08ڼi<  ڼi%R|t |tڼi@@<@T 08ڼi<  ڼi%R|t |tڼi@@<@TU ڼi|t`AڼiڼiڼiAڼiڼiڼiuA.ڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiCڼiڼiڼiAڼiڼiڼiAڼiڼiڼi$h ڼiڼiڼimD"ڼiڼiڼi (08@HPX`hpxp$|ڼiڼiڼiL$Iڼiڼiڼi (M$ڼiڼiڼi08@HPX`hpE$vڼiڼiڼix-K!ڼiڼiڼi aڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼiaڼiڼiڼi aڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼi!ڼiڼiڼi4!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi B!ڼiڼiڼi B!ڼiڼiڼi!ڼiڼiڼi"!ڼiڼiڼi"!ڼiڼiڼi"aڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼiaڼiڼiڼi aڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi?\!ڼiڼiڼi>\!ڼiڼiڼi=\!ڼiڼiڼi<\!ڼiڼiڼi;\!ڼiڼiڼi:\!ڼiڼiڼi9\!ڼiڼiڼi8\!ڼiڼiڼi?\!ڼiڼiڼi>\!ڼiڼiڼi=\!ڼiڼiڼi<\!ڼiڼiڼi;\!ڼiڼiڼi:\!ڼiڼiڼi9\!ڼiڼiڼi8\!ڼiڼiڼi:\!ڼiڼiڼi7\!ڼiڼiڼi6\!ڼiڼiڼi5\!ڼiڼiڼi4\!ڼiڼiڼi3\!ڼiڼiڼi2\!ڼiڼiڼi1\!ڼiڼiڼi0\!ڼiڼiڼi7\!ڼiڼiڼi6\!ڼiڼiڼi5\!ڼiڼiڼi4\!ڼiڼiڼi3\!ڼiڼiڼi2\!ڼiڼiڼi1\!ڼiڼiڼi0\!ڼiڼiڼi2\!ڼiڼiڼi/\!ڼiڼiڼi.\!ڼiڼiڼi-\!ڼiڼiڼi,\!ڼiڼiڼi+\!ڼiڼiڼi*\!ڼiڼiڼi)\!ڼiڼiڼi(\!ڼiڼiڼi/\!ڼiڼiڼi.\!ڼiڼiڼi-\!ڼiڼiڼi,\!ڼiڼiڼi+\!ڼiڼiڼi*\!ڼiڼiڼi)\!ڼiڼiڼi(\!ڼiڼiڼi*\!ڼiڼiڼi'\!ڼiڼiڼi&\!ڼiڼiڼi%\!ڼiڼiڼi$\!ڼiڼiڼi#\!ڼiڼiڼi"\!ڼiڼiڼi!\!ڼiڼiڼi \!ڼiڼiڼi'\!ڼiڼiڼi&\!ڼiڼiڼi%\!ڼiڼiڼi$\!ڼiڼiڼi#\!ڼiڼiڼi"\!ڼiڼiڼi!\!ڼiڼiڼi \!ڼiڼiڼi"\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi \!ڼiڼiڼi \!ڼiڼiڼi \!ڼiڼiڼi \!ڼiڼiڼi \!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi \!ڼiڼiڼi \!ڼiڼiڼi \!ڼiڼiڼi \!ڼiڼiڼi \!ڼiڼiڼi\!ڼiڼiڼi \!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi\!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi$!ڼiڼiڼi4!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi !ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼiaڼiڼiڼiaڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼiaڼiڼiڼi aڼiڼiڼiaڼiڼiڼi aڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼi?\aڼiڼiڼi>\aڼiڼiڼi=\aڼiڼiڼi<\aڼiڼiڼi;\aڼiڼiڼi:\aڼiڼiڼi9\aڼiڼiڼi8\aڼiڼiڼi?\aڼiڼiڼi>\aڼiڼiڼi=\aڼiڼiڼi<\aڼiڼiڼi;\aڼiڼiڼi:\aڼiڼiڼi9\aڼiڼiڼi8\aڼiڼiڼi:\aڼiڼiڼi7\aڼiڼiڼi6\aڼiڼiڼi5\aڼiڼiڼi4\aڼiڼiڼi3\aڼiڼiڼi2\aڼiڼiڼi1\aڼiڼiڼi0\aڼiڼiڼi7\aڼiڼiڼi6\aڼiڼiڼi5\aڼiڼiڼi4\aڼiڼiڼi3\aڼiڼiڼi2\aڼiڼiڼi1\aڼiڼiڼi0\aڼiڼiڼi2\aڼiڼiڼi/\aڼiڼiڼi.\aڼiڼiڼi-\aڼiڼiڼi,\aڼiڼiڼi+\aڼiڼiڼi*\aڼiڼiڼi)\aڼiڼiڼi(\aڼiڼiڼi/\aڼiڼiڼi.\aڼiڼiڼi-\aڼiڼiڼi,\aڼiڼiڼi+\aڼiڼiڼi*\aڼiڼiڼi)\aڼiڼiڼi(\aڼiڼiڼi*\aڼiڼiڼi'\aڼiڼiڼi&\aڼiڼiڼi%\aڼiڼiڼi$\aڼiڼiڼi#\aڼiڼiڼi"\aڼiڼiڼi!\aڼiڼiڼi \aڼiڼiڼi'\aڼiڼiڼi&\aڼiڼiڼi%\aڼiڼiڼi$\aڼiڼiڼi#\aڼiڼiڼi"\aڼiڼiڼi!\aڼiڼiڼi \aڼiڼiڼi"\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi \aڼiڼiڼi \aڼiڼiڼi \aڼiڼiڼi \aڼiڼiڼi \aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi \aڼiڼiڼi \aڼiڼiڼi \aڼiڼiڼi \aڼiڼiڼi \aڼiڼiڼi\aڼiڼiڼi \aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\aڼiڼiڼi\ !ڼiڼiڼii!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi aڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼi aڼiڼiڼiaڼiڼiڼi aڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼiaڼiڼiڼiaڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼi B!ڼiڼiڼi B!ڼiڼiڼi!ڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼiaڼiڼiڼi!ڼiڼiڼi!ڼiڼiڼiaڼiڼiڼi aڼiڼiڼiaڼiڼiڼi aڼiڼiڼiaڼiڼiڼiaڼiڼiڼiڼiڼiڼibpf!ڼiڼiڼi $ڼiڼiڼiv$>ڼiڼiڼi$ڼiڼiڼi$sڼiڼiڼi$ڼiڼiڼi$ڼiڼiڼiAڼiڼiڼimڼiڼiڼi$ڼiڼiڼi $ڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼiAڼiڼiڼic/HͶ<σdS))W}%SZ~W0o9 68XW0a.aާi%Kej|2d3#a9e}οED ")N4޹HN O3+J8˫pkKU !J9A|eA9&E{5>CihtqUqKQ5!j|6:&:e,U2Z6iSTV 7A?!57>@Ďi)$hix:jo43 9 JeG״!#0F}Ay3x|{uNصj24Тp ѱR90CC,m z8e^bSK>o2OKCͩ>]'}HfO>~(谒V\deguтq4 *N2n@v]K= O }bqu )nD|t . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@40"4 (!!0"0'0'YLL0"0'0'Ptd"QtdNetBSD@ ;PaX NetBSDearmv6hfH-MQ X10 ];_<@ @PP  R     0R/S SP 9P' `p`pV*0/V:`ଝX`Xp`pV*0/V: .g6&7& 6&&06&5&&5&&T5&\p@-<@@8PPU*P`0/U:p|5&T6&0H-$@$P@PT*0/T:0,&4&A-@TpP#`/d \P@PP PQ804 0ឞ 0 A/'A-|tx @ዞlll`PtpPPU: jP yP j'H8!P@H-O-M`Pሶ] rBX Yb@QltBP 壃|\X8(֘p,$`P    9p' Q QQQ|Q (P6 @pЍQX<` T'''''''''.|'0'9'`O-Mܐ@Pؠ`Ԁ԰pV  P P `P pp@`W  p`Hڂ@@p`VЍ'& 'bY' Z'O-MxQx@tp``` WpV  P P 9pP+J :p$   P,``w.`p V 9p`pڐP PV 9p9`w\@`V8,hЍ ''& bY'Z'O-MXhd@ PPpmpp U P  W Z P  P P W% X @ W W% P3W;*Pzl PP{`pP @P` :XX^9 PPi#Xⷜ@ PP]`pP @P` XX$P PNX$  pH`pP @P` !XXM X^ pt `pP @P` X P XIgXI P p`]XMpX `pP @P` XX-X-ޜpF P `@P`pPu P XXP0Xp+(`pP @P` XX^X^㮜p `@U? AQ` p Qp Q X  X X▜@ hhP` `@Ѝ<'''''` ''''Z'9K-MTV UPL 2 Zp3 A,`Scs$尀4 2Zlpj P  A$D0 ,0    V(2PPzJDPG @Pp P(@ YPL8V G3p @ Q 23p  1P+X{#Y@R{P  3PZ H{Pā4@P (P d9{(1 `pU 1PЍЍP TPPPP PW  1P {PP QPPQ82P ``zPX Q|1PY@'9'Z''''''( ''''''H-@P 0 <z0U0 1P`0r1P 8`P z`U t1`\1P z` W PpU [1dh1p -PP 4@yz`UP`9'<F'PA-M@ `P,0p U P2P l l P 0P @ Dzۍ,P Xi9''0H-@Q pP1P \PP0P <z0,P 0HA09'''0H-@Q tP1P `T"P+1P <y0,P 0H09'2'H- 0◔'\O-M`!V( 弱Q@᢬PO =ptPN `QK   0p3PF E 2/`V A $Q B B ` ' Q'  Q ! Ѝp XT  < ,@@(($. P(`#=102P1"(<H-M0 00  0< 0Ѝw((H-M( 00  0( Ѝ~(H-H-M4!00 0 Ѝ (H-M4 00 0PЍ='H-M8 , 00  0 ЍP(($/(H-HH-M(!00 0ˈ Ѝ(H-2H-M8 , 00  0㱈 ЍP( ($/(H-H-M(!00 0㖈 Ѝ3(H-M(!00 0ㅈ Ѝ?(H-ld@P! AP R0PPP0PaQ8(((  /((H-  ZH-  ZH- ZH- ZO- MP@e p@NE$P 8$( 8.p(d$ PPHuLP: d,U$P  8$('e@ 08L ,].p(80` ,$ 0 ,3/ p( h$ hz`X @P D` PR`3VP P#   Q 0`@J!S#(`1#6/H@@@3/0(  "@ @ڐ"@P㛏G  \ 0R*[ Z z|80 ($03/Pv p@!0$<`_@?``@ 0 P=$ Pb wj  8!(` `1/ $`wh  @ 0`P@0``@ 0 `8 0 @`P 0@@0@ 0    B 1/vp@ 0y m< @P\U1` U0'(4Z& ='(P(9(`(LCPC(@((H-  P P> PU5!@  !pP0*B P`  `Vp  `!(P 81/pP 8(1/p0 (P1102(P(X(3@O-MLP DCDpP P g  80( @0004/ @p  PpP/  P`8@< \P!# 0@#    *"; pP̑A '%$  Q` $ ^\  O pWPWQP p Rp0pRp r* @" " Ap  p`4 Ѝh ЍO+H,D$ $ (P(X(mZ`(((Ty!H-MP\ p@` +8( (03/@P +PЍ(p@-(PUp@8 03/p`81/(`p*@-M@(8 2/P#8  P 0( 3/P (  01/pP Ѝ$ ~Zm8@@-M@PЍ@i kPЍR70S5 0 0C S/1/.!0 R00000000 0 0 0 0 0 00/  /O-M|B p * T *0V,<08(4,D"@@$d@Hg3 *}!,`P}$PQ@#A3(0 0S/2`r"@/@  ` |1`p!tq@`pd; *  ` ,1`,!$q@`pd' *  ` 0` p@`pd * /0؃` 0!xp D@@ d ` b*Ѝ(`(FMb-r{!-O@-@Lᥠ+G-MDa 6 0pWB @0Q$$8 ($0 3/PP 5 Z$s'8 ($0 3/ R!:80 B($0  @T@pGW0p@!S#( p1#7/p Ѝ$$ (P(Z='B-M`A 0P`*!s#( p1#7/p"A P`80 ($03/PP`U: 800 (0  pp3/pЍp8 x(0p 0007/p U* !P`#"P $ 㻿(mZO-yMM` zH0, (($0T 8@H\I\Y  G@'QVGGOOOOOGOGOOOOOOGOOOOOOOOOGGGOOHHGGOH H,HڨqPUꌑ匡  U0,`001fP4 `QD@@ 0P JP!@*vu Bku 7@_u ``+lPP@h(((('d((`((Tl"K-paP @`` Pv O'u GXP L PMTp>(?P  0"PJPpP LR /0` ``0`@@{t dd⬇`==gPlt ((❇ ..g((('((Tl"0H-@P@4 0  @@0((@-!Q ! 0P@R00-0 BRP0P0#0Q @00QQp 00AQX0^P,W((='h(((H-X P 00S S P Rh(!!H- ? N#@PPPP P/P lpP ip tPTl`P "T$lL l@k`#4((β( (Z#p@-@P p|P``P #Kf`dd p8@ss0$$ ⣆4p(('a"9((0H-@8P (PP #f((H-DD 5np 00 P'(h((@-<<Q@ @0 0AQ00((////O-M Q@` V VЍP Q3P봀` QʜPAP pP  0  0oP5PJ`PU(P((4(p@-x@xxPx`t t0````e`Pp<p L(((((((K-Pp@Q؀ؐl  cP `QA|r ``⭅X>P0((((('Tl"O-MPPP TTcTCT#XX pQ0PRGpPJQY   PJwP  R R `kPzPpt" @ `P Pd{H"PP IPf H`P,P(RB  P0,00@bPV !PPP@`Z Qx! @ `\PP HAP3JBpP*J 8  P'JP @! `kU5  ` @PP PPPpPJhЍ PEpq DŽXpP`  0(((((('j((((Tl"H-HL0S0 P0^(((A-P x xPl 0N^`pAT V@@pW`@V@@P@P(((A-@!P⍠nPP <`P/Jp!Pἡsq0 >`cp dPXX -L`@ Uq0$,  ('(a"O-MP@  r`2 p P 챟p@@}pP&̡́@P4 `T ` l@P( PhN) VpPW#J@ `pTY WV蠟PP T P&$ xP4(Td 0pQ0W00 pT`R`Ѝ(((4((((('O-MBbܲP P@P6Pu U0`/pZ Z0 <3  aPC $2 Q `x`F Pᕭ R R0,P0p0`P ``PQPKY  !/p P00* T@Z%   00 0Q R P0@ o @@Ƃ8WЍ((((('(4(Tl"A-@P!Pٞ`Ṃ`P  9P-Jp!P  Yo0 ≂ᰬp hP\\ zHUP =o0(, m P('a"O-Mp`P @W% W#Ƞ@P& PWPP P PJA@P*`p P,P  Ѝ((4((H-|p@P`T Q BN@DPp2o $$('8O- MS`p@p PW%@jP Wژ吣 W0 <` _Po @L@P`} `@p Ѝ@  @@PJ肟GYPG`UG P PA p[ᘂ [ ,pW_Pm `T P`p  `0  U4 @P, KY K@vPPZ#n T@PdN MHG ` Ep[@ 8a [ P ^ P 0QP @!Ln @n xx pPED@ 9^(((((('Tl"jO-MQ䱟葟࡟@pP Fp @7Tp`@`` R R0,p00^P5 pQ(A <`@ V gm ♀*@`TЍNmh  \@P0   '((((4((Tl"JU(O-M`@P T prhlZ ` AQ` Ap Q; P<8[X $` A\P`  @^RQ'p QpQXX\X\㤀`V  ZP 1p @`0AQ`0QX⌀8X X 3`0p &Q0AQ`0X X Xv`0p Q00AQ`0X X Xd`p Q00AQ`0X X XS@TPyH` AQ` X X X @Ѝg>''?!luO- MPPr@o䄟T씟tട`@ xoPp EP# SP`xP sP# pPAP -P$P` ``  0`@ }P 5P1.+8`P"QP P !PP H#P,JP}#bqP " Q |~X}PPJ P P-P J2 P*JP l|pPTrPB P>n#,jPP) P`]`Pu u+ u P#P dPPD#@PP PP01 ~4 ~|P# P0 ~pP !P^ h  Xdd m~(~(('(.(0'̅(((((Z(j((((lH-MX @0H P JP(%@"% P%@"%Ѝ(ht@='>'H-$Q@0 E ((H-$Q@0 z ((0H-PT@P !P 8:P /P  @0(A-鰀@P`PJp 0  ;R,R ;Qp R R  Qp(( (((O-MO 00@ P  00@ R @p=0G=SE`D<<<<<<<h<<<<<<<<܊H<<<<<<<<<<<<<0<t܋D8Hԏ<<H8Ȓ<4䏟P8  W !WWP6 PPJ` QpR nR lRg   `Qt 0l0CS  QP`PPJG@oPyJVW`GWq`PpQ nQ lQc`^`pQ nQ lQa`@Q$`pQ nQ lQN`Q`pQ nQ lQD``pQ nQ lQ5`"PP J`PpQ nQ lQf`0PPJ`PpQ nQ lQ_`/ R /P R `, R@ FPP p`PpQ nQ lQ`+ R@ %PP !PhQx`pQ nQ lQ`_Q ` pR nR lR   `, PPrJ`PpQ nQ lQ`P P` pR nR lR   `d UPP@J PpQ nQ lQ  ;PP&J~蟟`PJ P XJ0 PV X``PpQ nQ lQ`8  PPJ PpQ nQ lQ PPJ PpQ nQ lQ @ <PD$3PP p`PpQ nQ lQ`P`0 A R*P `P"P= ` QoQ Q gQx`pQ rQp`` {PPfJm弝p P_J P XJ P `pPpQ nQ lQL`,Q`pQ nQ lQk`Qi "  .PPJ1@P{  $`lPn"P` 4 ` @P  P ,P  y' P PH wRPP 嘫E PFZL L PPJ( ` P 0`qW`P`Q` QP WP P Px p*PJ)P P} P, $*PyJ, 0RQ Pf PAP PT P )P W  QGpxP P:4 ,9 P P2 9 P P*8 ! PpQ nQ lQ (' P P x80S<`P PVGGGooPPQ Plq) P000(0 P S   PP 'jy (a P`PJP ( 0l0CS  PP P P FQs oPpPJ P(LL PpQ nQ lQ`P PfQ o%EşP0 WW HPYJPILH@ QR XQ Q4P a kPn"(P PTP!J PJP JP!P  `P R Pp@@PJn t$0@00;P PPP]   P<((0T[ $Py #Y P X#Pj[  PJdQZ  " QpR nR lR  M  (PPJ`PpQ nQ lQ`P PwP t  }!P  o oRQLPP^bX ^qY  P Q`AP P<P D` PpR nR lR   `(!P  oo oR~Q| P P P Y3 GP8V <3PЍ`P((( (0(( ! (U='(H(9(!!},((($(P( ((.(='(('>'>'K-P PP`P `p@P  0PPJpPW@@((!!O-MC儳S `@ Z  @ Z A8 J6Rs0砣4T4XX U\`Pe"Padd1;Z `!P^.Z `GU/Joo[`PPJ`Z7^Z; 0 @ S @%^Z-Z`Y \pPN"P g^Zp-Zp`b`PJLd P VJP<0`Ѝ`('((( (!!O-MY3 РаPpU W pWppW `P @tP  0  0oP pW Ѝ((4(H-4$H'X( O-Ma圑q嘡@P PP>  Q PHJ@ <PQ Q:P.Q$ P! PT R R @P UP  Q Pd  ЍHP ` ((((((('H-\ R PP < <0PP( Q ((((!!O-MP`  P! ̰PEp @P  @RpP@ЍS((((((A-M$R R$r QDbL  RP] @Q5j/ e @  00@ R Rd@2@P+ !Q+P"J d@ 0 S0 0pp pp 0p WP@@Ѝ PtFya ppth;@P@ ('0(<(8((('Tl"K-(a@p W\ERP" PQ/+ ,BW G 0\S0S0@ Q  a \\QtTP,e(((('Tl"O- M@`Pµ@ P1 Ă弒PP p@Q Q @ QPe T"Q@H  =` P`@QQq Q @ QPH  @R[ Zt `]PIJDDATQF P  EP  Q) .P*p` s2Pa` s|#P T @ Ѝ(T(P((('Tl"((H-P D, aA1S000'X(( O-Mⴱq崡嬑@0 `PPA`U P p`@7 P P P P P` P-&`PpQ`p PB@€@P jd Q8Ѝ J((((((((H-Q:p@0 0S)  p#ʤ`P `PP LP @dP/P /0 0  (((+ 2 H-4Q @0   㓈(((O-MpqP@`0p`PV0Qp0  BQP?Sq0FPP$ `U ` PP P@HX@Q P<ЍK((((((O-M  pJ LEpPB <`P,U P ` OP $Q`''尔P! !Q Q %QQ Z= Z, `OP 8$Q`+,% XY pU U ,`sOP #Q` PP \R  PLQ pm`Q> Q ` 5OPl "Q`,& rQQ  R& R< `OPH 8"Q`,~~  A Q P A Q   0P Q:;AUAAq  U0,`00NP `Q' DA,+^ pPp^ pwP @ P!@orЍP<"(((D((@(('Tl"(90(H(L(@-@JP 0e] p''Tl"@-H R <0AT B R @Q:(X(H-P  q\Ro MH-M (' 0 0uoЍH Ѝ/(H-,! P P@?00 QQP@T5@1<@P- `PpP QxJP @@ (^P d '0<(mO@ @ D] 00p((P (((('Tl"7 O-MP`@ P @P @\P [Pk@PR PQ  PP\`DVPP@@  V0,p00MP PPpP2& @P"  0ЍOBv\ o8PP X  ('PЍ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx(K  (((('Tl"4(H- ʌ^R ]R[Q Q]Q0.CQ    R  ]RQ@]QA-pPPP` VP2@5PP- PP%P1 @RPP TP"P 4PgPP((O-MS%P R @PrTZqbr弲@Z Z 0 <@ LP{ `"0Q@ `@`@ \Q  QQ o PP @PAP P)P P `da\  T0,P00_LP PQ;; @,*@P% !?[ pnP 1[ cnxPHЍ @@Ls(( ((((('Tl"(O-M @qQ elP 0p`VaJ@V. PVJx!p@`P2 @V  `P$ T@P3"AXh 0(`PZxPl 1  VPJЍ((((((O-Mp`PU  P  01 @` 0fP D `@p[; ` V8 [䓟䣟 [< 0p 2KP pQ刓pP  0P3  @A `pW W<0  JP Q ᠒P  0 R  0PnJ@`pQ Z Q  0ePi `@ R堡報 R,0p00JP0 dpQTLHV  P (S$P  0Jp Z  oY l1P ߍ^Y ``lX P4 4((((('Tl"b O-M@0Ps弳弓弃 \P0 &Pe `PD R R 0 p00JP p$$sQ VhE 0P @^1@Q20@P. bPD R R 0 p00IPl pHHrQDV1E 0P @' PT T 0 <p IP> pqQ UU @JPf8qT0 a   T0,P00~IP PQ**"mX k/P _X ppkh!P@@Ѝ( ((((('Tl"G-ؐPp`Pd 7P X [k#J\@q   0! ($(('Tl"A-PAQ  1S@pT `J@VAQ4 40$$ 0pp 0$((>'>'((O-M✢p㄂ptRd"d2P`mHPK0Ÿ0 PCpa@FT:V, V<!0 0 1`0'Q0C`!P PP Q!0@ !`PP` p`! 0 1p0``Sqp'q0P 0 1 0C`p22@@@ 0C PʔP l0 0X0DP LЍ>'((>'$((((((} O-M`@P/(P`wP#CcprEQm,pbr㔒ㄲ *cePrPf@PTh00000,KPLP PP@sP vP wP8FPp!=0`PE-00 X! R R$q,1 aP P PI  N7g@Q P  Pt  !g P  PPP `P %PPg< D" 8(D(@(0(4(<(,(((0'E(Ty!Z` H-ȁ 0rif' O-uMM0P`P U&  +  Q ⒞P $P0ph P*? ?$P  2/P, 3SP   P \P 9P   P PP8P4 /P $P+ '   P  KNpuߍڍ@+ዝP t#@0hP H ,NP`P $PVr PVD P( / P /P @@/PppP D [G X Ta  @ \$c 0Pc PC0pP   0 hqX尀 h@P`` @PԒp P YPXP   PeP L   0pG.NNUPeW  ~.DPT 8-<="#L H-L="#D4  3@(,(Z<(2C!8(   0(4('  ((D(E( \\=\ \9H-XX0Dd T  V H H0S \\HH-XX0Dd T  V H H0S \ \HH-XX0Cc T  V 8 80S \\HH-XX0Cc T  V 8 80S \ \HH-XX0Ee T  V X X0S \\HH-XX0Ee T  V X X0S \ \Hp@-X X`p@tPp`t0 T  V  p\\p@p@-X X`p@tPp`t0 T  V  p\ \p@oO- MP@\41T`UP  pgPPp`RPf `1@GQDL\H$0<TPX`ş%5`utt\%00|ş|%(54u{`` 0o mDkige@$000v `] |Nlğ$T4tq^I<tt   PL4@pğ0$s00@ß#3s93sß#+  ppX#000dX@  #0000Ÿ#2s p2"PP P \P\"\r`qL\"<V ``QT"X2p `W `P `00 `0`\`RQ X㪐/PQ P P P&"P P PP dP | H` \4` \RX EQ @Q , Q !0 S!P  F Ѝ6` X(ht@ >'P(T(\( (((H((((((((h(d((`(((((|(((x(p(t(l(0' ,xL  <(8$P(>'L(H-z} %eb' O-Mp@"P TPy P`P ЍOpPbPR A娡p@PD $ R 01LP \.PP$ PP >d \ 0P 3d.SPX  pPn@j@hPЍ@TQ( (|(\(((. - L(_ok" 5S \ S \ \  S / S 8 RL R $ /` S \ ((O-MQ ` pX0, \XTPlh84d`D@ @PLH(`$ PP $IQ \/ppV \.P PPp0PPX X`LHppt  P  RHd`LQ3Pdx0D  ax `B? 0`Va@ lP y@Q @Ѝ`P  Q 㷓(3 ((` ): ((J ((P(x((O-'>'('O-M@Q,Q Q 4!1 `PVЍOܒ ؒpW9 @Q ` . [`@P`XX X ^,P4   PJ`pP @P` XX`X k^XpWX` AQ` X X ЍX ЍOS^((((x( >''O-M@P,``P P 4`PP`UI xqxh, = [2`pP @P` XXX,^`0 0@`0 0QPpP XX P XX X ]X ],P4   PUP` AQ` X X ЍX ЍO](((x(' >'p@-@`4P R7P  V P@8\<p ܎  ؎(7Z O-CMP @@T3∠pD  0Hp `p V JIP?P ?` h P<W:PU:? Cߍ 'p@- M@ ` fHPp TR BQ P ,X0 T oIP Ѝp'O-M@ptIP P UmP ZuP `tP%<pPpATe :x p UH:pC0A=p p` = .` 4[ fp [ U:mp  pOP J p  P[ /pp@sAp@TY` !.0'i!ZH-kt \Y' O-MMP@4t Ibp UhPfP hP vP iP4  pp)PEU$A!㿷dPEP  P  `+r P ! qUDU3YP Z/P / `pp/QP pp/~PPP  Q:hX'` #P`X@X` ((((0'( H-s 0n[X'  /(O-M-MP@PXP AP\ P 8dP 8`^PG  @a\P4P_ @T@  PJIP !P 8*PP@)`~MT2pàXd W`㐄吴1 0Z,@  P p@ p$@8tXA ,GP @`` Zc@Pp'pw W  AQ  Pp `YPP 0? 글}4Qy  GP9p⪋ `$ PWP ᡑ A pЀ ᚑ A)d 0 L  (r ^Z  Px,$ Np? 80 @ $IP ?TX $FP P xr?@@P<j?/P Hc?@_?@ $;@$$P Q?$P -P D?$P P `P ]YЍЍY@((( $ 'A!` (@ Z((([ i }  P (EA-MP@kP3  ~p  ((% (> p R s%ЍNP)  ap   p R x`0 P  p0z`>8P p88 80@k$     L K"Z(  O-')hB'( ((((<>'(5>' ,>' (m $>'0) (m8@ ))H>' H-M pP`@p,ړp)P VpV t``` 0+pЍ(㋉@>'RUYC4K-Mrpb% P"P  @P   "0000 #XphBl WXRPLBP   P BPP P4AP + PAl Ӳ00P UR pA P\     QQ  @P  & WP \P p +0ؽ H0W@(傲L@Ѝ >'@)()(P))p) ( (()@>'hB'5(())D>'<А))AO-MMR"~"`6<堂V `尠X V@00 T P hB\"`U@0 ჽH"@2~ 0U@""1[aQ I !砐 U!F"n ;@U፽ 0P@0` P|!1~ 0U"d!0p24 (,a@0P @0U@  U @0 "  n0zUH! `"0nU[ "N7 \\"> =VߍڍhB'')((hА)D>'))s;& *p)A-~MHP 4PP,` @~,P~܍<>'( >'0H-Mxx @P`P 0@㞹QJ 0pʽ q5@Ѝ0(( >'NH-PPT4 4Q$$0 4((p))nH-@P`p wPp@DPTWH-@P`p GPp@DPTWp@-P@T0 0`P@VT0 0T @  T`t@HH@ 4@( 0 4p<>'( >'(D>')(O-M−@T|`pP  @PpPE`UW@T80 @  @Q *tB P@O4@lP4T  0øQ*J P0~PZ#P ݿP ٿP tҿP οP@@ȿEP@@T JT @PT4T tڌQ ᗊQ llp@ 3 L꒿@ 04 D4Ѝ<>' >'( (()D>'JO- Ml@PSTPO LP\F0P(!00 !pW* 0〰PP,QJ[PWpo ` 0@ [0QZP Pxd `   PJ8@u3 Ѝ<>'(hB'((( ( >'mi9 O-MPpPPP<PU8찟P@P2:@ 0`PͷQJP 0go V 0PP嶷0 S P  PҾ( 3PPЍ<>'( >' (O-MMP`VJP@P PrUD3pV C `p~,Pp̲bᎎH/@@ pgH/@pt ~,mPr@ `~,ePp\H /``pB`aW UWH/pcڼp`@UI  0j$4! UC lUPa 0q! P 0sH 0P8x`p!&!``pq      2p`pߍۍH sp08 0 2<>'( >'mo)lD>'N)O-MMD pн($28 pĽ#x2@PPP ЍۍcP02PP  P pWWNP 1\2422 2P0JhShchxp{@.P% P   P ᑹ P$ 1111PZ*PtZ1@ @b<<2<W 1((W1  R111111P6J̑QAp{.P- P QrPYP SP=yP  `4p3d1sP. D 1 1 }1{1y1 1PZ @ @0 j1)@P 10jX dP @U1?@@1x)(((Ē)p)(,>'$>'(D>',wRhB' 5]<>'P) *Q(}a@-@(p )plB'H-@ҚP ,媸(~ 21((H-vp Hn "1@-@:pa 01@p@-MP@pQ@PP NPP  P P B` p   P 7`@ЍpO-M@PpJaH0/PjJ 0/PeJ@6 PTq̀㸐  X @Q @0`3/P< 0P3P2J$!P 0P)J>P$J/P PP w 0@  0PP P (0/D )Ѝ跻 k0)('x)O-MP J!LL0# pW@pLP^JQ倱pLPpWPC GP@JY@PG 4/`PJ  2/pp(PJ  2/pPJYP /pVpF  @P/L 4吲" I Ѝ>'P>')hB'2)WO- MⴡApp`HPP'$ |2/P @ R 80 3/PP Q? WP; M/ ᑠPp[ P P pWP 3/NpP|(/ Ѝ`R X<1/P P,/))hB'o()O-M`P7JH0/P1J 0/P,J&P)J%5@lPP \P D&C/4P $PJ@SP (0/, `M'Ѝè㸰 p @P  @Q @0`3/P 0@PJH P   0@XP P P  |P9 dPJrPJ " 00 @/P P@0 ᡟ88 PP P P 0QP^PfF e PP Qf tP P@Q:P P  L @PQ @PF @pf @03/0P@, 0PPz | @P m kF  RUG  R+JPQ6P>F =  0ut("PP p @P E A<  0 @P"F  R.G  R# @N0S 0@( PP $ N8)4)lB')()0)$)L)H)())P)d)|B'x)G-AMp/@P P`PnP 圀p ᮱/P x 0p-PP /P PW( 0n-Aލ((( O-Mb@PPXJUUNH0/PPJ 0/PKJ̡P !PDJ X "#P=J嘑  M|NP. (0/P`!P J$(AP C@P   -@ 0@,ЍP帰 EP   0pUP P P !PJX "PZ)$)@)()p))P)(5x)O-M⨔p Za P.J `P+J,0/P&J02DP "PJ(d P W 40/ `RP t$ `ЍCPP\$PJPU PP !PJLi Z % PJ P a.   p (Pp@/P dP ῳ  .TʜP  p  @PꀷP"01,H i P (@PP P 0g1/pcP PP/  @P #   D03/p  0P,P  @P   L q  LW J P PJ  P P J pP ,@ L  F ))($)`)())P))x) )H-LP  P JPJ(H0/PJH$))O-MMUp{`  ᡯ P `+Ѝۍ@ /PY/P /@p#   P'`PJp PJ"PJP PJdv P  `R #G v0$`(+04T@dpGP ᰬaP(  /P 9P *P:  PJPJ ( P  p44 uP` P  "Q + QP0P7F 7+.*PU @Q:P PF p 6|pnڰ pn hmf,F R G RzPtQ0P7F 7꯵X!0`*nprPf Pb  @P   FKOF R] G R4  $h))(0)$)L)H)())P)))x)]?0H-@P  R ~ Rڼ~<  <)0lll0 pNPJL P@D0@P  0贐))))H>'()Ȑ)̐))@-0@ PR ~ Rڬ~<  t'))O-MPP )@Ѝ嬑q` R@PJ刱p?A` ᔰXP0P 0 RpPP<J1PU Up Q  P) P: @PJx  ll 0Р00 Z0 |PDUS@SU4()@))H>'̐)Ȑ))А))hB'qG-a@P? P(7pQP1JĐĠPʰPp RWpPc(3PJpppP8D 0@p@0 0@ L>'hB'А)H>')̐)Ȑ)0 @_̐)O- M@ @@H 00p@ 00C`So``V``PP ` 3  ?ἯU P&JРPU`U @APPJ  0P000S00PU `u @ Ѝ@̐)Ȑ))А)K-ȀQ`PP ڨ 0p@00 00 tt@pPJP pppP ؐ)H>'))А))̐)Ȑ)0H-80@P0$PEP0H̐))Ȑ)H>'O-M@ؑ P  P~'NpXڔ!1pQU`T`dd!`pPPU U$+P7J1Q 4 T` pV, d `V @D` Rtt Q }Q HЍ p))H>')3Ȑ))̐))O-M`Q|||Pp@HTjPJp@T@ pPE`UpЍ̐)Ȑ)H>'O-MQ儐P@`pKWpP`Wp `@DPT`pЍHPp̐)Ȑ)O-MPP!嘠@`pKW|PJ`pWPpPUOu``Ѝ̐)Ȑ)H>'O-OM`I PpF 垫x2FP p0H!&X4q4A4a @RP+J R PXx gpH L0"#  6&px /&ױ0T &б0 &Oߍ<) ̐)Ȑ)H>'0O-M@I `Dp @Q J!P !0Z&ꘀXPZPP崀.hP`` @RP( 0 R /P R  0` BRPZz``W J R PX `` H`P 8P $ %Ѝ\̐)Ȑ)`)O-]MPp 4 p5pE 0 @,8♪勀 H2E`P 8p0"%`4`D`}P L"0%P[Ӊ( $B ` PlP%`P0( R,$   [?44 OP  ` PP p+@)(*px |0" P#`  P 0$`꙰ 0K%` P ꏰ P0P?%`@0(Q,$ p!R P4p`]ߍ<) \)H>' G-` @P   /R dApPRT $KQ  G8p]P' Q; P0Dpp.РȀ.pP$( .PJ 0wDЀppl 0$ P张0D $PP$PpY)e)T))O-M@//Q/P? p` P`6P/ pP*zp4 P   p PG 0 /pP  Q  PЍ/\)H-Q#J@ pPph`勯UP 0<$P p}0$ 0$C$)K-MQcJ` {@PT@hp^\!0$PP $( UP$ R P  R  RN EF ` `CSP ?pP 0P#Q#0Ѝ\)X)))tB'pB'!)H-`p@xPP &P (噟 0#P)@-@ P $傟Ү 0@#)H-M@` P0 `.aQPP' P  0`# Q  800`Rp`B3Q  H0@!R!B3/ :P NPP py 0,#ЍpB'tB'JMbf/H-M@( * R I.* PRP ` V  [ p   P, " 0Ѝ8A-MpP@P bP* + `.P X  0@"Q "#!"# V"Ѝ  P XfP p3pX 0)Ty!i Q/*B0 0H-M@P QJpQ B `' & C `0 &' !Ѝ)gO-MM@( @0 <,P `DA($D {AD ,( 8P0$p@Ps8tDt v`tvptP P CP8  P  [& K  ,Dp:  CP8 p P p,j,j (ZhP# 7X XlP Z[pP +pl$,"0!P  P! 0!2؁Q P l0,P+Q $lPBhXP< p0PXP+DP, &< $!@7Cpl?8$ Q?0P8 긬 $0k!0 @ l  @o` $@@Ѝۍp)!8)T)\)X)<tB'pB'p@-M` @PPJP PЍp  P ۩P pPV TPp0 (PX 0 !P))Ty!/O- MPR^ 0PpP4W@@@P `T V RQP 4, | | $P   P (\J?  ؤPq`P  פ`PpWPEP4 ޫ< ګ 80 ЍВ)̒)ؒ)Ԓ)p@-MPR ` 0@ᖤQJH p 4P$P岫 0e PЍp)0H-M@PJPTP EF. * @0 Ѝ0 )O-M MIq` V k#  bPPp@@ PP  QP`8`5@P p*$ pF HL  #  0``q 8PT90L < /0 `Ѝ ۍ.O @- 0 SR  R@|P "dP @P JHP P@C,I@8)4))D))) )O-MLAP <08A04q4 P[Q P Q4`Pajp PV `P qP V  `P `Ѝ)))))'>')p@-P @P PP `ᣦ@P/Q\ e@0 S < ``p0p ``p) )|Q  lQd  \QPQ  P/0Q $ ٤/)))<) )))H-tP dpW `T@TP`Q Pm M?pW ))# 'O-LM@Q PPJPP (B4CE FI$0 `XclS, 2P @ P|0XX$  -PSZT  M4p X #   @ Q@0 ,+pJʚ  0T"$ 4"0F%P! Xp P8@0 Pp@8 <0 DP"P $!PX  P88Ȅ@ȄȄȄȄȄ& , #0 P 4  `Р   $00 0 P[  (@ XT偦PPDLЍ))) )P n    p)<)K-hMPp@P2 ( kFzIT0 TӃpH!W0pP   `><PH  6 $p0  =hЍKg x=t0 =<@Q*XPD +=  KhЍ() `  \!G K-8M@0 400 +0p4` #<800PpP$  @ 0߰P8ЍN!D!p@-XM@F P 08` 0\D ;A XЍp!p@-MP@PP Q `P0 QЍpЍp@H-Q \ 000SQR P* /00B Q:AB60Q:aBV0Q\ P * 0Q0A\A|.:@-A\Q: 2>. .W@ P0@3^@A  Q :1>A0A TQ:0AQ*@/@-Q0E\ 000SQR%  PH* 00@C TB"N/ A@CTB"N@ a@CT1B"N`   \&  P"* 0@0T00C!\@? S 0! S@"$ P: @-0C\^: 2>! !W@ P0@3Q@N  ^ :1>A0NQ^:0N^*@-4@Q@ @,) !H-P(@$q``Q a` S H2`U4`-V$``````V /P:VH95|p``:PXQ! 4``,, 0<?` ).0'$)q!'Z!/p@-`Pptt P XX@P0 ;P,, P,))&#'U#p)!O-dM/㺶Po3P `o @P   0U0@JQ_̒ܒtT 8Tl4đ$x0,p@XpĒD[@'PP /0 !P礔dT 8TdHdqQprPaqQ[6PڀOqoOoy qQg 9_30x)|%KI\L<,- 0 .( p' Q"*P -QQ= ? P P  p po/0 p'0X000 RQ[ R04/0#Lp'"P  唯N`Pp/  0z0 /PS0BJPĖ$Ę8T<thؘ0p̙X\pȚHx4h BP 8( R   i `{ `v  `ot lRmR oR pRaR eR8h,|'D)@)(B',)TRP6 @HbTr +P  㐚P B'4))B'pL@PB'B'@T<B'()PZ48)x P `lPPn \&P Pbԑ)pB'\)X)!(P t@PP;PPdЍ() Ē)4) ).|B')(pB'(@),)$0)4)()R!hB'tB')())ԑ)\)X)D))!8)L>')#0')'v%d)%%bY%%ؑ)%)P>'&&O_#>'L)H)(T$,$1$0))$#l##H8!E $) )xB'#))>' Gn 0.w$h)G-`@Ppp t`/W Pp pݠ 0i! #P  /,)H-w3'U)@-XX @0<D 074 02$ 0-\3'&&'(A-M `P Pp0A W L: RI 0lS bS kS(kxP;mS wS(oxP.`kxP# (f xP  0S xS P*S(6 0RP!0 PЍG-PQMP' Ȑ@PP! ,\`P=VP p ;P 0 S 00PV0$Z,)Б)$$$jG-P唀 @*5U xx`Eo p` 5WU@Pڰ  G5p)$' %p@-MP@P P@P PPPP PE `0 , ``Ѝpؑ)K-MP @P `p\Q Q\ QppVPf  "P ` ;1 0 ?;`\P P+ P``P" PPLP3 P fQOQPQ SQ ,gQ sQ pQ&  GQ Pv  ۍQt R ` v Dv $ )D*ܑ))m**)A-P P @PP `pp T 0 HPR ``0>p``))**H-`pW \P@PP` P  4pW)*'H-d!PQ! 0 {@T @1`0V (10S Q Q Q iPP0S P0SKP `P/`៚ @/Q @4PP/)) )+*H-@ `p  W P 0/ /PP pWxoddoP`8pP ePCSUS)))K-P`>Q%?Q( [QS-QJ  ! R/o `@` R? ]R# p-W pW]W Wpp#R@R*QSSP Q! QP P`*P P P  0P PQ P Q /PP )O- MM PP `@.T.Pq 7PpT Q@@QP.QP.QP/P] P %@  PPT R P2 R @  PA Pr   PP*Ĵ帒帢r@ `K fP d P  PZP/P wP Ѝۍ .P P P  @P 1 `+VZP P 2.   +c`apW7 @/P PP  w@p.WP pW @ /P P  P P  Q @ P.PWXP|B'-5+ܑ))p)X+++++,7,',^,) !O-MM@` &pP+iX  @'@P(P`'` [h 0*Pa V3Q V* V3W V1: Vr P5 &Q \Q 1BQ0B P@Q UQSJ@PT IP.  "Q \R\&R Z:Jp '@` VBp+ P ZX  T D Ѝۍ V*' Q pP P   '0  V ` P' P   +'ᛔ' P <<'0 0  0ܑ),,',,p@-@P` 0PJ Qp   0pp0H-P@P/TN@N TT 0@ U:UNAQ:0Q0N0,H-@MP@H`X0P8<0400P8<0400P8<0400P8<0403s|ßp tpt, upP  lPjJ fpP  ]P[J WpP  NPLJ HpP  ?P=J 9pP  0P.J (P&J "p P"JqP pNPP p nP @PA ꏚ!C@ЍdA᫖PP PE/Q  `,V`  U    /00B B る@PT,\S  P qbxPdP,a)'r-l)x)PhB'Ty!lB'|B'-β)()"(V-)+-z-@-hh h0@`TiHP U|0P ,A,P)()--) )H-< +P 0%=P\CQ] PU hP  P#=0<BQH 0S  R> F:Gʁ PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V R茒)/>3))A-@PI `PVE qP=  P7 #V \V `#P` *P`P P!=pEaV Q PeP `P@ 4  茒)/>3...-A-@PI `PVE qP=  P7 #V \V `#P` P`P P!=pEaV Q PP `P@ 4 ? 9 萒)/>3..Q.H-P `@V /pW PP`VXpP0 F R :,VU .V+P 'PA`VP W`Pe bRCR MR mR cR/pP KR#p Q LpUP R  `` ``0  (p RP 0  4    .5/V//r//)) /.H-0@PS# p .SnWpk0Sz`W 9Qp!@h`p&@ QI lP4PP!@k@d  P!@P!P!@ P!@!@ p0 'T*0H-@P@P  3 P @0蠒)/O-MY; CJP5 \2:BZРL JaV p !  !  p`P @P- `DP% @  `Ѝ   +2 A P Q     ꠒ)qv0H-Q+ C.: R&: R@̌@D@% L LAT 0B  P "P%  `$p% "  @T H ꠒ)qvK-`P p |`AT P  @U`V 蠒)0H-P@P G ] P ll >`PvgXp  D 궖0$ i @0褒))7)B'\010O-MMAQj pG P ,wAT `P _ ! 7  P5  RP5 @T P A` 0?QJ P* 0F.*p 0aP  @I Ex   F @ 0T <@1  Ѝۍ褒)B'00000H-M@Q0@@0@!P !Q @P`0U0B`Fvp@0ET0E^  `pppW: fЍ0H-@P@P  sP1 @0訒)1A- A`P%  ,@PqW 4P p P) pCP! ` CP qPP `PP k BP ,b `  P訒)r11E1H-lp`P @P ,[qW P p S訒)0H-@P@P = P @0謒)1H-B  PM-`@pW# P!=FP Р+0* R EP  `P@q 謒)/>33O- M⨲0S BʀCJR`u%s=P\p@Q000#0 "  U `p'`&p" PS0 R^ @PQ PXZ PG    0  P "> `1 0(=@LR 13'30H1S ` p'`&p 00 0   "  LP@   Ѝ 0   P 0p p ``  ꬒ)/>3)120H-@P@P = P@0踒)U2G-MlP =Pp aV  0 $@ Pp(` Z Ѝ踒)O-M`V9 @L@8<@P!=KP ! # " # " (0@ P p ZAP P @(q $ЍЍO:긒)/>32G-^ @D%C=P\@BAT $ `Ёp)P(PPЀP) p(P (P@U(  踒)/>3/G-MpPP/P` .q`P$ (P p@P @0 @ `P Ip0H 8 C ۍ()2)2O-MP@T) 嬐嬠`pP$P u  p p~P   @TЍ輒)X)tB'pB'xB'  Q /)H-l0S ^Q 000SQ)Ē)@- Q@P d  ׋P L<q 0D @!B'&30H-@P <P0 Q* P0PR PT 06O-MP+ P`弐@p@PP P@PL 0<, ,00 0Ѝ]3p%g33hB'3Ȓ)O- M@Ps`PJMzI$( KAQ:D"D2P,",2   d  l , t 0 |  tpe EjFG  㓭/ JQ   1Q 2Q  KQ `LQ /R5Q  (,(  `  ` 0 b<      b ,`/Q``@ Ѝ̒)В)Ԓ)ؒ)p@-@ Q Pᮊ`peRe #p@衊O-EMP j@Q eQ +@Q@P@dT   p; d k@Q:P P /@12 d I0 | 0  'F!