$ F!|$ D$ fD$l$|$@l$ D$@G4\$?u8Odt1D$;Au&Ghu Mq PSw0PVh|%H Ep w$Sw0PVh|%H>u$HujGtGht:?|%tP|%Iv%GHPulj%@@O;Au<t %?u|%GH0MttQhw4V>uhlw8V>uhw0V>E w8w4Ph|%FM 1HG8G4@uYD$uGA _iSPh}%F wwhSE0MuSh1}% GMWhD$T$u;wHQ'3jt$S 9 GdGh]QCty>D$Gt@O;Au D$$<ti]GdPG`t4ShP ;1Ct(hY%EjhD}%Fe^_[]USWV ֋T$ yF BuB |$$t(tCNVًT$ PjW t)<$r#)jVQ7 H N@A6=7FD$ًT$ PjUP t |$r F  ȉFn ىj3Wt$(' tEnىj:Wt$(`' tEnىj;Wt$(?' tED$ًT$ Pj6W t|$rFF ^_[]hW%hM%hh~%hM%hh}% SWVt$^ She%DG0+G8PSh%C Vh%j`;1G1h%C Vh%h "B 1O^_[ËT$ 72USWVPt$E $u :*1E E9t~WSV4 ur>jSV4 t jP< $WEWSVT4 u(h~%h}%h1 h}% PPV,4 tSE EdP $PEt]U$uu hCF PhN}%0A>u}%EHPV誥 Vh}%nA ^_[]WV։h,j~"t/L$ PǀcSc tfǀ 1 ,^_ËL$hVD$tF9tAtIdtI;u D$ th`%P^USWVt$#uk . GiP6VCtAt;<t5^ w$`KPSh~%? j\$1VUj97V/w e'o owT'GOGO oo_Hu.GdGhSV詣 Vjj69VT<w&1GG G$^_[]USWVT$ ED$@L$ \$8KL @r@t‰SLiha 4\$ SA-C {%uzd%|$ tn,W%\$ t]z8ZuSQA D$ p {%uld%|$ t`,W%D$ tOz8BuE1ɋT$8RTt$PD$Tl$P54$T$ L$D$\$$%0=1sTQVh%=1D$ jPK\$t2=[Lh\t$$dK\u1\% 1N%L$ QP3=ދ\$|$L$4uAPh,jGDžT$  D$@dtdрs@G RuMH t$;N(ދ\$u9L$It$cu%uSucu L$AhtL$ A(GA>ɀwȈGGT$ *QRP T$  t$|$t tAtftaލ|$`WjD$1SPW=/ 9s1Ht%t fG f|$fGD$T$ Ɖىt$FTȉGh D$4D$LJcScN$tG~DcScu>|$ u(T$Rdt$Fh;J11ɉދT$)ƒs%D$ PR5; f5PT$T$ Pt$~$~DcScuuʉtwL$y<T$ \$tmL$+L$rf@6L$ID$ >u/Ct)CZu#D$L$)ȃfPL$L$  $ShP ǀgjW蠮Ywb¹ sU4tJL$T$)9?4B+AQWP T$ |$Ã\$\$u9D$,t@D$L$)ȃf2AL$D$,tCt1D$L$)ȃ%f3ȉAL$%D$L$)ȃif7D$ 1D$$L$(rSX\$0u#1Ct$t>t$<ɋt$<r 1CL$L9Ptt$\$L$(B,;r|$ |$uL$0:u \$t$ʋL$\$$9L$hC\$$\$0L$ t$\$Wߦ D$4L$T$)9w; BL$4JQWP D$4ǃZHT$\$)9v |$QC\$$ AfAAPWǃ|$|$T$ L$|$,t6t-C^u'D$L$)ȃftAL$L$& ȋT$5tBL$)9?5BAQWP |$Ã\$\$%|C_D$L$)ȃL$f|tȉAy||x1ۉ΋ًL$)9gT$JIO4tQZ % Gt$FFCD$;|r|$D$$`D$(D$D$<\1L$t$$<1| \$<8 tpC9rJt$rbt$0\$Du/1C\$Ht$\$0tt$L\$Hɋt$Lr 1CL$t$0L1Ptt$\$@,;D$(`A|$ uL$D:u\$"9|$\$D$$L$D`L$(t$믋L$AT$$ЉT$$ЈAL$4tuh&SnSjjJ(D$@`xdp$jVQ" twD$tmD$8Pt$ ǀ%t$|$1|$t$USWV$\$@|$wK*PQt$ u)C Pt$hZ%l+ ىt$ t$ $[u^_[]WVt$ Vt>w`wUw J <W36|tt9uo@苆t)jPK džtPdždž^_UWV}tuPG><r 'u#r G(ftf u  s% u`h ƍG 4$D$,$54$D$\$$}~%C)WhVj e^_]Íe^_]USWV($u2D$><@щƒ u=u4jWhoP@u)u jh0j* Nu&h4j @`GHca%GP_iVjhS tSE0 "LJ r?t$AQ  BTsY EX>@PF UB( A J*R>RQP肌  ]rts4 t*Mq @T$hRQPYPV]h%2C>t2Mq M*T$hRPQ%PV]h%& Pj1wLw w wL$u]rruG XixiF SPh)%<& D$h$PS6wRh%&@u3ExCP t: @ NH M xtYh%&u Vh% &h%l%M1=u1HL$h$QP] t=w:F hW%Ph?%% wQ 1Ƀ8tmF SPh "%1Ƀ W?@uÍT$D$ Pj5S؃ PG tL$SQP hW%9%1ɉOG @L$jQVTT$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6貧L$ <G cSc{ ni;`CLsu&1C &cMScq s$b.PVh~%" M1CT$ wAOV*PRQ t,t$UĤ)Ĝ^_[]~ D$,$\$@t2D1ۋl!9,tG9r P8'PVhK%*8t<1ۋl!9,9rD$Pj5t$ t>|$t7T$ \$uK u)\$@I%D1ɋ\$T$ t*u4% Vh%%L$C$D$CL1CDpـs%USt$T$ t |$}Cu|$B6@t&Uj6t$ |$-%t$\$SWViStǍF WPh2% W|$? >uh)%VGiP6蚝VhwPjGPl%t$\$SWV=Skǃ PVh2% WGPŹ%t$t$WVtj1WUVWSVhjSX\$;Bt jjPt$T$ D$uw%#_u ǂ% ق%PT$ \$C<>D$u[BtUjjPt$T$ D$t7%t$t$WV%P\$SWVD$@ L$9Y\$sP4$C  $KQWPy >Vhxj |$h\$CPC $9KsPr4$C t6 $KQWPSy C@Vjj Yh%hC@sCCCC C KCK1{ {v%CHPVbxW C\H\$CPXUSWV։ˋ$($$h-%R \$ t$t;ED$PP$> $,uzh%$,tKP踃 Í$PmSVht$ P蚋V1$,$t$Vj6S. >uD$߀ Vj4W t|$t$$}, uZtV,j@Uh@h\$ S t$4$teSPh!Vt$Wh %t$(_ !ۋD$t$0$ P4$L$ t/PUVt$Wh%QSPh!t$Wh%t$$$PUt$ Wh3%Q h%Vt^_[]USWVPPj8t$ п 1t1,$t*ǀ8t#EPtUWP)v +މ^_[]SWV(΋>ulVjjK AuA jQVW t=Ht*ub 4$KPVh@% OV<D|$ss D$L$ q qQPWV  (^_[ËL$hiUSWV`(΍D$`l$EE(\$41 D$$$D$l$D$ \$D$,D$t `jW0 tD$ WV h}%`(^_[]USWV$$$$k\e|$h$WUp t'uPWV8t3k\t,Et$;tF Ph%h "O VS$^_[]ËL$1SWV΋1u1PPVG t7O t P SGt-^_[lF PhN}%g}%GHPVr^_[WVt$ F Ph%4!OhGL^_D$ȅtȰ (1SWV\$C r~ 1H4t${GPhVr ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$|1t6T$t6tt_;t?uIu^_[SWVD$|1t1T$t6t:^1^ t6uIu^_[SWVD$|1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$t|X{ Fo}e}h[}d0h8L%D$(PNd Edx t]SZƀH|EdH #HL$|$WViEd@ D$WPiF9VD$(PZ1VVPj VVPj ƍF8Psduz3@YMhVPn SWYG| WD$(PHZjVP^j ƅuSD$(P蘮C$t{tlSqYD$|$WPhFWPhF8MdQPhXMdQPhVD$(PYS谭1PPD$,Pi toVD$(Pf ~xF| uF|FXMdQP!hVt$|c 9tVVV1V1PPD$,P5i ƅuC$t$xh8L%D$Pa 1PPVi ƍC D$~dVbSn8Ub?1PP$h 9tC9t?UWe T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0|D$ED$} + PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$|tft$ PPt2Njl$$L$1tFt@t0Q;Ut, u&p 8p (΋L$T$(t! tE;F unt ;F ʋNHNj4ƉXEFT$(F 1ɉNON1wF ~ u  Ʌt ѹ )QPhs%jWi D$0L$,t 1ɉNFfL$OыE@rt$4VQ ƃu V^_[]h%VD$t:t0t!PtQPV PXVM^WV|$ 1u7jt @1H1N^_USWV $ yrn t$ $ q>Ypi@D$ \$fl$Ӌl$ h%WU胁 en 8th%h%t$@s"j@{Dž@7裼 D>t .o*ShpW%U~ ShxW%Ug kD$ 1L$A AAPj@QW1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dUV U~jV V1N\E@M U\$SWRQPUD$D$]@D$ (tE@jPS t=m<$Xj.PSj1T$ JO9zPW.EPt.tRD$@D$,$KU5E XUPh8% 4$qU f4$jVU 1SWVt$\$Gt!PtQPW P1PW tt2jPD7%W1VPjx^_[Vt$^USWVPD$0D$ h@$6G@jPUA tGT(1D$tJGTt%G OXQt$(Ph͆%=GTGT@t[Ot@HO?D$ @PGP ujLJ^_[]WVL$ 1@t!9Jtrxt~T8t61^_SL$t*t$\$ 9Juu tzduu1[ËD$t9 t3T$9Au$uuq`ty@u u1ðUSWVHu D$Pj1@MD$9st$FVh%j |$0Wq{ CPD$(Ph%WJ3sXsTD$,Ph%W(3t$t$D$,Ph0%W3sCtPD$(Ph<%W2Rt$S` " "y"\$ "@t# " t!" tn7!QW%SVP|$8WhK%uVl2 \$sdWh_%VM2Ct"1V%TG,C;r拀ht&d1VSG,C;hrKPD$xL_)L$D$@D$ $@sߋL$wdh1t9t F,9u9u*D$ 1t9t F,9u9ttT$ B D$GsVPhF%Qt$ D$8Pu2L jx@ \$sxt=1FT!ȃu&~ t GFXPWD$,Phn%u0t6u1@u M1He^_[]WVD$L$t8T$ t$r p9v? 1:T$829|$ tt$$ 9t,Ju>t^_USWVt$Ft-9t'\$l$9GuGxSVPU?tF^_[]USWV0t$DD$$Pj8F D$D$1D$?9u~}d|$tWETjPt$,V` Md)v tAu"EPt$h|% EdD$$"$t$$9r؅t$ˋ}xG u G4jPV O )v t|OTtYG `>@tL$D$ uD$(<tQ<t]<u|$ uqD$XpxHL$( jP$P* t$h%&w8t$h%wQt$h^%t$ it$h%D$xM|$ BD$ƀ2D$p΁w\Vt$hs%t$ w$A D$TAD$PIL$LD$H1ɉL$@tD$@ D$ \$L$T$HVD$ t)t$ ^T^TT$4JF4N8BF<SVD$PPD$(pD$ RD$TT$ BD$PBD$HL$LJB D$tD$ ǀa7T$4Bt$ F<JN8F4JRV0N,F(L$A|F0q|D$t.D$ @jPt$ tjt$$=u1ϋD$ x T$(ʉT$(@TT$8tt$ ~ tT$8T$ t$(r$tjD$ @@tTD$ x@uJtjt$$u4D$ @$D$(|$(t"L$ A4PQu hJ%D$$D$8V% g%~%t$PEt7MT$2 ,Hu܋D$@8t$tNGTtB$tD$t0t$t$@Dt$4VIj6"t$\$1ɿSQWTV1QW?hv%t$$D$u%D$>j菸D$@`>@A|$ut$hC%ƿt$0q t$hό%\sLߋD$,9CPut$,t$ V^ _VGP1t$,9GLt]t$,Vt$ P$ wPD$ D$لvn1ۀ_Uh%腿W)Mtk,‹t$(90t ,IuЅtVt$0p t$h%U|$u/j |$u$jt$-ut$h3%t$Rt$0t$,t$h‹%軾|$<tL$11BL$jD$ 1SWV|$G Ph%<ujjƉ6F_>tC FPjyt.t+@JAH *RWP" tF F^_[h5%ؽ^_[USWV׉΋A1PUS"FVUS t!NtHNVJFxjt$P vL V^_[]USWV8|$L_OTȃ GTGPtTk GX$PUh% t#@uUhc% S0AC $1E9^t 6u(Fxt1ɋPT8t9tʋхut4$h%޻j봋4$VUhl% WjLu!, 81t, 8t h%L$o@G WQSRPU赽tDD$GTՃGTD$ j.PUjt'OQPhs%j.Vd h%襻)hL  Whj:Pj謲8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPWY uFTt|$tF$61^_[]USWV΋yx1t>1COTШu* uG@jPw OTt OT tY?uŋFuh6v%Ph6v%Pt-u~`?w#F0RrF Ph%蹹^_[]jt$4USWVdl$xD$H1ۉX@X @Xf@@upT$@ <$OJL$ YYYYY YYD$D$T$ D$L$D$ \$}jSUп D$HD$$)D$(.D$ \$,\$0\$4\$8t$<] Shu%跸u.j Wh=<PEL$jQM u h%$BHJ?EUhy:jjɯ?E PhE%Uhy:U_ Sh%h h%ud^_[]USWVp$D$pC1T$@1 D$$|$G_G WG0oUW-M tD$WV@ hƎ%p^_[]ÐUSWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh؎%b PUZ(D$C,9r|$t"w 7h؎%a PW$(,Nu^_[]WVt$ tqwgVhz=jq1GGG G XGt$b^_% Vh%h "诶 ^_ËD$@|tHT(tuðUSWVD$1t(x|t!\$l$SUW% u?u^_[]USWVD$|81t9\$l$tp|tSUV u6u1^_[]1USWV$.FX|$ j.WUj$wWh%辵$$tXjVW ÅFD$Pjt$L$QƋ utx|$NjSW3 tL$9uPWVS t0 D$ PSh%d ^_[]h%شjjt$t$V;t+> |$ u2}E$<ދl$ D$ PSh.%늋l$t"UH4:QuU:QuU:Qu$|1t.tI4tU:QuU:QuU:Qtcv΅ M $Uu@4xh@L$ QPUWVRt$Sht%@$ WShN%ѳ F PSh% t){4t#D$} t*tu Vh% Vh%βjjt$Uo\$D$D$D$1L$ ‰1Cl$s6jPt$l$UND$ 1Cl$L$tjPt$UGL$ ,D$;ZE1%fX%t Qf9Au<< ,<uk|$H $W%jD$$Pt$(  ȃ|$>l$@T WV= PSVhԒ%̱ D$ PD$p Vh% D$ PD$p Vh %{D$8_\$ |$WjRt$UFf|$:ˉكčF DQSjl$ u(PhM%腰](F L$ QSPh%D$|$\kl$|$@5D$@jjt$U mtjD$$Pt$8' } f4$jv%MF L$ QPh0%ί k(&SPhg% WjSt$t$ntHf|$u@8ωčF DQwWj\$ s,Ph%0{,WPh%į l$jD$$Pt$Z& |$\$ tj݋G< $9O@s#P4$蚆L$A<<$W\$ SP D$x@;u D$8u/D$ PN(3 EPSVh%ۮD$H|t<PTtuȍN XT$ RPQhF%c h%F L$ QPh)%A b&D$w! 1L$ T$t$QPR#SWVPjh0j$ 1NtKljjSj hPgt $jSjj)Wgt WD^_[WV jh0j輯 ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQWD$jPV` t?jWj$j)V'gt"$jWh@hVgu%h؏% VC h؏%1N ^_USWVl$\$1t=$W% r_t1틃hDj詍ǸG(G,|7fLJ<fLJ?LjSjhW'jjSF t S7 C Ph%WShIS 1^_[]Ët*t%u鋃ujSuˋtƇ@S 1NSWVt$@u{Du ?t~ Wh %PK 1C1AKKK,K CVPj耢t(SVh|j jWh.%h "ƪ ^_[USWV0u<@щƒ ыu?u61PPSh|P+@uu1ɀuuA uD$Y%D7sl7PuJȀ1C uuD$u t8u V$1IHhD$(L$G0Xt/T1D$f;tD$ЃIu D$1>|$tD$t?F |$WPh)%# D$,hPW6+Chi%苨Gh%M1=u1HL$,hQP= ;?@L$9D$ L$Qt$R+ {TWjdqjZ!у|$$|$L$D$)ljT$ ыD$$8HT$,Pjt${ ShD$ tF|$+|$D$ D$19D$ }*uF Ph˃%ѦD$BsDW~CDtL$,WQP {HYh%|$t|1QQP臵 t$6*sD蓎1CDCH-\$tu2a 8tpW 8tfD$(Ph%h "萦 H u9H|t;APt"ftftATu y  Љae^_[]1ɉH1BPP@ H~ Wh˘%败 t(}Vh}j jWh%h " 뀍F Ph%ʥ+cL$tfǀ<8u Q SWVt$Vh$bj˜~ ;u Wh+% WhQ%ۤ1CCCC C Xt|^_[Whr%h " ^_[WV΋rjVtV%rjVtV^_1L$1Bt$USWV $΋|$ 1Ct <T$@D$tVjjP薛]E <$L$ VGtxEtptk8Y 1ɉHH@H HH$3}AEu%$P6&1҉Ӌ$*uLEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 t%tPV0ELP薊u4苊u<耊Uwdž6|tHtu9@t)jP菗 9dž ^_[]à Vh%h "FL$1jSWV|$WhIj臙txWhSSaWhSSJWh+IS3WhSSws^_[USWVt$Du ?^ Sh%Pc 1@1oGGG(G oVUj蜘wDӈoDoH&tS^_[]Sh%h " ^_[]ørL$SL$S|SWV|$t$_ueGPu_{ uY >uNt?uG@PstO WhTPt|t$WPVO^_[ËT$Bj(USWV$1@|$D{l$Hw C\$@ D$ $t&1V"G,$;r苃pt#l1V"G,;prt$<$tt p1Wt"C,$;trD$Vh %Pһ D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$lpD$tk,t$19tF,9u|$19u/fu)fr#D$t$@PsD$D$p9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ h*WWt$$t$$t$PD$\0 t0L$ D$ PQh*WVt$$t$$t$PD$\0 D$ L$)1HC t$@1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s 1>f։T$,|$t 9t,Nu:t^_[]USWV͋F4tPxF4 w$W%G ȉT$0u9  D$01uD$D$0L$,D$((D$$WhPe D$(D$,1҃ |$t$l$ D$ E $D$lD$pD$ 1t ߋt$;tS,OuBrD 1FuD$8rD$8u D$ D$t$E,;,$uT$t#|$l$ 1D$ ND$ |$l$ 11|$,ujt$,ڃu5tʃ D$8uExD$D$[jUP赊ڃ D$x73t"411A9rt$1u 1ɉË>1$1 $X%NDFH8D$PjWQ$D$ÃuVD~HF|tIHTu= r x t1>t,@Ptftft x t> u ft볉T$D$XtT1f:ÃIu>1ɋT$u(D$ >uD$@t @uuVDnH1 L$wZ sPD$uCD$6Pj URot.L$ >Ƌl$uD$ Ph#%;1l$SoNjD$x4t.X8L$lt&f|$6uN H NHVP)1N &H &H &H &t$ t"F>rD&N<F@LW WgG| tY;L$ t tv4t8Vu 8fu8FtIыt$ t~>rF QPh%轗 t$^4 uH|$ xffCfCxtMQtS x0|$ffCfCtD$[WPS L$<$t3D$fffCt$tVWS t$t$X1ҋTҍ<@T$$D=1fÍ΋L=L$L1ɉL$PL$TffffNFT$RL$PQP t$ރ$t$N|/ʼnD$YT ry >APtftft y t> u~f;}ux;unfthyL|$HyH|$Dy@YD\$@|$u0L$ >u!@t@u<$G D$ 3$t`4$|$1C ffOUPQ; C;$rΉf|$ffGl$1t$u T$ NjF4$1<|$,uO'T$0 1tȱ|$8tOGPt$,L$8AffOu85ft,ffpfG5t6PUWL ^_[]ËL$$b6USWV׉΋tt'|ɉ|$t7x11؃G9u t7+Py  1H|$r WhN%1 $ $fffNttɉNtt@|t]x1ff4tV= 4G;|r&tffN +PQV $^_[]USWVT$ˋD$$dX%󥍌$"#P8fp8fQfA$ BD$H4Jr $D$HD$LT$P1$$$$D$|D$xD$tD$pD$TD$XD$\D$`|$uSΓT$zl\$ uzpu ztuzxtB4<wRs D$%$rl$j.PVj:T$ D$F $F$N$$|$t0Bt$ tu_BzuiiB]%|$u%D$$R421%f'X%xf9puiB0F$tB0B ti9B0vB0zdtPS T$JZ0t\$@D$Dl$@L$0D$054$|$D$ fD$(l$(߼$l$$V qD$p%|$u%P4t$ t%L$$1%ftxX%tk~f9Fu`1ɋD$ D$ " "|$uVjGAUSWV΃|$$w Vh%11H׋ 1(t$$U1It~ $khkdk`l$,ǃul$UjRƃ>U|$,Wt$, u;;t<$t Vh2%RSDt#CHtƃ>UWPr ^_[]h%h%h hS%]V΋QhSj1ɉHH@@ @ @$,{t _{^ Vh;%h "貇 ^WV΋Ƈ?DtuU1BCwL*oGDOHGLOP1ɉODOHth`%VP6 ,9F Ph%G|t1IHU H$H u1j:u)F Phs%Ć1VPj;~^_USWVX։ϋt$u0@u'C|t@Tu1ɀ@ƃ@L$ tG uVPh%QV1Ж%8Wjj}D$$PjO|$w$LX%8uJٖ%=ǃ83%8u+U%8u\%8u %8{`G D${|tat$ްGTu3N`W u u1!1t9wGXPt$h%7 ؋?ut$u {`|$ui s`t$h % 1CdC`|$tt$C`\$ 1ۃÍt\$ 3ƃ?pr#+Itz=WVPjQ zCdHrWh3OPjyChtWh}|PjyC|Pʐ|$s|6GT rHO uuG OXQPh˗% #tG OXQPh%蹁 G$GT rWt+QW)1ɉO$O GWQQyyf  s WߋW芌Ahv%Wt;u|$G s`Ph<%t$gC`tFuaKdɋ|$t$u]KhG QPh%t$wT)_Kh|$G PhV%t$L t$%Kd|$t$W shQPRhn%t$ !j7D$uEG \$ VPh}%S sHsDhV7CuVh1}%趀~|t7OTШ u( uG@jPwˆ OTt OT t^?8|$W7L8<rtuj,xe^_[]Ë|$G Ph%w0ChPh%t$} USWVd|$xwo 1HD$8L$D$ @|tHT@uHTD$,D$`D$ D$D$D$,Bf9A)fftftf  $9v% t$h%T$BUD$PD$(P| L$8Xt T1f9Zu2;t$ t A9u19uAuD$?@u.j D$\PjD$,P3(Pt$ h%} T$Qfua1D$(D$$t$$)L$1UVQT$u D$ ƀ>1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`P~'t$|t$,t$,Pt$h&%w}:fD$D$D$PjUV*D$0T$4)̓w! t$hr%@}fjPD$DP D$LȉD$LD$PȋL$LD$P9v) t$Pt$Pt$h%|l$4D$h|tjD$@PU~ upmjhD$DPt$zǀyfD$ $BE0JM,E(EL$E(ETuET$%ETBE<JM8E4L$LM$E T$P9t MTU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVmK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ hJ%{ t$hٔ%*{|$ɋD$,u ȃd^_[]USWV|$_T؃ GTGPtG OXQPh%z wE tu{E|1ۅt5HT(tgGPt ftftGTu tǍF Ph%yt}u^_[]8Vp62^_[]SWV΋y WhЕ%y 1CCCC CC${t{^_[Wh%h "y ^_[Vt$F Ph %y^L${1 h:B99T$:,=Z(D$j P5h:藹 p>1 h:9T$:@=c#ED$j P5h:A h:D$0؀:؋L$9 18D$8j P5h:N D$n 98} Tءh:8B؋D$8Z,#@-: @-:h:X*|$W5h:^"p-:} 8yeh:D$#@-: 7 A-:#@-: D$#@-: @-:D$j P5h:з h:K9BT$:5H-:I1L$xA AAL$hAAA :hL-:QP5h:=>=L-:wwhP-: Gl-:W} = A-:@t!T @-:1Wh(N1;=>1=>1} R:h:D$ A-: Ck B-:_ @-:h:t tU1xDQGu\$$$$R$R$R$R$R$R$R$R$R$R$R$R$R$R$RQh$PIHH=w$)11ҊP-8B9u9~@-:u7hK$" ~1P-8Ph! C9uj  \$$} # B-:  B-: @-:@ @-:%B-:D$P5h:h:8L$9v\$$]D$$$9|$D$ fD$ l$ |$Pl$D$PL$T >1>1L$LD$Hl$H ($|$ T$ fT$l$\$4l$ T$4R: uhΜ%PR: @-:@Ƀ`F~2GtZLtOStf~(gtAlt6sf7At.Ctfatcxff f f@f D-:@xEhߧ%j QhE%Rh%h%Qh%QhN%P H1)΃\$$@-:j.ST u SU )1?$QSP谬 Ƅ<t- tU1CҀ|Qy lU1LQH tU1@u܍$1R{D$#jPW{ VSW{ D$8WP)|$XWh%jt D$8D$dh$VWjLyV膘  1Ah%TQhb%Z5h:h%H5h:h$6P&8Ph*%"C 1Ah.%Q# 5h:h%5h:hy%hha%1FV{Ph%V 1uS á@-:t=t>1 h%L1t$hFFFFFFF :hL-:VPS7u&=L-:GtÉ-:Guh֝%-P7Phs@$wPh-:A w ww` -:y h)&j( A-:@t5l-:hP-:P L$A-:tG$jVj'j)5-:%jVj(j)5-:%RP,DP@-:Шh%)$PVjQ6ud$xtA-:th %EK$ppj0j)5-:6%uc$5hI}%P5PVh% u2=t>1-:r-0*hL%}h3%s-:t>10 WBD$u h%Bu rH-8@9u) -:1-:-:) -:) -:DŽ$@-:@t$jPjh5-:$D$8@=-:u2D$8jPj j)5-:#uh%hi%|$u.D$8jPj+j)5-:#u>h%P1|$L$8jQj*j)5-:}#u hӞ%@-:rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5-:"y h %QA-:t+DŽ$j$Pj&j)5-:s"uK1ۃ|$$p>1D$,tD$t3S?-:uhA%h&%ƣ(-8,-8|$$tF1FFFFF  F)F.N,(-8,-89rF t$ƃ|$t.t$=L$Aut$h^%+p>1D$,|$,tF)F/p>1F A-:@;DŽ$jjjB y hy%Q-:-:X-:-:\-:-:`-:-:d-:fR-:'u-:h-:|$tjt$ j.j)V =p>1ujhP-:VU yPh%UPhp>1Pj)V uY=p>1tjhp>1j j)Vo thß%$PhP-:V yh%h%h%VD$ t>1 | h%E$jPhh5-:t$8jVj$j)5-:y hV%jVj%j)5-:y hs%˨@-:H H r8r t>10 s~|9~ h%Et$jVhh5-:y h*%jVhh5-:h@%d8t>1PQh%6 @-:Ѓ1۹N:PSSQVRhP-:N:t!Qh% @-:ЃPSSPVPh-:ot!Vt$0tWNuVjM VjB 1-:-:L$?V1FhN1Vhh%询 V6 USWVX H-:-:t91ɉ D-8 @-81GH -: .:-:f @-: r+rm ]1sqA-8D-8YA-8D-8-:P-8-:T-8-:X-8-:\-8 A-8D-8 t1@-8 -:-:H-8 L-8fH-8t>1Uf@-8 -:ff D-8fF-8=-:u"t$@jVλȣH-8FȣL-8t>1-8-:-81L$@A A@-8Y -8$-8Ph-85-: ƅx9t&y h% VS5-:h%E @-:uWh>1W -:-:-:-:-:-:-:-: u2ء-:-:-:-:-:-: P؉+-:5-:D$8t$1=>1t$4|$0l$0R: -:L$ -:L$ -:L$ -: $$D$|$T$\$ $41ɚ;4$ с6eĉ $|$؋L$\$ʃ t1؉+D$ D$(D$D$,l$($+D$D$ D$ 5($D$j؉-:-:$-:e^_[]11A-8fD-8D-:fF-8D$t u-:-:USWVH ӉΡH-:D$pu H-:h-:j(x-:,$\$1 %>1 J$$߬$w١-: -: tD+ -:-:$$߬$-:+-:$ۄ$5($D$1vx>1-:D$v-:ȉL$|$fD$1@L$|$(.:L$ωs.: -:L$L$ |$(.:L$ǡ@-:=L$|$(ݜ$ЃN:P1PPhWjRt!t$|W|$Wh%t$h5%@-:1$@$T$P$L$H$DfDŽ$@\$K $XK $HN KN SVЃN:PWWhVj$XPt!Vh>%t$|$\$,=-:u ݄$\$$F% D$D$(t hT%D$|1|$ ;|$Dw|$D|$x @-88j@9uD$ g Ȉ.:|$@-:t$ЃN:P1PPhVjRt!VWh$ t$Ffff9fDfPh% 1@Ph>1P:Ph$h% h% h% h%w h%m hƤ%c hۤ%Y h%O h%oj.$Wt$|j]uj.h!Wָ Wh%j.Wt$,j]uj.h!W裸 Wh%"h(%h"Nfݢ%fw %PA-:GNju j.$Pt$ j]]hx%<h%?h"2Nfݢ%fw %P A-:F h%Ffff=fhϢ%fPh%FffQPh% sFPh%hL$$T$ /Ftc|$ umh%h%3Fz$l%h%t$Ɖt$ t$QRPh[%h$2mPhУ%`4%h!A-:F<<ݢ%h<%A-:tFj%sV%P\K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( tU1D$0LA q$so#%PQF9uEPha%h% h'%h<%|$ FPho%j6Ph%Z|$ "h@%h% h=$h{$jL$$ 'j.$Pt$ jXF$Q4%hg%Th%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"P5 $@D$@|$ Ph "h8%%; t$ 9|$oh%h%D$$$T$ $@WjWhk$'PFt h'%0N1H 0N1~(N1H (N1 h(N1j )L$|$$t1 q΃j.PL$QjVuj.h!$P $Ph$%|$u"tVh% h{%0N1H 0N1~(N1H (N1 h(N1j t$GNjL$+{h%gih#gA-:t$NhH$INtuݢ%'P%1L$1΄u j,$D$H%x %%sVQD$9D$t$uKj,h%D$4L$:D$tHj,D$4WPh%% $D$4D$ uj,h%Z0N1H 0N1;@N1h(N1j)an(N1H (N1)h%h#@-:؋ 0N1Q0N1~ (N1Q(N1 h(N1j @-:z|$h ot$dc~)/F1#ty1h%n2td3hΦ%Y^ F N t$~WRQPhT%.\$S"ƅx*Vhy% 'h%N h%D$@Ph%~`1St${"t:j.$WPjRSuj.h!W> WSh% Sh%oC9u\$,t$ |$d|$h19wƉ΅h(N1苋 (M-:T$p1Ʌu9QV&jV裌 +r VPTj 5-:hӠ%5-:h%5-:h %.:tPh"%z-:tI -:9~h~$Z0D$D$L$d$ F! \$$$( 0N1H 0N1~(N1H (N1 h(N1j $-:-:tz.:$$.:|-.:x>1-:$\$\$\$ \$$4%q$h(N1ĉ h(N1跉 USWV $$919gՉ $t$ $;8t$hh0m%$,j =&GШu+$ ؃?9?)9K9si tU1LA q$so#%PQhV0=hV$,`j =GC~ 9r9$$ul&hh0m%$,Vj =wDG$8:$ t-؍L$VSthV$,i 1 ^_[]USWVP։1|$4$u9|.HPhw%%wS$%W )1@1sC9uÅu.PhQ&@t$߉E1 `^_[]USWV4)ȃ'hǥ%:։ϋ ˉ h%`ˉ $Wf_oUSRQt$Phh%Gl$j.UPjNuj.h!U Uh%LGj.UPjMuj.h!Uר _Uk_()|c؉<+<'ueh˥%0<9#<,uthإ%'<+ughޥ% <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5 R:t$PV;hD$$HL$L$ 1x1PPPW jh@PJ 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$c$1H|$$R:D$PVP L$@D$D$ 1 G|$<$D$=>1$TD$j=hW&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hW&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$Pz$))Չ|$)L$ É$T$(*)QSPL SVUL |$|$t$ v"+Hj=hW&P Ņt$,]> 04$@", 0D$1USWVT$t$1IЉt o@8t1t$:t|t9vOt <:t G<|uĉ^_[]á,R:tP, ,R:0R:1(R:4R:5,R:tP ,R:0R:1(R:4R:1USWV$ $0R:u=0R: ,R:uh%0P,R:v R:t1(R: ,R:PQEft $D$ui1,R:1K@ @P ,R:0R:H 0R:@h%P,R:u95tU1DN@u:t#t 4R:|\4R: R:0(R:#$(R:1Kc$t\u'V5,R:>eu ,R:u $D΀:tDME@A @Q ,R:#0R:1(R:4R:1KE:EE<$1t:t |tL@DD$T$$jPjW-Ãw2,R:tP{ ,R:0R:1(R:4R:CJQPL 1,R:0R:&0R:1ۈ(R:4R:0R:1(R:4R:؁^_[]À|\u 4R:n4R:bUSWVPj=t$ t$ Xjd IƉ$d]Q\um_:ډـ0u`_1ɽҍ ʃЅtdSCրE0tU^u-O:6:G"a$M7þw>$%߈FHGNm&Þw$%:܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4ޤ "FPWtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PU t2߃dރdDd)t8ePUu$U1H dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=8R:u t11jNt @R:WV/ t7j L$QPk  x#L$9uDR:;D$ D$uL$us 8R:8 8R:APQ~ PQT  8R: tuQhhQR:  |$uPR:1^_[]HR:TV:TV:1Ҋ+~,u"1t$L$t' t" t΅tAL$=pY:upY: t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=LR:u#PR:8R:tP 8R:t E /h"!V%E$j:t$ h 1@|$ u]:1^_[]WV=tY:u et3t$|$ 11t$t$Wj1tЉ^_1@PPhhY:hxY:t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=]:u+]:tY:tPL$腠 L$tY:D$$tˉ01C؃^_[]:tY:tPB tY:PPhhY:hxY:t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=]:u+]:tY:tPL$豟 L$tY:D$$tˉ01C؃^_[t ]:t D$]:1@1fUSWV\$l$t$Vn PVWN UU PUW: SA PSW& t$ V) PVW ^_[]WV t$uu1=]:u1F Džu=]:t<' 1=]:upxj PhHE!{ ^_Ë5>1S "QQh%Pփnf USWV1ۀ=]:|谘 0|$GSSPh]:jWG u ]:j( ]: ]:t$ r1H]: "1ۃt2u3hWh%ݼ D5]:~ȃ9w$ȩ%]:a$D$->1R h|)"L$Qh%PՃ4]:(]:>1@]:]:>1 ]:I9@>1 ]:I9@]:]:]:]:]:]:x]:o>1 ]:A9~_H>1W ]:O]:F>1|14>1|*H>1"]:]:]:]:Gv|$'h%v t CD$CD$ L$ =]:u hw>1>19}>11F-]:]:]:]:ӉÍO-]:]:=]: ]:]:tG >1]:V^: ^: ^:< 5^:^:=]:tB^:)։5^:=]:u!1$D$D$j D$PhHE!菻 15^:V5^: ^:$^:5(^:15,^:]: ]:r  ]:]:~.9v]:Ѝ ^:9v]:x[0^:S]:t/ ]:QjP 1e]:8t ]:1ۉ؁^_[]É9ru1BV9 ^:s^etu6&^sUSWV$l$@t=]:$1 \$<%UUUU)3333!!щ%isa+H!9r]:9v ^:99wetuw%ƅLD$801=]:1=]:u D$hpj PhHE!W $^_[]Ë=]:!!׉D$9|$44$9r)Ɖt$9vA5^:9{=^:!9r$ ,^:,^:etus$ ]:$D$T$7Ƌ^:!C!|$T$)މ)Ћ ]:<$D$ t%ƒ$1ɋ<$| A9u ]:|$D$ ‰)…t5L$ <)|$$1D1J "QQhX%5>1jJ "QQh%Pփ] SWV 1L$ |$t r =]:uu1Ftuj95^:s(tUǀ=]:u<;=^:r\;=$^:r,Retu !K DžtVjWl =]:t?藎 1ހ=]:upxj PhHE! ^_[Ë5>1BI "QQh%Pփ[ USWV|$,t$(u=]:utI11Gt9NË ^:9sI^:9 8Ս1ʅM]:99-G  ȉ  ȉ BrAS Չ  Չ  Br@9Չхu95^: 95$^:ŋ ^:!9r؅ ]:9s9sR]: 8!9t*@9w<9r8]:8! >1!9u=]:u\9sX7)SjZPbetu  ʼn9rPVU: U=]:u)vPjS 8!!š^:1҅ $t9pwt u¹^:T$^:Pt$jUVt4ŋT$$Bj^::=]:u%9s!/ $)QjZP(^:T$]=]:u)vPjS~ u=]:t<$ 1=]:uD$0xhj PhHE!z ^_[]Ë5>1E "QQh%PփkX USWVPˡ^:!9th)‹ ]:(t$u9,$)<lu=]:u VjZS0~ E)ÍFu1wA#%M^:19Xw w(% w#%1É;GsG1B TGHO;Mu9}tBtEM 9U9t9ztM }zE $u t =]:u VjZS } VBƹ^:a=]:uvjZv| NV,^:5,^:^_[]Ã^_[]? V t$=]:u01ɉHHj PhHE!J t ^ËL$SWVȋ^:!9t+)֋ ]:|$u 9t%)D@^: 9AwtAD ^_[USWV=]:V "VVVh>%>1Vhz"hr!h_%>1,"=]:u," &=]:uԠ&!"=]:uK!RQPhk%>1 &=]:u%!=]:u5" %=]:uJ#%=]:u^$VRQP>1>1$ ]:|$gfff̉ҍ4މ劄1"GO wh "hz"Wh%T$>1$ ]:|$gfff̉ҍ4މ劄1"GO wһ "z"SUWh%T$t$|$f4SUWh%>1>1$ ]:Ggfff̉ҍ<߉劄9"FN wh "hz"Vh%T$>1$ ]:|$gfff̉ҍ4މ劄1"GO wh "hz"Wh%T$>1$ ^:|$gfff̉ҍ4މ劄1"GO wҸ "PPWh%T$>1$ >1|$gfff̉ҍ4މ劄1"GO wҾ "Vh\#Wh%T$VVVh%>1^_[]USWV΃= ^:tPt ^:3!1P%ǡ^: ^:!)ȉ9r1U~% ^:9tEuótP-]:!1PPjhjUP t(4^:t8^:=4^:=8^:-<^:1ۉ^_[]V΃?8^: ; <^:v$1u8^:Ɖ 8^:^USWV]:]:]:΍ I$tSt$1҉PP ]:9]: $tdi$11G1ۉuuـUC]:9r15>1K> "QQh%Pփ=]:P 1ۋ ]:9sM ۍ Iً4$,$1ɉMMs)C]:]]: ]:у9rߋ]:ʉ9sWR4$,$1҉UU]:w)ÉU4 ]: ]:]:ʃ9r]: $T$ ^_[]USWV ׍B $Y1EMˉ)΍ 9wۡ]:D$^:D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$B L$ JL$JL$J ^_[]USWV $9]:s%5]:!֋ $Ņ9]:v6J Љ  ȉ  F1r{@p9]:sBJ Љ  ȉ  F]:]: >1u%1I#5]:!֡]: >1HH I$D$L$t_xtYXHT|$ <$T$ T$l,<$T$|<<$|$T$ T $$,$(1҉ȉӋ…utCl$l$ $T)0gËD$C$|(8$ (81D@;rzt$<$T$|8A9sTT t|$ <$t$l7,<$t$|7<<$|$ TH $D$1t$1 $T)4уl$t1J $4TCS1]Lt/щT$ Ջ$|$l:,|:1@- hz"Uh%PӃ=]:ulj<^: $9v(^: 1RRjPjQR @wb1= ^:jŋ^:!Ë4$)މ؅t$P ^:9tuxt$$^:t%(^:tY1;xstuu=19<$C9r-9$v(0ƹ(^:W,^:,^:ủD^_[]> VQt Ћu!Q1t9 t;Ju ыru^USWVPjt-t7muCks tht%9]t }zr tpzr xcω4$9Stj k jk*rs+jt 9Ut͉]2^RtZ4$t Ru11t 9t _1ˉL9t6z u~B @ z8tGXZtHX;tGSFPz uoB @ :xtGXZtЉGtx u1ɉH J G j9t&ӉЉFt-PBFu#$(BthPBFu^$c~Z;t3Vr@ G GOtyOHt _;;t$8GS~Z;t3rk@ G /t}GCt G;8t${_֋R$0$0F ^_[]USWVP $1N=^:1!׉) ]:D$)_t$ +t=]:u jPRb ;-^:v|u+HL)ˉ\ \ +; ^:s|$u\ \ D$+\D ;Gv$XىJD Gى;osouA =]:t^:^_[]#$H t ^:$x ^_[]USWV@׉9 ^:95$^:j* ;$^:u >9uP ;$^:?jWV6 #1ۋ,^:t ,^:98^:B@;<^:v@8^:B@8^:3B^:B(^:N^:9rWV u=ri j@S06 ->1H$ hz"Sh%PՃ=]:9=^:uZ,^:t ,^:78^:B@;<^:v@(u(8^:B@8^:t=^:rz(^:@^_[]9 ^:u) ^:$^:U6 USWVP $)t-1N1ۉ9wˉv X+u11B1ɉJ B ax Hx9tt { u1ɉK 9t>wt~ u1ɉN H G h9t&ÉƉJt-AHJu#$( HthAHJu^$czX;tBPA G W OtyOJt _;;t$:WSzX;tPkF G /t}OKt W;:t${_‹@$$B ^_[]ø>1ø>1ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[áR1D$t$PLWVL$T$ ‹q~y ;q~ t 1~9 QP"^_D$ tU1DAD$ tU1DAD$ tU1DA%D$ tU1DAD$ tU1DAD$ tU1DAD$ tU1DAD$ tU1DA%D$ tU1DA D$ tU1DA@D$ tU1DA%D$ tU1DA%D$ tU1DA@WV1F|$ 4%Wjd tF u1^_ËD$t w$Ũ%1ËL$1t9t1ҍB|uËL$1t# t|$ttU1LH1H rËD$t tU1DA$H1ËL$tT$At9ut1VD$t$tPt$VW ^D$ lU1DAD$ hU1DAWVD$ " "tƀ>t#%b 0PWVhu&hN1s^_Ð1|$w L$t9tø>1f|$3 x"t "fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fL$w%9 l'vdU1fL$%9 &vH1føÃD$L$L$ L$D$Vt$ t$VhN1脡 hR!Vt"a 0kPhj$hN1@ N1Vj `V4 ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t_ 0 _ 1$^ÐWV|$ W4%` tFu1 ^_D$ftL$Qŀ%1USWV$п$$ u V^  X)jL ŁTUUrP$@@D$0jPmD$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#4$d(5 111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$@^:L$L$ tUc|$$1Ĥ^_[]USWVt$~X>3܃ V$0% j F H @(N]_?[\;^r~uFF@^:@^:C><% ^q{t|~F~F ;^r~uF@^:FF h@]X@ w|(hS;Fs8)t)h~ wFDPpSe;Ns A9)t~uF@^:F^9րրw t$rI{i9s <$=tU1]D_\,<$t~uF F@^:@^:Au~uF @^:F>:* +F)@HWPF)P)?#{Ë;NsD9,u=AtU1IDJt"9~~uF @^:NPSN9/8}@F @y(N pjF H @$1P1C)F؉HWPF)PPY^XWSrF)`P}F)@xWPLF)P ~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF @^:F"{u@9s tU1DAu~t}1^_[]ËnD$D$F@^ ]njFxup tU1DAu f'tf`uW~F=@9t8}@u~uF ~uF @^:FЉ0L<$USWVt$Nh.8\u/;nr~uFF@^:@^:E}Ł' $~`$\%|tb]Љ8SdBtX@S>**.[9D~uF@^:FF @Ds{~F F X@kh@ wL(hU4V9s"H9s 8\u9)t\j)F wFDPpUV9sH9s8\u9)u ~uF@^:FD$ xt~uF @^:.n~EFx tU1DQuf't f`FjF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS F)`P9\9{ ËV9sE9,u>A9s2tU1 DJt" 9~~uF @^:N$PS FJ9s&9s":\u9}u$t1^_[]9s9sy\u9}tHA~uJF AM ^D$D$F@^ ]$.^t~uF @^:FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF@^:F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP] D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj jh%Wl> F HAj@Qp  tfËF X PJH<1|$F @tD<N9s8^u @D89si]tE-u]f->~F jpf]@T$P F$\$T$  D$^90NL$]H9s-u9]-t{[9 =:uv9r$8u@^:^@^:]t -$8u@^:F@^:$8u @^:F ËN98-P9:]:-f-9؋$r;u@^:F<]t<-u;u@^:F= T$P V9H98=9] f9u$ÉT$P^99]=R10f9Ë $~9u @^:Nff9ۉT$SRC1=R19f9~w;d;TH9stU1DJ)Ãr~$u[FPSPD$$P; DD$P4%H Cu$:u@^:D$@^::\$1ɈL$D$L$D$PD$ P%:$~8u @^:F1ۉD$1D$\$D$D$PD$ P9<\$1D$L$D$D$PD$ P9ÉT$PC=u,%11GPՃtGT$P1Ƀ=R1G9ɋ|$G@jP7 t@OQW fHV9sjH9ы$8:9]9~$F Hl$ 9=tU1ADWuI$:Hf9݋\$C@jPs% tCKf,f|AK$8 T$j-K^9H8] $8L$T$ D8$tF @tL1=R1耉11G1ۉD$L$119 $tOL$G9fl$|$L$=щF X@ $D$ t(^|$wO7E1$؃9u F H$8u@^:F,^_[]ËD$ |,uD$xuD$xu D$ |<tF +h 0Ur0붋D$ D(D$SWV$΋A @u1 tU1LAtx hU1ulU1f9DAuP(^_[Ë>^D$f@]D$F~>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ F^_[USWV1y19sC11-tU1D]t#=k)CB9u1Bt=|yuA @^:Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$%)@xWPF)PA~uFN)! ʉj~uFNT!ڃTjGEUS1CU?Kl$E1=‰$|у $~)ExWUWt$jpF)PR~uFN)# ʉj&~uFN#TTj)~ )EHWUF)PP F@^:FUSWV\$1=R19~1@(ϋF,@jPv(L t|F(N,QV,fH~<t}lU1Dh R11҃9~1B R1hU1Dh1҃9~)1BuG @^:G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF@^:@^:A^:^_Ã~uF@^:NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF@^:F1^_[]É؉D$%%t$t$U1 u U= t/uՃt~uFG롋$USWVl$q)t3ӉϋQ,t!GO RPQ1 o^_[]SWV1G9Qs7ӉjRq tF^~uF @^:F1^_[USWVP1N׉$1+t{`tswsK$%@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=R1|$ r3GtD$WT$ou]t$S; |$Qo ]GtD$wt$wt$wSM; |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4q L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ X ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$pt OuË|$$ωL$ =~uf~|$\$\tf tU1>|$u l$`\$\z tU1D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" tU1T$l$`DQuf|$_tfv3fy}$ljt$t$VPVUo Ɓ|$tK|$tA tU1D$¿!DQf_֋D$ !DAf|$$_8tV|$utU1L$ DHuf|$$_u3|$utU1T$DHf_u =wu$t$D$PhwPU D$<(D$@t|$0 L$4$hUt$HD$DHW_N$;GOXL$LY;GU_$_ŋt$DF81ۋ$;D$09$;Gu G1;G ;G~x t,sO$9u G19U8 LD$@un=$;D$0.@$V1ۋ$;D$0L$I L$|$D$<1ϋ|$L$9D18$ED$89t$DN_u_uuP uC͉$t$ t$ D$@PVt$@L%;D$8Z,5%)$%T$L$GL$Tt !1ۃ)uL$ dAL$ L$0)ы4$9G T$RPVqM t$T$\$@E9uo$L$8uG $T$LBT$AG$l$;t-)ȉt$ Ut$@Pt$@9Ml$D$89I $L$8u9uD$$9'$;\$0t1ۉ؃^_[]ÁGT$$ˉ+O l Lt$ t$ t$@Vt$@كÅuGlT$떁GTT$$ˉ+O l LL t$ t$ t$@Vt$@CكÅDGl T$T.M$t$ t$ UVt$@ÅH!=ET!4*F !فu։$t$ t$ VPt$@É뚉USWV0Չ\$LT$Tـ1@D$\$؃=|D$\$D9t$t$|$ |$‡T$,L$ɉL$(t$ɉL$$D$ F $%L$P)D)~T$P*D* cL$P )TL$Tс1Ct!1CӍ ;сuD$PL$LT$P*D*V9!ځXT$P JD$=zD$=y|$(~D$Tw|$gqf|$,V`D$=wK;D$ /9|$$~&|$ | f|$f|$F D$1=R1耋T$ 9~OD$1T$T$3D 8\$P+D+)ʊ$u tω\$DzD$Dt$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$4%$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ N4 ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf tU1>|$u l$`\$\z tU1D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" tU1T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA tU1D$¿!DQf_֋D$ !DAf|$$_8tV|$utU1L$ DHuf|$$_u3|$utU1T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$u tL^:1^SVt$ 1Ct%>t V @wj/V 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPhA%jPhL_:,L_:ø%Vt$1Ʌ1t э^fffUSWV$[ND$1dD$V׃1diՉƃut" $4,rƃu$UVjji |$09NjL$4sD$D$8T$<UVt$Dt$D+ L$D|$ t$ 1Ҹ$|$(RPQt$ |$@tjjdUVD$މ ƉRPUt$ ˉ D$ T$sD$L$ |$֋$)SURt$T$2WQPt$HD$HP'$RPQt$8W}'^_[]SWV[ÒI$$u^Jw $-hPV( u=uk+ WhPVТ -hPQ蹢 thPQ蜢 -hPQ腢 ehPQd -hPQM 5hPQ) .hPQ hPQ xhPQס hPQ賡 -hPQ蜡 t.hPQ| hPQe PjĄ^_[USWV[$GD$$L$ ttD$D$D$UPFUlǾUD$P%UDžID$8t۱|$;D$ T$$75.PWN EPW6 -PW PW tPW |$D$ tH-PW PW -PW iPWq tPW] |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [QB$ @$ $ ,19r 胼$ t+$ $$ FhPW $D$ D$jD$$ xfD$4D$dz /$$ AfAfI3QPRhW "t$ VPj $D$ $P1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ VthPWz j:W D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVP/t Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃK`D$ $t1L$ L9s ዄ$ @<C L$|I t$tjhQPR*D$4 "qPh$P$$9s|$$$9s$$[1 $L9s D$HL$H P RQt$ Ph$P$$9sD$4"qPh$P${$_9sD$hI$/9s狄$ @"PQh$P"$$9s獃t$Ph$P$$ o9sD$ tW"QPh$Pb$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ *$$$9sD$dL$HL$P L$pRt$t$t$$h$PD$L$HL$HL$HL$,HL$(HL$$H @  T$0PQt$,t$4t$ =9u8jj t P! 1 4 0ǃ ǃƃ t 01^_[ÐUSWV[!1$01 uut!j/V uS tƅuƍ|$r VPQhW=r ?h@VǍD$ jPW D$$WtLD, L$Pjhjjj QD$(P Ƌ<$t'Vu D$8 t_ 8 Q L$^_[]ÐSWV[/ uPv 6ƃ $tj/V耡 uAƉ獃r VPQhW4 =r ?t" VP tEFu7hh%@V}  hVP a jj t=jjj !ƒt" P4 1u 0 0^_[ 8#uVt׉ ƐS[*.>[ÐS[ .t$[ÐUSWV[-u } D$<$ t$u$$D$P誥ut=k<T$JL$|D$x$L$x$PQr$$$Pt$lH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$d1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$x D$@j PWգ [ 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $c \$ 8u$$>$0։- D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ,|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR^ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6W8G4jjdv6m jjdRPWPGLjh'v6E W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$,P L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$

t9u1^_[ÐUSWV[gL$tEׁu$C t+t9u11ՉL$!։1^_[]ÐUSWV[|$GtB#l$%t$PCt!G t7t9uӾ^_[]ÐUSWV[w0tC#l$, t$P.Ct!G t7t9uӾ^_[]ÐUSWV[tC#l$ t$PBt!G t7t9uӾ^_[]ÐUSWV[Ôt$0t$,^ǍVP‰t$D$(%D$1퍃D$ <$l$tg|$ !RPAtG t@/t;L$uЃt'D$ t$j…<$uNt$0t><$9tR譣 PUWE >&t1<$W^_[]fUSWV[Wt$D$hEt'1PVAt%D=u1 u)VPj=D$@ 8^_[]ÐUSWV[|$ D$hEt$1PW@t%D5u ^_[]ËD$@ 40tM跢 D$jPt$Vv ŋD$18t腢 r"u## u)B"tt$ a)4$WPjуH)WPjSV[ét$ vv V^[ÐUSWV[dD$,8tD$,1퐐8@ujHƋ|$(WG[F$"jUF D$ D$,F>D$Pt$1}nu1ɀ}ouL$D$j=Um tǃ|$D$,t1PUQ>tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$j7Ņ8 t 4$CV:1^_[]Í)UPjUSWV[ñ$4$, 0 *jPUf uj:Ugl 1*jPU= tKt$}/3t$UhV jVPcU Pt$UD$P |$ )jjWjjV`N mt$ jjWPjV0N t$/b$0VPW} FD$ GL$ *jjQPjRM tqVUWR R訝 0i$0X蒝 07*k胝 8uj/UŃt$ $0UW J 0*QPWȒ 111% 0i$0P$4虒 11,$j$4V$4WjUPwPWt$t8HPQ&蜜 07*$0P$4 1,$D$PzUq] 0^_[]ÍW*,$UPVW1+ (WP$8$8VfffffffS[×D$D$ $L$T$jjPQjRK yD$[fffffS[7D$D$ >$L$T$jjPQjRJ yD$[ÐS[D$D$ ?$L$T$jjPQjRAJ yD$[ÐS[w$L$i*jjPQR衐yD$[fffffY+T$ u ÐS[t$ SWV[|$Wt$t$蟏 9r ?{*WVPj ^_[ÐSWV[È|$Wt$t$N 9r豙 ?*WVPj ^_[ÐSV[9t$ YSƅu*Pj ^[ÐSV[t$t$Rƅu*Pj ^[ÐSWV[ø|$Wƅtu*WPj ^_[ÐUSWV[wl$|$UWN ƅttu+UWPj ^_[]ÐSWV[(|$Wt$( ƅtu8+WPj ^_[ÐUSWV[l$|$UWt$] t 0U+UWPj ^_[]ÐSWV[È|$t$Wƅux+WPj ^_[ÐSVP[HD$L$T$$RQPB ƃu+Pj ^[ÐSV[t$t$t$B ƃu+Pj ^[USWVP[öPt$0t$0t$0t$0t$0jt$4}u Ɖ׋,$t1ʖ (+t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[6Pt$0t$0t$0t$0t$0jt$4M Ɖ׋,$t1J (+t$,t$,t$,t$,t$,t$,Pj ^_[]fXL$"wÍ ffffffUSWVT[Äl$pMtE\$0 $tt !\$0,,|$lL$h|$|t$xt$xD$@PWQ9rCƋD$t D$xD$|$ut ʉD$ \$L$(QT$@D$D$<D$D$$ $D$D$ l$1D$@|$ D$ (:ɋT$ts;;D$| L$ $t.L$)D$ t$$~ v뜐A9sE>؉)v%E\$0t$xt$xt$@PU\$(T$(|$@<$9)<T$ |$|ƒ|$<Ɖ|$Äul$L$$L$ \$,$,$;l$s L$L$ \$L$$\$D$@D$UT$,D$,D$ |$,!\$,T$( 4$] ;D$ L$ t $Ή $;L$rɐt$t L$)|$$4ȃ;D$\$,s>\$)v,\$0t$xt$xt$@PQT$<\$(у|$u+Љ4$9\$,%(D$ \$D$D$ l$$4$D$<^uD$@AD$DAD$PD$ D$,<D$tD$HD$xD$LD$ L$D$$D$4$ƈ.D$$|$,E|$,։$5 D$?Pƃ,t$Ή|$O|$0@,|$T$(9L$H|$?=\$;\$@ D$ ~t$D$ 9\$tD$x \$H*o|$ 1к t1#D$x#T$t L$||$9 D$ D|$,<‰t$u$D$D$4D$D$$L$;L$|$(s L$,\$D$$؋L$L$4D$H1l$M D$Lu D$ |$ 1\$L$|9 D$ tR|$,<‰t$؄u$D$D$4D$D$$L$;L$sMT$,T$T$4D$$B<$tIL$L$$+L$D$ l$46t$D$CL$L$4D$$1ۋD$4$L$A;D$s $>$t$L$)v34$\$0t$xt$xt$@PVlT$)vA\$0t$xt$xt$@PQΉD$<|$(D$(|$_906<$ML$L$$+L$D$ l$4|$7|$)\$0t$Lt$Ll$$UPQlkʼnl$9sƋl$D$D$ }mu$T$|$,<$t$tt$$+t$D$ l$4 $F9s>)W\$0t$xt$xt$@PQD$<|$((|$D$;D$@ D$ 9s=։)\$0t$Lt$Lt$@PL$QpL$(kƉ9s$D$ t$ƃD$|9Ɖ;D$@9D$D$ $\$T$Ѕt D$$+D$L$09s>)K\$0t$xt$xt$@PQΉD$<|$(|$ D$ D$,<$4$|$L$A9s $>$)ȉL$v-4$\$0t$xt$xt$@PV|$(\$(\$(4$ދD$D$D9s<D$D$P|$ tD$PD$|$,D$ 1MD$ $$ʃM߉;D$@ D$ $tЃ;D$؉rŐL$ȅt D$$)؋t$ Ѓ;D$s>ʉ|$)v,\$0t$xt$xt$@PV\$<|$(D$ޅuB؉906D$ƒ$D$D9 =1D$ <l$4D$]D$(|$t$<l$4D$1D$ D$ *D$9t$D$D$ $,\$Ƌ\$؅t D$$)t$4$4Ѓ9s $>$)I4$\$0t$xt$xt$@PVL$<|$(D$DD$ ]D$ \$]D$ \$;D$@ D$ t9rȐ<$tt$$)D$ l$4 $F9s>)v/\$0t$xt$xt$@PQD$<|$(|$ u$9/4D$ <D$1D$ h4$D$Ή4$t'1ۿ<l$4L$D$ D$ $/D$D$D9sD$ $#D$ \$D$DD$D$ D$ $1ۉ,\$0m /$|$D$|tAЃT^_[]ÐS[jt$t$t$t$t$[fS[ÚL$T$ Pt$t$t$[ÐUSWV[T|$$t$|$0t$(aD$ j/UQ ,$t|sUPt$ WVt$8IuU, 8uFkt$ t$Pt$t$@t$; H8 H81^[ÐD$@:$fffSV[I8t ۡPU t㋋QXQPY& t.P$06誸 ^[Í,-P,j֧fffS[êD$ ~ L$u [Ë PQ2  [ÐS[jD$~ L$ u [PQt$ [ÐS[* jt$ 0 [ÐS[jt$t$t [ÐSV[ 0t$t$V' tD$~ L$u  PQV ^[ÐSV[it$ t$t$V' tD$~ L$u  PQV ^[ÐSV[  0t$t$V' tjt$Vh ^[ÐSV[ùt$ t$t$V& tjt$V ^[ÐUSWV [dt$<|$8l$4g$gMVT$$T$D$1D$؉D$<$L$ϐU E   $MQjuUv;t$tMtEt=;L$=?j WuUUWuU% k$;T$8tT;D$u:j WuUU;|$~Gj PuUUG9}$ǁE|$9~j PuUQUW $E;L$8Mj QPU%U|$<D$ $|$dDHtj WuUT$D$PuU$ $tuCj uuUTEj PuUT9}~WuU>$ $$D$D$D$j t$ VPU>Tj WuU*TD$=D$ $ȉD$ t$8)ΐEj PuUSEPuU# FuՋD$ D$Ej PuUSEPuUx# t$VuUg# D$8$(14$ ^_[]ffffS[  0[ÐUSWV[L$(9tL$(#AHD$D$D$(p@, u L$(I1ɋT$(;rRT$(zD|$ D$T$(R94$@T$ 4L$D$ 9u(Gt"G͹!ȉ;D$u  tsuD$(@, $+Hi̋D$ fgG! D$GWD$,p|fG;|$cfy눐L$t'T$(B,4$+HiPUVRr4$D$(;p}D$(@,1t$( m1^_[]ffffSV[ p VuN8@1^[ÐSV[t$ VxuN8@1^[ÐS[ÚD$ L$jjjjQQPPt$(v$[ÐS[jD$ L$jjjjQQPPt$($[ÐS[: t$$t$$t$$t$$t$$t$$t$$t$$0$[ÐUSWV@[$\$Xt$QP訂%$ % $$`t$PRc&$  $t$PR$&$  $$dt$PR&$  $$l$htD$xPR蘁 |$x  T$xtD$PPRb |$P  T$P$t$ptD$(PR  |$(  T$(tPR  $L$(T$Pt$x$$PQRVWU$P$4P$t d^_[]ÐUSWV[Ñ$$tvMu $ $tvu $X 󥋴$t!ut$ $ Ƌ$tvu $0 󥋴$t!uit$ $ Ƌ$tv u $ 󥋴$t!ut$ $ Ƌ$tvu |$h 󥋔$E@mHt ։t |$$$$Xt t |$,$X$t t |$P$$0t t |$d$0$t t |$`$$t t |$\$$t t $t$ht t ʼnl$Tl$h$HPЉT$ rȉL$t$|$XjD$D$8$$$\$`l$($D$@D$ D$ D$HT$LBD$0$L$Qxx},1T$L$'؋ $ IfDL$9$@,dL$$LD tu@D ^_ÐS[گ t$0[ÐUSWV0[äD$Hx'pdL$L|$DGDD$GHD$ fD$$GLfD$,D$(G|$D$Pw|w|ut EGDuQDP@I|t+1zxtItPv1^_WV^D$L$ QHׁ8T?tׁ;>uQDP@I|t/1zxtItPv1^_Xƀ ÐSWV[h|$0 2D 2 2 2 N h N$ NTl NX N\ N`l Nh< Ni Nj822D22G G$hGTGXlG\G`GhlGi<GjWG1Ƀ2QP螞G GpWWv ^_[ÐUSWV[çl$uۡP/ Ņh4j`1ƋD$L$dž3Ndž2dž2 3ƃ dž2dž3 h3,V5VU|2@xpu xhdž2jjjjjjV,FjjjjjjV FVZVVjjjjjjVȟF tdjP֜VMVDV VbGHt 3t VjV@P|2t Pjd2tuc29ʼnu3V1^_[]ÐSWV[ht$|2t Pc2t7uc29lju2VbZ3`3R90uV9^_[fffUSWV[Ǧ̣ t$@+@+@+@+@+@+@++ uǃ\ >ǃ` <ǃd ^ǃh vǃp #ǃ4 :ǃH 'ǃL #ǃP #ǃT #ǃt -ǃl -ǃ| _ǃ |ǃ oǃp -ǃx -ǃ <ǃ >ǃ *ǃ !ǃ f|2Ot^t8tjtfx ؋tvQjPW+ 1 QTlQTpQTtTx=u^_[]ÐVY1 T$tlqtpqttqtx1=u^ÐUSWVP[Ö l$j+UGG(ujj 9QPJ u Pjj3QPej>p j< j^ jv j#8 j: j' j#pе j#` j#P j-@` j-0 j_  j|x joh jp8 jr jy jzȸ j{ j| j}@ ǃp !ǃ\ +ǃ !ǃ` ,ǃ !ǃd -ǃ !ǃh .ǃ8 %ǃp 0ǃ %ǃ0 `ǃ %ǃ4 aǃ ǃH fǃе ǃL gǃ %ǃP hǃ &ǃT iǃH %ǃX jǃp %ǃ\ kǃ %ǃ` lǃ %ǃd mǃ <%ǃh nǃ` %ǃt qǃ #ǃl oǃ #ǃ| sǃط %ǃ tǃ $%ǃ uǃ( 4%ǃ vǃP ,%ǃ wǃx %ǃ xǃh ǃ ~ǃ8 #ǃp pǃ #ǃx rǃ d"ǃ yǃȸ e"ǃ zǃ ǃ {ǃ `"ǃ |ǃ@ ǃ }|2NthtBt'zxø ò ϋtuQjPVl 꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVXG l$+4+ع x( PPu^_[]fffffffXL$fǀ ǁ4ǁ4ǁ4ǁ 4ǁ4ÐS[Ú t$0[ÐUSWV<[dT$P(B8$u&J9JuJ9Ju9uauR Ft R讠t$T3t9h10Uǀ3A<^_[]Ë3tXՍQ33DA9tʼnD$ D$D$ |$jju@PWWWU'딋>9L$u+0D$PH8@<utCu-/u5tMt$ul1‰jiP0t$UƉ$L$PIE/t$1jƋL$P1‰PL$Tƃt|y<x -tl|.D$8T$PAB $tJt PrR& U}" E @t9 A 8u/3t$h10+ǀ3e -D$T$D$ D$D$ L$jjr@PQUD$PU%|$u@*2$t u $ L$TATJSV[ 0t$t$V tt$VZ^[ÐSV[ét$ t$t$V tt$V^[ÐUSWVL$[`|$0D$(T$ 2D$ED$4D$D$ f4-tW-t$= t)Q 4ֈ44 4PƒЃ 44]|$ y 444Hȃ4f9ufǃ ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u} 4ֈ4 44Hȃ 4 ftdL$LqfxRɋT$ f9yt20%L$fA 4; 4fǃ D$4Pjjj 4 449)4L$ 4QWPt$ 4;4}2Dž4t(D$4PVt$ t$| 1|$0f 4)Ɖ4fǃ ff9t |$ u |$ t)Q)R;* t$VUF @f|$t7&D$@  44 44H 44L$ 4QjPt$(e4Hȃ4`%L$fA 4; 4AL.tt#4ȃ)44>44L$4H441; 4f f1jD$` `4rփփ19‰44f fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ444L$4H1; 44444L$4Hȃ441; 4f f1H-Pjj!Q j_kS[*t$j[ffS[ 0t$ [ÐUSWV$[Ԓ|$u5|2t PZO|2GHtȍL$ QPVU|$<|2ȉL$uCT$ GHtȍzRPQUy|$<|2uHQ(W$IO 3@@D|2@ǀ|2@@l|2@@h|2@ǀ|2@ǀ|2@ǀ<|2@HHpG$|2@@(j-P tjjP  ,GTs-P tjjP  GX!|2@@xGX GXO <W$h OT l|2pt13~0t*~pt$u Htu$Luu tt12LJl2TL$L$D$l$ tL$qcLJl2|$L4t$V4 P誛D$$<$$u$Pc HuǐuUS4 P1D$$鐐<$$u$}P Huǐul$Ut$VzV+U"$|$~"14^;>|IV@^_[ÐUSWV[fǃĹ h葕u$ DHDHDHDH uǀ2ǃȹ ǃ̹ ǃй 1IT<,$-j T<TV$|2@-4tV- =wlj<$hVt$ V}# V- 1rNj2Z1퐐T,jj L,LNp9u^_[]Í2Pj1`S[  0[ÐUSWV [|$ EG8$u%O9OuO9Ou9$uxW/t W"`8tUEHAIL$WW9uOO 9L$u-O OQRt$ PGGMIAG GAE3t4h10lwEǀ3 ^_[]Ë3t*Q33t8tVW^‹D$89L$uG8W<ut#u%'t^1Ƀuk1g RG4$Ƌ=u8 $A @11 $<x D$8 $tQWTL$|$u $E t΃2t2u΅rhƋ $a aUr* 8uE3 $tԋh10yuL$Eǀ3뤐SV[Ʉ 0t$t$V t V^[ÐSV[Ét$ t$t$V t Vr^[ÐSWVP[G$t&T$t$2PWj $^_[ÐUSWVP[1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV['T$9D$P' 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[A1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[ôD$0>Ƅ2L$ȉT$ D$D$ D$t$%fG ̹ 9й Ĺ f$t|$u!|$t'QL$ )RW謆ŃuRG @tG2& 8u=D$3t.h109qD$ǀ3G @|$tmG  fȹ Թ Hȃȹ ̹ Ĺ fftVW衅=Vtй Թ Hȃȹ ̹ 9ȹ Թ Hȃȹ ̹ f9ufǃĹ f АT$ftiLjfx_ɋ4f>t%fG t~t-ȹ 19й fĹ D$DhhAй Թ Qʃʃ19й ȹ fĹ ^_[]ýG @tB# 8u8t$3t)h10nǀ3g 룸2Pjj Qj)VSWV[}|$W藃ƃuOG @tD# 8u:3t)h10"nǀ3^_[ÐUSWV[w}tt$339}3AP3@t' 333343;33PQRPQ 33t331^_[]ÐUSWV[ç|tt$339}3AP3pt' 333343;33PQRP 33t331^_[]ÐSP[{$tT$ 2Pjj $[ÐX{ tT$QT1øUSWV[R{TAx43fTFT$Pj Ά+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhh<to DHDHDHDH uǀD$ FF^_[]øT2Pjj2,42PjjQHjQr2PjQffffS[Êy 0[ÐUSWV[dyt$$F,NVxF ,|$ |x<$ |<$l11;3}:tt3PS^_[]ÐS[:PT$t$t$ [ÐUSWV[P93|$0t$,T$ $u dMDH@utl$4D$ Uw鐐t$ D$PL$ QD$ P̍x)t$tL$9D$)<9u AT$)RUt( $4T$4R7D$0D71^_[]ÐS[Nt3t P[ø[ÐUSWV[ÄN8D$ $4VjPjtSʼnt$U!ZƅtMD$ $t$UD$PV認tT$t$$V V=j^_[]ÐUSWV[M|$3t P 3~/11퐐440i0;3|4i3ǃwwLJ3j0jc4tW|2Ht<@xX3~3PP 6|2@HX3@$3Ƈ31^_[]ÐUSWV[çLt$3t P3~/11퐐448h0;3|4h^_[]ÐUSWVX$Lt$01ۀ3 3D$l$4 334|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([I3D$L$ 4T$ RD$L$<1҅?D$ 4D$D$Wq1Ґ$t$V|$(WD$0P轇t$$ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V $4D$)Džu |$ $tR1VT$  4$)tWj Ve T$L$ (^_[]ÐUSWV`[$H14t `΋43t4|2NzRЃPWVPVhk3s39u)E8 u# RL$3 $L$L, $;M}, Rt,<WiPWVjUt^_[]Ã<$7L$ȃ,D$11$D(PD$DP蠱y;3$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$P莈D$T$3;3}D$PRjQD$PRjQNj$D(PBD$$L$ ;37&ffffUSWV['F|$$D$hjjU t)ƃ|$t:L$tVD$ tNt*T$T19tL$  11fVUl$ U躇 D^_[]USWV[wE|$$2t$Ƌl$r:D$0D$4uX9uE$E EEEEE EEEuDE$E EEEEE EED$%ET9tL$ ft M}Wt$U 1^_[]ÐWVYDD$T$ t$w4  p@^_fffSWV[øCt$Vo}~tyы9uv0_v,_9p9p 9pt P _V_1^_[v4q_9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29P^ffffVXZB t-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[A|$ uT$ [[ø[ÐS[ÚA|$uT$ L$/[ø[ÐS[jA|$ uT$ [ø[ÐS[:A|$uT$ L$[ø[ÐSWV[A|$u<t$D$ 9% Ɖ-t1^_[øSWV[è@|$u8t$D$|$% Ɖ1^_[øXK@ t/HX|2#H@H@Rz8tT$ щH@1ÐD$t/HX|2#H@H@Rz8tT$ щH@1ÐS[ú?T$ R[S[Ú?L$T$ 6[ÐS[z?T$ [S[Z?L$T$ [ÐSWV[8?t$ 8tCGX|2@TtgAWW@x8tg@1^_[ÐSWV[ø>t$|$tCGX|2@TtgAWW@x8tg@ 1^_[ÐUSWV[G>΋AX|2GTt tNA t tNA t tNA@t tNA@fy tNAt tNAt tN@t 4tN@ t tN@ @t tN@@t tN@t @tN@t(tt V4t"G8tt V 1t$׋NX|2#N@N@Rz8t N@^_[]øSWV[Ø<΋AX|2@Tt{ @f @tf@t Vwt Vr1t Iy8tf@^_[ÀfA =fA9fA@5fAf1fA-fA)f@%f@ !f@@f@f@RD$t@@øÐX:HTtG1 u<uA uFuKuP(uUa1(uHT t  t @t t (tt 8tt tLt ÐX9HT1  4@(1( S  N @I D ?4<9 6@3@0(tt 8tt tLt ffSWV[7t$ 8VPVW ^_[ÐSWV[è7L$|$t$x"1t%<t9u WiPWVN ^_[ÐSWV[H7t$|$W3PWV ^_[ÐSWV[7L$|$ 0x1t!<t9u WPWV ^_[ÐSWV[ø6 0t$t$Vˏ t|$WPWVn ^_[SWV[h6t$t$t$V t(L$ |$x#1t&<t9uWPWV ^_[SWV[5t$t$t$V t|$WPWV ^_[ÐSWV[è5 0t$t$V軎 t$L$|$x1t"<t9uWRPWV7 ^_[USWV[15$ AL$I,D$$|$@1 $D$HL$D$ $cUT$1 |$@T$ D$D$jD$Pt$t$D$$Pt$$)~"D$@PVUD$PrxNjT$u$^_[]ÐUSWV[!4$$AI,D$$|$<1 $$HL$ D$$pUT$1 |$<T$D$$D$$D$Pt$t$D$ P$$)~"D$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZºL$1~t$ ~9J$u9r ^ÐUSWV[wD$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77莽1^_[]ÐUSWVP[t$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux pQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0X)ŋ Q q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p h912u-t@:uP $Pd1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV[Ô L$(l$$UuX< ;~$|$,M;~ L$ L$(+ut$l$,+o w4$tpL$l$4$l$(9nы$;JT$,,$9U t$t$ $;r|D$(GD$,G W: Wt$ IOD$,G W D$79t,鐐FN Vʼn |$(69ujW1^_[]fffffD$H8T$ ʉP81fffSV[) T$L$ Aq D$t$jVPt$ ^[ÐUSWV X D$1tYՋD$  +T$$QQ\$(Dž )yy A;D$$&ދY 9t$$A9t$(7Y9~ 1 ^_[]ÉL$\$t$,jVt$0Wtɋt$NDHDNHHHh L$ H$pH$h0ȅɋ\$xƒrUǃ߉AA8ATApǁǁǁut<ҍ<1Ґ9u$J +N J(~T1B,,B+FV, HMPUE $pQHDT$E;z}J(뮉SV[ T$L$ Aq D$t$jVPt$ ^[ÐSWV[|$ 199Rjw www0$ƅt VW^_[ÐUSWV$[dt$D1Sl$HGL$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV[L$8T$4y1ҋt$}t$j kJ\$L$(xu$0)\$L$(xl$Hl$H}D$$ H1D$4Wl$H9} U,4I,U L$D@t!t3t$t4D$84NT$8R,Ju͋l$Dp(EDd d EHh fǃl L$Qu|*ELft MH!L$fl$|$ ~tD$8@,Dtbt$$HL$xo$j2 D$@, !D $jjUt$W|$ .\$L$,@@A,D$(@(x ;i|J1D$(@ D$3D$@x9D$||$D$$@u#L$8 I,T$ QT$L$(q  tU1L$ QRLD$0T$,T8t A xtpt$4d PV#(iF!;D$eFٍ 4)Nj$y1D$ @@LD$,|$0t$;l$l$M|$HxGu ;W|$ } D$HP(9}eD$$3l$DtJL$4L$4u:D$XfD$\$jjD$`P讹\$ D$49 U:D$$Hxq2U 2;q<|$@D$(u(Gu"$t$W&\$D$$HL$pjiD$X, t$<;t$ t$u 9uƒt#L$  $jUQVt$L!+D$$L$ Hh;l$${"T$$ω;l$GD$(l$u $t$W%\$T$|$,;T$0;d )tO;h T$JR,t$ R 9ut$9ru r;T$wD$@;D$ T$t<i̋D$@ ))Ƌ$t$,G\$T$ 9v(TL$ I ywwy1,L$;i|:A;D$ uL$$ yL$s;D$ A8uKЋT$Pt$ D$$xLL$CD$ @tGt‹$jCD$ @HjV 딐$;l$Tt$W$<GŋL$$ yuD$뾋D$$Չ9h֋L$ T$9Ju\ыR9~S9}OPp$jT$ [D$@, $jt$ VUV:(\$D$$p h 9|T$ R ztH{t$L$q9|d@D$\$H$Pjt$4(T\$ D$|$x D$$xD$8;xh@,L$ 4ph Fd fFVp !jd t fNt 49D$8;x|T$t$t$ƃ$D$8;h}xD$$p|$OoL$AD$$j \$G, 9;t$u 9l$ut+9L$D $jUt$ t$V$\$T$BL$$ ABA9\OfɺL$Nff|#udt$T$։D$,)jVD$PRPfL$< $|$ T$t$WL$΋D$)jPWVW#t$XD$ @f|$(ut$It$t$,QqpHQjP-ɋ$JdHPjQpQ f~$~gD$@u]D$$t$Fd2u&T9u%$PD$<0U;\$6>v t6>vuD$ @tt$ t$tR{Fq$jf=D$ @$ $HjP\$ 6tdtH$PjQ`P\$ D$ @txHL$pmGD$$j\$G, 99uT$9T$u +9 $jt$Ut$V!\$E21f΃9U,<t$uw\$GEʋL$HAQ,1f1ɋ$u뎐l$;|$ ,0t$l$,L$DT$0;|$  E;l$(ŋt$|$T$0D$D$4l$@sD$D$4@ωD$ D$t$9MD$9D$<D$T$ЋL$9ȉD$D$ AD9x x x $Pq|r\$ BfBD$ ALfBt9zAD$Rq|\$uD$<GD$D$4T$D$4x;x u| D$P1r21x $Ph Va\$ ǀw x $PQR8\$ D$@x L$P| D$ T$)ЉD$LD$‹t$)T$4)l$,0|$LD$ xpT$)l$ E@H0T$҉|$t$ xpuDt.t%|$T$t$>t$ ;W|$Hrt$t$ Q=f HUjPkG jjjVWKt$ @UjppDG jjt$jj @t$QeUjPG t$ D$4T$L|$)T$t$T$L։t$TI,T$DD$<4|$(|$0D$<|$4D$4D$D<9;t$;t$D$ @,֋T$(;W|$Lt$|$ WQa HUjPB jjjVW|$ @UjppB jjt$$jj@#D$PQ,aUjP`B |$ F|$GD$0D$D8jjD$0PVQE@tT$t$9rt9؋$PQ`HQjPA jjt$$Vjt$8HL$QPc`l$T$ϋl$$HWjPaA |$D$l$,t&ŋt$ $@Wj1A u|$oL$ɋ|$L$T$ $NHVjP@ |$0)l$l$,|$ $@Vj@ u|$ $jjt$$VRv$Hl$@$Wj^@\$ uUjH?@ |$t$ |$,t!|$@UjH@ u@L$ IQjp0^ UjP? jjjjt$ $H$VjQ?\$ |$0l$l$,@$Vjg?\$ u|L$ɋ|$ t$y8UjL8? D$t!t$,@UjL? u@L$ IQjp0] UjP> jjjjt$,@@p1HQjP> L$T$ $jRQjW\$HD$$jjt$VRS$Hl$t$ @$WjH9>\$ uL$L$ T$9Q|$ H$VjP=\$ |$0l$l$,@$VjL=\$ uR3K33PQheRD$EUSWV XD$\$DT$@|$ PQJ t*NjD$9 t#We$~ 1ɋ$HPjW+ ^_[]ËDD$HL$ h;> MIIlttt$ jQ+ j D$uǃ USWV$T$ [ D$PBpL$ t$tIT$$l t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$HPjt$) ǃ ǃ 11ҋlD$8 tlj)D$<>$DD$8 $<t$u; } t$Ћl$)$t$@@9 9<$HPjQ( @x H$L$T$ t$hՉL$)4/L$T$ 9~L$T$ <$HPjt$J( ǃ D$ ; ;T$ 9<$ to j P'x) @ltHQjP' F t3 j Pi'x) j <j -  ǃ 1;  $Hl$*ǃ ;  @@ltWjP& yA t`j t$&x )ȉ }u D$8o@@lU8 LQj u ;  H"UjP7& ; ~U   @@xuă tjW%x) j띍H ; ~- @Uj% yxD$8 )ȃ,$D$ D$4$jP5% D$(19 ș)Љփ< 9D$@u t!j t$$x) j ^t D$@, @D` D$,$.  -; !D$P, t$j<L|$ tv ufL$L!;H@L$uSDuLf~54tC t L$ fu-@t!,$UjPs#  t0j t$ #x )ȉ j ǃ tD$ D$ $^_[])ȃ|,9t$,$,@tUjP" <,$ t!j t$S"x) j & ; ~nUjPW" ;  @@xu̓ t!jt$!x) j룉PS[*D$ t# PQ!x) P]1[fffX۶Hy8~DyD~>Hlt htðuu냹tt u1ÐXk@ xÐUSWV [DAP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`ҋl$tHPjRB MAҾt.HPjR $l2 !A@MAlthu u]$h2ǀd2IyTt#|2IITtd2t$!P\~ǀnfǀr|ǀzfǀ~|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀl"ǀp"?~)1ɐDŽl"DŽp";|$ fl"&fn"(p"ǃ ǃ 21CpD$L$ /jt$e\D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p  p0!0  0(9uD$t4$L!L  Lq1tt  ^_[]ÃttِUSWVP[vL$9 ft$9|$ 9h2uCUw$-4$t$sk3w`3|$ f|$ p"up"fl"fn"6f;l"u f;n"tЃp"fl"fn"*1^_[]fff놐USWVX42pT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVYW|$xv9{`|iT$t$l"fn"f1h2u@>_w-s y3f>2~w-s q3f ^_[]ÐUSWV[÷L$:9O\~~l$t$Ifnfpt$ frR ztC|2Rt0D$T$t$ VRPQW6HQjP 1^_[]ÐSWVZL$x?9J\~2D$t$|$ Infpf>rf1^_[S[Úǃ$ǃ(9t% DŽl"DŽp" t 1[ÐUSWV[T$L$h2uI~w-ss3w!x3ff fff$f&ǃ(>t* f0l"f0n"DŽ0p" t 1^_[]ÐX+d2ÐUSWVP[t$ t@@1Eh2l"fx fn"yPRt6$HPjR' 4 $!A@El"fx0ɋ|2@Ql3HQjP En"Zfl"fx fn"yPRt6$HPjRt 4 $!A@El"fx0ɋ|2@Q2HQjP) En"]fx*ҋ|2@R42HQjP #H@ H@^_[]ÐSV[h2tu6@t!t$ HQjPr 4!F@^[ÐfffffffSWV[ÈD$ yOQW~ ;O~ t Q WP行W ^_[ÐSWV[|$D$OQW~ ;O~ t Q WP8W] ^_[ÐSWV[øxWt$W! ^_[ÐSWV[x|$Wt$XW^_[fffffffUSWV^7L$xLT$xD 6~9|5^9~.nF,9}#,]19CENV1^_[]ÐUSWVL$xHT$x@t$~9|5^9~.nF,9}#,]19CENV1^_[]ÐUSWVD$$pHP 9,$l,$,$m19|$ Í],$]xppt_ÉΉ׋HP {)xs)x݋X9|֋h9~ω\$ Xl$h,,$݉\$;\$|,$\$leh^_[]fS[ê t$0[ÐUSWV([tt$@3D$$3D$ 3D$1Ʌhvx|$ uLGD$wD$ GD$GWwD$GD$;GTu"Wx|$T$D$t$|$T$L$pAI(ȃL$(I ;~t"|$tL$ L$ $t$$$U迶t$p7?1\^_[]ÐSV[9 0t$t$VL tjt$Vh ^[ÐSV[t$ t$t$V tjt$V ^[ÐSV[Ù 0t$t$V tt$t$V ^[ÐSV[It$ t$t$V` tt$t$Vz ^[ffffffUSWV[l$t^T$r9n t9tB 1ɀx$u B1Ƀxp|$$t1R(Wt$$t$$UP 1^_[]ÐUSWV L$[p|$8T$dD$01DFt01ҐЍ GDFu<.u=GLnL$1D$thЃՉ,$D$tGDFu$L$4PL$ + T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K3Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K3Й~ ƃQWT$H ^_[]ÐSWV[ø|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[:  jt$t$t$P1[ÐSV[  jVjt$PJ1^[fSWVP[÷|$t t9t QD$P8L$QjPWL$N|$kK)l$kK) C;Ci)5PU 9t;y t0q$t~fuUv8u1 q 5^_[]ÐUSWV[D$$L$t@1D$D$>D$P7L$QjPW^L$kL|$kC)l$kC) C;Ci? )@6PU7t7q tAy$t+nuUw7u AD6y^_[]USWV[đD$(L$1҄t@1D$D$8>D$D$P~6L$QjPV=l$-?L|$ ) i)ʼn) i)k&D{&Dlj*SiŠ)ǍH7PD$P6t1D$HL7<tzp t:h$D$t}suPui6D$uދ} مt3l$,t+Et$WPguVa5EЃ^_[]ÐS[:t$ t$t$ [ÐUSWVH[t$\4lD$P̛ND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$U3L$QjPUL$ȿNt$kK)kK) C3Ci)5PU\4$D$$5ED$j=U(tƉH$$D$<$|$W2L$QjPWL$Ƚ-?Lt$) i)) i)K&Ds&DƉ*SiŠ)ƍH7PWF3D$5tcL$f <$|$W?2L$QjPWL$ȽkLt$kC)kC) C3Ci? )@6PW2tD$EL7E!D$D6DZ $$D$2$PU=2 hPU%2JPU 2PU1/PU1tJPU1trJPU1teJPU1tXXPU1u^O1<5.' D$UR0Nj$tP@0 1L$;D$v==wL$L$Qt$L$uD$ 9D$ tf, UQb,$t'UWb|$BU4+1t$ 1` t]|$uf, FM $QPa4$>/  $LD=uVQoaV/ $4D$ H^_[]1|$t4$D1USWV[҉h諕WT$L$ $L$d1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG3M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$胡o* 1Pʋ$H $$$H $<<$Rt$Wk /$//$H $>$D$^_[]ÐUSWV]Ť2~:^^t@\|,$n*^ÍxЃs.