@p\ziЀd@Q :!P.1q0PPAP@WP@Q: AcA0 ,\ ql@Q :!P.1q0PPAP@WP@Q: AkA0 ːd0\ yt@Q :!P.1q0PPAP@WP@Q: AsA0 㮐GIpD: @Q :!P.1q0PPA@W@Q: AA0 ㏐(\PP eQPppQ :!.P1q0PPAWPpPpQ: AA0 f1 , @EߍI Ѐ |pQ :!p.1A0ppApTpQ: A{A0 =   h,'@PJPJP P@s4V47443Ȓ)48)44//0H- Q @P x\ 0P 0X (P HP8Q0  0HV!4ܒ)Ē)4O-MP@PJMInj֏( p |Y!R  +p/  KAQ:`|#|3kF@5`#`3  + d  |  "p EFzGj  H )n H6lpt ,kp   (kpl  mJP1 @R0 0t  ( cK@Q:gPxP1xP!  ,`Q\QE KP    `@   1 ,  I  'PQ  !&"&p ( @ /R     <04KP4   Ѝ̒)В)Ԓ)ؒ)Ē)I5x5s5}5 6O-MP @Q :P P@P# dPP  @` dQ.P%Q#d@ApQ /Q @ X+TT }㒎T Y  㻇`/ P%   }{ d 㧇0@ Sc`2 375pxt41 vX 4H ` &tOI@ XAQ :!.p1A0ppATp@p@Q:& B0 .!&&WQpv0 @`qQ :!.`1q0`W`A@p@pQ:P& B0 ! ,4&0I0`< f  |QW:!.`1q0``AW`pI6pp0| 0 PK d h``@|Q :!.q1`0``A@`W@`Q: A{A0 㿍, $p`pfL|Q :!.`1q0``AW`p`pQ: A{A0 㘍 l @70 r00F<$P !   0 L`jds`Q :!.q1`0``A@`W@`Q: AcA0 _ x#e,l@rlp{@Q :!.p1A0ppATp@p@Q: AkA0 ? #E0LpztpQ :!.@1q0@@AW@p@pQ: AsA0  |"&!@Aq:P@@Q :!P.1q0PPAP@WP@Q: AA0  "0@ߍ,hP0 haU P  X)`  \PP}PP@@Q :!`.1q0``AP@WP@Q: AA0 㰌  }B@PJ PJPP p`3 P J @ yPJP P@Ē)366S6)B7{6s66usta s!68)` 6)6A-MMMPM `@h  P+㔅 U UX K<0 wMލڍ }S_ ))"70H-@ᲈP P 0H6H-MM A0 S0Q \!@ 0P `.p*V ?V.`pp\pp0` Q0/P @0 @P$J P0 PJx @0 P JL @0} |O@Ѝڍ'l7w777K-M-PP  Z!PP l0 TP匀`pozP @ Q 0Aj`P @@U BKЍ'660H-ƼPJ|@sJtPP hlJ\Q0#Kż<P 0  007)))7M0H-MP@ 0tPP h TL0P P  ! Ѝ0HЍ/)()@)P)'p) M@-M@@  0P  c!|Ѝ@ Ѝ/)p@-@QPH R `A`P  @@}zP@@p)Mp@-MP@P0`P X tl0p `]  !T @ Q  Ѝp@Ѝ/)()@)P)'p)ՠH-M@Pf8d; \ap ;LP PPp9 P5* ~P& @/P"}PxPp p 0#" 0"# i@PQw@@X`{@_$Q` O0'G7-Ty!'9H-&8 J'7O-MP@7`p TTTg\pp eP qPrP vP xP0 VPPP RP fP iP! pWP dPpt p x`V`PЍPQ[{pPW9 P\@Q  /Q@ pPP/Q /=Pp.PP .PP P ZQpWPP[}@[n(PU e,再p@:P Q PA P ։PD ҉?P@ ΉP< F7Q *  . Q0$ R$ $ R Q  P   P  P PP ߻PV PU.\3Ls P0p XWP@ ~P0@ȀSPiP}c䲟p`@ Q (pppppp(|Pg X Pa `Y4Q X PO P P] P 1$QPA p  # 7 忺PQ* P, '|P$P$ P?P! X $ f  DQPP 3PQP  b`<pP~rPP  唰̈P Ȉ?P ĈPhOB! D0 O` ))7)))))0' s8) ))Zok"7`8H-'6 K'8 /)G- M@P A0y@P$P"D`P2 P P- 㤺P( gP$ `PY`GP @PGp P Y@ob Ѝp(cT PP WP4`4c 0^) ))B8A!'` 87O-OMM`@Q  p  P p P}P Ѐ # "!Ѐ # "  PYpP 0㽀w p⋇ЀX` XPzp X ᗸPXἸP 0㑀 `ЀX` XPzp X lPX_ᑸP 0f:ЀX` XPzp X BPyX5gPq 0<iW WXj`  9PR  PpWPIW7PA 0 9РZ{`XV`: ZP `j PZzַpp`XP TTppz ,,pppOߍٍ)ZO-MP@E4L p@a@ vPppPpP?P4 䠟Pgp!P}$p/ϖ`P PQ P Np Pd/㹖  ` P A` )0'ZH-4 3'8K-P3rP  pR吐G'(:`3: .:DG!0 aS P KA) ))H-@Q  0Sdd`P@' @qW ᘃP `pPA ) R 0 S$A'  A/A )p@-P@U  QX`PP Pp))H-lP@hp`Q `'VPP H^) ))H-@PQ  0S``@' D @qW P pT `A )@-@P@K- aK@]9P 1S ppW1 0'PR,PP 0 pTp `\[` AQ M[`@T K]9) )XE)<jEHD'p@-d`P@Q  R @RP'Up )O-MP4pW1 АаP `=4tP =P @ \_ AQ Z 88 P\`pW`ЍjEHD'LD'tE0H-`@AP aP@00P@P x @ H)A-Mc@ >3pPPQqQ Q, Ql&]Q] PAU@@@@@8D@`@@@@@@@@@@l@xPP @G ~"p|2   Gp ppH04 G@ @%8R }p@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S     ȓ)'B)ؓ)Г)EEH-M@P7`PLrP  IRNP  rpP  rpEPP@@@8PP7Ѝ)ȓ)ē)̓)E0H-@YP )RR0̓)H-  7ē)FA-P$@. `p P Q @ AQ ^8T@Q@ AT  QO8P`@ QH8@7@@v@0 0PZo` C' C'؜)h)QK-0M@pЀ,(e`TV F P :(( 0$@P0ЍN@PWV  F008@P( `0G [Г)G-@P넠 %Rpo`#U&P`DW@ 0W J̓)FГ)@-@Qs@ $<Ld|   Y # qV PL 0~^R R ^" #o( ?@ d2 0TQS?@2 dS TQSQ!!R .," # 0C~FoFcFp@-MP`\@`P T, TP@+ z|@P"PP P R P    RЍpؓ)h)C'͑"BF(!K-@pPh`P7LY@0 0̓)Г)K-MP@#` 0BS0P RpToo "WpP 0Ѝ̓)Г)K-(MP`@p!PW$WD W_ WX 0p~'GP:$W= "WA#PukW9 WoUC ЀEVeUFaP'WP'pWAp&P FT 0o᠂; 0/Ѐ 0(ЍK'FPvU Ѐt`'V'VT Pp Y (Ѝ6F̓)Г)(FQFO-M8ȰȀP`pB@ <  0?@ DR0 0SR* @Z 0pD`PP PЍГ)̓)0_G-Md`B<peP P,PU& `V+ pWz FPw @|p|4` Dz D|P ZPPL-PPE \AP@.P.PP/P, ZP TP# ` Pp}4ᡲPJ  P  Y}Q Bp  1`PhЍ@0PPPC'F)ܓ)FF)2 Ty!F:GFp@-X`@PpHP < sPJP 3pp@ܓ))GA-@Ppбp,`PP W p6QP XXVPiW@ P@P n))C'ܓ)O-MP|sUQ$CP lSPHP FP  GX CX@{x3Ȳb@/Q PQ P@Pʈ4@UP U/P@DpWF 8R8 PQ /Q @|P P+  |P& @PT4@/P @PH4@Y\T1T   t/R@pWT p@[5p@P4@/P4@P`P t2x  Wd W@PDP Ѝܓ))C' C'؜)Ty!))GG)@P/ 0RS /S  00B /)0H-M@P P/Plp p 0#" 0"#oBލ0Ty!0H-ALP:pPP2LUk7PP0P$ @T! !XT AQ vT T0b~(%#!O)Gܓ)/GHD'PGp@-@ \.2`\P g2E~"P P 2`20p@V2Tp2~Gܓ)H-$Q  HV Hܓ)G[GG-rP`V lz{P Xt{Po`Vl P @T7 \T0@a DR0223`222`2`2`2`2`2`2`22`2`2`22`22`22@3\T1 0T `@ P0 BR6!Ar@q#\@` P,  AQ ʺS `V@ @ @ @ @ @ @` AQ ʜS @`@X  AQ ʋS S! !lHD'cGH-Pl U))H-MP |l   #DP 86P_nnЍ))ؚ)C' MH-M,  0 Q D)@-000@Q#AT))MH-M  0 H- pD)M0H-MP@ 0| p@-`@P PQ:Pp Rj* NT P  FTV  LTT J;TTJ- p|2Tx@ AQ R <00 p@RQ PR D')8) D' )7!ZLD'p@-@P`| M@-M@  0 }@-@w M@-M@  {| Ѝ@ Ѝ/0H-@Po| 0Ht MH-M   iЍH Ѝ/ a@-0P r R P  R @ S@8)l"  0/ ))))A-P$@0 `p P Q @ AQ 1T@Q@ AT  Q1PPQ1@/@(()C' C'؜)$)O-MP @0 3!`d8pP P` @U ^PZ  P d`P0B8PP.! /V(ZЍ^`P ^`PPP" ^`PPP}lP ZO^`PPoP PU[P/U`aPa``]P 8OO (P *OP "Ob9hP O0`!*(P O P O5yR3QP N j``3o` 5/ /P OPTP 6 ЍP`PPC'p)())H D')G-M䁟P PP ! FPPpW A ` KpWdPXP`RP @PIP uP sP PP6 P3 -p` F PP  lIPtP P =PP;P,PލR)C'h)\) ILD'EI)LI()))VIK-@pBPP) !EPP`V Q K`VPWPQ AQ O 7P`QW'`Go"'P W9NP&PWPP bSFq(PP NWPP 00 EO8OKOC'h)\) ILD'!I0I)())4IO-MP@`p^P3P耟pP QP $P"  pP P P^P PP@Pp1 pAЍ)C')()O-M@葟 ^Pk-UQ`p`pW  P `!00[P p paxP& XDOHO O AQ  O =\O AQ N 6O Q?^PP P P [PP, @ -ЍC'()))h)\)rLD'K- MP,a   p@W6 P2@PU   SP PUpW P @PxP^P@ P  @T P^pP $@@, Ѝh))C'()O- M@P t%pPW7 T`P p< R  &PPP VDPJ1D}VJ'`$pWQ&` RDP ЍVJ xg)^I)()O-iMxP$/? c,@|_ aT  aopP q9P  @T p_W _O`T9P  pW p!P ppp}+tQ t 0t1 t<<>6 (R PpPt(ptAtQv BuM|QU2 }=` @  AQ hM @@fP @M AQ RM ``MP @UQU L`  AQ 3M `MP `U @T \`v *HP@ `TPL AQ M KMpVP[ |PK K`Pp oP$PU<`!RIpt1 \ P @pP`@ -R -RQ ` pV`pV# TP@@p\ pW@ptt $pPm@Ft V$0P b` `Q @QC*`pPlP?P PPXJPxR(j#Tlx lYp&PP Tl!/$P lIP8 lP8hd\T 1P ]JxtxP x P4 P d;hBxx@Q*h`P T$P Px @ uJPB뤨P8 HP:X~X(@0 H)D)H-`@P)'qpW #qpV R$  +)8)O-MX) pR%pPPP :PW @ m`Q%P`U@  `jZ/P/Ѝ p WQ:Q:Q l@ЍO$C' C'H)O-MtSp`@,b@Q'$ggf,g8gffffffffff@gHgPgfgXgp`@PW2 ` RU pW P  ,RBP P hh$h0hX [ Z V pWdpo 0P PPQ PT P PKG !pW=oT pPU PLiXidipiX[ Z V poPQPd|Y:T@1FP 8EP PPЍI)B'4)L)HD' JK-鬀嬐@p PP `Q QQ`PP|U:P P KC)L)B')K-M Rlkkxklp @P w`#PEUY t G!Y%&Y$ (UE$FASR PPP =E;E9EY 4E2EF P @ AQ IE *l@ AQ ;E Ѝ0_JZ))iJoJMJVJ4)5JHD'sJH-`@Q  0SCpa!(@r !!ApQU klP" pPV `k"P P,P wPpL)))Ȕ)@-LL@ 0 0PP @XȔ)))O-M/@`P0]P P` :P `xP* pP P P ϠpnP |nP xn   p P pp @P|@Yp P >PK h  pa"Q 0&P P P&P /P  W YA P dp   PPe P ~ nP nP np@ pY( 0`@0 @ZE7 p$p@崐`W pp@o p@RPP [W    Ѝ@崀`pPp@op`Pi@Dg!!bP pP", :4)JB'H)J))J C'JLD'a"H-`P@P `pQ%V jP pP@CH-XP@P `pQjP pP@D0H-8P @PP@P0DH-XX 0P R RQ U 0|S:B'L)K-@܀`'pPQ Q:P P:QPPPP %Pv%P`:PPp@<@qVQ`UV Cq `4)JB'A-销P`@T pPO~@p@T`|V:PP A<)L))p@-`@sPP PO  PpP p@p))0H-MpP@l0>00  FN P Ѝ0P Ѝ0H)C')H-0P QnOwO-MHT`p@s(oPP VP`ppP vP@0cSo  S R X s@@ `@YAZ @` QoiP4 P;P8 @ `Y |CXA [P AiCP B AQ A `Y ptATAP 0 `@ P5 @ `pPzX{h{x{/ZP$ ΝP0 ~@Y&k@YeAY|YhY <C @@@P KJA@XQ&YB@ p  B`q@DTYPBhB@ `Lp@@Ѝx`pdd cS JJ)p;K%K3KHD'CK4)K{KeKIKPK` KJKJH- ~H C'G-P!`1 @`!@1q`!A`af dR\0P0X PP= @A ap` >p p` W p'ppQ*l  Q ؜)ؔ)Д)Ԕ))C')h)C' C')@-0 r RSA sQڈ@AT :QQ0Q 0 0NO-Mp  $  DP`~P  Qp F ␄   `P<UځE P#稁 |t mp U :U U =UPqpP p P +YpP D AApPPp PP|{ lppP p@Pp=P pP Pxw`P0< @Q)pQ&sP] PTSP('PpPT p~PP=U PpP FYp Ap P; P:9{ p. P lp P'mPPap UPUpJpBp Y P`pЍ)PD' C'ؔ)h)؜)Ԕ)Д)O- MD@Pu 48r0b@` P]P @Q9:P @P, T/@ PT3  U3*@T T`` @ XP% H NZP P `PWP PPU: :Z@ UT PP ` U: PpW pWQ P q  Ѝ))PD')"G-PJ 0Q$a$(@ >RR4 *R[R?R p P d P ( *PP P P  R Pp@@T))))0H-P ,P@@@@Q0)H-t@P hPh`ppP P P))))O-M P*A`☠Q1@pW 9W ځGQ:W Q V W W /W  AQ d1pQ ЍQQ P YAP1 pW) `Đ偀Z w P p P*p P PPppW% C'ؔ)C'؜)2 @O-$MP o =V@ P   P&  (P. p`  * `Dp5PR0C V7 [C0 U 崵 tA P `p Q @Pd\\d50AS p*P@P p R 8pP^ R"Q PPQP긴V?P `F0V0`, PQ^HU `p P $P P PPU`F R ß0PC`倰@ c! !@PXP ` `@BQ7*Pc  0 %t̲Uo `u P Pf lPY PPUKB Q0\\||||pP P1p!W pP 8ꄁu V%- X1@00 0PA0 0P  q!a 00 A p A y R  0S S@`VW   S S00SP$Ѝ0  UB)Д) C'ؔ)؜)@C'K)Ԕ)O-M \#\TPc0P0 ß( @ pEt%"Y p  2倒p唢`<E @@PʼPoJPDP  Jp[eP TPR p@X X@`VPhPV A E@QPE` `@P1P@D`T`PGPP  P p P *p P@@PJP P PL E w4PP0P {ЍC') C'ؔ)))Ԕ))؜)@4)O-$MXX\D PHP@c`@A`p崠  BQʿ 0< @@ 0@S "R   @ $Ѝؔ) C'؜)h)H-hp`@PP Q Q '(`P @P))K-$QPD  P aP p@ @P P P P`P  Qd`dp@@QP P P))))G-Pq Q:PP U PE` p@@T @R:PڊP P `P' P@D U p  U00 =P=R V Q V`F icP`@V \cPBO-MQRp `.@P   pV p  $< pAЍV P (` TpLL0 0-R$$ :&C'Ԕ)؜)ؔ) C' D'K:KO-M((pB`PW*(QBP A  WP` P @,؜4ĝ8 Yp `P^V`ZpW:!pEW}: `PGZ`@P wQ  0S Q:ppW*]pEWY: ^P:GZP wQ  0S Q:pp`ET<* APZ Q@EP`0 D` CW P@tPl`@Dpʞ@@ЍQC'Ԕ)؜)ؔ) C'O-\#P3 5Q, .P&J.2 /PJ|PP 2\Z2PЍbB'<)@) D' D'D)LC'LD'A-Ȁp @`V PXPP P P  h\`\P $T 0 P,P AdB')C'@)<)D))TQ/@ 0S  R0cq/o/<)B' 0 C/<)@)K-@p` R Q $ hl0d V@0P`0 0  P(P K B')@)<)D))H-M0q@PKp3`ˍP  P 0 T .PQ#  0T*P  P\P ЍL%0!)ELFJL)dL-LLp@-`@P* U1PP*@P TT 0D00 Qp,P p@zp)B'B'D)<)) R/0SB'0H-hP`d d0P 0@ 0@8 0 0 $0@)B'B'<)D)p@-l`PQ@PPVDD D0@Qp(P p@,p)@)<)D)B')p@-`P@PJ*P E{ P<XX Q0 `@@@P`@0p,P p@pB')D)<)@)B')/B'p@-HP@QQ 0`Q QQPpB')|L0H-@PP 0B')0H-P04@4PP P)0B')H-4b@P(PT; rp )pP Z))jPuPR2U &[-X-U-#Q P ppM >p$Y8D (Q P Yp/ P&p! Q)&-#- -@P MP pPU/NY\ [Y< TY ML)ؚ)C'7|P)Ԛ)LMLC' 0S/C'H-H` )H-<QA @P= 0P Q`p0`pVP AQ J/ f0p PV@PXP H<Y .T)ZdMHD'C'))M:M*M@-@B@` O-M(:$PCq Q A F`P4   F p0P ؐ g0АX AQ . /PPЍ($` T))X)5rO\MdMHD':M*MO-M@P` %P  sP# P@VjP^ FQX!p 0S 0S`b#0SL ApQDP1   Q& PHP7@Pp`P PА?PP P Wp"PE`UW%P -P +P嬀P JP| 'PpZ ЍTDp 0 0 cN\)X)C'NNsNp@- 0@1 S @@T P`V P@T@@Q Q Qppr $@T % r &`V 0p 0pX)5rOC'\)H-@PE PC \Q`l  Q  p 0s S 0S p QpR$pWP2pW$Q 0 pW pW 0@PP|P H-TTDL44D$EA)MX)5rOM)jMH-P@kPP ZP@lP pP@@T QP! 6QP@@p`P `pP P(5MC')HD'ZO-TMP)ؠZ Z P$ 0J p<Q` q@P @Q V V V R TЍOb.0 PP@ TЍOZ @ `p W 0#s.   I0+P s !!P - "0W.RP 0" @J.@R q P P! q0S L"6.LL  ,Q!p  # R  @ i!. JR@V, P@@Pi,@`:?, P P@Z  -JpZ @Z@PB,`@P7,|@P),X p<_,P@ / TЍUۊX)5rOC'^OgOlOuOzORunningdMO-M X`P QP NPv,QP&@ p`P P T  Z  Pp`WЍX@*`6V `2pUj ,lC'C'M\)X)T)O-M좟RpP` @pUPP ThRhh"`VpЀP PD 0S8` ` pw$ Wp P pW \  \ `YPp ppWp P  Q: ``p[ RPR PU:` 0pPQ" P P 6 RP QP`  R XP0P Ѝ)\)X)ؚ)C'LD'))0H-dP@P @P0P 0Ha0))0\  L\ \0 R\ 0 Q/Q Q p/ ,Pp//O-$M@T dP nP pP[@[  ,P ?1PPp pWpsPx#0 `V ``@`0 P``P! P`P PP `PP pY P`p Pg`$Pp R 0  R Rp AQWN Z PUpa pWZ  p YZ  PP.Go" [ Q 0QA! 0 pZ  YY[ pQ J,p[  ?,l6Pp(p$ЍQ4 LMM)NT))\)X)C'b MA-`APpiPP gPPjP pP`pPX*pPQSP@W DDTD0@ V P   Q *PPPp`Ѐ* AQ `V 0 0 )` V 0 0VP,N)?NX)5rO]NU HD'NH-0P >P`T)cNXQ @Q 8  AQ /0S /\)T)X)G-0BP P `PP`FPVܑP P RE APQP @:aP|p` LW  0P RR:HPpQ! P0`C0S @0GP%PP @,.P0  5XPP$P T)\)X)))C'L)H-Pp`5@P t  0 0RNA-P@`Sp A& ! 7&dWVV4&&UP*.!P'ڂP NP UPZPPgV5p 9%6%W p6P -%*%'%TLQ +qؚ))ԙ)L)C'C'M&!LT)A-`@PpPUU@V  X@p8NP pV pPpؚ)C'B'H-@pPp ` 6 RN`P2`Hp`P.d)C'h)p@-@ᆂdaPP Q $p; P !DQ [ , P Q0pT 4sPP0SQ PQ QkBP PLP pPWQ/+)C'MX)5rOC')04 N RQ Q  P @C'@-@QhQ XQP 0S 0RS Q  &T)\)`)X)NA-MP @|P R 0`S`l|88,DLLTdt|dd0(~X. PU bPU `V RP `VP xXR}`T P < 07 ;w#~{y`V qQfo b Ph`VL_ЍAYP PPPPP0S `'CAP  0s x @v' &T.Ѝ*(ЍAh)@ -O*O'OSY$O!OOb bYA!1IOOw 5w OOOrN)!NNNNN_ a NNNN OKO-MŸ` 0QxR| <[ځpK W$@l$HTht|` #[ $['[ =[K \[ @[6B"[V\@/`  PA@0@D T: PA`F@PApA  b@} "DA @ T`,A) @ " @"p0QGT@p[@Q$Z @ P@ PpWp@ @[  "=@A: }Q"A0Ѝh)d)MO9a [OSOp~"=O3OJOFOp@-P H`@PT 5P<9,PUpA!O-MP L <P ,$R  PvAp` Pk pP` QP/Qd@PJp!0REPBP@LaQ* PPP:PU aPP `G PʍpJ G` P[$` AQ W$`P@ ZЍ=p) )):x)H)OC' C'؜)@_LD'O-P-P P8 PP-P8 -P`c@oQT poP 5PP TP Q TPTe RTDTPK,))C'RR)0H-lP6dN\@P vPwww=ww(0( P$ 0Hs0C'ș) RHOA-P``QP PpPp$P@@ @`)A-@P PT@ TpICP @7TX XT@R@LBLr`PE0 O`FvB AQ ʼqA ` Q E P /`Fv]tq`Q CP `VH @TX P  1 PUR@Yp@ Q` Q  R `V@ AQ b T 1pW`V PAPPU RpSC'R&SR7!SHD' Siy S4SJS0H-l 1@T PHDQ R APUP0C'R)))@-0A Q @BP  @)H-MPDP0 \ 0 0Ѝ<)wSO- M0pQ`V R 0S -Q`V  `-V0-`S PU 0BPp@1P?`Jp\ R 0 :R  0 R@:P R Thh P:UD  `|Q1 @  Pp@@1  r ?`PP0p @ P,S` ` PPK Ѝ:U H  `=:`$PP_ D'SS` Sb S@- 0SQ @T7 -Q40Q0 -Q@T) P %P# R@ R @ :R  @ R :R  RH 00P 4 FD))S)S0H-@P 0P  PPk P!P P@ @P^@P0 C'H)TH- HGH)O-M @ @ T7 P @ T*` @,P( PpQ@P pP WP @P5? oGA@T ЍC'p;O-Mⴁ@T P   !2W Pdp`P@Q* P pU [ PPFP*rP PT!TV @T\   L1 VTЍpC'p8H-@   C'p@-@`4P P`P Q`0pC'O-MQ[@ @` P  N   @  B/o"D`p @  pQ  j  [ЍC'H)?p@-@MP@ Q `3> P x "0`0` 1" `#>TUJ(8 1$ 0 PC':VUUV1VA-pP P@PT5@DP pd9PP @`PP%Pp`P @W !C'C'TH- 0\C'AVO-Mw D @ P$PP@;5P#######$###**|$$**** $ $%**%*% Q    Hj 0 P KPEP2   P5P!| P  s&Pj  `PP p `PPU pP pQ P,QB HT$P Z6 P -P 08A P0`P    ` P\P Ph)>P pQ`0     Rc   PzQJ Q0iP`p  4P1p QQ@p`0j P @Q* P QA P8   0P Q,QF  "0 00 0  @P%"%`P Pc`Pa P$PPa@ @ T Z P  @ ЍP=P PܰP0`p  ` P P ptp @R*PQ  C'C't$BD'TH-lQ$@S PS@Q* HTP$(`,P R R R @0 @BT:R R  r R"0`8pA     F    P `&C'@U@-@P@ 0/0S/00/BH-P@-@(    @ C'O- M Q 0 ``hR@p` P'0 @  W p V @   ` R =R    QW0p$@@#Q 0XQrPK؜)UP6 P$ Pi`P[%@p?PE PCpA<u P Pc\P 'P] P pP ^@uH)' P@p@P'P>P@%P%? %#@Q Q@ p B [괦%P%? %&@ R R@u\%? %)@ R R@?0%6A R RA?0%3@ R R@pA ?Qm Qk p B  d    `@BU^J%? %,@ R R@?0%9A R RA?0%6@ R R@?0%3A R RAp@? P P p B  A??@P P P P@P`@pP<PT F ,@  PQp @x@QPЍP kP w`P Bpp,"$p WWp>U WpC)&P |P >P #&P >P <P@@J ` ( -P(  @p PQ$` @@Qyuq 0 P*tetPXH~<|؜) C'B'C'B>@'H)U;UH)VVVVV<)@)UU̙)Й)tUO-M|P  P P=  4b4r4R$80P@,@T:T D P@M4O4O`N4O4OdO4O|OO PpTt 0\T P! R0 T T  :;T" |T>|P%0p ЍO5t!)&P&P ;P    ЍC'H)B'<)@)>p@-\Ppx@xPx` P08 0Q 08 ? |\P p p@rsC'B'H)p@-H@8Q 8P` AQ (`8  R8 pC'؜)O-MM4(@,P0 $0Q0`pdP#pDW0Q @0j/P$P`P`P Vu ttD pPltl, P  `[P \P`[P P $P1  P  `  &`P$-p!\P `P  0 0(  ""P` P\P\@PʋP`@PʂP̂, p`EPN @PDPPtVP` Z V P   }PPu$PAP`q@Y   .똁@ 0@P\P ( 81 1SP  AQ   @B AQ TP@ @P @PEUMߍ 0 @ 0P 0墩(0 > C') C'))C'B'؜)H)W@-Q @ჩ@Q0H-d\Q T@PU U U <04 P00C'` H))H)B'VVK-MP@c 4@T0pPU ` -Ѝ`uQ X<XP ```C' C'P)L)nV|VO-[M `p匡<ր3xXP@ P T@րL4`PD PD ,> @`@`P PiT P P Q QV  d`!V 0\X1hAp@ր8T`P[ߍqP )C')C')` ?7W C' R/0S /<\/0S  R 0/\)A-pW \@P`pQ@U p dgWT)p@-@P Pd]ePdp3`d BWp@-` @P9@PpO- M`P@```@ %`8 `U (pWWpP P? P @T Q @P ;dQ  R Zl P Qf L P,P  dp @P:Z=P QaP Q  RW  cp=T2 P< PPPd c@p2P 2P? c@p8 c @p RP WW  PUV@@TPxp Ѝ  L_22 \)̙)Й)`))X))WT)WHD'4D'LD'( R/0S /`)0H-P @ kcpQ  bcp  \cp   Vcp0  Pcp 0X)W0H-P H@P PP0 2/=cP0X)@-| P@ T  D#cPZT@$c(( 0P Q10D'gfffX)K-MS`@ T@P dbbbccaaaa pWJ0P  R N0 ᪴`UP  R 0S T Wo!pm P1+0VP pbph `*dp|   P$@xpp bP`J`W  b b  p ,}b`PYJT  V P xb Vo"Vp#sbPP  gbP P ЍP ЍK I1PMb᫳  ;1 l31@7b/1@<*1ϴ )`)\)OW)C'D)WsW6R Q%ebbp@-M@ bp`/-P P 2 P ap\弳a " """ " EcsIp@-XPX`@ᛥPpP p@bp)\)) P/T)p@-@LPU T `V PJa`Pp\)p@-`@ RRc  aPZ0P 0PT R aPP a@pЙ)X)0H-@ P7P @ $0`)@-<@P  R  &@]a`)O-Mp#`@``凾pR SpvP sPV` upV G3 hɷP p+P -P=,PXU: (P  Q 㞷PQh oᠢ Wb aQVj d%  % p@P0P`P+PdWW]Z  0+#p' PR P  P r `p?   R `p9 Y  0L`VVPP J@@ 0;T@ tЍ Q}x1h.x+b/DZ T\/ @ .0'W.!;!XaXWЙ)̙)Y3Y#XHD'GXO-Mp`p@ PW  0p䐟`[`@  PU[ P[  UPP z0 @S[U H o<ЍOjЍHD'!c;` 8!} !Xp@-@Q? PAQp`R @P``D>Q <Q R 6D@Q:P P r d! RHp@P-;b [Xp@-@PP QU,pP Q  R w_p `q_p l pU h. Upb.ǰ ($  `)\)XpX0H-P @lPP$P$ 0P0UYd)b A-@Q @P8 x`xpP  ?U U @PP@UZO-M@P PP3pn+PP/PXg+PE Hb+PP#4e4u4P@P 簢TQ NPP s@@T@@U`7+P 2+PpPU`PED#+P J:D@lPPEZU@@U%Z c T @p WWp@WPT f0  T@[p@@Wo᠂ZDP{@Z9P `V @R s,P  ឯP# P @[*Z" X P   P EL `Vy@ < KP `@VeP P ա[  r|PlP `T 8Qxlal@pP P T h T@p@Wp@@WT p`@P P fC@@T@Ѝ-PPU?K"ZbYp)))p)UYHD'D+j!LD'ZoY!ZYH8!dYxYH-M@DPP 8U`Q U PTT TTNPP UP`P`TV T6`P`qT`P PVЍ p Q8NQ> T<'8 :V V VKp U`VN D?P:, 0p  \P6QHQ `6QP`p)p)ؚ)C')t)T{H-@P`pP P 孠`p W:8 Q P Hl)p)p))K-Pp@HoሐR`P P F PP E`P:XKp)p)))HQ/8 0S 00S/ <R:/p)p)0H-@+PT P Q& P$!PP tQ PT TTT 016P T,PK+P0p)p)C')))))p@-H`@PP@Pp8NUpt),,PQ /PQ/p)p)O- MqQ!1`Q@P(QAT  APᾟ3hPl0d `P  P 04P `00( @ Ѝ贞)))p)p))()(? R3/1!@R/긞)0H-8P@P0+(%@0)H- ȟ)ğ)A-JM$PPP$$!Q (@Px@b(@P \T@PHQ@TP?4(@P@J$`Vf \ P@ PPPP[gF?PPPPP:A* 0` [\'[>ğ)))()ȟ)))p)p))HD'0H-@Q P@PU PP00HGLD'LD'p@-@ Q!- P ,Q$`P    AR \P  R,P ^@p))̟)@- Q @R P J Bpp ӲLD'G-@'PPPP P`P3 P1 @P`'#{#P@Pn"``E@P_`\'PpUWG 'W @PHpV @P:@P/@P$Z`P 'P p@P`V @P'PG7Z<LD'0H-D@OP'P @ U0P0<H- H D' D'A-RP`p@ YP P (P  T@:pGWPH0H-T@TP P m P0P 0H10) D')MH-M  0 ЍHЍ/@-M@PP ^DЍ;#Z MH-M(   ЍH Ѝ/HD'Mp@-MP@ , `,0 P@PO!@Ѝp@Ѝ/@-M@ @ 8 0,@, A僼Ѝܟ)h)T)[p@-M`@P )P `i `PVH@H P@8Ѝp<))ZA-P``Q=QR`X@' h @A@pW P }P @pPpX@A)p@-d>ȧ>ܧt=@/ 0Q@/p@-M@U  ㎀P`L P H  "Rq*P P 00@RQЍp.\'?\H-@PRP QC C `'RVA%RpPp`RP @QAƔO-M`P@)T~pDP-PpkPPr -P)Pf lsP8 lP!PDZbZ<Y @P@DTD p@ P @KPPL PP P&PT.pPpDPP PXPZJtPJZ]Pp @%Pl`P5 UPpv Ϣ@UU)EP%K  `P RP:95P pYDA\ \弢@pZ` ͑"j\HD''P\K"\Zw\!\!\H-M( 0  tLD'8)\@-M @N R 1P ! PЍ Q\H-xС\LD'0H-@M⧱@T P= P "@TO @0@ ]|| Yx@p T/Qd0d P` KPP, GH C@Ѝ0)H)j/b ]PD'S  RHO]]6O@-NP  K|@|p   Q  PH@HHH H0 0P 3 )D)<) )\)C'4D'LD' D'HD' D'0H-w@@勱 0@S @@QlPoX R@@TP,P Ơ0H ()L)C'B')t))0H-MP @  P   nPЍ0H-PW a@PPK 縲ز$$$44hhIJIJ %  pW pW   PUPU PU  Ep@-P- P`@PiԴXԴԴԴԴԴԴԴ̴ܳܳijijijijij88ijij @G 6 Q  00S) ! 0 00S p EP/0H-P @P PU0p@-MP @P``P`U`Ѝp0  0R  /P/P/Q /ទP/O-M-0MP @k U % P EQT[\ q%P]%P} C*PmpCp.Y@*P]@@C@Ys WY.aIP(<(((\}`pP v t  pPDYEIPt:VAYq BYOpy@IPp P UE0h S03 ?`Q Q `XXXXXX(Ĺa'&QQ" "Q! 'Q\Q P  M   Q^`b tnvfreQ^@-IQ. ('P"P Pp@TP NJ@p P @\t " (q(@ w t  +S t +S  0-- sp  XflV r XY pTv`fPpDP -,$&P %PPP \R Rw PP0]S 0S MS ^R+ -R PP^S" cSW . b`%PP0@`` 7TQPe @P$PPP 04P0  0Ld`Tq 0w t  st  j f `@T@ x v s0p v  0 0 vf  h ^Bp P\/HcP\P PD p@]P 0P" MP^P -P |p^P cP&   p/n@ ?P epp 0`` 7S00CQpO aQ  5 AP \P' vtA AQ =' 00 P P{A AQ ! h@[!'  ᝝ Dp  |k0ЍЍdE;k%YNW xBT h !ۜHD'x)` 8)LD'_0'|)^ ^)ء))))')Z);^%^^GA-P`p\@DV/V90FPF*@0PrP@0@APl `0Q Pd\F PnF P%  @OTHx@@V6 "V? 'V '@8EV@4@2 @0R @& @$ @" @ @0pU``  A`GV/`aG6`3PV`3BAq PRdݜXP@"@`EQR̜P'c^x)H^^0H-Md@T # xPUᩜPЍ0|)^H-`@P p R 0BR0 00p pR AQ  @茡)HD'p@-M@PU 'P"P `VP `[X `  @`$Ѝp|)^x)A-P@AT:H8@@4`pD 5j@@^x))@-@P QH@ "P" ^^x)A-Mp@d\Q  0 Pa`P8  0PX`P5 pW1 P<U uUP P P  PQpP ^U-P P?PPPHP,ЍL@4 y`y\<P_4`dd=eeddvp@-M@D 0h`媬`Q TP ` ៬ QᩞPᤞ Ѝp@葬feP_eeO- M@: P `p|wPPp =Pm   !kXcX' iX2 %PO  P(p  $?lX oX< P= , P  (* P" P' Q) PX P QQ   P P Ѝ d`eme eZeeP_H-P0 ,eep@-M`P 0@-Qo(@ (P ( R  Q4 1/Ѝp xUDh`edtH-M$ 8d0 }ЍH-(Q @0h D9+̌K<8<@0 8D0< "8 < D,$@@-@ D@09+̌@K<,@8<@0D$@@-@4D0P8 MD0K,8C D/H-M$ 8d0 #Ѝ@-M@(<P    I,Ѝ`tH-@ ptGPJ8, PhG`Gv!8!<!@!HPD!EpGw!\!`,q!@-@4TD8,( 8R <  <  8< ,/@-@4:D8ߜ,@-@(P \D0@ )+̌K,8<@ D8˜@  @,$@@-@4D0 0&ẪE,!H-8ÜH貪H-M( wHpЍtfH-kHpnt fH-`Hpot #f0H-@ P@0#Phh 80P TT D0P@@ <0P ,00paadbbcc dDdA-P`Q @P  @Qp@-Tp`Q PP PQ-T`O-MP@p1`,V `Y:  `T `U `V ©t PP 㻩TTY <%AY8Y %/Y&@Y@3Y ! % t ` &X%@ &8% `& &u` &% &`&| &\ <PP   " Y %@` &%u&Y xz! X%qY 8hY _ XYO` &%F &%= 4PP 㚨TYP<"Y ! %`YV%o%QPP `Y p `%T`% &4Y %u`&  &%` &% &% tY'P DBHpW 8bpPd 0֧ pWP 5P ܧQpp0S) ap @Y P   ᬧy0  ᢧp W ;;p 0SW p: :Ѝffgg)gܡ))5ghEhLhTh[hchjhdqhyhhhhhhhP_hhhp@-pP@`V IP :P嘧Lᕧ << 厧ኧpܡ)H8! Z)@-Q@&0P@ t -M0S?^S^@0@d)b O-tM`@DӔ88p[- q9PU!"Ġa@Ppp bCppʓp[pP a8@ p`pʄJD Dp0̌(d DpÌ $ Dp廌GP:W W P`(  0p"4Q0J 唑p`pP%P 2PpP   P3?Pᚘᚘ0ppQ0P  pʨ4P  WDpʄW㊤@@ 04Dr` 0','hh.ZBt @hht@ht@h'heigtihH-< `'iH- nBXO-M`@Փ"x|t|T do@o  0QPKPP  HP $gP RP fP/LP PP( hP vP!    pPV QX Q`Q` `[`Z Q`"PAXP ,dCp) :CpP .(!P \pppP #P p@P48 ZP^@8PPU ሣq嘁向`@ P20t       U W P `P$ ` q$  Pq00 3/P P  P E8Pq f` ))GiTD'.0'Oi))+ DZok"<H-M88088 ,0P0 咥 i))'[wj@-@P #P |P [w)p@-M@`8P #PPo`,P PЍp  0  ZiO-MM@P+pk+d+L+P{P;Dp P$ P `  pQ P Q  z蚟캟 A@6Q $(``x0phX Z Ko`p[ V]r N_\[ 9o`ps"Pc  Hh 8xGF>< Vp8;"3 .` P%  P5  n`p9"P+ 4   )"P ` _XJ XH pP : / P@>x +Q *Q3 7+pQ('pp$7 0pS70S&6 0S &AAo <7pPp PMow<pQpXPEpUڈQWWaW&00;p pT&,P   AP  PG@P* l,TXU` :O%@5P0Ǣ p P Pq@UB<dU PP`U0嘣P5 U$ Cp*PP@6P! U  pQQL  U @PTf/T $  㹔@P @@;?S#h pFtp@ >Pp #PPPJPUi 0PJP >oRUW PO PfZ C`V PPb GXH@P . @P p P NP PI>A!XPA` d2@Pd@\ׇ? P'>>p>>>D!<*}C}\!J}) RV}rrrp@-@PX P  PQl `U UPT`LPLPLOo0BP 0@ p@pjAu(u)) )))H-x`xP@tpo QQ P 0D;Q0 T m@)))w4rG-M\P`@XLLPp  0ἡ` PV1Po'@-M" @@}P lmmd!0!@"pD0" @4@D"t#@Ѝt j 0H-0@v P P$0H0H-@ P QP ]P3 yP 0H *p0ȨPCP PPtP㼞@P@  P ( P0()edA@)3y)$)()ا)DyO- MP|0X@  Rdd!PP( , @ 0 48 (4 40 P"!!4S !4S !4S ޠ!4S נ!P0S Рd!T0S lɠP= 4TqTa P1  0a0p Რ0 ᭠0S !S1 ᠠP   ᑠ0 ጠZ: l ЍO|',|n8|?|F|M|T|{[|` d|n|x||||||| j?!BB|?!O-M@(P* ,P) 0P( 4PlPl8P,08<Q4<P (xQ Dk$ k ЍkP (_Q kk8 R*k8` aAQQp@BP p``Br 0kv0hS pRa`P R (vk<Q vk< QvkP PU*v` R 0 0R*0 Q*b kp pR:ppW:|rss,s>sqs^sss )ts]ttttO-,MM  (P `kP pTGP@Y1@[& :mP(K (( F1`V ( P  P9  Pf   {PP PXV  (@`P KPg @`\V:  0,P 8 jpV* 8JP% H`( &P  !P  P  j(p YXV @P T  0P 8 jp\ @P({h@x(dV`(d\ Pd L Pb < Pj , Px  P  P  P  P  P  P  P  P  P  P | P a`@VP x  5jHP:($| -j@ &j5 ֏  jP 0FPFPC ?( 03P3, 0&P&8 0P0 0 P L< 0P (4  i4  0P  0P  0PXs  0P e 0PPX 0PTKV*V:   0( d"( Q` (  (dVV $S/(VP \@`V Y P P  P @[: P ("! @4`(dP# </(P  04P X hp@"T:@  h4h@@ @(t P    T ( ( =tP P(  @(l!Q P ( y(@!Q  ( k @(!Q P ( _( Q } @ (R( Qpmp,Uo,Ѝۍ {hp@)]}{"7}} ~$~2~C~S~a~n~r~}~~~~ )~) j'a}*Y~~~}}LW\}n"nw}p@-MaP@H.Q)`P @9p/P +PQ  &pڄPPH8 p4/@Ѝp$$#@)WEV)gdx$)xmdrxD'xH-$00S Hk9tD'@-@Q f/\@@)K@-@PP PD P P00@D@gxxqx*xZ  xD'md)O-MS+4 *0  R Pg8`KO놔X @+pkB I!  dfQ f/P{4Q ,P(P  Q "1QPpQ: P |PM 0@gF\!1QA0DP= H 0/g5 P  0#gP1 n šP! @  @< f/tPɯcP dk ߍܧ)4))yVEWا)` }}y8)WEVy )#zNz0)'<))ybyO-M`p@ PPP@f, P4UP6? QQQ Q Q8/PP@Z Y  QhP h f@ߍ8P 0P tf4)zz{&{H-P @)H-MP5P  ep V"QBЍnz~z)H-MPP  ep ;"Q'Ѝzz)H-`@PspP RR! P0R* R v LL fQ4>  ))ܧ)@)F{H- 0,S P)p@-Mh` R@4T[(:0PЍpp4   )ܧ){{w{H-MPRP@ p`zdp""Q  "QOQ QQ @Ѝ'0H-PP @P <P +P@P0G-M@PPQ 0/P feЍ /Pt` 0/p8pP 0,`pP   @))p@-M@PPQh.eX` 0``P $e `Ѝpa}) Q 0P #:r/ Q 0P #:r/O-M-1MPl+ኟ\h0p!X (  P p ((D ` P> @T1P@0@aT=:ZaP90a @R`@š$ ,\C\蠀 @!P! p P$ ?P ` @ P `"V< LX " @]0S  3/:`@ " A@ mB*    З  p P' AP@haV :aP @< |xP4"*  0"q "Q<!Q* , !A@ m  B*   틗  gpK P <0 A { rL! H!Q <0  S(! ὗ5,,C P $ 0 }PP @b R q R @T:t 0 ^(1ݍЍo) pBuOχ(7)')YM0H-M@P 0嚒\ cP Q Q  Q  Ѝ0HЍ/'0H-<<<@P E PQ  `0H;o) ELp@-fMMx0@+p <4< SP% D| 0 P yP<<fߍۍprdAkp@-M\@`X\ 0S  P nP yP*ۍp)ǃ 0H-@(( XP 0H'<))O- MM)% XuU `P!TpY P ?P @\P @T0P:8c  @@@  0/p4 P  㫈  MT̄t `@(p P  :P ဖtThpt `@( p P  !P g(Tt `@, p P  P N,S堃s `@0 p P  P 50`S<\s `@8 p P  P 8S؂r `@4 p P  P 4Rtr `@< p P  P <DR@r `@$kpp P  P ѕQ嬁q `@$RpW P  rP ḕQHq `@$9p> P  YP ៕0Q䀟,q `@P  p% P  @P ᆕP@倀` PpT P : (P nT Ѝۍň'<)(p*=l"Z}Մ9[Å(HlȆ"p@-M0@  0P  Kۍp 0 X)'p@-Mt@xpt 0S  PC@`P '''''(ۍp)"X׈0H-Mh@ PP yPP 0[ Q(ۍ02O- M@P =P|ؔX `@p`IP@pX P`P1 NHP`H@TP:daP `pP @P` XXX 㭕Xp A9 Z* P@`pP @P` XX Ꮥ@T A9`@P`XX  wZt Ѝ. *'H-M@p $PP7  UP`P_ bQJQ#KA P[ +,,,,,,,0,,kA P +,,,,,,,0,,D * B Q CQ GQ 3P`,gQ cQ,A ,* '  *B+   Q`|PP8@ 08ă4#p `V00p d%Ѝړؓ@)crH-P@Y R!O0 J0 E 0X   0X  0zX  0r ]`( `!, T0 H8 <4 0< $ $ $ $$P T   0:l!R@p\`Pp ޓpWx 0!HK 'q2>p"KV[dvÉ։߉0Xt{"E O-MpW `S 8@T,PU5a 0ᣓ@ !R! ᘓ@ QT0<1T0<1<1(0<1T0<1<1H1@ IP P=,,3: 09#G@"T@ 0@偒@8p,P DpP"@ 0@pi0@a T0@8"  88Q  /<P@PPY+ S_N@8 D SQ TTH*TTD  8@  @ < P @PP+8Q @PP* 0Ѝ++** D @dm{tqЊ` H-`@\(PᥒP9 0P p 0pW:H@-@< 2/R f/0WEVp@-Ͽ0 3?0/ 4@04@4@04@4 2/4 < 2/< $/$$/$$/$P 2/(0P T 3?2/(04T X ,P0@?Ͽ2/5_4O4X \\0 D,PT0@8@4O_>8@TDQ5_Q  Brpp0 Q5_Q  Br 2/ PH8R?O>5_8HP 0P`@ 4O2/@ 2/ *0**/* ^:p )@-@8P wf//8)@ 0S3?S q R3WEV )G-MP)ڤ 0P0 Kꈀ刐@p P pa 0`;`@P`XXX /pGwЍ). 'A- dd0@ᗑT 0D DDP`H0pሑ`F v'U(HK-M@`pP Q p||`   ;V`Pp  `2/ЍK#-    (H)))ZK-MPJ@P PC*  PA*  2\`P8p "Rq1*w1  ^P&"P p# 0 ` ?.p lЍT  H `T0 8$0  %qyd))W=ˌO- MMP@($P[ P PC-p   P} 开帀 -p Y Ġ (zjP [(DC QmP XT 0`pP @ppW` 0QBBR}  -p X  p@~ 0小(X RXm-pRZ` 0㴑`吏AZ- pW ᆏX9 `XP KpXyP&;$ p  0e,+ Ps"] 0'u 0V`pX Ѝڍ ` &t0(, ⿏8D ! ) '-wd)Cxd trM  э@-MP@  KP*DD ,pЍ,0( H ;){dЀ)Ύp@-M ,p9    ܎P @`   Ҏ    ˎ   Ď t   \@ ᶎЍp< )td@)5S` zˏH-MPxx@ e,p P`T 0ፎ `<腎Ѝm )zd@9G)(p@-MP@p`1PP X+PHo"@  ,,pЍp$0  ? )wd)O-$M@䑟Pq` ҇qP p eP]PW儑 @ @@+p аP Q P*klP> @p  +p OQ# )0  p0R0P P`0p   `@V:Ld܍$Ѝ(( ׋.0'j)|d)|THː\` ܐm@-MPH@D +8p  ,ᱍЍ0)d@)p@-MPBPP? @`\P WP RP MP)` h `h`U\2P`HH 5+pЍp00, 㥿H,$t!K)ud)H-PM@` (SpP( +p (HV V( 9 ` m *Tp` H0( &PЍ(4 f  a)}d(@)A/a"@-M@ P PP P<<  *pЍ 0 =O)vd)0H-*JTR0O-\M@PH\e\p hcPQ@Q:aPl@Q HM(IMHMHM@IdP plW ER W rGoldW (p acWoW$PdWc lW Q0 -PQWD RWD SWH@   ?*pMpWM rW @(j Y   P@ @fP `PUpP@%@UD`@< *p(XH@ m )p  @ ` )pdpvj@tjXX"PT HT@ R4"0+RPbUn RP@QikPf T n@lAT `>Q吱 `   灤 sP& @p kWd P (PNk Vw@P pX  3kYb\Ѝ3X ޽ ҽT ǽ4 Ľ`Ƚ` ̽뤑.0'*}D;IVi!yaratcid'Zi|D({Dב~Dɑ LH-M@ ,$0    ^Ȓ'O-$M@PRHXA    )p= `eP7 p  )p0 P/XpP`Y !ZU.T  0X)kY$Ѝ BD$:!A!Cӓȓ0H-P? @Pc P P P P2Z P P)^t P0Hl@ˊ0Hjd 00HuPTXcP0㷈@c4 scidtcidrbmngntsyaraloobZQz]!O-cMPo/00@ϟ弟00/0p⬏嬯o40,00000(t Phš@`/P @(PH  P~{yd`P ej/P 0pP H p9 0W[ /P9 `6~0 #P* ^&P3J'p 4` Vp~+ V+ *C&P UP  S&$ <`P  p ,V /bPP  p (l aRP/S@'P(U|WYYYYYYYYYYYY\WWXRYYLRVY@WYYWYYYYYRWhWRHWRYYV 0@Q&A@QUYYYVxVYYV/8006P~8PyQsQlVRRR <tT<Qppm"  R I Qq Bp `/P pb0]8 ZxpVAQ*?8P8P MoOP0 PEucߍ,n!pT`$P FP #xXn `\X)U .%؆PPP'xPP hP T\Q0Q P<oPTEPP| P`@,&P H  P\L P0 7<`w0 \pno"@PT $pp5d\O0 ; ߰8p&ʭP9T~b? wp bP @b? hp@@Q Q@%p",{Ppd9pOd/ %p9\m<@/%p/8f/(H!L1  |p@pJT   + R< 1>R B ?0|(p,00 4h.n~,4(@00< l~?P\n0m@L~LnLΟ0,>0~`B`?0 R0Rh 0 P D U,#p   `m4M# @ T aLP 0-P P ]Ln/4o,U  @_,| ,P P  < | l\ PP,0p`0p`}0  P  P  R \ TP P Ѐ4P鑃!ލ !ލK\i[F_,)iO-DMpl@h`t[8 ~ Pp4 P| ̂^ *p@pP<=<̀P@  $@9@p  ^ $ P~  0 p <@  0l p0 P yP@p@K\ @p@pF@ `@ 8oRPZ[X <, (p؀WP90@ PQP S `  \ % `P `  P @P0WptP PX PPo8PR D@ P 0P[ `@(4, P<P/ [- P4p<V H 2QU QV 0VP@`0 R :S p<4P pi4<, P p8P U?ᩐU0  W|f 0X 8i[P`[   [ 0 0  0` `5P 08@ S(pPQp[8p g t(<P P@^ QR@Px 0T ! 0pRppp`Y```pPVp` 0 0 Y U Pp<@ 2aV a10P`W```W@p 0 S44 W<PPH|z<@ 0S0QS R0pSppp`Y```pPVp0p0Y0 PP `X a \ 0  P8@pVoppp"P @ )   0` pf<(0ePZ   0 @P v   0 @P  0R PP4 a@-P< Z  0P@O 0P@ P<Q Z05 $QHDX )'@  4!,@Q 4   Z @  0P0* ,04 @0c(@ %pPI4 WE p'?Lp@p@`PG V*!0r@pIE?W f Qd `P_ P0 !C0ppp ppL@ 0pp@@ ppx? 0 pppk$?AP@ !0p pppU@ 0@pp ppIP|  ? 0 ppp=$?@P(@PP" `PUPE>QQQ<P`@QD`(&<0@DЍXSLPh)` @))j )P))<),)1!L) ǸZ4)8)0)߰".O- Mp @ R,PQ-t ЍOPPX@PbPP 0PUP  Q P 0 T * 0 ЍOP; tQP5|t)`p  W  0*P Q@  0W   0*@plWP " RJQQtldRP ЍL ЍOG0))h)ڬ@)]C,).H-M<<Pp,<,!,1, 0@L0!$!1 0@$0ЍH#0P@ 0` p`P~|||p|` 0p@@ Pp~XX X ЍH~)D'D'x)|))t)ij4)8)0))/L)P)S\@) M0H-My~@@PP|婩P P p @Pᗩ Y@oЍ0H Ѝ/ հ('8G-M@Q/ Q, pP`% P%& \ B p \o ) @⅄PEZ* 0>C$R% P` 0p a1P0Fp [RQ8Q t `CHQQQ Ѝ߱P)@) )/O- M408pQ.  P 0P0$(l@T@T`P@PTPPPPXPQ\ CPk oC`!R RR@Q QQVtS!@ $ QU=ご$C,Ap Q W ! Q 0  R Q\  ` IGR )QQStbR \Py\ PY(B\S BPX(m0\" # \d  ]0CS   B0p0Spr!R< ` 0 @ sAQ ;P\8 @wVP4 U ,   %Q QP P댰Pꀰ!R$ @V@0 Ѝ4㟪Sw)h))@))P)ײ0H-`P@T 2@  $'@00@)O- MLp`, PPؠ*@AP 0U $ 0 W PPPP@$ DU U E㊴` \!` G l$!$1p @ G Y p@A p  Q@( ?D+! ?8  Ѝߩ@)P)4)8)O-M p> pB1!?! goP 0p  R,ЍOP 0 !  PG,P" sP Ѝ㈩D'D'd)O-kMM%嬵u崕eEP-0 800  pcPd @R/0@@@@@@l@@Ġ@@@@ĠPP- TPoP :` p ~P @T" P" @6   8@$,  @   7 pcC3NPQ nR R oR|AXCP   L AP@Cep# U A`@  LpPp/P P"2 PpvWPP&  ,Pi p\@P DP 4P\  0P`:AT @PY.;㪞QpA  pP .p7 s^Pa@P/"P,*<Y+]밐(!(1`kߍۍX0 3 'xd.%.| |>!)))h.` )$)!l))0'8!y}Ft!Zzd@)edAUX̹{7&PXH-`@P;p  p H-u 0vsԼ'A-`PV p@:( `0%u``'Yp@-@P3 P+P &P !P#`V PP `VpP \P P`V PP `V@p}Ft!)))O-MM0@TP `P `V@@lPd \ Q vT p ㌘ 0$Nt @P8  ?P0 Sp@`@ F[ᖘ`P -P = qSP p   L q?pP @ @  a "V  tT JpBP tW Stp @P8 P T TV @ LKZP T TЍڍ p P P!pP,Z ,QP b  @ @ rP P7 ?0010A4,Pp[`  s yP [  Y Y0ShPPY | Yp tP` )2!).!! )H8!!2C!]"û  0/))/)/) M@-M0 @   u @q'G-p@ԐQUP s`Q Ps ntWa`sUP YsUP @h $sq)))ՠ MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    LqO-uMMرNp@ @, op ppJP-JPJn@  P*  P oD ޔpP   p ԜpP' PZ'%8%<5" #P P|p   P 8D4(l uߍۍ)i!Z)kAQ2H-M aP DD 000^r 0 VrЍ)H-Q 1/ V)0H-0P0 @@P07)@-@@O-CMM@ (000 $4t0 0尀p,剞P ^`P 4/P 8P P0P  Ar4PY  (`  06/PR $P , P ,W WPYPYs C/; 叚 p 8 P`]v ᐰ xH * @  `V P  PP `l` G0ş 1:o<0A 41,Q,! oo8@`PoX@Pphp W  AQ X P  mWNW YWyWnW Y@BߍHЍ/<)D)|@)>'6 G-MP娣c  Q1oo p @p P  f @PJ4t P  nP ntrqPP\"QQ\0/`c\p P:P   0`X  0p N`M PU:P `PkP`P^ `WP \`KD pP  @0` ;T  Vn PЍP+`xpW"% %UV ( PP ` ` ` 0M`QzN  D8)<)D)ۿ.`O- M0`  P pW Pup|pLPPip Z pW!URQ Yt+N`l  @THP `PLQ M 0 Ă1@! PX0@0 ,KP KPDpQD#M MMXYx `@@ P ! `o 0D p Ѝ$^$(* X+HP#,30 4080 00 C  P;L#HCPPP , (pPR #0 U($!#0Ap 00 < t pP30P<@/l X X $P, ,  RTPL@iDPB QB* " ,B.0p40; 40   E PA O A P3 X4A P `0 R 8 `eV#P M M "  Q)* ,PL \*  0Pdh0l PPUPMPPHPEUPBpP>b@d@)A[RRaArrAa|1!3S'`H-MpP`sJ@P p00 00 " P0< @0!10 00  P |L vLЍO-$M`lp 0@P PRFP p< P PP7 L P p@0 @P} 4L@0@0@@] LPLCLqC Q@>P PLp$ P @P Lq @ QP@LPPPP@PPPPP @PLPPQD:P P p 0 0  y@ 0  m@P0  _@P R *0  Q@PPPU:KpK$Ѝ-G-M@XpPEP  d 0l!  X vX Q $ LK ЍD0H-ML@P 0T!@!@% t T llppЍ0T: tP0T:LPPL0 t0! M 0<P "+!P\P/ p5/1/+!54"O-MPpP: `p P 2R B p:C q&: pN qO*0 r," 1H @dC p,:AS A s:A@0 PJ!AR A r:A@ d P5  P88 ,P' P P'(rs#*@R r   1S @ s:@@0 P P  Pp`Vt: ` P PЍ9+!54"jVe|1!@-R8P P *2@T@PO-MPP:`"Q2 sS p @P`Q:Q*r@pTSPP`VP:PR\Bp RFZ:Z*0 b `V Q Z :A0Z:   z(bJ q : Z ! z:! Z :Z *@ 0WP TA,  0LPpW::  0  0<`P P UPZ *  V pZpGV:PQ *"0S 0@@@Q@P0@PЍv)+!54"<K-@pP Y8P 0S *r` VP 2 S ``tP Y:P` Q*`Q `)\O- M`XP@ uCP Ul L p $ P&#t S H0/LpPWPwPP   HPQI: ,L0S s2Slpplp00PrP'tppPp0000'2Slpplp02#402Slpplp02p#T PP0Q *2SlPPlPP202#20P0Q: P @X !P0 !  P P @@ Y:@xHuH@ ЍcDO-MPpP@P;:`@Q  Q P`V:&   0\@PTgP PQ *"0S0Q@0P+ <`ql Q(@q PQ*lP P G6P PP:"R PVB@Ѝ4-0`Pl`<@w|1!Z"A-P W@B$B`V` B@T@ |P p!00|Gd(KBP& (KD8Q:PQ*" P:R R 0S% r:GGl\`8P $ 2 p p p L)P)p)T)$Q|X4p@- @T 0@00T@@Q p 0S @0S0S8P8@@7G(`4G@@pH)t)T)p)L)X)P)G-`x0X@XPpP  0   p T)H)t)O-eMP` 1@P S:PS*h X\4P`0$00d@PL@D 8`DT0Pn `0`0C !Pa@p 0! (@,`a  P[ 8`p YH` HPd@` ( Q Q ( T @ YK  @P/ (D (JHT` @LP`0P_ VPa `8P0  P*  P: ` Pp@h P(` @((` dP<@@Y 0Q$P  \04PSXP P K  P d |@ Q@@ P @QtQt <X@< Q.  0 p R0 PMJ QKP G @ I0\0 oS4P0 XX`P 4PX\  PR4@@ \ @LD 0@@HP $d` X PpT  Z3q@ pq0Q \4Qp\@ XLLq   0 T P} ,p0\h`QlPp3 `T4`` p p\PL`pp @LD \0`d@@d@0U  4|(]8`QRX\` P|\`\X XTb \  D $ Qa*l 0l@ A`PpWPO pE@P?p pEPT0U: @ T@:UHP8`>*  @A0`PpWP- pE P?p pEPR0U: @R:8`U*HP p0SP 0pW?p00P  Q:$X< EHP8`<Q*Xz@\ X4P Qz \P  @\P @P`\` PQP`P@\XX ` dyDZ8`Z ddP"@P[ e P L@@Lq@@!Dd @Ad@P- P < 4P, = ?LPP*D  QT0 ;O Db V %P v :D% ` !YP P>@H\K`HPQ<D`PX@8`w+P! Xd@@LLp @@AdPE d X \HPddAT:LPT*D  T/ HPT L PT*Dd#P @PP d @AdKdX\HP @?HPT* !0 P $ $$$A@ DLd Q: g P LAPdQ*D`P B PR:dd.Q H 7P) `@TE G  X P6 3<veHPPq  LLp^" WXP HPR8 QW  Ll;PH \HP d=KQ=@P  K/@P HP@=HPP #@?L)DQQ P LA@@L p@@d \<(d\"\D`"Lu`PHP8`rddLd @hhX\<HPdL@dDP5 D   ,P(p@` 0! qHPeR yP^dD `  d`T0Q:P`Q: 0Xp!\Q僒TE\D Xp\ PQ4@@p`=@@@ L   0d``d`@@ LDP  ,p(P 0/! R Pi\eߍxl 0~+L) EW\x)S1u|-p)t)H)7 :ayNO-OM@ `P ܢPC RpWd<PT `ᰒ崂PW d pW*QQWD: LrP0:PP-*d0@` 0P" $ ! "d  dPpPUP q ,P PUPXp`SxOxMhKh U@! 0P`` d 0QP,Q 4 f 8 90 Lp0  4 4    PC ! Dd  /d`P 0o`OߍUX)T)\)`)l"h)p_@-@P A\)A-ppP@/`P `FZ @DTdPU@?dx)O-M@0TV:0 X18<`倠0 p PpTE*TDpW@@p` 0D#!pU 0  ! * p P" [* p 0 ! l P P T D 0BT ЍP)NO-ML@P HP PP+ DpV TJR@ߍڍ   P ` P _0]@^`{F~tPgZ@`s[ wvP \^/p P =X T\jFF F@O-LMP8 @H 0N  @C E$S4<CE(S8HD9ⲟ9揄, !2/!A4q"X3\cs2/3?6o7"X3\csݩ٩թ ??j ͩ p Ʃ p Ῡ, p ḩ$ 0p ᱩ( X1X\ 13?1 Br4 01Ѐ  ŕ$5(u,e<Ͽ3?76o ń$5(u,e剩@ 8p Ⴉ< Hp {D`H%L5Pu2/3?7H%L5PuT0TX0X\0\LЍ0H-@P` [!V!Q0A-P <  P<Ͽ2/3?> $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 !""D`6oD`#@`6o@`#H`6oH`ߨL`L2/3?6oLX8<\L01`\XM`Mpp` }}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p YD!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,0ЍTU  +0 BR!q p/G-MM`RQ:@ +5 T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_ ЍۍLABLK-M,(pQ@Ppp  @P` Vl# 5_ PM Ⴇ 0AQ p ЍDLABLG-P@ p`C P CP  !  @T@@CP CP  !  Pp@A-@Ppy`P@ P$@q`AO- MMHQP(8 pB`?0 @o?T @4  P p PP2 B R000 i>YX"XŸ0<P`6o`@`o`T@p@p pW v`ov Q p p R?rp e0qPZ !@T p` Vk# l@1/p7 4P0PP R000 >@ 0@@ ߪ` *ת@P .^;  Pppp ЍۍQ0X *x**p******O- M @ ` 4  R000 =p0PpQ  P 0PU 2`0 S9 0?sP/5PU  PP  P `bB pR0 @00 x=!00` R  W H  GP0Pr `P@`ᕏQN ULVI  dPB0P`ဏp`F PY0 0  BP@ R000 +=0  R q p \ 00 P 0 U  $ Ѝx*p* **p*H-M 0ЍH-AM`p(@P/N X 0P@AU:P: @;P T0P ?s0@p:48 S /$/AލC**k;!W qG-Mp@P聟Q p`V̑Z PPS 0pPO PEUC p ! ` Q p4! 0 P,U/ pF _X@PQ u X2/P dPd;P Q P wpЍT D ЍG8 P wppЍG****z*W D'!p**O-|MMBNX ^P` P /r 6* R . c pP dP`5 LD:P  @V  p`$ 5U@ h$ $0Rp0d50S 0Rt01l1@0Rt0lpBHenPU'L.P<:PU 0 0T 0 H uP  R3 03p@$ P$`4 0S R AqR AqA"tvPQ W a  0 [ Q p  P+?PI p `@  0㗦 t `@P:f V<S @  0ㅦ! D0  f@ V.-!:P  0`@ " p@bO-t-p@@|Ѝۍ$R#X 0P/ ?@A PR  4` p  P |d1LX0 S( R- q)|}-xe 0P0p$h`S?BL? @GR q?p9?   0T- p  0^VP{ Vx*W **8*D'4TD'*-!?p*J*kO-$MHp) pP@ :D`@ 04  0@T`d#P ; @Qp0; `400< 10 0 @00Q1 0` 80 =@ @pQ ptR TB(Q 8B r4 0S @PPPPB9P  @ p垦TQ p H24 P0`  ㉦ 4`V:P ,   PO @U`P o@?>`  0 O`p4>P .>PE 0 - `p `$p>P >P >PPP _  >P>0 0S R qR q $Ѝ `x** *D'*D'*p*D'O-MMZ:`P 0Z0*0V0: V* Hp@J@`` T)`pLWpPH<0@X@0 W t0 0EWt  (`_ 0,; W X - Fp 0W"@X  F@ 0 T Fp 0W  F@ 0T@ FH >:G 0 <  @<@4 ([@  P 8   ͠& P0 pc0 S1S1QPS z [  ( Ѝۍ8T;  d0p`0, P$`(p( q`,p4xQE ᓠ ( 0`ዠ$ Ⴀ| p78 p(,tP 7 `X%p 0 pR" ^ [h 2/0h p7( $0 @¿d?`0@h $h p4P@P`P a16"! QX!Q0SPN_0P[ `- L0 0  `P 7PPPg JM0 ,07PPPT J9T0P q0?Ds`Dc00 Q(`  E00 `V:P p` 0a731` `b4P A`V@``Q1Q`S pV N- L d0S/7P8PPZ P" p 0qbp`(@W`0P) P}$` wPt 0 8@pP 1qh 1H!0` R `P]h 2/$B2/$`P $R?0, h PƟ$B0, 8 ; 㭣G)P 5P  xdPD@@  Mߍۍ**x*|*p*SwKt**O-MPPa:P \:!p  U :x`U=:@  0`?ᐦ#"$1&(\%R !`0Ϡ&쐟b! x`E`@媷 doĀ02 T2Q SR0000 g30x`  ŞU  0㽞DD0Q0Ѝ  0%* *x*Tt**#  /t*O-,MM`HPP1/ @ (QTT ``0 3$JZ0tP@ɯ  ` @ᒕ0"Q%* ` @ P 0_#0 U1S ' P P `P$pRP`V P $!2/! Q($ 73` @ pQD tQ> ̲QP $$! ",pAN ~7P P $@$$ PtX$2 p PIP $  ! R ؚ $ P Q 0 Q  0HP $+P  6%L1P1/ @T ` P$ ,ЍۍPnp  Q@@R PPHDD  x****p*p**SwKt**O- MRPP@pp P P GPDb8P4Q @ @ 0 0 P P  0M`? 6\ś\ 0 00U5v\ p?p 0WH,PC va\ p?/0 @|M\5)S A0 0   QxP v``\ p?L/ 0PM0 0IM Ѝ*x**TO-M 3@`0p$%V:3Ѐ@R : 0P@@  ἰ劜?k#"\5 @++`#S !p0ϠB'`r! xpHF; d0! T!Q0ϫQSp ee7 @5"Q  2Q0BŸ U`SQQlrP 0P1P2 P lP `AP2 [l<D@`PQ p P hp) $oPp7PEuPp7PEu@l T;T(EP<@[2T\`P`P q QQ 1P1PP` U TJ P ՘ T:@ 0  1<0h,Q ЍT0"0*8*@*(*x*H*TL*\*T*X*P**`****|***CG-00`P@ ᐛ< !``0P0p P`H p8W P5a8<W0pT 0P `0p@ P` +:P  0d"8b"x*f *H*8*0*`*@**X*\*T*L*P*@-@P +`*O-M  @p WR )0 `B? P``P0V8&P]  ?t V@ #1P(00)0?o200 $,` p( 00W @`Ɵ@P 0 U:@X 0W `P`_`0SPP`Q pp)Q d 8Ѝ !**x******0H-PT@ ?ᙚ@P !# " 0 0!**p@-`@P TQ HP`@#+V*+P+p***A-MP@`pBW(P q1 Q! !G`P H  R0Q  L P0p`` p4P , p-PPh uo3T  $Ѝ*\!W *p*j0***@*t*H-P 0@JU :xP:@XyJTP HH Pp Q 0l$P !  Pp P 1UJPP qpKJP CJ`Pp P ᵖ l04JP(Q 0!4H%J****Ct{"*@-p @08@ T 2/`@0 &  t  D ͮЀЀ*K-@@P`V DⱲP pP 1QT 2/ЀX:P 6oV P:pPa**0H-8 B@$|0@P@00H-M@ Pd$0  P @ nIn2 AR: Q Q Ѝ0! ,O-$MP@` P2Q P@Hv U *@2`P P@%$y 0p Ә'!% U R-: Q ``W`1/'P p  ! 0P* F00 R0uP R)a1`$\5S !0 0 t  ?[- ڭ嘄Q P QP T  \ P PP 1 0 \p! Q\.0 p؃pG pL$  Rp$4 G  $*㶙/lP  =*Ds  X  X  X80 p /W "pp R } z溯tQL 0P(r z溯H<emD Rzd (0XⰠA.!Z ؔ!? T pb;wr0 RSrQ 0 Z  ῔ 0  Ḕ p3P(& dⰠ .P 1 ? T pb;wr RSrQP ፔ 0 0  ph||| 0Ѐ Q 0 $Ѝ**x**CT ***U m***0**t*O-tMPs0P 弐E4#@`(3\%R !0 0 S  ?, ᄬQ P QP kPP X@X㡲x dBPH" PpR  Pt 1dP1dh 0P t ddh `6P , 0P @ P$0`PQ d h0PpppP PK1P  R0V : 0 ᳖pp!Q\.0P p@Lp$4 pp $   $* -`P d(P P0@0/ PtЍ(`ax**T ***U **@*t*0***O- ML`P0 PSVC2 c,3rOQU 0VuQS /r S00ZS  PKZP YP" 0 l? `R w Z2  R4 @-00 PW`0 U@  p㑉I+PU`PU  pPs*@Z  R  pQ( 0 Y *NQT 0 J w*  0㰭P  0ᥭq@P ˒p@  0ᓭqP 7@  0ᄭdP`0 9*JZ0 0PP Ѝ x***O-DMhh` pVWP გ,PV@Pp0 ` W ` p m  hW 0,P0  @c<D> 0SS>CQ 0t08P`PC p`T%$ 0,,8_R0PU %< R 8,!S2 0TpS` $0P@㕨8+`VpP 0V P @ 0P*0p0P40 $pP@̐WJ  `T Wp   @j$PT@Q@ 0P@ Q< 4O:Q 0,( `0 0S R Б 0 ˑ R ő 9 0 ,  $h T 8P `",00 08?R00 "<@ R 40$ !   ),@`(  0PP  0E! R m  07Q 0 1 0pp0 (4`VVp:8^PA pXL80 0/Q0  $,<P  7 0倁, P 8 0 4`(V5 0`F4`P@`pDЍ@@Q 04 $Tu  0**x*t*0H-HP@8+  0 t(@0h@0x*O-MP0@,P ,du$4dpppp =TP!a@Q'kdllmo moooooo,mdmo|mmoooooommmEP FP PP$UPl XP BPzp8ὬPe (ḬP_  0pb CX p ᛬PI x ᖬPG hc 0XP@8&p m0  R *Ctpn  ghpaLTZpTdPKpp R`Y P  `P `pPUW PџP ̟lP şŸU3@Q][PPXX  0/ppJk`T@bT@(>#JZ@P@Ѝ+LKul *|*x*p*l*t*u***.**h**t D'****-"*4r0'0 >p *H-[ hC@'(p@-M@P` (Q QЍp  0uNO-MM$f@P6PP @ps PPn k%P P P P xhtP hbdoPPiP<c"P(] PW P PME$@  80pa!   6XDt@d!!/00b  0ᄩ 0どd@!!P 0y4$03 0 ̳"BcPe s$ @R 0   BPP 0 ,po0So7W'|c4@`/8P@`u/@p2'6wP# ` X0u'  0  AP APU B APU ABP APU B APU ~A$"0000pRP '\b @04*㑒<y(0P # bP.' ,P ApQ ! ,pW:!1 0 S P pVlP@P& PDIP 4DP $({P (  00($0@$@AP P)T@Ѝۍ**eo*x***>\}*0*(**4*H]*******p**p *`i!2!O-MMdd0,P< L0@k;%\5Sp0[ p0p p 0p[ `P@`_`P@V@ON @@F`PVh,[:4@uHL$00P(Ο_^A`NP`PAUP Q pX㟫, tt?mppRppppt p8 $xH((((@ @<4K 4mX@4!\5S 0`0 0 hOh  ?$  !Q P QP  hlQH@P  X pd,`j4| 0` @0PPVX`Az T*d@A`0xP p(@ p,ppu`:hp(\ l`pQ @TQ`P W`P  (l0h T0  04%TP p` pthpPW tPOK00!  Q :0QQ: \RVO:\P P 0?l`hp< 0o\@$"P Q, ,+؋V@(0 ythpPX XqtPS l@0 C}"PQ0 @,/-h ,` DP1  @@pwQGZ"hPBl pR4 Q% ᩋ0# \l`dPY`:@hPQ ቋ0 ? ? 4`_P`LPp0 B?bqJ` *8pp R`Dp PPTPPL >8(PJP  RL :(Qv P<QLq*P P LP 2 0e V 1 ]: FPf8 F0t ORt#AQ2 0Zp-L0 RP   ;q:hP  (P 18 = pd 0T`"00a#P# P`hPlp@P L 0 `@j>( RT`pPh% 8|1p P PhP `p vT  V)ʆp( P (1_0iT Xh V8Pt@ V? i pP UT! X0P @A_p- QTPp P`L@Pd :* R \D tpPNTP> *l`L@h0`P`D 0>L:0ST0= P!  P F 0.* RT * P P 3 0 =t XR 1 =  P`L@D PB  R\@l`h0 L\@l`w PhpQ3 Q pP hp#PpPR 4P ,Q  pq0p1 p t 08P`  8p  ' R P t 1PX1d0 x***TPtXdpP4 `P TP0 `h@ \R 1Q xtQ  0 Pn ?PT@\TPX \Q 0PP  TP0 @P@PU  8(*0*p@*<**' TR\ 0\% 85 =LpT ? pb0 RSQT   % R <0t p2/ **@TP@ P 4ᒡp  %PP l$ R hp **DhQ 0hp 0! +  0 P?P la`bP  PQ # R **Q 0hP 0 &$( Q 2/H<x-**P`r d`@0 0pYpr`:p%0&0tr[ X@Ÿ40P0003`PPS`Pad (r & %E Vt*A,%Pr pYXP*(D ͦp/*7P P$ XP$\T T0 P@T0AX`p*qX@`q,@T:T pk@T0gp` @0b PЍ؍| GCh9X 0( 9H x*0*U **<********|*K%s*p*\8*****\*O- M؁H PX`RP:  @)P d"Y\ p R <h pW8@R`P   `PL.  H`00& !+a 0 P ;FPK Q | Q ` 0`& 0#0 QL"`0`0`00  # " `pW P `t`P d lP@PPe<`P  ЍP 8*B*\p**j***eP(*O-lMPXi堡1 0 X,QZ x@P Q  pd,`ဢ ( 0`:Q4 pT):P$ ` @ QpR Qt0\0Qt\`"P  @PpW:,X:lЍ*x**T<*i'**O- M `V7@ЀPp  PpP  ! "   Z ZQ P `Vpp Ѝ*j*O-gMMm"AP (P v P& P *: 0S3 R ,: 7 Y P  t OT P   0#     rPW7R , , MP "( 0|Y|I,x9 㵏 X)T!DP8 78 X(p$А?@$P `pH@QdDn$ 0p9p(P `P4`(PᮡE((PZ4(`  (RY Q_ M]A_  !'( R   GP @@d(P@dET(PP& (R Q Q  Q      4 k84PU [ (@Մ 0 @[- (@ʄ0* ( 0, ` Q1P  0`0`0 P, Q(: 0 @`30`$ Br0 (0, (`  R1Q 00 `Q`, R: 01 Br400` @0Up@0,0[ $U10$U ?@p8X:Qz <$8Ys* (`p4(Pg  ѢZ X (@ : X (@ 1 (, 0R 4 0P00,P U: (, (0R 0 !, Q:0P@0 Z ,4p p@0 X Z(t2/%1Z(t%.8Y:Pp8WV*| 0(0S `0@&P#P0s8pW:= `  @0 M|QP&  @@@ 0 0P @|0 * @pAPP`PpPQW:pW*P    " pPgߍۍd ?**p*\A***4L<*' **GB*!3**m00@/O-IMM@ @P8P# P Q 2/R |,03? S *Q 0P H P*O  @`V 8PJ {Q 0KQ!(,㘚 HHH|+_ R  `p  QP, 0 * ( ( SPY @Q+ @pp%JP 6o  = *+ 7P4Q 0/x +P1  (@p P   A  PP@p`Y`Q 0\yQ!L(, (( p p> P  P  /r PA0q   p0 P0 A pPG8 @0 B S qwWpW (P/ w ppqP PP6 + 2pcPPC  pPSL  0P J 0LGP 7pP+ Pl &/9Pb _1P  PN`0`0P`0C h` >B&PQ `@p ͅ pDžP  0 A@ 00ᨅ R- P.Q`VP4% .P%PPD| 0 Q 0T4`V *400PPy(P* Q 0PP Q 0P P Q 2/P0t4 Q0 0qPL弃PQ 2/p`GP?*PpW \PH`PXC Q 2/ 0>BP4 PQ 0t Q /* R   * R   <P|GP:WR WxPj0 S 2/L2ebQ 0p0 P1  ! P 02/?0 ll!0 `P THPP$ PˡǡP Q 0 S 2/0p00|Plp@U Iߍۍ(  ****Ty!p**#;H*`W~*U**9Q/0/*O-MpQ\`s/0 AL0 Q @K `PDdvh 0`3P`(  @R@p00R 20S20S W* prP&P#J@P`  PT 10S R @ p a:dqY+ 댑PX (PXҝp    `" \"t!`"`!Pp R Pt1d0"ؐP#*Ptdhcw |P "Q M\@LEpK[5*ߍ**<*o'***8****STO-lM@X`c,Q B Q pd,P  0P2Q p@U|:LL2 0RpS R0t01\1RX0d0`1R0t0\X0d0```X``A0V_XLHL`V )P tP6 h!R0 8*HP'  0`0#`&0 Q#P P  01 ` 0`0  Pp@Tx:,`0@,XO:lЍD 0!x*<*'***fZz*2*nO-,M<(@p`P? Ř$P4\%R !0 0 s  ? +Q P QP |P(p(pP X0P YKp$P BpPo" pDa P P  "0* M Q$Pd(pU  ?OH0P?`.1$2H PR L 4P0L(p  8 QU 0L$p$p Đ$p$ 0 4   \!,$P p@`YpUW(A*埁P &P P@ P,Ѝ(@ 8P `P?ٗ2 L` e"cc`c `US&Q0x**T ***U **(***O-MMLLPp@$@]$PdpQXP-$P'NP 1PXP N.$``*P v `XPv$eVVqVoğP` 8Pp0U"q0p_~PO1.10!$P` $eNMP < p 0on 1!$eV`P@Wu_~qq P- Pp`L0pPPi L,pPP*㥀  P , PZ pLq P 1PpQ☚؋Q$5!SPQT!ϟ`@PYDU B_ `!>P!Xa\QT!1XBPZd`0  PJLQ qATd ADG%|t?H D8 < x@5$o PP0 XPUH%@! 8 0o0SPb`/0`P`ΟONapPn@p@@D@@P@,P2 TTⴐ4pT\lXPXBL mhp@pP d>,Ph0 P;/p?'!\%R !0 0 P_Po  ?  _t Q P QP  FP P pP SP N x儇P @P @P 4'\P 0p`dPh@ e?4r5 pU%7Q Sj 4!\5S P`00h |_o  ?gP X@ h  P ]/@\Q@\PPP$ LP `6'\xP 0p`dPhp@ e?4r5 pU%7Q S,Pl,)@ RQ@pp@X lDX p %QJD,A\QJ cP b@ʕPd$P8 ổP`p(@FύT@! S0! R !X  xPh gPPD^,PLUX PJLp P2 PAP!pdddpl+@QL!pPU:W:PP0J/qSL!0AV8P= 0p_^Ap~Pp0C7 0HJSP0pQwpq8 RPQ Qy1 `9RP 01 2 + _P]  PK dX)QD! !0)QHPE x******PET d  >Ppᬔ  EP /堔$P`\!08 818`VW$̷P1`P. \X0 p`  **Q $UQQPQPUp00`Q`V:Q $%Q! !t / a| /Qx /ALs %/  `P0 P · A(h 0@+\P  |E*|P  < *P 崐 ||e|E p,pW:|*U d  ``P%PDQ\T `P# XkP d h|$P\TQD  Y|D **'<*P Pf P0 `4QLpP\P @ P\ !P @T`VTP/:`D@3P`pQPP @ P\ ! P @T`VbPLp"Q\ _8P: PP5 0,"P\QL  {!dT **H@%^ _PK  P D0<@`400 000( 0000$`,0 0*(pP 謀0 *b{J|P   ߍ؍**h 0 |*x*****&*U *T<* **|*8 ***Rp*v*AK-Q PPpP`'*`@"*@T )P V:z"3O-Mr!n bR@1% P#  )*CCzP 4d  ,  P P@P) ڼ %, %*zP 3  ^P[@U>T ЍЍO6P P P,x**ZCD'r***p* 0/**/*/* M@-M0 @   * (i''G-p@Ԑ寔QUP P)`Q PE) s$t`9)UP (UP @B $()-'***ՠ MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    &O-uMMرNvp@ @, p ppJfP-JPJn@  P*  P VoD ~JpP   p tRpP' 9PZ'%8%<5" #QP Pp   P 8D4(l uߍۍ*i!Z*kAQ2H-M 1P DD 000' 0 'Ѝ *H-Q 1/ l *0H-鋓0P0 @S@㞄P0xp *@-y@㏈㑄㎄o@O-MPO``(pVڤP 0  P  P `;pEPK P '尯o         @ `X` p PT WV!<i c 'ߍpڜ|'Q P R `T~p 8~LR> JpA@@PV )MPU/F+\P p)ʇP!" x  RYP9 %, %*2xP  P *'I tQ>Y< `PvH/H0DSm4`PhX PPb8 = N@pP= QP @ [PI   >+ ,0p0 lt`P\~<8P?@o_pA  #`pW.|4 R ( {Qd PdJ P; <zW`P AT* ر[^ `4P\ X[ QY ͎0p8 8Ė<\S$ P -@$PA` P9  @0X# *PERwT : H P h @X RQ!  @ %_ P0 < %  %*(w  P  P:= P * w0  $ P ` <dQ:( P < *v  P Aq P3Lq+ QQ%ڈG R hPHP*v  P > P 0 Hq& F0 aRH 幸P P*v( o  P  4 Lq& , o F4 aRL 卸P P*[vxC lP  PZ@唟唯F~ \4S) R& PQQ PUQ P8 ( K R  : XK QДtP DP | .Pp .P*u P S Q,QS 0"!& 0C04eQ P P*u$ P M ( (R xQ+<Q) xCx P< (%P ÷P P*uPy DP  H8%<5#"( u8BH0/S8<%  呷PP*_uG |P  @L@%D5#"G BlQL0/S@D% <^P0^P2*,u P @ @ @ pP *l**t*/\L0N-H@?@@_!0/@QP,%R{PPF G********x*Lq4 QQ-0N R PP*t P B |*P Pz |.HPL0P4e00P@ XLPVTs *'O- M@ @ 0`@  Pb P @A PV P Q@\TT P(@poR  obW[ X5:UNV+ J(DP@@ZP P p 0`(p Z W [oRob8@,@  Ѝx*t*p* **H*H-MP@T d n<0> ^S>Q`p'`&p @T@T  @  0 00P@@ЍE*x*;K-M@Pd p``2wp0P PpQ`S! 0 T(D D000 0r`Ѝx*t**x**O-MP PX `@V T pP@!@1V< 0Lp pT9 R4젟0@`L3 BR@Q  8H$dPL @p e%705 U1Q S P  0@ `RЍ*Rx` *x***O-M`@@P0r!p   P0 PS X0 @TB4p     R+ [Q "P 0%@ / ' P ?  p 00X@@d0P  `Z sЍ**&O- MPJp`0@Pᐢ!( A P Ѝ 0PT P)  P O 00i P`U ЍO&*|4*G-PHP<4PJ,(PP? DP ,PP  ?~ 0ꬓFP$ P PJ cO ? *kthP ] }0SySsp@T TQB  PF rARP TbpNPpU @ U`P# P"  @P$T$X$*@jP . @ P帬P 寬t!@@*j\hPP ׻ @PP D听0!00*ajIP ḻ P @dPN0 N3(奵G袵LA*p********x****H* **t*p*1****x*t*A-\%U?F;R-R#J + u??΀ CNLU 0`pp ,u p`0 P%0p`P%,0p`ip@-`D@PP ( 0Pp*\O-MPD0p8^ R/P 2xNP`C YJ.@!2 @pS @000 R@0 TPUppPM"\5 S !0_ 0 pb\B  ? @}@@Q P QP  ' P PqPN `Yϊ0P @!p 0a"!o P `n q"P@T !DA `P\8p ? W L#`0r`Q#F`@0T00A 0\P  L$p  pG$p R? p G @*p||`hP Hx P P PЍ, *x***T ***U (***p@-@P@`@  |(P  p@茻px***H-XM pP`X@P` @/XЍO-\M`"p&P@ m!Q@P*  X嚂H$% 84 \ЍO{& P' `D : @`@D - ~@K LhDP/  T `X H P4& ?eH+.h\Ѝ|*4TS) i!0H-@l P:\0P fD D1S00 0*x**D'0H- Q$P@  `  @HP TLP @ 8 P 0qZ*W`h/<*O-M@\PUFP PJUM PV7P V.gP ԩP8 Lpq|Q ` x{ ` n{Z pWQ  pW{W ׸ M{ 80H  \ ?p  `h / C΄L0P_?q`0P Pߍ*c**H-P|@paV Q PR P  `@*< 0 0!R  R//*O-M`PL:@Pp PE!% !3S 9 # "5 ! oQ,P( `40,(Q  R  tP 0 `pP Q D |  0pЍx*^F**** @-` 0!% L#R 9.$P% "  / #"o  x*^FO-8PUp$尐q灰p> XxAa pWQ\ 5_P5_pPQ8PHhp@`WX H-`0S&''4' 0 B A@o <H-`0S''''   B o H-`0S(L(0(h(00 B1 B H-`0S((()00 B1 B O-M$uW Őlp|hh79oNQ`vSvq$p p|0Wp!@4OW:0p P[N` A0VU P 0f PX@``PU0@B D  E`T.Q  `R   N` PP `FV0D R| !  P !! B!Y @2/P 2/ ! !2/ BY2/! |Y 0@0ЍG- MPpR `xF@P< VF@, P `Py  ձp[ (`<ND 8 0`` $(`0~ x l ` T `P `Y< , ᘱp6 ᒱp3 ~Xp( 0( pW *⨠=W  0 ~P t0 r*PP 8 w ݍ0 Ed@hyedAzd@'K-8MM8 ;PpP;`p @0 P?pW `2! 8ЍۍO-MMP`pl@PJ   P)  P/㮎P rQp#0@p=Pzp Ƞk≟ {P `pWiW~f Upଝl~婰P `n  -K@`PTSJȰPNJ  !o eP?J040 #2=P6J<P2JY"N 0 @P!J̑P~  ᔰpL~P!0f @PPZ~` P V =TJ@ߍڍ   P ` P _0:N@^`{F~PgZ@`s[  +P \^/9p P X +T\jFF F@A-M@)`PpP  0Jp0P  R VЍ0 0a lp0cS@ @* c@P c @*x****O-MPpPlh@`T u^ 2|QTЀ  e^P @0$" 0  ?  0 РP C^ j A0 Z)*?`@ `(a @pTP` uvH1P  0XDP`@ 2V ^^@P 0 0R@P) o# 8@V p` ! `Q 0 R-JXP 03?R! 1 R z pP d嗡\P pPT0ppx******p*O-Mr`V1( !V   墾P 0O0PP !V; XЍ`Hp 0Z ppPx `pW 0@ P X `ZpX  0@  0P P  Pp W@*8x*=**[w DD*Qyp*O-LMp@Xp`P 70 Px ,pP p(PРP8`U (Z@p '0$ Z ! Q pU+* # @" p> p $` p @p Y$`Y 0 P`,  `YP {}P d P Y(p Y(p $ LЍ**p*0H-Q@!1 #R# @ @P @3@ @# # dP@L$@P 08$@P x*^F*\O-M(`,@P 0Y\V` 0pR\P @h`0P " Z KYP`pUЍA-M`p@w(,0'P\(P\pP 0Prp]0 Xpp!0,0?P(P 048<p@ЍF^^F :O-M@p 0P `R pX X X X X p@A@Ѝp@-P@`(( XU 0Xp0H- @0PP* S30 S * S0(( P,$0 U0O-\Mp`W0 W1 3P1A2P1A2P1A2P@P  0  @VYJ WW: S^p `y@PDp&Q:  PRPX( DD @,p,p(D@ `p0$D @48<< 0$`@(84 ,@  DP 0 r  x O@\Ѝ K;SSQ;D44 $80, ( ,DS;!SR00;S$PU:AU0 pv@@<`E4Pc' &(@,TpP` $@ H,$ P0H`LpP,$QW Q QPD@ p4a"0SQ@<8p<< ? or400P P@TpX  # " P{@D@X p8P8D@P :@[48ppWqD@@ PPPTP PTP` T PPUW D@Pp=T`V ! oPPp!ToP=P:D` A "0SqW*P ? q40 0P 00#`(0 D08 R7 B8 Q   D`PUYD`DH Hp'& ,(&'0@@z` O@`%GPp p0 8D D0  0_*^LBAWMBAWNBAWOBAWcB@-@,P ` TA,I,&8P0@> 0 */@-@,PTP )@& 0 0B0H-0@PP 8 R B8 Q    04PU8P0(( ,0 q 0kO-M,P/ `2p@0 QU    0"P  PPU@@4[Ѝ 0I+[CO-MpQOP 0Р ``@`Z`Q` @FT* `:[0 P@[Q?Q P'PEР `:[0 P[Q?Q P p`PpVQ 0  Ѝ 03 H-,P @NQ CP\ @`P'`&P @TQ$$ (0> 0? nCG-M,P+ `(pJ(W @P P # "  0EPP pG@ `WЍ$$ (0O 0Q XCK-0<S 0@ pTppp@W@`LQIWPQ@P @ pQp࠳^0  0f 'uH-M@\$P p` DD 0{$ 0`Ѝ**H-M@\$P p` DD 0\$ 0`8Ѝ**CH-P 7@rP YP@\PPQT`T@p  T 'P pW*s*\*@-,@P ,Q *H-M0P,^Ѝ Ѝ*0H-P@LpX Qdd Q 0 D`QaQ 0! 0**x*H-MP +P, R@!h `Q a AR *7.` @-H5T8P ,$B `d# %ac, %*XtP  @!. p   0[P" ZhPQ \cTA 5d#, %*ZX4B(P ᱩA @d AR *a#BP(:RQ% Q &`P /@ d#a#*(Xl`P <@ @Ѝ)**x*\***+*GiO-MP\` @(T P L H D @ < 8  k$tP<@8 kPlP tP( bPH.   p   0 pPЍpcPX( ;P( 0P$@P T0DP P p HLp$P8`< TP P0 S* 8PZ`p `J>\ p;P T mS (`,  p;P P`V:PVs  p;P pd P $$0U$ 0 SP |S$ 0  FPG ( ( k0 PZ 8 $ bpQ ( pj  0 R0Z 8 $ Ip8 p \P(0 T   0 pP&4 (~0'D'5b ZO-MP8PLHD@<`04u@@HD< faPLP bP iP cP)     d pp AP8P@`  P 0 P@ mp DP R<@@ߍG@ `04$ `HL0_P @HpLP4<@DP 0`,PP P @ X #$p pT( /P@dd#e0Gp2ڔAT1 $4P `y@PJfp&  n $fp n/_ Pt%`!t`4!l!Xn?!DP`VY ,i80(`?"R10`@@QP? p oo4'@8P-`V* Z V, Y 8$ m0 xmP!8P , !$  0 !( 4P , !$   pW75 ``$@F0*p, $ 0#p% 9p X H@ X ?40'E'zd@2C!Mb-K- @PPpW ` 0`W0 0 0KO-M`PHr@ pPpOPp AP4PP fP.pWppP"P`v P [P m P  0@pM vpI Y> @E$@@ 0@@a +  0@lP+  @nU   0R   0 @ upX DH4p@(@Ѝ 0',E' Q ? * G-`P@tq &fP p rP@@P  p  `P  U G+oP M`W $ en p VP$ Wn  p Z `P$ Hn p H$ 0'DE'    o Q/H-$ r0Q0#1"$#O-QM p`V pQ^@ ఠ?