ÉD$$dD$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%dTxp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[1l$E<%uEpuEπ r?(уstlu~;|$~,|$t'릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[IL$ T$D$$Pj [ÐUSWVX$1h ։ͅu4$ u'$hō 5 @0t$E4}0u"$h荍E, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$,&σstlu7D$ ~ ~$&DŽ또fЉ9N1ҍ$1$$u>D$$hjPF l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,視E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $JȉىӉl$ |$uGD$1l$뀋$dDptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $L$t"A$|t+H$D+$,#1$uՋ$#1ڃV$xM!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu, RE,}0M4T$$V$0PRQZ1$E4$!1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$P P=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$dt$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$t1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,)rE,u0M4tڍqu4 $01$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,tRE,}0M4$V$0Pt$QTE4E,M4},$1^_[]ÐSP[yvT$ D$$1Pj= [ÐS[Jvt$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[ vT$ D$$1Pj [ffffXuL$,ÐUSWV[ôu|$(t$ l$uۡP!ƅ>l$$uj[hj>L$tfjVP NjD$uj(P/D$@ x |$(uOVqE\1F4N9Pk1D$tGuP|$(%Ox |$(tF|$(mIOV|$(vOPhht@U&  t$t$tL$t RB(J,tRPytjjP IA(PPtjjPo IA1t^_[]ÍNPjEOVSVP[hsT$L$D$tRQPVƋ$t P.^[fUSWV[st$|$t$jt0ʼnVU9|$T$VŸOPt$gt~zPt$PtkOPt$9t[OPt$"tKOPt$ t;OPt$uA1 @VK^_[]ÐUSWV T$L$[ùqǃ OP,Ņt'}/u{L$$ t$  OP/PlPVzuU<DžjWWWHtpL$v u\D$ VP$tIT$ L$$ Pt$ V`'uO1V='OP$|$ $~:s1퐐Nt:t됐tÍMwUPWI  D, L$$ t$ [tuP>tGOT$ PQhR`M~)T$ L$$ t$ $Ot$ $:uw1퐐Ot:t됐tÍMwUPVI D, L$$ t$ [tu$ $ȁ ^_[]ÍO USWV[Änl$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%\$L$ A ZAthhP+jj!貃G(hhP|$ Gt\$h(jP|$ "\$jh\|$ G9ouG)o\$UD$pQ|$ Go\$UVPx W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjPU ~ gC C$ދ\$PvF$ދ\$P[~ F$D$\$jWF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|Vt.)9uUt$V9 t6u0,1(Vr 9ſuUt$V9 ^_[]fffUSWV [4fD$48H L$@ 1퐐/t <,tEPqUWPA .,v3l$4uW&EED$\$cD$oD$|$j|WxtD$4@ T$L$ t 17t<,t\$RT$ D$PptDl$VWQF Ut$P4  1<$W Njt$D$Pl$8u{EW|$WV W迀D$D$D$ Džt$蝀\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0z\$<u3D$u'\$U1o\$8C k$K($fC K(K(|$T$ t$4oP>p1\$91\$-4$K\$oPD$P~D$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q} ^_[]USWV[TaD$t uy o|$ 1퐐/t <,tQL$$Plt2ƃ$UWP? 4$t$P+ 1^_[]ÐUSWV[×`|$ t$FN,9vtU6wuCu;U?lt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[_|$ l$ZPWuLt}D$x@ȃǃtVot$ Ud)Lstƃntfuă뿐1ɋT$z HD$8l$|$ u)1|$oWuPt$D/WprpWuPt$D1TL$4xT$$s$tntfuσ1} t WPV/ l$ E|$f>t WPV  }t0EfEfF}WuV f},t&E(fE,fF}(Wu V f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[X|$ t$FN,9vtU6ou]uUUodtHnNT$l$f,Ninf|FFWRP ~F 1^_[]ÐSWV[Xt$FNy9vtW6 ouCu;Wct.~NT$|$f<Ny~TF 1^_[ÐUSWV0[ÔWl$DdEDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1 pbGj|UED$tL$j|Ut L$U=rUPt$P 10^_[]ËD$tPL$ =r7p"D$t+P^L$=rTpQUPt$T^jjPltt$ $@ 1D5t <,tFPaD$4 VUP8 D5$(L$tSD$HtJ11t <,tFPa Vt$P D5$h|$t+D$Ht"t$致 $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0e$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p d$D$t$HjjjPjfWjQpVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[FD|$ $ ftGt H1HWG(f$ hwU =wb,% Ƅ$ |)ƋtVPU 9vD|ŃƋGtVPU[ 9s D|ŃE$^_[]ÐSV[ICt$ tav_v_vx_v m_v$b_v,W_VN_19 uǃ ^[ÐXB @ÐYB @u USWV[ÁB$(E$$4D$$0j:W9tbjQP t0V$0W  NjE;$^_[]ÃPu 14tMXu<t6`uDthxLf$O:t @t@uS4$l$w$D$j@UP2 <:t$EF<:uEl$4$D$D$Otu0P(PPa(@ǃ0 T D$O.$$,PQhW* t" ǃt}茝jU 007 4( j TOP T "P#"P |Ptj/V-.t|$ul.$jPRQV'l.T$T$jPRWUQVVPjeSV[>t$ j:VưtbjQP  tt$V"1^[ÐVY>T$փ1u4t^1P^USWVH[T>t$dl$`L$\D$Dȃ=4uP<$yL$VPj@QT$tLT 9 $ƅtID$\WUP ~*)NjD$\u $dVUQ ;L$Dt[a1Kt$\P4DŽPDŽ4 $;D$Du ЃH^_[]菚USWVT[<|$pL$ll$hD$P=4uP $t$ uL$WPj@Q_t$t$ T$Ijj WD$Wt$4? $t$j .9<$u-;D$PuyL$T^_[]WQU ;L$PtNTPM4>DŽPDŽ4 ;D$Pu T^_[]0USWVD[ä;L$`T$dt$X}|$@uM4u Pt9ƀRQt$dPj@W tRQt$dV> M;L$@uD^_[]ySWV[:|$=uj4u PtVw.}tL!P4DŽPDŽ4W^_[ÐUSWVP[D:D$hT$dML$LL$pL$t$lуuc4u PtOz=m8@tW=m1.T$ vPQj@Rx. VPR b#<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$lP  4()uT$ff׺r$σߺfDfu,$tу$$1E;D$Lu^P^_[]Ët$dPe4VDŽPDŽ48,$1,$LS[ú7D$u&4u Pt-[P[ÐS[j7D$u&4u Pt-[t$ Pº[ÐSV[ 7t$ j:VtbjQP- tt$V W-^[ÐSWV[è6|$t$j:V聨tbjQP tWhV WhV ^_[SP[I6D$ L$ $L$ƒu&4u Pt]-Qt$P [ÐS[5D$u4u Pt1[P蔸[ÐSV[É5t$ j:VftbjQP tt$V V-^[ÐUSWV׉[ 5Rjj D$UWt$4 t$j ̮19tG4$P4DŽPDŽ4^_[]ÐUSWVL[r4D$D$H1,<jUPk u} t @u D<@u^P]4NDŽPDŽ40D$;D$HL^_[]Íl$ E< us{U裝8|$jWP u|$ u}FuP4DŽPDŽ4Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<: D$t$DRL$D A @`? ڇ19<$ D$D@ @`ƒ?ڇ91 D$D@ @`Ń?+ڇ9 D$D@ D$@|$`D$?ڇ;|$  ՋL$  <$‹D$Dp D$L$ D1 <@4$T$<`Ń?|$_u+ڇ19QL$ T$D $L @`ʃ?|$_uڇ19 l$ D$L(D$<_D$$D @`Ń?+ڇ19 ՋL$ T$D |$_$D @`ƒ?ڇ9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t;D$(Q,^_[]É<$t$D$ VRPQT$T$L$ t$ ?3ڇ|$D/? ڇD/ ?ڇD/D$ڇ/T$T$L$ t$ ?3ڇD/? ڇD/ ?ڇD/D$ڇD/D$L$ < ڇL/ ?ڇL/ ڇD/D/ <$<$2USWV[á+$D$$$  ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ @ +3k4t2tkƷ< sԃ1@tt tlj瀍 ;( 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ,|$| t!qtAD>1tBD>׹@ +D,|t.tkŷ< s݃1@tt tр‍  1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ,|$| t!qtAD>1tBD>׸@ +D|$t=2t$Fi%I<<fw1@tt tlj瀍 ; 1ttD~t  fAB w~4AB w~4AB w~4AB w~4AB w~4A wʼn41 @tt tlj瀍 ; 1ttD~t$Q$A $B $u1 @tt tlj瀍 ; 1ttD~t⍃ 0pRQPRQPRQRu D$p D$l D$h D$d D$` D$\ D$X D$T D$P D$L D$H D$D D$@ D$< D$8 D$4 D$0 D$, D$( D$$ D$  D$ D$ D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فSр3ʉрUɀʈǃ$ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ΀ D$ D$x D$t D$p D$l  ʋD$h ыD$d D$` D$\  D$X D$T D$P D$L  D$H D$D D$@ ʋD$< D$8 D$4  D$0 D$, D$( ΋D$$ D$  D$  ω D$ ɋD$ ? ? ։? T$ځ¨ $T$ 1 u E Qu ƃu %?? lj%?  $T$ @D$Xƃ$ $ ΃( ,  ˨ ˬ J΃ ( ,  ˨ ˬ J΃ ( ,  ˨ ˬ J΃ ( ,  ˨ ˬ J΃ ( ,  ˨ ˬ J΃ ( ,  ˨ ˬ J΃ ( ,  ˨ ˬ J΃ ( ,  ˨ ˬ ( , 7 4$l$T$ L$ Ń4ƨ x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]wUSWV(]TD$<X%UUUUʁUUUՍ4P᪪Ũ Ŭ x ( , x   x ( , x   x ( , x   UUUU ( , $؃Ũ Ŭ x ( , x   x ( , x   x ( , x   T$H ( l$ , ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y $$( D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3 3 3 3 3<$t$3~3 3 3 3 3 3 3 3 3 3 3 3 1#t$t$D$|$811t$3= $3= $3= $3= $3= t$$3= $$1L$t$|$l$3l>l$|$l$ 3 3 D$35 35 35 35 3 3 3 3 D$t$D$D$$7֋T$ Bl$l$l$$xl$   $x ( , x   $x ( , x   $x ( , x = = $x ( , x   ȃx ( , x   x ( , x   x ( , x 5 5 x ( , D$@P1(^_[]ÐS[çD$1ɐȊt tT Tt t t4 uP1[ÐSV[&D$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[MD$$D$DD$@D$9\$6D$L$T$@jjPQjR^gqD$HPj XZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWQD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP$jPD$0Pju\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]mUSWVd[$|D$<$`( hjD$@P0 DŽ$@D$Vn$@8$u H$@D$Μ$@UVljD$P]t;uHʇWP҇WPuD$WPݴD$UVYljD$jPW1 D$,u:|$$@PW#x$@L$,UVD$l$0t$\$UVD$ D$D$ D$$$@&D$ \$UVtt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V'1$xU膰$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-sPQRC_h$DUt$@Vj j jW, hjU , hj$P+ D$@hjP+ D$<;$`u`d^_[]D$RWD$tsT$@PQhR=l$ $gfffffSV[9 D$ h`rƉPw)Ɖ^[ÐUSWV[ l$0jD$PU& th%h`) $)D$j PUV $l$1}$K1D=t<$t h`tt$,]ō< 4$t$L$QWPjbV( L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃t$ Wt$t$Pjbt$(V< ( )  * jQPR ;@ + ,  - jQP ;D . /  0 jQP ;H 1 2  3 jQP ;L 4 5  6 jQP ;P 7 8  9 jQPS ;T : ;  ( jQP  Ƅ;X jjt$h( ^_[]fffffUSWVD[$|$\w a2t$`tD$@jPV NjD$@9t8t-D^_[]8"u trD$yD$ kD$D$[D$<D$8wD$X$2a$WQjP0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$  $fǃ< $1< D$? Pt$Q: ΜjxPl$UdK VW;1ҍl$?4$$U03 UV;T$iȓ$T$) L$i<@U2D$uj$P4$$U2 +t$D$fǍl$tt$t$U~2D$ fƍ$t4$$U[2D$  jVD$@  $$ $ jQP   $$ $ jQPk   $$ $ jQP.   $$ $ jQP   $$ $ jQP   $jQP  H @jjV D$;$uD$^_[] LfffffUSWV[q$ $$D$$AO$WAVUW!B W$$l$ UBD$\6666D$`6666D$d6666D$h6666D$l6666D$p6666D$t6666D$x6666D$|6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$|6666D$x6666D$t6666D$p6666D$l6666D$h6666D$d6666D$`6666D$\6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\t{E6L$\4\D$tdF$tB$ڹD 0D \0D D 0D ]0D  u$t D 0D \0D $V ?D$\j@PV9? $$V"? VW@V>D$j@PV> jWV> VW?D$;$u ^_[]GHfffUSWVP[ö|$l$t.jPUH Ƌ$9t8t"ҏ1^_[]谏8"u t7ސUSWVPX6L$ |$t$Q̓t2$1ې?ڇ9u)ދ$r`?ڇ?ڇV ?ڇV?ڇV^_[]ÐUSWVPXfL$ |$t$Q̓t2$1ې?М9u)ދ$r`?М?МV ?МV?МV^_[]fVYT$ t$tt1ut ^Åt!^Åt^Í҇^Í^Íʇ^ÐUSWV,[$t$@VcL$DV,~09rЍ,1V8T$$V(T$l$ D$D$|$F4D$L$ 9v|$VWuW$u WVf 1,^_[]ÐUSWVH[Tl$|BUƋD$h4$l$D$D$lD$ D$pD$D$tD$D$\D$D$D$ D$$D$(D$`D$,D$dD$0D$4$D$<D$@D$DD$8$PctUV |~D$xt UVP $tL$tA$D$PW$5t!UV W$  UV 1VXH^_[]ÐS[jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$8@4[ÐS[Êjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐS[:jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$8R4[ÐS[Újjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[Jjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[l$hUۈƉD$ D$PljD$VD$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$TD$ tKWV(tD(1t$t$ U}T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[4t$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[Zjt$t$t$@[ÐS[*jt$t$t$[ÐS[jt$t$t$[ÐS[jt$ [ÐS[êjt$ h[ÐS[Êjt$ H[ÐUSWV[dt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Ät$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[ät$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXL$Q##wxÍÐUSWV [Ô|$(l$$t$ D$4|qD$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[D$ hPt$u [ÐS[ht$t$v [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[9D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[TD$pML$LjPt$lv D$h|$df$D$VTL$)L$D$PVW+ID$ |$$v=D$8t$.D$lp8L$ QjjVzVT|$)cƃPD$2PL$QH ? $ $$m=|$D$lp,t$ jjt$>VVT|$)Ƌ $PD$2PL$QKH  $ $,t=D$D$lp(t$ jjt$>V蟍VS|$)Ƌ $PD$2PL$QG rg $ $,p=D$D$lp0t$ jjt$>V4V;S|$)v#Ƌ $PD$2PL$QuG sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7L$R)уtuÐWVt$  r!̐cw^_fffffSWV[øt$|$G@hjPB j@PWB g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[Ñ$$N$@r8hUtE\EXETEP$t$tAsE@hjP@ Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjVg? h$$V˙hVU< hV1;$u Ą^_[]|USWV [l$(16t$ %T$$NP NT  ()`N`L$$WRP> ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP> 1 ^_[]ÐUSWV_z$hRP= RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W#0 hj$P/ g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ. $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV. D$hWD$$hPD$;$xu D$e^_[]ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[ä|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tey t_y$tYqtR9uNNwAL$x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]Ť$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$a$FQ? T$‰ً$|$D$G<uD$ $ $u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4L$ |$ )t$)t$$t$,)wD$ L$?? n T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4EܤBT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍 FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00^sL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q# l$El$ $t)G t#ωVt$D$00co|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj ƭ&t$ً$|$tv|$ulT$ (uG(jjjl |$(fD$hL$hjQPkL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?̤ፅGPGX GTG\GG?$L$u aD?ڭFQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  FL$Q? FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$Ԯ$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v'tD$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=G$FL$Q?P$$NL$Q?D$T$ ߋ t$G$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPG]RQPc L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $USWV[biiE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRPV )t]D$)WPu8? }43M(U,E4E09w)RVP E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[Xht$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[gL$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU F4n0)Pv8U 1tN0^_[]ÐUSWV[Wgt$~ ~$n9uMwr|$} t >?t ^>?u(jjjr_ t$WPd_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[4fL$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8R2T$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXA`D$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@dD$?? u)D$(L$(ԮÉ$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$U1FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+ԴT$D$tq01t ^_Átփ*tUSWV _4AL$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$V??L$1)t,)9멁f*] ^_[]ÐUSWV[@l$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjP )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[<|$$ $w9>~NQǃ8wHl$([ tWt?t u(t#IO+t*tF(n(~taV:NG9wͅt2Uvw S o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj%3 G0FqoUO9,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0~* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoUk6,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~+ Nl$("dFx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQA F NFy,t)vNPQw0( G0$F oUw5l$Eo9wŅt2UD$pw  o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0k' G0oU\4,$Eo9wŅt0UD$pw  o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0R& G0oUC3,$Eo9wŅt0UD$pw  o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oUj2,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU1,$Eo9wŅt0UD$pw @ o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQV52 $FlF\iU^0l$E$ыj9wŅUD$pq  $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQV0 $FlF\iUH.l$E$ыj9wŅ(UD$pq  $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaV;-~l$(džCN\^F8VjjjV*u+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQU^mAlA\uVF}9wDžt)$Wvu  } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uV F}9wDž$Wvu w } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUmAlA\uVF}9wDžt)$Wvu Z } ~})})~uFFD$(xy1)Ћ$jPQUKmAlA\uVtF}9wDžt)$Wvu  } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]USWVՉ[|$A9wDžtB)FW6U= F@tuWUv0P WUv0 F0>~^_[]fXÐUSWV^tL$4t;T$8\$0Ӄs3I͉у1&Ӊi913ƒT$4zR13ƒT$4zR13ƒl$4M1ʉ3xT$  1ϋL$ 3Ã1ؐ\=13\=139uЉЉ̉D$ ,׃}l$D$D$D$11|$ $333.3 $3Q333 $3A333D$ $3A 333|$D$ $3A33Љ3|$|$ $L$l$11D$D$333333W133333G1333ȋT$33W 1‰333\$33_1ˋT$ )333É3ϐÉ13W13W13W13W13W13W1Љ3O13RЃ^_[]ÐS[*t$t$t$ [ÐUSWVX $D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX $D$$tz \$׃vND$t$1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPX6 $T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐUSWVPX $T$tfǃvEt $1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[jt$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffXÐUÐX+L$ÐS[jD$D$ P>[ÐS[:t$ ![ffXL$ ( $ <, | 0 P8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_LJT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P詚L$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXdD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$LPP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +8)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[Xt$VGR=yaratV=tcidu3VuVStt$PF I81^_[ÐSWV[t$VQ=yaratV=tcidu3V;uVtt$P蠇F1 ه8҇^_[ÐSWV[ht$VWQ=yaratV=tcidu3VtVctt$P F Y81^_[ÐSWV[t$VP=yaratV=tcidu3VKtVtt$P谆F1 8^_[ÐUSWV[tt$VcP=yaratV=tcidufVsVoƅtJ|$$l$ 4$V%D$PWUy 1uM(VQu 2(^_[]ÐUSWV[t$VO=yaratV=tcidufVsV这ƅtJ|$$l$ 4$VuD$PWUax 1u蝅(Vu 肅(^_[]ÐUSWV[|$Gt,/D(UwUJt D$0 $1^_[]ÐUSWV[÷|$Gt,/D(U蘚wUt D$01Ą蹄^_[]ÐUSWV[W|$Gt,/D(UHtwUt D$0 d1^_[]ÐUSWV[|$Gt,/D(UswU*t D$01^_[]ÐSWV[ÕPt$ t$ ~v t6D$t7<$D8W`t$WtD$ 01苃肃^_[SWV[Pt$ t$ u t6D$t7<$D8Wrt$W1tD$ 01 ^_[USWV[Ôt$VL=yaratV=tcidVoV苖ƅtl|$$l$ 4$VAD$PWU-u t_V{D$t<<$D8Wrt$WWtD$(014 ,8&#8Vt^_[]ffffSV[Ùt$t$ePzK=tciduL$1=tcid^[ÐUSWV[Gt$t$3eP(K=loobul$V袉Eloob^_[]ÐSVP[D$P趈t&Pt$t$f D$VDD$1^[ÐSVP[Øt$t$Vt$t$f D$V^DD$1^[ÐSV[It$t$t$1dVPP^[ÐSV[t$t$t$dVPQ^[ÐSV[t$t$t$cVPwQ^[ÐSV[ùt$t$t$cVPQ^[ÐSV[Ét$t$t$qcVP7R^[ÐSV[Yt$t$t$AcVPGR^[ÐSV[)t$t$t$cVPR^[ÐSV[t$t$t$bVPS^[ÐSV[t$t$t$bVPgS^[ÐSV[Ùt$t$t$bVPS^[ÐSV[it$t$t$QbVPS^[ÐSV[9t$t$t$!bVP'T^[ÐSV[ t$t$t$aVPT^[ÐSV[t$t$t$aVPT^[ÐSV[ét$t$t$aVPT^[ÐSV[yt$t$t$aaVPT^[ÐSV[It$t$t$1aVP'U^[ÐSV[t$t$t$aVPwU^[ÐSV[t$t$t$`VPU^[ÐSV[ùt$t$t$`VPV^[ÐSVP[ÈD$QPHt&Pt$t$b D$V<@D$1^[ÐSVP[(D$QPHt&Pt$t$9b D$V?D$1^[ÐSVP[D$QP!Ht&Pt$t$a D$V}?D$1^[ÐSVP[hD$QPGt&Pt$t$za D$V?D$1^[ÐSVP[t$t$dGt&Pt$t$a D$V>D$1^[ÐSVP[èD$QPGt&Pt$t$` D$V]>D$1^[ÐSVP[HD$QPFt&Pt$t$Y` D$V=D$1^[ÐSVP[D$QP@Ft&Pt$t$_ D$V=D$1^[ÐSVP[ÈD$QPEt&Pt$t$_ D$V==D$1^[ÐSVP[(t$t$Et&Pt$t$=_ D$V<D$1^[ÐSVP[D$jPFt&Pt$t$^ D$V<D$1^[ÐSVP[hD$jPtFt&Pt$t$}^ D$V <D$1^[ÐSVP[jt$Ft&Pt$t$^ D$V;D$1^[ÐSVP[øjt$Et&Pt$t$] D$Vr;D$1^[ÐSVP[ht$t$tEt&Pt$t$}] D$V ;D$1^[ÐSVP[jt$Et&Pt$t$] D$V:D$1^[ÐSVP[øD$jPDt&Pt$t$\ D$Vp:D$1^[ÐSVP[XD$jPdDt&Pt$t$m\ D$V:D$1^[ÐSVP[jt$Dt&Pt$t$\ D$V9D$1^[ÐSVP[èt$t$Ct&Pt$t$[ D$V`9D$1^[ÐSV[It$t$5YP*?=gntsuV!t L$1^[ÐSVP[t$t&Pt$t$[ D$V8D$1^[ÐSVP[èt$t&Pt$t$Z D$Vd8D$1^[ÐSWV[Xt$t$DXP9>=atadu,V)st|$L$tVr1^_[ÐSVP[t$t$Tqt&Pt$t$Y D$V7D$1^[ÐSVP[Èt$t$tpt&Pt$t$Y D$V@7D$1^[ÐUSWV['t$t$WP==gntsu?VŃUt$UPV t D$8 W1^_[]ÐSV[ét$t$VP<=gntsuVzt L$1^[ÐSVP[Xt$Xt&Pt$t$qX D$V6D$1^[ÐSVP[t$(t&Pt$t$!X D$V5D$1^[fUSWV[÷t$t$SP;=loobul$VzEloob^_[]ÐSVP[XD$P&yt&Pt$t$_ D$V5D$1^[ÐSVP[t$t$Vt$t$ D$V4D$1^[ÐSVP[øD$Pxt"Pt$胂D$Vv4D$1^[ÐSVP[ht$t Vt$?D$V24D$1^[ÐSV[)t$t$t$VP@^[ÐSV[t$t$t$VP@^[ÐSV[t$t$t$aVPWA^[ÐSV[Ùt$t$t$1VPA^[ÐSV[it$t$t$VPB^[ÐSV[9t$t$t$~VP'B^[ÐSV[ t$t$t$~VPB^[ÐSV[t$t$t$q~VPB^[ÐSV[ét$t$t$A~VPGC^[ÐSV[yt$t$t$~VPC^[ÐSV[It$t$t$}VPC^[ÐSV[t$t$t$}VPD^[ÐSV[t$t$t$}VPgD^[ÐSV[ùt$t$t$Q}VPD^[ÐSV[Ét$t$t$!}VPD^[ÐSV[Yt$t$t$|VPD^[ÐSV[)t$t$t$|VPE^[ÐSV[t$t$t$|VPWE^[ÐSV[t$t$t$a|VPE^[ÐSV[Ùt$t$t$1|VPE^[ÐSVP[hD$QP8t&Pt$t$i| D$V0D$1^[ÐSVP[D$QP`8t"Pt$}D$V/D$1^[ÐSVP[èD$QP8t&Pt$t${ D$V\/D$1^[ÐSVP[HD$QP7t"Pt$ }D$V/D$1^[ÐSVP[D$QPA7t&Pt$t$z D$V.D$1^[ÐSVP[ÈD$QP6t"Pt$N|D$VA.D$1^[SVP[8D$QP6t&Pt$t$:z D$V-D$1^[ÐSVP[D$QP16t"Pt${D$V-D$1^[SVP[Èt$t$5t&Pt$t$y D$V@-D$1^[ÐSVP[(t$t$5t"Pt$zD$V,D$1^[ÐSVP[D$QP15t&Pt$t$x D$V,D$1^[ÐSVP[xD$QP4t"Pt$>zD$V1,D$1^[SVP[(D$QP4t&Pt$t$)x D$V+D$1^[ÐSVP[D$QP 4t"Pt$yD$V+D$1^[ÐSVP[hD$QP3t&Pt$t$iw D$V+D$1^[ÐSVP[D$QP`3t"Pt$xD$V*D$1^[ÐSVP[èD$QP3t&Pt$t$v D$V]*D$1^[ÐSVP[HD$QP2t"Pt$xD$V*D$1^[SVP[t$t$T2t&Pt$t$u D$V)D$1^[ÐSVP[Øt$t$1t"Pt$awD$VT)D$1^[ÐSVP[HD$jPT3t&Pt$t$Mu D$V)D$1^[ÐSVP[D$jP2t"Pt$vD$V(D$1^[ÐSVP[ØD$jP2t&Pt$t$t D$VP(D$1^[ÐSVP[8D$jPD2t"Pt$vD$V'D$1^[ÐSVP[jt$1t&Pt$t$s D$V'D$1^[ÐSVP[Øjt$1t"Pt$cuD$VV'D$1^[ÐSVP[Hjt$V1t&Pt$t$Os D$V'D$1^[ÐSVP[jt$1t"Pt$tD$V&D$1^[ÐSVP[èt$t$0t&Pt$t$r D$V`&D$1^[ÐSVP[Ht$t$T0t"Pt$tD$V&D$1^[ÐSVP[jt$0t&Pt$t$q D$V%D$1^[ÐSVP[èjt$/t"Pt$ssD$Vf%D$1^[ÐSVP[XD$jPd/t&Pt$t$]q D$V%D$1^[ÐSVP[D$jP/t"Pt$rD$V$D$1^[ÐSVP[èD$jP.t&Pt$t$p D$V`$D$1^[ÐSVP[HD$jPT.t"Pt$rD$V$D$1^[ÐSVP[jt$.t&Pt$t$o D$V#D$1^[ÐSVP[èjt$-t"Pt$sqD$Vf#D$1^[ÐSVP[Xt$t$d-t&Pt$t$]o D$V#D$1^[ÐSVP[t$t$-t"Pt$pD$V"D$1^[ÐSV[ét$t$EnP(=gntsuVz t L$1^[ÐSVP[Xt$Xt&Pt$t$an D$V"D$1^[ÐSVP[t$t"Pt$oD$V!D$1^[ÐSVP[øt$t&Pt$t$m D$Vt!D$1^[ÐSVP[ht$t"Pt$5oD$V(!D$1^[ÐSWV[t$t$lP&=atadu,V[t|$L$tV[1^_[ÐSVP[èt$t$Zt&Pt$t$l D$V` D$1^[ÐSVP[Ht$t$4Yt&Pt$t$Ml D$V D$1^[ÐSVP[t$t$TYt"Pt$mD$VD$1^[ÐSVP[Øt$t$Xt"Pt$amD$VTD$1^[ÐUSWV[Gt$t$jP(%=gntsu?VŃUt$UPV9 t D$8 W>1^_[]ÐSV[ɵt$t$ejP$=gntsuVt L$1^[ÐSVP[xt$xt&Pt$t$j D$V4D$1^[ÐSVP[(t$(t"Pt$kD$VD$1^[ÐSVP[شt$t&Pt$t$i D$VD$1^[ÐSVP[Èt$t"Pt$UkD$VHD$1^[fffSV[9j ƅt%dPV FF F^[ÐUSWV[|$tzj 軿1tcdPV FF FWXŃPwtQPˊ~n VX1^_[]Í[@PQhR迼SV[)t$ tVXP4^[Í[PQhmR_SV[ɲt$ tVWP^[Í[PQhmRUSWV[dD$tfL$ L$QPjj1x@ƃ$Pt+ǍD$ D$Pt$ t$W諏1ɉV.ʼn^_[]ÍnPQhERPUSWVP׉[±VtPQ8j 舽t}ƍdPV n~L$N uq$ U VP@9tBPU$u vV}1uWhU贁^_[]ÐS[st$Pc[ÐUSWVP[öt$t d9.t 1^_[]Fu V5F $P[t͉NjFu PW複VtPQ΃j t!UP$ F~$F qWbaUSWV[l$1t d9}t ^_[]ËE D$P蘻tߋMu QPD$߆VtPQ j Yt'WP_E$ED$E y4$iZ+L$1t d9tËA ÐVYT$1t d92t^BBtu ^ÐS[úT$t d19 uL$ tB ;D$v1[ËBu PQÅ[ÐY[D$t d9t1Ê@$ÐUSWV['l$1t9d9Eu.E PtNjEu PW2^_[]ÐVYʭT$1t d92t^ËBu ^ÐUSWV [Ä|$ d19t$$9Gt{o F D$D$Pt[$W ȅtЋT$ՋVtэ8eQPRt$t$V車Owo tQ/1 ^_[]ÐUSWV[ôl$d9ED$ Etp} PwQ$PNtM}D$u T$ $8eRWQP|$WM}u tQs1^_[]ÍPQh+RgS[ګD$td9u L$ t9t1[QP[ÐS[ÚL$t d9t1[ËD$ Iu PQ5Q[ÐS[JL$t d9t1[ËD$ Iu PQP[ÐSV[D$ td9u L$t9tf^[Ëp ЅtItRP{PאS[ÚL$t d9tf[ËD$ Iu PQ2P[ÐUSWV[Dl$$|$ }$tV 1^_[ÐSWV[8t$NtFt_V9wwu QPtFVL$z~ ^_[1U0PQhRAm0PQhR"0PQhRSWV[xt$t$|$PWtu^_[ÐSWV[(t$jVt j V~1^_[ÐSWV[èt$~ t1j VHtw;~ rjVt j V1^_[ÐSWV[t$|$ʃ>tXVt j V1^_[ÐSV[t$ jV)tj Vt jV 1^[ÐSV[9jƅt5htFFF VN1^[ÐS[ڟt$&[ÐUSWV[ôD$ t$tPDD$D$l$$~1̀ws 琐<L$yO!