`p@>{6 W  pp?{7 Wp|@TpW&*P@LpW pW*`$c`?`@P ` \*$Vp$c PP?@PP@ ` V@:O-M0pWXP͠0@`pWT ?ps@TP5T P@0S6 @TP@&@TP@ @@TP@p@TPP1WP1U:@ℰp%7{p pp@0p0@S VS*BwmЍK-Mp($D` P f$P 0f!  ᎞ PiЍK-MP$Dd' 0`f !`   LP`ЍO-MpP`P l 7P /`  Q 03 @rpQ'"$  p R* $H@   )j@[ 0tP  ["  `0pp[0'1 #pP @ 0P Pv 0 0oX PnQ0%! 0  x%  0`@ `PO X`   P`@ X>P`X: @T  +  6P+  pT 0 PU P$ 0a$ P.  kP pP@@@T:`ЍQ $ 0 [(ꂷ = ` u y (Z}  M@-M@P 0 ( O Ѝ@Ѝ/G-MPpM`P1 @d`H <0@$LT8P,40$ ;4Ą(s)p 8ⷞp @  P&$tЀW|p _ @+epdp @ЍpWL Ѐ T   0h`pP 0P  0` Ppo 0D p   0ppp  0pcp P. V0:ꨄ嬔  0g k 9p pW' .p Ѐ  pzt P P $ R*0p{s od@d@    L 0    M0H-MP@ 0xk 0 Ѝ0HЍ/MH-M 0 0 ЍHЍ/O-M PP% @ UP!? "R R$ P PP 0 P `  0`P @  0P   0  0 @Pm P 1SS@[ prs,|` pPp| 0v pXP!D! R1S SS@H L0  0 `p* 0 P tP @ \ 03`A 0 @[P_`Ѝ"I[?P/@-M@BBQ L p 8$ pЍ@/d@u  K-@`P p ||P  LL< p<T $ Kr K'#@-@IP CP  =9QP(( ,   K- @PT0S `pPu 0S"%T  0XS pp `rP0S`%a"$& Jp Eq QF \ $$ 0H-@"ȠQPRPSQ@@0 T /$ T! /$  T! /O-M` @P T6 P؀p0 @T(e f P㐀p0PPpp0 0T :H`@D 04P@TЍ!'"` t ~  H-(4$$,0@ePO-$M@WPRP |P $Ѝ 0TP+ $tU` H0!p *Se 0 U0P`p/0h pUppp R0W0 Q pPp\ 0R`_  0Pp $oPT p 0` pPG pZ0  W 00#8 \    8yp| $$p`2r"3,H0` R HRP `T p`^pa P`pV:LP PXRQM 0.pF 0  0  0 0P  4$$  a $@ `  PARTEFI q Q ,   O-Mp@Q W PPB$P `  0PPPP < $ PЍ_[Fp@-M|` @PRh~2p 0r   lЍp.   0H-hRLR aR bR*#iR sR tR! P 1@PP@0: RP; ( Ep @$/@0(.  p@-MP@QL` ]PQ  Ѝp. 0H-P@Q 0,Q00.mA-M@`Pp+  P # 0RS sS bS SS pW bS S BS R \1PJ $$2!PЍ.O-M` oR r 0(Q0Qy @pPr Pn =Pi P P^P[ (QQW R 0#"N R " 0#D$p@0 PT + p8$ m0o0 pNdP- 0P   0P!@ @  9/$ p'   T 9/$  p 40 ` -@PUpЍ@ r Q0Pzp( A-`p@^PP  7/$|p  7/$ qp 4 P H- sR iR aR Y pA-M@ P $T`p 0Fb  0P,(p 0`2b XP 0`ЍW 0DJ`Q=O-M@P p儠刀P`vcP `V    PP Ѝ.!H-0p0P@` 0`VO-M pP `^dd@   PP P@TЍ` O- M`Q 04@pP <2 ЍfP P0S* "$0D  T0#+ 3/P#   jp $ 0 T0 У0  0 Wp (  (2H-`PP .@P 4pIP  @(.Rp@-M`lP  @\p8 0P  Ѝp` ՠp@-MPP0($,4$$$(,0@` 0弌P ` "r "#| P80hP\(Ѝp@=@嗌@Ѝp0'\E'2b GO-DM@P8`kdq弁< fP lP2 r6 /PO`` bP L P=  P( , 0\@#Z #  SPp0S P .t *PZ #@ DDЍ.bY'm0'hxE' 8$ O-$M [ L p P@`Z` [ $ЍH` ` Q pHp  p "0# H  @ '0%  PPQ$ QU <2Q 4"!U(1$P@Q QT H 0@ pTX@ $(`a`P_ TXpHPLP $ .' P 0@0R 00 P ``  $@00$ @T@` P`{(@P%P$   Z@p@Hp 0 Lp p0`P00P`P T00Q  O H0}aP/@-@$P $@!O-,MX TP\0R, `Pp;_ @P  02_TPTP  0@(_ ` p 0@_V 0  0 $X(F P=@T9(P5$P (PR`pG  0 GW0 `P p  VV VX,ЍR^V0 000PyO-MS9Jp@-l@]l`d \0dPP L  0O<`<@PPEu"v'Tp{"O-,M`P(Ls(@ pP p&ePp AP fP sPP (@P` AP   x,Ѝ  0$ @p   `P$Rr@s` p 㰠P1!Q P!@<10  X!HRR&t 8 H0X p(`p P@‰XR R R Q R  (  00 p| px $@\C_ 0 pl@ b4 ^+E'0'*KX8`d1O-M` 0P 8QQ  %Ѝ(庨 Z @ 0S 0 0S000S@ R@P< 0뺨$$ 0p [Z  P0#S:@ @p01 B<0 3/p (8 H0 (唠$D[  倀PTPpW:WEV\*@-@RR R R @ R R@@@Vp@-0@P R CP礮(08p` pSp#S:``` @ pp pppa  0 p\*K-M0"@PpP P`P <ЍKtp lh$R 0 "0# "    Q   o/o"R P 0 ЍP U0cp  Q P  0P  0p Q 0pp!)  0p+P# p]U   0 0 p6p @F8, =E'0'MQ ? * dM-M`@Q V$ĀP ꬀P {ؠ `  [P p T 0 D ,  Ѝ[F_z^C1O-M`P!p? V V2k쀟䐟 BЀА Bn@0$$  V p H  L 0$@p L 08   Ѝ[F_1A-8M P@8`\xpp4 Tp $p @P4 0d8Ѝ8E'0' lV(O-LMP`D@<840(,@s8@,0@ bP p qP   0Zp$ (P8<PP 8< 0S0S @p"`!p PT PLЍ,00@ D04,p p8Pp @@D,`UP pF $1&P $$ 0ppX P pP pWth Y " # # T 0 0 FX 0 0  0@!$ + !(PP$Tp  rNpv $ PnY0'E'(cO-TM(P`HLusH@ 8sP  0{pGp qP*dP$HL  0P P|@p0 Tp D$$0WP` P   D 0!PH L0 E 4 8 P   6PTЍ$ (  P#  ` ` $,0    QP D,!0!P    %`㓒!@Y<*`@D  %P @0 S  R`0@0<倐Y:D 0@R^ [P80^W,00S࠳t`S ` ``S4`` ``V PQ;800 80D tP0  `@ppY  0  T0 0 `P  4$$  _T  d \6h W4@ Q  0@ V0  `R\; # $@0 `@P p (P  r4 (  R$ Pp0$0'E'l("eDJ6O-$Mq@`P   aP bP iPTN   TG 6TA  >p;p NP7 lP1U0P[P  0S0S `p"`!p P 0T \P  0  ^s$Ѝp{"F'0'O-eMMpXp`@ 6a@ Q$  4pFp uPBP5 P允4P P  0S@T `0"p!0 P@T P `Pb `VD  '``eߍۍF& 2 &.C P xPpdf @  0`pP @P` XX X `pP @P` XX X Q   ~`@P`XX  @@i`@P`qXX gX  %E 0d 0}VP Q0 $4`##t  p,$4##,`@P`XX X @8$ m0Tqo# }PU>X o`p@|$,4; TR 0̌rP@@ @$/ 0@S<L@ 6,1   P0.ЍA& "ЍAPPtq0d W| ЍA P8$ m0 P, 0 Ѝ: b 8e"fp` 0!XJ;,& H-M0P@4ppb #  Z p8 0P  Ѝ` ՠG-HM P@8`V8  |Pp4 <TP p lR& T pT  pT d8 P \PP 80<6papHЍ(p{"0'dLF' 7PG- Mq@`P  aP bP iPT   T {T  p ЍlPp PP  0S0S `p"`!p P0T 8P 0 p{"lF'0'O-LM4嶀ᴐ `Pp8 0sP㰔00<0岄(PDP,`E`F <@ P P  Z48 Op+lP`p<@P P p W48 NpJ`FG `(`H0Ip4 4800KP`,`$P `VLЍG-8MP' PP# (L 00 `@Q0  pp<, P!0 QQ1"2(p40,( 0pc2P  0p P`8Ѝt@p` SP p W1 00(pbRp`P0 "O-lMP$ 嘐p,P0  @ $ `@ @`` A @ @ :/p WlЍH-0p0P@` 0 ` VA-t A `pP@ `Pp @PP@TR 0 AA-MPP !4p `p @ p1 P0 W2:pW@ 0p)04 $ 8, 0p?  ` P 0 P` @4g 0wЍq!~!h!N!4!A-8M P@8`Tp4 p T pT lP` 0{P P 8 0 8Ѝ!F'0' @-@R_ *@-@RR 8(*O-AMfvP@ oPpgPct`P $$rt@ZPy P7 p @@P-0h0SPa 0 <P PX ePp@pPPa <P/  %P' !P! !P !۰P !հP !4ϰP  !lɰP !XðP !DὰP  , ᵰP r ᮰P   ᦰP s ៰P WpP CP @@T Wp @PP` tP d  P wP #80[ P P rڼP  s^P P $PW @P X  P{P "`0& Py "@ 0 ۰Pl  0ᯰPe  x0ᨰP^  `0ᡰPW @$ m0P ( ⷰPH PC $ H@ T: P4 @ xԡ`P@ pWP9 pᶾ4 PP#  fP& PތXU nAߍOlᚾ\ @`咾 @`厾 8Xῌ` g}AߍX HH H04h h0 ` `0bY!.0'F'!#!!b {""1!I | #"#%"""""'"2"="J"Y"b"m"z""""" "& 'O-AMp` \L iPp FP P$$(,0{NPP`@pP  AߍOo  P  @ O(P PB P $$0P:   P   ᚬP, s/ ᔬP& 吾P叾U , 0I!  $$ ኁ$P $uP @oPV 8 0( $D`SPt | P |P8 | P |$P$ OP  IP @ CP , | ӭP | $ P , P !R$@ IP$D0 )I!  0$   P$8 4@!1#I!  $  P$ 0O< 0$ , ,0(  08  P0 ( ,( `4 \ 8D @PH0T L`~X \z$$0`H! Y $$ ὀ$PR,<`(4`8 \Z$4#S#H! : $$ ᜀ$P3pXpAߍ|%| t30,bY&#.0'F'*#M@#!l#""#""#" #{"(1!I #'$& '" "2"="J"Y"b"m"z""""| $EFI PART$$|$`$G$5$$#K#@F'O-$MMP @tyP Y R`#LP QQ| 0o   _P H H< ` PpgWN H$0P @o { `+P#  #  `  0 e_P T GP v` PpgWN #LH$1{P`  0 :_P  G d p ZV   Ya#z$Ѝۍ@@ G**` 66666766A-RMx`00P00 0D(0 00 00@00H40,0$000 00@0LPTpp<0!1X\h0\0d@8``l` \0XN@N 3Rߍi@i*777p@-M `@PM )  Gp < ᧀp Ѝp 'iP767B7O-M@`pnp PLP pF FD=P Pu, 5PP lP,P e%P ^ P PhQ @ Nppb P ohZ 0 S 10G pp P P P![ $ Q 1  [gU  ,0(S 1 G0P Y  4Q 1  Y lnHQ 40L S 1FPZ @ hP qM1P l 4P 0 S 1F@ `p@ `p p R 2/p 8 Xp Ѝ|p`` LDd <\ ' M ?o7]777Z7y7`7667K-P! P P pкP `@ P PᙸὺK-M@ PḨP ` D`p p >PPUЍ L  8 Gp !0 `7iH-M PЍ@-M@p (  QЍH-@PP pPL?L` ` FD8LH-@PP pP *` ED"LnLkL?`H-M, P \LЍK-8M, PۧPA $P      GP `ƷV q 0p@0 *P PP @᧷D8Ѝ 0I77H8Y2!K8i0H-Mx@8P PePl P gEH Sp Ѝ0 0V$K87E8U8iw8@-,@,@@8*F'@*LA-(MMA^@pK #p P(Ѝۍ @7`CP PPG@P$P @CP 0P;G@Pi888@-M\ @ P P p8Ѝ 0㫩 @w:@Y2!i@@-M\ @P P p8Ѝ 0㊩J@w:E@Y2!iN@p@-M@`P æP uPaP P9P p P Ѝp88 80Y8( ^@w:Y@Y2!?@h@?@-@8>P , ׿@ 06??w:?[!0H-M @Pp  \P H ᶿ@Ѝ0@0 , 0 o7w:?[!7y7p@-M@P *`AV*ѹP P 0*p l `PPpJЍp4( ;i$<@@@H-MP `|ppᑹP @ p|pxZQQPPp`W p`W xi Z?i?P?O-4MR @T @`P0Ttp lM|pa` `0`Vv <oᠲ@ PpW`VdQ pWQ   @ 0"0 PP1/PQ 1/P z8P |p p `0  ! P6W30`Vpo@崀PP00PP@ @ U0 P`t0+uY PP@ɏPP @`d@`$*hN*ɚ;6eʚ;>4L'4"Gp@-M`P@P  p k\&1<0H-Pl@ᨽt@P qPJP *0$$ $0㘧EM ?w:?[!0H-M @PNp `P H0H@Ѝ08, $ 0n??w:?[!y7p@- M@\P `3P P 0p l ``P`pp нI` Ѝp( >i<@@p@-(M@ PsP- VPp# $ p0   `q0 ``Q$` P P` ᚽ@RPD(Ѝp 0f9w:?Y2!0=0H-M @2P P p qڸ !0p@0 pЍ0 0Cæ9w:?Y2!i0H-MX PP  @p((gH@Ѝ09Z?p@-M`PP @ Yp ?1<////00 /L'00 /L'00 /$L'00 /,L'0 0/4L'0H-@|=7PP HP00D PaD"P# *@P%D?Q:G ADPP*@0>>K-MPP  `@m5pL5`尀W00 P   |pW 1/pmPP`  0PPP PPXrL p Ѝ0 0i㙣F 0=w:?#?ui E?H- m;0H- M P@D, p Ѝ0& i<H-M,   PЍ i$<H- L4P >=*G.0>*>L>!` \*U>_>j>>>L'@>C)= j<67A<a<H- MP@`P \ p NNNN }$@ DPE Ѝ0=vi 0H-MP P @Pnph A  Ѝ0P"448@P,0PPPЍ0?>>` \>0H-M P@A8 pAooЍ0ip@-M@OPJP EP|@P lll P0 ``AD `X p Ѝp$ 2DkC'E***7ivCH-M@PZ wP lyP XPXp `n{ @P Q aЍZC8!!CK-M@P P>Pp p`(LA 뜂  tp8 PV P @ sp <'4Q ) P? ` 0SR+ R+ PA pZ @TJ xP QRR T@ Pp6P22! m7P# p PP`! RQz + {`V UP:˵ЍhxPDTT 8i(CA!^ 1E0n"8!` CCDCV}Ci.?C;ECC676@-mP$@$@ D*T& 0H@0'SE@-M@L @PHH0 Ѝ 0D;DDY2!*H-(MP`P& @ϴP  p(;@ p@P\ 㳛P D(ЍD Z8_  [ D*8i(CDDD6H-@ᕴP `@p˻PύP @PXp,   0u *D;DD!0H-M@P 0P Ep@-M@~VP @ᎻPျOP d`@ 7PLPϴu, Ѝp 062D**e;DE!p@-M@J"P @ZPLP \`@ PDPᛴu$ ?ЍpkC**eA-@P @p*PP @Pp `l,, ,02՝ a'E*t ;D$E!H-`P ?@Ppy 0p A @H-M`P P p@  0P hP  0p @AI?F? ЍH- P Q   Q 1/pK-M`(P ( pv9@Pp:?"Q P ?Ѝ TP?"ìP , 0 gp A> O-MQU$& Q P Q @PtH Z@PHp{>Tp@W Wf Wh W >@ЍW WP SĄP@Q  /NP@@(@ B>0($0  ,pRP `P$@( [ dP (QM VK( ( 0R`P$QD _>@@``P`>Qp0 :R Rw a`Bv`VW B CRp0A`Bv`V7 B0 Br` VwSS0pSor0PxP:i">@ @ `V   Q Q@P:>@" ̲TW T4=@ 0PP3Q0 !P-P* P(  R$ *% `P@! CRp `PVP@P``٬P p@ /7$PP QᾸ`xV  0@p PP @P `ᡸ@[T  dPU @D8 0@l( f!͑"E@Eh@EA-@T `Pp9P:^=_P  0p AJ= O-$Mp@<P @UK H`pP#  0@`4/P( P+P <MP < pH`V 0{  PPUZ Z <Y< P }<<$Ѝp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V p@Q P 0P -P :P :P `V<<Ѝ @(@Q 彰QQ 崰Q R-0877777 )ޟ\ᎪP P0 0  0p 4 D< *Ep@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`pᛮP p`$@ $1H-`P@pᆮP pP @B,10H-@PP  R$ Q  0H/00Q /  Q /K-p@P`P QpU ̪P `PUP QpjA-p@(`#P P@ @p NP41A-MpP,`P T @$ $0(0 0Pp,@Ѝ<1O- M0Y$ P 8fP J 4Q44 Q Q((8YP Ѝ`P$P Q(`O- M@40PP)U' `@plK0X* @  04/PCPYU@A  :@ 40 BpB!0 X!*U @Ap  ` 06/P@TD0X*PU D400 ЍK-R @P`V`V {p6//y P@T p@-@`PP έꊭP V  WP PT   l:P pG-FM@៮PᛮU`P` VU:@&ȵPŵ R  pF`9 pp P3ppPƘ 3@ @p(娴Fߍ EE!FJiVFFF0H-D@D4@4,P,0H*M'*XA*BG-NMMP@Fp`)u(q9 [V pp/ ) +4 `P*(k) 0pTJ 1JO 0pIJ0P,0Q,* 1U(() *0jNߍۍ*KiKfF 073)'FH- 1pIiF0H-hP@P p T p @jT@ kp@@0M'*O-Mp@(Q0 0X t xQxAoᡢ@X8 `xPW (P2Z    # V.*   W B V&*@ 0 HW@0@@`X `\ @p PFP@8P$@Ѝ'F'FFp@-P@QU 0PxQ  000  @UP ` XUQ p@,U `PUp''aEFA- M `Pp@w8W W# `@`Up@JV:U` \8  R@⿧P P`  28P ЍH-p@Pp `P  v Hjn6:7H-M pP`@"8 @ЍO-MMMPc Pp` `K{bp] @F8 61`,\qXpYE @5P9 P5 pp 1 $ jp !@ !P 0 o" 000 3 ;HP 3P t3 ``冲Y,cMߍۍ<0$ ">Gi*'GGG676H-M`@Bp pP7  pp M1t Jjp A7@+P H7@1P 7/PtЍ4 iGGX\"H- RHT*WGA-Q P`p@ 5P PP`V@- M  @p l  P T q4bn7 Ѝ XpG9iGGG@- M  @kp&  ᲔP   40P p ҒP T q8*67 Ѝ  yGpG9iG67G0H-D@D4@4,P,0H*N'*0M*M@-M@ p  QR 0R@ ЍGG 0#r&'GH-`@P6$P ` p/PLU, RpG':iG@-M\@ yP L  pЍ0 0N8H0K}LY2!iL@-MP @P  1pЍ( 0Mϔm~!0K3LY2! | ?P XPT :Q00@\p@P`0  `XP0 @P TP 0 @DP AAq X \!PdH qH5ݍ(( CHLL'!Li8 KLL@-0M| 0@ p RP L! p0Ѝ(m$$  ^1HiIHLLLp@-t@tlP!P@PHPH@`@#p@' *lN'@N'0*TT8*PY@*TYG-BMPP(4` pp `  t8484`!4 p !R*cW%  zp P P  gp P l\P X  T)p |p Q$P I >p QzP s`8u4r 'pP * pZ \PQ pVOHS!PPPP pm `V !RAqpP!0   :R P =Ppta@T ,EqSo@DP0 $8P p$ $ p @ P\P  Q  Q BߍXkx8i(i&Mi-M*7M@MJM]MUMlMcMi8sM'L{MQiMMy ii`6MMML/ 0#'M0H-M P@3$ ZpЍ0iIH0H-8M@ P 3$ Bp8Ѝ0i8 KO-UMMd8 @2p*   " ep$P QPJ+dPJnP PiP +dPZ d  PpC3|  nappڴ(Y:@ p!0(  P +PP@pG`'W[ :j*PzZ  `( (Y:!0(!    004g2P8 P@T: 0% PPO 4^ |f @DpP `dPN  PEp U ADQ) Pxp4 `@``v\T DP 0  @T >xk4euP )P  0@@TPUUP  @0P@TP>GP zQ P=@QGbdededededededededededededededeee$e,e4eaLrth\ P D8, P  K[ c,I'Y.0<Q  20fp3HVZa 0 ` P/) h6 0 ` P /S) 6@-M< @ފP  LЍ 0K0KKY2!@-M< @NJP  5Ѝ 0؍AM0KKY2!0H- M@ Pp t ᩊP  qD Ѝ04c 0㭍iK0KKY2!KKO-dM`pʼکnpʬԩpaP p P < ?py <Q |忩TxaPh"hh  cX@` 0 P PV( 0ppM H40,( (@ 0 $Ps _<@. 'W vVO-,MMPkp 0㨀 P`pOHT2 p$(PhhbhRhr Q Q X@T f P:T 0D! XP0(P$P !XԹԓP !ȹPqPF HAH`'X P: X, @X``hPⰹ @@婹 @@墹P0, 0  @ 0WP ,P ,  P, ႹtL,Ѝۍd dX8,ЍۍOt%WS|*8!^ 8W\` MWZb [WmWWVWa 0H-Q  Q @P"P Q  0P*p@-@P6 nQoQ  P# P ,R RP @P,PP ``,PP(ߞ,@pP*V}Y0H-P@0H-BM @  P0 "x(t0UpX  0' @ , |@JK׶t[[O-Mp`tP#8188A88    IiP jP oP rP6eP gP  0P p`FQ(` ,`pЍ0'.[.Y[H-H l'%\0H-@PDP /P0$᫄0H规0H!_\x\J\0H-P@0H-M @ P0 ' 02Up #P P  L L),s#إ (  0U*!^-^\^r^O-Mp,P( 尰尀`@ ᎱoP 0GP ;pDEQ A O#.0'!.\[H- Zӵ'%\0H-@PP /P0$0H0H舝_\x\J\0H-P@d0H-M PAN0 & 0Tp "P P  H H㒵("A A>2!^-^\^r^O-Mp,P( 尰尀`@ oP 0P pDEQ A O.0'!.^[H- ķ='%\0H-@PP /P0$|0Hx0H_\x\J\H-0H-M@AP" 04 0 Tp L aO-M,(帠帰`@pP ᆰoP 0?P 3phDQ @ A +ЍO Դ!.p`[0'H- 03ƴ'a0H-@PP /P0$0H0H{_\x\J\0H-P@WA-M@ PA> )$0Spt 0@ D `L,<\PPnszc{c[O-MPp @0a!bx LPg@Q!<pppppȣpppt9P GP8||||MP' UPw| ||| 0cPc W||RO ppPQD0Z  S S  Z`PY[` kSp' [<pY@tZ (Z PPᒛi$||Ѝ  ic.a[0'( H-u  㙳'c0H-MP @፛ RQ pЍ0  0d@-@}P@[w@-@&P@ @-M @bQ QpЍ /d0H-@P1P /P0$ᘁ0H蔁0H_\x\J\0H-P@0G-JMM 4P@00 0 0HRpa4@Pph KPVP S QP0 P Y0 0Qp 2@E P!ʎh8P 0<p 00 ; p0P h40<0 Դh@D L0\`dpl`pPt@TX P$@`p Q辴Jލڍ0 0㹲*fhhh[p@-@ RP PP p@輔(P``p㖲X*YO- Mp`H@0H J뀶嘆否 @P@A@7P<t0̫ܫ$H\l|ȬX\h̯2P/ 3P6PI$D]@ IT( RG a58 yltp l,gP+4P a@]Y 0"P P    @B P  P  @           y"  q $ g     p] $ LS <  (I 8  ? @  5 , +0| @rd$ tW, wK xB0P }pGQQ0`+%4R 7 ЍT$-hP'gP'.P'Hd****R!gggggh h[0'H-h0H-M@ PῘQPЍ0  01h@-MH@ <0 @  00@@*㣰lii'i#j@ji0H-@PvP /P0$~0H~0HS_\x\J\H- RRQjA-M`PPJN OpPJ@@ RR0 O NP 0pЍzQjp@-M`P@ oNQ 0㐰ЍpO- Mp@PFp8 p0`pF<8$ $  04O79 2/< &   4@K<0 p P 1Q 2/R 444H Ѝ @*Dnj~jH-BMjo^# 0142/10 >p0p @0 0 P m ,,宱H<Ͽ BߍjA-MP@` p$ XPh 2/R1QP5_U @4O@ 0 xЍ*jj(0P0/O-Mp CjP `@ p{P`DH @0@3/p@P;p@"WP ` p@y)0 @ 3/ qZ㋐r P P YR*$$0b<ЍjjO-M@[ 9@ P p:c,Po pP0`P  d,@8  00P h0 < /}$Bt`p PT P p  P 0  p8 3@ P @!0x z D  0zp PQ 1 UP ,P Q @|P+Tt Pyqp` hD U 000  Pߍ0*k***jO-M-M`p(PBT 0 ؚ݊@C 00000   ᯩg@Ql$< DTlp  0MPy A@@ P , P Mph  @ I 0SPb@ ] @ ; 0SPZ@ SI P  p GQ$A+@  4Mp, 0(<S00 p@ Ppp 0ЍЍ)` dXL 4 H .0'tl.lllmBnUmm?4k[llH-. ٯR'6n0H-8MMA.NP$ 0 (08Lp. @' P@. + (()P  ((x0,NP ` ,(L00@ 8Ѝۍ0, Jlllm m9m)mGml0H-P@0H--MX 0@FP     Ѝmm0H-MP @Δ RQ pЍ0  0d@-@ᾆP@[w@-@gP@ @-M @ᣔQ QpЍ /d0H-@PrP /P0$z0Hz0HO_\x\J\O-LMP8 @H 0N  @C E$S4<CE(S8HD9ⲟ9揄, !2/!A4q"X3\cs2/3?6o7"X3\cs ??j  p  p , p $ 0p }( X1X\ 13?1 Br4 01Ѐ  ŕ$5(u,e<Ͽ3?76o ń$5(u,eU@ 8p N< Hp GD`H%L5Pu2/3?7H%L5PuT0TX0X\0\LЍ0H-@P, '!"!0A-P   P<Ͽ2/3?> $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 !""D`6oD`#@`6o@`#H`6oH`L`L2/3?6oLX8<\L01`\XM`Mpp` }}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p %D!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,K0ЍTU  +0 BR!q p/G-MM`RQ:@ + T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_} ЍۍLABLK-M,(pQ@Ppp  ȑPb` Vl# 5_ P N 0AQ p ЍDLABL Q 0P #:r/ Q 0P #:r/O-MMؿp[/@xsrP PP PPpGPPlllo ,8 Q`40,( B@4Q P<<<P\<<<<<<<<D< <<<<<<<<<<t(<<<08d< <@Pc P @لP+ 2 10  0#DlO 8P `D` 10   0 <-@Q  $$/0BPP 6 v 10   0 80  *0l4 TL 80   0 c00  0 @jP eP q#[ @Q ᒂP T 10   0  10   0 0>@=@ Ἇ@ P@x  0^ 0 < 00  0J O 80  ,0<`@  10   0*K@@:PX/PSPf PJ<Py/10 1@@(.  T 6C, sP' Pe !  !  0 T X L  C( F`  Ap8 @x P P D %#pP[otQxB AG@P T@P UHH,H<T @   x00[?bFp+X z_[p& P\P T+| KP pp W,Ep`T {@ pt -2z Pz? eJ p$ zFpTpxPt @#@z *P;xPJzpFpm*l j ?3P@@[ot   zp PFpTf) ?|)@Pt@x$ P )P*   0Y$p64P$pBDI8Y$ R!Q ʨP~`, zPp}yP+pP*+pR j  P" P$i 1!#$p $@p .Z0$Pl, Dp$ D[LP ᐖPt pDH `q!'P  0P-$@V U   DD`Vp V :po+ QʌPtfP  RL+WtP  Q(*NtfP9PP[oQ,P VP &0/tQ 0Q 3,80(  @w W Dy DP BP @p1 㰥*5p4p*9p]pvE%0BdIzDCCCD%0 Tp txB@ [?DpP傥,%B d0!@{ȀB_<`- p- $PZ P P)  p! P< pP p0B/pPPI@4B/Xx. s4rw*v*P'*=w*w@d  #PT*[`Y p, K8 PrG @  Pm  Ph [`Fy pPV聟ܱPp [oPBt ?R   Jpd4"4** $"0QSQ% @PP*x   R' [w** P  0QQ[oXQ <$!@1H!0[ow[oPu  0 *pR''p*< **5p*.*}q*q'Sys*oqYq**[: Cx"\! qBq*q*R'*BywR'****f"*^v*pQ'**0'rr*y*nffsOrrnrrrfrTrswsss=ttttti!*tt Wss\sr>r+rqA-P@ T0⟦x⛦ht @0pXX`P`P ᆦpPW*')z]zzznO-$Mp9``  rq P@p0S$ P| PaSKC P0PkC P0PP PBS GSPbS gS x0(P` \  ` b R40rbpSjQ72VPZƟQVQ"P) ()% @P W P%  p@qH0L S P  p`0q$Ѝ\ 0@ 0<p@0p`0  0cyyy*yyO-M-]MMԠԠ1B P@ P< TU rA`@0: P`P P`:pC 0p: P P`.p BB0 D: pp# Wp"  0kP @ &P  +P Px0 <0o (5,%(,D D R$, 㯤$ P @P 㤤 P @Z B0 4 ᓤ P @4A 判 P @4D Q|X P @0 Q*q, P @0Ql(f P @04 Q@[ P ,`@TD ! / P*0\PB\C0\@PXPzU XQ*`XN;͆PP$0 4@BN_ȟpbnRHpLP@0pS0P^T0QTR@P`@80pS0 P` D1P9 `4  (08Pp8 h pφW @ T 威 dQЀY48R T?QYQQP0Xd@Q4!U:8 ៣P `4@8T<4 p01:3U?F;)\5<0@@D00@x@|pQ$P0LEPEXt 0\)$x !婡 H@Q1tpB?p  0A0E HP?  !p@!G0Ep/(50$u 噚z"@0S @!1R\(Pu DP x@8P@U 8<pPo!xpT@8P 2!0 0aq# 0Q0#Q0Sr8< #pPo 0; ? A@pQ`1S P PPP*!1 PP! !Q :A Pܑ` 0A.pN$!p!P 1!a1Q``@ 0`<Y0 P?QYQ?@0AQ0`@0p0S Fp0B0a1QpP!a!! 0`PpWp#Xp1G 0 !0B@1 Dᡞ@/X0^ 0a@/.!PV`0PT3_>QQ10Q0U@A!`? d p 00a@ V㸀!` 1ؑT/ a!R, ********Q'**R'R'z*z**{ؑa Q ֡@Pp$ x帀@8d<`P0  GH ˌ0FP8p`Vß@p T%_`?.P>$U1!!0U08!L 0 0R,p0| p 4 r? 0:  _Бp 4y ?@ so H44p0o0 /LP0@%X\V Qph? ~  P\% R\%R`d~ -{Y{{{{*UUUU3333**| ~0: P`P P`p@J P  0P P`p e PDPl`F r0QTP R&0 댏`H pJPE@T`VA P !1L%H a+0`'0|~Tq|>@ T딇Q JL+0 P L  7+0j@PV.P f@ PJ  BP%x2P , 0A'"\u W A0 0d/ 0`p130 P/0QpSp0Y_ ,Pz/p=#QPP\  P0R0CP0R1,@,@Tl @`XA}p@8<$Ϡᔆ P0QP\PZ! @Va dJ\j |*4 `@, Z !/@ ZJjM2 Pf pz3 E h [$Q`0pP tx R !x * PJ,@P LTX\`/$%R0Q@h$l` R/dP1T P  Pk P P P` <$P plQ>d4-QTT! !-QPeXPeV d! ! !B@p!!G 5$N n8P Z:L^  0R NN^Q n4 (n|~4 d0P.4-0P  UZ 4P   0x 0S0# !T P`\uWl`*^F|)}**P\X @Tq/7"\5 S A0 dp0 g`6P0   pW0QSQ aP\PK`x 82PC@ 0p@ A尜DL`lP`PD !LlZ?#\Q @0`d0 80 0h93H  XaAQ 0SApTP尫Aa[ *d唫AP@ aPT@TK.-DT@@Cc}oa<{T[?&#\uW Pp 0pd ? p``2w0 P`S0Q !`0;@P`*PaP ,  PPi @`,V:T ڛ PQ   R P _E EP: _I` :*~_A E9N90 l dR 07E\@!U04@0vPLj @D5Lp0? dL'ht@9@`AL9_q10q/l0q|E0q p`GE04 0 , ( `U!p`43@P@$ d0@ŒDuL c`p4d 0STQ1{SpqP4 <  0`p 06S`V`pp hP@a  $9U 80- AF0q Q0 ,Pp@X  ` @ PTP` X  2/X 4  ~0 XPq#P|QXp  |`@ UOFK\\%R/0 QO?d`\TXP 9t0}(qPLo @DeL / 8-8 dLA!QAqݯ4 0 , ( 0 1 qa  t 00CAq @DUL / !c8p 7 @l أd0 c4 0SSQ <O  0aȁCAspP@P PP40Q ?. ?{0p4 嬂@A*P`V.VDV<P PP\(` PJ ! ?f 0AP 4 0AdpHd4 L g6P pWSQz0PP 4 0Tq4 daD74z7(KЍn ҙ0,&ԗ%җ(З ˗*ȗQ''ŗ×*㻗㹗㷗㵗㳗㱗㯗㭗㫗㩗 㧗******Q'*T** ****** **A!` {} R'T'*8 }}~p@-M@P`P   ^tPt!"$! PЍp, 0R$W*****]~M-MMԠԠ@`PSTQ LpW@@! 04#'p( Pr P;Tc P*06 q`V 7Q  QWI@_l\ F0KMq5*0hK*$***** *oH-M@`P P !p_'"$" zP zT 0Ṙ"㾖(( !Ѝ*****7~`0S     0/PP B1 B/0 //'}p@-`t[@P\{TPC/EBp*Q'O-ME0d` p f7P `VSQgP 9倵 QMQN QG DT% 0P S` `` o b9B RUrQUQR    `@1 .Ha@aV&`aV Q凘d\8 _Y0<LH*P Ѝ S`R      0XH!0H 0`C`$P!0lp.0Hp`@(0@#0P@  ?  0 PLdp g?9 pWSQ QTT! B! QPuXPuW&d  R  b9 Q?S먠   0 H? ᄡ !?A0 P9 4{@8r0 H  8 A ? $ $8A4  4 `8P `?@>p T`@`A~0o B0"  l `8 P`P  8`d@ p d7` `T0QS_***U '}*Q'}VO- M\T`0dP p e7@ PUSQDP sP Q )P Ao" 0R\ 0C 0!.0P 0dP p e7@ PUSQ@0$Q $A,X: 0mP @ث 0`?ᐛ#"2++\%R !`0Ϡ|' r! xH0 dp`@P 0d `T036QPVS `g0f WQ0S NAU/F+\Q%x 0pSQE `z(1!2/pG w( X q13?A qX0/x 0 @pTQ% @p`p h!p`Z`p@[!p@W   l,8@P0 0 ЍO;Ó ***U ** ~T *p@-t`P@P n@P 0PppQ'*G- MPpR `@P< @, y[P `Py  ;3p[ (`<ND 8 0`` $(t`0V ,\x ^\l Z\` V\T R\`P "l`Y< , 2p6 2p3 +2p( 0( pW *⨠5W  0 bP z0 r*PP q 1 ݍ0 7d@hyedAzd@'K-8MM8 ;PpPY`p @0 P?p&1W `2! 8Ѝۍ0H-@PP /P0$a0Ha0H|z_\x\J\O-M(`,@P 0V` 0pP @h`0P " Z P`pUЍA-M`p@y(,0'P\(P\pP 0Prp]0 Xpp!0,0?P(P 048<p@ЍF^^F :O-M@p 0P `R p     p@A@Ѝp@-P@`(( XU 0Xp0H- @0PP* S30 S * S0(( P,$0 U0O-MMP, ,j,@q $ TYPeP=f@QU`- 0 0 . 0 0 0 / .  +0rRP1D @ R- 0 - 0 0 \/ 0 0 0 0 l/ ,/  yl)Qp R  R ZP] bP+0\>SPT VP 0Np0sPU vPdPP 09<< 00(c 0& 0i e p]hX$T,0p@F D 1&88p 6p.(`Eq&P#fX f ,pP T pW /p"'D P& ;;fPJ~0p @ &t0p8 Pe .p_ P P,@ u 0P@@th l @D 0@P@tP(P @D.P*  0Xz*$倄PzPh Q,R /\@`PV{VeP64} # vp, {R  h0`P!a@LPPL RFFVB( .pL| wzHP0 P`UlkMȰ  P{PrJ pP P I @YTbfA0   / .z Z .㸏4poP< @ b%dP  0p嗑V W  -`V_pq.8aT?  ppL(!PpP (P @D V$ P ZP  0| 04*̂.0*sH*qD*x8V'w@* (*w,*f"^v<*p0V'8*4V'0'P*y*!~rrrrrTrswssss\sr>r+rO-Mb`` \ @P@Q 0SU0aQ JQ 0KQ 0MQ SQ jQ 0kQ 0mQ sQ0pBQ GQ 0bQ gQ0`pP p`#"P 0''1`0'#Qw "0'  P 8p<0 W ЍH 0 0$$  cyyyyy@-z 44@$( 0i5㕎':zO-iMPP@ .ϟpo  G"1  "" ? @P",R*?`0Ft?0V:@'T  WW O@尐TYR0@ C ! OPG oo g & f f   ! Rv$PVCo  `@wP WPi4 W $R,f f2! `VS&Q W01@( N@d X XC$PY >`:0,0PDP U:T P QR !bPQR` ( @P, *$$ `,`($ @P@/|M0C0 (ࢂ0 0`fR `x$`84 dPN\ fbX(@DPHL \` $(0,04<ppd-,  T@<%+<PEh@vPU P@*x LY\`T iP,% c0@PV Kp` Y  d V:VK  0Q RS 1c!QRSLK\ , , , P1,, VPE,V A,p 0`0V1 Lp㰟O pP`(\_`xP!:!&{0;qa P8 0 (80"*ڎ O0 : PUP 0@P rRh.0 n Pp GR pW  P8!P $.  9 ^ ,P4 P,P #P Q00CP0xQ0$$TmT. X@Pp((,PcLPd +㺵 oRp &",   0+'z,l6%A0sv 4@ P  P+" AR*1p71 @ p 'P`P:P `PX:P U:k 0,4(p VE [  P,  0 (P P$P pᗐ$$pdW:,& 0(PU: P00@,P[j LPdK$P'\ Pb$PUZ.bEUPPR[8:[_ P1 Q R. !b P Q RN0@,P: 9U  qPP(` P!  T P[:[ P Q R !b P Q R$ P[@U PLP \ 3+P *V %"e%aq' 'd  `l(4miP\ gFvkgP$ 0@egP  VGU $<U*0 UP*  6 d$S( ,p&:wP U Q:QP YX h PYXRM* @ tfQ 0PR*A, 0v < (PGU0<*!!U:LD&^,*3333UUUUT!*P!*(*<* @5q0 ;003S ;B0V@%P %P@0@~,AU1P\ 0V'4V'X!*H*D* 0p'U*$AV ol$P  0gl  0ALP ``PFp3 㰦m`) V `#P p l h d)&ẗ" | $P V0P :@,pPFP PUCУ& 07V㴰$:,pF ` PV1    0 ᴰX pⴰfH8V'QS0*` 0?0LpP`JPA\V) @`Pd`plh) |GPPr &X2@` 0 Eob@U+X&,"R0%A0)iߍl+!㦽 ᢽ ួ ᚽ ;㕽 8㐽 0ዽ ᇽ 0Ⴝ 8p   oԐܐ *f,*b(*<*6qX!*H*ۄ4*-j'*'*8*'ht@'*{}A!` Pņ]XY'܅ h['@V'6}~  @-L(ƞP d Q:Q0 @S RT 0Ad!SRT\  X!*H-MP`PTp`H%G!  ^{PЍ 8*<*T!*kG-M@LPN TL8QpW,appP`V5P P+02 q`V 7Q  QWL!\ D0ۍG+0ۍ8*'+X!*<*H*,*'*xH-MPLp`@%G!  zPЍ k<*P!*ׅG-`p W @ ` pP @  PUB@D`Rq@  X!*'*G-x`,FQR vWO:MdPK P 0@  T 0Q0 pW S Q @p0 pWi`! 7,fF&0i, A, @ `  ʻX!*aO"O-MhpVcP| ` W%:( @,Qw  0+t,6&00,A@`(`WN*@WP 0p&!&T $&,f?"  h0" XQ S 0$&?LP5Q0ᒀ$  P ((&d 0EЍO!ihT PH 7D4  00/ )X!*)G4V'ׇG- MPpR `3@P< @, NP `Py  &p[ (`<ND 8 0`` $(:h`0 Ox Ol O` OT O`P w_`Y< , S&p6 M&p3 &p( 0( pW *⨠⊲W  0 P /n0 r*PP Ƭ  ݍ0 ጺd@hyedAzd@'K-8MM8 ;PpP宰`p @0 P?p{$W `2! 8ЍۍO-MMAn@Ph<X@X  ᒁ@@5Q ] 4a \^ l^ 4a 4a ^ 4a 4a `_ 4a 4a _ 4a l] _ 4a 4a 4a x] ] 4a 4a 4a 4a 4a 4a 4a 4a 4a 4a 4a 4a ] L] ] 4a ^ ^ 4a ^ ^ 4a _ 4a _ ^ 0^ 4a 4a <_ _ 4a (] D$((4 ,u44 mD44 ,app2%p `3 L@`3 DH@T3 <Ww 03 4pXplh$ a (\2 ,SLO2 , F\|2 ,=8T2 ,4 2 ,+,2 p,p 081 pVp x1 `Z p`'&L`pP F| ~R`|P/ P,p6P'`p"Q*a/@TP   0P@qo@P A.Ѝۍ  .$~s[L=,ƒ w~܌"0'lyH-M@P !Rp`P@V>JP Q7G@ Qg@ P1b b b b b c b b b c b b b b b b b b c b b b c b b b 'a 'k 'fkЍ 0ၸ}rH-@`pP P  V  0grH- XX@᫆L 0~00E#a00~#20~`Pp#<0$0`僠\0tጠP04pp0H0orl0G0ppp03pp080~pp100pn00pp`pX0 0e~p(@dpXp00< P00R<! Lp1 @UPT # P*V [aAi/K  p p 0PP  P 0AP  p G"P0 p[@e(Q;P @ 젍P QZ rPPV ` Pp pFo Pv Pq  P@TPV젝q0(Q  @oow A 0  0O0($sU @P! D@TI@@P쿟`<8|0(,D,@ `T  "! 0@D  T, $  < ( V 8 @@`RQ08100<,|(PP /0P@0S  000A B0SR @A@ဦT`Q P <P8P Q@NaQ:`PxPP`?pLP젍 tPeP r>lp d(G,w0gP n3!p `/ [PT5 T@7*<?W?p#PW :x 6h 2X .H *8 @)$ :$ $*P[P000 Y< !b<QuPsPqC   TpKp I @ eP P PR ^A ZPN8PPI Q찳@Pᓳ AK( (@@ 8  P2 HPH  Q8! Q/GP- 8 PDh T+SD( ޭ, `RMb@A{Gz???eAGQW7,  0PPZP H'z8![ZppZp PPLLg@@pU8P ᔭ@   W!DppZF0SX:  W &Jf0 vD0g"Q"\P Fȕp  D0 pX`U D0 tp` D0 ep` D0 Vp`  0%00<000%00  \E @( 0 00'a0 U@(0<0D0 "p  @3DC`p pp0VPP  p0Pd  0 pL[ 00 A 00SQ: !Q8H@(0 0, $084p0P@ 0<0 0 4$ P p P$Q (#@0D q0S0pPd;zU BDp2zpPU y  HH0 pʠV C0 plx 0 sp0匂 0yBP`p\j 0pZp P1 *IGPAPPP P!!\P PH H@LPPPTPXP-P,A*PUm'+'+.'+ٖ'+֖'+%'+z'+\'+'+>'+!0''+A3,3,` '+'+(+)+)+ )+)+')+a'Kx3,-@=B'),ė ),H),L), -Nsp\' P),$ `),p),]A-pP! @# `P T  $OPP 4OP QT P Ak0v(0 g  c'+۠. H- yw'H-DQ 8Q ,|(( R),),Բ ),'+H- p7`),1O-M-Mfv @% $=; < #P!qE 0 /pLt 0< PpL @}^0 Pp3< $  D  1DP@#0H头<` R D0p0PpW d4!(q!( #H4  A<$0@  0P Pu 0D ^NC ,3`Sp 's  `ß `P pPdXs`P4 Zү 0B:   A 0A Z@   ? {A Z A pB `  Pdڨ2 ]  PptBp- Xtur $` PXH P  Zy H A*  0I Jl| L%@ q  * P| x1PB$`##p3p@ A81BPp@  \  R 0Ap `D0g"Q"\P ЍЍPD㱩eA),p),),)+),'+(+'+ҟMb)+L),'+'+'+'H*,),),),P2,'+3,3,ɚ;6e5wK )+x3,-@=B'O-M-8MNϛ@  ˟   A 08˟I۟帍席]`@ Ǯ  A  0@:Q3@˵0  Pಮ  A B* 0 @Pt M P  A B* 0@INH˴LN   1H @M  ~Pv  A B*  0@8H˴LN@ bp  ( *PUx<D.@@'+@^dl'A--0M@>T q|B|qtRtqlbQ `qP PHq @ w(+   +Sq qQh r,(b  * R + Z;K1+ B+4QR+ ; ;#K!|K$+S Kq6 ; f T8@, p`P\0 4 0\3,ء3,0'ZK w "` 8dN8!+p@-8@@P0@,`PP 05ol3,'` "O-MMP#`pP@'P  吇U-P w匧GW夷  h MP!bBP2 t T ` h 0S` DR MRnPP NR6 RR  A=T&QP H T8(A T%QPsHP {lHP@5 P `bAP P& ]NHP -_`Q Z-@r)P $u P:@@lQtP4 PP`pFP(  0PwpWBAi$b l  3P xX0 V! P HX0 88 0M J  P hP X0  04Hj&β3,&*3,3,3,.\'УH3,£3,\'3,\'3,f,3,|3,3,3,BZ0'$ '3, \'3, P 3,kTy! 7Rp 0H-R@XX PlH l< l0 l$ ldj'l¥O-MM/?@@`,, l`ll|<M∯\x``T寂@PP P LL3 @@  P ,P NQ/P5=ꈰ븎n~P  @l   U8  Q P@P<c@P Q Q @̌Q-  ` -͎@0vk @@ 0ϋp%P,0Blu u u h D` L < < 0 m PP  ,@  P L咍a@Q?⌌ t  p 0  $ T @ Pb&P# % @ 嘰P x#   0 물 ꐋ?PY DPoP _Pf[P} F@, OPV(& P] k@ 9P@}PN kPvt %P,w  P H @@a P * :$(,048<t th,Fk@1 PV P: P P @1, d PP% @ P P @ `P DP Pp `P$ @j(0jP PK o ``\PXPLPt @1 0PP DP P 0P PX^0\ P  j +B  >`Pj P@@ ;PBPD  j@{ 0@t #P* Ph PVP% |0 @@TD P @I (Pe  Pj0 @\` 2 |0 ~sM ` @PP @80 TiP` 됕xV[ 4  V` @H!A0 p @`  P RP ^ Q  3R V`1RH Y 0:/ooBRHP TL0x`% $#t |P@R QC 4Q0 Q   ?  5 4I 0@pQFQT@l@hFPyppdhPn 㘷  @們Q p ri d |P AQ  QD PB    P AQ  Q/ P-   tP$* l` PP*l@AP @PѸ ڰPi@ThX ii L5[x弱夀P @ P:@D 75 H`=  p` P @`)Ѝۍ艩i! 4 X8,3,X9,\9,'P8,p;,d2C!!%\3,bvWNf"3,+=A w(88,w. ;!Ty!D dͪ| VӨ}W.ڧ§v:{"h! Ħq" 3,\' K-P_ P" `p匐@QQ Q  0B01F P 0p0  pظ3,3,88,`9,0H-P @P hQ\ 0 B 1 <QP @ P03,88,3,G-`PzP  P /P../ pPP* sZ Q 0/S/Q Q P/R@P5 I@ P  B0QS/SpDr0.SAYPp`FQ @P@ET@EPP/Q@@Y@ Q   0#HeTy!-'H-<iP0P$Y"P4e}3,\9,өX8,A-@ R R P䀟`!R"R'Rp?o2QQ QQo2pS gR R R  \RpQ  " 0'X5A-@ 0P h pW \\!?0`V`p`p 0`pW!@ R  A0 % P *  ^ R   q P / = #44 g @%3,'3,88,'=H-MpP B` 0 d@P P P0QLXw 8< X0pfV`Ѝ88,\'3,Ӫ'تK-pMll`@B 0 &P8iP0PA $吐P! d`PeY  0n .P*  Xf$! P p P  0 P  0 PYIT@pЍ\'88,3,3,\'3,'@-\\0 B@0 1 D P  R T@88,\'O-MQP  X0 P# @P pt X0ydQd`pA 1 0"  @WP5:쀟@PXp P# `E 0P  ePW  `$`VP@U:Ѝ3,'<8,88,@8,3,,p?,O- MPBa @6PT F `P7pVPpp 9 `P PP P`PV W  P  XeP@0  P P PUD t x d L L $HP$H 0^eW ] QDP nK `V  9eZdU  TpP $PX $C(ppp NX pP B0"  /!d"X W> L  0< @ZpPu BP/ 0 dpf{ 8 0 @Z@=|pM@ZpPB 5 0 @pP1 F$ + 0`$ @ 0 @9\pP  \8 (0 X0Wd Ѝ88,83,'P5x?,|NILp?,֫t|INOFNDR0H-@P #|0x   `0\   D _0 ( 0HVx?,|NIL|ONTAPE|INOFNDO-MP  X0K뀑P0:dpp@PXp}PQP@U: E 1 `V P P  c9 `@T" `圀堐XP pW PP  P  c p$@TЍ3,'m@8,88,3,p?,H-P  X0 ؽP@T `p P $p$J `@TV4@T (P$@T3,'p?,ެO-M  RRP  X0"㟽 P  X0㖽 W D븁就P` R]*唑唡lp1P` U *@P  0G  c %0&  @P *  " 0bPP 40 R:Ѝ3,3,'3,@8,3,/?VwO-MP  X0 Ԣ `PPp@`P pP P:8DR0  P *`byY:eS*P* P e R0  RKa T *P  P\bU@ T$(P:P f- Q4@ `.Cp Ps` @   0p P v*Ѝ3,'3,@8,3,8?G-MMP @8P ,, X0> @TP  X0 (ȠP':P ^P `pV  S@T@ `PU:Ѝۍ3,'ͭ@8,A-P  X0딀P8`@PP p RFP pWP@U:3,'ح@8,H-P`pZP @o"@/o"PPoR T 0RP P ,t  IaP!6'O-cM@P  X0t$0``K`c rP9a S0#:`ᓜp 딓P T @0x#0'` rPTDa @C0@#`pp \P s AP/ $  PuJ(8 Т%>`PI@/0㪯`2x0aS0-  $ (,p(A@pp 8 0<,QDp4 p]ύJ` X8h̡刑HAQֺPF! 0P [eP ĺP2s@ PH  P 及P6P$M U`P {P PcߍcߍOHX`XT$ H0 3,'OH8,3,\'n3,{?,`'ήܮ?,3,?,PC, H Y ?,?,?,?,d'"O-CM@(PP& UP`p㰐Y AzP y yQ py@T:]U[ ptXp `P 0<PP P `X:P*P  0 P  0 0SP l_P + [:P Cߍ3,f,xa,3,'ֱH-$ 0S  ¹P/?,`'p@-P@`  P ll l0 a 㤹P  ``4൯`p?,?,?,?,\'H-M<DP,0 $0 $2_\o3,'ղ@-H@p `  9P p@`Ѐ\'@-$@   P3,O- MM`@P/0 [ !  0 01/ Ѝۍ0 01/P ! @0]댁P epP dP TT ^pW 0P  ^rp` 0EW @`尠0 P  ^ +0 0} D`p 0@`WC,;!?,Ty!'Aip@-M@P 0`@P `Fv\\ Q^P ?  +Ѝp',O-MP `4,㰠Q +P+Q!R 0KS p@THP T:P |  ^pP T ] pP 8 09pЍi!@8,3,'ȯO- MM@OD/Q 8F(pPC @P? `P/0젟 !EP. # "  GPqP pU DP cpP  P (P @(0/Pp Ѝۍi!MbC,?,H-P /0`@aHqW !  p@@@ C,@-@/@<O-Mp P  X0&㚷 rP#@0#0c\#P 0)J]먓P `e0 P` \@`@( p`@  xPU T T<xP6P@`@0T `)@  \@ $txPiPZO P@G $ TP@Z 0P4p lP h x0ST ! 0\ $02   r rP h0t x nt 0` &\@v A$ 0 ʶT<奆Ѝ?I @o\ k\) 0ЍO讶|\AtXDAP P 0៶< 03,'3,H8,3,`'ή?,հ3,3,I^3,O!(uK5K-MMP@`/0pP # "  0Pp ,p(tA #@PTD` Tp{ p# P p) KT @[U I [Ѝۍp P@[Hl PTpL P@[H ([-YC,w?,3,3,'˾̱p@-/0@P`㈪8P # " `VpC,@-4 T#P D@ 0K,#P@ 0K@`'\'p@-`@ dPV*P ?K<P # " $@p@8,TS,PS,p@-P` U: 0 ?%0P  " , $P 0@0#@$0$0$  p 0p@@8,TS,PS,!G-M@PP-:P ?qW!   $p P@`@`TV/VPW  P pV pWPۍ@8,TS,PS,O-MP0p`Р L@D*Z: 0㤩P " $U /dP$ T &ЍXS,@8,TS,PS,;O-Mq(@PT̡@q4`P @@(@V($@@`Q(@A$( ]P `/QqY ` @$ >  P  2( #P!: ?1P " $ PPh @ \0@ ZЍXW,3,R@8,TS,PS,tA-/@/P PpPP `P PPO-MPt 딀 q`P 3@Phc  BT0aP@U ЍOK6\W,3,@H-`@p V: 09| ?ᚨhh`1Q$0A$@T @P! $@T@8,TS,PS,3,5p@-@P P P  P ` PPU U PUP` R P{P@400 P@$ p蹳̳\W,XW, R /R  R/TD@-@ @\W,p@-@P`P>V  ` @/`PXP `u0o p%\W,O-tM@4PP $$ X0,PtЍPXP F XL@P` @`GP p 0 @p@WPP`[*P9 @H  #P( p ||||HQ dQ\ `   Q 0h$Ql(㼲pWX@ T *P@,` Pq ``D@ 0QDᕲ`V `@ 0p@@ pp @0 08pz@ YE (T%XL tЍOI3,'[3,uv@8,TS,PS,3,H8,3,G-MPdP XX X0LU[  `p %E Wo*p ʰE W_x0@ 15@PU ᠀PJ0 }p ʎD D\WT=P@RQ* rQ=4" `!P `8 Po0n  0ᇦ4P 0Ѝ1tt!`PQ`PHLP p 88` P 0C(AR`PqW qqq R( R*0`pS1100aS110 0aS11 0$0ppS11`$0( P0 }T3,'ݴv4>`̱3,3,H8,3,3,ĵߵ@8,PS,TS,Ty!0H-P(@((DP P@0آeH-@!0S Kaq:pP P@2P fTPVP D P0VtVP lP\HHC44 0V3,3,`Y,P8,'dY,bY7e&!hY,lY,p@-dP@`@QpP`P :60P @p$$ 0&Td'3,l],'yG-M P  X0 ϰDP  yp@C0\#P  S刓嘣 00+|P0 `%`V Q % P "% P X/VB PbŸ"0Pp0CA00G0LP 0& [P d"pk0 <`rR pp1  R8"BP$tP } R ` p4ڈ  B? P B2 P2AP P t!( XUJaP"A|PЍ l3xB 00!p0dB LU dd00{pU0 ѯS3,'dY,lY,hY,d'3,3,3,`Y,l],Ssg,>84,3,p],t],ڶx],TI3,3,H8,Ty!d''3,Ij<8,88,xa,a"H-MP" QQ @P ЍHtt ~pfB <L2UЍ$$ 0)tR3,\'hY,'dY,d'mO- P|* 0تll$P X ,< P. ( P trB`P@P  c  p#ZPDP PR M,#,ЍۍP`TT(P' 44 S4$s( p!`"pc@ p'`$p( $h> p@P`> PP $", XP 0KLO@B` #0 0Q a0 XO(P%tPPW (P  PP(@PEUʐ[Ps x e`U! V0pG V@Q  1T0Ѱ OT`G(@n`FVʴP``(@a`FVʧhY,a,|a,3,p],3,3,'!ȷ .LaP8,޸lY,dY,d'3,`Y,oH8,3,Ĺ3,t],й` \84,a,IXH P/AQ y d'dY,H-h``PP QLLP N@ @0@P@P0 PP D XM<P(P p:  ZU P@   0@ PDH 0'P LP  ,P   XPMP WP-pԴP@P 1/T  `= p< D@$rZ 0P 8[  (2/P pDXP`)0 LpW`P @SP 8P @ 0@C |8x# PP @P @ `PU b8b  Z 0{Pr p 00P $ XLL `PP  XL ЍOE`P=  XqL7790|& P b8bdPD tt Up@8{90<t90 ?L `ЍI1 vU _b8\bpP tp@ 073,3,'3,3,f,3,f,f,Y U Z ٻ3,!Y N{!I"gf,b,T lU "%\'̺  43,Y pC-M`@ P *P g+%PhUP @PP L PPH؀P 040  PKЍpg,f,g,<3,p'O-,MMD A "Ph`pAU`lhQ \XTP A" PA 0" XP`P P 9 QHQ  A(2/A PXQ&Q  A(2/A q A"@9/A"@9/A  pAA P0 pAA APPPA 0" `PV },Q  A(2/A"9/@Q Q  hJQ Q  EPRPA P P< P P 0JPP!PPy P P`gQ8j@P!0x`P ,Ѝۍ84,ͼTa,a,d'3,'p],3,MH-MT  P< ЍH<, 0(0P WJGf,b,3, 'H-L`@HPpW0p$ ᠚pf,g,g,H-0P /JG3,5'O-EMس@P P  XJT 8c@XpP PPp 0 #IP @0@!4IX X' X 0B  B  0 f"$ 0B  B  0 P" 0B  B  0 :<"p 8P ,IP  "~P  ~P P  0 Y:XX X# X[ !!X% X- XL L!+  !   pP   p    ptP 0| Y :IP X kEߍR3,'Ed'L;,3,]m ` /p@-MP@P  0|3/xPl p ЍpL@P`ó(6< 4 0`HjF3,f,f,3,f,3,'p@-M@P  03/P x 0np ЍpL@P`即5< 4 0`H4F3,f,f,3,f,3,־'H-4P4`4@pPP p84,3,Y MH-M(   UIЍH Ѝ/'OVVP3XBX9W0H-MQ  13?  Q 1 Q <R 040,@P0aHЍ0f,I3,'K-M/@/KP Pp/P Pp/`P\ 0`PЍ0H-PP NN@P4p `P TT X0HH0@ղ:50  0HH3,3,' 0H-M@  h  P9b,Ӯۍ0g,0H-@  PG G GP  G P  GP  G$P p G0d\` S G LG<<0H' 7EmGk,Zp@-MP@ P`P ``PPP8,@, ,0 `FЍpg,0H-MP@PCp \P PP X0Ѝ0HEG q4$ ( 0;GЍ03,3,'@-@P Q P K G@tPp XP LL X@ Gӱ840 $ @G*A3,3,'a @-@P  @pPp TP HH X@F蠱40  @Fq3,3,' H-M`@PR Ppʀ3"VPpڐpP x0x| V X0PF@ \3,, 0 FpЍ3,'3,&/ MH-Md   5GHP<P ЍH Ѝ/ PC'3,z"0H-PP 0@p T@P DD XCF n30  9F03,3,'\4@-@P O K@pPp TP HH X@Fװ<30  @Fp3,3,'p@-X`@PU *PQP@ p@8,0H-PP@:hPQPU@u: @P00H-@P ᬬ   ᣬ  ᚬ  ᑬt  ᇬP P@ }, ˩0k,|NIL 0@|NEW|KEEP0H-@PPPDD sE0  @0P 188,'pA-@Ȁp` YEΠ AQ  opP U  AQ  o P   nU yU'>P8,G-MP40`p@.PP/P << 0_$   0p` EX1 0 L 0 C  D  D  D  Dl  tDT  `D @Ѝ8v3,-` !A-M\bP x 㘠pP d \\ JP 8P \P| P@@᎞0P Q !0  qpWcJpp_Q-Q\0Q0!|p ZBqP$UBJp* Q%  r  * 0<p@PLZ ` @ P  0*PJP * 0``@ 0` 0` PЍHADu@4uo,$n $o,(o, h'qho,3,Y[@H-u A-BM@< P`0C  Bߍ o,H-PL@`pԪ wpͪWHRo,@-$@P  o,@H- Mp P0@BX PP ` 0   p  gP Xo   P`qE@-P*   P @PH @P\ \\- XP2 @P$ 00- `FP@:Pa0@3S) `@BKy , , y , y lx , y y , z lx |y |y z ,z Lz , `z , tz |z , , lx z z z z z z lx { lx lx { lx , lx 0{ , , , , , <{ H{ T{ , , `{ `R 0A@@ S3x { { { { { { x{ { { { { { { {  @< 0@K@< 0@K@ 0@K Q Q  @w s p@R < 0@R  0@R  0  @R  0 @R}  0 }HD 00 +  7@Rc  0 c X $@RS  S   | ",)      , @@ 0@ 8@  @ (@ @@xhP`0PPp |xS`   P !X  aQ QP 7o/oP" Wt`Q pp@pĪaT gT cT\'  p(P ` pr  (@AP @R p pQx `xp@@P@ hP PD  @ P@@  OP P( @ P@@  4(P P(t , @ P@@  P P, 4 @ P@@  \P LP4  0 @ P@@  P P0T`K`Q PP $`@P`XX X ?hp@P_ p7P `P 7P P  P`L\\d,T 3PP 9p@PP2p@P- <P R' $0 0r` `QV1AzV0v QV  `\Lo,To,p@gPD P@P2P " 0M>P  G>V3$DP TU 7U UDo,@o,$F,> =L H 8o,Ho,Xo,Po,\o, 7$5(3,10/4-8+x&!Jpdo,b`^\o,Po,Ho,Do,@o,.ՠ[X\"0H-0P@P PPP0d'O-4Mp`P@P,P!,0 $"00 (P PPPP’p0P P P00 ᰒp0<P 0P o=0pPp UX*` P, R  PyPP `V::x  cp7P ,Q>8  PP M !=0@P  =(/`P 7P P|*tO p4ЍLX 5oto,do,V}\o,%8o,Ho,Do,)!X*D7:O-\MM@`P QH 0@<$\ЍۍO<<<@P}甉 $ $ $ $ $ $ $ $ $ 0 $ $ ؊ $ H H H 0<#\P etX`d<(\s d8<  d x5 8o<!p4,0,#W W\P oHdX}  V<Q, Q-)"K<"\Pd0X`\Ѝۍ6<dAPt ȋ $<W!<T< < < Q\ЍۍO8Ѡj@Q:g@P189 :0T;p<`=Pp`P;%8;=E4@APBpC`D9 :0<>?($ `pPP4;jP8 @0; \ЍۍO;\; P; \o,8,h '!<4w~/! fC ,Y` O-DMMQ `XP;L"@Pc4rX`@P`XX  < 5 R00pRpa0ypCppSp` RQqA aV= ZX Y Y*C^hXH qQ 4C0 .pA~hX/ pP  .0 0 .: ; ZP@`@P`XX X <XDЍۍ 'Xr,ZDo,H8!O-Mp@`V` ` GP      W W` ``ဣP; V? "VA 㺥 Pp 0`B V0 a0BSWBA0BS7B0R00S`P  ܒ ؒ ؒ "Pp p P@ P:0WW``- ?( Y /P1 W/`P }p!`Wx 0`Zp @`Ѝ p 0  zЍOC/`P WP i}pP YP   B`P9`W  ?( =lto,`f'ho,Spo,J;p@-@`AP R!PU e1 E op l lto,Xho,JH-XP0000 P<P<P<P<3?0> 0ASR   7S86S80 S :S40 S44 0< 0ho,0H-P@U U A D> 0Z90  S9X0HR'O-dM 4"p(0P$8,$<0 0pep<P{ P~ $<0 Tpv<@5Te @@pQUWyQQY NyQ pwd\1X @8 xp2 0`C`S``0p01 P@pP" H `0`bD 0`\ 8 `@P`XX X 9@ T:(dЍ@j(jlf'E[gbY'-H-M8 ((0$  8ЍE[gP P Q${8y8m|v- 0H-P@Q  \0t4 0H^8$0HZ8  0HU8 Zp@-M@PQ`%QP .P ,oP `V V NT\,_ Ѝp@r0$$ 07 Ѝpr,r,s,t,S@-M@T T Ѝ@Tq( 07Ѝs,t,H-(ML 0    R 0 Q: 7(Ѝp@-MP  P @P.MP X`↠P@TL@@@ P,ЍpSr,s,@-Q R R  RR@=@7=@0 @7s,p@-lh0 @Q   A.@R$B@@@@@P`@ BU:  pt,0H-M@Q P5_EU_oP4O T  PQU ʠ $<P,ホU$$| @<PT(<@Q3 P18E> p PP%  P| 0 PP x0PpWP 80 T TH<00 07/P<AQ  ľ T 8  គ 8pW P 48 @< P @P<  @0嚅p  P@ @PP`00(T0<@P @ P 4 < D L 44 C0D#;0B -0@)0PHppp$p \G GP,6,2GpppP hW,(`,$LGp  ,W,(,Gp  V, ,Fp  V,,Fp  V,,hFp  PV,h,ޅ\0Fp  V,ԅ8,Ѕ,Ep  U,ƅ,…Ep  U,ḅ,㴅Ep  pU,᪅,㦅PEp 8U,ᜅx,㘅lEpW \%@P 0/t,ህ,ㄅ$$$a/HQ \/(Y/ /[I8@ E> @@@}pt @ 0G8 @@PE>  PPPjpM P4 Pj8P@ E> @@@WpN d@ 0! 8PH @E>  Dp; P$0H8@ E> @@@4p+ @ 0@_0.PXT^ 8Pp 0`L< PPQ P @E>  p p7"Y/18<@@b@T' $4Y34匒@P@ hR8  QQ  <0  <4@`pT:,(TЍۍ $P@ 0 0\)8PP A PU:(QP 0 $0 PP  '0 PX4 R-  P,,|,D,!Ty!` xf'8!f'|, |,n!jc^WmK,o!x1;!C{{,{,qf'B|,1O-MMp=ㆈP @TT?QD@=oP.PQQT o P ؏ (c$,,$ `( 0ኀp+ , T` P  00@R   00 SP V, (`05 P( @PT=PD 㲑P; =PP4=PppP `P`vd00@Do,dD`DDD,@pP _@ = @҇P  tP W ,Pz @@ P p@  PI  P^  Pb  ߕP  ڕP  ՕPT @Xt hBQ0H ` h p x aRm pp QzT%- P PP@{ @pQv ]@TzPY u @PW oPV jPU ePR `PO T  @Qv PsٗP8 nRr3T͗ PP P@ὗPUTdP @ P @ Z pPL@ =PPF=P@P 0P06c` t>FtM.~p ``X" `p0 `d0`F> `>p L`@PC!AUt (`0w P` =PP[ =P  =eP 8 PA =\`0@P`0זc <BM. ~p  FnX 0 A``P`d40 `ـp hP\ H% P# pW ( 8,0L `0 7/ ЍۍOK(0`P PЍۍFPd d d d ,p(P  PTTT峖P  P``pd "P 0P P? &P- @  @PUPK, (`0(,`囒@PU`+P) P f D Jd  Pa | P mQ Q Q [PTdQ:"[PS p`F>  0 p D`4 F 0? " <MG *B(*: %PW  @Q l,{ppP ppy pP.` 堠 P  㺎 PI 0pPH c 7M. 0- /} q 4 q'  @P LQVX P d F0  ̔0pT@` A$ M> PRp @@`@PT!Lc  G|, @Q  PP   `PP -f'`PP PP  R%   |,xf',|, ФZ PZPZQ*Z'PxtL 4-|,'@PP |, ;PP P Z<M `0 ~p P, P PC 0VM.0(X ɔP |C0 0>F.0ϏP _&U`PEP T&Q P L&U PE@W hKA&W W0;& K%  3&|,|, |,f'8!|,aaE 'A-PLP <PX``8 0`up VP?Q qV<QQ  0to6) 1 "  0V PP  0T !!  0 Ѝ|, Q|,|,|,H-0 l 0@  @ @ \R $0@BR'O-MĀ弐`Pp @` 0 T  03 /p F@`VTD8@P Ѝ YR ` O-dM`PP Z8 p@ ^|]J 0  0   0  .[0<P Њ@Z P ݲ dЍOOa'T0H-P @P08PU 4P 48`PU:XP0PQ4P8P:XP00,Q$/  |,(|,f',|,O-MMP`[8 @?P @u앟 F쥟 TP0U@%P , , , , , , , , , , , , , l , , T  H , x , T , , , , , PAP DPYPwPr@Pi PaP[PS PMPG 8DP1嫇PspP#jppW  FP P:   L8W`V LP,P 2X WWsP nP iPWGP;  $  $ $ $  |PgFWڀWI  WV  WpBpRJPj `AP <P8 tv W; @Wr!0 0  0=Wd A 1p[ A "@P) P\P'ZIH D!00 0  0R8 '  p  P&( r/ *o@T 0 !$!6q0pȀ,,.T,!,,,܀,؀,Ѐ,Ԁ,̀,0'+!`QZK-P@(a(q( jtPP>aPp'D Q Q`Q@@eP! @P:Q@T tkP dfPz6@HH P#8  ܈,.0','40H-`6@ P  | p d X L @ 4 b'BCH-MM@P  ?P* ߺP%J  `pPP #P ``P   `p4`ЍۍJò,܀,؀,Z0H-M@  >P DPP 4  ιpPۍ0؀,,ZO-oMM 0@@@DPH 0@7PP PpB ;=Ep $  .›pI @(,P $P* P: @$h  .hp0P' SP!1  `4P p,danXaP R5 r,аX:(P.  .0P(P% @P 0a P `X `7|`P 5 ;@T: ᐸ()PPkNoߍۍA!|d~8!y,@edA>!O-MMHP`$̳̃ @P =PN pDPY E ᷄P@ pPY  p(P Q P `P 唄P ,PvP p@ s4,[p8  @oPr/ G`P W4[ P Y ("(2` FBP MH!1P3p`V @o9o @㘡+ Y @`C4 V \ 0_O`54 V  R 0@[ d됰 0张@P P PP *(8]M+!`c,m,\!Ԏ!w@'0Z@-@pP dƒP   ̷p 3, ؀,,$O-M-`M< p, @㬷P!`>P P  ៷pV <  됰W <`,@W W  lǭԇ<`\,@P ć\P Ho[  p R4Y `@ pWBnp1@DT p<H0,,'8G,g,ǟB@4pk-6-dA!N!8!NcN0H-@P%P PQ x0 RP\'&H#&P0< {{00 0dN!ܬ,6-Va>->->-H-P@P@T`p|T Q\ TITDP 80 %,%P@p耨,>-,d:H?-VaH-P H3 i6-H-P H3 N!6-H-P Hr3 p6-H-P$$$ Yv3ܬ,v$?-6-H-P$$$ Gd3ܬ,?-6-H-P$$$ 5R3ܬ,>-6-H-AM@P 6 DPL PTHAo"<@,0T@Pp0   `A 0V0aWp0U0R0%!T Tp 1@P P H &@P PP 2Aލ6-x6-6-6-O-lMR0 Q* `P @pp pQ T@: R R Phepp p   AP R S(  0S R :@ T T0@ pW T P@ B P@TP* \< $π@T9 X4H$ p$Q \Q Q ,P1U:`T 0Q0p@T1EPaq`ap`W@PTpaP@UTp0 tj$0 @ZP]\Pr [P|$P P `` 0P 1@aV,P ]Pi $P  P+P\P $P`p 0V 1F!R H !PqR pP Up,P]P> Ps  D Ps PU P Ph $Pq Pppp 0U+ PU6 P PO R  D QEPC  D P?u B\P P0  ]PP 1EQ HPqQ pP Up PU P PHPaQ `P U`XXP +x lЍ''6-6-6-:-ܬ,O-DMMP<@l P$ <w>Pc @@ :x+P <<\ PT <@ AP 0 P3 <P. < 00< B@0Qo0TA0 #PP <!@P@PQ5,AP> < P8 < ,0(<  < a0 o2@R@0P`"PP < @aP@< 5@PQY 8DЍۍ6-G-|. , ,(,6-6-6-l,x6-ج,h,H-8<P 0 ,,P w)ج,ܬ,,A-XQPQ DPD`p@ Pp@G-ج,l,<,O- MMP@P\ |PXx`Vpqdp` 0oL0+?PJ0?P 0 0n +0?PZ0$@@0voPaP nP@pP qPt t@l8 @@ ^H0  Ѝۍ<,l, ܬ,''hG- P- @- 0$ 0 @`6-.HG-KMp@P3`@PI 8"0P$0D@?oT@Q2P 0M@WT  P0 W2p@pCT Th!@<P P @!5<P PP .@3   0/m@+P@ r( @ R @}Q  VTt 07)P@@@7Kލ(@6-6-6-6-t?-A`6-ܬ,1a @- 0$ 0 @J`6-.O-MMP P";P 2B  00$zP P E7Px?(P t\r P>Pt P6-0Ѝۍdh 0/ lf6-s`6-G-t?-|. , ,(,?-6-6-6-Al,.aج,ܬ,z1K-AMP-@P) `P Eu+0Ѐ``=p pPJP  0`E+0=p; -8 4n Aލ6-s!`6-.ܬ, P/iy H-P ,,, ,0Pl-ܬ,6-p@-P@P Po`t HP `CP K-pU , `P$00 piy ܬ,H- 0 @,6-H-P 0P $$H蔵-耨,ܬ,6-H- 0 ,$6-H-P P!,$!A?o2Q@0!`@PP pP @P( 00 ,@P h@P \h \?PL  D  iy p6-,ܬ,3Tj,6-H- 0H 耨,6-H- 0> ,6-@-(@(0 3  R脨,6-p6-H- 0# l,6-p@-MP P P h/o"Q ) @a/o,F@P\P aVPq<P@,s@@T P x` h0P t0@  T0LDL 06Tj(0Ѝpd,iy ,Ԭ,,ܬ,6-H- 0 h,"6-H- 0 |,+6-H-P PP@PP P ?0pʨ +xo200pP`TT @S@p L`@``0`Q ,iy ܬ,Ga,6-H-MP) P'P  8P P}Q xP ll\P PPP 000+Ѝ{6-,ܬ,C-G-l?-0H-P P  P<P @p ;ll0P \T < 0HV+0<y($ xi0H6-,ܬ,?-H-MP PPL  e8P 4`P$)+Ѝ l?-6-O- MPS PX!D8PK HaHPP34$P  P ;P0 @pP P P PPP pPpP Q;pP3P* Ѝf6-G-|. , l?-ج,l,H-MP$ P  7P P|  7P PTP@P4P * Ѝ'/l?-6-G-Mp`pJoR@vP WC vP㌑P' W4 lW&To:p`pZH0P( PP0Q$V/ ;`P cP%) 0,ЍG]hW`p**Pt@:|` qd0  $V ЍGЍi$ot?-dbYz6-tܬ,7O-$MP P" 7P{ P! 7Pr  @@ uP |P ;P^ PY @uxqxPP2@`#P  @P3 %,,P6%3 X, ,(,t6-,K-MP P!3P +P p\`&F&&HH!p P 8 P(/@% P P垮$.售ЍPnP `p@ NZP mP @2/LP$.6-ܬ,}h,T (,8,t6-H- 0~ 6-6-H- 0t ,6-0H-P PP U@  9p%`0L @HH000 0?m,U0 0H5m6-6-6-6-ܬ,0H-MP< P @  3P,  2P( P%ʴP Sc@P  P  @Gc@d+l P L+lP \%Ѝ0ܬ,6-6-P6- ,6-:-p@-P P!0PoobQP``@'`@,P P&P !P )%|| hP  \\ @HHP 88 0 piy T,!x,t,ܬ,6-H-,0, (0\ 0 耨,,/6-,H-,0, (0\ 0 耨,,A6-,H-d`P` `0@P0lHpPD D0``P0_$`耨,,/6-,A,,H- 0O x6-S6-H- 0E |6-`6-O-MPPR@Pږ$Ѝp`P ~P pyP`U ^8PJ`U W8P:-6- U`T P 0 0p S p. U`T pP x0dl `p0h`P S `, ,/!s!O",,,oܬ,y i,,H- w6-H-P |CPt}Q hP \\{T4PHHH 000# 6-,ܬ,C-G-l?-@-MP P@ Q P QJ R  #Ѝp| 0/Ѝ@aL DD@0  0 Ѝ@ Ѝ@!t?-`6-ܬ,U:16-0H-P ,@,PP0#0耨,6-K-MP0 8RQ4LtP%" 0P! PP ܑ jP !p p W'P X#Jq p||AjP1pF p P  W2  WR3 pV@ AQ o1 P p AQ ]1 P\l傫hЍpG$,,l,ܬ,G-H-'"6-0H-MP  PP| 0P K4@Pp @ 80t"Ѝ0ܬ,N6-0H-MP # P!P /P 4p `@ P 5L0 |q"Ѝ0ܬ,W6-H-P P"(HH]6-b@-00 @P 0 @Hܬ,jH-MP PP  /P 3P @(P PPPC"P m` m`2 piP [ [',ЍtA!6-O-MP  PP  ;/P (P PPP!$Pl`d2|@ ~i lPll Ѐ`pDD0Kp`LЍt`6-,p6-a.6-0H-P)@PP P PPPP5p 0PT0H004 4! 0x!,,ܬ,6-A-M─  RPx0S lpl@lP` QX0`SЍAo! Ѝ6-m'ܬ,` H-@`pt&P PP k10@0PT,, H' H!ꀨ,ܬ,p@-|`@PI&P PP < 8pp@ ! p@6-ܬ, 0H-P \P H@LP:P0!80   0,0H&_ꀨ,t?-Iܬ,6-0H- @R: 0`  R L@ PP @ 88 0,0H_P0耨,t?-{ܬ,N6-0H- R R l@0 PP ` @0@@ 0,0H^ P0耨,6-t?-ܬ,O-$MMpPQ %P $ -P XCP` hP P@XPU  N$Ѝٍt)g`\ A@T @D @ Sp$Q \Q Q> 00iRZ @)g jP@P@0 0@ @ AQ`@)gjPR%o%P Pp  P P [ T@pP Ha8K @P   ,` Qg` 2/PP )=g$| @P  P Y& Z2 ,,G-8,'̬,ܬ,}6-h(,,8,@,VO- MPl@=P LP P-( *(P Pp  ЍаАЀ:`P ]P `P"pW pGkP|P PP `$,(,x- - ,,,bYp@-MP @vP  vP GP ` vPU PP 0PЍpd|%PPЍp@ 4 vP F0h4~G- M p` Sfp. i P/P:P" 5p P "P  ЍPP `A`pD@cP'`PX]ip p. f  W f /p9}P p. P :-}P p`{./ PPp ,@cPP PO"6-mi!O-wMMp`qq|qxq`T```tq```````|`hpx`l`h`gppd``0`` ``P p &p  &|p |&xp x&P; 5= x@0  p x.|d.h-Px(UlpP'PQVPQUy U}Qy - _PG Ptp tkPP 1/pQP x d P P P P wߍۍsP */;|P--P P XXX/p`pPP``\`X` FP/P/?04P  4_P@~ \ X^ 4 pdq5dP X_ T@  <4匥,P PQ `pQ P %x%^ R Q OP cQ P QxQ-/|@p |%|#P@P' HO m5P ikv peV \k"P WJ@n Q;Q  @n qQ QhPwW p@nPP j d R ? 0  R (` U/? (`͟(荟` R 0m S썢 Ρ0 ,4P  P 0( 0 `p Wp  ᢛp j#PP   ᖛX`Č PP t̟P (P P P&@W[(P  P̟ R 0E nS3 nH0ppT0(h:@P0 `#p @P  P  p  R `@&#p0 P0X+ P@ @@=R$ ሜj/5ue0SG/ rP@H tj/5euS FPP T&@p 3Pn P``@8P y 4PR |gPQVT PP`@P t: 4_x,bQPUQPM PNJDxApHgP |P$ #@4P (, 0 %0&   P 0 '0*%`0 P& #  P P  0  Y! `Rn Pj P帨xPq!P RK *pe`n"P8 $pLn_: P  yP j Q Q P yeV:  AerP PPL$pXPW QP PP  P +P"x/P x`%IXP  ! jo 0 FpA PPPj2,\ 0 (0) "'* $P.P ,7h? "FC P}P"`QP) PP% P ! P @P  P+ #p @P   Ai1P ꐨ, (Yh.X\0S ! jO`៚aX\ 0!3/`ڙp@X,  pP" pD Z  @ 0R~=,X6-`6-qW P eP1 )n `Lx|PeeeegTUPv?  PeM|P Pigbfl6-I,ܬ,kv, 0 ,ؕUYP^ HOP b[jo O  00 0NxP  ` `P P  0 p0Po2  .ppm[.k?Y#px ᦘ,` Y {0< `,꠨,,^}, `P OUPU c)gP @UU cgP 2P {tatp1d}!\^|Q<e!DtZ0T1\!P<X!нP  sPP P: x0-x `pc0x| p< /x// P tm pv/P| l$ Р 0g/ 3 [/d P <,QL/ PZP  C/p6-,,<;/똀P` D|YpQ`U P ` P "/L@ PV P $ P /UP T m//p [ȰpV( `j?P`,0 4 0 P; P , 00 p4e P 0 p],0 P Ri! P,0J F 0pH 0 P Ȩ, ,0 04 P@`pH@ P0 DV U P `W: W, Wx| p%) P400  pP@`~ *SX6-`6-,ܬ,` p,,,G-38,= ̬,8,  ,.a ] m  ,H# ,   ) : N  c ~ ^}n''      i  ? G j ~  ,     + F O-LMM@  P0P(P,PPPRPlP  $@PRP  40 ,0$P:RP $P (0Pp ,P P PP*?UP( LЍۍ`P@V= P@P8 / X,ج,} ܬ,,@-@P /P )P #0H-@P PU m\_P 0p@-`P@:eOP !`'P %ZOPx (` ( P P !PR! R s(p@o( i ^}H-Mp@`PP< 0 S*0SJ  0C @P 00S  P Ѝ,d K-p[@`E P AQ P hQ AR0Q  qQ  PO-lMMP@3   H   X$\$`$d$T$H L@PD0sP P`t_]D,@P,QNXDYC ` @k->-P,,6- bY& '`6-- .P\!Zl?-H,,L,p6-7 D ,,A-MXt` PWP p   $P  pW  pPpQpCP P8 P7 P P{P1 P}P|zt@@V`cP Q PPQ h 0SPY YV Nr   0P3 P-/N:   D0P0 P(B`m i   0`#C   =P< o P P6 oP h P pH@4P,@)'PP Ѝ (P  !PPP Ca|6->-?-?->-l ܬ, (, H,@, `6-- \!P, <, ,,P,6-\-7 !  @-hM@y0 @@rP sPxl@d 9Q`d C PP0h(*X,l6-8,G-X a ܬ,P,g O-MM̨P 崘@  _똈p>ڌ 0 /P]TP2 HP.<x p00P `` p,P|xt4$q p1$P!~00p! P P4 "`_ 000G~`p,pQ_` Qa Qb Q F@[@Ѝۍ <  @0p@P>Pd"|x$t4q px0$P!~0p0t,`,(,,,,,,,@ (,ܬ,X-6-E l x,q 2 H,  ,y ^    7 g   ,# C S    O-LMTLQ LЍOl @†pD P 㻆p= (P(, С mP<=iP(, Շ 00( S00@BSCC /Yp UP U#P ,P ~@傆LЍ  <yP@p< phUP dU#P   gp P_ PQp =P0 b @ ꌨ,t,,Mb j (, O-LM`Ptpp̣ǿ[ǿS@0PW 0MU@P}@   ppUP U#P  pPJW~ PP  ᴅ@pTP T#Pe ᥅@PJpGPWppP  <# R rE  0PQr" @P  P P ء ?$  R# PSp#@Wx †0 08 (P4$p0SE/ppP r_ P=@AptTPP'  P #!P0  @P  P # @P   @0DoBDTPwLЍ#0꘨,ܬ,O-CM-`/@P,M\<|LЬ0 P  @Qo" 4Q P0P&| PP3h   PP4 PP@" \P @WPY-P ![   $  Y ph PG PB8QP< |P7/cpSP S PkW @W ʅ/*P㿅pSڈzP ~S PքpP rS P LzP < Q  ) 0 p0 P, Q P  mPJ hLIPd d P P Rp 8  p H `p  A dIPJHXPP 1/P iP`CߍP [P lw T0sP@ lP0 P Y㰗 %P (8PP |P  $P? 'p,dt&XP\P@p H  P gP Q @VP QQ P Q@P P  R @@Q(*P  Lv `P! R &0p \UP PCR P $UP @pEPT#p PI P pHRY"  @T @P  P pB   0-,  0  P`P  ,p @ V v V  ,p #tSYi @ TT @P  PI #E0 pP000JqK,t\ 0 KP!JPp`Pd P pP p`U  0)pIM#- @P   Q@ @\Q@ZQ P 0 @ ALQ"@c P 1/P $A h0 S R P` P QP ?0 !0  <8 @`p<,`(p0P}pLAP8]0 ,꠨,a|,,l6-' ,X6-,ܬ,  + ,,P,,6- bY|6-W i!Ty!i >->-`6-- \!Z&'T,,X,p6-z P,   ,G-/P/p`P @T`pU`v+ܠ+ I . V%@1dp1PpW u`9P PP0PÂPJu0QT.Q@DP 8 <i!Ty!T,ܬ,o W 0H-hM@\t LPd AI 8PorX, ܬ,P,A-MLQ@PC `lP    0P  c@ %PP uʴP5T P+PPyP`Ps qۍ@0P(ۍA\- \-P,6- @-O,@ O@X,8,G-dd@PP LT Q88rPQ $r " BPP0PQ0 ,HQ00 E?SSEA<<AIoQ$N@ (A@0,A4A4t@d!pA880`L!01<<8@@ DDRVHR RHAYP\ KH GHl@ l!+=H+9H@W+4HW+0H l P  G/8, ,p,,(,?-\-(,,\-x6->-,>-|6-6-6-6-6-6-6-:-0H-tP3 `P T P,P 88 80(@PP ,X,ج,ܬ,@,P,G-8,p@-M@P T 0S00U 0 `S0100 `P TU T@Ѝp@-P Q tt咈`H@ PJP (1@\-T 6-ܬ, qܬ, O-4MM0,@ ,~^.>@0@_B^~n.Q ^n~^@^pp@[>Pn~ @@n.@@d>@8d@@tΟPx>~P|.`n@@@@@@!BP @(+)G PF*0.0B(.P  BP& @{P vP qP lP D vKP l pKP< A8P R Q P  AP MKP@@lP\P2A,X P(AP T Pll0 0`0,P 4p@DW/ @ 0 H H H H H H H H H  H H H H H H , H H H H H D H p H H X H H H H H H H H H H H H H | H H H H  $ d H D{( PB( 0P :z( +)F 0 P:8   0  @  0 o, X)0 eTH|@ z$tp wpjp E댉php$$➬P\ Qc pWS @,y( XP ( 0P 7<,(8J 0P& tx( a|P( 0P <xp 0 Cp $X凭  04Ѝۍpq`@ 0"'7w0UA0,@@,   Lxd7 `PZ@W@w@@@@PQ  뤕P @P}@P P PQ PQ +E@ Ttx+6 P:?Px X @Q@v P , @D  6?&PP u?P  u?P  u?P  u?P  t?p%pP \?X%XP D?@%P  (?$P  sDD0Po[,::RP ,VPd |Pld ,@p:@P `p00 ?Q  0`+7D,tp帓r帣 DV@@03 V P R P 04@ _>@P [0,p.87 4    ?@h0 ?_ 0  PJU0, q@LP PG<_p0 ` d,X,\,p!`,! p,l,, h,t,x,,|,,,,,,,,,,ɨ,Ȩ,,,,,,Ĩ, ̬,βЬ, }x!T,! > C Ԭ,M n! 'ج,ܬ,, .e H Q .,,; ,o !# , , bY,,,n' , 0', ,,,, ,,2  i! tV "-9 t B J = = $,x- - (,,, { O- M((B44R4bP  P  z: )0 p  Q PSP pp W| P lPdT! B$  2/PP P  @P  P   ЍP  @P   ~ج,ܬ,4,8,C'8,c 8,̬,h}(,<,@,T x- - p@-xPPlP `@`P PHF(@( P fp0,m' 4, ! p@-@P 0`PP P @pm'p@-xPPlP `@`P PHUF(@( P ,p4,m'B8,` A p@-d`dl0`` 0HP\@ @T p8,̬,D,H6-H,8,L6-H-P* PU& 0`p@S`P`V p`V V`Ap Vp `PUWg'O-Mp@`kFV, PPV( V)ItQ@\p1pdd!W  X!P  `Q R K 7`PF ЍO賦ЍO!V,ⴰp`P p| 0U 0\ HX ` A `2/Ѝ Aܬ,   ,  %g'0H- $R!R!0S S1!Q0t100 R R R@!084!0S S0100@ P@\U "UPU "U P@PU& P@P!UU U UT 00 0S S 4 0( 0D,H6-L6-P6- n'n'0H-P T@P PUP PP  0 m'  @-D@p1y0PZ@o n'ܬ,O-M-Mp$  $p P+(<8@ y(P4GN/8(P()GN/8<@8 yP  jP u 0S l%(P@T3  A  A%( (  _dUdPj0`Q-@AP TC@D T$tdPp?DA( js j X`@ pP:j)0$  uK!uPP:S0:UP$j( KP(10A,qS @DG -T=IBJ P@   APЀX0 x A  QD-@ *P : 8s0( %k!%P@ :S0: ` (Ăr1p|&pd`"g "'ue 0 PR,@@X!@R : P\" R`p AkG   H 0 JT!eP$P!ePx ,(P &wލЍ P*p!e Y@LL!@Q5?e,AQ%.v w,BD@b"(r02r 7"cA qdP| (@0`v `Pv%3,1.A\-`6-\-]-,,  ܬ,$,,D h6-ZX6-B T6-QI ` S ` ų A! u  @- M @ @ vw Ѝ0H-0MP@E =7PC0Ѝ0@-E@E@O-M-JMPP- F`wF?pPQ @C -T=IBJ   Ah@T0@`p  A  Q`pX p $ # 0 F=P9[ڼ#!HP1 e0 PK xP?@K P*8#ePvw @#` pp7cDepV0&+U'@`Up*S0`p:P ?|r#;p Bdplb#5'{AeL"G5B h0W`Z pX@"fH ZPuJߍЍ.A Y ! P@PPPP.@P) AKE4 H 0  Q%ᡏ,!p@Pf @ U: d0@vw @ ` pp7cGdpqQ`  W 0Pp Q0pSh f`ꄨ,,\-, l6-` \E.µ ų   X6-`6-  ]- ܬ,@-fD\@ RHP < 8,P uOD@蘨,ج,ܬ,O-kMPpPN `@xP/ pӫ.[3뀥p4P| ZP  P PQ P p  HP P  @PX   p :P p P| hAP  P \AP P\vPJ?P p P(EPEvPJ?P p P.Qs AQ  M Q  Q Q q R sP PQ .p @ U Ph | hrP PP P H @ Zq AQ   Q q[ܡ Q pK q Q  x1 0Z 0ZS P\ Q7JpP|8 P  P CP ~ p ^p|VpkߍXhLdd`T\8ɨ,]-` ?- ,ܬ, ,,G-' H- $  ]- M   A-PR@`  P,P AQ  PP @Q:p '"P%a@ AQ  8\P p"P HQ 'p; F@Ddt08A`p AQ  [P \PQ  Q P ,P p D`FdvxL@DFX@@P HH8@P?P PP @q@o]-]-9 SH-`tPrP .Q1@P pgP 4`pG -KPoB@]-p@-MP) QQ  1Pʌ! yQpap@l1 R0P0R LP R 8/Ѝp3P PP   ``: 0` `: ` : ` : ` : P  Ѝp@^(,?-ܬ,Z 6- ,d,\,Ԭ, , >-N!>->-?- ?-$?- D?->-!>-H?-g"p,h?-K-MpP`=뼐@? T*  ` ?,` B0pdd Q`Ѝ@{J $ 0yD8,ܬ, '̬,8,   O-dMPp@`QP PPP `W P 4P V U ߵ~  0ppW ̳̃ԓP `0S  / + P 0jpPVpP \P =P=P p9 + +P pJ`P: Q @P@$ <a@ 4 P@<W@TQ d@P@<E@P4 $P@<8@`@T&QPP!@PvpWEQa=P3 PpW:TX@ xt1p@P  PU i<? P  PU [<?P dЍ) 9 PfP|| , ܬ, ,t  ',tV G- ,(,,,G-38,= ̬,8,?-G-C- ^6-A-ā`PpPKV q@9 P:.P Btt0 Xd @HP L HP 888!P V  i P~y pP 0RP @@8V  @ C?pP  1s0b Br`,,X- ܬ,  HS ,?-?-  >-i>-t?-Ĩ,+ I0H-@Q @QPP  jHP tP dP TP0 0' t?-{ ! @-@P  x0 t@Rdh0HT P ۳<Q,\-?-,(,?-,,G-, ,,,H-P @P 4 0,P o X,ج,ܬ,$,H-@>PaP pP Po+pPJooP |pP Po @qT>P (,\-,t6-Z H-P Pzo c H-P`p @ᅟP :@ R* T 0pRpp`FPt` AQ  PpT,`T 'B " 0 @-@PP # @-@uP?-O-MMP`QQ P RP s@@P \@ R BP{  --P@@{Q`@T``rp+6P/P +(p+(pUn!1TpppUp Xo R 818a8pv 0R @dP:TU o P   o RT @@pz@Ѝۍ(,h,G-a-a-Ь,i! ,,p6- ,oH6-X-]-   p@-0MPP `,= 0@ P LJ 0Ѝp@P @ 0Ѝph,A-MXaPPLAPpP 0P, Q,@P;  Y R/ 00 @ @,@U(  0(,!P}Pp@U PlPlvP @ pЍ,,t?