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸ]$T$J(z 1 7>w􋌋L$qD$ tL$9QWP~q 78/u%<$D$@$|7>7VL$A$>tGL77t$ wɋH vHN15t$F FFFFU=tP w싔Nx"u+1Ҁ8t$FHt"tV x>t1^_[]ÍhFPQhR芦USWV_l$D$P1 D<&t0<<t;\$rJ1ɋB닀ztuTz;uN<szuuuwXtEuW菳1^_[]Éw񐐐USWV[D$PZ>L$QPjjj$0PD$PZ$$_HtыxnUextUt띐$$QL$ QPƅtׅkU%xtT$$4$tz1Uw$ƅt`L$HtыxnUwutUPjQt t뫃tX^_[]Í.PQhRL.PQhRޞ.PQh R连PQh;R蠞PQhER聞X.PQh RbS[ڔt$&[ÐUSWV[ñ$x4$tT}tNU9t H|/t9鐐9/ 9sf$.V29H ro9?fD XDXXXXDistX/.plV0W$P\ 9ucV^tUjXwPKwWVat)V^Ut$V/`u-8888V^Vr881^_[]É9tE9t qy/t)rVUPa, 4USWV[jsj豞1 Ɖ|$hj$] tLǍD$PW,t.L$Al$h($#$V9s&W]VW]V裮4$D$ l$t1jjWjjQj,$EWX]tFjVWa D$D$ u;jjjhj|$WP謲t",$u U1Č^_[]VU4$ڐSV[Ét$ jv6ra v6űV踭^[ÐS[JD$P6st[ÍPQhR莚D$t1S[jt$t$ [ÐUSWV[ñ$4$0$,D$PStED$$;t 1^_[]Él$L$QL$QRUWVPu=VU$8P$8PD$ PT$,$0릅4$t$$8$8D$ PRt?t$ $,|$$0D$$1;<$4t $4jj$8W$8Ut$ VJS$,$0PQjjWUЍPQhR聘S[D$P[ÐS[ڎD$PP[ÐSV[ùt$ vV^[fffUS[ÁEM L$$D$e[]ÐUSWV [BPQa W^ l$UV5tPW^ ^_[]Ét$W^j 趙thʼnPU|$GEOM,$EVC^W|$Wt(P&V^4$辩p1l,$UW9uVM_PQh@R蠖US[EM L$$D$e[]ÐUS[ьEM L$$D$^e[]ÐUS[ÑEM L$$D$e[]ÐSV[Yt$ 1t9u V^[ËD$@$ÐWVYT$ 1t 9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZjL$1t91t^1^ËAQ^ÐVZ*L$1t91t^1^ËAQ^ÐVZL$1t91t^1^ËAQ^ÐVZªL$1t91t^1^ËAQ^ÐSVPYhD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY؉D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYHD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y+D$t9u@H@ty1ËT$ BÐSVPYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYXD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYȆD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY8D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YD$t9u@H@ty1ËT$ BÐSVPYhD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPYD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXT$t9uBJBuy1ËT$JÐSVYYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPYD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPYxD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXT$t9uBJBuy1ËT$JÐS[JD$t9u L$ t9t1[QP*[ÐVY D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYjD$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVYD$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV[ÿuD$D$ D$~6~$,F0tW-uk$D$jPv@ T$ D$1ɿ9$8"xxum$D$jVZ$D$jPvՏ T$ D$1ɿ9rG$8"u=$jD$Pv ^ T$ D$!Ѓu #8"t7L$d$D$F&jPV tu L$e^_[]ÐS[J~ jPN PQ/ 1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[)}D$0 VP_Vb1^[ÐUSWV [|t$4L$8AAItuQPRj W~Z&UVtWVt UVR1 ^_[]ÐWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[|PQO PL[ÐS[{ PwL[fSV[ù{j@蕇ƅtC$PVjPMF,F0F4F8F<^[ÐUSWV[E{t3Pjtjj@DžuUhOj@1t=$PWGjPLo,w0G4G8G<1^_[]ÐL$WUSWV[Ôzt$1$9nULN4 Džtbl$~4<$tC1퐐F, 6苉1VD1^_[ÐUSWV[ml$}t^_[]j@xtƋ|$$PVjP>F,F0F4F8F<}$t7hnxtL$7PUrVPbUSWV ։L$[>l|$ *jjWg !jPww Ht(ut$$N!jD$Pww (u$uyGL$PQht$0WtZD$=stL$$jt$W t4jjW t#@jt$(P6t$}.t1t$$蕇U  ^_[]ÍPQhIR~tS[j!Pt$ [ÐSWV[øjltyPtWD$PVQ tEVt8>VtW0G49O,tktklD$jjjWP,tqG,O4QW4DP*D$(Ct(aKPQhbRrQ]GP%;WH1^_[]É.KPQh`R8rKPQhqRrKPQhRqS[jhL$A4tPQ4I,Dt*P1[ÍPQhRqPQhR~qUSWV$[gl$<|$8uV9}4tM!D$ PWtj Wct$D$<9t6$V9$$V9!PW,^_[]ÉL$jj8}tHl$WUP jiDžt!tPWGwo 1^_[]ÐUSWV[\l$1t9}EuBM1tDm $t: $Uht^Ut$D$P U-;1$D$jNht"WPT$ED$E E^_[]ÐZ+\L$1t t9tËA ÐZ[L$1t t9tËAÐSV[[T$ tt19 uL$t r ;t$v1^[ËR1ttVRQ ᐐUSWVP[f[D$1t t9t ^_[]ËHh t( $tDUgt؉Ut$Pv ątIPQhRldIPQhRMdZ»ZL$1t t9tËAÐS[ÊZD$tt9u L$ t9t1[QPj[ÐSV[IZL$ t t9t1^[ËT$19Q ut$tRVqN- ֐USWV [Yt$(~$t  ^_[]ËFyjQvPt҃~ tD$jPvEh ʼn$u 8"tD$NN 9u8"t=IPQhRb1jPj N,$Ue7ǍFPD$PU tcD$;$uZjPV& tD|$u W.u1,$jdƅt-tPV譱F~n Wtt WtD$$0USWV$[aXy11T$G=w ⍋jAPQ u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5jP2"F,F0F4F8F<^_[ÐUSWVP[Ot3Pjetrj@[DžuUlWj@[1tE,$UW蔨/GjP!$G,w0G4G8G<1^_[]ÐL$GUSWV[4O|$1tv9uloU@!O4ƅtIl$44$t*1G, 6b1V蔦1^_[ÐUSWV[WFl$}t^_[]Ët$j@RtdǍVP7t$jPG,G0G4G8G<>}$uL$UxUSWVP $[ãE*ts֋|$jjWƥ tCjPww 諩t(t1@jjPUt$wt1U&^_[]Í/PQhBRNS[DPt$ ë[ÐSWV[D|tyPСtWD$PVQ tEV衣t8>V袤tW0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%/PQjfRLQ_GP]W_1^_[]É./PQjdRsL/PQjuRWLS[BD$H4tH4[Íh/PQhRLUSWV[ÄBt$(l$$~W~4tH$PU胛tj Ut 9t6$WV$WEPUU^_[]ÉD$jjWtHVD$~T$rL$9F/PQhRIQ>/PQhRHSV[i?t$D$ PVu^[ÐUSWV['?l$}tQ97uGW2EtS90uOH<1;M uM;H4w\t @,4MW^_[]Íh/PQhZR%H/PQhBRH/PQhGRGUSWV[W>|$wt<9.u2VbGt>9(u:G@D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[8t$@|$t1 @u~1ɍ` >t 9u#;T$t$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍsQPjyS[ÊL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV[D|$<vQPt$@t$@׉L$dODH@u=D$j PW+ Ɖ8"u+" 0]`Pt$ QIT$91\ ,$ .,$ ,$ ,$9,$dT$9މH1,9'T$,$xt*unD$<L$Pt$-u FD$0t$4E<+<-mL$XT$,))D$ $t$љȅuD$+D$,\$؉D$$1L$T$ /t$T΋T$ D$L$9~D$<0D$TuT$ ΋D$tNj$9|D$롐T$$t$Tt4$9|t$l$TD\D,$9|ȋl$= ()ȋt$()։D$4$t$֙uD$(L$$)ș\$؉D$1t$L$ +T$T < L$ D$t$9~D$(D$T<u#ދL$ D$tˋ$9|D$말T$΋L$T<<t $9|L$t$T<4$9|ˋt$ŋD$D$0 L$$ $\$|$ Vtu<-u ~4$<:tkE$<4$P-L$ tEH<$W;:&L$A;D$PʋL$TTD$:uX8t}:t4$PA" $? tǃǃȃ<^_[]À:uL$:tVL$D$X:L$u^W X8t}:tjWP! Wx:L$~T$0L$ $_D$h/ :t#j=R~ʼn)))ωD$<$t$יut$$)\$؉D$1|$T$ (T$T  T$ D$|$9~ΉD$<D$TuT$ D$tNj$9|D$롋T$͋L$Ttȋ $9|L$l$TD\D,$9|ȋl$1V蚰D$\8l$ pD$D$1T$ $\$" $>T$tbQWR腣 uW( $9D$t0ϋNT$\;LuN;Lu N;L tD$딉l$뎃|$t`\$X8D$X8:"RQP& $L$$D$ \$\$D$\T$l$ t$\$D$\l$ tyD0X8|$Xt?:t;RQP 1L$\|1uD1 <-t<+::_yX8tD$X8:tRPE ? Hl$ t,L$)l$XSA;D$PʋL$TTl$Xu{D$L$ D$TL$DL$D$\uLD$8uCX8t}:tcRP1L$\|1uD1 L$  aL$\D1L1 t1ɋD$`<85 X8t}:t4$P $E<-t<+u:}:1<: :fffffUSWV[GT$l$t$` tlǃ` 9}@L9-u7y Id -uK-? ^_[]Ë t d ::ur??t::tgUPQR~듍 j-R3ymǃd --QRytRx:ue?u%1x:tH9}gL$|鉻h T$?(ǃh ?t :D$8:?fffffS[:j jt$~ [ÐS[jt$ [fUSWV[t$l$tyjj1trjtkNjD$oGG EPjQRjWtKjP 讪1^_[]蚪8l$u!E}8t(Wx!|$7j!P(릐USWVP[t$ l$ME 1҉s9r J9sAEOQ0t`U)ƒQjRD$ 萝 E $}E T$)9w΋MVRP贝 E E MU9r‰^_[]ÐUSWV[T$L$t$ D$tt:ufWpxA)9}8TV t,mUPQhR x Ήp HPp 9r@ 1^_[]輨䍃dUPQjR S[*t$v1[fS[ Xt$ t$ P [ÐS[Xt$t$t$P[fS[êL$ 1t$PQt$G[ÐS[zjjjt$$[fffffffS[JL$ 1hPQt$[ÐSV[t$ jjjjVt^[ffS[t$j t$t$[fffffUSWV[÷|$t$jW~G0t ujWЃ^_[]fffUSWV[Wt$|$ttft7Gt9fh L$f@Hx$p,L$ H(L$$HDL$(H @1^_[]ÐUSWV[j 1L$,l$(D$$t$ T$wGo Ouu u&t,t+$Pttڍuft?$L$et: $fH f@xp$L$H,h(@DH ]W]1^_[]ÐS[L$ D$T$rRQ0P [ÐUSWV[ç|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[JD$t$t$t$0P [ÐSWV[D$8pP^tWփ1^_[ffffffUSWV[l$T$B0~-z,t xu z$t juuRC1Ƀ^_[]fffffffSP[YD$ L$T$$RQPG[ÐSVP[(D$L$T$t$4$VRQPG^[fffffffUSWV[t$,D$Pt$,˧tcNj8uBF f|$tRt V wN Vt׉<$‰u+t'vуV+fF $1ht$t$, Ņy?t;p8tf8u"vV 1ht$t$,_ 5D$ <$t 9t vV ~ y vFFFFFF0tV@9t QF0ǀǀ @F0ǀǀxn9tjWUXx\U[}UD$fF f~vF$F,F(F D$tDjjjV*3|WfF ڠL$ 1^_[]ffffSWV[h|$f tmjW{G0tW@9t QG0ǀǀ GG1G uGGjWN}4 ^_[fUSWV[l$T$B0~-z,t }p z$t R UE!1Ƀ^_[]fffffffSWV[H|$jWzGHO~ H0 WjWf|^_[ffffffSP[D$ L$T$$RQP[ÐSVP[øD$L$T$t$4$VRQP^[fffffffSV [vD$,t+8t&$PWD$cD$D$ t$5\x9$~PFFzXNF )PQj,^[ÐXL$x9$~ÍÍfffffffUSWV8[ÄT$LD$4D$Pp%VPKVPqVPVP՝VP轝VP襝VP荝~VPum;VP]\ZVPEKVP-:VP)VPVPVP͜*VP赜WVP蝜Oс0 t9uuhl$t!j2pUP xqQPs`YRKD= 6 / ( !  l$"PQj2UU̚ƋD$XtPUt$\蔐 ;D$4u 8^_[]SfffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^ËL$A)A31|$tA AAÐSWVL$yuTt$wKQ Zt@uvt |A 1^_[ÐD$xtÀx|$ÐL$ytI .wuÐSVL$ 1yt^[ÊY u.wT$~9|ԐD$xtÊ@ u<.wL$9Ð|$t1ËD$ÐSWV[1|$u:T$D$9w&t$PjVŋ FfFF^_[ÐWVL$ yu/T$Az |1z|1:RT1 |1A1^_ÐUSWV[4L$(yQ׋t$,<$PQVa8 N1<$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ËD$xuHuP9røÐVL$1yt^Quq9rt$ x9v1^fffD$ ÐL$ QϸwD$T$B)J 1ÐUSWVP[Æ|$ L$$T$,r 4$9u+$1!)1օҋ|$t$uEEFEMPjQ 7D$8t pVPU' 7+$p)t&uFA̓PjQ螈 7+ $O 1^_[]ÐUSWV[Tl$$1L$(T$4z <$9u+$1*!)1ׅҋl$t"uGFNPjQЇ D$ }+$x)t.u$GAL$L$PjQ艇L$ }+ $M ^_[]ÐVt$~)FσwyrrF  9r]T$  t9tq9w<q  9w! 9s9tQ9wQ^ú9^ÐSWV|$)OσW 4 9L$ 4:t:tz9w_z  9wD9s.D$9t7tz9w#z9w9rָ1҉^_[1VL$t"T$ tփuQ^ÐUSWV[w|$ T$$D$(<9D$|$,Ѓt)։Ѝ4*T$$t9wY|$tOL$,|$t u D$ (GPjWЄL$8T$0D$, W9^_[]ÐSWV[È|$L$1uLwt?;t$w6)w*t$uQRjQ4 ^_[ÐSWV[t$|$D$Vt$PH ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWVL$tkʃudT$t׋t$(9}GT$\$ א?tW9w)o/9w 8t9r^_[]ÃD$$(>+T$吐SWV[Xt$|$D$VPt$ 蘂 ^_[ffffffS[jjt$t$t$t$[ffS[jt$ t$ t$ t$ t$ t$ [ÐUSWV[á$$$$fRt$tPQj V-D$0D$4D$8D$<D$@$D$(D$,D$$D$L$$PQVut)6P`PVQb <$D$@tp hPV蓂 u$_ PQt9xu|P mtUWL$$U$$Ƌ<$t$;$?Ę^_[]ÍD$$T$DPhQR$|$D$Pjjj$t(D$ PjjjD$ $%x}D$ t$ű$<$t t$謱jjt$(Q t$$PQ  &PQ]fCt$-jt$xjjy/PQ]j`t$$ujjx*jt$xt$ 訰t$蜰#y8uYD$p$uMP6ߊuR$$Ŋu8D$@$8j `D$HpQRj/|$ WzL$ $t$$tjPQ T$t$u+wjU6$PQt$W NjU6$Pt$Wȴ2 j/Wt}jUPQW蔴XWPQ[ j_USWVdT$,L$[éE$` CD$HD$LD$PD$DL$D$DQPj説 l$$D$D$0D$ l$#PZmjuD$P Džx#"10W)!0 W4$;$u Č^_[]!8USWV$[ÔD$8D$D$D$D$D$D$D$ D$ T$OQRVPuS<$t5t$@l$4$N$\$D$PjL$Q$"P\$D$]$4$֋$ߋ\$Ut$//$$$ߋ\$$PNT$NJ<-td<+$tHɋt$@$t؃L$Q$jP!$tHɋt$@$t؃L$Q$jPn؅\$VQ%$$$ߋ\$$PDT$uYoP$x1u5Ku*@P$wt"tt]tXuto$WhhU'1D$ D$7,1D$;$uȁĘ^_[]1.USWV[TD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP#;L$u^_[]k.USWV4Չ[D$$0ƃt t Ƅ$/jjjhVRQk1Ʌ(t$$/jjjhPUW@t1D$(D$$D$ D$D$GD$D$D$ $L$ OPQRl$U4$|$.vt:D$.jjjhWvv荿uW$3Phuu,$@$/ut dPRQj14$D$;$0u ȁ4^_[],USWV,[E$(Ƅ$'$'jjjhPRQƾ1$@D$ D$D$D$D$D$ D$D$OL$D$ $T$OQRV1Pux<$1tdt$&tBD$&jjjhVwwuV$+Psu$ $11P8E;$(u ,^_[]G+fffUSWV[ôt$,|$(n L$N\$ PjQf F1l$,$1D$' $ $‰ЋL$9 $ރш̀Ѐ w ЉT$d̀şw©T$M̀ſw ɉT$-tuʀ߀¿k w:T$ ՋT$D$> $ $T$- $ $1 $+L$T$,J $ $T$,BЋ$)J)Ӄ!r^_[]ÐUSWV [t$ ~Nƃ V҉$t`L$FшT$?r?鍋u $j@UPQF\$+u ~t0|$>L$:$u u uL$>͍ >T$1ҍ -9si$:U;L$s>t 9sE.9r9s34$h9s맋 $ 9s$u ^_[]fffffUSWV[çt$|$xU<@PPWV7 U^_[]fSWV[Xt$W(PPV} WҚ^_[ffffUSWV[D$L$H $xhH@i PQUWt$t$RjV芧$^_[]ÐUSWV[ÔL$T$ t$|$千WVRQL$QUPt$H 1uA$L$ L$ L$ L$ L$ ^_[]ÐUSWVL[l$dD$$D$HE$MUu}mUWVRQt$PjD$NPr$$BPQjjjjPƍlJ3mVjjjjWƅUVmt$`L$QL$QL$QL$QL$QL$QPV0$uD$L$D$@L$AD$ D$BD$D$CD$D$DD$D$ED$@T$d3L$Df3J ?D$(PwL$QL$$Qt$L$:QPt$1 mF mLFuF(;D$u ^_[1wUSWV[$ $$Pwh@V1$|$$ $ u#D$P|$WBP|$`l$d$$ʃ|&jQPt$ YV|=P$Pt$ ƅ~.V$P$P |) uc84$b8|$$uj)fƅ~$$QPJ1mF mLFuF(4$W`|$;$u^_[]1xcS[ڼjjjjt$t$[ÐUSWVt[ä$D$pUB$$Uk uj)GƅtVD$\UP91L\mF mLFuF(;D$put^_[]1uffUSWV\D$pL$tpxH 1!t$T1ȉ͉L$PʉT$LL$p L$DыT$pZ\$XÙyZ|$H1T$D!1L$tIɉL$yZ1!1T$tRʉ$T$H,$ʼnyZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1͋T$tRʉT$ÙyZ1!1ŋT$tRʉT$́řyZ1!1T$tRʉT$8ȉyZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$<͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$4ƉyZD$1!1ދT$tB8ȉD$0t$ǙyZB<1ʋt$!1ȉD$,ӉyZD$@D$L3$\$ 3\$411!É؉\$1\$@فyZD$3D$ \$$3\$011D$@!1É\$Չ™yZ$3\$l$(3l$,11!1ʼn,$މށƙyZt$@1!1ÉƋl$ 3l$3l$<3l$ʼnl$ ߋD$@߁ǙyZ11ÉŋD$3D$3D$3D$D$މށơn\$@11l$8D$13D$43$D$ىˁán3L$@1D$3D$ 3D$03D$ D$ʉсn113l$$3l$,3l$ʼnl$8D$@Љ,šn11ʋD$ 3D$(3D$3D$D$ ׉l$@ׁǡn11l$$l$(L<>4LuŋD$;D$u^_[]Ë$ffffSWV[t$,D$uj)轵ƅtZt$(P1 mF mLFuF(;D$u ^_[1USWV[Q$ $$Ph@Vs1$|$$ $ u#D$P|$W,P|$`l$d$$ʃ|&jQPt$ @|=P$Pt$r ƅ~.V$P$P  |) usM84$isaM8|$$uj)ֳƅ~$$QP1mF mLFuF(4$Wr|$;$u^_[]1S[Jjjjjt$t$[ÐUSWVt[$D$pU$$U uj)跲ƅtVD$\UP1L\mF mLFuF(;D$put^_[]1ffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[t$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP? 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP> ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [$|$$D$OGD$ $?17l$ )ȃ8NPQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jWR( ;D$u ^_[]fffffL$$Yai qyD$A(tQS[Rjj3X [1ÐT$D$ Zbj rz $z(t RPS[äjRjW [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[RjjNW [1ÐT$D$ Zbj rz $RPS[ʍjRj W [Xt@ffffffSP[ÙD$ L$T$$RQP[fffS[jjjt$jdV[fffffffS[:jt$t$jp[ÐS[ ht$t$jOp[fffffUSWV [Ԍt$ D$D$$|$jjUVjW>1D$D$ $jjUPjWD$D$$jjUPjWD$D$$jjUWjPu:18 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjR 1u ^_[]ÃtOw OsҍHfUSWVh[ uj'x D$Pj L$@B1lj1L$ED$$1t$ƋEpD$PjIxw L$@B1lj1L$EHD$$1t$Ɖq jP:u( L$@B1lj14$e^_[]ffffffUSWV[ĉl$qgjPUZ u @t tQU8aujPU@Z t 1^_[]Íu>jPVZ DžtajPVZ 1uú!?E1u<-ut<+udMDHt$}D$j PW L$9e9$YQH}+t؍ ߃/Љ(!ffffVZjL$?w5t<t#΃? ?9tA|t^1^fffffVY T$r1>w ^ffffSWV[Շt$(WjV_ xqN|$,t?r$,d$D?r',- d$!L$jWV ^_[fffffffSWVP['t$WtB PQhRdx>L$ $ )QVWRsds PQhRd  t@ ^_[fffUSWVYwD$t$D$I@t ~_wˉ"+t҃-!ЃÉ^tu/u4u?t#!tu>uG{Pt̉#.!t,#.!u븉# t# )#>  ^_[]ÐUSWV\[TD$pD$$8D$HD$DD$@D$01UPt$ ŋD$G6DoD$G   D$ 8t,PIIG^_[]Ët$$T$(,}Vf jVPQRWjUSWV׉L$[.x2jeV j+Vt-1Nx|$WjPj[yFu<$|$1jrVftW $UW]t1j{u%07BwB01^_[]ÐUSWV׉[Cw tuxBmu?ru<6bBFtjP?^vDB+u4jj"^&v%BtjP^6 B^_[]ÐUSWV[ävT$0P1L}t,PG$^t1D$D$08rl$ u_Pt$,ŋ$t$Zy0}t,PFWh4$QAt$EA=01UPt$ŋD$G6AoD$G   D$ 8t,PHFG^_[]Ët$,|$(l$$T$0#VWU{@ jUSWVP[VuL>t,PE tD$9Gt7?t9Gu(>t,PEHk1Pu E>t,PpE吐jUw  ƃu 8tWt4$^_[]fffUSWVH[dtl$`t$$WVUt$hytUVt$Yǃu.o8uj让~;$} VPXǍD$9tLVDA$jD$Pt&WPUt$hiy{D$$oH^_[]ffffUSWV4[ÄsT$`t$Xu tduurt덫tŋL$\tD$ 0D$H|$T|$LtD$PT$0xKD$(Gz9G|~dkd׉<$T$`D$L$D$=SQ|^)k׉<$T$`D$(D$L$D$S<$D$dD$D$1D$عD$dD$ $D$(D$Ѓt jt$RP9|!jt$RP9$D$t$L$\|$ L$ȋ|$ŋD$(Ћ$19 d$0$0L$,ȃ;D$LAgfff׺QՉljʼnҍ)l$趭L$$T$ QWVQt$$W|$\0URWt$hL$t$jjd|$WQʼnр|$u|$эLt$t$(t$$QPR|$dRt$Ћ|$2jjdPUKϋ|$LыT$$t$ rLt$Rt$$QPVWt$d7L 9wlj4^_[]jWRPtjWRQu$'jWRQ$jt$RPD$$fffUSWV[m$4$0$,D$ D$D$$uBuB$($,%B JB$$,L$' @fA9of\t u Gt\t @fA}Ef\tuEt\{tL$ftLfAGft:fAGft:fGft+fAA9r $,fxL$P L$P^_[]ÐUSWV[k$$$B t%E HM =rf{uf~}uf~t[f{ft"ft:Gf{u)t=hL$PVQ D$D$ $UD$D$1ft[Mfz~f{t@f}utWސf[u҉鐐Qf]tfuft̓벐먉$$$'191ɉ%9fz1f,tKf[u؉ωQf]tfuftȉ븐f{tf}ut랐uL$D$9s D$f9r1ɐT ffuL$$$$L$"1^_[]ÐUSWVTXoiD$ $P1f9~$L$B t$$L11ҋ|$DOff/D LDOff/D MDOff/D NDOff/D ODO ff/D PDO ff/D QDOff/D RDOff/tzD St$LYMLN?O2 P% QR S9$tZD$|$LttD$$NT$t$L\$ PhQRVxquD$t @ t$R$j t$(;$PT^_[]Ë\$ Pt$tU1ɋ\$ftzfTLLTft^fTLNTftTfTLPTftJfTLRu\$ IL$$Nt$QhRVPgqtQLL)196t0N,1 9tDtPt$FPF^_[]ÐUSWVYcT$tht$1BtBظkw+tրztЃːt *u1^_[]ÐUSWVՉ[BÀb4B tvEVPRy}$uMtQjP&D$ t$ L$$l$E1퐐f$NQV$r$E/%f}/L$@Ɂ1O tgTO tWTO tGTO t7uً$$$VPV$t@uD$$$PQ~D$$$PQV(u%#D$=@u;$s!E/F$$L$ ;$u Ĉ^_[]Ë$肻USWV[]$T$ f$$9t$<L$ D$,D$D$$EfR$t%=LEu⋔$B @D$D$PQ}9j=*uA=*uA=*D$$AD$9$L$ K D$$);L$ 4 f? G D$D$PQR$1 #L$L@ Eft:$tK=LEu0$hPQ $A @u$P $PQ t#$A @1 $p1ɐDM CDM /DM DM u~ID$4PL$DуP$L$8\$l$0XL$0\$$$W$W$6t$4T$D$I t#$Wrw$v ux .u$f:.u@t(x .u"Pt.uxw T$ ;$w'0jf2fu;$w9;$v%$f8tB|$,tY|$$D$ fD$fËD$;$f|$E;D$8f/D$ fD$f9$r f|$91ۈD$D$ $|$D$D$D$D$D$D$7ڐ\$u=*uLw*t;$OL$ڋL$d$t=?t)=[uBD$G=!D$t?w=D$uyt$f9t$uYt$$w1T$ЉFD$ЉT$(|W]uZD$D$;D$(;L$ $tڋ|$9|$D$(D$T$BD$=]zr-u%D$f9wf;BwD$z뾐f;|$tD$랋t$$|$t$fT$f9ljf|$1t$0FTFTFtTF`=u1D$ $T$D$D$D$:ЉƋD$D$uT$=*uI~*t;t$NL$T$L$؋D$t=?t=[u1umF=!t,~*uU|$։‰}f9|$u:g~1ЍWD$(tF]}D$D$;D$(u6;L$ \$$t$tT$9vT$D$t$fD$f;T$f|$D$&މD$׍W=][_-u+D$f9wf;GwD$wf;t$tD$랉ŋ\$$fEL$0$Wt$($]$D$ fxD$D@uP$PtP$P$P$AD$L!=+=D$ f\$$ 1$A @D$4uPPQu 8t$A T$ $$t$ W$$Y$0Qփum1ɋ$B u^ZH JRD$ /GT$ $$P$tL$< ;$u0^_[]ËD$ fD$,ffffUSWV[aR$$$tu1|$$t D$3|$ Ph@PdD$(D$$D$ cL$t$L$\QP|$tXD$D$0t$\ |$d$<0fD$PPj7X D$ $D$1p1$D$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$tVPVw $D$$uh\ND$$D$iD$,D$ 1҉t$Յt6D$D$0D$4At$,jD$8P .jD$PD$0N D$ D$r€r|$9L$x<r9L$y<r9L$~<r9gL${<r9KL$z<r9)L$q<r9L$p<r9sL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9t$u4$OD$^D$ $GL$m <s9u9tL$n <sI9uD$$$9r4$tzOD$_WY9t븉t$ypd$i$`t+t'|$jPwo u1Wt$sdƋ$>xt$dD$|Ay DAD$$uD$*dՋD$DJtDHD$D$"$@um  d DAթD$jPD$pdt$$N jPD$p) D$ t$xtG$`L$tZjPq@jPD$p -1ҋ$tjPD$p1҃ t$D$t$$D$ $D$D$ D$(D$$1GD$ 1PD$1D$ D$D$8{< `Y1D$ D$|$t,>D$D$\Pj7jQ |$8|$|$ t"$%tzXjPw |$t!D$7|$8|$ $t t$|$H|$tu Vlt$jl$ U> 1$u Uuf;$u Č^_[]yS[Ijhjt$t$t$Y[ÐSWV[øI t- jhjVPt$$t8 0jF  tPAU u^_[ffUSWV[7I jjj  |$ tWQ  th1i  9 wHt Qe  UT t$WUP舎  u 1T$ Ɖ^_[]ffSWV[XHHW  u jP .xǃ  1 t  1W^_[ÐUSWV[GHW  u jP-x8ǃ   U";D$wUt$10W^_[]ÐS[ZGt$+ǃ  [fffffUSV0[ GD$D$L$ jjPQjR蕛t_E rT$,$$t>Ut$ t$D$l$tt$$t$D$l$Zu L$(L$D$ l$Ze^[]fffUSWV [TFP t\ƀ8tUT$D$j PV׾ tŋT$t|zt)VPeZ1ɿ kP&wAզ@(ʹ+&u @9~ $jPY,$VPYT$t$$D$ t ! RUPjQ"L$ t>! ^_[]ffSV[D8 u*ǃX B[PV<&8 tt< x+VPa1^[ÐSV[iDǃX 8 tP[9B[PV%8 ux+VP1^[ÐUSWV [C$ǃ< ǃ@ ǃD ǃH ǃL ǃP ǃT \ 8 hhUWD$ 1Ʌ$t$L$@ $t$ L L$l$<ǃ< 8 hhUPWD$ X t$P Cj\WV1J t8t剃< 8#tj\WVJ t8t뉃@ j\WVI t8t뉃D j\WVI 68t牃H ǃP ǃT j\WVI tD8tP%P j\WVWI t8tPT hH |$$W |$j\PD$ P I ǀ8tWu͍UWPthUW<tTFUW(t@ZpUWt,WUWt5UWQL E5xxMf l$<$j\WV'H 8t牃< 8#j\t$VG t8t艃@ j\t$VG tOǀ8t扻L 5PW#"H ZpPWtb`H D$[(X PQ{T L l$tэ5QPu D <$j\WVG t8<$tP袩P j\WVF X8<$tPnT t$t$1ɋ;$u ȁ ^_[]觜SWV[?t$ǃX 8 t PU.B[PWk 8 t2t+V< {u䍃< x+WPo1^_[ÐSWV[x>t$ǃX 8 t PU.B[PW8 t2t+V@ u䍃< x+WPϵ1^_[ÐS[=8 tPǃ8 [ffS[ê=L$T$ j@t$[ÐUSWV0T$[p=D$H$D$$E͋T$DdD$D$|$\$9EtL$|AyL$DAMZe*?$D$KWP$H$DD$&h>|$4$l$t$ D$1t$ D$,8hUPVV%l$D, jjV$L$H;D$$~UPHl$|$UPV$LV$H6Pt$VW$L$LN9u`|$D$ǃ;|$.$D$?11PSMUJM;$ u,D$$^_[]D$ʋ4$t$ l$1/USWV[×0H|$l$t+PWUD uu~uڸ^_[]ÐUSWV[70H|$l$t+PWU uuuڸ^_[]ÐUSWV[/H|$l$t+PWU uuuڸ^_[]ffffffS[z/0t$t$n [ffffUSWV [=/} F FEFUVzRu)ʃԉF:FJFx9uRuEoN ;Nue^_[]+USWV [Í.} F FEFUVzRu)ʃԉF:FJFx9uFpRuk N ;Nue^_[]uffSVP[-D$L$T$t$4$VRQP蕘ffSP[ù-D$ L$T$$RQPkCfffffSP[É-D$ L$T$$RQPCfffffY[-T$t :td1ÐUSWV<[$-D$PL$8dPQR}X t$\ hjD$P d D$ $s D$ t:t|tD$ 9rt TPQt$e x JPQt$e L$ QPt$e xNt$ PVt"WPVu 1  VVHGj:Pt$V t l$UPt$h tL$ zSUPt$Zh t D$ ,TUPt$7h t D$ JUPt$h t D$ ^ D$ PVt$d \t$ PV PVFPV9PV,°PVgPVO!PV7'PV-PV3PV:PVDPVAPVEPV(7PVwPV_uHPVGePV/U7PVEKPV5PV%QPVPVd1DQVޒUVt${e tD$1f` ~vnf^VNF>6.&)f` t$ (DFUPt$xd tD$    lUPt$Fd tD$    xUPt$d ftL$f RUPt$c ftL$f g UPt$c 1tL$f rRUPt$c tL$f UPt$lc tL$ xUPt$Dc tt$ gUPt$!c tL$ -UPt$b tt$ fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$& aD$ `|$4L$ qL$%L$)L$-L$1L$ L$5D$ PWt$Pb tD$ UD$,Pt$3b tD$FUD$0Pt$b 1ɃtL$Nt+D$PD$4Pt$a t D$1vF UD$(Pt$a tD$ 1L$ F L$ D$ PD$(Pt$(^L$ L$ t$1|$ PWIt,Eu勃d1DJtWkt$F t$ @L$ L$ l$|$4cD$ f fD$4dxD$6D$50UWt$` 1tL$ D$51UWt$` tL$ D$52UWt$n` tL$ D$53UWt$G` tL$ D$54UWt$ ` tt$ ǃ\ WEVǃ WEV4$?t$D$;L$8u<^_[]蒀fUSWVP[#|$0L$Wك</@t)9v"9vH8/u)t\9v N8/@tvlj 9thUWVƄ+ ^_[]À|$/t0ÍeffffUSWV[!l$UtNL(d1DJuK4$ D$j PU2 }t֋L$9tJ9tE^_[]ËLJ wӍ<(x@눉8"u rL$ <$։q1늾=3ffS[ j t$ [fUSWVP[ t$0tttnL$VtH|/t|$/ue29r9vzz/u)ρw hUPVƄ+ ^_[]fffffffUS8[ED$D$$D$ D$D$D$PQjm tD$(|$0e[]ffffffSWV[x]ƃttk|$|$ueP1uPRjjP t8jPMjWBjW7|W9^_[j"fS[D$t=u[t$ PE[ËT$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[@[Ḯ̀rS[ [ḭ̀rS[[̀ffff̀ffff/̀ffff^̀rS[ð[̀rS[Ð[Ḥ̀rS[p[<̀rS[P[̀rS[0[ḇ̀rS[[̀rS[[ḓ̀rS[[̀rS[ð[`̀rS[Ð[R̀rS[p[2̀rS[P[ḩ̀rS[0[P̀rS[[ḷ̀rS[[Ḷ̀rS[[ḉ̀rS[ð[̀rS[Ð[Ḛ̀rS[p[̀rS[P[Ḩ̀rS[0[1̀rS[[Ḍ̀rS[[òrS[[ìrS[ð[l̀rS[Ð[t̀rS[p[s̀rS[P[r̀rS[0[p̀rS[[j̀rS[[m̀rS[[Z̀rS[ð[ ̀rS[Ð[S[z[ᐐ*̀r׋L$Q1fffffỲrJ!QfffffS[SV[" tF" Pj-ts" 4+" 4# " R  ^[Ë" H" jjjhjPjV81tȉ" uj$Pj> j蔒S[:D$" );" t Pu3[à QPj7[ÐS[cjP# uP\[ffffS[útPt$t$t$ [ÐUSWV8[|uD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$ydDP@Ӻ\$%D$ D$$OL$ۀU|$ɋuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ PйPt$t$ ZD$x$W袹Pt$Wr @D$x$WwPt$WG )D$x $WLPt$W D$x$W!Pt$W uD$x$WPt$W zD$x$W˸Pt$W `D$x$W蠸Pt$Wp <D$x $WuPt$WE D$x$$WJPt$W D$x($WPt$W D$x,$WPt$W 1D$D$$T$EHL$D$D$D$ P萷Pt$t$] D$@D$ P_Pt$t$,  D$@D$ P.Pt$t$  D$@ D$ PPt$t$  D$@D$ P̶Pt$t$ D$@D$ P蛶Pt$t$h D$@D$PjPt$t$7 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ J|$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ LD$ U|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$^|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ V肯D$Pt$VP ID$ VSD$Pt$V! 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$tQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$$ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$lA(|$€´| 9tVT$T$ 8t u름t D$1D$04$^_[]fffffffUSWV[l$L$t*t$1Ґtuщ )4@tRjP艐 ^_[]fffffffUSWV[Tl$$jU}|$(ƿ߂jVU~ t$(D$ D$l$ t=|$,QP͉D$ ~$tarQ}T$ t\$l$E ɉt Q,}E,$,Vt$(U赏 .D5=L$Qt$,P蕏 -1$^_[]fffffSV[ D$L$ t(T$t L$ RPQ肔 Ttƅu D$ #jQ   01^[ffffUSWV[Ñ$$|跚VjjU= ;r| $$DŽ$DŽ$$jPn$8jPDŽ$PDŽ$TDŽ$X$`V[$`DŽ$hfDŽ$lf$n$pDŽ$t$|DŽ$$DŽ$DŽ$$$$VƅxUl1Ƀ ΋;$u ļ^_[]dQS[tt$t$Pt$[fffSP[éD$ L$T$$RQP;[ÐSVP[xD$L$T$t$4$VRQPu:^[fffffffUSWV[4l$0D$,tf^|$$jWNsWelG0tW@9t Q8G0ǀǀ GGG yw%\1|$,u"fG GGCGGƍD$ L$PQWq T$T$tD$(Չ 1t<;l$t1Ƀ|$, fO Gou G9u(o/$UtB1$ʀ;l$uG݉ojWt^_[]þD$9tPwu$ffffUSWV[gl$jUq}(t4UjE u8jjjuU(!ЃtsE jUosW^uP}Tut5Et.+E EM0)׃9t E<)jUsjUs^_[]fffffffUSWV[wl$jUp}(t8UiE uEFt P F t\~tM1퐐t(0c F t((T F t( E ;~s F @ƋF P) F,t P F4tP F8t P V ^_[]fffSWV[xt$pW# PVaEW^_[ÐSV[9pV־# PDV达^[ÐSWV[pW蕾# # PQEWt^_[fffffUSWV[çl$UuPUt$VQ1tmNjt$l$Ut$2QDžtqV7!t^oEtЃVPt Eu릉l$}uEtP͗E^_[]É1ffSWV[t$Wq@# PVOWX^_[ÐSV[ÙV6@# POV^[ÐSWV[XW@# D# PQOWԼ^_[fffffUSWV$Xt$8T$dD$ 1ۀ0T$u,N 3i=)Njtt+~%L$9N$ut1Ƀ|$tΉh# uj(ƉDl$Utwn$Nj 0Q| 1|# utjh=ʼnd# 0ƃ|# LtMjуh# @1t*n$F8UQj P|$z^_[]Ëh# )USWV[l# |$i)Njtt+~%L$9N$ut1Ƀ|$tΉp# uj(iƉDl$Utwn$Nj 0Q,{ 1# utjhʼnl# 0ƃ# LtMjуp# @1t*n$F8UQj P衽|$z^_[]Ëp# )USWVP[Æl$UhNjt# $tOs;1҉v# ljh=t# $uƃ# D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$<t0h# tuR:t!jуh# tiE$Sh# uj(ŋ$,tIEj |$WPx WtE@E$L$1E^_[]t$t@ϐUSWVP[Öl$UxNjx# $tOs;1҉v# ljhx# $uƃ# D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$Lt0p# tuR:t!jуp# tiE$Sp# uj( ŋ$,tIEj |$WPv WĈtE@E$L$1E^_[]t$Ĉt@ϐUSWV[çt$|$ ȈtЋd# t61=tDtPǃd# D$L$ƃ|# t# t?1=tDtPSǃt# D$L$ƃ# ǃh# ȈD$ 1^_[]ÐUSWV[×t$|$ ̈tЋl# t61tDtPǃl# D$L$ƃ# x# t?1tDtPCǃx# D$L$ƃ# ǃp# ̈ĈD$ 1^_[]ffffffUSWV[Á$tA$1uhBƅtcD$E/$tt$$9ux/Ĕ^_[]z|?$9u/X|H|>8|?USWV[t$tD$tdPVxaa1ɐ΍,?UQt&UPy.w{8"tV {1^_[]ffffUSWV['t$V{# P# ƃ# d tj~V:u^tVtDi@u\uRDQ@u말:u~u'# t Pǃ# ǃ# 1vz ^_[]ÐUSWVT$t$L$~ 9tS1tT:u>8ut}Y8uuuȀ@t:utȀ:u 1y@t^_[]ÐSP[yL$ jt$jt$ [ÐUSWVP[A$p$L T$8L$4|$ $h$dʼn\$u# tu$l|$th8|$t:|9v,t:t|u싌$lhS$ $L$1xjjjUPk|$` PQhl$XUٰjjjh@Uŀjh@6L D$1l$t$(1ɍD$L1Ë$L$AD$$Љ|$L9rB19r0T$\$hWt$蠜 ƅ4LT$< u|$tT$$$1t$#tT$$l$t ߍX8؉t*s:j|a;$v<t:t|u싌$l덋$$$L$t1<9< t+< t'#<:t <\ut111;T$l$ \$$L$T$$L$)\$QPT$)ʼnl$‰$L$\$$l$ '|$t t$t$(D$l$tEFH4$DD$\$t$(l$L$T$Ј$pL$T$D$$1L$,$t$(l$D$֊<:u>tuk{D$X؊6U8u Xuuu@=uUt @hƀ:t FuFT$L\$t$$Ut$t$4-\$,L$Lt&]u%F:D$L$,()D$ tD$)T$ D$t:u)ʀ| :D$@t:\$L$ ыD$)9L$ |KT$<,$D$)\$D$PU))\$)D$Ɖ$T$<*)׉ڋ\$QVP Wt$DU t$ t$t$,/D$L$, \$D$T$l$1ҋ4$t PsЋT$ЋL$89T$v6)RV|$ u(VL8s|$ |$ L$41s04$ r0j# PwCt$PƤ# L$<$ 14$$lD$,P2r|$,\$D$0jD$HPWUU t t"t$D<u/t$,D$HȾ\$UU|$ <D$\$VqD$xWt_WVP  UUxx1ɊD$D$8T$D$48B\$W |$t$蛗UUq |$ ;$LutP^_[]`q0WVƃ|$\$t t$B4$C\$U4|$t\$t$\$t$, j')XL$ЈÐSWVL$T$ȉ֊t~8t1t0:t+|t&9vt:t |u^_[ÐSWV[|$t$# tPuǃ# ǃ# ƃ# ƃ# WV]^_[ÐS[ê# tPcuǃ# ǃ# ƃ# ƃ# 1[ÐUSWV[Q$,E$$# u# ȋ# u!BQ0蒫# # t1#  # PQ,t $D$uz1# WMWFtǃ# # H# @MBQPҪ# u<d1DN@u:t#t # 8|\# # # $ƃ# l$L$L$ $Dt\uU# P+uً# t:tuT$ T$WtfW#sǃ# ǃ# ƃ# ƃ# l$=ǃ# ƃ# ƃ# D$:l$Wrǃ# l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8&ƃw5# tP)rǃ# ǃ# ƃ# ƃ# GWqǃ# ǃ# ƃ# ƃ# ǃ# ƃ# ƃ# 1E;$u,^_[]À|\u ƃ# ƃ# +$USWV[ÔD$ l$HU:u0U8u't#ϐ7U8uuu@=uE<@}D$jd0ƃd$L$ƿd$M]d\u}M:ȉʀ0E€0 ȃE€0 ȃ,^u"M:t ts:tn[<$)FdPW>7xу¾2w/ :뷃벃뭱멱 륱 롱 띱 뙉,$)uj %FPUt L$$WU^_[]ÐUSWVP[vD$l$HU:u0U8u't#ϐ7U8uuu@=uE<@D$jdtWƃdNJD$ƹdEt#<:tu)FdPWu4)uh "FPWtL$ W^_[]ÐUSWVL$t$T$~ tB:u>8utމ}Z8uÃu뺀@#uZ@tỳ0uB 8/>9v$uP1Z FN8D} .