-U 6-ܬ,X-', O-,M(rPbP@PB HPGq `+P.+P8P` YP a 2t0   ` ,F<8P<@  P6  !0  * @3U.  0(+'P}PpU PP2vP  < 8L ,Ѝ6-,,t?- ܬ,X-     ] H-0 2DP  a-  H-`P`h@\\ 7 pP D 0 pP, ) pF%N h  A-P  ЀQp`@P !+PQp`"QQ l@0L"Q "R  Q S0:  @G-6-,,GC-X-H-MM P@+4`"9PP >P /P7`p z4PP o/@oPPЍۍTy! O-M@T `Pp7PPpWPP`]8U@D` U8VR:PAPp  P@ * aV  uQ#*t7P*` @P  P `V: Q* XP  00S 0ЍT6-ܬ,@-M;P@ ,<P }m( QPpP:@Ѝܬ,ht@T6-H-P P#Q  P p\Q H QA@P ,P@먨,,,, @-M @!  f R Q Rd fQgQ mQ kQ Q bQO OЍ''0H-M@PP *0lpd\P LP *0lp Ѝ0Ѝ0H, , O-pW% Q" S AP\ ` @GT ^ *p\W ^p2P`pW ^U1:O- MCPpA`A%[ [ V* `Pb[.KP :%[ M[c n[ m[^ c[P QDP8c[.[0 Qp 0p/Q W0^1PA UP0PA2!USp@S/T Sp0pG@Q0QSp/Z0^0BQ- 4 BV*.0.[NV|* R07 2R10v*`.a!QPP V  m[.P| R_ `PtꀡlAEVS*% iLPHPb V  RA `PVV8*% RL:2V-*/   R)*<00 QR937 2R1*+0R*00 R*`>Q V  R `Q   Ѝ(,G-bY?-G-C-` /O-\MMp`@ 0  ;7 IP HS +71 1P P R PUP kp8  ip* P ipG <8HP k  ip0  iq(((7 0:w8p0@   ; &IP  +18!@[T8$P+8pP! jH0 m=iS00@,a@ SBCc / 㲀gipu8P q8#P #X!j8AQ"P<`  P*T0rjp ThV} `J8`<7 \Ѝۍ) ,Y ,Mbl  K#i0H-@P0H@jp@-P@@P`p``@P8P 8#P `Qp `T 8H-`pv@@P`PP Tp`@P7P 7#P `@P@U 7@p@-`XP@.5P @)5P P $0@@p ͑" H-HP @-@]p B MO-DM@h h l0 ._Qa 0i넱04|A `=p04P i(80 0 S0 0@BSCS /$pW7P S7#P "P L7 hP$ pA7P =7#P  Q  A<@-7@'7  DЍOЍ/ @,Mb/(/H-M$Q 0 &iЍ0H-@gP JP0㌩P @Pg0p@-MP0``{P @$`P g0+h@ЍpP @-@g噫嗫ᕫ@/O-p'R) c-'  { y O-$MM̢@# pPc/ 9 嘒 @  c d  % \#P` d#P P "`@ 9'$@ᐭ @#@P `Q< c# Q#QP-  P'X X  X LOP <` $`@V cP ZP#  P@P # cP tZOP 4 ` P0x @h< gc #c$ЍۍDj-j-m-"j- QP Pp6P` P!OP s? p0t V0lW8`8 aP ЍOYj-"m-dc j-j-P    0WE '^}" p' K p@-M $_`GP @P tPp* _TT _H '_nP,Ѝp@Ѝpj-Y`"p'j-j-- @-PMX @P MP @P 4\A_p UPЍ? j-p'E M @-@8^T U j-Y P 0H-D|ATP(P* ^"p'Dj-p@-M< ,PH A !00 ^e GQY c? 0S$ {/x    ?0 0,S/܍pg p'j-Jy in-0H-0MP@ p*P \D0@ w s0Ѝ0Dj-ixj-p@-0MH`@P 4* P  Z0ЍpDj-i0H-,P,@ _W" 0H_Dj-zt @-@YT_&^@0H-@PP EPP 00O-$MP]P@ԥp%5p pp券p %~`tQ; pOP0@ Q,* 0@$%$5`f pa@Q4@v w 0w w Hw Xw w `w w w w pw w u w @v w w w x EPw FP- %Pz   %Px  *P PP`P*Pe @*Pe 0 *죟`P PPFlP`/P. `:P} B  `` 0 0P \po(P*V  SIT`D~U QiQxA`)P @!00$B+(%"A0! WpA PA @XPd P p`oB@h! <A@PlP GPqPP=P $ЍI=| Xx|dP o'@n-Tn-0i-g-pn-@j-,$$ @ @ ß ZZZl#0S pQ PRU(C YPJ Yp<#Pdbhr`嬒 vP 0@ Q :p  ᫉ 0@EQQ@U+  $ P : t,y=@a,d!P  @RXX!0@` żDQ}p P?XG% P  i@P PPP P@P  | h i-i- i-$i-" 0i-,i-0''4i-4j-" "   '" 8j-lp',$# @-((@ V @2Vj-V6MI4AP((P 'P >$a P!l DbJLPL 0q  'P B PZl p-p-o- p--~ l K"-l p-C}S}l p-l p-l -@p-l @-P'bY p-Ԡ- m @-@@&H-}P >+[ Q Q/@-0S R PaQ:{Q:A@AT 2[S@ @2@S@P@Q0S@-pd@@T@P-L@P0P j=iLO0p-4p- p-o-K-0Mh P XY H P 8ŸQ, 3KPPP.PC KPC PRN ` P P!5 P5 P>:JPP5 2P51PKP$ P+ 'P P%! P K PKP nP K P       @ @ " x0xp`P   ,Bx`P (@I  0ЍDp-Hp--|p-Pp-(.p-p-p-@-M eKP @P FP @P&PxT t@Ѝ`P FPPP@<@P$ ht@0m p-E! p-u@-@P @FP @,t-@-M@@P@ 8 d l t | (Q  |pdXL@Ѝ(Pp-Nm Km Hm Em Bm ?m pl%l`%`TTHH<%<g8u P  ,#p "`+a$?X2 páieP ,"pD  ht tetfPd hP \%/H*&$((A<-/P!`0V``0F0epp-Hp-,,/P!`0`p-!  8-= ((2%eo Po-{s 8W2e Qe-x-hu-A-`Pvp@  +!P-@  %+`V VJ >P  +`@V(k$T AKAD-bu 0H-)#@"P- P: P PH P;!P QP ytP,P|0Hm@+Q Q pQP atQ< :$P%P! /P+ 7P (!0H-P PP- 0#P# $P 0 0H]P0xl0H#tlpP 0p 0@ 0 0H 0H,/-p-=-!u H-u ` -8-D- -o--@-@   7  s,  6  1  p, `'  P"H H0H 4@j--'u 2u >u Ju Tu i!_u ) D= H-%P x 0s  `P T@TPP`pp` HG p---hu-p@-/ ` |@Px@U@d@`PV DU U4(p@8--"bY<-tu c !Q/pu-0H-P@U @0O-M@pS   Pp\@@@ P p F`Y V P@ P1. @RQ &X P P*P  P P P`P  JGpZ PW:@ Uq P@T AЍH-ttq/2pd"\\ )pL"D 88 00 HL-Pu'u P-w'u xu u u u u H- p H"L-u O- MPRF @ `hpP> @@V!0Pp P(P ` P`` P PPp ZpP Z:  Ѝv H- p H#"P-u  L-H-P; A@0T"*Pp`VVW, PV @TPgU P@EPU uPU P@PT:P @0S gS 0@dS fSd0d00 P-@-M@d PPQ( QЍT-X-O-MP@QJ8`-pqWAJ`p8@oP2  0p&  --$ &#PMP+P PQ P@P @p x@d!q-@ЍqGP@PEQPnQPdP `U`uQcQ! eQ pS  pʴ/!vQ Ps p ! S  p !xQ@p-L-u X-T-v P-u 0H-M@PP )PT aOPP ;p P qЍ0u G-MpD`P,PЍ`P @`PQ p pP  @R d 3  BP`d`3`dV P V)dppU PAEPQ`p-Hp-p-P-O-M@U` pPPUP)GPWP* P Z P@T: <P PP @Ѝ u' u'0H-@Q P R0(B R P#0Q 0 S*A qR Q 0rS Q /P H-Ho-O-M⼳P@P P + `V p % P~X`U Vm  i@Uf `M Pp pd@PS V ` P PP"PQ X-Pllr@ @ TP opW JP**p@P W$* & ` V 3 P*`@P V *wPUP nU gP k_ЍOq@@P Ѝo- o- o- o-A-h@P`TpU?P W PE` x- o-0H-@PP PKP0H0@- @P No-P/Ep@-`P >P@P U  P T  Ppp@-,@P @@@o-H-8P,,H`-v o-bYH-p ,Hp@-M@KR@*OPP J'*P@bPa`UnU aU dU -AU DU) OUoU qU& IP )P 0 q)i8p,@zmЍpo-v r'8w v A-@QPP( P0PQ@Pt{p`P`pPP PW {P@P u'Mw s u'H-X PMw sO-M@M넁P @@T8 ``Q`pY  T`JP   pT`p@P[ pV-` Pv@[p0 P囌pMp @P @`P e @V`PЍMw s u' u'\w 0H-P0-w w A-MP@P& `P" !ppjP d\ 0!AP@(p(@llЍ2 ^"i!G-00P@`p#Q%QWWP P #Q %QP h`Q `p`@#Q%QTTP P #Q %QP E~`Q @o-o-p@-`PPPX 0@ɋOP`P2lP/l-lpp-cw G-BMPIP2  0(p* `,4(pP`@Pp` QQ sPpP:  Q*{ PWBߍȠ-O-MGPv?@P RPe P PPQQ!|`PldQ@`p`000!00 kQPPU p@ rPU r'pkW VPXP tk@ok@lkЍp-Mw sbYgw pw -w w u' u'yw w 7eH-M`RP% @P! P P``p\T 0!Ŋ7k<Ч@1kЍЍHŧ]Ԏ!RG-@ddbP EHP U `y} kePp@Ppеpw W G-MpPh PdHP\ @`T|P`F-PDpT sP1 pDQP4pA@ @ 0PBXpjW V @ T@ &Ppps@upWp@fnpT:P,@@pЍp--6t bYUv w @-%@P sQ%@@LA-MPP Ѝ@R :UP `PЍApp 0pPȉ@7jT ЍAp-w w p@-M @'P`$jAouЍp0H-MuP@P 'p!PP   P ]*CPg|h P O5PY|,|PiЍ0̠-w'w'@-M@'PJx| 0Ѝ/R@-@"Pp/Q@p@-l@P pp `@P!$ %$oB@hu-H-|@Pp pP`!% &%@P@3hu-Q/-O-M(0p,`PP @X Pڨ@QfJ Qd Pb [YWpW`PJP` ! %P ! 9IPDP& P`To % &PP  [xP H@P`P Z T1 J/ P* <)@Q P S!  xGJ(! P g6 P 5XЍO<@Pe$b @_-p----w -D-@-o--G-T$ P`Q ,Q p P @q p PY Pp Z@m`pPX WR@ZT W  LP 8PG----p---G-M`xPP P!  p@!' $'P j !0" 0@ЍV @P P  P@pH 0p@M@ !0" 0ЍP G1 G8hu-p--A-MP`$p@p  0@%ЍV ЍP A Aꄠ-HQ/8p/(Pq /@/---p-P/@-@ R P R0 S   PQ 0 0C0R$  B }g@zgo-x'-P R/x'P R/x', P0SQP/x'/-H-pP`@T P @T%0@UPw 0"@ 0$00P00 0@    Qx'-P//H- P PH- P P// // / /O- M#堳@() P d \TP ?  P p~p P Zp VQ q Z  @PE 0N@PP ` UK[ @TPT p*p| @x D DooP T Tt P P0P@ ^M@TQxQX @XPDP P@: 5 PZ@0 PpP 0  P00 'P *PU   P P p ЍO  Ѝ--hu--x--ؠ---O-MSs@`t P  0Y R `@Y`PP mlP U U  P P spq [mtp PCP?P P\ `@@ `@P p `8pK Fp` Z  P0 4P W$eQ P LTT" H8" T7! ! iP  P@j Us `  T`D  p0 Z P P  SPPP @ PZp@Z 0Gp`  `PPPPpS   h A Ѝ@Ё----Ƞ--pu-t-t-t-t-t-t-t-t--Q/H-PH/ᤁ-0H-@P P4P @P@0褁--G-hR@P P` Q `t` V P rPB Q7 P)a!@ R \PB A rP>aP !QL@HP<U!$@ 0EPP.P+ P P 0 0/S| |0` 0`A@QU ́-؁--pu-ȁ------p----O- MPlpP \@E RPu0S9EpPeU P$P `_W/ `_p`p+P P h`_W `pH000S0P P `_P` W!P#*#3S p0Q@0DRQ B1Q0BR @@dPW;R p< `#A@K@D  PD,030#0ßPE0PP PPpU9PB  P/PEUʖt_pP``wjP P PP w 0  P8P  pPp ЍP r`Pq@ (唁唡@A!Q0p@@ @@TP9 @  |PP-̐    P0SR   R0 @ v` PP A p``---ā-pu---Ё-Hx'---Lx't-p-t-t-t-A!Ƞ-u'A-TPP D`@p 0dPpW@--@-(@Pȁ--K-APPP PU KP@+ˀPtmWP d\`!`q0` 0@`C`GB`@DtAQ P UP R P 0RX 0 pp pp000P pp p`pPPpȁ--́-؁---Ƞ-----x p--t-t- @/ᬁ--l R h R P @ P  0 00 0 ~ /́---- /ἁ-́-G- p`r( (P$p! `p圠@P@UP@P@t T`pYXP`Ppx---O-MP Pp` =PP7@@ P! ԰`v* TpP 0@Q: 0QQ0B* @B@D`` Pi`pUZЍ`p--x-O- Mp@POp!̠` 3娰`A p0 `0` ``VP `  P@PP Ѝ踁-u't-p-t-t-t-H-`pVP_ @P@ZPPVv@@PMPH aP@@PqPuPP p0 @@ @@nP P xPQP_dd hp`0 @@ @@@pu---t-t-t-t-t-t-t-t-O- M@0`4p P!0PT  0s  R`@@ㄲP"xxb PpQl iP P@oP P@  5P `!q1 `p` `0` `V*X `P`<q@QIQV 0 `0CS`@  ЍY P P @ @g QPAā--Ƞ-----t-p-t-t-t---O-M⸠pPZ@Y`TV V 3\PT .\\ H  \\PP`@Ѝ---H-l cR:TH0P Dc 0>:0   ----K-`V @@TP@@ PЀ)P( PU `V@<P`V pp q`` VP P` 0 p  pPpT P P U V RtP0A `pVp0 `0 R A 0---O-MPP@%$UxbP hb pRpPp` !Ѐ| `!WU0Rp0^02PfРЀZ  ap  0D*!K UZ  0) U  XR : P1ЀР U `p  0*! X! U   0 @ P@8  Ѝ輠--(-,-x--x @-P@PJdP P (P ,-(-y O-MPPpp@Q ` 0pRp!# " phP4 pS"p# pKp R0UPpFNPЀpU 1`  0Gp + ! XU ЀpXx`  0p + ! X  0H Ѝ-x-O-Mz @P`Dpot[J Q@e `p!&o T@P` p P`& p'0pЍp-O- M`-P`k< : 8 mipdp_LP% PP! P sP @  @  0Ay Y@TP@/mY'@$2Y LP Q4@< ЍO !7]Ԏ!Z.y -G-MPf`p  p ! @p@ .U T  ! @ 0 0ЍK-pP`P  @mוP8 @$ ~|z)A wp p  Y `Pp pPwP w P  ppypw W p pPwPw P  pypὖ @+Pao PH?y  !-V  0 #@ p /0-H-o@--P$P 'PNN5.P ^P@  P !@ a @R:A @R' @Ap\ @ D04@ 0  C0$@F0-(-o-x p-y vy p@-MaP@U:A@Q'P@ @ 881f0fЍp Ѝp@!y 0-o-0H-M @s p + ++Ѝ00-o-p@-}P xx N>P4d 0sX0`$d0d4`pQ Pp p@p0-o-Ԡ-0H-V@P 0 R P@0o-]y H-(A0$RŃŃ0-@-M@Q Ѝ@P P P@|PJdp XT ЍD8 Ѝ@Tp-y r'p-y y y y  00o-@- MP P PF.P'<1   R% ! r+ @^P DP0@0S   @ Q PJxpPP@)<8) Ѝ 00Px'Nz Tz Ԡ-,z RK"z z p-C0P/A$P@)/Px'p-CԠ-@- MP P PF.P'<1   R% ! r+ @^mP DP0@0S   @ 6Q PJxpPP@)<8 Ѝ 00Tx'Nz z -z HOz zz p-C0P/A$P@)/Tx'p-C-@-MP @P  @Ѝu p@-P Pp|P pp@qB@eP p@KPp `? p@-p-z Ԡ-@-H-MP P P< $ >ЍP'{ H-P, BP H:D--i!0H-M@P P P,PlP=P MP hPP|  mP wP sP@ XP@@P0@P(P@&V^Ѝ0萠-,-Z'''P/Ġ-P/R @Q*P/H-`X PPNLLHJDH@F<D8B4@0>io-{ \'^ { "{ 8{ `{ { { | K-MP P* PZtQ@' 00B S00 C R0A :! Q@,PTT:0 @@1Đ@ 0 S `Pp,W:ఀ!\pWL :8 8 \, @QߍHx'( -b 8 Lx'8| ZH-MP P P*P  R Q ЍH1xx l0 0  00 $D< (( 0 Ѝl| u' u'H| @Q*P/p-v|  P/p-Р-@-@ %\H-} O-MP PP Q Q 2/`V ؃P FQP  4           z`P@ T  P`aEPPpp3PP P =PV PPPP > [aFPpp3`@V @P3$ 8 ̪ ` ̪ ̪ ̪ o  PPWPt   P Pg P 0 PR  @R 2/T hT`VaB V nV8z`Pn`z$+ R[ 0\P' @+P |-Q@ @@\+QP`P`+QV' !\ \Ѝ @PD< ` @P-T--D-H-} o-| | | H-M0S8< 0*ЍHs *sЍT-} } A-M`P) @p>$PQ$ pP \Q`P \$Q T ,`P `Q,  ``Ѝ-} A-MP @pP`@W @  ЍAfW  hh ZQQW W!  x@PNخ  X W4 W/ W>oQ4W) W W. Q QV$WV W W  |QAP,  o  P PV R X2/@PX u U@Q *p|P X ,Ѝ XT-D} (} } _} } -} P/So/Q  /) P/P-H-M  ЍP-T-} H-MP@p -Q `0F PT 00pC0@` W:T  -Q`W  plЍ} p@-MP@`00C PT* - 00@0 0`C V:0BS:0 P BR@a R `0bV03  RTV  `)Ѝpgfff}  RQ/ᜠ--@-lCPP\TQ @P T 2/$@P~ -Xx'@ 0S/ S  C Q $0/Xx'O-MdQ0SA ` pW* QP@A@Qa@"Q#:-P X T T FDo᠂P p  p$PZ  RQ   Q P   ЍXx'O-M`@PFP    Ѝp夠嘀 Qt0P  R pʻP #PP  - -hu--H- -H-M (WH-M@^P`` 0pPpЍ0H--@Pި Aڨ  A (  0 Q0Y@?@-l@SB?qNJ4$T J A !   0 QШ.A?QH-M |pP `@PV0%n`@PЍx---H-H`HPQ <4@ pP P@p '-o--0H-@XQ A@P@P:$ @0- '--@-P @PA-M` O!P 0! G0  E 0 rp@ :v-PbЍA-M` O!P 0! G0  E 0 rp@ :v-PbЍ@-M`P00`B RBA/A@C0@ 0S@A0p- bЍgfffH-= @Q 0% pHA- a@0P Sp P Pp3@PP A7P 3Px@ @Q 0%p a4T,A - p-o--t-.y t-p--G-M@P%PPdP nP sPP( p``PP P WP `P &P `P  @ Ѝ0H-@Po<,@.Pa 0 -H-|pPx`@PP r @PP $Pvo- p-p--A-M@`PP p 0Ppp `to"]pP 1OHP ڱ`WpU "OЍ踠-o-9 @-@P DZo/O-MLPD@p@ H0 QWhoP  7`KV0o䡂@`F p^ p P p T 0 Pp0RQV A/o"pR@`F T:@P@DPpLP%, Ѝp p p@@0@@/p-$-N-DD p0SC P Q 堎$-p-K-pDD0 Q 1PC010CSPʁ蠋$-p-H- P  Dp-$-O-Mp쀟P4`PQ P 0Р@+`*` 0P `5Nu@@P *+@Ѝp-(-$-0H-\ @0\0H0^00N @@\@ 0^0$-p-0H-HQ 0 @0P0s0: Q00$-p- @- R <0A01$ P r :0Q $-p@-\^ D 0 @ % `$0 ^@P@p$-p- P@PPA@/p-@-|xx@x 0tS۾`׾TӾH Hξ< <ɾ0]k -,-k k l j 'j 'Lk 'O-$M␖吆@ R p` 9R :R ?R \R  %R3 .R Rw  PU @OUcaEQt h | , , , , , , , , , , , ,  PU \@bEQ p @ L 8 8 8 8 8 8 8 8 8  8 8 8 P BEQ&  8 l 8 8 8 8 8 8 8 8 [ !0  CBU DULUK`PG J! ?TUC PzPU96 9 P 2HP)""]y P v t P~|!  pd P,'PP@ $^ P " RkP B0ڻM5B P C I Y9 PAP`!%pWl P0g  aPs@ Qn@PhP, 0 X  r$ P p !P  B?dGlb 0 R : p P2( `P ~ 0 R : p0   p`aPWx  fN0 4S RSC $Ѝ8-8-` o-) lG!p-p--8p--bY0H-@b AR0P;PQ0P iRjR tR mR BR bR0Ԡ- 0>S:SQ\SS/.SQ?S/'p@-ddd`@oPBLL L0LP 0QCA$ p萠--,-t-t-p-'8p-@-,,,,@ 0CA@t-t-p-'H-@@pP<` Q P  )]8-8-p@-@z0P C/o"sT J@`@T @i !0  /o"Rpp@|p-      /@-L-G-@P Q먀TYP P@8`Pp p0@@U(-X-u-p-O- M0q A !P7 P P,@P`p ! &@  V  0!   Rпz@TP ЍO贿 Ѝ ЍOr'r'u--p-H-T aP 8H=P oH\@-I X-0H-@P PZJU    0h-`-0H-D@P PDJU$$   0 '`-h-0H-D@P P-JU$$   08'`-h-0H-@P $Q 0# " 08'G-$@^````V`@P&p)p pPpPpp"P#p' PVP$p`V ЁpP pp"P#P PЀPXP`V ^<P 0Zo r'r'- '-X-@-DP 8@P I@p-@--t-H-X PHa-X-K- MQ`@P s vP+ PRJRP psp,P; -PP6 x P0JhP`P!  "8RPI RPP pAP M !0 ` &^#@TP P  ` d ]``X 0 0! R !0  `V & P`V? !0 ` 0 0 0poP @\PT Ѝ@  q@P @--X-D= I h -Ԡ-p- H-M`PpQ  VPZ6P H@U@ [`PPP`p ^U@PP:pT@p04 ,pP00T00Ѝ踠-t-p-O-`(;P }P+Jи ȸ$ A @ $@ `T R \` @ R``P1E Q*P}K 8*@t"P tڄ@`@@@hU HUIU gUPiU pU,U U;U# p{P #G P=  00@ P3;P1P(-wU  R 0 @ JA PR R Q J `@ ewl Q  ,p} P p $0S PPp @\S p{R @   R e`  @P P@Z  \R R  0S S  @P E PPH`  Pvp{Q @ QY p{Q1 @  p{Q @X N@Q @PP P @0"@S.@`qW PP pl#@ p{<  ,%p3)&ꔮ--'Pr``뼂xxCQU pP 0*=PW`VP Oߍۍ 0 ̏0 PďthPTH0@ `宏d U 㢏T0 囏L㑏|pdXLd x0$H<$ m딮--'-- s d -A -Z6 Џ R - ^ W J % @ $ ' Ȑ r 7 ȋ u ,-0-T-X-O-MPC HP@qP{P tP rP 2aP bP.`V P p0"pS pX PP  <@TЍ(0 $p0 p`똶---W ,-A-MM@0 A R * 'PЍۍ.Q$Q +Q(/Q \Q  `NP P IQPR IAo`AP,,0 $0 㕎-- D p@-@0PP@ R RQ <4 0(P ` p'--f O-M[a [h \[l p[] `\0[S \S SN[[ SDF@P[U-<0@^X^000@]XX5 ]X! [Q.PAU PP0pW" P]UPW0C0 U \U nU 00p]Q pRp00ЍDD0 D((0 0 --Ҏ O-M`Pp @\ Z \Q Q: . AR [Y. P[R[) \0S$ Y" IP ]Q [QY[[Y][Y   P R  P R[   pR`  IPX R5Ѝ,, @PE 0r---+ T-H-M@`PpmPn@ P2````` aP dP fP       P pЍK-@Pp`?V?PV @p`?P VPD`P00@?6SC   ?Q7@?QW@Q?0|/O- M`P-sLH@@sXL4X SHPa@Q%TD EP GPX IPvHP\!X@L  "@ P 0қP ? 0śP \? @\!@~p%<0APU  @PPU p00 0p.`@p pP PUlaPTWD` - 'Ǒ - .--`'--0'd'-9-H-jr 0ZW'h O-M袟rಟ`P P P5 %Pg!&Pr PQ QxYP X H P" 0?#n>P:.AoRy\`nX>PsPQn\,0n(>PV;P ?0  O=mP PPQKQPPEPPAP l>0  OH=Hm<PP, PfP( Pg >P0PP P O 0 (-0---P-DP  R {RP 0pꐮ-8-` p@-P! P@`{P wP sPp P` p P`@Tp  ؂ZO-Mءԑ` @P 0p&W \W1p2 `/W-0G`2p#  pp'  p@ Q :H2  =W `p0\W&W``\pQ :#lppQ :Ѝ`-'X-K-Phy*Y`PK||!|@0p@Sp` @P`DP" P@p@@: AR 0=<<<<<< 3!Q , p0:OP! PBQpPP Tp  X P K/ --k r V}p@-@PU, `P TP PU Pd>>(>8>H>=X>PP PPP@p-(.A-M @PJP `+ Pup0㕁RۍA ዁Z L 0Q0p0Qp \ 0 /=P'@-,AP \0^R S0QQ 0QQP|P P# Dp?   @A- @-00\ 0S 0^ @T P PP Q QP RR  P \ 0S?o\@.-@-|t  0  L@Q  @ TQ Q  -@.K-8Q <P  Q0AQѸ0ڰ = pO!< Q P嬁q@`\P P  b @T( Q0AQѸ0ڰ  6OP  (P  ,P  4PP Q X@P @PѸ ڰ  OKZ@.' ?-ي-H-M@P @P ^e@P /PCPPsP@-@?PP+@ p`pPQ Q  @p ЍPn!n" O-M젟@`/pԐTPP`T   N 0R} P  PPQP@T Ѝ  _K'ؓ -O-MP pt ğ L?p/P  @:PpW% xxğxQ `p-QW-Q0eCQ Q  `eS kS iS` ``Wc೟@p  FPPa@Q%HJJ(I8IJJJdIJIJIXHJIJII@DPEP IPH-P<@QP5 SP <p^WP p?Pp^ZP ?P^YP ?P<{ pEQ`T"AQ聟 (  9QPPQ ! $j-P  oP, GP 㞌P  LP  L H D P JP Pᖳ@ڴP00 LJ--(.'Y"-l'v'q' .2 + # 0'@.--ht@gt'< R X ] ]1 g ^" H-d oLI' p@-@0PPUp00 `VLP UP UU@ %t0p@>LUT D p@4L,  0p@x-- Ͻ!' @. ݔ ʔ O-TMPRPbpP  EuPP}p GP gPwPPUl@X $%P p^ Z u@pY P@ dQP`@NP Q WA ap ajp p }}W "pZ pX pc}P B @P@0|d R}ᇛ H,B} =}5 .0'w !< Ty!c m Z]t ) H-c uKH' @-M@"P   p Ѝ }뉕 0H-M@P 㓱P P Ѝ0 "Pp H-P@P Q `1CP v<P`P CP rQ ^<`V@-@P &y P 孫  wH-aq1S  @ P PU  @S*QQ0Drr0S  0qq R q0C'@-K@L@p@- `!R 0@T 0RpQt@tQ  tt 0Rp Bp'H-H@-M@L@H- 0C㵤G' 0H-@Q0fvP0 롿P ȿ M~?PϤ ̤ %vl@@'XP L  B<*r000-.-- --'O-,M@PQT(J< P$0 AT ! PP !rQ 0p 0R l帼㰠$ՑP , R P 2/0 R  2/Pp pR  P0( 0p0P 0$ PPP `P  㭣P` @`Y 㢣pPᔰP Y pPP auPe P P0S 0 0 @sR Q1D@_ @r  1 `Vʰa@ r R @P\pdjxPSP P'P :XPU PPN(0 ,sQ  Q0@@0R A (0wP7 t_P M}' (0 _ 嫬 Q 審$ @p|PƇPPvQ/P!AQ2SP RPF@Q \T[`T[]T[[T[\T[T[T[T[T[[=P P. <Pg>P) ?Pt ; [\\[a 2pPF R1Q U 0!0CQpaC_ `SVpP|fQ.P !?0S[\][\(]"P0A@0 B0!ARP !@ B/!ov2$pW eâP¢ 0㑧P P۫(P[epPU$ pP X PQ X8vH5  0 O҆ PPpP<P! >P& dP$ &QPAQ:P wPuP qP#RP SP U PQ  xP EPPAqP(Pߓ1᝘u cpp|r0S! B   Dcp| xPQ zPaPxP@a@(P(@P  t bmQu P ܨU4Rpf 9 R  2/p[ P!PU   M [u `P   `嬨`aA7 Cu P ʧ嘨P &Q P`P & P`qV4 R  2/ PPP ߗ P,Ѝ֎ 0 ̎ (0  D 1`P p FDDU --D--.''. '  O-M@QtpR'P- `ᝠP@Ug 0ᄚUP` p` ㆠP@U 0nUQ  1`p@VpG s\ 0RA0PUp`FU``vPUڶav0|Pv00C?s`P10YsPUY `  0`PE !VPrU V!   P ( 0q- `PqUP T0  6t!A ڿЍOF /-Q/A R / --O-MPp*@0 T` #P3 `  J늠`P   @<#P 0H 000R0,0(80(00@0404<<1D0 Pp 岑$0, 8@Ѝ --@ @-PJ@Q 4A P v< --Q/Q//0H-@LLP@U U,U02.%./bf H-Q0 cHw=ꆨ @- Q0@Tixiiiiiii4jiP` A2,+ ( % B# +| P d ,P P0SP  C @ +.:.&.ftp<,.9.\.H-M  f=Ѝ.tgzQ/ jjjjjH A8 (   B<,.9.\.<.,.g Q/  p. P@( / PIUEx EP `X@\pP` { {EPPЍ!iE--D-8i(-D!0H-BM>PP .PQ9P @0 P  Bߍ0F-G-H-@pP` ,ΉP EPQ.P@(P 4@P0\ { H{F-G--Ty!P/` K-!MP<|'PPC 1@ ``C: 0`;@`0p /P P/Q/pI/P |0@ P\1L0P`@ $!ލp!$!$!` $!G-PB@U% 堀嘠`pW Y /W P EQ 0$@  rP p`T:'#'!H-MCQ DD5<8 4 0/S 0s$Ѝ8,.:.$.2C! v-.p@-M@P3  @ Q ||| E 5pPt@0h` /QA$50</Q PP7$Ѝp@-&.8,.:.8+.2C!|".@-@ @2&.p@-MvP Q 㡈 㝈 @P dd d0#PXX@L40  #<<0 #@ލp\.nfs$!,.<.8+.`,.$!|".9.H-BMP P RxPhhdP X5TrP H5D"D2 @#4G6@P$ 25 0 bP !5 0P !1`  l?!1xhuxx 6P, P4d jXafLc`8aP ,$!X  TP  L H[NCMP`P [HXT ENBߍ@-D-0y!$!-2.Z#!-H(!$!D-%!-/%!#!!%!E--9%!%!%!H%!HS%!'!E'!G-`'!x'!CF-m%!z%!H-%!%!H-pP@ p `[8 p劇 @᤿D-G-BM@`PP hp; P LLL X    0@PBߍpp!*'!` <,..'!8. PP  P|/ ,P  ,PX/PQ !PDD/Q QcX U5pZ" H-M, 0 0 QЍH-MP@ 0 pppxp% :P! ` 0 pppwp dP Pp4/P PpЍ, A!p@-@D `PPPц xUPp)!H0H-@PP Q P P PoP P0$  H- 'O-M`V! @Pډp ሆP P PP `VЍH- 'K-Mpp$ag0< P2FP H@L! 0 p4/P pP 1/$qp 8 @1/pЍ)!O-lMP P< 8p@ L03/P' H$  0` 6/P  0 3/o Q 8 <01/P   pW:lЍO-QMMz@L@嵌㲌lXl/ @PDH`pSnl0t@V@|@P#^4@4@LTN/ W䇟g0^ N/*P  3P P0 }PTX\ ᕅ "␅8  ㌅ @0!pK`048q00[,aH!L1`A [@[R$()!( H!L!,!0!4!8!(d` V< hVaXfPYb(b4@$ $(!0P,qP,q048!HLQP0 5P`V'#EG pP@pPk?he$;$BP^?@P H!L1  W!@$+p$%B :0n<8<<P P4l8 kP Y PP $1/$@Q() Z}P $}PK? @$܃LPLPX @$48!LHATY0H Y `#0?0@'-  03 @@pW > TP 4|)Q l! @02 [#P0 @P+P@pPT:  ($ ,T*d0`48 xP 0 ;`5/P WLL L04 L-!w*!y[-!m-! l2!H -!-!-!tm۶-!.!.!.2.vD!*!ٽZ0u0s0H-P0 @^P0. 0H,2!` @-@  p8@-0H-M Q 8 P Qp  0@xP@ 0 0;5/P @ P㷶PPЍ0-0H-$@P  P㨶P0-O-MP 㜶PV@.PI  ᏶PDJ@ /TA q`BI P R  NP  NP   P @DPPP  VpH  @T Ѝ'y@-M@ %Q Q P 0 oЍ0H-*JTR0G-MM@08T<4,[ Q P0 `$P P0A`T4`0 P{ ,Pg ,T8Tr 00<Ÿ`A@T   0pc8 R^ P4Ql @0R 0pW PpRaPVW:( R1/4@TP* \O@pp@P@TBP0< `Y xP K? 8P 0P4PP 0`4``N@TV  } P4Q @0( R1/4@T:0 ߍڍ`_(+.d!'H-  !//O-tM@R,0 0 @, q P$ `P 0QUQPU Q003P  L03/P P `V:0Z  `Po Pj (0$`P4 ($`,q P( P 0QUQPU Q003P@ L03/P P  X:0`V( < 0`H m  0```sp <`8`$`4P4`/8P  P 8 <0p!0$` PtЍ..O-MpP PE `  Q7 pp @p  L0 3/P! ppt`0 ~P 0~! #dP P m `}mpY: w `Ѝ%..!0H-@P P 0H0p@-P @`Q0  p@AA-@ P" Q ` 熁(0S `V:0S P0QqPWS:1/A&K-0MPP @ `p L0 3/ p 0P@`W:@`0Ѝ8/G-MMPx` ;p@p p6/P  ;x` @p p6/P ( 0oBЍۍ9.!G-vM`L@HpP DP PN㟁 z%  Q Qm uP! aZ'Pbp$`Q a$qU(1,!04# @` WP P%`0@겁PC P?Q; @?P7 P 2 割p^ `p$P  `$@0MPU?@\& P5 &P2@4P- (P) b/P$ K?t # np4qs} G0PPA@# 0`@Yt\ bo݀H  Q唑qP P1 JJPȀ@p TĀKXq D0 H @  `P\`TOP P K?tb # `4\"pru{AP1 p/67NPEQ* FPXQ&g !0&p A0y 0sK?a # ^`3! p; ,70@` pP(Q0030SP'Q 0W'pQp0p 0WP07@&P: Q@ RQK? #p ^p3 ` 0PPPNvߍ )!''ffs].!*}DIVh.!{"` 'r.!-QQ`.!.!H-S P`V VVPU  0B `SV VV U E0\0@P`pw` V :w\VQ Q `&c``a0````0``Q `0RO-dMMpQ:P P dЍۍ _}`P Y}P  _[yV7 +j|/+j(P \R R 0S   @PU2 $P  R 2/phQUc+lj+/cjP{`@PaUj:7aPf+Rj$$P  R 2/p pP0 _R9rP[|P K? U4P ` R 2/p1/4rN_[p$aV| /x;@@ P( ,0"# 4\0P $^qTP@P R(( 0@@rX  Qo P T6 #Wߍ@4!%.0!3.آ'-..`,.62!0!8,.0!$.0!1!T1!1!1!i!1!1!1!1!$2!0!0!H-M Ѝ M0H-MtP@diP PTD  5 Ѝ0H Ѝ/i2!H3!#!p@-PU |@ `P YP  PUQppp0'Z0H-MhBP oP@ PJ< /Ze܍02!0-2!2!3.H-MA n:rh`f#XqXQX!0] @ KS0g<@   H0 0   0 ` @ P`05P!JP@x@f0 *@( )P n ަi@fߍ2!/-0-3.4-8-8!`S|S2!'3!2!A-M`0BO P @ n dP`00U0($ @ލ4-3.) H-c<H$@O-M☒@T@tP`TP Hr@TP@'@T q` wqPU W!00 Va vPX @epeTK .PH  n op@ PPP UP: " tP/ 0 ! t  P  Pp   _pPD"lpvPo4pL0   `ЍD-Ԫ'H-@-/-0-q@ri!qr@-M@P    P  Ѝ%.MH-M  0 ЍHЍ/O-MM@  JPJ BPyJp` :pq8Epuڈ< Po -Ep{P3Py p xP`P x`p 6mP `=P  ` YP 33V$ iP * @P!HP  UPP O-PKPb ` P P `-  s5TjPЍڍ \3 Y3i2!Z73!O3!.$.H-M Ѝ M0H-MtP@dP PD  *3 Ѝ0H Ѝ/g3!Hx3!#!;i2!3!@-8@P ( P @P@3!3!3!O- MMtgP/ P/ =P! PĠ p`@+ml P* +L^ T  +F^ T㰥P P 9 㢥o᠂ Ѝۍ -G{i!@-@o R@ =od/!@-4@pP  Qk #.9.\.0H-PPP#@Q@U }P ut \@<PP<jZgZ$@zTPwTi0Hi.$.0H-M@P @si$  03 Ѝ03!'4!@-M@  Ѝp@-PX@*Q `Q ?pP `*Q@T@pآ'K- M@$aP pP` pp pVQQP:$aP ЍMH-M$ 00 0ЍHЍ/ሖA-pP`P @V !k P P8/=A:MH-M$ 00 0ЍHЍ/H-P| p pd dX XL L@ @48-4!3.4!7.4!3. 7."3.i7.0H-@8Pq@ 00H-@8Pq@ 0HO-DM @`P pP L03/` PU:pP K ` PVF pK L03/P2 剁i(PQ "0P  j PPP$P 04@P@8p,PU000, U X040T \ [2Y1:PDЍO-M8@Nqp@W[ Ѝ4 0pS RP pP P`4Pi p j U*p`pP/A-HM@Q9 0<S8D@ @8 3/P P P`p L03/P `V:  <0@D8 8<P@ D01/HЍ0H-@Pp R 0H@-@ (@A-@PA pag0 hPUpwpW * 0 SpPW:P pag4PU Q 1/pW * 0 SpPpW:AK-MD 㫡p8 P`p.@ ? @ }6 w0 0d@(ᖡT @ ZiPЍPP DP @T갑*}DIV4!` 4!O-MwPB ! c0 PU p`Kk iPa@PP! @PU! @p t p@埢PP P ᕢ@T  ߍ0P r@ Q R@T: Q2`!~Pa0 0 pߠ0p  eslQ+`?p  9PP k YӠ 0T a0$(^O u N q Qp @᩠X0 l P0g 0tQ z*5!vD!d@edA=!@-55!P0@ S 0  0Q00A B r   " /-H-7M(@P`*o 0 hh0 0000000` PP `嗾@Y7ލ- ?D0+S ,SQ/A   -D0+S ,SQ/A  -G-Mpj W`@`P``儡D ki W@#WO  c W"&@Q(:Pa P)PP P PP ŸP lT2 \H"H2kPQ@Lbo g  `:(㷹 PPg !PPQP[ !PP0`oRIdPf  4'ヹPP3 P, PP& UP 0 ! 0PP 0` pPUPލP 5!5!5!5!6!3.5!d,.%.Q!2C!A6!@-E <.,.'6!8!8!'*'!ftp` 6!H-MP" @pbP{kP aP `xP| 0B`Rh C ELP/@T KOhdЍ4-8-0- !/-'@-,000$0 @@!10-/-L-P-@-H0 @<0 cf((!10 0-/-P-L-kH-MM`p ;@@*p  Pp ៞@m`ᙞm`ЍۍA-錀@P@@@ @ `P p P tP  P7@|d zd@H-MM@ ;`P`*p p 0V@P`tEm`@Ѝۍ edAO-AM@ PPAߍ`P L03/P  P@U: АԠ,( X*$  L03/P  X: аp  [ ,[( YY @ 0 h`,( 0h@P $g ‐0 P`!0@  hp  0h@PT `H@ p0@Pp 0n%.#.H7!O-SMPP@(Glp1hXP@T嘰fJ `Vc:T 40@ YVp@$pPi (Ɵ0p8`(P<@@YP @ RRpP8  ,NARX=|ş 0<@H1/ pP0dp0@ ppp3/ P@0p, 80 3/|PPP@%!$Q l$ Q P<4  8L0 d3/P@P] P p We 0 7  ßP0 00F 0PP׶ \@p8 <`PU 8Qn4P@ PP0 3/q8r L0 3/, p@D0@ 0| x@T0 XpH, \ P\<@T!a8 RK B!a"pQ(PT!B"QA@x8pQ9 p7d 0@ 3/P2 T `Q4P- 0 pW2  0S$ d@0p 7/P ,PA P p d@ (pSߍ@ `P <  `Q d!PQ9 P P<P-  ,P  J0`03/P ,P Pa0  Q Q Q HPPpZpQJpQ  q" 0  QЍȀ}lG-`MFPpWy dPz dP{ `dP_DdPŦ $dPGdPHdPIdPJ~dP} udP~ ltdP cTvdP$ R p`(Qfd p`P$ V:pp0  Y4Qq$ Q $Q$QzY $H48PQ Q`$ Q\ T$Qj L$Q D$Q <$Q 4$Q P 0 'HL 'HL &HL &HL &HL &HL  &HL@ p&HLR X`ЍG&PB 0 0c2)( @P 3"Q 2 `ЍG&HP"@PP!h@0 c2D@0 yc1(b 0Pb# H!@PP} 0&`ЍH \ @H x` 0 Hd0S< !  [ (P 0<P^& @Q*  P`pdp``I 7/(60  -Pp 0\@P 8H 0\ H.L.P.T.X.l.\.`.d.h.p.t.x.l}w7!` %.#.7!}7!Ȁ 7!7!7!7!7!7!7!7!7!l"7!O-4MPp gPA P6 `  L03/PPP` V:#0P,p!0# "   % ^ ( ^ 0S PppfR,Gp `8`e 4Ѝ 4ЍOZ,+.A-@P> P\1/0 ` 1`0F?o2SP) p akP+ 1 `aP! pbH"PKk h P 1  C0"K@AhꔔO-$M@\1/Pp`Q `V` YP( pW H3 0P  (0Y0 01k0<0  08 1V0 010<0  B 0o ŸPCP\P Epp`rPC" ppJ0`PŸP\(P0ppp,g< 0 @Ѱ0Pd (`pPV pPP Yp`Vp 8I  cPpuY  PW`PW:uʞ`lp0 pP 9P {pP R 2/pW,0t0Pp(%p(p p(,(Wp,$Ѝ(( (0jvX-$hs6!6!6!-xi!K-@Pap *`P6 pp Q h`"pJhpd P bI"pJ`  p(p崁'Ud`vA-M@P `03/P ! 0P ` 2/ލO-EM@$$B3PP~ B@@Lg`pIPq WT.E @ P2P @ P*0 簀GCp0@P\ @ pPT00@D00 $0 PX 00Pp PñWn/"SȀ SssssA ⸴  o  0 屳s 'P J 8PP gP Lp,TH1/PD `'@@LL X4P0PPl hp@PHD<8a L0 3/ 0`6/PN H  `R L X6/P; X\ 0l h0 3/p-  L03/DPh k Hh 4pl0 0p0<80`  0T@4P_VD@hpL<8 PU:@PD`Pd Tp!@ a@(@!PU  AL " 0IiPB U Efa"$I 7!.7!O-M@QR p  `0PU,(PbQLQCQ GQ (lQ cQ gQ$1MQ SQ mQ sQ#    0CZPQ +Q 0Q PPP ЍO-M` PX  |$T  P  L  1/1A$ V`0`&P p0 7 ( *H YP` 0YX P0P 4 T L0@P 0 H 0R  0Y0%pX `8X0 $SPP AHP$QZT`P  Q`P @PL 8@<:%P%q0`p\dO㾸\ 2 P P㵸\ )ppQ㭸\ !`W t` 0` 0=VTR8p@ P@,  (  @P` 㘠D PL#HVP0 D F0" 3P ZP P! PaP:<qPh L0a@ 3/XT P@P5 h l@㜀@ (p ` 1/ 0y@ 嘠圀T X*@ @㜀嘠@ yXT P@Q  O 1/`*@P!!0!P  XU FPO 0$X@UP4`0 V0p0T000Q,p(0P@WT^@8pPV9 `@P&Z U T RЍ%.---#7!7!#.>7!A7!O-,M@%PT  (@y\ s n4`P, VV V`%U:V   P  P K$U   00 M% 0ppq(PJ`1ḫ,Ѝ 0Rxؚ s6![7!l7!@-@,PQ 0 4  a808  qAQ l0 0 80480 3/P,41/,H048 TX , 4 R80Q0Q(1R Q// @-@|0S4 c$S 40,8 0P0803/P,41/,H048 TX ,pQ:0QQ QS: S  Q R 004 H-4!\ \ 8 Q Q80$SrQ80SS S0Q:\ S\ O-UM`pR, W (1 3R$1A2R"1A2R!1/A2A@ (ZPW P0@ 0o @尠V@Pp*,  (0@ @LPJ(P ᓪ@Uߍ  0 0R RH <\H @`/O-LMMHQ h!0Q *1S$QLU )P ILЍۍpW P!T17/@P@@ P& PHLp L03/P ,P0PP  ;x`  6/P pW:HL2...p@-8M@`040 0PPPADPJWPTJJ4 0 0*DP UP@PoQRQP8Ѝp0H-P H@WPP 4WP $WoRP0i!l!8!H-H P` .@-M0P /P P@/P@ 4,@0 P /P YЍ.8!2C!p@-@`PPPp@.` @-@ ( (P @Y` .I9!K-M@qPPᤋ@pY@ؐP  oJ`P  eJTYЍPpp㷴 +@LL P 0 bF` .4.Z9!%.d9!'0H-@P, ,Pa0 0H` .8!@-@P@H-M@Pt`tpPCP BR}P`7@ 7R 0ǿ܍` .8!G-MP`cp@P` RUPp RapX  0㗿܍` .8!0H-@P5 P0HX` .A-M`p'UPP @ oR` P`0X0 0fP P P$P@Ѝ` 8!..0H-T@P P 0800P0  P@P0P0.8!` .K-鰀@T& p`VP P@T `VPPP0PPL  0PTP[ .` 9!.H-P`@P 4 Dp` [Q WQ`H..A-MM@ ;PJ`P X 9Q ɊTЍۍ{dЀG-騀Pp@T 删P`YP   0᫾@THP@T ..` 9!..p@-@P`3, ,P0 p@` .Z0H-@P@ @P@$ P <o0` .9!   H- oH- oH- o P/.H-MP ` 0pppA @ 0ppADHP0BPkЍd k9!x9!.H-HH-Ma@(P<)P9$p 9P6 P1 $1/$P  0@ P P@H!L1 @ 01/P !PRP$HQ@PRP @ RQЍ@2.$@-Q @T R Q p0S@@P@3 @@P@3 p:/H-M(P@U )`%  0o1/P L@Ѝ/H-hMP; a!1P@pPPP  P P P 0PPp 0 0@dpP d 5pPhЍ ġP8,.i!9!9!9!.9!9!9!.9!9!/H- H :!%!///p@-`Q  0@RPU @T00Q0SR p 㹱p@x0H-0M@l    ,($RP P@S  PZ 0Ѝ0.//H-R p`@PTPQ SP `Vp@8$ PR PSXP9!.0H-PR00@R@Q" % %!$#0%.#.H-@@P`lSP $( pN H.H- P [@-0H-@P03.0H-P@( CP0):!0H-P@!P (/2 ,P. 0:!O-GM  TUοP @젟P`쀟p妠P# P   Pp |P h G 56  Gߍ\.:!8.[.:!:!:!:!;!K-M6P`p\- `P @P SP@T 5P\`PЍk 8;!G-!M`P@30q<!P㬁M?Q0bP/ p P d |P)Q` MP=P%  P S ^PP2  0E+@TB0[ B>P @0 'X@P L iE4 7!ލi2!:O V;!4.r;!Zk;!d;!8!H-P@8dpd0P3 T`,`M/P  < ;E,, X4.;!;!;!;!;!0H-M @)T]  0P ^ TP@Py@ T8 @0ֺ$ Һ܍0\,., ;:!b:!:!H-H-㐯 H辺:!O-[Mh@PSU mP b(PY Y Y$GGP d"P ;P0 H"1P0 PM3 )`!0X (`P0 +(`PpW2#73 La!0߹8Y```!p`P P P pppp @`@J@ Pb6JE F0 0 & 0'h 0ppPP(@Პ9[ߍ4/ 㤮PJPS%.ت'5!O-TM@p$<0 4 `e8 @ `Pg $p@pD` 0 R ,@XXiH L08 @R @@@pT \  0@RP WPWtrQ` P P(P8  @x,Ġ⺛Y# <0` Q BTPPQQS S S p 8S:pQpp2T2 0`Y8P P  *WY  ǫT$@`TP u 㾫Kr/ @(L(HTL W0 H  @DL 8P @ R<^( (Q $mM  @ 0QP  v UI 4p s(p R0Q0  TЍ:.G-A\[@U$ `p R2SRRW W W 0 EW:0R00?S? p`U`\ p"( (Q $L`X u  QPv H   PPP:.0H-@PO  P0O- M0p4`pppQp@ ppapb@Q w1 Q, w* @TPPPUPPPXPPPUP PP@(P  @   TPD" P%@0@P00@0 pGY ЍH-@+R 2  `PpWpW V ` SPT | RPT ^z  p`" G PX>!O-DMM@XP \P `P dP hP 0PH H0P 8pWQ r 80`PPPQ PV`:pWp HSp9 0:W` pQp S0pPP瀁 D` GP^ `D = 9\`0d 20h 0+X ' P( Q圱圡!0ap  p PP p0 @X  X:  0D@0PހoRDЍۍ 0 0 0bǬll p0XX X0㼬Q!' T?!f?!u?!?!?!?!X ?!?!?!#!?! @!=!>!:?!?!?!>!>!O-$MMPP @$ ;ppv p p0 `ὀpTHL$pQPPPLUXPHh$PpPPp p PF v P P  P'q P  % 0P P  F Q  0P0P pZ:~ PMP$ Q:P a0rD`V `VpWs0CQ~p$ЍۍpedA@!O-PPH *PC `P dd@ PPpJ0 P PeJ   00\0GXP P$ElHP(H  <Ѝp /h/p@-MPXP \P `P dP hP" @ Q &0)Ѝp\\ l0ghHH T0hc44 <0i^ $0jY 0kT=!)@!:?!?!?!>!>!H-R0H #EH-H H-P`/]@P# p@H EPaP:a@P*Q P @ R @ R@P@@-P @@ 0=!?@!N@!@- @/@~Z@!0H-@P>T TH(((((@P@TT T  T T@ P"T0.G-MQ@`P "T*Q7萟耟Q (P (0S,  R4PPV& XP" `4p %0K l 0@m ` `QD @ @0(@`EЍ.:.9.l"=!0H-tP@PtD  Q "PDQ , (0D S Q4 p0.:.9.O-$M H L rX0`0P\pS YQPpST@0Q^ 0  0G Pp  0GYp [Pp   ^ T  Y P `  PRT r 2H`VPU BZG`@d0P`@@& @ @S@@Y@@Y@ 0VP`Y```@S@@@` PZp^TT@ p 0 `gGPTp ^P  pY8 P  P   p  p^TT` @0 Pp3GPTp ^Pp Y\q:p $Ѝp@-d`@PP`0rRv+Piv@ 00  S@ p:.O-M 0QA q` P . DP@UP U Z 娰 @ 0`;/PwKoo @P  @0` p1/Ѝ :.p G-@P# Q 80 Q3/P41/P D0/P@41/@K-"㖹묀@p Q` 0/P``pWV X`|LP  TR!HA  qK, :. :.p@-P@Q DP`! R 2/`V: p@:. :.H- MAp>0 @P UUT 0@U@@P` VVU@V 0PPDR0 @0$`P0 Ѝj@!8!O-|M1/H1/4l0P1T!sP 0Y[, (0H4p0`0 (8 , `3/pPoHP kI80pHL4T0P!0 0P X01/\ 0p3/pR H L03/PJ QE H L0pp1/>H@$ $p4 80 ( ,7/P\ 8<RHLdh 803/\  p0 @3/p 0[zpp|Ѝ2.O-M@P )`Qc(P`TP%5tPUR Qn ,0<ᔅ 0 0RpFP0pşp R0````p &0PHpTPPP@H@Q>@ LPLPJ=P `P TPQ `" R pQ 2 !0PpW:T`V:P Q HTP :@PP@T@PT:Pʣ(ƣ$ãc&3pP"0 @@.`!0$(0  ` $噣$哣H`@PP)H0S @8 3/P PTH`He/ pŸ p2R0 :HP ,o `AH  0` `````勗p^ Pz,GΗPR P`NKP ῗLob@P P  P+ pPH` L03/P PU:X\P P`=V 5`P wP R 2/@`Ѝ `=T0S H2 K72.%.` E <L:.\l`Qt.p. 4.@!q@!@!@!O-LM@ PpPD@( 00p6@000Kp- 0@p ᑓᾸpP 0h Q* ,0p 7/P, qP lP0@姸||0  PoᖸPЍ,' "l#p.O-MH`@PHjCHAP X(P 0Ÿ,@H1/p`00PT @Cz@@TP41/d 0 `WQT8p pp3/PI H8P0`<(p,p@  60  0嚒p) H@PY P H4 03/p4|PH@1(0H  PPPЍ蘝 H 2.%. "l#p.O-CMH@pP t`P  P `"  `8 @B pȐW3 vP @X,P<   Ro n/ " A0    0ppՍ\ቷPZ,PH 1/D@P`p L0 3/ PA Pp`V:pL@8P 8s DP4@T@0X hP<Ha L0 3/ h0` 6/P> <DP `R@ p@# X @6/P( X\0lh h 3/8Pq  h L0 3/< h4pl 0p`D @0)>Vp@PL[:`@B &,  PH⑿`Cߍ  p./O-MPQ `$@@`(儴P `"pg;U $Q 8 Q "X;@p@ЍH &H-@8pq X R 2/P Q8q5 1S ` R   `0SP P $0S ``0 3/< 0 2 PQ`$PPVP*8p+G-M0PPWCぜ=Py=Py p=Pz gz=P{ ^q=P_Vli=PŦ ML`=P$ R p`(<=@@PTy!2C!8!i!H-Ip@-M Ppo@PJ  @nPJ Pn`n V P: 1,qQ0OЍpO-M080 ` 00z @(8pD DD DP 8P 0T 3/P[ P. 8phAg"80s" 80` 0S ФP L03/P hl ! PU:P8(P"8PpW: p0@p` `%0000 ,`8p5d%XupX@&T  R q p5@`TP7 K50 `0-` R4@$ X,`0P4$@,p0@Tw  00`Xh`PDD00L`,!<HHAC ` 9P4<xP@9P;8Z C9P p Z 8,p0@ [*!k8q  0 .0, 4 0@p0^0 0 0 ,pk0CVJ9#X 0 0h@@P̙ T `P H 00@ PXv@VSJr%PoBd{J:$(8<H1/@HpL 00 /o" +6 0  PQ`7U`C0   S 0 (0Z( 080S 8 0 0Sp 0 p @  @p `P0`0@ pt P @ R0 0 x R8ЍC(8` 'x8C!%.c#.8!2. 0!i!'0H-0MP   !0Id @|P6U7C @, @$P 3ޯ0Ѝ0%.#..H-(MP@a1(P⌭(p,p10 (0R0< 0F0P0 000```Pp1p, 0,v(壯0bP`(囯(`(Ѝ.@A..G-0M@(@ o:P(p U d1`0 p  0`Qp@810 5! 1,0 " R Q P ` L03/P  P U:PU  0`Xp PU@P2,p(EAញ(E@0ЍT5 LN,Pp@-M)@ᛕP7 P 0`000S0P`pP %+I@,F P0  ,+4 P 3|z*, ds-%0TT Z@Fd.44 40 0ZЍpm!E #..?C! G-pMQJ@PPe : 0 ` V " 2p 05":, r`T Pv#ڔ|"p` \0 5L":0 w<"J&  ,Pa 㼔p0"(H0  R P5 ` p=TX)p!0 Q 4 t R8qT TX`  P  ㈔@!p(0 p } `p  s p( 0 p`+0 0@0 J pkV UpЍ8=0p 0h` Ip@ (02/`P %.c8C!7!TC![C!cC!^C!jC!O-M)$qQ `W W PQ% P!T11/PPP(0`o"P Pp`H!L1 ` 01/P p$qP P `pp@ L03/P P P@ `V:@V?@ Q<@pR  7p0S P1Ta(h lP`0 0S h 3/, hl:`$o ptЍ2. A/////O-lMP8`@A5Pp 0W 00V0 $00@ `` 0@ pVp`pQp pP *..멷  P:R ,0ST0 S Qp xlЍO 00 8 Pp $,`X4( ,$P `Q Q 803/P ,(Q  RR(  (  ,Q FP N B p,P P(4Q4"@`G[2P V2P GpP,,(($`P P p X:(4,$($P Q `8p L03/P LPTP P (` V:(8 0 P- 88`p L03/P HLP 08 < P    R pW:H1/` [*k8q p Ѐpx@p@ X0T0@ 0 !k , P  0 2p@P@0@ X* S0pP Ah0W $0@ [ 51 07 5$P X*1h2(0 S&*1c20@0WP0@,  QP@p`A R80s@0p 0p@X0pP0@WPZu$4p W!*!!P: 0` /g [0p@Q`@`V 0@Q@$0@P [#* 0P` /Y 0x/0p0S P  2p@@0@0XP0` PN0 @ Dp @P@0@ ? P<0( @,Q :R*Abp^ q P rPU  P$0 00Q* 0^qa @PP8/T  lЍ 2.i! 0!%.,+.O-CMP@U\0`dR `80 R0P pQ0s  BYO p㛥PJ ذpP@@V p v,hP0 dpp`pPW:!8phP @T pPp Z,h L0 l@3/h @T:PdE oq/AQ厧P@@0KPX 8@@H1/PPH L`DR < #"PLX`PPz0  + @p8q ``( L0 3/d0@TpTHTPDP L0p @\.T PPdp0`Y:Z4*d 8 pኑj< @ pR P H L0PDP `2.Pp "0P0I$P``P `PPU>0 =dP9@ \0@r`Y0( \0Z@ H 1/ 0Tp`P(``R$`Q cT' X@ 84`0h<,`pg[c P85 P ] 04 0 Th < @\ 3/PE ,hl$R8P0  p p p0 000HFUE!_E!0H-MP@ y(ypyz z :0 0S O +&0PU  %P QU}QU/e  +PPQTQXQ\Q})<, X  "S  P a/Qbxb 'dZ [ `tP }AQ  Q  Qa/@T[V  0@X p j  qP)1  P#S  8儁`Xw$Po pP`〰 8 U6*L0 3/P, 'P$ _Z& 0    j Q$80   V P 0$1/``$PPV. pP P L03/P P _Z j   Q  8 @  PU: p| @ TP xtlzhp| h0 |XT\| T0 @d@`@$P  D ,@  0 ,, , P H4| @0 L@<@8@P (${ | 0 | 0<`20 `00 (Pd` `00QARQaߍ.(+.iE!7.J.2C!X.3.@J. J.|J.J.3.\J.̳!Q/Ѵ!/.O-Maa8@PxВ`ؓ4$P   PxpW   R/07/P- L03/xP PPF `48`00PS D%`_ $ 0R 6Rt;$ _`p" P   PIPk|DP`,Iph!P RP,1U A T P0UP @P 40#<IP˹@D$ L0/3/PT"0 P  I+ `!P @P !bPIPHRHQP #I 0@㘹@pRoP   P8p@T*0x 0SU C"T3_p"IR/P,"I`0_;$r _@p+ 45 @ X| Q0" ߍOU Ro   $ L<  0P  0P|  P `  P `^Z38 PZ ,|,D`D@P <P @ 0 PP P$PH`YV' <@xP 0  5/ 8 B$0xP0 05/40<  哉P!@Y PP   P JĪ@P < ,8 < Pr  0x BQ8!# Rd(@@;8$PQ , PN HPLp;`|   8P@T8!(0S )   8 ,u 8(@$P!,0S d)  8 ,c 88p!00S )   ,R 8  0;P,p@0`L8P  R8(,40y0Pn0 0`帶  & T(y0\Pn0 ᪶   ((8(P 0 ᛶ  'y0lPn0 ፶  ` P  OP '  0z  0@? PP P' 0g  , @P0LS' W  T0S& J  X0S& =  `0S& 0  d0SP& #  h0S &   %    x 8   0400`0`Vxp)(@$PS8   08Sqpq R  R   Qx(@$P,8P,Q@|P 䄟8p;P84AP 0P`VF $ Q?  L0 3/P HPXP$ Z:) r ` P/P Z/ P Q  P{8P 48` AP4>UaV{V 8h<P4PP 8`x Q)4# 0RPc 9P $P 0 ^0P市P(80448!0| F\b% P  8P 0P0PPUOPQ 9 9Q Io0F0F PQ @P >PPPP x < ⶵP@P < ⯵PP t 㨵ߍۍP(+..4.F!3.xJ.nF!f?!F!F!F!F!F!#!G!G!.G!AG!'F!2F!3.J.ZG!G!SF!7.J.G!G!G!H! H!H!H!.H!5H!t!S9!x` T HpPPPXP  0 ,p! W ,܍ Px$0 - Px  0% P x 0 Px l0Pw P0 Pw 00 Pw  0܍KE!7!A!ZK-HMA`PDPpo   0  0ppl QN `l@ @XhxPPg9 gP2D gDPP$U*P$ `l@ `l@o@PP `l @0X &pİ 0Pp LzZJPWHЍ谬''b .O-4M@Q< `PpPP TL0 3/P Xo R r P,`! VU $@Q:P P+E⚠+,, }PJ4Ѝ \J.0H-P@PL $P P0G-(M⬂`p-W BpPwPPpG wppV@ĺD @v0 { @v`QP !0 ! p@Z@v`Qvt g0SP  QvD!0 p@: P P!$1 p@+ P P (1 ֯p@ P P ,1 ǯp@ P PL 01 㸯p@ kv(0 gr(Ѝ. b 8!Z%.K-MP P@爼 $lн(   0 `P``y /P @ !0wC@/QPPgPoaPP]0,!<  0POPoIPPE o @ PP< P9Io PP2 P/Jo PP' P$Ko PP Pn0\ p 0Pp xHPWPPލb 2.$!@-@Q P p$$ PUX} J.@-@C7P < $1(!,048<G-MVP`|u MVIHha@p@PP   8p@T@)$* @Tu 0!(0S 㑮@+,0Sd ㇮@ 00S4 }@- 1u 0:܍E!E!b A!K-JMhAPpo L  0  0ppJiQ /`l(@ tdP,P* .  0PPw#n,@1`l0@0d )p# 0Pp wGPWPPJߍԬ''b O-4Mp`8` P`fA`P $$ L0 3/P`8@ V V 4Ѝ@-@$0(,04+'$Q"d  @@8QE!A-BM@VP`qt B V8X,Hh3 @Xt 0m@Qt  0 Xs5 @Et`0c6 @>t`4\7 @7t8P`IPV/tPd 0RX0SH! j@4; @t`d99 @t \0)`0S Q:h0S H@l0S >=p0St 5>@ sP 0 ? @st`Qs0 BߍE!~ b E!E!E!K-MP Pk@ C`lXp4LdHd|P P!0,!< A 0A0Po0;4Po458P BP  0]v'dPod!o\p E`l`pF`lhpG`llp0 㰬 0P  8vFFPWލpP PptPotPP Pb 2.@-@ QRQH-@ P`ppp p@`gဣ$Q"d  @HؓQE!p@-@MP@PJDP R ,@! p``P T X0P @Ѝp..O-MM?xhX0(P pW pW rebq(@@BP   ,0RoU  0    0``fp pb/ghPJP`,吁!(Q !C A ,R㐁 `  `ߍۍ.:O-wP卅`U04X 8008,D$( 0`8p P#w؀Xk8PC PPZ 0 #",  #"M(ⲗ8P h vP>$D P 4 vP1x@pW W   iP"  aP vP 8 R |8 8d08 vP PJD[0`V: <@P1 DP 8 880p W P p8 Pp8 pxv@    `9`V0   ᘹPGߍۍd@J!J!J!K!uK!K!R K!#K!+K!SK!O-_MMP|P pP ?v@P _ߍۍH@'`Z0u@PH>P GDh(PIpEPd T 0,`@f$<YOp84PpHLP\e`oPG P [ [( [TP*T  L`/\  CP \%eXePP    PX  *P d! 0   `T`p  eP P  P  P \P㮖PdZ 4 @ $8H@W$,L 0HPp<4eP X\uHLP6 Y P0D` T0T `PP0XԐ84\< P 3 T P  Q <p<(SPd)HLPp <@84,0DP<h 40p8@<8@[0`v?E(޻D_/;` W/ ,0`0 R 4P @  PPPQ088P`8pZ0W ꨻PP0@,0a[/ 0pl@P<tO}Ppql0 [/ `@`P(x\% Dp0X  !`Ъ040 0#8@ 0#  R `xp W:ʂ ?D@7$$ $0 D01l I!.L!AL!3.UL!.gL!A!JX;G |dLL!G-0M@( t`P H_P PX`TP|8`P&&q8Z`0  $00Ѝ 0k I!L!͑" / /H-0`@V PpD P  P `pV@p@-P 0P@U  G`DPV?p@< 0k I!L!L!@- @s@L!A-PP`@pW PqoEߍ-a !K!A-Mp  pP(N oPDP 0@tPhp`BjP  0/PBS@ЍK!4 G-MP`@S  PC PD PM tP0 dP1 TP8 DP14iP, `pP P P@@PP i`P 0@( 8@ ЍD` ЍG(EP )P@P K!L!L! L!L!L!"L! {O-LM4嶀ᴐ `Pp8 0sP㰔00<0岄(PDP,`E`F <@ P P  Z48 p+lP`p<@P zP p W48 pJ`FG `(`H0Ip4 4800KP`,`$P `LЍܣ G-8MP' PP# (L 00 `@Q0  pp P!0 QQ1"2(p40,( 0pc2P  0p P`8Ѝt@p`P p W1 00(pbRp`P0 "ܣ O-lMP$ 嘐p,P0  @ $ `@ @`` A @ @x :/p WlЍܣ 0H-MP0!814A @rd  0PJ X ]e  0L@T 0 4/ឿЍ02.0!O- M0 >,0LQHA04q8aW X   ?V   T0`  R Q  0 p?`\p`  ЍO/ Ѝ2.UO-\M RV sdLA p0P  P0bg6`@>PQ @0P ۜ P0Pgu6p@P@P?HL P PU@P _ 0\/%$X P@10`d5/p`\Ѝb 2.@-@P. .0H-|P@Q$ Q0XT D 0"!Q@ PRUR0 0.J.H-@P*p- 02 H?  0EGf묧 gM!M!z]0H-P@P |T T TEU P *P0T T 00 0 0.J.ħ 0H-MP@P  gPPT  bP @"QQ Ѝ0QЍ0H .J.Q /^ J./0  D<S :H-M 0  ЍH />H-M @0 Ѝ? 0 ?0H-0MB"0T00    000&P0Ѝ0H-M0 0 Ѝ?@-M, $@0 0 @ ЍX@H-M0 0 Ѝ@H-M 0 ЍTAO-WMM"XP0`p @P t"$0 P$`VWߍۍ刵P AP*[P ,"@Q[ " " 0TG0P QD∠ 娰X\`@dPp !0@06 ;@@@PJP PH9p7w  $`刵P!1 d  @(`@(P L03/P X( \,0"# #" 0@ T:$`0 0xp 7/@jD<pAI!yd)!G!vD!gM!M!M!p@-M4  ?0PBT T TT bRPU 0 Q T TT @  0O PCЍpO-R R@> 2 pTЍJ.gM!N!z]N!4ETN!M!O-tM8^Pj 40@ SD0AQ0R^C0` p@S[ PPTTT  rp 0`:T X0W0-0Q0*0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^ Q @ P`P ``P`  T1^ [ :^ q0<w?02 `PS0p pl 40lpp0 PJlPU4 R8<`[,P  Q [  0Q0pf 8@< 0RD AQ 0pS @0 SD0AQ0R @ RD @P QmB`0Dp  W T `V`@<`8@@D40  P8PP!@ "L8 PQ o PQ xP啰  85 `pm0p LQ Q= `V@  @0D (  T, @% @0DP$00(PP0Q01Q U, $0"[  PP(PP^  P $040puP 00U 0D@ ̌pP T" PpPP P0H`Q V Q QQ S p`@VP  RtЍ`@OPvPUv4 R$; 0-`J.4E,+.N!gM!N!N!A-8R4`U @v@TvR @~2".H-(M`Pp @n 0 @p-PP  "0P p0`0p`007/TT (ЍEZO!G-`MP@`U0P0pWk40  F P UEq0` pl`P1/P0= (@K1/pUK   0Q000S 00     p`H p P/ 0p0 0`D p  P 0P8P<`U`0 40p @P1/P0 p2"p7/0p`ЍpJ.p O-MMRU ` |pZ %P'+ 0 @ S 0/;@PJ| -a3p UX,p4p@`<  0P`@ @,BAT(@P P $p qWP< <P@ ,`@ P1@őPH)0U84 1~@( PG u 8@`E?4A@?@[(P 0D{ 兔rU Z, 躅P,Z1 oo@PT8*  P娅p P @,   P啅pǏt '@`$prWV8 (18@oߍۍ@@ @0X^(0 40  0M^d@gM!BP!z]P!5K".P!O-,0`Ģ4`@8 ;PJ4dD(pPp@,P P PP P! )PPP P  `p$0 !R RR.R@0K# " ? 400O@$ˬ@B R R R (0"r" " 09 0YR0pW ,@$`PBqP T `p W,4,㋄p?nP" @0g 4z pP,| s `0 W UPD (pX OPsPUs4PJ/z%  P-"P(8 L03/PLP  @RD @P Q1/  @sU sp<Ѝۍ$`(p 0\gM!LP!AL!J.K-0M8.qP/ @P`TPV ppW? " `p>,0Rax V0  "P 0τt@0Ѝ 09\gM!P!AL! O-TM $H0$P L0uPHJ0H 4LP`P0 4<($D @0^P.J(< ?P@ˇs#,W'(t(@p;)_,! 0!Dp_G%"@T'"p\    0,P'"X$! `VQZu  吵" ?@Lp?`HL Q pWp   0%L1!#*P 'P\ H0$ 0PJPPL4p 1!H0  0 "`V  Q @TЍ2./p@-8MP HQ2"d@A` p 8 P2  L03/P*  ,# +"+p  @0 0@# A0" 0 t`#2 d""0   #<",R*" P&0=8Ѝp2.UUUU3333O-M4@pPo? FFPP Z QPکPW   pP pP JzPP PBPTW Ѝi!G- 4pq>pW(PT \ (0 ?@`RU U UU R, @"0R Y X $P  GP:Y W ᶉP?6"R 22  G 2.4IO-MMPP TQ4pAn 县 @P w  ;㪹pp ) Y .@XpZw i-0P 1/ BT _`!q`VqOPqPUq qЍۍ 0k ~Z{dЀgM!P!L!H-MM@0P 1/ ;Sp `PnP p ,p-zЍۍO-M@吰px| Q94`0Y`H pG0w@0P@PЍ J.l"..Q QR 0+ /Q/ AR/1Q/Q//@-@<P T$Q @.J.K-M─ Q @4` 0m Vh p0(@DD0  p"!@@@@ЍJ.l"=!..K-M⾀4 pRAT W* TpTY `P@T U T TT W pP`UT ^ D0 0================>=====*P ʷPڸ@Q r4  PPP ЍP P PP P BPH-@p0P`v0 0`H PP P P Pp@-@`P@PuUqp.p@-P@P P`P  > Q  _ 0( ̎@pl"QQ Q/Qo/ ,(Q/Q QQ/Q/p@-`(Q U@Q q>U opH- (!  ,P " "" S  R. Q /PP/O-M,Sx*0N b!RRU RRRS!P UJ U p W R[C 4Q@RG[EX!U[. RU+ ?`p"RR R RRZ"@ T Q  1Q R pWBQ!R`GQ :RZ GQ*w 0S:X P0QЍK-P@PD\D@EUP \#A ` \@@P`pVp^S8 H   .J.,+.A-Q 0@PP`p!R TV R RR R  RR !T q ppXP  RPP`@VBT 0R S  S P 3/0H-P 2S B0T2BPC2@DQAS0G-$@QQ Q(QQ 8Q @Pp  SjQ ` 0Rp00\ 0$ 4"P sm<XG 8BT R`dm`V_m@U82?06rWW W :>8Q 4PU" pRUUO`8m`V3m4W  4 ]@@PXRU PPO` m`VmO!O-M⾀@p_`EfPP V QPکP"0@LKQ RY ( "  `FpvPP P[Ѝ @- P0r0222R0+09 R  @ " >,Q " 0VgM!_P!{P!p@-ρ BP  P`QP?@0P`QP?@ `@ 0$b #b0P 0pO-KM`P㤕Eu  ɅpPePfP lP zP6bP eP  0$ 0ՁppW @T  =(p 7/ Z8 X6T4 <F ,坨Pl )P$   P #`@p 'XPI j$ fx#ṩp]pkZ' I(pʔPp|KP(( ($'('#0mP 5$ ($'(' bŸ2 pRp@ Xpf@ p PF/<)pt!P  ePt pI(pTvp<㜽$[ At($'(' ㉽'  x'p@P P( P'pQ P 0@T rP 8$(l'@^Y ͡`   R0q0 P0R0v 1KP V V A Y VkP@밎..PR!.[R!ʘ0'fR!R!UR!ht@'̎.Ȏ..Ў.`Q&S!S!S!R!:S!R!R!R!R!qR!Z@-M☣@50   >㷈FS!'` H- z( H&@-D@p1'0PZ|@oج'̎.O-M-RMp |V (x&hd ^(L~@Ɵ`@ R0`RWF`&W@A X *``eP7 p P. 408 0' PD.` P 9.480 'P zP t 0S $ 㾉@T2  A  A$ @ ( _dUdPh0᠉`XQ-pAP dpGW$$$$d$TP`?G!h℉j Z` P @p:j)0$  u[!EPp:S0:Wp#hP@ ]p  1(A$QS @DY -T=IBJp   A@T0 A  QV@*P :0 %k!%Pp :S0: ` p2&1p|pd`"g P" `'uh 0 P R,pX!@ R :P! R`@ AkD `  H 0 JT!eۈPPp!eӈP` , P =%RߍЍ P* e⺈ Y@ @Q5?e⮈AQ%.v w,BD@b"(r02r 7"cAt qd█P.A.؎....Ȏ.4Y.Z.B Ў.QI LQ!` 4R!S ` ų A! u  ̎.0H-0MP@ PC0Ѝ0@- @%@@- M @ @ % ЍG-RQ PP7`QLp@: `T0 /@`P: &v!A-M`@@P1 pP@P P:PUPP$-P  U    TP V  Nn`@P@Ѝ'H-`@{$Pp  pn$P$U|P7p@-P @b$p  `8$@n$pp@-M@ %p D@ЍK-`P* pP  @P pA P0 p@p R R  R@R R #R;RPPr "R#R \R! R  PH-MM p !Ѝۍi!0H-@  p!P  PU P R ggP  R ggPU0Hge!@-@  K #@O-MMRO @ PT k p`PH`Vp@U+   0Jp P #P* PT" P U p PF@P R@XL jD <0e( (700Ѝۍe!e!e!e!p@-@$P`iaP 2 Z Pppp@->P`@p T 00< p  0ppb bO-lM K @oP `2p- @ .p I$ $p Y#p pP w$p" L#p $p  [ 9 4 " "$ lЍ -  D A0H-@P q  Q"PpPPq  @"9 p000H-P@@#p@P@0p@-pM`0 @p P "p @"pЍpO- M@ 9`p jp tl0Tlp0pPZX0TPZPT@ @Ph0P姅 Ѝ f!f!` Ty!&f!q G-MMQ>7QPp@W ` VPZp` !ЍۍH-R @P`P pW  R: pQP 2cpP+pP  QQ*cP  P Z0``0p0<  0PpZee`Df0H-MP@      {!p P P PP  +p Ѝ0Mf!Cf!p@-pM0@j` !p$  Py!p!  s!p  m!p  g!p   P 0 , p Z!pЍp(hf!p@-M@ , 3! Pۍp@} ۍpp@- % P ( DZj$$ SPV  QpP$%%pH-@qDa%@$ PU  mSPtj P  @ @H-M@gpP@ 0`V %PF`PPI PK`JPE %PE,H!0$  03-P 8"  4 { p 4) 34 4ЍHЍH$ P P P P  Ѝ84HЍHf ЍH_N<l!xf!k'f!Gf!l!p@-@p@PU L` P,PUp@0$ p@_4"l!A-HM@pPP M0@$ 2pm` 0P ptU @ | +l Up  PL1HЍf!f!f!A-@`75p$   11 1  6  rD Q 0>P :&P P P <U eo0A- MpP@`5HP$pP5 Vp P !U LP pPM`  5pP  >P P _\nC PH LP!o H+ ЍAd P9 P6PXPi5P eK&' ЍA+ X+9CP $P  =~p=P 4jU ЍA ЍA)f!g! m! g!l!m!"g!Cg!3% @-M@pM0$0p    DЍ9m!'m!H-MP@p)P= + 0 + );P  0 `Q Q RQ 0 0 R\  P]SP HЍ ЍHXg!pg!cm!@-M@xP Q  xP | 0Ѝ[m!H-@ PP`  -P p 0 0 Sbp, P uH%m!@-@Bd*LP P?HP P@*m!g!3% p@-@`HPp P$  P9B !$P dp,TA p Lp@m!K-MPq & ` 0 pP2 @P0 p P3 P P  > $> >$QC **b?P @ P h `WPF E4Fp5p< Q     Rp LP! 2PpV $ PJQ   :P]a!/pЍg!g!g!|g!g!H-@P `pxt , ]A`UP) 0P PBH m!'fl!O-MM` * 0fp   q |@P +` !p@ZJv$7P  PP@ `Z p7d!h1 pPI PP `@P T`V( @P  0P` Q@ LP! 0 ` `V`C HvЍۍg!g!h!MbBh!zz@-@ `P HH R$ @J@-@*@KA-@Mp@PR `NP V :07  @ЍAP"R P 0~r>pWU# * !P P `* <0p \ pd <0f 8[X>P * @ЍWh!kh!h!h!O-$M`PPH PG PPK PN ZPO@Zp PIp@T6ZP Z`D: @  ` @Z P p'  @XP$ 8A $ЍO ` l`Y@P @P0 ppD _ p @ p  03vjPMP4P 6P poP kP nP NP UPqpP xPJpz`s s  P 0 _@@@T P ` V ` pPP PZ P V m'p3 @T  P(@T P P U P p`P `Z ` U A'p @T@@@@$ЍP+ $ P3@T h@ P PXP Q Y 0 *0 b  P Xl 0@  |P3  P h!h!h!i!i!0'Li!T!h!K-PD!*QD! `V p@x P  `V@-@ P   P@2;p@-M@ 0HP* `PL1 @!@ 08P0@00ȌP 080  P 090 00 Ѝp@ЍpO-MpW= (@ P[ ` PP PXP[ U$ PY `|&  0= U   =OpWЍm!O-MPD@ @fP aP Hph.dP,PHR RDRLRRRR|QPsPtPp &K쏟_F&K@`u   0`.t>P?Pp] 4P 6Pf@Q紇Xć X,N@P<@3]引@FKxtoPI<P  H☡Iᔑ7 0`pP% H 0P%[6xloPH@ 0`P pH 0` n3 n-P|@N j a R[ *   @M (nQ > .H+00| s p  P( (= B(Mp P HPU :@x  PO PPBU:PCHPP| K/o2 oQ P  zp_P , pQP `,| H!P pn 4H H`p2@T4 [PP0`; Pv`+{VpVpH+0pkpv{dp `Z#pPfHD  H 3@<@  8PP, `@<@pH"p  DP k@P  R000 } Q[H0P -4[<[H@[ q ( M HP ( ,P z[P@0 J q[o[@|p @P ߍ< ^pP ` ( Xk!ck!hT]"k!k!^"k!k!k!؜k!l!@l!kl!tl!Zl!k!k!k!j!i!i!l!l!Cf!)i!S!o!p@-M@`@!QQQ'Q5 Qg PBNQ= 4 p7``Ѝp@Q" Q0 QJ<XX!0 Q5 Q?!H:pЍp@! 0P L!dP1BIЍp  P0 Ѝp@@LL @T @DЍp@Cf!m!m!Gn!On!]n!6n!>n!/n!7!n!%n!n! n!n!en!@-M@4 Hp PPP0@DЍ@QЍ@n!n!p@-M0 @+$p < .6Pۍp ۍp@W'o!@-@,p7P  P@VP@=*o!K-M@`PP Ѐp R p0 `   !  $ЍK7 pЍP PR b\<`0p`> *D>@p耼H-M@xP |q"P'P pPxqP l`PP\a<4"U9 >Qx[ `t!R p P 0P  0.'p9tP3 >P/ p *P> >HtP%D  0Pdp %P  % P  wp Vp|qЍ [`V >P`tP xL>P p *`> >p@ 7{hs!|s!Zs!s!t!s!s!Pt!+t!H-`?@_?PSP*@S0p0Gs p $pP00R0ʚ;/A-PM @`M pq PP Q L QH 㣶P L P Q   V `PX OP  p0Q0@P `$$ (0I 0J>ht!t!t!t!H-MЍH-M 0ЍH-P, q \ 0S `]R Q  B P 0   0{>ht!t!t!H-M\J8 ^+ 0Ѝʚ;G-PM PUO @`SO*$(p`W P P p0pW P 4 OpPP# P( `P Q   Q,p,ppp,<< D0q >(( ,0 0>ʚ;ht!Du!iu!Xu!t!H-M0Ѝ0H-M8 M=IP̎.à( B 0Ѝ0Mbp@-P" (^ @PQ`V`V ^R`V`^`,``4`PP4P p 0#=ht!u!t!H-P P T 07=ht!%u!t!P/H-P8 0J=ht!0u!t!G-(M$@T < <`$`Q ``` pP8@?P:1<! 0`V: p <Q  ` P8 p <`V:(Ѝ 0nC=S!ht!i!t!  R/ 00/. .0H-X|Q@P Pp T@0@4@(@, @@S0P/@-@8<P Q   SQ   S PQ ,  wS(PQ 4  lS0PHgSHL@/@-@@\SG-MP @PP儒PP @@ R D2/(`V P P J  P s Q_   P" 0S Hpw `V``0pPS00 pQpppp000QPH0cP9 `p*P2 7pW. P  Q`Fr  Q 1/p P P Q 1/V pP,1/4P`4`PPm TЍ` 0'<. .ht!l!t!A-M P0` O0pQp*0 Q  0`0@s Q0  0(PU @F`pPp*` ` p@ pP*W pGp@ PUЍʚ;MH-M  0 ЍHЍ/G-AMp`@Pp ` 0qp# > VV@ V L ᰀ@ DUs >   _Aލ''MH-M  0 ЍHЍ/G-M@P`: p 0q_0 +pۍ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    fЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    HЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    *ЍH Ѝ//'/'A-MM P+ `p @ PPP ,`,$ `Ѝۍ'Z/' @^'p@-Ps]PP` ;@g ^U b@Vp''^P/@-@&7Cb @Q0H-@~"Pp ! ~p ! wPpP0p@-@p 4 p 0 P "@P0H-M P@  , p $Ѝ0iA-M P`@p  t kPp !wv PP 0VpPЍi$  H r /Q/ !/p@-XM>PU U7V)@T @`Q BT TPUA @>@P@ <0 8 z> "P> *@XЍpu!@-@T GB@G-Mp`W P P  SP Q  0R @ OBpWЍ 5@-@T B@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB2 0^0R030O-aM0@p`FP @+JPm +pi UZg   RpR$P  PP aP ZM@T PP @U @FP @U@Tu  \@PY( P` 甝P \P U\dX @h 烝P d@TdX,TP X nP T[TDo,  U( Q [P!P $PR$PRPTPH (LP @` ,@ X$, 0 @6  pp 0  @D pA@ 0@S/,CP !5SO S1 >,TP5TlA(TpQP P@T P( $P,SʇCP#:SS S (XPp X (@L TJT@, 帒*> L@RX p 5!D pDL}D 00H ` I D@gNaߍ u!iv!+v!k!u!GA- MP `P @ dP P ]P:t` Ѝ:P `  p8W Wp8 3 P  !00:P PPA`p ``0`P iQ.Q  ` ``Q4'H-@MP @P`R ~p `V pT mP P `V`@Ѝ Q/$ /p@-M `@P  T0( 0@E pЍpi~iH- M@0 P:`V 0 PpP P R: R # 0`P`VP Q  Ѝ p@-@ VM PP ` `,PV:PGM($P`P` ` (`,PV:$P6M$(pp@-iPJP$ @ (`6@0 h bD@ h@pZ!x!O-6\ 0 0p   5 \8 G唅RB 0``  P0  0 P P  0 P U\ GeRB0 0  P  0 PP\ = P)P ` P  P  P  P  P  P  P  P l P X P D @P  P,0 @`P/Pt0x |P t, x!0 t,0 @n`P/Pl0p _P l, p!0 l \X `W ` \G A  \  0p\3 HP PH\% 0!   @0 R \ GeRB 0  PP 0 P p 0 P 4  c @`P]@ V\Pi  K\ 0`B   @[0 R\ g0 a sPO p0)\ , @P P`P V  0h#   0@00@,0P @\ R 4R 04S 6R 6R\` 0`B   @[0 R \J XU X\ ,@`ppWP" P PG )P| !PH |, W!|P  P PPp\  @E|~P4!\ G%5`p` @P P\li3 P     TS  lh\c ^ [\ B   eYiZ$PS] $\ [:` C}!`VP P PF : P˿@P p0!p  pp pZ0Pd ܬ'\j P+ ($\_ nm $PPUP P P0E`A  pwZ0PM \; @i,y!y!ͯ" \& P<P pVy!\  0p i V~Q  Q QQ@iPQ0 Q Q@@@Q)  Q QQ!5{!@TPA P PD0  p`pp` p Y0P  6z!=P pv!&z!0    @Y0 R3  0VPmP- * P  %1` 4,$g?8 gt" m*z!/z!7z! / `ᬾ@P /㦾P@ OT `/P C`Pu^ W8Up`P}T P P P.P; Px!iz!uz!z!z!z!z!z!z!z!z!z!pPkQP lfQPP X@_QP DYQP 4TQP  MQP&  GQ@P  AQP  h;0,A;  @:0A; 90A;hNFQ{!Q Q QZF<P  0%]FP P PVFz{!S @P Y P  P    @ W| V PQ  Q Q Q4P@Q Q Q@NP yP<`4ЍB P $'|!$ QP `0S0S  ,PQRU, ,POP $ % $(` )A|!W y@` d`0\pKP  PPPF::0-  ?0@V0,Q }!|!, `p P| P0`0638,0 P  P P P\FTPXPV/P @PK PI@x 6PT 0 ``` `U0(Q 7TD| @P(8X`D4 U U [ \ y!WW\\V x!v!x!}!y}!K!}!}!]}!y!+}!{!{!{!t!@|!X|!&!1!Ϗ>=!!!!!!!U!N! G!Z!!{!b!k!e|!|!|!|!+! }!|!z|!a|!{! {!z!z!z!Nz!9y!&!O- MP`pq@"Py"P p@p[gVQ UP X `~*`VU\P @mPsPnP9 rPWUY UUPTPR 0P. bPHUJ FtP> xP@ p 0pp  0@  P5 U 3  E.U!   0RP P  pEU P U U P X: PpPPU [7 Ѝ'O-MP`wP0 =@ᲹP/ U ``V p IP! `V3? wP @ >P5  A ЍЍO 'P wP p? qdp a4=P      UЍO>}!}!H-M@PR `P /@P p   xQ &UT `` pU hP W /G`T ,PT`U ,`Ѝ}!}!G-M`P wP k)P wP p ᔟP @ q T)PPP< 0 f>d>Ѝ}!K-@M @P < `8  p  $P t t@ЍG-p` V1`@P*P X FGZ : J 0pQ00@T*H Q3/K-T`V0 TpW1 @HH Q Pbqp ||PPPP DDPQPQP3PPPP Y $0C' 0>'~!!=!)!@-@e  i@ Z!Z!@-@P @H-Q# P" iPP# @ P ` TpP `W9P $$ (03 05&~!N~!\~!~!H-P TP iHHj= 0&~!~!!0H-P @ PP T 0H0@-P @e i@ 0[&~!q~!~!0H- @`P P᫿1= TPP00H-P i_ HP @ᓿe7@P 0s@ 0[}&|~!~!~!H-P QT$$ $0n& 0~!~!1!!@-P @PT@ 0V&~!~!1!@-@}P X@H-T R H 04&~!~!~!H-P @ e_ؿP ` ѿpTP(`Wp@- MQ @T R R! PeoP Pl ` 0 \ Ѝp<< D0(( ,0% 0%~!~!~!~!~!!O-MPF pQH H< z@ 8P < pL`TtPP PBP >P V  mVH0t00V td\ 0 SЍHH L0 44 40 %e!!l!!` !!!!~!Q!!Y!O-4M@$`GxtCP?   @PQ *P $ RP P$`X  pT Q  P P T8lpPP9PPP [YTe|X P|TTQ88oP3  P  P P P \ỼP TT R8 8<PYP XX3PxxQ )p|VP e_ fP; ` pZ`PP*9PP&៽ wPT P    p AP =P jV $P p@`lᙼP !`Pp pP$}z4ЍZ!Z!~!~!!\!e!p0Q03Q/K-Q TPp Q @P @PnWCW+ | |TTQvPttlP88gPM `Y p/P+ @)ʻP" `tt TTQ88EPxx@Q o᠒1 pP `# p}P @Y ṼD@xx@`$$ $0#&!"/!>!M!~!!!H-P QQ/ 0;#o!!€!H-P Q=/ 0Qw#o!̀!€!H-P Q Qo"/ 0}\#o!؀!€!@-P @Q QoB/ 0A#o!!€!@-P @Q Q@@oB/ 0%#o!!€!H- MP6 @PP 0@_oP!PU ` eP `/PpP `hWP ` Ѝ(( ,0" 0'"(.o!!!€!K-PP~@.`DT ǁ ,z/Yi T dD`QP 0"(.o!+!9!0H-P2 @Q4 PP QP P 0Q QQ06/P@o!R1 AR #P 0Hҍ@0$$ (0 0V"o!r!!y!p@-Q( PR* `@P P pQ  0p@ 0 p@'0H 0@XPp(( ,0m 0n"o!S!j!^!H-P Q!. $$ $0" 0o!!!€!0H-  @P`XQ0Z!i!O-TM @PP@tpR P P0tp@@@@tPU A`@?P: @PUPU @`@?P:q @PU ptb  0PP~tU RPP TЍS!S!S!S!M0H-M  P0 :Yp @$p@@Ѝ0HЍ/G-R'P@U`  R R* R/ `PPPpV# P* P a ZpP dd d0>!YE R  @T:q 0(!뱁!!! !H-Rp`@PWU H0 p P `p``P QH RU p`)}"3% g!0H-P@p 0H0H-@Q pPWP @Q<` dPPI᫾PU:2!A-M@`PPPT  wp' p AP$ !R*  0pC pp PP ` Ep1KP 4$w ,t#ЍA iRU 耟p` ! qTPUЍ P P!p0S  H@ ,QP PxD0  AH!M!!ƃ!݃! b!7!O-M`Q @U z#{QP PC@0峵,,'P p S p Y  ~p p .P% )P $P P P P tP d PY 8 Fp  !>p xC@ . PP 0S  2p @ }p DP R Ꮨpt @Yv   Ppl0%05$  pa H0e %S S pT D pN L pH $ pB @ p9 LP pM0$p ` p'  tP <p C@~ !`V# P P   P`@Ѝ`Cp D `RohVp  㹸P `  㱸V  #Up T Up  㞸`P"p d P/ 4P& $P! P P Pn !P PP_ P[  !p}  pw %P  pm 7%P `V %P`V 8pU  pM PP 0S  p9 @ /p2LH G!!!Ƃ!Ђ!m!3% g!m!)}"g!l!Ղ!Z!!!!z]! n"@g! !!&!1!:!D!Z!O!ZA!`!i!t!!!B!P!!A-R 0S P`@8p p 0S赃!H-@BPpP$  ᥸`P.P! &P !P x ㆸP HE .ӮP`(m`P @!H-@'Qlb(PA p`pP @P` XXpX 5UP:R`pP @P` XX X "U  T T T  S @     T  S  S  S S S`@P`XX X HT'!{!!!!!!!%!0!@Z8@VD*p^ [A @@@ .Z:p WA @'*^^@NY `Z:`^ ^ N KVH"`Q V`FЍ:774O-Mp8QqP@` X*{Y P`JQp U Q% \[ PJ \[V8 WR\ V/ WI P p8   @ 3  B$ 0p=p  @P`TP0PPEu 2 pAK GߍۍKZ l"b 1n@- @  Q7T  ᥷D03Q Qp@-@ ``P P `,PV:(P $P`(`,PV:p j0 {3A-M `P+Wp@ Pۍ@@ P `(P @///p@-M@ (PP/ P"3 p& 0)``pxx0@ PP`pH@ 0" pЍpxd![!i!{!0H-Q@p H.0HC.G-FMP>P# pF`   J" @ `ӲLp`> *ɲK`Fߍip@-@P zp  F?`@:pp0H-@M@Q@8 @P፶oQ Q@Ѝ0CMd!H-Q  RRL` 0A뎅!ׅ!!$ /Ho/0H-@MP  P p 0H-(M `Pp!