~ wF F Pk>uWv 蔋 etŃ ~?:}|@uH)ƒVԍ F F BBQWPbY uvv  ?~?:uF:~t e  e8u eF,;8u e^_[]S[z0t$t$ [ffUSWV [=} F FEFUVzRu)ʃԉF:FJFx9u0Ru͉ N ;Nue^_[]#fUSWV0[ÏD$(}CԈPQ# t$M L$ML$f|$ L$T$|$QRj WP"uOt$ rF|$j WPH u0O L$FD$D$ PjL$Q9 79_t$} ur' tgM9uWM % h QPR}WuJ19r"y";L$(# jjP< PED$t$m L$ WDt^fxHuHPQ$3U q 3u uًI3Muˋpjt$VT uEPVuuW ;EsD$t$WKCL$%D$"T$ ;UwRPuU 1ɋt$;D$(u ȍe^_[]S[*R jPE# Yh PK:' [SV[# hVt$t$t$%t1^[fffSV0[æt$DD$@t2D$D$ D$HL$ $@D$1L$VBS븉l$WP3I11!$P INQV9l$VR`D$ $!VRL$W,T$9F|$L1 󫋼$$WL$PQT$ RPt$ tt! $u*G $~oQ $u D$uD$D$D$ D$~3D$HD$D$0D$VQ|$W.T$9jFT$L1 󫋼$$WRl$,UPt$ tt(QD$#D$$D$~kUD$1WPtWD$0k$uD$D$$D$ D$D$0D$~D$HD$WPF$D$D$,|$L$9sȐVP9rG$)X $u0u8L$$QP(; D$D$T$ -L$$QPy9 D$8u|$|$0$D$D$,D$W9D$l$T$jFT$L1 󫋼$$WRl$,UPt$,`tl$t%)D$ D$$D$l$~UBD$1WP$uD$D$$D$ D$~VNWPD)ЉFL$$QPߟ D$' T$ t 9l$D$D$,q|$cD$T$ u^?|$#L$,|$$L$0 VP]rD$T$ |$ GL$(D$<$Hʀ߀X$uD$VQ $uD$fxWt$,jUl?D$eWt$,jU< $u&@u(u-uu||$|$ |$fD$,T$ L$ )L$L$ m|$[|$$:|$<VP7rL$׋T$ c|$Q||$|$ D$T$ D$D$8׋T$ fD$9I^׋T$ L$Q׋T$ @݉T$ @L$D$,N @1|$8 D$,D$D;$u6D$,^_[]Í$9v׍HL$@VP#fffffffUSWV[|$l$ 8u~yjU6}0u LJE T$uGEt-U/E EE}0T$fE ʉ $7to9h};8%fE EMtY9vU8PuPEEi@9tgWV(Ɖ|$UPWV7 l$ E00L$HcMM0$^[ÐSVP[Èt$ Rt$t$pQt >0$^[ÐSVP[8D$$ Rt$t$t$pQ$t L>0$^[ÐSVP[t$ Rt$t$t$pQ$t =0$^[ÐSVP[ÈD$$ Rt$t$t$pQ(t =0$^[ÐSVP[8t$ Rt$t$t$pQ(t J=0$^[ÐSVP[ؗD$$ Rt$t$t$pQ4t <0$^[ÐSVP[Èt$ Rt$t$t$pQ4t <0$^[ÐUSWV[$|$,l$0t4?t|$u"$ Ot$VQjjjpROtt$(T$$E$ tϋUWVRt$0t$0PQHt ;0$^_[]ÐUSWV[t|$,t:t?t|$u"$ Ot$VQjjjpRtwtl$(T$$$ t0QWURt$0t$0PVHt 1;0$^_[]ÐSVP[ȕD$$ Rt$t$pQ8t :0$^[ÐSVP[xt$ Rt$t$pQ8t :0$^[fUSWV['t$l$SPQWv t"t$ VWz cWjjPdUPQWu t$lfffffffS[Újt$t$t$][fffffUSWV[dl$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]~USWV4[ߓ$Lŋ$0T$t$Lr8 |L$FjPlD$ tn<$l$jUJD$ tVD$D$ujU%t5L$D$$X$P@u&t 11l$1҉D$|$01 $H|$ E9rQ)tku߉ r L$0QPUWx9!xt19sPQhR輛|$ T$$$T+|$ ;$Lw|$t$(V7ǃjP,$t[D$1҉|$$1 |$$P@uT$L$(PWQt$Vt.V5t }D$11t$(1҅t}W1Ƀl$r9T$1ɐ<||||||| 9uօt&T$1ɋ,$<<9uT$T$,$D$$Pt*@?@[@ #$P '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@|$T$L$ l$L$T$ jWPjU1xL$ȋ;L$u^_[]USWV[G|$t$t V.-1 L$1jUWPV ^_[]ÐUSWV[|$ t$t V,1 L$T$jUWPV^_[]ÐUSWV[ç|$t$t W,1 1jUt$$PWy^_[]ÐS[Z L$1jPt$t$t$C[ÐS[ L$T$ jPt$ t$ t$ [ÐS[چ L$T$ t$Pt$ t$ t$ [ÐSWV[Ø|$t$WuGكs^_[!t_t$t%<0F0F ^_[ÐUSWV[|$ u ^_[]l$ t$Wt t- t(WttWPu뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[d|$0t$,Wt$@[D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv<$|$Dփ 6D$4)D$4@u \҉L$x MVt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ5$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/dDPg%0W$\P$D$4@uW>u#dDxuGws>4$$^_[]ËD$4  !rfUS [!E$D$D$D$PQLD$e[]fffffS[ځt$ t$ [ÐUSWV[á$$%= uRl$f4$Rƅt0e^_[]ÐUSWVP׉[Àr 1}(PqpD$tjD$0|$$tE(uhN@D$D$u`D$D$,t$>1fFH%F D$D$D$0t$T$j6,t5D$"D$<u G OJD$,L$T$T$D$,D$D$D$1D$HGW(|/uL$V7 }t!v$&;v$;v$輆V賆W5^_[]fffS [7jtPQt$ t$ I ,$ [ÐS [it$Pt$ t$ ,$ [ÐS[iL$T$ tP[ÐUSWV ׉[ÐiT$4Xtbq=t= T$4t=uD T$41hL$`L$\L$XL$ D$l$ L$RPQUWV=uD"ك@Tw"D# $T$сK1 $  ȉD$D$ ^_[]ÐS[zhL$T$ t$[ffffff̀rS[@h[̀rS[ h[ ̀rS[h[L$D$9tt P9u1fffffffS[úgt$ t$ v [ÐS[Úgt$ t$ V [ÐS[zgL$T$ tPt$ [ÐUSWV,T$[>gl$DD$@L$D$\$t?D$@|$"v/Z 1t$\$UP \$u+t-tD$D$@tN1D$D$@u90u4 @$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[p\[USWVT[T\L$pw| l$l1n |$h D$ʼnD$4\$Pg;D$,D$-؃D$ TJL$#l$ T$p $|$h&l$ щΉ $9wՐD$ ŋ|$ht$9v<\$VWT$|\$D$ ~L$p|$t51ҐD L9u֍*|$p)׃|$rσ|$r1Ґ ,, LllLLllLLllL9u4 D$(l$ ؃JL$$D$ l$t$T$pl$ $t$щʉ $9wՐD$ ƋT$;T$vՍ<\$RWT$|\$D$ ~L$p|$t51ҐL D9uՍ|$p)׃|$$rσ|$$r1Ґ l,LLllLLllLLllL9u2t$4l$,.MD$4t$, D$ L$8|$h\$PWT$||$ ?\$(ىL$0D$L$pID$u$ojUTƅtF PVW u$>*jU!t@ PVW 18t u $tD$ 81^_[]fff̀rS[J[ḃ̀rS[I[SWV [I|$D$ D$D$$0L$jjPWjQ81u9 u 01 ^_[fffffUSWV[TI|$ $D$l$$tt$L$T$(PVUWt$<t9tM $)?T 2"1^_[]USWV[H|$ t$$D$l$$D$T$(t$0PUWt$ $@ D$ D$DD$D$\$t$D$q P$j Vx$9jS9uBD$\$t$D$q P$j V$99u$@L$ \$فt$DPQ$j V$99urD$\$t$D$qP$j V?$91#9u$H*R )tȋL$ \$فt$DPQ$j V$99u$@L$ \$فt$DPQ$j VJ$9<#9u$9 9 $91$y L$ 9uD$L$\$7$D$DAD$HAD$LA D$PAD$TAD$XA D$dD$D\$Pt$_Ռt$.RPQjV$99u$9 9$Htȋ\$"t$DPQ$j V$9s9ub\$L$$$Wt$ $ƒ(\$"t$D$qP$j V$99uD$DD$D$DL$\$$PWt$ $8‹L$Dtȋ$;d$V$$xQkd)Ѝ4 kd(d6$z D$D ljNj\$Pt$!ƒ $\$މǍD$DPX!ƒ)tL$D8$9O 39u"$Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$PQ\$щkd)Ët$ Qkd)i{kd)Ɖfd\$L$D$9 9uL$Dh$9 9u1 t$l$u7y3$9a-B9B09<\$it$DRP$j V$9 9u1 „tÜ\$ \$$l$u2|$ y+ $9-A9tfA09t[ $it$DRP$j V^ $9\$D9u<$5L$$9 9u1fɋ\$hebf tƜ\$u7y3 $9-A9A09 $i|$DRP$j W9 $;$9$u䋄$$i$$$$\$\$P1|‹$1‹\$it$DRP$j V$9qc9uRHx1it$DQP$j V"$99u $L$ 1it$DQP$j V$99u $\$1ƍi|$DVP$j Wd$;$s.t/9$u苼$*$$ $W1$z 8-Є$$t9s u7lJ5\$]\$$L$ $<$Y\$t9u4$<$Ήƺųʉ kdk<)΍\$VP$j t$TV$$99u<$D$ ;D$pu t^_[]Ë\$USWV [T1t$ \$Pj 8uD$D$l$$tt$׋T$(PVUWt$<t9t+L$)T "1$P ^_[]ÐUSWV [Ô0t$ \$P 8D$D$l$$D$T$(t$0PUVt$<t9tpL$)aT T"1$P# ^_[]fffSV[/L$D$T$ y9RVQPi6Q4Pr 1^[ÐS[z/D$y%9' PQj@R  ' j@4R  ' [fUSWVX/L$tCt$81ېDWl$llof9u1t9u1)^_[]fffffS[ê.t$ ht$ [ffffffK̀rS[p.[USWV [T.t$ D$P7$ |S_ NL$ 9t6ʉi)iAi ˍ $$,4L$(T$ o9s9s}$?9r|t$^uA$t209r9r։,t$^_[]É݃t209r9r֋9s9r9r봐USWV[ä,|$8D$P3t)1ҋP1L$4T$0 s7ǃǃ ǃ$A(Q1@Չt$sAs(11ҁ¹)҃L$  $$‹D$4HL$|\$(ÉhT$r1L9t;Ⱥ_ Nʉi)iAi ō 뺋D$0 $Dl$S9w9\$rыT$ҍ4)tG109r9r΋9s9r9r봋9t$r9rʉ艃,)D$ L$4t$^_[]ÐUSWV[*t$.̉׋D$)ō$Pt)1ҋP  $t1,(4$D$^_[]ÐUSWVP[6)WtI,010($9r$9r$,i0mNA900W^^_[]ÐS[Ú(t$t$t$ [ÐS[j(t$[ffS[J(D$@ @@@@@@D@0@h jP [ÐUSWV['' ) ? EGGjWE8jPEǀPǀTǀX`Xupǃ' WFŋ@~*uf~ XEuh?25l$|$h @ h$Ɓ| D$ 1u0dždžjPE08jPE0ǀPǀTǀXD$ X`zD$ $ȋ|$F FFFFFFDF0@h jP课 W^_[]E1␐USWV[g%) ? EGGjWE8jPLEǀPǀTǀX`Xupǃ' ^_[]ÐUSWV[ä$j0ZƐ+w?uiƸPJ0l$x pxkX$, 1׉j0DžDžjP~G08jP)G0ǀPǀTǀXX`l$$1E^_[]ÐS[Ê#j [fffUSWV[\#$j(j*9$hj9ljt$V0E ut1^_[WV9dtGPVgtۍGPVdtʍG PVdtWVcVZD$ L$qtu0qwY^ËQ tu*I IH^QPI;@P^@p^^ QPI H^ ^ ^ ^S\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ffìrS[`[v̀rS[@[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWVL$D$utdT$pא?t 8uلt&~Ր}8t ut 1119^_[]1fUSWV4[$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOFRl$0PQjUU$\9ȋ$QU$`蝩 FfN3QPR$`U$`^1Ʌ9$Fx$P$T)<PURQ*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D L3QPR$`$`gl$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$ ]PQ|$W$`Ut;$Tg$P$T)D$D }P|$Wt$L$QRL$)D$D Pt$t$t$RL$)D$D Pt$t$t$RPL$)D$D Pt$t$t$RL$r)D$hD Pt$t$t$RL$9)D$/DPt$t$t$RL$)D$DPt$t$t$Wp19D$F$PED$1$1 D$ }D$]D$׋D$ tD$ $ 1QPt$t$UH)D$>Ń19t$un 1f$PL$$T)fv fD$ FVQURt$pL$ ;$T$_T$0L$RQPWst(8WT$\9vpD$0P_;fǍR$0PQhWW $\9v QW$`迣 %1QW$`襣 D$0P(_Fl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF M u)L$ QPtP芩Ņ$y+8ERT$ PQhR2=$w*;$(v.L$ UQP艝 $$1%D$1;$ u ^_[]taffUSWV[$8$E UPZE 1Ҩk4$$4$0$,uRUW-VUGXt9~uۋ$0tPv u*ft#Q&$4ƃ1ҁD$D$ƉffD$D$hVQPrt$D$L$ T$PQVRug9t$D$ ff9|$$0$4t*G9D$D$u_GRQP uEt$WVUZ24$1E u U>V;$uЁ^_[]1ҋ4$E t_fffffff̀rS[[USWVP[P\xT$1tJT$ t4i t}um9ujqt$$VF 1$11P`a蘦8^_[]ffffffSWV[(|$jWeG=tjWX^_[fffffffXL$r(ÐSWV[èt$VtF~tP^_[ÐUSWV[Q$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ $D$8D$4D$0D$,D$(D$$D$ D$$\$$b$xuxuxu x$ $\$P U$1t2\$WtGotP܋\$$$0$;$ЁĨ^_[]$k$@$QC$FD$8FD$4FD$0FD$,F D$(NL$$vt$ T$t9t5T$ t tu#u u$ D$ D$D$\$$PWti$t$tf1ۺD$11 ߉D$ŋ6t>N tFtI1л t̉1$1D$\$ \$t$\D$ L$8L$hL$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$T$ T$PL$LuD$ $L$$Pj$rD$hD$8D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$LL$PL$ D$\$D$8D$hD$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$L$ L$PD$L$h\$ N3D$hD$8D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$T$P1T$ T$LT$ t1#D$! ttD$ 9tFtll$$V9t$(\$[$9މuL$ ȅt$utT$$ۋ\$$u <$t$T$(oL$$$PjL$ 1T$FM@t$Fu \$ =<$3\$ t$iEjjPfY x P8wL$$\$$PjND$ 1ҋL$T$xuxl$\$j%$U'kD$URXL$)L$D$H$PUl$U$4$\$t$H*$yL$xugl$D$$u&JB$L$$\$$PRUJBD$L$t HH ɉH^[ÐS[*A<tY<uyYQuy uyuyt{wqhQ)t9uGIuQs9l0n$l$t$WM\$t$(^_[]ÐUSWV\[ÔD$PHD$x8hD$8D$4D$0D$,D$(D$$D$ D$El$ |$uHt$WT$RT$RPWQV&t,t$D$t$D$EML$@ML$XML$TML$PML$LM L$HML$DD$Ut$Ph$gWOT$$pJ{8S9=1t$p|$tu0D$.$p|$!L$, !uD$1B ‹/tу9 D$D$;t$(4$zǃ=r8t/$|8.u%$WhWPVs?Ƅ3& .3 D$ $%1օҋ $4;t$(l$4D$@D$ D$D$D$0D$dD$ 1l$ T$$!)D$Pl$UVt$4Q|.ƋD$,fxxt$ T$<.PH2fD$.P42fD$.P 2 f|$fD$f|$"D$< $$!t$hUVt$4Q-D$D$,fxxUT$<UsƋD$9L$L$PUl$Uoi 1l$4։t$1t$ $T$ul$;l$(gt$uQT$$%T$uD$ftAft;t$t$`D$9ft$tf!fl$ Ut$8V~#hj$Pf DŽ$DŽ$DŽ$DŽ$UVP$Pj%Ffwhj$P5f DŽ$DŽ$DŽ$DŽ$jI$%>ID$V1IPt$Ut$LQ$Pj%T$8L$D$D$1t$ 3D$fuf|$tD$D$1f $T$D$Df|$8D$D$1V/fD$EP.fD$EP.fD$h$!Pl$ Ut$4V*ƋD$,fx$!xUR+Up=hL$L$l$L$L$t$hRQD$ 9fD$T$ l$<L$L$0t9 ~1 1t$ T$0f|$u 8u|$<tƃu11L$ T$0T$99u|$< t$l$9~Umo4(l$4$%JL$HJL$`JL$\JL$XJL$TJ L$PJL$LD$Df|$tD$ D$HtD$ jPŅE ET$U UL$\ML$TML$HML$DML$LML$PM L$XML$`MEU1L$ MM!f|$tЍ$Qt$Pb 1l$ ML$ t T$ ՋRul$ ȋL$L$|$ xxt$1ҋl$UL$)z $T$0Vu ypE T$ D$$@@DŽ$DŽ$DŽ$DŽ$͍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$0OtXL$ A"NfFt1f΋Qt֋L$ tѐt$ t$ UL$t $D$@T$4tC$~|$$u$%ttPx&F=*$!Aff*01|$$;$%u#%^_[]QK)Z$9WVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVT[RD$4D$8D$<D$@D$DD$HD$LD$PD$D$4T$$j Q7tǃt$U5|$L$ t tt,Džtt$PuϋND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$ PD$PjU|$t"D$ $L$k|$ tމ mt)Ett$#Eސt$xu뎃|$t D$PT^_[]1USWV Չ[PL$8D$T$4t$@j1҅Ft 1Ƀt xut$<$΋ D$ PUl1!2PU|D$@6<$t 9t$Aƃ jP[{ǃ GO ɉOt$NONOVWNON O NONOGMOL$OO!E uL$QPZ\ T$4t$@jVs1;L$ QUP 1D$@6<$t 9t$Aƃ jPkǃ GO ɉOt$NONOVWNON O NONOGMOL$OO!E uL$QPj[ T$4t$@jftLtt$<!GtI@u!tt$< Gt&@uD$881ҋ<$;D$uEЃ ^_[]ýWtGwtP܋<$USWV([1$H$$E UPM 1$<UP4$!U*m$DUtڋ$D0W[ft4$DptPW9ftu뗐$@tP$Hp fj$DWeH1$@T$t.$@dT$D$1L$D$=wu4$T$$L$%D$&hRWP։L$!4&t$$DPX D$L$T$ t$$QRPVu$t?14$E t 4$1E u U>;$$(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$T$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$芑T$L$ ut$t$$LUvffffD$@@#Eg@@ܺ@ vT2ÐUSWV[Խl$$|$G? OW@)19w_WT$Vt$$PL$ V T$]$19s'D$ 0L$>@9r|$1T$ )URPV^_[]ÐUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [t|$$D$O $GD$?17l$ )ȃ8PQWH jPW: EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWM ;D$u ^_[]fffSP[ÉPt$1Ƀ $ȃ[ÐUSWV$YTt$8D$D$ L$d1DKNl$\$1Ҁ0u.N K $4K8D$T$ 1FfffffffUSWV0[Ô|$jjWjjVEt$EjjWPjVD$\$l$1$D$ 119ozuB<tR<uBtՉ t z $D$ D$ 4(ftf9z}B |$t$r t>t 1 tmt t.t |$ ި \$t>t l$ l$|$$xt$\$l$t t$ t$v$1D$ T$Dt$ $u U<VBWjPR< |$t$$|$ 1ɉt$!1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W < Pt$l$U; t l$ /D$$<F\$hPW; |$ l$(D$D$ l$L$ff9NF L$\$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$D$P$t\$|$WUR:T$ \$WjRF:T$ |$L$F t\l$Et Njl$U \$Wt$T$RG: E xu D$L$ H$l$L$~ xl$>Et Njl$U\$WQRT$ 9T$ L$E ED$\$l$PU趼1t$U袼D$L$$9sD$DQ耼1ɉȃ0^_[]D$D\$S[t$6[ffUSWV|[ğj$j1tGljPW:#t)l$XD$\|+WjD Wj1|^_[]jjWjjUj#Wjt҃cD$ l$<$D$ƅuUW_뚐USWV [|$$(rl$ NBCD3EB 3M t D1 ^_[]Ë|$,j<膪Ɖ8D$0FMNUV } ~$E$F(L$w F,w F, F,$wF-T$$ T$$w F- F-nV U(V|$Ǎ<((1t)lj~$BF9r\9rXD$9rPl$$9wHҋ|$1Ѻtr1ҁD$sD$rBV輹s@sщʉѺ u׋ $)jQWjF0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPjF4~F:F:t1F;pS[t$t$f[ÐD$@ ÐSWV[T$|$9W v#wG,ʃt$<u0 Ћ0@L  )r;Gv@D$Ot$1^_[ÐUSWV[4t$,~$ED$\$Pv(t$L$<Et$81^_[]SV[it$ tv vvЃ V蠵^[fffffffUSWVX$$|$(\$$t$ D$y7 \y7y7D$PX) 1ȍ<)1׍48) 1ލ7)Љ 1)lj1<)148)1э)Љ 1)NjD$1 u|$(t$ 1y7y7D$PX) 1ȍ4)1֍0)Ӊ 1ڍ<) 1Ǎ:)Ɖ14)1֍ 0)ω1)Љ 1)ƋD$1 u|$(t$ y7 r3t t uF F FÉPw/$ FFFF‰y7y7 rƋ$ #FVjrQƋ$#FPwH<$FFF|$(tƋ$,#) 1ȍ )ʉ1э)Ӊ 1ڍ4) 1ƍ2)1ȍ )ʉ1э)։14) 1ƍ2)w1Ήw^_[]ffffffS[j jt$ [ÐUSWV|[ĕ$$$T$LT$L$$Dal$L D$0``D$4 󥋼$D$0 =`l$TD$XD$DD$ZD$@D$\D$<D$^D$8`t1 l$H L$4,`otXǁ t>Q 9quJ :$D$D$4$u{#t$"D$<$L$HL$D$ l$D$$$ku$`$ttl$$;G%`t %)l$ E$D$D$pt$L D$0^t"l$ N$D$D$0t$L D$0v^t"l$ R$D$D$t$L D$06^t"l$ V$D$D$t$L D$0]t"l$ Z$D$D$pt$L D$0]t"l$ ^$D$D$0t$L D$0v]t"l$ b$D$D$t$L D$06]t"l$ f$D$D$t$L D$0\$t"l$ j$D$D$i`t,l|$4t&A$L$DL$ D$nD$,$t,hrkƁ Ot yI u"D$4$D$L$@L$ D$wl$$$.rykƁ Ot yI u"D$4$D$EL$$6$.%&%X$$%^_[ÐSWV[Ø|$ZƁYjVW[ yRWPV ^_[ÐUSWV4[D$D$0D$IuD$HL$j.QPj>%T$PQj.jR^$tEL$PQVR D.0;D$0u 4^_[]3USWV([ät$L$-uAD$QD$ +tD$ +u AD$Qdx<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVXy1D$d8D_L$u D$(1ˍA^D_uk*… )хt 1Ҁ|0.щ^_[]ÐUSWV[ïq}LƁ<$D$P lHHPP%0ppp RQWV e^_[]ÐUSWVP[6ql$}fPUH%7PUHPUHPUHPU~HPUfHmPUNH$jPUTA 1uRdMDHt?j PU~ 8u$8 L$A.&L$0t9^_[]ÐUSWVP[æol$4lPU9GtxF u6+jPU7@ 1u[dMDHtHj PU} h8u $8 6D$t8^_[]fffffffSWV[n|$t$jWGHO~;G~ t H WRRjW^_[ÐSWV[XnT$L$Bpr~ ;B~ t 2~: RQxR^_[ÐSWV[n|$(D$$uU$PD$D$D$D$ jWG0u ǀD$PWjW^_[ffSWV[xmlGHt $Jt$ @t $A$?t/t5Gt9E4'P$ +Pu0 E0M0)u40E HM @PWjdj$+Pu>9E4'P$ +Pu0 E0M0)u40E E PE PWjdj$+P>9E4+'P$ +Pu0g E0)u4M00M AE 9 SL$Pt$ jdj$+P=9E4&ƃP$ +Pu0 E0M0)u40E E uEE ;D$ }0L$+\$$E0 E0E4HM0@E ;D$ T$ E4PW'1&E E ;D$ sɃ}4w\$D&}4u0E WVu,P &%}4%E0 E0HM0E4@MU \$WVu,E P}}$u E +PQjdj$+W:<9E4O%PWu0 E0M0)u400 M t$ )΍VUUUЃ=T$XPRVQ@0}4\$$ʋE0f (E0E4HM0@2+D$E HM 8HM @D$QE t$T$+t$Pjdj$+P;9E4-$Ƌ\$P$ +Pu0e\$ E0)u4M00twE SL$\$Pt$ jdj$+P:\$9E4#Ƌ\$P$ +Pu0\$ E0M0)u40E E uE4w#t$M0fA  QU0E4A|$XVWt$u .F9E4\$##VWu0h E0)u4M00L$M M E4;L$ s]}0u \$"M0fA  QU0E4AMU E4PWu,V""E4L$ 9M r\$"}$ u4u0u jP}$w u 薽E +PQjdj$+W99E4("PWu0k E0M0)u40}4u0E MU }$ E Y+PQjdj$+W89E4!PWu0 E0M0)u40E  E ֍;T$  D$dD$`D$\D$X)XVPQT$ D$Xu4u0Pj}0Wlj}0)E4u u |$C;D$ \$ }4 E0 E0HM0E4@ E4u0} PVu,W  }4 E0 E0HM0E4@E E \$P誻M ȃE P蓻E E u0P~"PQV E M E4u0T$ PV!  E CuPjdj$+W6v }$ u4u0u j脗u0VƉu0)E4E HM @+PQjdj$+WW69E4lPWu0 E0M0)u40E E ;D$ M11 }$< u4u0u ju0VƉu0)E4I \$u +E E \$PM QU IT$S+|$0\$QPVRj(jW5\$ 9E4PWu0 E0M0)u40M t$ )΍VUUUЃ= E48M0ArintAto pA ong Aoo lArd trecoM0E4I }4u0E WVu,P#}4E0 E0HM0E4@MU \$WVu,E P}4E0@ f (E0HM0E4@E L$ )p\$P衸E M4;U0B  ru0M4B\$8PQjdj$+P39E4Ƌ\$P$ +Pu01 E0 0M0)u40}4E0D$nr3)M0 M0E4QU0A_}4sڋ\$E4u0} PVu,WgM ;L$  \$AE AE IL$1$+E ;|$8t1ɉT$|$਀t^L$ P3dPQjdjV29E4PWu0 E0M0)u40T$|$L$lE 8D$E ;D$  |$XWu u$u, E4u0} PVu,Wy:E L$ )o |$ 1ҋ\$dL$$+р਀tJR$Pt$ jdjV19E4PQu0 E0M0)u409T$ ыE \$냃}$\$u 褵E E \$P苵E L$+|$X\$PVQj2jW1\$9E4PWu0V E0)u4M00M u4}0T$ VW~\$E }4E0 E0E4HM0@M T$ VW7\$E }4vE0 E0E4HM0@M T$ VWQ\$TE }4/E0 E0HM0E4@E MU VWu,Pz}$E +PWjdj$+P/9E4P$ +Pu0  E0M0)u40E HM @PWjdj$+Pg/9E4|P$ +Pu0 E0M0)u40E E ;D$ L$ SL$\$Pt$ jdj$+W.9E4 PWu0N E0M0)u40E E ;D$ r(E4u0} PVu,W}4E0 E0HM0E4@\$u ڲE P9 PWjdj$+PA.9E4VP$ +Pu0 E0M0)u40u vE PIPWjdj$+P-9E4P$ +Pu04 E0M0)u40u E E PE E PޱE +PWVQjdj$ +PY-m|$XWu WK9E4PPWu0 E0M0)u40|}$9u XE E PCE E P.E +T$XPWVQj2jR,9E4PWu0 E0M0)u40E4u0} MU PVu,W}$E H*}$rb\$]T$XPRVQ x?D$ }4\$E0f (E0E4HM0@2+ \$+D$ +E }$t ,VQPRjdj$ +W+9E4PWu0 E0)u4M00t$ 9u RD$(Z&D$t$(jdjW0+M )Ήt$|D$<+t$~;D$ƃ\$T$t$PRWo |$}\$5\$-E 8\$Pt$V8\$ ƃ9|$u؍$+)9u4VPu0 E0)u4 0M00\$}4mE0)E0HM0E4@}4E0.sAD$.)M0 M0E4QU0A~*}4sf E0HM0E4@ߋ\$gOPjdj$+P)4+D$$D$} \$dD$1҃|$|tL$ L$D$$4+1 D9T$t> ..x\$DK.ẗ$Lx̋D$DH.t뻋\$/֋\$L$ t xL$DA.t.$+)9u4VWu0' E0 0M0)u40D$E E t$ 9PM0+L$NjE ;D$ HM  ɃtڄyL$u2E4e׋M0A  QU0E4A D$Y+T$RPjdjV(9E4PWu0Z E0)u4M00D$T$L$Z*D$v+$ +rz4w|$7v+$ +r|$7v+$ +rz4|$7v+$+Rt$v+$+2|$7v+$+2z4|$7v+$ +r|$7v+$ +Rt$v+$ +DŽ$ +====2|$7v+$+2z4|$7v+$ +r|$7v+$ +rz t$>v+$ +Rt$Vv+$ +Ƅ$+=fDŽ$ +==2|$7v+$+2z4|$7v+$ +r|$7v+$ +rz t$>v+$ +rz4w|$7v+$ +r|$7v+$ +Rt$v+$+Ƅ$+=U4{ u0$+$ +^>~}0U4FU MU FD$E M4U0B  ru0M4B\$QVP2 u0Ɖu0}4)lj}4>r3)E0 E0E4PU0@+}4sڋ\$}4u0H;T$ \$BE D$BE JL$d$D$T$E D$щT$;T$L$t1਀t\D$T$PdPQjdj$+Wy9E4PWu0 E0M0)u40T$dE L$D$E ;D$ \$u4u0Pj|u0V )E4u0E X\$u4u0Pj|u0V)E4u0E )E4u0} MU \$PVu,WM ;L$ t$ )΍VUUUЃ=rE4\$8kT$X\$PRVQD$c|$|/}4\$6E0f (E0E4HM0@2+|$[D$raT$$\H @>rET$$H @>rT$$"H @+<$+D$$L$D$ ^_[]fffffffY 5T$4D$#`dÐUSWV[4|$ l$t$~Jt$~2UVx(ƃ|$tލF9wȉ9v(+t$^_[]ÐUSWVP[F4|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }(^_[]E ffGftC,$RWגxǃ9w,$)xD$ hHGftf,$RW腒f 8 9Xσ95,$)5|$ oGwtc,$RW 8 9σ9,$)|$ oGwtc,$RW衑 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [1|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$. ^_[]Ð~34$UOx(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0Quus]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5 (LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[4/|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.^_[]Ð~34$U迍x(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu苛U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0}(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWVX,T$4|$0$D$ D$11ɐq;t$<_T$WT$t$,$$,?t$8$,D?‹T$$,DD$?$,l$Dc D$fD$Bу1T$r8Ѓ17T4T7T4T7T4T7T49ut41Ґ9uM;L$<T$D$0 4$$,|$|$l$8T=$,T5=|$tT$$$,D$808=;L$0}V xn^c|$8XD$4D$~D$dD$‰<wsBքu1L$ˋ|$?|$ $LOL$t)L$<$\{<$|$ LOL$L$D$<$1$ r $L$t|?TWT$T$ Dzt]$؉ÍF$и rT$ӋD$T$<$t%D$ЉT$;T$8D$^_[]ÉUSWV[&|$t$$ u f0x<$|$Vt$~p$ƃ|$ 19tG,00r7 $ r7jB؃u;$}B.뵉ED$^_[]fX%I ÐS[%I ht$ P [ffffÐ1ÐX%K ffffffUSWVX[d%l$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMn L$"jWRPj2jQŃ9D$"PD$tPD$pD$)D$iǓ$))ŅtUT$ T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ |$"jHQPj2jWH9W|$WD$D$lj|$)ƋT$ D$kD$pd txҋ9|Wy>TWPڋD$+D$pyffffUSWV[G"l$U6ƃ;D$vs(`|$UW[1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[á!$$$hWP! x3l$hU$( xUW1Ʌ;$u ȁ^_[]~ffSVP[!L$t$D$T$ $xRQVPx9raRQP) ^[USWV[÷ |$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[7 |$t$l$tt$$PW%tO^_[]VW t W LJWVUF ͐SWV[øt$|$jW1Ƀ PVW ^_[ÐUSWV[w|$tt$O#PW$t0l$VW/ t WRLJWVUM ^_[]ÐSWV[t$t5|$r#u#jV#tjV$F1^_[S[ÚD$tL$ ttu H1[[ÐSWV[Ht$t_|$G?wSh,>1RjV"t3jVU# tۃtjV"t jV/#%^_[ÐSWV[øt$tAjVq"t2|$jV"wsf~ 1^_[ffS[JL$T$ tP[ÐUSWVT$0L$@[uD$\VZ[D$ Pǃ\$D$t6\=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$H.$@.$<.$8.$D$D$D$\$$|$,Vt$8PQRW9ǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$hL$ :u`ȊiD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\J$W$PQ%\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$hD$D$(D$ л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$-\$:t$,PV聩D D$,\$=bPV`uD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$H L$8@ t$ D$P跱uQD$L$  \$QPޣك-`؋|$8tWA\$t$ t$蕣wًD$݀h-r{|$tD$t fD$zl$z߼$Xl$t$X$DŽ$ ߬$u{*1T$89T$|$DŽ$߬$|$tDD$!=w2ݜ$$$)$$݄$\$ \$P*D$ Ƀ|$8|$u <$'${|$8؋D$Ɓ\$`|$ $L$T|$D$\$P\$PD$L$$ݜ$$|D$TЁ uD$$|$ |$D$݀p-r^|$rD$r fD$xl$x߼$Pl$r$Pt$DŽ$߬$|$8t\$`ݜ$$$)$$݄$),$$$PD$|$ :\$`\$L\$PID$L$$ݜ$$$|$D$`9u~|$pT$p fT$vl$v۔$l$p$$ڤ$|$8u% u D$݀-L$݁x-݁-؋\$WPt$Dt$ 8t$,t$vS$tR6D$D$ـw|$؋t$MD$D$ D$ۉ؃t)t$4$ݔ$$D$$~iމjL$L$`.t $ݔ$$L$$ʉ)كD$(NNONt$@\$Lt$(|$L$lt\$(t$HԉT$T$ T$@\$Nt$,PV芞tQD$,8("$@\$L.PQVݎ  $DD$$@$D$@D$,1ɋT$01؁T$D$ $$ݜ$`$dD$D$ D$|؁|rMD$$)ɋT$0t؋t$()ƋL$ $1 PD$gD$$,jK$6D$p|$ D$D$ D$ |$ D$|$ D$D$ D$ |$ D$ D$8 $t$DD$5%=%D$xu x\$jP谧t$ D$P'D$xu x$%|$8t$|$tB#D$=w2ݜ$$$)$$݄$\$8\$PoD$8$$@|$ D$|$83i4$k(ٿr1Ƀ|$ 9.=t$|$ ؉|$ t$؋D$Dt|$ tD$$|$ D$$\$t6WZt$Nt$ BV9t$-Ū"T$0L$4tD$,$t؍e^_[]ùk)ًD$$ $u=t$|$ ظ#D$|$==ppL$TtJM؋t$|$8t$<$؋D$t$D$X$t$|$ I\$PX|$8|$D$%jF)$DŽ$܌$K(T$$ D$$|$D\$b$V|$t4D$%jw#F)$DŽ$܌$,$$uIzGD$D$$&D$xT$$t$|$ ؋\$Wۛt$ϛt$ ÛV躛t$讛|$$؏-$ݜ$H$LT$0L$4QL$4T$0"7|$t%=s t$؋\$jt$ۢD$t/\$t$ t$Oك-~D$t$YS[L$T$ t$[ffffff̀ffff̀rS[[̀rS[ð[̀rS[Ð[̀rS[p[USWV[T|$l$ ED$t@U1D$t#:D$ut$UWS u1^_[]fffffUSWV[|$l$URWG9U6W%M;OuLtF&t;tu5t;tu+t;tu!tf;tutf;4u u1^_[]ÍW/J//PQjCR v/J//PQjDRt /J//PQjERX S[D$`QjpPjZ[ÐSWV[Øt$V'uE|$WuO;r$vtuO9Nr w1^_[Í///PQjeR///PQjfRSV[t$t$ u1 ^[ÐUSWVZ´t$0~: $D$D$D$D$D$ D$1$ ك˃>N.D$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[J|$  臢 >L$s*D$@--tr0twPu@-G[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[hD$Hr蝡 %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[ùt$ >t0V裠 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[D$ L$t9u[Ín0`00PQjpR9S[êD$ #L$t9u[Ín0`00PQjpRD$t&L$tu1u 1tÐS[L$ D$Qss)ǀ[Ãuu ǀ[Ín0`00PQjpR5S[êD$tL$ t 1[Ҟ[ffUSWV[gj C1tQ@@jjPЗ v(o8te(WiU(^_[]ÐSWVP[|$OGQ9u0$jQP\ 08t  G $GT$pw1^_[ÐSWV[ht$tRtC|$t3~t-0~r4;~rPoVf^_[ÐUSWVP[D$H $t.(1tt$V蒝t 9<$u1^_[]ÐUSWVP[ÖT$J $Ћ*1|t$W2t94$u|$ l$tWE$F;$} $)Qtu<|uprP $كU|u!Ǹ1>u5~u/~ -t/9uqL$Dl$@|$<|$ l$L$L$HL$`2,$Pl$0l$PRVQt$t$t$ D$(P*k 1t81L$H^_[]Ã~MF @USWV[Á$0$8 $ $L$HJ @BLt$FNV62l$VRQPWhU׿hzōt$hWj jVPY‰$0u uuuVj PWt$}w$0+i@ ;A7T$ B@$0p t$ Vz $0xD$@ {$0;h/t$v|$$2D$)L$L)ʃQRt$ PW~~/9s)u̍2L$hPQ: =t$0@ W$0@  $ ;$^_[]WU蜍$0@ V|$0@ tt눋GD$fFFfGD$GD$ @@ t$$0@ )<USWV@[TD$\L$<(pO uO Pt"D$j.PUVt t22D$$O D$PσL$QRPD$Pt$U $tQL$TA 'l$TU4$tɋ;L$4$^D$L'11UEV<(1(^_[]Ë$D$ L$@T$HD$A D$As |$L4$먋D$DA4$D$ )D$ )rD$D$DD$AD$9v |$Lgt$t$t$PD$PVΉT$t FL$N FL$)L$@WL$ƃ)]L$D$ D$D$D$VWP|$Lt$$9ubft$ ff $L\$Vt$P1t$3\2Wt$@Pj%돍Ef$w rM|$jPD$D$DpOUeOPVt$Lt$HQj%bT$L$ t$|$$1ˋD$l$9T$0|$V$PuPt\2VuPj%T$09U |$$f|$Du D$8x|$,t$\$t$0Wt$t$t$00Ƹ1$Hfxx\$t$ x1gD$;D$$|$,t$L$(D$89r3l$8(\$PR l$8L$(+ $‰$ȃL$(L$L$t$u\$VJvT$4ƃt$ t$l$D$ )D$ ;D$4D$@$ 9s'D$@|$0WUQLj 1l$_l$0l$+D$xzD$xil$ (\$Uu=!Ńl$ 1$D$D$t$$|$,L$ t$\$R1\$ t$$ t$$ˉ\$|$,t$D$(D$@$Hd|$,$D$11T$ ;t$,tZT$ :/1$Hl!9ht 9uf|tP݅uT$ tDtN9|1뚅tb;l$,}\M ;l$,tK~TlPΐ|tLf9~fTtLf|tN멋t$$L}t1L$W\$t$a*\$?USWVX[ÿ$l>Wt1T$ T$G j(b¸D$$D$ D$(D$$1ɉ|$ D$ l$L$Pt$ VV%ǃt$Vt$ t=ꐐ< t쐐D$$D$ t$l < t< t򍃍fPW$t1ɀ8 L$L$D$D$L$ t WP#qtT$$9s=ȉ\<$.u)$T$rD$09wL$s>$t$$;L$0u?4^_[]$D$09uڋD$,T$PB D$(BD$ L$$J$_USWV Xd8D_u$$ ^_[]ÉD$T$ T$0u+Y t E<)׋$$x`<$1L$D$ D$}T$uUc6$T$E ulD$;tM 5^E=t܉t$L$8QP`<t$ T$u#D$@=u$ELM D$|$uIt$MtȍL$8QP<L$t$$D$$ʉD$|$ T$4t-E uEjjjuT$ $!у‹4$$t$E0D$ E0D$D$ u?|UPuTE)΋M0E0D$ D$ L$tKE<)‰T$Ή4$Et$ $UE8T$,))Ɖt$ƃE<$D$(14$T$uED$,))t$ $E$D$ D$(E D$$ T$4uPD$+D$D$0|>$0D$9D$}&D$,L$0ȉE)Ήu|$(T$$21+ELt$!!jRVuT$ !ƒt`EME0MtU@9tQD$ e ߋD$)D$Ubu E+D$U/tjU8Ĵ^_[]Wt$t$ uT$ !