@ጸ\ 0cPP pT !W:̸7 >P(ЍiH-M `P@(j 㚱 *p  Q(`!TPpP 〱( ``PЍ8i(iH-M P@8` p3 c$ (PPqЍ:iA-M P`p@ I @ЍO-QMMQ PTP @T HJtp8\ `KPT`Pp P @*`PT`  2P T`T`XP3`T`ZU| px Pp{PpPH x|hH 0`xPT`T@嵷p  uGWxP Z " ⛷ P p [` VFVPT p ` GFVTP 0  2T P  X  *@PPEq rpQߍۍ88 @0$$ (0 0뎅!!~!~!!G-M" 0 `````Rp: P8 &P4 `0 Ap' pPP+pP"*   'P\)P  @῰ ḭP pW:,`Ѝ3+`W`\!A-(M P @`Q Pp(Ѝ0'x Bp 㼶pWtP z  QF qP   RQ|@|  8Z  Q& XQ0Qx  pPTPP8hPT 0뎅!!$!z&!A-@Mp @`P@ R ク !U4 P$! U @0e@Ѝi@iA-p@0G0"PWP`R*n)P b `EpۯV p@-M`Q H 99p 2" \Ѝp!G-]M@ p+Pp Ud U`d`bU[`Q[QM ARX*PO(Q`ZL $` H PC   Ek? p9  RRyRppuQ  RQ  RQn@㓵 P ®,!." $uNpc Q n AR:QwPƵ`]ލQ QPP1 P .0`PQ p P " ( QPP , RRLa ꉵV`P` j`RP QN 5 mP i1P XXP4,i?Z.0  0jpH$i@0!A!H-M 0Ѝp@- @0 Q*P`E``U`@ Tp"pp@-MQ @P P R Ѝp@ 4P=PQP' @)/$PU ` j@PU @T `>P* ~P @Tմ@ЍpQ/@-P@@@忴V@-P@@@尴VP/  U~d!K-Mp@`@J@$'PC @p~p8 P p- Q'P$ p \ p ) p 9/P p t#P 4p W)@Ѝ^!fB@lBg!O-M`P    Q4:  0Qp@T W pPP }P   ክ 00 R :   q Ѝd!H-M0 iЍgB@- M^ *@ @  0 Ѝ@-@ (@(@-@p  p 1p~B G-ZMP  x Y   ꏳ D   d`!.Zߍd! !gB e!8e!K-Pp@`HQ™\ r崀`T 0R ,0TQ G™`,p V:T 4` G,P@TPe!z!!!O-MR/pЍ@PU.* U p `p!W*P%W Q  ၬPP@P  06Hpp 6P  -Hp_ppp"!H8!G-MMRp @`0GP P !Pp  pPȲPЍۍ POt GPp XpG`W p O GpGp Z@-M (@T tЍ @R S 000P Q:@OO-,M`P1 @h- P_  y0gP t o 0XP @pP*Dp`aPQ` `` P ZIpPH PH Z( q(  ᛫ j0($ $ PR R$ `t (0$-8 *  P`X: R `p` Pp"pPP`v hX\ T`  !0P p0 Pv 0Pm piP$(d$ {P\ P(  8  P`W:IP `Q(  XP9 ( Q Q$ t ($8  aP`pW: Q 0p QQ 0p$`,Ѝ` !!O-M P崀P"@40$4P$Q``pW pWJ XN0l  p P" 0P` $Q:` `>N0  p 0  p P" 0P$P !N0  p N0x  `p 0lP p$`,$ 0 `tp 0,P ,@$`%y  0^p @Q b@,`@T:A{f R @`o,`@T:xQ tbpa,`pxW: Q F B`0 P1 ,@`V:6Q pW Q, P" ZP X!(p   0@+}P(P:0cP (" B0("   0P! @`p㊿0P0P"  P ("h0 0  0@`,@V: ߍ蘆!!!͆!!! !kO-$MQR @cPPSP Vp$ЍcP,H Pl  0 p YU*`V VB Z  X4VQS0V   `W 0 Q"P  BR    pP   H  0 0\P rWc~0H-@T PV PPPPPP@P*I"02S @"PU 0S, 0 00H-PU @L00H-@\Q  P\M\P0@-@`q ``H-M`# @p4 P0 ppp% 0 p p 0)p   V  p @Ѝp@-M`@P3 0hh P l0 @ P L0DH   K $ Ѝp@o!G!a!!pp@-@`hP >P:&T R RQ TQ  p >P:  p@Ԋ!@-@A @F pp@-`V @@PpPX 0${K 8!L p@p$p!G-MP@p `$PH` " 0 `` 0  0E  *@0`PHvH V  `0`8PG PK:jT @   * @$"K`(0  $K  H0BHP[P hI RNH=ЍGG$48J ` j@   4P 8P  @  * @  PdQ Ph $J 00 P<PPpH0p 4 `2@8 L2@0 82@,4 80 <48@Pi`  +0.CpjhmH? P hdUP  Ѝ UP P P dp`  0ЍGw?#ЍG)J 00D @s??g!!!!!ԇ!!3!t!!Ђ!B!!!!$px(y!ӈ!!xf!xz!A-MR{ @`  0Q 8p0 0S  R-  . 0P Q :  PS q 0P Q:3 P 0 P:P 0 P;P 0 P  60\P Q:Ѝ$$ (0  0 h!!!!H-@ P`T08 l A\ 0080L<c u`Hf!A! 0H-@P P DHi $ hhL0H&Z!! m!p@-`@P\P# P?P\ 0d Z׫P TTP PpPZ4!''! K-P`p ~ @Q$   P"BA  P  @  ~P  01    rP d &P 0$ ` KL hB4 HK KA!h!!!|!8!p@-P`K@P D 0Q 0 pKpcSc |Q0S/080 dQ Q/  m!A-`@VP 0AgP ,1 P i P P<P $&H U 2 0p: p pp HPpp hpdp?$  #5 Ɖ!O-]MP`@R L@p@Qp1P}pLpe} @P  Y/$P  Y/#// R 0 S d R 0 S z8T0D`@  ? T0D`9P`kpwH W _pp jH@pGK pP dP IQ* Y( RQ cR R SRcQh (> BP* wH  P YY" p^< F  ((!Q YY <P ` pT0H@ @$0,@S4 pDPUPY Y d\ hPP PSP p4P4AP* p 2 $ p0AS*  zD00500$0`(S D0S0Io (<Q CQ:6( `<Y0PAP'8 ̢4`Y    HPxPmYH0P AP:2H `0PY Y Q BQ:30`AP: 7 QA 0P#!0pPpP0pU P Y :R P4p W pV PP p,0P:APF+ D4`HP$M HP `5P pr`W P: p-! 0` ``! ` p `p0p P  pYp:P 4 `P H$  ` $P,0U:0@p 04WAP:9,p04HPwP  0Y BPM` ᷡ4``0P`0P((P AP=(`(  ♡(4 `Y     WHP`DP pBPdpup0P`Z B  ZAPa:P`Yq    Q L PHCP U HG 4U( @ppAP>@p24 0AR+QU$ HC  ` 4`0P)< 40Pp` `0P0P4 `  `@p0P4Z8 H ^AP:t`Y     HpPyP ` B8P p <P ᵠ4P _ A pP*8< P p8 `E&JPKKЦ R* nP(  0Ѝ!0H-@PU  (@P P QQq   p 00H-M@H PX P  R (>P: ' P 0+' P P0    }wPZL @  +S00 @Ѝ0Ѝ0HzD5!O-M Mᴐ P(@@ q: pB PUP P`i`H 0pPp@ p(,(q( `EQ oP(  +?p &03 pЍ ۍOh  L>@tGP(Y @(((> *⚝ (P >Q * 0  0  pF& @L@ @@ S! ` iP'   0 ; (|aP( (((1x|!0 Ѝ ۍO +PPp U$ 걣PP   C@  50P   P PP   z cQ0S0SS 0 PcQP 0$P @Qi cQQSQcQ0p i _P Py cQQtSQcPo l@TP LP [P * `EP PP cQQ}SQcPx$V@ H   0<m@Qf k2c \( P `PP  hh dPh{0cSceSPcPhe   .d@U r 0 `0 P0R  $@ @@480 BAC0 48\ $?  Ѝ ۍh0 T tm!^!!!Ə!!'!܏!N!h!Xg!!!$(yZ!0H-@0 0PUhP00H9O-MP@pWQЍP PdP(  0\ d< ! wP@Q P Pu?  `h m`P   Q $HHP P A{P P  0 Q 00S A AR:ۡ   n!!Y! m!K-M@`p P P$PQ6> i@P-  PP  0UP |HD@(! 80 @Ѝ ꇐ! m! R *jP   0ЍO P ( Q e0 q W 0S: @?> k|Q  0u a V[ 0S:  50PQp p WPP P dL H$ PLP`p0   0PPu`VW6p@s   60PPh_ @= dЍOP`0 0   0PPW6V@`V` l 0PPP0%`#JPK?04 0t`QP VN 5iU 0 45@  0RЍ4 0J  P P  B P BiP p4@PPP < <Q 1P PQ % PPX  P `4W QK Q`PW`@`$QDW   60PN QK:<I| 0  ~P PL  ~ 0W   02 Z]P'   P0PXQL QDFX<`B   P0xP   - 0) 0y Q*! lP 4  ĘB1t!0᤿WA X!  RP* FP   垘 0@J p` H `唿\PP!!4!^!u!!!!ߍ!!1! , @P r 5 ,P j80.4.'p"/'H-0 R ^  R:R |R S 0C R:R 0|R p@-H`P@P U((( 0000p@<.8.@.D.@-8@P |U  0000<.8.@.D.O-MM``CP P R4F+ Pq sP 0SA  "0SUP   AQ 2 000@:R#RP\@o"t `P @OU  Pq +Pq P Q ` QjPPpQ\Q PQA:Q @T T\ `@: P90 T+  R :R|R   0v`P P T` d`PЍۍ00S\S000@.<.!8.0.'D.K-= P{ pd7Px Pd]Q\Q R:Rd 0Q0@0AT&  @ `0V  p^Q Q:QK pQ:QE ppaRMRB0BS `4T|pqP%mRb0BS`4T|:NR RR TR nR rR tR     @Ed P P EP P ꡔ  P  b PA-= wP- `dP* Pcpd R:R pd :@@vP d`dP@` wd  ecP , [ dp@-`# 8P  0Q  xR p 0/@0PC U:aPCV@U:APC6@U0S2 pH-<P P  PH.L.@-<@< P R)PH.`.D!O-M8P R`$$r UZ  PK oA쑟` P( p}[ <PsoP  P J Q   P Q  @PAS PpPZЍp0 p+P ,P S 00P P P S0RS0`.H.a.L.d.H-pS 8@ P ll@p@-@8P  PG@DP8`8PP RTpp\.H.`.L.0H- @ PPP RP0H.`.p@-@ P  P@DP8`8PP kRTpp\.H.`.L.H-P\.@-@P@\.O- M`p[ pPP[@ @P! X P 7P P[ X Q UP0@0``P R`P Ѝ\.H.`.//////@-MPPP <4@ 0PЍꈖ...@-<@< P 'P舖.Ě.O!O-M`Q<@8p P_[ V``P 8bo pP8 0pZ ᡏP(P  PJ Q@oP P  PJ Q  @PQ PpP) P P P P P yP$ :PPЍĚ..{H-MP`@`pP0P  0p`=PPoPЍꈖ.H-M(( 00;PЍ萖..K-M`p@PP  0p(`pPPooP@@pP PU@@Ѝ..Ě.0H- @ PPP PP0舖.Ě.H-M(( 00;PЍ萖..K-M`p@PP  0p(`pPPooP@@pP PU@@Ѝ..Ě.H-P.@-@P@.H-@P`p#    Hp@-M@8P ` T@`PP`P|P ʐP@ \PP P@Ѝp(@<>$ 04/ Ț.ɚ.ʚ.V}'b!` O-,MM$@Py F0,(( kzpq%弅5@ LLVLf/oP bp(@  P P Pd+Rp <P ,5P P (@A@9Q @@@@@@@$,@@@@LT@\@|@@@@@@@@@@@@@@@@@@@@ @@$0$ Q ;   BQ.!"  Q `PD8Q A @vP M= 0;/(@PE a귏  Q#|2p RtBR 0Ppb0P@@`ņ`1T 0`HbTp4Bp 1`pq1@rPqRp "pRp!q`pQ3 1   AqQ$  u@@N!1q@v!|1|QP@"%QP15Q*!q0  a@P P8@,ЍۍPPؚ.ܚ..` ..Ԛ.i!X!.ɚ.Ț.ʚ.''..'.... ..... .....(.$.,.V}0.4.8.<.@.D.̚.H.К.'x!#@-@<P*@2$PP @$,.O-M@`P%P PP3 ` P5V-:F !t 4 P*@fpW:WP%:W#PP `V `PtP `PlP` ` @喿Ѝ# 000 0[:S [ 1BY`Zc# [p  1W `PpW pD P~ `( ;Jpp= J`F02X !$X  :C:00:S !!B $00P  "( Y4 ` 0 11R 1$  P 0# Vg FX02  め X I101S !$00P  " P =|P> ?l!lp@P@pP p@W I P `J J 4 `Y pI' ` P KxPGt@;|`@;XX 04/|UUUU3333.,.......D.P.T.0.ɚ.'!` ʚ.V}Ȥ!H-MP`pP:FPT Q :pP/4P*V@U&P*P PPU:U :sPPq PP  pP ' P@pPd P@*Ѝ<@:8 004/f|Ț.,..4.<.ɚ.ʚ.V}'!` G-MP@Q PPT PT `Q*Q3*  ".c1PP pP:P_EF ! ! ! ! 2!"!" 2/o?o! bQ 3!0cP03S7 A R# RX" RTP pU  1P 6Q*Q *P PQ:LL 02!0R 0PU*FZ 墾PP PS U`1p ԅ|RPUEpG < !pP Q T B L 0 <p p p P U*HZ ˋ ~ uPUEWP  pP ЍX@~9T L04/K{Ț.,....'....4.<.0. .ɚ.'*!` ʚ.V}A-`|P" l F02!ႁ$0SqWg  BA8PpPZ kGFW!@P\ QW W     W'Q0z R!p0 PP Q QQ Q T0*P w @   ARZ  A] @hWPPZ  4@AG ...\!P!0.D.@-M@<P0  @6TCЍʚ.V}@-Q p  @2>$ RNT C4 R  ..0.///O-MPC|p 07/lll#p07/l#l3`hc@ P\3RXxP U*!e!@p,` E 6 `P U:pU*e|,@`E ``  0@ PU:(qЍ.... ..К.'!` .O- M`P A؅0@pq EWzO0pp@@ppP Eễ@01 ES U0U0 S=0S: p Ѝ.,.A-# R*# ?`P P I# RA!!!!((o!aX3-\P2# R*A!#!! !2r880po`8Va  "2r 0p8Aaap$ R 0S 0pW. PGP_o Pe,@<`2u' #&p|(0 P0RU <?0P( Pp8P'  01@P:8PpW*1 @0T PDP_o Pe,<`05$@0@&p@``C`;4 0 c03"  P R 0B0?o 0c,@<`p#"00& 80 R*  pW 0G0?o,@<` 0c'01& `V@`....'.'....A-P@T5 ܀`V p`@P@P#`@V P pxp@hP * `8P"P.D.P.T.0...O-MP:  2ApP *pW pZ)PD R*0a P$`v U5*UP*P 105P:  P pW NP p| `1@` 8$Q9ЍP.$..(.G-0Y S `0SYZ 0PU 0  S&  !00P^U 0 R00` Q``Z Q Z 0 R 00\ 0S  QXSS @T R$0 S 0R  P Y @@ R0 S 0R  P Y @000@@0@`V R2PU R @@@PU R'`V R9 }}V R` V 0  `R (  `pS`$ @ )`V R` V 0  `R -  `pS`) @ .`P0@ P` V  0S 0R   0Y@@ `P0@ P` V  0S 0R   0Y@@Q p@- 0P ` @06A1 1U1N $PPP \  `0000p..G-`Y V 0P`VY Z `pW` V#   ` 0XS  R00P Q P PZ  Q Z 0 R00\ 0S QXSS @T  R$0S  0R  P Y @@ R0S  0R  P Y @000@@0 @`V R1PU R @@ @PU R&`V R7 yyV R`  V 0 `R & ` S`# @  (`V R`  V 0 `R + ` S`( @  -`P0@ P` V   0S  0R   Y@ @`P0@ P` V   0S  0R   Y@ @Q p@- R @` T* 0V  0 R`0V `  S C Ru 0 V R @T  R  `0 R @TXPU @ `> R  ` R   R $ ` R  " 0 @V  ` R 0 R  @S   0 0 @V `@ PU 0 PQ   S@ @0 `VpO-TM@PIP刂`j[: pPTHpU:UY: 0 r`p UPݵpp@ eP11 5/Pa Z 3xP < @`PDQp* 8O `pDH P pV Z P `Z*` PV TЍ`pLL@ PW!P.U``vr.@.D.<.4.'n!. .8.. R  R/ R/0S 0Q0 S/G-0Y S `0SYZ 0PU 0  S&  !00P^U 0 R00` Q``Z Q Z 0 R 00\ 0S  QXSS @T R$0 S 0R  P Y @@ R0 S 0R  P Y @000@@0@`V R2PU R @@@PU R'`V R9 }}V R` V 0  `R (  `pS`$ @ )`V R` V 0  `R -  `pS`) @ .`P0@ P` V  0S 0R   0Y@@ `P0@ P` V  0S 0R   0Y@@Q G-P删0刐 `V h@pP5`  W* pPH.К.ܚ.̚.p@- R 0` @S@S@3* T  R`@V` T  R Ry0 V R @T R  `1 R @T \PU @ `A R  ` R   R & ` R " %0@ PV  ` R0  R  @ PS  00@ PV `@ PU0 PQ   PS@@0`V pO-M1@0PAp 2cG0s`a0@da220S@ 8W$ppG 犱 P *$q  A Q ``6Wp5PP PЍO P ( PЍ...(.$..O-DMP P;A P7ePPe]Pb  tUZ a嬑嬡A威pQ  @P@sPE@Q@  pW:5 ᆲp8`@ @-0 4/P) @PQ P @P@7P @Q P\PmDЍH R@Wo4.<.'n!..D.P.T.@.8.p@- 0R @R@R`@ T  R`@V0H T  R R{0@V T R R  `1 R @T  \PU @ `A R  ` R   R & ` R " %0@ PV  ` R0  R  @ PS  00@ PV `@ PU0 PQ   PS@@0`V p/'/'Q/P  P/Q/P  P///////Q/ 0S/Q/Q/ 0S/Q//\/0SQ/0P/H-^ 0`SQ 0CP1S 0Q  /1S 0Q  // 'p60p CS  S \ 00 / op/'p/'p /'p/'p/'p/'p/'p /'p /'p@/'p/'p /'p@/'p@-0`P@{P @ T@pГ!Q Q //Г!Q R !R/ R/ RQ/ r P/'P/p /'P/@ RRR/@-@R !iwp/'p/'K-MLp@P@@@`P}U0`8 0Ѝ` ]~"7!' R/QQ/<' 3P/` q H-0A CANr R 02| R 2 s~ Rs~ Q QQ//ḑ"!'Q//e"!'///MH-M  0 ЍHЍ/0H-TP@eDP d}(  0Hn'ZPՠMH-M 0 ЍHЍ/ MH-M 0 ЍHЍ/ ///H-M  ЍH-M  ЍH-M  Ѝ //////P/@-M0@!Ax !l ! R Q: P @|@|ЍUUUU3333p@-8`@PFzP P Upp!Q/ /!O-M`P P@ xpP:p@L `P xW!* 2P$  $P`P㄀( @,@|V`' Q `0 0pp0000 00pP偀 |  $[@   P * @   P:P  $ A   R P R@ p`0p`"=SLP H9H9H9H9H9H9H999999999H9 :H9H99999X:99H9X:X:9< VQ<`J 0 @7QP30  @/< V"Q<`"J 0 @" P >#>#"R RRK<0 VQ<`J 0V QP0 @` >3S0 @R   <Q:8@TP<`X P, X >3S P: <` X PUP P P,H AqPV pP8X @X @Q, 0 BP *PH0`V a1V`!aS:0CRA 1S0!1 ARP *QQ:Q: 0aaPVP1`Q A` <0 8 `p _ pU  R0 >#R R0S0CRS0 00 pE0He<0@0  LP   R OR``ЍTUUP>$KJ,EX.A-M@``>Q$A QA >CCC?T@??CC0B * (  (b]Q?Q! [Q \Q V:fP`>Q( <Q+&%^Q {Q |QP;8P6 3V:Pl @` V@`$ P*)P )  V LP*`)P P`Q$**0@SpPv{P0S*dt 000,R Q ,VQ >P *PU +P0@ ]?P^ {P`0P*0,Q < 0VP 0 Q* }R X g. `A $  $ zPh 0 @-0  @&0@ | @P!A>#" P>  BQ_`%p] ^#  x 'Q`QP   P  }RP P P* *0BS p`v P D {R P*$ЍX.'K-M @\Y  P:PH```JY0JIPAFGGGGGGGGFFFFFFFFFGGGGG/y`qPLP  O$ l F*YU .Yv [Y[$yP( Dn{ YIP2 / @` V@`$ P *Q*\P)P \) ' V LP2Q1* \R)Q P$0&+ (P bP ``QFV x'Q`Qy y  P#*0*SPh 0 @0   @Q*\S{Q $YЍ`0Q* 0,R<Q*X 0VP   RQ1*0\S0}S/ R *Q * Q\R }R P P] ^%`PxP (n X.'@-@P*^Q  $  $ @-@P  @ (  (p@-`PpP@P:(P    !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QPtPn u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AO  R0@0 @1>3 " <^P P\PP  1 B>3 ! A ЍX.O-,MP@Q * boP2  \oP/ @  [LP  00@!v <P* ^R 8 P*]Q -Q- P &  ] '4  0  $  Q v*W0]Sr  R*-S]P$b-S! [S'R%* =R9 :R Q:PPP ]R-RPPPP PPK-pPA*0-S=Q;* ]R8 -Q/-`.Q:PPP]P-PPPP=3 P*Q* =R]Q P`W Qw:pP[:WPPP WW w | ppQ PWP fKP T!p`Q*40 `@V:P  npp@rP> p WPP PPMJp`pPPPP ppP `pPy # " P>   Pp  PpG0H S@@X@P =F 08  0 @ P!A># " P>  PF 0  @ K X.H-q`@PPQڥ  ,( HP) ,( ,P<P 0Q< Sr1`` Q  Pr0P   'X.''@-@ P*Q* [R .R. Q 2R1:QPP00.S ]RX.A-@X 2R1 :P`q0pSWp]W `00S:llpP LkPnP pPWVPX.D! !H-@pR P` P 0!kp@-@PP* `HP `PP  pX.K-qG `p@P># RR: -'R:0aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaap >Q>"P P P Q`qQ` O-lM`e ,@Q 0EP  lЍ,0PQ : `  m,0  X:  ` > m,0 = @Z:,pQ$[ 4Q8Pp R0*$P PJ@p P< [:$-;,0P pKZ-p`P0 m,0 . @Z:, pP$  4Q8Pp X*$pJp@P< X:$:,0P pHZ @P$i:,PP 4Q8P$PR*p(` `@@pPP< [::,0P $PKP#RR>p&A Q z}}zz}}{}{}\||||R p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp~~x́~~~~~~~~~Dd~~~~~T2 Q@  0p@ @P> @ X:} P7<pp܅>S 0ph `Rd\cA^^ p @ !40PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00' '''!O-,MP`TQX PX p00'$@  D | @(@p-+R0@Ԉ܈ 8HXlxȉ    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B#RR>p&A Q 簒8XxR p>#p!>3 S 0@@M`8 0 E FPP @  0 @p6PZZp  0u 0  `8 0@ FP@ @  0p P  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp紗hhؗT\|hhhhhhhhh @|̚hhhhh02 Q@  0p@ @P> @ X:} P7L`L>S 0ph `Rd\cA^^ p @ *.0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00' '''!O-,MPp`T@ QV,ЍX0 0($P  " ~(p -+Rr0Px̠(((((((((<M> AHF !0 > Q  > 1> Q@5>  @> PA+^$ %p"P$P P( Q qP p  zQ ^J @ሀ`Va^J !>  (R P 8 0 >03@88Q ` <@Y PPp( 3PPL( )PPPP @ '''O-DM,(`0 4$\a   Dh  0lP\P   [ 8P P X8l@Q$ ! ̌X <<(l@P  p +P@8,@p0 S S@  @$@@<qp W W  (@pPS4p@Whp00@T {B  0@T0<{p Q40\! 0^ hp,4*48p _^ \ <_\p ^hp,8 r  hp ,_^ @qQ0<@0p s0RtB  0,@@P p4, pP^\ ^ @< r _\1\ 8 r _ ^ o"pP&<@8p^t w0  wp ot0 Qr?o24hp QqB  0o@poP  pP5$@ *P@Q) (@[%P Y Y<@h 0tB D@P8@ @@@\\_ < r Y_\eVlP h@P DЍ'O-M8@S*P`  >#RR>p&A Q 焩TTTTThT ,LR p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp爮<<(0Pp|<<<<<<<<<P<<<<<2 Q@  0p@ @P> @ X:} P7 4 >S 0ph `Rd\cA^^ p @ u(0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@3T3 P,)P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00' '''!O-,MP`TQX PX p00'$@  D | @(@p-+R0@зlllllllll(xĶĶ    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B<Y PBP(vPPp(kPPBPP  @T$ ,Ѝ '''///H- // //0H-[* !* 0>p@ 0p0  >X d 0>P`  0>@ᐅp&\T e!0[  0$  @$ЍP @-M@(2<FPZdЍ@ =E  *4>HQT )ED $E , E E  E  E  E E  D D  D| D d DT D hЍ2   w e ^ 5 1   O-MPQ`@T ᘹP p ኹP P nPoPoPa@PThhhhhhhhhhhhhhLh  WP  WPZ U  WPZ T VPZ Uhp VPZj UZ< VPE ( VP?  VP  VP  VPhZV U4 VP'  VP!  VP | VP h VPBZ6 UZ UZ UT13TTTT TTU  Ѝ3  I # ^  o N 4   _  p@-`M`@048<@D F?P@@@@:X2 0P ㋉p$ 0H Jp Jp  {@p@@@XPH JXPXP  fXP`ЍpO-DMMp@|"0BS @ @!yqPB  " 0! <R5:0V/ `Ot`TV}FM xI$g'T# Q "2q`pG`Vp4 @MPJ"2"2pqapRp STS@P3/H%P  BP  SPCq@a?0!Ba.PHrT2LbWp 0!  @4PꟆ)\P ף(\*vɻgP O-MT2PXPPt@P" p nP. T@ $  ( 0 8 8 @ @ H H L P D X < ` 4  0pCp  ,@Z aV$zXP `P P& P Q QaVQ 4V e F3P9l|h 4$ 0 8 P ( d x 4 p  `` ddp  hpx"0 "K p  02p;0s0{ 0p3@ P9P P 0P @PPP`PpPPP P# dstdayminsecFE C > d 8  " ! P" X n " v"  # #  $0H-P<}X @&~p z}w}t}U:|00at T0T0 P <  Q/0P  Q/ /жg 0H-|0|0 @ R@ P  0P @PU UPP@T0 0褶 H-H  P 0S !  P舵p@-t0h0Q L F P0Q P`VP  pH-PP @p PP `Q\P`H-d`@`P p `P PQ@PP@H-d`@`P p `P PQ#PP\O-M`"P6 PfP5 @p`P  P QP{  `DpPY W F /0`P Y```SЍ艫  H-P@Q p`P `Q,Q P F K-MP@Q p`P `QQ4 Ѝ FQU& BJ pPp```1JYp!"PpW |Ql 07/Ѝ4Q$ 넠  <8t7 @-@о ξ@˾O- M`pPP PPQPX @@PP oP F H `yPC `nPoPo@o`=8P PPQ P Q0  HQP S h@`P@P `^@ Ѝ s٧ ` O-MMpP@}I` RP:8Pq  RP /P P Ozp az}EnPk 3$<0 ppp"3pe [P| p0 3pT `P{ `尒  `Pn  AP 0=p  {pv z rFP$Z AE 02p#  32H` A!H`p AHP/Xs AH`H` Ap@ᄽ ႽH`Ѝۍ 0p y>`P    0`HX  0 `yzd@x ` m  - p = < pJ $A 7 H-M   0@2pЍH-M>   0*2pЍH-M?   02 p ЍH-M8  04D pЍ蕾 P  / hdH-0H-@@PP :H? $  034@Wl0 Gh4PZ <0U088, `YP4,,!Z: @V-Y4 Z#(@ P3 Y*8V@AP>34PWl0 G`h4t< `, m`34 W @0  GZh4 @$0 Y<34 8Q ,FVQQ `V;@Z3 P`U*=0 G4PJY@0,p0P80/ h$0 ZZ.*Y:@RYp`4`V @Z3 Y*`(R@ @P>34PWlGp0 $0h4 , RO ( l @`K G  `4PdJ Y @0$0, Pn, lR ( ` @(R@ @P>34PWl`0 G$0h4 p@RP`UU:V l8`P>34PW @0 Ge34`WGp0 $0h4  8`P>34PW @0 G$0h4 @V 8< 34PWlG`p0 $0h4 p@RV < 8U 8PUk PU8d @Z3 Y*PR ( p @ 8pP>34`Q @0 Aw$0h4 @W34pQDЍ辺  H-M00ЍH-MPЍ0O-MR @ `pPJP/<1aP D  0Mp4 ЍBBЍܠ P8 PPP   0P p-pBP  0pxBP sBP8  0 Ѝ ] ?L ة  p@-MP @0`0 5/ЍpK-MMp `@,+sp P/P /RRP @ Q$  P ` ' ;`W etPp   PP00 PPP BPBOЍۍ O-dMMp :P / R R: rRP;Kd`+:X *RP7  >>>V dK V |P VVK ajY eP BBqV PP >>>>||||QW ;P ^^^^` aU %P   QV P U B U P hh |?@ hȠHČ pp`p P@ P @0, 0 000h 0 00P00

Pp\0` f`V2 A1 p P P(U,P\0  V 封LP:8@4p_P#  pW   Pp\0 H`D! p!rAD |  ?p , @!PJ(,PC PH!X[F  PAqT   P PĮUX,  [  A$P:P`P  `V    H` KX D PXP ` 0'ACHPA`D | !  ?p ,H PE U @D d(Z\(4偻`V`C{PC8tPpUPCn@pH iPCT@C H U\pp$pVp@ PLT`k\@DW,APG`D |  >p3 ,H P@a \U8pXH PLWPL PpX`Rd,PBAD |  >p d,H PU@Ⰱ Q XQX800P TP X䰝p,`KY TpB APXY@,`PeP U5  ` P @夭T,` U఑PP: @ۧP  [   X$ pWBgTpW A4<   P P`UX,` WT[:@ P㘧P\  PU  48a8p DA`$YFX,Pdh  X9 d a P @TX,Pd  Xd ఑`P:D@$JP d Z     @L pW\H`0YI `X弰 q, PK\IPU6 A  P `忬VXH`, Y [:`@\P  Z   08PK X唰p,`K dg8pW6 dA(   P PnUX,`d Wd8[:@ P㤦Ph d PU   \PHXYh Xlq,PK`\ \dH`HPUA dA,   P `VX,d XdH`[: @`LP d Y     \PkߍXPp@-M ,,`(p@0p 0TЍpXp RD <  ,000S?@H/$q RD @  80($0 0S ?AH/p@-@t RXTD   0 0?#B0S \H 0 Q ^,@PA@@`0D```PUh``@Sp,Pp@-q RD  XT P 0P 0?#B0SP \H 0 Q ^,@PA@@`0D```PUh``@pHhH-H L0?A00S 00ȠČ0 0̠ȌS DPO-,MPg Pb |80Ip$p 2;` P D V )PD `Q: PpA pW ` PP* V ;P ! 0p ?c00D |LW0H0 4;:P ,ЍQ``VP,@PqP@U  ; d,Ѝp@-P@P 8`具PYM@pp@-@PP `pPD8PpH ?30000S x00840 SP0  D0| Q 0 Q 0  R/p H ?30000S t00840 SP0  D0| P 0 P 0  R/|0 /KO-M$P`@T4 " !  !  !  10! qp 0qp p$pqpX\0`ph iTpj`PPD\ 8pЂT X0 0p`hij Q (   KЍ`x$@dpT ,A-MpPP=(PP J`P @ D  `` /`*pY`㩏zPX m pT gpO pQhPG  0PPPPP8(P:  0PPP-(P/ p+ C$p'  0(P  i'QI5P P P .^PpW Wp器ᗨ@ЍL HPp@-@ PP ^(`V (V`!@x\vQp@mHA-MHQP+P- #v*' !: !^ <0 | >@00_`oaf`!pS@qa R 0@T rpWxSqW 0RQ  00 0El!!QЍEh l 11Q/lDG-M`pP+`(P Upb0PY3af넕P ^ ><^v8#ݳ:ڳ0'׳#Գ #ϳH#ʳp-ų-_㻳|㷳o㲳p㭳br㨳vy㣳/z㞳{㙳M|㕳}㐳9  H  %!,+&.0p*&!?@ABCFDHG/ + I%I/ + JM/ + K*K/ + L %, M  Sb #, Ev/* G//* Ne ", OM- P&.* Q9 R   R 0S  0 S pW" sPUJ1P1p80Q  d0 0 D0?C 0( Pl Ѝ8F x n CTH-0 0 ( Q @(      /SO-HZ p`Q "P !?>`APQ0H P P| p @`v @@ KQ f p  `!>0@!Q QJ q" R R !0`Qq  0〰Q`Q 0 rpxAT `Ta  0 _`pdQa @ K. A7Z Q "P  P P p9 @F`vX @V@ KQ p(  `` ?>0 B!0 p;@!0`Q I`BPp( @,!A`l ?>0 BR!! 8`p P@`PЍ`/. @PLDD 0!\QdN d\[ O-M8f@  P`R`P Yp|0 R K Z 0 R KPm E( $ x!R  Dlh<p$(I"P  KT="P  PC XR$0Tp |$ t@0h0pPQ\pPPP QoPHP QLQdSTq倱,VP `p PS Wm LATj &*Pd P``p$V <P>PV*P P`@`p$V <P>@PV ^@ ዢ ቢT [  +PEQ +P E W  +P~? @ pA `pP _P \[ P TP#  ZЍ\[  *PP@Y*PPPV *PQ *PP @Y *PP P PV *P( 83 Y Y $|0H-L@*PJ 8*PD D)Q08 QP@Q8 P  %P+mQ,P P PmQ! 0 A R:;Ao0Q 1 A R:;Ao@;Q 0A P3@@001 T T @-"TXh@000  |@ ,0d@@0XX00H<0 0@VxX4@4@ @@(Q/  X/8p@-@P`` V PJpQ PP?PU9p@6O-MM@PPyPU J,P AqDD!D1 0prppp P 0 "pPU) aV S( W , % I(pPHX`  0"`VpЍۍ #㵾>>>>XQ uU ꌿO-M@PQ PsPp8$Q  BQ   BQQ9&# P U"P  0 P 0`0Q 0`01`N  ojQ @8LЍ Q  A AP ̡P op8<Q q A Q) q-(p 4 P@ x!@@; \+P7P3 L'hp  <PJp <P  XYH X PO@`!{hh`|D@- (@:p @ ػ@-@:p @H-M0< R    ЍtO-M(`p@PP U PJpQ Q 0Q[ЍK-Q1Q+ ZY# &p@P@DT P` 0"`Vp 0 "lK-P`p Pp W PJpAP P QO-M`$P@ `QPLU VQ"V Pp ppp@ !*PhP LDf8|  @[ mp] w  !>qP( PU YpD ᲻p P wd U Hp8 @ !>0qBH" @" Q5! !@10q! PQ p RJr0"1pW UpB0S 10Sp02\Xa ?#>0 BD1`R0 q0 p@ u)PPojPP xp|`Ѝ|| 0 Q6d\ 444h4d4P4 Է66X5P544J 333l333p@-P@p p@@ #)PLPojPP 0(hLpIJH-PPQ oj@0 R pP0   A>   C{ @H-PPQ oj@0 R pᾛP0   A>   CH @H-M@ R  0 Ѝ (Q/  T/ԱpA-`q@P qpphPB }PG      papUqP U]P , Aq@ll0L 440 ̺5ǺxE E E E ԯO-M, 1!a1sqaq P P廜U GP i V*  0` V: VPD0H |0-p Q` V 0@ -ЍЍ@- (@6p @d@-@6p @0H-(M$ P@ \(Ѝ00H-(M P@ O(Ѝ0p@-(MP D@6p `| :(Ѝp(Ѝp茭p@-(MP@v6p `h &(Ѝp(ЍpH-M   ЍH-M@  ,00   Ѝ贬H-M ,0 0 1 00 0 Ѝ0H-MP `@,6p  ,0 00 P Ѝ0Ѝ00H-MP@6p  ,0 00 P Ѝ0Ѝ0(=Q/ ▭@@-D@@p hi$  $DO-M3 *  @LP %P  PP Ѝ*0hi0hFp 0  P, yPЍ4\@-@ @P l 0 \  *.*4 ` 01SPNP$Ш,@-@ @ P  l*>:X01S ` P$P|$@-@ @ P c t= Q* 0OS*` PPԧA-,Az@ P 8 =^ZQ8 ``: P ! P  08 PQ  *0po8PQ*P8` P(8Ԧ@-@ @P = R  "+ 8 PPp@-@@PP%` ` P  = P * 0oS*` PTP p(P8<@8p@XA-PojPQ =~z@Q$  "+ 8 P"P Q j@Q  ,-  h@-`@@Q O=Q  ,-  脣A-PojPQ 3=~z@Q$ @BK@8 PP Q @Q  ,-  @-P@@Q =Q   0G-`P`Q =@ Q+  @0p,@-PP@P@8 0pPtP Q  @Q  ,-  ̡H-4P ̠,H-4P 脠J-@ @P }= R㰊:HP@ PH  Lpt PpLpp pP<J-@ @P G= R㰊 DP@0@pP:P E/H,P ?.*P /  ,P ?>:P 4/̅,P ?.*P /ᐅ 0P ?>:P 0//L@-xP JpP @pQ N6@v0tP "t@ 0P ?.*P -/ᄄ@ R Q/*0S/ 0/D,P ?P /P ?P /H-<P ?P p H蔃H-@T' jpP @tQ 5H0tP |Q pPpp|PUw tH?H0 |O- MPE ZCz P=S;p0R@P @pQ  K`p 0:PJP  `FPGP  J0  Ѝdc @,P ?P /$O-MPpW!  K`  0W* UP  0`Kp   0zPP Ѝ܀p@-? ZP ?|P @`ސ|`0@Vאpx& @P@|0㊎P Q @XPPpD X|$pp@pAp8Tp@-@? P P P`璐`0PVp@芐G-P @zPP  X `@ P R R' A0ɠ ,   BL\0!저|X/0, 0 F`00`R`` B0SXP PUPP`opP `VO-M   Bp T P  [k`p 0PBJ' [`Fp P bP P P(@ PJ JP Q P@U  J@W  ~ J@Z    @ЍO-TM +` R TЍZp!R @ 0 t03TЍO .tATW |! BR8   P,` 0TЍ € 1,p pWS@4`  f pʀYpt 0@ 00 0Sp ` t1 Q 0 0*` q Y`G-` PPp h@AAP@Y ZXT  P@P SQwK-P pP2@ P+`P:#P$JpP $`V(V QX !`ppPV pPV pPvH-?Lp0 S @ 1  0  TwPL 0H-@{P  R"4唎P PUX P R P 0S0 0S  s0q,o`Q Q QP ZX0H/,vD  R/P@0?30Q/@ 0<( /uP/0Q@?R/@0</Q/ uR/Q/ <tR/7R/p@-@@P?`+ptS/p@-P?`@pH-`Q/X0*@ 80 @ 80S84@tH-P/X0*@ 80 @ 80S84@S0sQs0H-@PU XTP@? @<8P@@(0rq0H-@PP XTP@? @88P@@0qH-Px o@XjPpTQG  Q@@ Q@@ Q@@  Q@@ Q@@ Q@@Q@@4Q@@ Q@ @@Q@@@Q@@@Q@@  (QP   8QP 2  X0@ (p0 @ 080S@0H-PQ P@XTP/  @ @ @ @ @ @ @ @ @ @ @ @@@@@ @ @@@@@@@@@     08Q@ @00mP@/H-TP 0 R S !\ R! ^ R (!R !R 8!R !R  R LQXmH-TP& 0 S0 R !^1 R! S0 R4! S0R!S R@!@\R(!R !R 8!R !R  R LQl0H-@ P[ 0Hl0H-@PR J 0 P  S C 0H0H-P@7 0H0H-@PQP J P  Q  0Hk0H-@ 8P%p   0H0Tk0H-@P%p P J Q  P0 0H0H-@P%p  0H0p@-@ l`P%p V J P  V p p@{TjO-MP@`p,4T'  㔀) 0 ᠀ @D PT  0pڔX ЍiO-Mp` 0PU(@ 㔀  0᠀ PE `U  0ږpڔX ЍO-Mp P@T'㔀 0 ᜠ堀 @D PT ` 0៖pڔX ЍH-M 0 0ЍfO-M@$p2 p`oV) 㔀d 0  ᠀S `F @VP 0SpڔX ЍO-Mp`0P1U' 㜐% 0 ᤀ娐 PE `U @ 0pڜY ЍO-4MP, A\pXaQ  @QB \$YIPPK X@PzvPX @X`   T@ U8`F  PV p pc `VTU8P   $P X@ T P8P  p aX@T PP' 0 @T (0 pQ 0 Q  0hPPf @Uq, D0|@0縐p H LPEpG @U(0@   X@QmZCAZNTQ8P % (0  p0S0 RPD|p HLP`P ( 0A@p Q0@ TP,X@` (0 P P  @ xtH0HSD#P0ᰡpP:Xp@@ PPN @pW@ X@ZPpG pG?PW P k Q%Q{ `Vj,@pQp_D|pp HL `!PVMP[PT R 8P R P P@( 0@ pP0@ ]TP,0( A % 0PPP Q `E@(0F  Q  & P4Ѝ,, a l^O-M@pP H`Pk\8 Q A ЍVrXTXP EP8  P  ,PBp@㤰 0ⰰ pG @W ڤ 0 `ᄓpڤ[xj @Q _ T P 8 O Ѝ, X? @`冔xt0  pl(Php`0S0 p `S00Dp X1P  W H`! 0Q!!` 0p00 GQЍЍ Q H@48!R!RQ@@/WX48!R!RQ@@/`W4P @@/ WX$Q@@/VD/*X(!R!RQ@@/W/X*(!R!RQ@@/@/W@/A-P8@  `@Q yxPp fZ <P  R P@@UV,V R/A 000SQP T/VQ/A0SRPT /0Q Q//T0Q Q//pT4UO-MQ @pP\PHX P\T \ ARA `PhVTV[Z KQ`K V @ Y+ [  0@K[ʔ P 0!! F VPE`,0p!W,!I YQP`,D | p   MpM `PVᰁH P PHV 0!!E `V,0 !pSppppp!, Y!PUPp`,D | 少  p `pVЍPU 0@gPXP ЍShTH-^ a^ 0S,@ Q( ,APapP0SQPQ RA/Q R  A//// ///PO-M@P H?A,0DP   p@Y*  Xaq | Pkp pW:0@  hЍЍO@-T0 0SQR,,r@  @ A``( R/,0\  R0/Q\ @@O- MP5,`p@䠟 @T)Q PPaBQH0 0A  P !(Rp (X! 2/p < 0 Ѝ ЍPMMA-@(P $Pp(pWa,Q 0QaB8pP,p0 p,Pp@-@(P 0P`(`VpH-H  R <0Q0 RG-P pP%  0 @ QB `P V ``0BV` V `QB   P BPPPC: ` P>`PTPHP@ U P` V `UPV`%P `P R  0S`AV` V`Q R @R RP p h $P Pp pp $JJKXKJIJI\IO- M@0ZX'PQV Z0A(0N01 ,PP`,PaE`a ZpP`Q` pP4, ZPPl j,0RPe ,Q4FPY 0 H0p4,PP P4Pp 0ZPJTPP*`pPY, PPDp`׎| `cp 就PZPPQ P ЍPU  `pR G 0p PGQ QpPG p$ p0S GR R /PU  RQ/$0$\/ P/tFp@-`@/P`*P0T0p$ R Q P8U}Pp4FPEG-P@Q謡 $ Q P P0  @$ ` V`V QIR H@p 8  0$`p WpWPQIUPH p PkI p$  `0S0 SPR HU P@p |@hT @T :@p@ED0DDC8D0H-P0S 0@@T@PU8P @^Vtx 8P,0 00@ PU @P@U@S 0A-PQJ@Xp0$`SRJ p`V` p`ApBX 0S0P P ZPU   OPUPY0 P >8 Q@ @ 8 /0H-M @0P@0Ѝ0K-MP Pp@Q G0 U `E `V PЍ`Y` ^`4@@P `$P0PD H0P pD H0` 0 R  PB(p,0 Q@, ! 00  0pW(P@0H-M @0P@0Ѝ00H-M@`PTPE_o0  RPP PP Ѝ0??O-MS8UPYSZЍ@<@`PP p @p< V p(@  0A[ 0cP ~DQ HHP `P$p(PPX`@p _pW ,[D 0`@P"0S  Pt=>==H-M  @ 0ЍH=P Q/H-M$000kЍ<O- MQ@R ЍPUzP @LzP, `}P0x 4PP# 4<LP0 `0H 8|@Q`  $H* \`dhlp8}P4D p zP= 0@0(Q@ 0Q8 ^ X9 0p@8p pW$0Rp@S8pV @08  R  R| !Rx$Ru RdQ8o~ |zx@e8(^ 00   `4 X` x P4p` , G04 !P# 0` XaH-MPЍA- @@(Q0`p,0 Pa B,0 !00  0-pW(`p@-_X Z80P\E @` P8`Q p$0 TR80Q08Q Q !Rp$R RdQ8p:/p@-M 0 @ P0C B 0 L0N````ЍpO-DMlpS@pG@`h0tR0C@VFWL@`_ L pS PE@pRQop0 pER0B pp^0V0DЍ x b 1p 0PV`P , P YPuP YZ x@  $P  0!P 0  Q:\55H-Mp@pQo :  tx 0P`a'Q<9 D 0` FA/   