ƒtˋE0tU@9t Q[E0EEEe jU:81뙍E@L$ 9D$T$$tQE0U fU 뼋L$MEfUSWV [Ät$4D$@u38HL$@D$\$jV51D$D$D$E1;|$,v`\1WtztLEtD$uWj蝿D$$)Љ$D$PD$$tt)ȉ$  $EWt$UP $E3RQUP x$EWQUP t"$tWE RQUP 1D$u7}u1u-WD$$1!34PQd  ^_[]ÐS[jD$ hPPt$[ÐUSWVP[6|$t$t!t2ujFQVtZ$$FQVPt=T$$D$ Jt?9:t t j9zuL$(t PVу1^_[]ÐUSWV [ÔD$$L$ 8͋1t1uOWfL<$1t0t/ƉD$EL$QUPt-EL$QUt$1;t$(MtQЃ1 $u"Pj譼D$$ $t|փt )ƋEtot`t$ERt$UP |$t,M [14$D$$ ^_[]Ét$ERt$UP t$|$tϋM 3t$PU 1u%}uDžu4$ D$$1눉넍,34PQi1gS[jh(#t$t$ [ÐUSWV[4|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[Ä|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[ԣ|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[$|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[t|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[ġ|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]fffffSV[t$t$Vt$t$t$~>.u^[ÐS[ڠt$t$t$t$t$:[ÐSV[ét$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[Êt$ t$ [ÐS[jD$t$ P[ÐS[:t$[ÐS[t$Z[ffY$ÐXۜL$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVXT$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$>PQV ƍGэ}L$,|$ U(!Ћ$/5W|$ƀހ:w7$83w;t$b\Gn߃^rxo;l$1\,, $*$4wkdT$Ɖ*t$i $*$4wi (Ћ4$$4Wm;|$Yȃ|$ U(!Ћ$>PQV xuD$ ƋL$$35QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$k>(^_[]Ë$N>ᐐS[jt$t$t$[ÐUSWV([ô|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ 30|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[:L$T$ tPt$ [ÐUSWVT$[t$4L$|$0\$t4D$0|$"v$,1T$\$VP(u+t-u!$$l$0tC$l$0u20u- h$`;$u ļ^_[]USWV[Á$$$<$D$$DŽ$DŽ$$ jPR$<jPXSDŽ$TDŽ$XDŽ$\DŽ$p$d$tDŽ$lDŽ$x$dW$$P)g$d;$u ^_[]USWV[q$$$,$D$$DŽ$DŽ$$ jPQ$<jPHRDŽ$TDŽ$XDŽ$\DŽ$p$d$tDŽ$lDŽ$xt$dU$PQf$d;$u ^_[]USWV[d|$A|$ 6D$8u D$ L$(A0u ǀy1AD$l$(WuPJ E})Elj|$$t$(V+~6Wt$(Vq t)T$rwxsD$ ;0L$ornEt%  ȉ  ȉ ŃUD$ 0<$tL$L$ )W$(D$(H @^_[]F @4$utD$t0ِUSWV[~t$l$|$ jWWUVt$ -jW^_[]fffSWV[x~LЏ 8tf,PQQ QDžu:jt.P *QGGG ^_[ÐS[}0 PQ0P[fffffSWV[ø}t$|$"WV0 ^_[ffUSWV[Ç}l$|$PQVz^ t"t$UVxb cVjjPWcPQV:^ ^_[]fUSWV<[}$PE$8FNl$u @QPۓ4N$TolȃFFD$$D$$Vj PU1Ʌl$t$ D$D$ D$D$Pd$`Ǎ5t$8jWPhVY=hVp)D$t~ƍ5PVv)tHL$ T$RQWЃ D$t3L$ t+tCRjQPJ.l$V D$;t P)D$ u QPJtj 4$|$|$|$|$|$ l$l| |$||$|4 l$t t$ jQP1B4$D$t*L$tt$ t$ уD$;t P*(E;$8u ȁ<^_[]S[ZzD$ L$01R[ÐUSWV[$zt$,Nt\ ?5RQPW"Y~1dED$Q5D$ !\D$5D$s5D$c5$t$X;~F4UXFDtt$XFDtu&u8tMt$ gXFDt4$QXFDtt$:XFDXt$XGj 0W^_[]ÐUSWV[x t@11 t5D$0[Ptz 9rԋ u(1ɋ I `QPst6 Il$u}ml|4 t d_<.D5t>ot'1t PO9tGGP7GT$JRWO1^_[]ÐUSWV\[äw|$x|$|$LD$8tzoKƉD$LWG tki9t uD$tL$HD$ D$ WG9$u8; H u(!D$D$ D$ WgGhD$PHD$xD$\$T$  $uFø1$t;hF9u;dF\$u^_[]ÃÍxF1 9tn9uF.9uFߐSV[9pVVB1 VFB^[USWV [p@ ɉ$tEW1=$L$D ~7$H $WP$uD$D uhZp{Ƌ$@ tDyt f|$~H hWPQ @ t55ԒВǃ %V҉t$>.hFs/.lFƁdV$Вt">-00t!t$t.J"1ɋD$+(dF$ >-00uʅV~{<1\FOs*7ƁdV$Вt&>-00t!t$t,J1+O >-00uѻ D$D ^_[]ÐS[êmYP'[|SV[ymV?YP=Vw?^[ÐSWV[8mhZyƅt#T$#tVcO81^_[ÐUSWV [lt@Հ: jqt;ǀ}:Fjs#u/1ɉj<DžF $~?1퍻W69,$t".dVjEPW uƄ.dV_֋F$lF16D$t$;<$t$EƁdVVrt$VtFD$@$FFF fFdždFƆhFdžlFfdžpFdždVUTCdžZ1 ^_[]ÐS[Jkt$薇[ÐS[*kt$jt$t$[ÐUSWV8[jM 1QT$,t$(}t]\$t_O9މЉL$ |GtnL9t }b_GD$ 9މD$ T$t$\$}c)L$ f11u< r0< dV t;wOZ\$[ыW+D L\$jhY`QP ӺƉT$Y`kiˀY`iӐƐt$T$T$t$)‹|$ˁ€Y`;t$t$ |ىЉD$ L$$;D$U|R}|]9D ϋ}\$15H(1Ƀ\$|St$T$9}'<u|$;||$|}։9|ك}>7dFL$(uW.tL2hFG 2lFсdVO(}t'T$ВuEdF1+ 1e^_[]ÍD$ \$uuPW7L$;OL$OH}+L$T$11։Ht$΋\$Ӊ11ىpuSWV[gt$W9YP2 PjV@ W9^_[ÐUSWV[Wgt$l$Wl9YPUjV@ W99^_[]ÐUSWV[f|$t$U8H uLhZr< t*Ǎ5jH t6jRƃH |$U81W< k,t< tdV5H(^_[]ÐSV[)ft$L$t$< ,t)< t dVu 5t5H(^[ÐS[e Pt$ [ÐUSWV[×el$|$V7H uLhZPq< t*ō5j t6jƃH l$VN7 P< +t)< t dVu 5t5H(^_[]USWV[dl$|$V6H uLhZp< t*ō5j( t6j2ƃH l$V~6t$< H*t)< t dVu 5t5H(^_[]ÐSWV[ct$W6YPb PjV@ W5t V:1^_[SWV,[Åct$<W5YPEPjV@ DWi5tt$@V81,^_[ÐS,[cPjt$@t$@tt$D$Hm~{ р$u7lF7dV-00tƄ$T$L$T$뮽8D$ ;$$R(^_[]Ã|$1L$D$;D$D$D$$<hFT$9ʉudFD$1t$9|$tT<$hF9tT$dFT$+1F T$jD$P$HPU*|$uqT$jD$P$H$H*|$uGD$$<dFL$ +t$1Ƀ~ N DTʼn֋|$ 论SWV,[]|$<$GD$GD$G D$ GD$GD$G D$ G$D$$D$jP|$x ,^_[ÐSWVT$D$t$>O<4lX~;F~^|1ɉ)^_[ÐUSWVP[F\$P`.D uYPl$|$@ tABR lX~;yQq|1)͋$P-^_[]ÐUSWV |$(\$$l$ MAL$ I $ lX鐐~;YQq|1L$4$lX됐~;Cs{|61\$()l$$9}aD$L$ 4$lX1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lXL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[YU+D uYP,|$t$@ tWVP ƉU+^_[]ÐUSWV`׉]@Yh/eD$ tfGt>:t#>/u*R _>:u݃>/VD$?=/O D$ @nfo/@ onei@re/z@/sha/usrh/VP/; j.Vj.Pct89tx/ux.uHt/uϋt$ jV<t$ jV"Ɖht$P8" +&y @L$V2#cD$4V#?L$ A,D$l T9͉},$9,$Ƅ5>|$~i9T$$1ɸ>l$$<t >st$m[t$9}&t$t$9r1ɋ\$<1\$$\$T$,$M|$$~yD$T ʃ{ s {y  pKl$T$@s $I 90D$$,$uM 1~zQ΃1r?ȃ1;=dVT;=eVT;=fVT;=gV9ut,|$,1ې9u؋T$1T$1\$Ƅ fVfDŽ dVED$D1L$@L$H1ۋl$39l$l$\L$Hyq L$H9D$D7D$\$$|$0]؃l$t$u'M } EyjǁbM E M E M } y Ƌ\$C lj\$T$T ʋL$\  ӋT$Ly ˁ ˋD$L$$l$09t$999l$t$D,$uEl$L$P t!|$ t\$wY\$ׅL$L|$8tt$wt$ӉD$t$ kD$`^_[]Ël$|$tL$4,$i`D$ 8 SD$ | DED$=\$D$ =DHV} D$ D$D$ D$ 1D$D$0D$D$;D$D$L$ „T$,|+~#1D$,\$UP t9u\$U4΃1w$dVUPc%D$8D$D$ D$ND$oD$D$9D$,$} EÃ|+ك,$ >:>u]KS,$|$ D$1\$;T$\$,0MY Il$@l~;uM}|$ |1ۉȋ,$p\$~ L9t }tDE>]][|$1|$L$T$ Œ1u~}z5pFz5lFzZ5hF5dFu~}z 5pFz5lF:Z5hF5dF 9uD$tKMQUt$  pF lF| hF dFED$l$PFD$\$$PH9иL$€Y`T$ $>D$dFD$D$h1T$ 9 $D1ЋL 3L$ u$8>9~;\$~ $dFދ\$; u $hF\$:Ku $lFT$,ЋL$Iы\$QPT$(\$e$@$L$t |Y`ƀ $T$>D$dFD$j  $D 1L1 u$(>9~;\$~ $dFT$; u $hFT$:Ju $lFT$,ЋL$Iы\$QP\$q$@D$L$ɋl$$~z1>t 9uclFdV-00tP> hFtсXF~ 9Iu#hF19t 9u1ZUSWV$[ItJ<€Ѐ r<r Au)hT$@\$1҅SG$D$0D$4D$tbNɋ\$~D TT$,D$$ IdXdXQVR D$ SDža\$<6$jt$D$ D$ D$D$,T$$~@ $XXt$4\XD$0u ɋ\$t8 $AAD$<1+D$@dFƁhFǁlFfǁpFǁtFƁxFǁ|FfǁFǁZD$4$N dVUWP8 Ƅ.dVL$PАʀЀ rՀr HuƋT$)օuʅt .~1҉ЁĘ^_[]ÉL$Ht,t ;VL$@L$L|$ uG68tU<;t<,uT$$Rt8,uT$p\$7n8e $AdFD$dD$@D$l؉dFƁhFǁlFfǁpFtFD$`D$LD$h؉tFƁxFD$|FfǁFǁZD$1ɉúQ\$t1ҋ\$CT$ kd)ز=\$u!D$ i)T$i6‰D$ D$ً\$p*D$ D$9D$D$,}SCTT$L$T$\$Dt1ɋT$)i)\P(\T$w = ףi6QT$L$p\$DCp ;T$D$,|D$DpD$D9ȋ\$L$PD$t$<֍T$L\$t$<\$W$@D$4T$t$<714$>hF"9D$4uD$0L$ D$ T$P9L$ $t$lD$(L$ T$pt$h‹D$ T$Tt1+i)\P(\T$Tw  ף\$i6QD$\L$(9D$'|ȉT$8ЉL$8L$|T$8);T$\vD$ D$D$X\$L$$T$XTL$$\L$p*D$X;D$\$,|D$T;D$($>AD$L$D$ L$8\$D$$L$\$(\$L$Dp.L$(;L$D$,\$| $L$T$'>L$\$L$ D$(D$\D$ D$T$?D$8|$(uʋL$8;L$4D$0T$PD$@1$+dFt$0D$@|$4~zD$1 9L$4te4$>hF>qFuT$+T$0$Tt\$$hF:t1$+dFt$0뒋D$؋ $dFƁhFǁlFfǁpF1+D$LtFƁxFD$|FfǁFAǁZL$Hh$@L$ L$ $L$Hu4L$`A T$dB ABIJ$@L$H"$HD$ +D$D=L$H| $f@t$51ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ51i4Q9uB ^_[]ÐUSWV0T$ $X9D$T$Dt14@lX~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$D$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ 麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$Gw)jhUt$ 1wT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$96l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUPu)Nj\$jhUt$uL$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$dL$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ t$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPYt)jhUt$CtU\$T1ڽT$\$jjdURt)jhUt$st$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$5|$ 9|ځ51ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$8X2D$UyqY QT$QT$ Q T$0L$XI$L$}tMt$$xq*ƉѺʉkĉȋt$$D$|$(xѺωt$$ppD$$xqVй*щp;D$x кUUUƒD$ p Ɓlq!\$Te^_[]RT$)1T$D$ kčIT$(T$@)D$$1L$+6FpnL$ 1ui)\P(\w ף1T$6r$T$ ui)\PT$(\wD$= ף먹QkdD$ +|$ |$ iʐ)ʉ\$(|$|$ ʼn ō@L$5+~'G\$( |D$FQqPƔt$ OD$<|$sD$<D$,2|$ ED$D$,;D$<D$,D$D$ƋD$l$|$Ft jPnn~ e1^_[]fUSWV[&t$1tGl$)Ήv,|$ Wt$T$,t1Ʌ~|$ 1^_[]fffffSWV[X&t$ Wt1j2t_L$T$PHp  1A"Б  xuxt%txu8u롾Wr^_[Ã눐USWV[ä% D$ P=   $ L$ L$ǐ|$$tD$$9G t GtO  tGwЃ GЋ 9t DžuZ u';|$r$;|$s<$$<$C<$1 t$ . u#t7W@u^_[]ÐSWV[8$t$ W"Б  xuxt&t xu8uj/u $p@@  1W^^_[ffUSWV[Ñ#$$$D$$DŽ$DŽ$$ jP$<jPcDŽ$TDŽ$XDŽ$\DŽ$pr$1TK1D$$d$t$l$x$dU$$P$d;$u ^_[]S[Z"tt$t$Pt$t$[ÐSWVP['"D$L$T$t$ 4$tVRWQP]^_[ÐSWVP[!D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[ç!t$}XjWۡE`HM`~;Ep~ t EXHMX WRjW褣^_[]ÐSWV[(!L$B`pr`~ ;Bp~ t rX~zX XRQA^_[fffffSP[ D$ L$ $XQPR[ÐSVP[Ø D$L$T$$XRQPVp:^[fffffUSWV[T T$(|$$t$ t&t"T$(qfTN @1tVt$jRBL$0A <$uy‰Ņf1qyQuE)ljuދl$$1$)1t$ ōACAAAjQԡxՋ)v1WPV迸L$4 9l$Qu0}T$RPVΉ芸 )~>jVzl$$jUi$+D$1t$ ʼn^_[]ffffffSP[D$ L$T$$RQP[ÐSVP[èD$L$T$t$4$VRQP8^[fffffffUSWVP[fPt$ S1_ht$t$ x=|P_WfF FfFfn vF$F,F(F $tjjjV(^_[]ffffSWV[Ø|$jW՝w jWџ^_[ffffSWV[X|$WG;D$w+t$9w 9w9w 9wPWVy ^_[{fffffSV[D$;D$wt$ Pt$VIc ^[\{VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[ð[USWV[×t$F0u ǀFFF tVu"V͗t aV);F|Vu?1FT$i.;Ft F t uV胓u^_[]fffffffUSWV[t$|$l$jUtWVPUjU^_[]ÐUSWV[lu}D$d$G0u ǀD$?$u X$G tu)$WstG 3G Mf LfA$`$DŽ$tDŽ$x$|$jP$jPDŽ$DŽ$DŽ$$hh jPX G f$Gf$G$G,$GD$$`$$DŽ$DŽ$DŽ$$Vuu WBƅxWC1Ƀ ΋D$d$@M42I @+2D$,E$T$tT$D$D$D$DŽ$D$`D$XD$$D$L΋$T$ L$L~1Wt%t됐t\L$L)L$T0T$ً\$ 3KT$L$)Ɖt$T$r/9u8D$T$tT$ L$TZ\$ T$C$D$PuË\$D$D$T$tT$ T$0/D$#Ƅ$7D$LD$01҉|$LƉِAσ s&1)y1ɉL$0T$to`, $:' $:L$4D$#L$0L$Dt$T$8$8|$@߃ЍT$t\$@مD$D D$0tD$0ȃ|$XD$";D$XJ9D$@@1D$PӐL$H11Ҁ{D$D$8t|$@)D$8T$PD$D$Hȉ|$@9 $:L$4%D$D$@D$PD$HD$(1_)+$9 \$Ѻgfff)À0iT$|\$D$D$D$х{ D$dډˍ CT$ ‰Ћ|$T$|$r1T$t1D$ كT$tˋ$ȉD$ D$GD$$8KrD|$ } $D$PWYhL$|\$D$D$ ك$ \$4ˍ$|$$ 0|$|$(D$9ߋ|$|$\$(rÍQ|$4<00 D$PD$4:$mD$T$tыD$ |$@) ˋL$D$D$ $CT$ ‰T$L$Ѕҋ}$D$PWg\$D$D$L$t]F D$ G $CD$ D$L$rD$ t7$D$PufT$|D$D$Ӆt 1ɉ뀋}}D$1D$ L$tD$( D$0u ˉэT$t$AD$ D$ˍJL$rF$D$PWeD$D$1D$ T$tӅ D$ T$t~D$L$tD$4D$@|$XtljL$ D$Hƒ|$PCD$HL$D$D$|$4T$uD$XT$t}D$?\$ CD$D$L$rCtL$D$PWdT$|D$D$D$T$ t1 D$\$ D$D$1ɉT$ D$D+D$4|$X?9Dž~w\$ D$4{|$T$@׉|$AD$rRT$tta$D$P}WEdT$|D$D$D$T$ \$@tEQ1<|$\$ \$@T$t%D$D$1ɉT$ \$@D$X8)Q$|$ GT$‰T$L$ҋ}$D$PWqcD$D$1D$T$tT$ \$ D$G a$\$ CD$D$L$rD$t9$D$PubT$|D$D$T$ t1ɉT$ uT$|$ D$1D$D$tD$ T$҃\$P)ӃT$H)‹D$X|$4ljT$H‰\$P|$HD$D9NjL$ w}D$XD$4D$( D$0u1$$`$`AϋL$D$D$L$rDW$D$PRaL$|\$D$D$T$0b$jj WQL$,׉ T$)ʀ0$D$4$D$XD$HtA$D$Pu^T$|\$D$D$хtM1 D$ы$D$0))ˋL$|$|$ D$ G ~r$CD$ D$L$rD$ t7$D$Pu]T$|D$D$Ӆt1ɉ넋$CT$ ‰T$L$r;Ѕt?$D$P}W]\$D$D$L$tt#ً$T$t$D$ѐD$(%|$8ˋL$|$D$8$ؒClj|$L$}$$D$PW\\$D$D$ljʉ|$8G ωщD$8l$ؒCD$L$r1\$tt2$D$Pu>\\$|D$D$tZ1z|$$}t-$D$PW[\$D$D$D$T$t=}t$$$t$$|$}t$$$t)$D$PW{[\$D$D$ucD$u[bD$TD$T}t$$u <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZ8t$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v PE|$8E|$8|1 uT t$ 9wS$w닔X:wl$Pmt t$T l$PU\ / U| 룋$L$19u $PB<^_[]þUSWVP[D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$rKUSWV [rD$ 069rljT$D$uj$jWPv ~}(w}9$T$JHJHJHJHJ H JH RPE$jWPrv }(}8t!}0t$|0*)4$PjVp $L$D$ 81 ^_[]ffffUSWVP[OEET$@t$DT$$pU }: ;j);jD$܋:T$\$8t$<EΉ7tƉP1t?D$|=WjPo )OjRPA1 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]GUSWV׉[Ól$CXtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[m|$hE t$p |$<$_ MM$U ; ;j);jl$l$܋:|$Xt$`MƉ2t|$D$QC-t?ƃ|$|=FWjPk )OjQPe- o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]BffffUSWV[E\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$ ;juL$tyD$0D$lD$ $D$T$D$\$sNjD$L$ttW% ?L$@\$D$4\$);j؋E\$Oju P") mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃X;܋h;܃p;$ۄ$܋x;|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(w;D$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ R&D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋0R|$$ ʋ|$ ʉ$ڌ$؃\;ݜ$$$$$݄$D|$<ػ|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$jbM |$ ؃`;D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋0R|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك0R|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃L$T$vثv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋d;|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋0R|1t$H|$)3jbwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$PdWD$PsbWi^VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wc\$ Džja|$|$l\$WPac`؋L$1ҋD$DD$4D$R]D$t/L$4t9t\$Qr]D$\$Pa]\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$t&` )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt${\T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$cD$T$|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋0R|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ&Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QbPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR(NDž~#T$?؋L$؃T$$jj Q)G |$@c΋$jj t$F ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QvED$$PfET$%T$$1|$D$Ȁy0ItL$R2EL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QRIE jt$KLM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P*E ljD$ D$L$L$D$D$QPƉ|$Wt$ )Mt$ t$wMt$,N0L$ x $tPCL$(T$D:Pt$ LVyCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj PD D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj V6C D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q%B D$(jj t$ B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPEH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ KGD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[hD$1r 1 9vW<t8Ɖ^_[ÐSWV[D$1r 1 9vW{<t:L$T$8ƃXt𐐐Xut^_[ÐSV[yD$ PHpR=^[USWV XDT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUeE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[z;SVH[QD$0hjPI; D$(D$,DŽ$@DŽ$DD$ D$D$$jPj5k sL$(VPQjD$$D$ D$D$D$D$D$jPj- jjS[jt (h1^_[]ÐUSWV[l}uu\$D$4PDBD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$<ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ8<:t$(PV'T$4D$(=bPV'uD$(D$D$NL$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQ( D$p '3 |$4t$N  D$0P QVR( t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhPR 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}"P"L$D$ffffUSWVt$F98[Él |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[ßku }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[÷jt$D$T$<n~,D$9r9s#L$9w)QjP^ ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXiǀ@ ǀD fǀH ǀq fǀu ǀQ fǀU USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[èhD$H~( 1u 9r1$PƉ^[fUSWV[GhL$L?t(P8 w t{ ?u1>PsƅD$t/Fn?t(Ps8FF ^_[]1?t(PH8 )ʉʁ oΉoUSWV[Ggt$tbF!r V膃OL}t3(W7}F  tW7  ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[4fl$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQRm E!r&UXE!r\UB1L}($Pm5}T$,B  ti4$E5\L}th($P#51}F  t14$4$ T$,  D$TG^_[]Ë  1␐T$1Ɂsrr@r"y(6s@sރx @tS[Êcj,tL$H@[ÐUSWV$[TcD$9| 9}T$P7P|$, $r0wD$PjR% $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rUz9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [ZE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[X$|61P$1jjU" ʼn$tƒ9tt)D$P$ts#D$ =uXi/tZfx $tu f~ $fFvF$F,F(F AOĀ^_[]fffffffS[Vt$t$jt$[fffffSWV[ØV|$jWGHO~ H0 WSjW^_[ÐS[:VD$HQP~ Q[P[fffffUSWV[UL$atrt!w 11Qt_tGҍzwH>@ؐ+u˽뿁뷁 L$) 1^_[]fSWV[(U|$f jWZG0ǀǀ 1G t WRƋO twуy y wqG0tW@9t QpG0pG0ǀǀjWG GG ^_[ff̀rS[ T[SV[ Tt$ F0u ǀV"uFH^[fSWV[øS|$8u-.GG Ⱦ uuL O @G0taW@9t QoG0GG81t&WG GGfG u W-G t'LV%PYV$GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÐS[ZRD$H u P[1[fffSWV[(Rt$t`1mT$ |$L$D$t#t8uӉ6@VRQWP26@VRQWPFx6@VRQWPL^_[ÐXQL$AA A AAAÐfffffUSWV[AQ$uthjf1$džt.%u%D$PQq1t+8$u!8u $t4D$P$UQ)VD$\1 D$` ϋ$<$ F8FF F FFFF44 DhjP$ t;$PQp|$=|F P#FEt$Pt#FV EtF4Et UMtЅBt N&tEu4 hV. VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaF>j P ;F@NF(șdžHF DDN ȃN艆8hPjQD MPV$$0$tNC(1Vh(1^_[]14dž$j$WtJpH HH зH HHH 88oUSWVՉ[ÐKjqlalj1&NL$jP6a$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u18"8^_[]ÐUSWV[J4jQ@" t D81t>07frPtf/t u8~)1 9}8tQe݋t PVet81^_[]ÐSWV[I|$tOWUe^_[ÐSV[HD$ p|$s t.jt$ 1dž,dž,^[S[jHL$tAt[[ÐSV[)HD$ p|$t_dž,1t$t$^[ÐSV[GD$L$ qt dž,&t 1҃ƒt$t$a^[dž,빐USWV[TG|$(D$p$xudž$dž(dž 11Ʌt f9 tSHt ()9bf|Qf9udž $뢐V($19jjUV5/ Hf9uxV(9vo(f|Qh QjPQV Hdž(fytV($9 (tdž(f|Q댺f|QRu(f|Q^dž $dž(Cdž,^_[]Ë(|iw&jt$(t$(PVڟuƺm tXiD$$ËD$ ÃrLi#dž$뀋n tD$)K$L$$)A(1ESWV[XD|$t^_[ËD$tx4t&jjWQ uЉuLJ01뷐USWV[C|$(o(o(OG0!D$;G9} $wD$D$ PuO$L$L$D$QPt$͉ $L$QjPX t$_$D$ Gjw Y $tNG(PO 9~ LDLDG G,9vG0 G,Ut$W} ^_[]ÐSV[éBt$ t$t$ #F,;F(~#F0^[ÐSWV[bB4aA>j P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>N$Jl$Dijt$@URV"uD$`뒀gt$l$UVv ut$PQ]j $ $tbL$jQPg ;'D$ =b1 KT$4$u!$wr |$u LJLJ FT$(tt!ʃ1ҍ 9r1F1t$fwfQVj{- u`WQRP`jjP豦 dfxu8u fx7jP7u $ t!@@t!" T$L$d$D$D$L$ȉD$ɉL$D$ȉD$D$ ȉD$ D$$ȉD$$|$b1u*|$u#t$=wu D$$_tEGOot U@St P W#S1Ĭ^_[] D$D$  P78ut$,jV7 $`jV7ס K|$,@@@f@D$fAA Pjt$V jV7薦 jt$ SV[5D$ pFtjP6Z F u^[ffffffUSWVP[f5t$$D$hEtjPu Et^_[]ÉPt$ U=P t݉ƃ<$t-jPt$(jjVU6u!@uEj6uu j6u_ fffffUSWVD$  D$$|$ lPɉʉPHɉHP ʉP HffHf@1fl$9LpffLp 8ft8ff48fL8L8f48\8ff\8fL8\8tǃtJL$OL$Oo/OL$OL$OOfoffol$fO> 7l7\7|7<7\7l7L7L7f\7ff\7fL7Php0hPHHPfhfPhHHP h p ph P H H P hpp h PHHPhpphPHHPhpphPH^_[]Át1f9v|pff|p<0f\0ff0f|0|0f\0ff\0f|0D0t^ ~ N n n N ~ ^ N f~ff~ fNoUSWV D$ D$(|$$GHL$H hd$Z1f!fDp9t$1\p<ɉ LflfflfLLtÃtID$CcL$K cCD$CKfkffkfKL$V ;L$L;L$L;l;,;L;L$L;L$L;L;fl;ffl;fL;Php0hPHHPfhfPhHHP h p ph P H H P hpp h PHHPhpphPHHPhpphPHd$1ffDp9t$|p 8l8\8|8<8\8l8L8L8f\8ff\8fL8D8tO o _   _ o O O f_ff_ fOiPɉʉPHɉHH ɉH f@f@ ^_[]ffffUSWV[.|$oEtjPuW EjWuLEtPJE EtPJDžDžtPwJDžDžUTJWKJV6^_[]ÐUSWV[-|$0D$,pFtjP6Q Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6衝 6Y 1KfffffffSWVL$T$t$r ;uwt1>:8u 9u1)^_[fSV[Y,D$;D$wt$ Pt$VI ^[輊ffffffL$1s!t11҃9rfWV_+D$tL$ P1>1^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[$+L$4T$0t$,t#D$8yt9W t11҅1116n!ՋN σu1҃01Ʌt3OHOOG8^_[]ÉT$L$D$l$ D$uTD$,FuBVQV N u€thV:l$4|z<$jj?1hƋD$,p j?Ft.t D$,l$4D$0F Ftu1VE1NT$,NL$N1jt$Pt$l$ QPRhUv=r?D$ D$D$$L$QPj Uƃt:Uet?jjV# t-$<tPV蹨tjD$PjS -I(jD$Pj9 V0((;$ u $^_[]4ffUSWVP[ä$D$dL$LpFtjP6) F uYD$pttu\F($<uS|$ D$l|$hO@,D$9v@D$9ыl$l3XCrl$lD$PWVg eD$<$H*fJ<$uD$L$USWV[dT$0l$,t$$F( :N;M.N9"$F(  D$(ƅt$,$BfD$PVWYT$< $E9v$,$BfD$PVWYT$< bE9uUEtNjP77 $fD$QVWD$"Y  jt$ 6 T$0,$fT$|$(u -,$fT$GjjjPPQWTWT$L{O(,$fT$wjjjVVPWWT$LEO(EjP7Z $HfL$QVWD$8X t*jt$ u T$0l$,O($l$,L$F(jQ6Ά T$0$FD$fFDU<(DtG PV [tjGt PVZtMO, F)WPP\ fnT$0DVNft>uf+9f9sf9L$,|$0fugT$,zT$0)Ӊft~ft$ty\$ 1f1f9t9Yf9r1ᐃft9f9sf9yf9sfy)|$t$$\$ frR\$,t$$t$$fs>\$,{T$0f{N( 1uN; uN9vfN^_[]1fTYf9\$t|Yf9r1fY|Yf9r1fTY|Yf9r1fTY|Yf9r1롐USWVT$[A,D$L$\$ ;t$dFjvuZ $FD$Du<(DtG \$ Pt$ {XE%\$ uI}Ut$ VUVmk@$} ‰$E)QPP;Y $fEDufD$ftZ\$uWً$t$fdfEt$fEE \$ jUD$0 Zf%Kt$f9$sffuwUf 3fL$1ff9tIO$f;L$r1ސftf9sfWf9sfW)D$$L$frD$$fsUfUt$\$ jU6\$ D$8ujPu $.PU$ut$Uki1Ʌ $$^_[]1D$"f\Wf9T$$VLWf9r1f4WLWf9r1ftWLWf9r1ftWLWf9r1뜐USWV[gl$|$Et$jP7 tBMHjP7 E1t+jP7~ tMHjP7賀 ^_[]f1̀ffff ̀rS[[SP[ùjjjPt$ 1Ƀ $ȃ[ffffffUSWV[q$$$ T$$xt$%Gudt$ $1|5vuN| 6?2+$ $<19rj/P讀tR1ɋD$;$ȁĜ^_[]Ðj>>9r?Xt|$W$)$hPT$RQL$$ $t 9vϐ?/(9w$)L$L$  D$>D$$tht$U+ t*$hU.Ҳ1Ƀ89t$1$8j?Pt$ tWH0tȋ $9:<D$ND$19ubD$PU-um9t$uC:3D$PU-/1Ʌ#D$$=@L$1ر1Ƀ8ifffSV[i D$;D$w.L$t$ 9w9w9w9wPQV蒥 ^[jffUSWVT[ ED$PD$LD$HD$DD$@T$@P D$FD$FD$FD$FD$ F D$F$L$N|$ j@jD$P, `9tE;D$PuT^_[]Í@PhUSWV[7 t7\\ƅ~ O9^_[]Í@VuJ@PQR^G \PQƃV8Yj@ǃ#j @11j?jjjhjWj+t!jWP* u WUs*1V\@P`1j|USWV[ñ $D$ $ BD$|D$xD$tD$p|$0T$pPD$LFD$HFD$DFD$@FD$ D=AP+T$fPL$fTHL$lHŋT$(хuL$$ MM|$$OE D$G D$MЅuPt$ t$%> Gl$pjw uWf H jPu-h L$ω‰ȉL$uT$ B|$DT$H\$k1t&1f1TS<у9wl$HL$DLM| T T$ J+L$fJ|$fLzN\$t(1f1|~>9wL$T$ LJ D T$Éх҉u\$ K1ɉL$TSL$y<9|E+D$fEL$fDMD$DENɉLL\$l$pD$P9D$,D$8L D$ |$T$WPjjt$u@f jVu2f D$ t$ \$l$pD$jPuf jVuf u赣5jt$$ue jt$ue jt$ue 1\^_[]Ë\$gUSWV׉[D$PQ~M^ƋT$0l$(D$fF $L$fNONL$NO N OL$ u-Of9 uGfFf}D$,0t$j, ŋD$EEGEfED$fEG E D$ t+jPD$0b t~HjPD$0d $t$4t$4VUD$$UW D$ 9tUD$(8D$,0jVD$0#d U1^_[]ÐUSWVXDD$|$$L$ D$fBfB$GG ȋD$(u"t"1f1lo4/9w1$4LL$fJfJH@ u't'1f1lh<(9w1<2D2fBB B \$jRD$0b^_[]ÐUSWVP׉ $[1l$D$fJfJ D D B uD5OP )fOfOɉEDDD5 L t5PQ8 D5tcju t$6G` twH jP6"b 7E (D W)fWfW7PQR7 ED7fGG G jWD$0a 1^_[]øcUSWV8L$XD$L$TD$LD$$fD$T$BD$,1L$ L$ T$ɉL$0L$D$(111$9D$ df9l$u1ҋt$Xf9l$L$I T$?T$LB4 4$4 T /\$|$LG$tփ Tߋ\$f9l$v8DL$TAʉ$T$LB4 4$4 1f9l$w;L$0s~9D$ txf9l$tFŋL$LT$4I)fJfLBЃ|$ߋ\$Vt$P5T$@|$$ 9D$tD$(tD$(L$LfAfAD$@(tB@L$;L$u3Af;D$rfAf9s D$LAʋL$P J)fBff9l$vD$Tf)D$PD$$D$9D$ 11st$TF$\$ $ ͍p\$PC)fCfDK؋\$Rt$P_4 9D$ |$1ɺf9tT$T$R t$?t$TF$\$ $<|$Tt$ KT$tB։t$ 't$TF$\$ $1D$Pfhf;|$,uD$PfhD$$8^_[]Ë\$_ffffUSWV[|$0D$$pFtjP6a] F wJrr GF(uI1G8@T$(:zD$ PWltGVD$ PULg|$ $NL$fNjP6\ jv6Z >1ɃYh &5F,jj6=Z Hʁ@ TP|UfMjP6[ jW6Y u\F,jj6Y =H+@ )H| fBjP6E[ jW6HY uǏbN(NPf9$fL$N,L$;|$^OjP6Z jw6X COPf9t$&$fD$N(uNftx$fL$N($FfD$1fOLH|jP6Y jW6W 1Ʌtz@ t닁$fD$N,L$;|$t7OjP6sY jw6tW t OftjP6EY $(|$FtPF FF($nf~ F(jQt$4Pt$8RV{(!@u$Fjt$6X ^_[]H@ nfOLH|jP6eX jW6hV uxjP6?X jW6:V 1xjP6 X jW6V HUSWV[|$l$t$FtPSF FF($nf~ F(^_[]USWV[t$,VT$RQ ǸD$(>  .,$OfL$ D$ŐM;tjUD$0V /GfD$ wfteL$A ;Mt jl$l$UD$0V El$ jPD$0T HfOD$fOWt$t$' ulHHf9Ou8pjPu6V thjVu/T fGOT$(‹OJ/L$;EtjQD$0U D$((fpL$ fH1^_[]ËD$;MujUD$0U иfffffUSWV([ÿu~,jj6aS )|$FD$ VƋʋfqDBtjR7T jV7S D$ L$yftZ1ցϋD$ t@t$΋Mfq Pu Q% tKOT$뵐1ҋL$A uN1f}%L$A }ED$ 1}  fueL$ItZjQ7Q D$t=@fD$D$Pu W$ Ljt$QS D$ L$If9uYL$ItNT$ jQ7~Q D$t-fD$D$Pu Wn$ t,jt$Q9S D$ T$ MfW e^_[]j|$WQ S D$L$N FE;t$1ɋ}L$Fjv7P tVHɃ9jt$V}7R L$;t$uD$1ҋt$jt$VQXR D$L$O GE;|$1D$Gjw6P jPu6D$Q D$;|$uL$1}fVL$tgL$}LHLL$fFjP7jQ jt$7jO L$rL$1룉jWE0)Q D$ ufzD$tguD$DA|jQ6P jW6N tFP9fyD$uujQ6P D$ Ufff̀rS[ð[ÌrS[Ð[Ḉ̀rS[p[̀rS[P[ḹ̀rS[0[S[t$ t$ jt$$t$$t$$t$$t$$$ [fffffS[t$t$t$Ѓ [fffffYD$|@Px@Pt@Pp@Pl@P h@Pd@P`@@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^ƴL$<A$iA D$AQT$QT$IL$1t$$@l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPr F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPr <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVgq^_[]ÐY;D$APAPAPAPAP APAPA@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[Jt$t$t$ [ÐS[t$ t$ F[ÐS[L$T$ j[ÐSV[t$ tAAj@PV p FPhjPo F@FDFHFL^[ÐUSWVXa$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8AD$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPe FP3nPtPWjPe UVj~jUe FPNHVLN@VDPV^_[]ÐSV[)t$ tA`Dj@PVke FPhjPe F@FDFHFL^[ÐS[t$t$t$ [ÐS[Út$ t$ [ÐSWV[xt$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVc ^_[fffffffT$D$fSVP[èD$L$t$$hjjjRQP $^[ffffffUSWVX[OMD$<D$&xdDḰ v~A:D$L$'G -D$D$D$PjD$uD$PjX1 D$D$D$ D$D$ D$D$D$D$D$D$D$D$D$ D$ yD$D$ 6D$D$ !D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ jD$D$ RD$D$ED$D$ %0D$&LD$D$ ( D$D$ )D$D$ *D$D$ +D$,D$D$ < D$D$ D$<D$^_[]ffS [ç u?D$D$$ T$jjPQjRt [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[çl$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQP)OV QRPg ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRPt,NQW QRP FEE1^_[]ÐSWV[%D$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [ԼT$0|$,D$(L$$)q092sVP$D$00$D$ jU0:+ Ÿtr|$9rL$EQPt$V jUD$(0,D$ )t+Ɖ4$juD$(0* ŅD$u1 ^_[]ÐUSWV[L$$D$(T$xD$PQk1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0+ L$,+|$ $t*D$D$Pt$(L$njUD$,0+ 1ɉȃ^_[]ÐUSWV[Ժ|$D$ hj07w) tk@ uVxPQ4$9vDt$jW66) t9<$)HL$PV9|$w jP7* 1ɉȃ^_[]ùfffffff̀rS[[ḿ̀rS[[̀rS[й[S[ú[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[$D$D$huܓET1}8XM4tI$PE8*$$E4E0|$ 1D$L$j`QPu8VR ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$ |$ Wܓ$Ƅ$D$TH&PW7 t.$Ƅ$8u$L$ThPQ $ 1 $Y?l$$PWm$D$t2) $j UW$WQƄ,j W$UM !oWjD$$PULM ʼnPWD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$P6Wt_`u|$ <5$h$PWH h$PW2 U|$|$Tt$h$PW |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP K t$|$"$t$|$t$PUE$$t89UltC$($,2D$XP$0J $0$$tTt$t$;$r^_[]Ë$($,kc7$QPI t$bҋ$0t D$TPS$,$ $$t%(tPD$(PQH $$(1?7$($,91$u$QPGI t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QPH t$|$ t$$tPR$$t R"$($,uWPI+`|$ L$1t2`r/j`PWD$ CD$ `1t`rŃ`j`PWL$ kCL$ `댃$t!$9b`Y|$ D$荫$ $` $hjD$ PB tF;EuED$E$D$ETt+hPt$$VD V2Nƃ t$ $tVD$PQ[BL$ t$$uO$;$uSuO-wBIuxH|$|$ $u5$t&M0;$^_[]Ë$lD$|$ $$Pt uHX틴$L$t$T$9rD$Pt$U>A 1gL$Y;L$OM :$ffS[ÚD$L$ AQ jQ0 [ÐSWV[H|$t$t+jP6 tH  W6^_[ff̀rS[[USWV^$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉiffffUSWV[ץT$D$t#4׉9t u|$))t6t'Xt u) WWJ^_[]ffffffUSWVLX4D$L$ht$dl$`1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$Z D$$PT$)rh,D$GD$\$UW|$t׉t$l$Uуx6l$V\$t$|$WT$tx:|$4l$l$x \$|$Wt$T$tx|$|$ D$؉D$)\$VD$@P|$t׉UVуx4\$Ut$@VT$tyx\$Ut$@VT$tx|$+D$l$\$UD$ PT$tD$WUT$t|$x!A\$|$Wl$ UT$tx($x \$t$|$ WT$tx|$l$|$ \$V|$W|$t׉ljl$UVуx1T$|$\$ T\$t$Vl$UT$tx+T$|$\$ x#\$t$Vl$UT$txT$\$ |$,tPD$tY\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$L$HD$h9L$\$VWT$tL$uӃ|$,\$h|$ tOD$tY\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq?81pjPQw3b1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[ht$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øZMPjj%QUSWV[èD$L$Pt prxxp| pPxtz xyV豭1^_[ÐUSWV[4|$ l$9v`wDt9xtNȅuT$81$Xq36<61*׋PtIQPEjPQD$ pD$,`L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y;5ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$pv( D$ L$Q$ЈA1ÐSV[)t$ V PatHP tQ P V@1^[ÐSWV[Ȏt$>gthGt tww$Ѓ gpNjPQw];u<tww$Ѓ Yt3^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[xD$t$tA|$1ɐt 9u)tPjQ7& ^_[fffffffSV[D$ D$D$$jVj$V uƃ tjjjjVjU jjfffffffUSWV[dt$0|$,ttq1TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P< Pt$8=t +l$1jt$81^_[]fffffffUSWV[ÔD$(@x>T$$B tzu?Rt*0 0F \$L$()}u(D$ $L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj Wv t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$# D$$8t$$T$(thA9},ߋ\$Wt$ t$h#T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RDT$(1Ʌ$\$PW2"D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QP T$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP" D$$ $t$$L$T$( 9J9s\$VWP! t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ffUSWV[g|$tpjWG 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;LW YpyP]BWX, jW ^_[]ÀO @1USWV[Çt$N 1tT~tM.)>1uFFtUWvV, ~)uNDtvу N @1^_[]ffffSV0[t$̀rS[p[S[ZjPt$t$t$[ffVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[Èt$8u]N uRt8F0t~@9tR蔟F0N FFfN ~u VCN u1uVVF11+NN^_[fffffUSWV[ñ$$G G$=tUL$QPxC#T$ L$xt+OLuo(1; $1D$G u9tiU. Go,$̀|$t)OtPt ,$́f o Gfx@NT$PQj@RT_1ɅD$PuINP1҃/w,MD$1T$d DQt$L$ QjhjjjjP |$ t:L$u $O GCGG;$u"Đ^_[]ùT$tщ1USWV|[t$$$F=tYQPxI#L$1 ED$ht1FLu*N(1; E|^_[]fffffS[jt$ [ÐUSWVP[æL8|$t$F0P*PF0PyS9tnPjSF0Pt8PQPjt$S*SN0PǁTt!ǁXN0TtXXu\QjKSN0QiO^_[]ÐSWV[Ø~L8tR|$G0P$OG0PsRO09t,Pu'YRO0PǁT 1T1QN^_[ÐSV[ ~L8tJt$ F0PNF0TuǀP8POF0P`N^[ÐSWV[Ø}L8tn|$t$F0P NtF0Xuj\QF0TuǀP8PNF0PM^_[ffSV0[}D$<L$,QP1;T$,uȃ0^[Dff$D$4̀D$̀fffffffT̀rS[p|[Ḹ̀rS[P|[S[:|t$ ht,@t$! [ffffffS[ |L$T$ tPt$(t$(t$(t$(t$(t$([ÐUSWV[{|$t41 |t$t$ t$ Ww uD$ <=u.|$$  9ttD$0 M9u; s|9v9tfPǃ ǃ $jWP 08uyPD$0t$ )$jWP v0o8u4)  $PjQ  $ L$ ^_[]ÐUSWV[v t 1t0О DtPVt Hى|$О jjD$P tE t5jVt$^ F: tVt$cVfŋD$ 9tPKǃ ǃ  UjP ^_[]ÐUSWV[çu81tR/tL,t4t$t$U uD$|=uօt D$1^_[]ÐUSWVP[&u|$1|PWtfƀ<=t^tR)tI1 $ $lt+Vt$U u|5=uمxD$8.1^_[]ÐSV[yt<PFƅt0^[ÐSV[9t<PVFƅth0^[ÐSV[s<PFƅt(0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffSWV[xst$D$L$~tQPRz= x FPVTf ^_[ÐSV[)st$ F tBNtjjjP !ƒtF /8u;F %T$L$%fF vtRQP; ^[øUSWV[Çrt$D$L$|$ ntWQPRt !N tfN FPVT fN ^_[]ÐS[rD$HtPF=[ÐD$L$AAA USWVP[qD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[dqD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[pD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[dpL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[ämT$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$L$$t6 ruLQU x$t?$L$UL}$1)L$^_[]þT 0ېffffX`L$dDHÐD$L$ DAÐX[`L$dDHÐD$L$ DAÐX `L$dDH%ÐD$L$ DA%ÐX_L$dDHÐD$L$ DAÐXk_L$dDHÐD$L$ DAÐX_L$dDHÐD$L$ DAÐX^L$dDHÐD$L$ DAÐX{^L$dDH%ÐD$L$ DA%ÐX+^L$dDH ÐD$L$ DA ÐX]L$dDH@ÐD$L$ DA@ÐX]L$dDH%ÐD$L$ DA%ÐX;]L$dDH%ÐD$L$ DA%ÐX\L$DHÐD$L$ DAÐX\L$DHÐD$L$ DAÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[@[[PS[)[m[fffffffD$t8t9@€tuuuuH+D$ÐffS[êZL8t[Ë[ffffS[zZmPt$3t[ËD$x1[ÐfffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐWVD$$|$t'L$T$t$1~961Ʌ21^_ËT$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐVD$L$ t|$tT$ t121Ҁ9 11^ÐD$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fff̀rS[S[S[Rj1[ffSV[R u# V<u蠵1 ^[Ðfffffff1ÐÐ1Ð1ÐX+RÐ1ÐÐUSWV([Q|$@t$< Îf Hw(_ uҋ Ȑ 밋 t5 t* 9s8u+h 3ƃ 3D$ D$$D$ D$D$D$D$ $ D$ fD$ D$Wj(Pփ4^_[]ÐfffffffUSWV[qP$E$ l$@$D$$$D$1D$8t$$σ EF <%tL$9sL$א$D$D$ |$0\$EȃzH_M*.Q1 w#1BMQЃ rx뫐T$ 1ېAEȍQЃ r\$T$ \$^ L$ tȉD$ C $:L$L$D$!\$ $+D$ $ $@ $1}lu $ $ $ $D$yD$$x.uu uu@u0L$8L$T$ A9T$L$f8͉L$ L$у $$ҋ|$x;u'u u&@wʱ-L$xL$ L$11ιq $D$OK $D$UL$4a l$,L$L$D$LD$cWL$ $ɋ|$ $u"u su @tD$11l$,l$muUERjU_ :)9 $lj-L$ $ɋ|$ $u"u u @tD$1)L$D$8 $ɋt$u"u u @tt$1l$,L$L$L1ҿl$L $~|$D$ $L$8D$x1{wD$1gOL$ փD$t$ F~NL$T$ u $ $ʃuʹD$$T$ |$҉l$,|$T$ x$$ u$|$ !tU$>T$8 MÉ19Ɖȉr$򐐐t$ À019t$ rӍi$tz0tu0n $rFNj\$jj VP菉4)0M1ɾc9ىr0E$)T$ 9‹t$$L$ǀ|$tD$ D$<p $F \$DaUO $1҉Džy1D$D$s $tD$ T$ D$9s 09r9s 09s9s09r9s0붉L$L$(ʃ.D$9tTFl$@E;$u ^_[]fUSWVP[fD1P$t5h$~xX~f tWT$ ^_[]ffffUSWVP[CD$l$H1 m \$D$H1yt9~u~f;{uًv;suD$t~u밉΀~t뉋t}u ~vD$$*jt$PA tAt=}txuHT$f;Ju׃xux uxuxu1^_[]ÐUSWV [ÑB$,$Vf1f $$0~ )$,$0hL$ QWPVx[9wQWAGP2;$$u;$(u$ D$ P mȋ $ $1 ;$u ^_[]USWV [qA$ $q if;$$$(J ;$,Ѻx$ #ȋI(ux(u ff9<$|$~hWV$0W$0耟xS 9wIVףFPȣ$,$,PW|$Wu11<$<$;$u ^_[]虝USWV[?ED$} D$0$u\$ jVi=~ t$t} D|$ |$ L$0 ;$e^_[]ËKu at8\$ XQaVjjP̲Vt$Wu[]KCD$L$|$D$|$ D$9C y{1K ꀉL$9Otr:L=t&/Of;L O;Lt<Of;LOЋ\$ jPQT$ T$ ] L$]DŽ$\$ $Q$QPT$ T$ ] ut  L$}:Hu[t"uQL$~f;HuF$;H4L$~f;Hu)\$ jP$PT$ ] |$ u}<]fǃC ~lvr‹9‰}FfDŽS| tًt tȌt tȈ4 | |Ȅ|$ tȀC fD$ D$D$@L$#=@\s t$t|$| t$K$K$KS$$L$fL$<މt$vZuDD DDDLLDVfVL$уutt4؍<؃ǀ 뗋t$Vtȍt$| t$$]D$D$$LDD$D$=Xf|$ ~8 0D$t0\$ WkabPQRW |$ 0u'؅USWV,$[<(E$(p0GD$|$'j j PhW$\$\tbhPWU Ƅ$'D$?D$D$ D$D$D$D$D$D$#$@j)bPD$PWt$ QRs0E;$(u ,^_[]譄ffffff̀rS['[D$L$ T$HffffffVD$L$T$ t$pH^VL$L$ t$t$D$T$ pT$Pʚ;|p6eĉP^SWVD$L$(T$+T$ |$|$$t$19}ʚ;)ڃx)Ήp^_[L$D$+L$D$ t1Ʌ ËL$19L$ yÈÐUSV[%uD$ Pj#t*jPɳx/$iL$T$VN*D$FD$ L$NFFe^[]D$L$T$ PiL$HUSV[ %uD$ Pj#t*jPx/$iL$T$VN*D$FD$ L$NFFe^[]L$D$T$ QMbl$‰QffUSWV [a$$0D$$$ $fEt$8c$,$,$,P3hD$ Pjjj$@$@$@jU(ƅu]E $@tR$4hD$PVU ƅE t'4jjjPhD$PVU ƅ~s$4WVD$PU<ƅyvE @t73$t'LPtcEcPRtxEtLGP<$OfWfw fRcVRQt$ Pr߾WUnD$;$u# ^_[]ÉGffuXUSWV(]"D$$$$@$<"jV1t81ۀ.Qu닼$@9vy.Åt1eD$ 1ۅu\$D$#hPWVJt/$P$P$P$PPV1\$d9ٸu^T$L$\$$P$P$P$PjWVN\$ ƅF$<L$T$t$D$~D$D$ *D$sF D$D$ i^DFT$L$D$~HD$\$D$D$ ɋ$<t .u xuD$$P$P$P$PP$TRF8=z$<1t<tu-D$ +$L!5u D$$<X1‹t у9#|$L$  \$$@D$u]D$D$D$ uA|$u:$P$P$P$PjW$T.Ɖ1t P$@|$ $<t.jP蚁D$;$$uL(^_[]þ|$t؉j$@ZÉ뿉j됋$@D$L$/{USWV [$ M$1@ u tE;$4 ^_[]ÍcP9tЍBQP%tƄ$T$d $D$1PhhR1L$$t$ T$DH@u u{F$$RYT$D$u$DH@utD$(tDP@u Vu$,FPQW' D7t$f zUSWV [q$($$$$$ @t-tcc$0$0PUQCU ƅtbW=sUt$WUPhjV$8$8$8$8U$44r/j$$~ $ ;$u9 ^_[]Åt|5.u|$hVUWID4mxffUSWVX[$$L$p|$lGtG ,t$xt$|HcPVt$|UQ$$E$ 5BBW(fG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$xxnNj$L$|PQ}$L$xPL$Q|$ǃ$fB$) $W 9$A A L$|PQ||$L$xPQa|$Pjl|$PQ5|$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPrwƅxՍ7Pj {7Pt${7Pj{7Pjt{$ 1۸$IUSWV[l$ |$t$D$@t*dPi) l$$FPj)zF|PQzfFD$@ u1ft dPhVPzVj{zG fffG )^_[]ÐUSWVP[t$0|$$T$ l$D$@t8dP(hT$$׉)Ή $9|bL$(B9wW9vSD$,UPyEPt$VyEVt$8P襯 )WPy+t$ ^_[]fffffS[ jt$ [ÐUSWV[$$D$0$jUxEt U uEEEji!U U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžh tkǃhpjP̭ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU{wD$ djVU tfPƅD$$}`hVW葆 ƅ_EH}DM\D$ 19s( w Ld1҅tމ8D$ Ϲրwr tt$$D$ BPtPǍ$WhhP'E`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$P'A$<#t<;t΋$doma1$in $sear1$ch #fj P$P $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P5 $< t< 0$< w dA< vhQt$ ƅ_fPt$jD$ kc$< t< H$< w&TeA< vhQt$Ve ƅ_j VÂtuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< t񍃋fPV贩< D$<@@@@ @@D$@D$8Rj5Pj j$PD$PD$;t$ s E$EtJugP[EDt%uHfPWiu퍃gP[fP袏tV[ML$0 ;$u ^_[]OgUSWV[÷ t$xPdžft91 9s)tQDŽͅtMtt|h9utfxt PRWU%džtP8%džf^_[]ÐUSV[ðEu jP謖$D$F$FgfF e^[]ÐUSWVx[OEL$ L$pu D$jP9D$3D$fGt$VIjWVJ VWjRGL$ ;L$pue^_[]JeUSWV[÷t$xPdž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[ÐD$Atft$0UP EO $L$(T$ L$fL$fL$ F< t< tjt$VV fjPV< fj PV" gjPV &6gj PV %j PVԝ jPV躝  CgjPV蠝 JgjPV膝 Mgj PVl  %jPVR XjPV8 YgjPV agjPV jgj PV  ljPV͜ jPV賜 $`FPSn5d$/FP3n|Gt^fGddGtAPt$'F Pm|GGtgPQ7< < {$H׋$ugt$0UP $gPT뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]PV蝜?r?D$PVt$au D$L$Ƅ|$PVN?r?D$PVt$u D$L$Ƅ($H^_[]ÐUSWV8[Tt$P|$Ll3 h3 p; t|ua9h@tOa|x$D$D$%D$ D$D$D$`fPjjjQt_tt.`fT$QjRjjtv_w"t F F 1.jW!t N N 8^_[]ÐSWV[t$xP džft@19s)tQDŽ^_[ÐYKD$tÍ2ÐYD$t(ÍlfÐUSWVL$A t$yt(:u,T$t't( r t(rt(D(B2!D$(G B GBGwr΋L$A 9}퀍S9|^_[]fffffff̀rS[ [SV[ t PBPi^[ÐSV[t$ t PrBP+^[ÐSV[ÉtP@^[ÐSV[Yt$ tP^[ÐX+L$ÐUSWVD[$X$`0@D$BPa$FED$$P ;1D$(D$ D$D$ |$|$'}$XD$|$D$|$#EL$H@ u uuPt$V0|$t4oE1tVPnEub|$tT$D$ D$L$9AD$(A D$W蝡)D$$QPt$ܕ |$|$D$@1ɅtbL$ #WPKǃ)|$$=WUl$U荕 L$ l$$XD$@DuL$ D$+D$L$(L$;ED$@ ;D$$|$OP1R L$l,G )D$$L$D$D$ l$$X|$D$'Ƞ 4$8u 4$4$|$MmxD$(AT$ $Q D$ ) $iL$ )ŋ$h19Rt0U- $A,Q )׃9t$uы$@L$t$ 藟ƃ)Vt$$Uܓ $(|$ tM1D$D$PTƃ)rWVt$U蝓 $@L$,9D$ u$@L$ t$b@4$Ĥ$XF t$4 v D^_[]Ëu W֐USWV[Ç|$D$(HJ @BBPtLƐw ww7Vt5Hp U1Z uVݣ'G V轣G ^_[]fffUSWV [ǃ ǃ ǃ $ 0 ( 4 1ɾ\{4rfg0F(h thl 9tF F$F(h l r Rp T t ^_[]19u뫐S[:QPR: j0SWV[t$8h t3l 9t^t,t p z h t7l 9u l ~t vdV[^[19uΐS[t$6[ÐWVXL$ tsAQQBQQAA,h tDl 49u4l 4~ vp T t ^_19uSWV[(t$trTh l t/<t)t p z ujG(u^s^_[]ÃtRG$jPW tՋ(@PUW? 1PU7j> uG$ 1랾뗐USWV[ÄD$$L$ DA4DtFPt$ y>l$ E)VPP f}T$$DUMft0uf1f9sf1Kt$$fums)̓fftg,$T$1f)f9t9Qf9r1ᐃft1f9sf1qf9sfq׋T$),$fs$\$ sl$fs1^_[]1ftYf9tljTYf9r1f4YTYf9r1ftYTYf9r1ftYTYf9r1럸ffffUSWV[çt$nEtjPu7< EjVtE 1t u1@uz)u1Ƀ V2t^_[]ÐUSWV([t$@l$<}GtjP7q; G ujUڜ0 81qujWjjjyb 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P蠒 L$9jD$PD$P밾L$jPQUUu*t$t$b ;D$uTjD$PD$PˋL$O$t:jjj^a!уtRPUr u !1(^_[]fffffUSWV[|$ t$tGw#jPdžL$G|$$1D$@DA,Du!@Mu:O}GQWPUVf u^/|$$KQ;v RP-t2MQUQRPd EG/1^_[]ffUSWV [|$(l$ E,D$jju\6 $1\$>\$LHQPu8 jt$u6 @ )HfOTH9t,y;l$$vًl$ $Yf_T$|$(<t\$M)1ɋ\$+k$tg;l$tY1<Eju6 5 t%MLH<jP66 ;l$ujk $1MED$$)fE ȃ ^_[]fffUSWVP[|$ L$T$iD}w QR jM $uJ t t})Ƌ $9u>EDEf $fDMftMftMfMB8D$H1^_[]Ë $LM))PRQ T$$ fL}1fD};<$L}D}ftfL}fD}ِUSWV\[t$pF D$=tD$jjt$|VuD$4-jj$VPL$4I H Q*f\$D$<@D$01D$t$D$T$$t$$D~ L$ ~)L$t$0D$ DF)D$D$ Ut$HPL D$ L$ f FD$L$)ȉD$.Qt$P L$ Af,FfɃًT$уfLFflF $T$$tz*9 $f|zz t$)ŋ\$UL$HQt$xy ;D$tT$$DzL$f+L$tH)ЉL$ *\$VPQW ~ff+D~t$frflrD$ $ $t$t$D$9|$1ɋt$4L$4yf $T$HCT$$D$,8뿐USWV[dT$B =t $|$ t1|$,t*|$$|$(tMj<tuWT$ D@aHf=tfWtfO1 ŋJDHjWPV|`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVK|+l$͉ $l$,t$0t$ED$9G u*D$G4$P L$,1TULGDHjWPV{ t&dž(@f8u$dž  ^_[]ÐUSWV[ÒzA =tl$$G)B fT$L$D$ uf͋t P,$Uj#|$(todž(dž $FDGjRPVztiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$J^_[]DGjt$ PVz t׋@f8u$dž wSWV[|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[¤T$$wA =tF)G D$ *$Ffu^L$t P4$jNL$t$,t$,jWQPt$DFjWPQxtjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $HЃ^_[]ÐUSWV[tl$0|$$D$jPj t{t$ ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6%!ѐf$@#q't21!& %)!E%!x%!%!%!%!X!%!&%!hX&! &! &!&!>J!&!,$"%&!"% *&! ? 6&!|V &!Xd ?&!pm "p E&!X # H&! N&!8 Q&!< "< ~C$ r x"s V&!/ U&!/ 7#( Y&!P _&!P $ e&!H0 %l1 % #H k&!$`t&!|h{%rz&! % &!0$&!?&!,&!,%I%-""P[/"P[$_&!̊|$%ZB%P&!P&!P7!8&!g%>P!k^%f&!~|%!#ߌόՌی*!<*!A*!o!`$H*!H&s*!_"\*!u*! ")*! "%*!*!l"*!+! " +!+!<2+!6+!;+!@+! %E.!,+!slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not available'#~0!1!Ӕ1!ߔ]$@@1!;+$i"1!s@@(1!.1!0!% 51!;1!@@P!"@@A1!unblock and -DNO_CONV?pPX C Њ0i X 0unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdoutclose%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input3rrrrrrשrrrrrrzrrrrrrrrrrr˩r'3I100 0abcfGgHhiklmNnPt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-10-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted ony!vvvvvvvlzvvvvvvvvvvvvvvvvvvvvvvvvvvlzEt:"vRvWWv          WUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupHOMEno previous patterntrailing backslash (\)infinite substitution loopnothing to undo@ FC!mdں& mJC!mNC!m)"mC!m"m-%m W$m RC!mVC!mZC!mbC!m@iC!m@pC! mzC!mC!mC!mC! mC!mC!ml"m8@C!mC!mu!m C!m TAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] ""$W"$"$$$$`"$!RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d-FFkF'GF'G'GF'G'GF FtF'G'GGFGFpWP`?B?%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/netbsd-10-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/netbsd-10-llvm/i386/20260402190042Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/netbsd-10-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/netbsd-10-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.Y!Z!' Z!*Z!?Z!&\! "[^! "HZ!RZ!E^! "4% "8[Z!dZ!}Z!Z!Z!Z!G}Z!\!E^!addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgekeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s forceUsage: %s device %s device command [arg [...]] Available commands: ;,^^*e^^qK^^^^^^^^^^^^^^?^]^^/^^^^^}Z^^!h!.h!Ah!Wh!xh!h!h!h! 3i! Ri! }i! i! i!i!i!xi!i!j!)j!cj!j!j!j!j!j!j! k!!w##w#$'k!&w#1w#2/k!3w#4w#5Kk!6w#8Vk!9\k!9ck!:|k!;k!<k!=k!@k!Ak!B+l!CWl!D~l!El!Fl!Gl!Hl!Jl!Ll!Ml!Nl!Om!Pm!Q&m!R;m!SUm!T^m!Ufm!V~m!Wm!\m!am!cm!dn!e$n!f8n!gKn!hKn!iKn!pRn!qw#sw#tw#uhn!vw#wnn!xn!n!n!n!n!o!o!)o!;o!\o!|o!o!o!o!o!p!p!=p!Op!fp!p!p!p!p!p!p!q!q!q!q! 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: # r!ҍ!܍!!!!! !!&!!&l!&!q!+!4!?!($D!H!qq!7#L!P!X!\!$b!m!|!!!WW!W& !!!p!!!!'!-!3!:!D!A!E!($"H!$7#K!$Q!$# r!ҍ!܍!!!!! !!&!!&l!&!q!+!4!?!($D!H!qq!7#L!P!X!\!$b!m!|!!!   fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdV!`!#h%;%#>%"n%k!r! x!! !!%@%u(%%#_!!@Z%@!!getmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node Warning: realpath %s"%s" is a relative path.using "%s" instead.V!`!#h%;%#>%"n%k!r! x!! !!u(%!@!!bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node e'((k''(''(('V!`!#h%;%#>%"n%k!r! x!! !!!@bcaseinsballnamesaiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %s  U xb  @U <0m%u,"%Yb[Z\[Z\[Z\Z\8[Z\Z\X[[[Z\Z\ZZZ=YZ\Z\Z\YZ\Z\Z\Z\ZYZ\Z\YOZ%s: can't read disk label; disk type must be specifiedpWP`50zero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/netbsd-10-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/netbsd-10-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitT!1D!0Q!1R,!CI!I^!0w!1!4!5!E!e!1L!)`888F88488g8T88888888888878y88!888?88$8aR**************************************************************************************************************************************************************** !w!}!!j!1#r!!!\!!1#r!!!\!Can't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:Bc:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_COPYBACKRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. RAIDFRAME_CHECK_COPYBACK_STATUSCopyback is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of parityCopyback.Copyback status:START array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status: B$tI_\k3zw>wwMw#%O#%#%#%#%#%#%#%#%$#%;#%#%q%)))))))))))))))]/1///.600h1h1. /... /hihhhhibjrjjjxmnnmno}|{9}H}9}{9}}9}!9}T!ڌߌX!]!./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / quitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndstrdupO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). ' "ß&"!"!!(!A#P!%h! "q!z!3% "ɩ$" " ' "7''L$i! "! "% ""% "]! "\! "˫[Z!!! "g!!! "U!!!!23Ldf/aԴ ):))U!!="!!! !!+!7!E!R!b!n!~!!!G!!""F"["r"""""'">"O"m"~""""'"\""""""9" a" w" " " " " " ")"="T"k""""""" ." ;" N" ~"""""'"E"["p"""""#"?"h"""""P"""" "# "; "c " " " " " " "T "0 "N "j " " "! "! "" "$. "%C "&^ "&~ "& "& "'!( "( ")+ "*^ "*Y "*q "+ ", ", ", "- "/7 "0] "0{ "0 "0 "1 "1 "2"26"3Q"6c"7"9":";\";";";";G";T";^";z";"; "; "; "; "; ";>"=Z">{"?"?"?"?"@"A8"B]"C"D"E"F"G"H"I"J+"K?"LP"Nw"P"P"P"P"Q"R"S"S"S2"TK"Uq"W"X"Y"Z"Z"Z1"ZQ"[p"[~"["["\"\"\"`"a"a-"aE"bR"cn"d"unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identifyreassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. %s: scsibus%d target %d lun %d <%s, %s, %s> unable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneentire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x W;;z;;;;;;;;;;q;;ùaC%ƽPFPF0* XXX,,x<<%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. 000 (00000hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname   V q`H3>%D-5< "S "!"!"!"$!"#9!"!"F!"T!"f!"e&!s!"!"!"!"!"!"!"!"!" """"'""/""'""C""'""S""'""e""q""""""q""""""""""""""""#" #", func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)destroydescribeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)#,:7-I-d---oK^pp0J  < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY__24RSrs   "'(229;446:<<BBks *0/000 %& #      8 : ? ? gi{BD psvy0WX``   ;?__KLn : ; N O U W q z      ) ) 1 1 4 4 7 7 : ; = = C F I J N X ] ] _ e u      ) ) 1 1 4 4 : ; D F I J N U X [ ^ ^ b e r     ) ) 4 4 : = E E I I N T W _ b e p      ) ) : = D E I I N V X _ b e p ;>\HHkp""((++35:?ZZ^IINOWWYY^_[^}w  7?T_mmqqtx,/<?ACnou LO}FGNOXXZZ\\^^~  ( ( ) ) * . ` c d i j o r s O!R!!!##'$?$K$_$&&&''' ' '('('L'L'N'N'S'U'W'W'_'`'''''''''''++$++/,/,_,_,m,s,x,,,,&-/-f-n-p--------------------........////@0@00011-10111111122D2O222MMǤ",?x./ko77==??BBEE@O$/SSgglouu  '';;>>NO^46$/K  669;=>@            4 7 ; > H O Y o##c$o$t$')szFW_rUU  ::??EEGIQQצ _)#*#./000>0A0MNƤ0k`66666'7\7h7y7778`5`5 56 5 5T8`8 040H02KMIIINJIN7MIIIMOXOqOQThQQHTU?LQU(VdVQR2RII[LVSR]RVVRRWSMTT,S3SWZSS0LWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTF SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. S-  co>>>>#.L #:l1ASc?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t ""#n7!"""LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionCannot allocate memoryLINESCOLUMNSkrklkukdkPkNkh@7kDhcxndaticmso|^LESS_TERMCAP_DEBUGLESS_TERMCAP_Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 08bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF8utf8invalid charset nameinvalid chardefchardef longer than 256.less-history-file:.search.shellLESSSEPARATORLESSHISTFILE.lesshstLESSHISTSIZE"%s less %sCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s option!done|doneNon-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found(P)/usr/bin/.syslessLESSKEY_SYSTEM/etc/syslessLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledCannot use lesskey file "%s"Warning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~...skipping... Cannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current fileMark not setInvalid mark letterlog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parameterssearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filequit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollwindowquotestildeshiftno-keypadold-botfollow-nameuse-backslash... (interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sD"D#D%D' Z n Z   Z  Z Z Z  Z K   Z Z  B %!(#k%-"s"0"P9#S$'#&'3"!#!%%7#?2?2?2?2?2?2?2<2 @2?2 @2@2@2@2@2?27 D7 8 7 8 8 8 7 9 : 5: : 5: 5: 5: ': ; ; ; ; ; ; unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... ? ? B <@ 0@ B B B B B B A  @ H@ B B B B A @ A "%=$ 0l$4"<%H9$@"@%#8"Dy!D@$ "@"L"P$T0%$$$$-"5"="E";%alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/netbsd-10-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/netbsd-10-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/netbsd-10-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)e[ n[ [ [ [ [ [ \ \ ] "] 0] $00 ""-"""ĵ"""̵"a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP Informationd e e d d e e e e e d e d e e e e d e e &e B:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu buffer p Ep Ep "p Ep o o Ep Ep o Ep o o HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... = 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written W   o      FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file                 ҏ           #  < K  Z i x                Ґ    ) D  S o   ޑ     ( 7  P f  Ε - i - - i T          . 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory ݼ ݼ # W  a r r  r  ^ h               ' I  X          s /+ + /+ a /+ /+ /+ /+ /+  /+     /+ /+ /+ /+ p K Z /+ /+   /+ i x /+ /+ /+ /+ /+ /+ /+ /+ /+ +  /+ /+ /+ /+  P  /+ /+ /+ /+   /+ /+ + P /+  /+ k /+ / /+ /+ /+ /+ /+ /+ /+    /+ M  /+  /+ C  \  /+        R  { /+ >   ( (    ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ! c! ( ! *" ( " " ( ( ( " *( *( " M# ( ( ( !  # g" ( |" # b# ( ( ( ( ( ( ! -# S " ( 1! ( ( t e # > ( # u#  ( C! # # ) N! &! ! ( " ? A@  @ H@ G G G G G G }G G G G  Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.File%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] w w w 4x w Yx y w w x dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Ӆ        ֆ                  %  , B G ] h n w }  .     ΋ ԋ ڋ  .  X ܚ v                    # #Q!0#<#I#D8$<#I#D8$"_#s##E#Z###### #_ #^ #F #< #>" #?5 #H # 1 C b |  ) d     Ƣ              + K        ݺ  PATH=8 2  < F           L P T  2 Z          J =      4 g    {    # M  N D       n j   n X =  ! = = = = =  ' ( 6( * * r( ( ( ( #) ) 9) ) * *  * * U* '* .* 7* @* G* N* ' ' * * V+ + + + + , , &, ,, - }-+?=###%%%} &4|%t=!"f##d##s#"c ##m##l#'`&r ^%#p# #n!##v )#թ"b    W W W W W W W  X W W W o] o] MX UX o] o] o] o] W W Y o] o] KY o] Y yh ~e g 2f g h f g |g &h Rv fh Kh e e p y y y y p k m y .n =n y y y y y y y p y y y Ln y [n jn n y qn y z z y z z { z 2{ H{ 'b$=#E#I#M#R#W#[#_#c#h#m##w"q#v#}#############+$#rT!#L### #@!%#x#Î"j#%EOF reading here (<<) document}-+?=Չ , ; ~  \ \ ~ ~ :$z###}#####%%@%#####%##@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'40#41#(41#<48#P40# d40#x40#40#M 40#L     ( ;    i   ҹ    i * i ? H Q i i i ` k ˺   } } } } |    Ƽ    7 R f# E! ### ";W$#"!"0s"LM!K! 9%`!%]' "# %" S&ߋ!J#;"C$]##L%44# 8#!&#z%"#":$`#                =$: #$ k&8 #8 ~'# # # # # # B% G$ #M & #'  #8  " pd$ ~C$җ =#: # #Ѷ w%" &' #? # :L#p #F #3A #% % &#X #  K" ! 0m%B # "@ ]%5 #' f#' % $bM ˏ"L Z:$% & =#" # W 2 t W W W W W  W W C W              c c  C c         w           ) )     3    3 3 3 g  g g g g g O g g g  g O g g O        R c c c c  O c c E Y  c c c  c  c  c  Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set:]not compiled with history supportCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguousCannot fork (%s)You have stopped jobs. && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-Current option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALLeq!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %spgrpbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefcinputrcgetoptsfdflagssetvarumaskunaliasulimitwordexpevalPPIDNETBSD_SHELL20220122 BUILD:20260402190042Z SMALL#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complex%s: invalid field width%s: expected numeric value%s: not completely convertedUsage: %s format [arg ...] pB$#$# ""$#W$"&#$##'! $#% l"% $# &'#8(#[!$#:% c&#0 & x" j&# |v! q&# '#1 |&#o %# @%C '#2 h0%C %#c &#k c" fx% &# ~&# y# %#$ U!C (#(#(#(# (#@?!@(#(#(#(#&#&#&#&#!#&#3&##&#3&#2&#3&#3&##5(#=(#L(#T(#E(#'# (#@(#(#(#ǝ"(#x"%(#,(# &#&#~'#'#&#&#'#'#&#'#v'#'#'#@&#@'# &# p'#h'#'#'#@'#'# '#&#C$&#C&#C$&#C]!"&#c(#j(#q(#x(#(# (#@'#'# '# '#&#&#&#&#       discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...]    ]   >   >  ( / HLPRfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... owner:group|owner|:group   W  v   I    # l  B                             j 3    a     v   e     N  "  " " [ "  " "  # r!ҍ!܍!!!!! !!&!!&l!&!q!+!4!?!($D!H!qq!7#L!P!X!\!$b!m!|!!!A7#I7#Q7#@W7#@]7#@e7#@l7#@t7#@}7#@7#@7#@7#@7# @7#@7#@7#@7#@7#7#7#7#7#7#7#7#7#7#7#7#8# 8#8#8#"8#(8#48#@;8#@@8#E8#O8#U8#`8#g8#m8#s8#x8#~8#8#8#8#8#8#"7#8#8#8#8#8#"8#8#8#W7#8#8#8#8#9# 9#9#9#$9#"8#-9#49#=9#E9#M9#7#S9#Z9#n9#d9#m9#t9#}9#9#9#9#9#9#7#9#9#9#9#s8#9#9#7#7#& !!!p!!!!'!-!3!:!D!A!E!($"H!$7#K!$Q!$%A#6A#FA#wA#A#A#A#A#A#A# B#(B#;B#FB#$fB## # # # & ' ' ' ' ' ' ' j' &' & ' ' ' ' ' ' ' j' &' ! B#,"M B#9" C# $: )C#"g VC# E!" oC##" C#n7!2# C#*!!4y"J# C#4!# C#& !!!p!!!!'!-!3!:!D!A!E!($"H!$7#K!$Q!$# r!ҍ!܍!!!!! !!&!!&l!&!q!+!4!?!($D!H!qq!7#L!P!X!\!$b!m!|!!!+ + + + + u+ + + + + + & !!!p!!!!'!-!3!:!D!A!E!($"H!$7#K!$Q!$# r!ҍ!܍!!!!! !!&!!&l!&!q!+!4!?!($D!H!qq!7#L!P!X!\!$b!m!|!!!AB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtenD5can't get msgbuf1 5 l2 5 5 5 5 5 "2 5 72 5 2 r2 5 5 2 5 [2 5 >2 r2 v%%L## r!ҍ!܍!!!!! !!&!!&l!&!q!+!4!?!($D!H!qq!7#L!P!X!\!$b!m!|!!!|%%D%. %%%[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]returning to single-user after filesystem check dfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!L    =  = = = = = =   =   = = = = = =   0  X  q  X  5  5 a w       returning to single-user after filesystem check  n= j= = j= C AC )C VC C C C C D 'D D >D pD D D D ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@P#P#P#Q#Q R R R Q Q untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-10-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-׊#ߓ#####M#V###'### ##.#C#U#i#w# v   ~      <00T0l00000000400T0l0000H#<  Է Է Է Է Է  Է   Է  Է   !h!.h!Ah!Wh!xh!h!h!h! 3i! Ri! }i! i! i!i!i!xi!i!j!)j!cj!j!j!j!j!j!j! k!!w##w#$'k!&w#1w#2/k!3w#4w#5Kk!6w#8Vk!9\k!9ck!:|k!;k!<k!=k!@k!Ak!B+l!CWl!D~l!El!Fl!Gl!Hl!Jl!Ll!Ml!Nl!Om!Pm!Q&m!R;m!SUm!T^m!Ufm!V~m!Wm!\m!am!cm!dn!e$n!f8n!gKn!hKn!iKn!pRn!qw#sw#tw#uhn!vw#wnn!xn!n!n!n!n!o!o!)o!;o!\o!|o!o!o!o!o!p!p!=p!Op!fp!p!p!p!p!p!p!q!q!q!q!;&%͢#|nQn- q+آ##|nQn- q+##|nQn- q+ ##|nQn- q+$#/#|nQn- q+=#!=rGy=iG}A#L#;Mt?W#b#mWC 3KOOm#x#yD<#*=(##3Dh&]y"#\ M}-##-чHD!̣#-чH$#ZIчH%#IчH. %#IчH]##2IчH r!4#S'@ )Ѹ@#G#*1@ )Ѹa#|!1x )Ѹf#p# 3  3 H 3 3  [-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglu] [-i index]gi:b:lua %*s %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuUUID changed[-o outfile]/home/source/ab/netbsd-10-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u #}##0C%0##<0## #[8#/4D{Z#e#p#|## ###@#### #0#@###j%''# ## #@$Z%#zi0'"yi###<0#80Xt%##<0g#d0#01#0#A$0x-$0##"<0#X0,#2<06#\0=#\05#{<0<#{<0&$Z%#G##Ц##Yl%&$y##$#0##$#0$#$#0###y#0###$ 0F"#F"<0#Yl% #Yl%`##@###Yl%Ц##766666d,,h--h-e.h-3h-3t55a7O#?<0U#|0 #0##0##tG "VVXXXXXY\\>[[[X\\\\\\\\\\\\\\\[[[\\\$\.\8\B\#0#R<0#0##pI<0#0##4J* <0;$0#0#d0#R<0]r%0#]r%I* <0:j%0k#80&"MS######_## `:#:#Y`m#r##!#x#m#r####x#ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeeui64inet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI%"n%k!r! x!! !!u(%!@H#O#T#]#g#k#p#w# bnorripbgensbextattbnojolietbnocasetransbrrcaseinsegjo:rextattgensmaplcasecasetransnrrrripjolietrrcaseinsV!`!#h%;%#>%"n%k!r! x!! !!# #%@%u(%%!Z%@#_!d#b%!@#$#softdepMddddddddV!`!#h%;%#>%"n%k!r! x!! !!%@%u(%!@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorGsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath dOTddddmdddddddddǐddddddddАdd d8dd@ddIZ6cd˓V!`!#h%;%#>%"n%k!r! x!! !!#_!u(%!@###"%# #@ ###!_E!%"# D$@/B%u#{#(#### #@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac23Aa:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXwsizerdirsizeleasetermreadaheaddeadthreshtimeoretransConflicting version optionsIllegal value `%s' for option -%cconndumbtimernfsv3rdirplusmntudpresportnqnfsnfsv2maxgrpsgetnameinfo: %saddr=%s, port=%s, addrlen=%d, sotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d Usage: %s %s %s %s %s %s [-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-I readdirsize] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path nodeUnsupported socket family %d%s: error = %d rpc_callrpc_getport%s: reject, astat=%d, errno=%d recvrpc%s: short write! (%zd < %zu)sendrecvno : or @ speccan't get net id for host "%s": %sNz۞u(%V!`!#h%;%#>%"n%k!r! x!! !!!@!!g:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point ʴʴʴʰʴ?ʴʴʴʴʴʴʴtoʴMʴʴʴʴʴʴʴʴʴAʴ^Htʴʴʴخʴ"ʴ?رsiqiiiiiVsiqiiiiiV%s: can't read disk label; disk type must be specified%s partition type is not `%s'#B#p####s######+#K#####$)$I${$$$$$A$c\tDZx WTWTbSS-mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberIaaaaaaaaa_aaa6%s: can't read disk label%s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file SSSWTWTbD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Z.022220220222u0Y0K12 022222222222202//2@1/V1.2212g0K00/d1/W/2o1.DEEdFFFEEGbGGGG.H\HHHH I GIIIFAOKOUO_OuOOOOOOOOOOO`RMb@A{Gz?-C6??333333?(knNK AzDCannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dst[p\[p\ \\p\p\p\p\&\p\\p\0\dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] K`mm`m``m`ammammammgdmmdmdcmddm ecdde&eIebe{emeemmceeee ffcfcc$fcmc:fmmmmmDfNfXfmm_fcffffffrff~ffffffqqqqqrqrrrrrrrrr9srrrrBrBrBrbssssss$u;uww.|w.|.|.|wyuyyyzzzdfLnqSsTtv%$%$&$?&$W&$&$&$&$&$'$2'$^'$'$'$'$($*($X($MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGNNNQNY~UGHRBD M@dmCLS1@2plb +6atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspec*PPPPPPPPPPP$Pċ@PkPPn\یwPPPPPPˎ hw.disknamesswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node _x%,"7$"#"w" $7$ E!p-7S$S$S$]f^fffdffffef^ffffff^fffff]f]f^f^f ^ffffffffffq__f^N] ^/^f"`ffff___].`>^i`M^r^f`*************************************************************************************************************************************************************************************************************************************** "zZ$~Z$Z$Z$Z$Z$}~~P%"9$%>C$" C$Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260207%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldWriting to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)_ַFg,M{Zj%j~~/NetBSD gzip 20240203123456789cdhlV(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlV] [ [ ...]] compressed uncompressed ratio uncompressed_name<**X1HPTX\--+++++++++++++++++++++++++++++++++{}abcdDgGhHilnNpPqrs tw xy !:#=P>oo%oooooTooooooooooooooooooo;ooUoo:doojo\ %lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] I T  ?      ?IGI,:jx ;HUa&2>JV,:Hx Pu^ -;K3%=%""7I%R%7_% "7g% "\7s%|%7.%%7%%7%%<7%%7%%7 % "7% "7% "b7&%.%7;%p7B%I%7S% "7]%%D7f%3%7p%%7%&$7%&$7%~%<7%%;7%%:7%%;7%%97% "W7% "V7%~%d7'%%c78% "b7C%Q%d7c%%a7o% "7{% "~7%%%%%%%'#%X%\%%%%%%ܑܑܑsM<З44444bB# r!ҍ!܍!!!!! !!&!!&l!&!q!+!4!?!($D!H!qq!7#L!P!X!\!$b!m!|!!!%%%%%%. %D%#|%NAME=Z$    !"#$%&'()   !"     !"> C\E7j?JXfF1LH_ro  # r!ҍ!܍!!!!! !!&!!&l!&!q!+!4!?!($D!H!qq!7#L!P!X!\!$b!m!|!!! &%&%%$$$$-"5"="E"x\\\\[^k^y^^CkkkVkVkVkVkVkdkrkdkcdtTT]TTTTTHU\UmUVXW2XuXqXVZ]__IaadgJiRij-jFjjj# r!ҍ!܍!!!!! !!&!!&l!&!q!+!4!?!($D!H!qq!7#L!P!X!\!$b!m!|!!!SCSIfictious\&Ȃ$,$d7 P1oz$1%!1%1%1%("1%#1%R8#1%1%1%&1%'#1% #2% L# 2%"2%!!2%&2%42%>2% N2%R2%n!a2% [5#g2%!q2%Zb%{2%p#2%%2% XZ!2% _&2%Ĵ&2%o$2% !2% 9%2%GC!2%h&!2%"2%S#2%3%3%3%&3%ı Wg----------------------------------- - --------------------//tmp/usr/var !6Qf{,3zh   & N       ^6[8yBYi6[R<H)Fc#HmNy3Id./0123456* +++$x&&&'_''''d( )))\*M++K,,01q81g23348?@@@@kAA% r!]y"]y"&%&%#. % A##D!$]#@#a#f# =#!9%׊##M###' Details for index GPT part - # r!c%!9#9%9%9%%D%. %9%9%&!&l!#9%#%%!$D!9%l#7##^%##$9%t!a#9%=#SFH0eC쬮#q!SFU0eC쬴#qq!Hah!IdontNeedEFI#â#(s*K>;&%͢#|nQn- q+آ##|nQn- q+##|nQn- q+ ##|nQn- q+$#/#|nQn- q+=#!=rGy=iG}A#L#;Mt?W#b#mWC 3KOOm#x#yD<#*=(##3Dh&]y"#\ M}-##-чHD!̣#-чH$#ZIчH%#IчH. %#IчH]##2IчH r!4#S'@ )Ѹ@#G#*1@ )Ѹa#|!1x )Ѹf#p#booooooooooooooob))bobooobbobooboobobooobbbUq! <%<%<%\q!n!x#<%?!A<%n!s!<% =%=% /=%==%tz$$($RRXSSSxTTTTT'U?UUUU%V[VXiYq[=`iWjjlAqwx{{T}<~dvՀ  77,777L7Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 10.1_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.1_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.1_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.1_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.1_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the first serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.1_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/10.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlolo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-30s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%untpdatepasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)Ukrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_free*************************************************************************************************************************************************************************************************************************************** "zZ$~Z$Z$Z$Z$Z$b:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] L)a,r, Copyright (c) 2006-2021 Roy Marples@(-2-25-2G-2-2-2-2-2-2-2-2-2-2_n{_oBRbr  0-2   A-2f-2-2-2-2-2-2-2  7 ; /@ o-2 H ^ X    !!/!?!u!!!!!"3"C"S"c"v"""""##.#>#N#-2$!$$%%)%9%-2%%%j%bM"c''dw%ei%f%j%g m%h1j%it"j3%k?j%lg#m}%n+&#oIj%p3"qE$r}%sTj%Dy!t\j%u$"vfj%w]%xmj%z""y}j%Aj%Bj%Ch%Dj%E}%Fj%Gj%Hj%I#Jj%Kj%Ljt!M%Nj%Oj%Pj%Q*%$S#%Tj%Uj%Vk%W k%Xk%ZY%1#k%4,k%6-V$5k%Fk%|I?!~Mk%}Xk%Vk%_k%ok%k%k%k%k%k%k%k%k%k%k%k%>%Q%o%k%k%x%o%k%k%k%k%l% %l% %l%!l%.l%l$s%4l%:l%Bl%Gl%Wl%`l%gl%'j%sl%AA&A&ALL*L*L$#Rv%n!v%e#v%#:j%#v%' %j%_& %w%define 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt #7z%;z%w%@z%Gz%PT@P HEPT$ @CD@DC~%~%~%[>!~%d%%m%u%y%)%}%{% % "K! "$CBEBB(DTDEEErDoHHGHHHoHHXXXXXX7X-XXXX1XX5X[Z|\K[ZZZK[K[K[K[ZK[Znnnnn3p#1%:%E%N%U%\%d% m%u% ~% D%%%Ǔ%ޓ%%%% '')*PQ'|}wcontrol_free%s: no terminatorcontrol_recvdata%s: no arg buffer%s: no argscontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: writecontrol_writeone/libexec/dhcpcd-run-hooksexiting due to oneshotforked to background, child pid %d dhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 9.4.1 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinfreopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGEXPIRE6EXPIREdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sdhcpcd_initstate2PREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with itdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: truncated read %zd (expected %zu)dhcpcd_stderr_cbdhcpcd_handlelink%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid00000000-0000-0000-0000-000000000000machdep.dmi.system-uuid/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop_event_add_rweloop != NULLread_cb != NULL || write_cb != NULLeloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclasswaitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfiguredefault_configread_config%s: embedded config too bigunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %sinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundtemptemporaryoption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deletedif_missfilterrt_buildif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtopbuf != NULLlen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initaddr != NULLsa_in6_init - %s /home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %d%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeif_initrt%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpfBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sdhcp_bind%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_readudp%s not founddhcp_openbpfdhcp_readbpfdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s%s: deleting IP address %sipv4_deladdripv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cinet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 router solicitation for %0.1f secondsipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: %s: became stale%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: soliciting an IPv6 routeripv6nd_startrs1%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL address%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: DHCPv6 Vendor Class too big%s: %s %s with xid 0x%02x%02x%02x%s%sbroadcastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s%s: ADV %s from %s%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %sSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/dhcp6.cdhcp6_validateleasestate->new != NULL && state->new_len != 0%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addressesdhcp6_startrequest%s: failed to request DHCPv6 address%s: no advertising IPv6 router wants DHCP%s: extending DHCPv6 lease%s: %s received from %sTIMEOUT6BOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 address%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebindSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscover)( ^^`??ppppSpppp!pppĀ~ppppppppހ_p}pp`wG kp~pB͝ʡԡvKAأYߦ%%<$%%"آ%?%P%^%Y%a:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlimݿ'+ݿ'+u %1=IUajsgfVU%I@843.*c'$#" rbFCV{JB%DW7#XZ%lH%5+$N%h%p&T%.$q%Z%&BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~a%xU1e% %%n% %%B%W7#Z%H%5+$N%h%p&T% .$@q%Z%&'"' 'd d d d d d d d  d d  d     e ,>Eam%$$$E%E%E%E%E%!##%E%E%E%E%E%E%@$((((((((((((((((((i(((i(i(((((l((((l(B%P_ W7#_ Z%_ H%@` 5+$` N%` h%0a p&a T%a .$ b q%pb Z%b %%%%%%y%!%%%% % # =# % % % % T% % %p!U=$ %%%%)%%%!B.!#%'%+%U!/%|"3%~"7%$y".$ ;%!L%"[%#g%$s%%%&%'%(%)%*%+%,%-%-%.%.k$/%/#0!$1%2%3%4%52!6 %7%8%9%:%;%%<4%=@%>R%?`%@n%[k$\%\%]%^%^%_%_%`%{%{%|%}%}ŏ"~1%?hAhA??hAhA?hA?hA@<@a@ADDAWB{BBBnCDDDDDDDDDCCDNDaDDDDDDDiEFEFFFFF[GH)IHdIyIIIII.K.K.K.K.K.K.K.K.KIIJJ,JHHHJHHHHH9QSS9Q9QSSAQSQSCRbRROTSSsTTTTUUSSSSSSSSSoOommmommmmm/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumcntrlgraphpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d %ju%s%0*juع=u snap ,archivedsappendschangesimmutableuappenduchangeuimmutable PuuuuuuuuuuuuuuuuuuuϿ O9~YIqQ[link#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/;GS_xMF]zEyyTu,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444   +: UO+Gc9ca.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmesh-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]PP%#jo%#jx%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrffflbiInkey wstate screwed - exiting!!!ESCDELAYTABSIZE[ sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Could not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!+77/home/source/ab/netbsd-10-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank-O8OOO8OO>TTTDTJTTTPTZ [V[[[[ abcbba5MS7) xPxPxxPxPxPxwwPxPxPxPxPxPxPxPxPxPxxPxPxPxOyPxyPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxPxwPxPxPxPxPxPxPxPxPxPxPxPxPxvzbwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9#$ !     rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^G^M^Ikbskcub1kcud1^M^J€II€IIIIIIIII-IIIIIIIIIIIˀIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII$$$$y$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$΃$$$$$$$h$$$$$$$$$h$f$$$$h$$E$$$h$$Յ$a`hoxņІTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdbansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3sDҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰDҰҰҰҰҰҰҰҰҰ_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxonbitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswslacscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom  # "  !""$  b A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cReRCMD_CMD/usr/bin/rshCannnot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz   #& +6 )4%/7(3-!0,1'8"5.*2$ 91)! :2*" ;3+# <4,$?7/'>6.&=5-%  :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'       !"#$1234%&'(5678)*+,9:;<-./0=>?@                                                                                                                                 argon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789OrpheanBeholderScryDoubt6789:;<=>?  !"#$%&'()*+,-./012345 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[                                         r sysssosˆt||7uuv v w`wPw,x0^     `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check inflate 1.2.13 Copyright 1995-2022 Mark Adler  #+3;CScsA !1Aa  0@`@@ϴ===========ϴ===ϴ=================ϴ===========ϴ=========ϴgggggggggggggggggggggggggggggggggggggggggggggggggggzzzzzz111111444444444444444444444444444444444444444444444444444)̿̿̿̿̿̿̿̿̿̿̿)̿̿̿)̿̿̿̿̿̿̿̿̿̿̿̿̿̿̿̿̿)̿̿̿̿̿̿̿̿̿̿̿)̿̿̿̿̿̿̿̿̿);;;;;;NNNNNNNNNNNNNNNNNNNN3NNNNNNNNNNNEV}}}}}}}}}}}V}}}V}}}}}}}}}}}}}}}}}V}}}}}}}}}}}V}}}}}}}}}V deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,need dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c             (08@P`p  0@`  0@`/home/source/ab/netbsd-10-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)baaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabFbFbFbFbFbFbFbFb:b:bFbFb:bFbFbFbFbFbFbFbFbFbFbFbFbFbFbFbFbFbFb:bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbcdddddcddddcddddcd@eee/home/source/ab/netbsd-10-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist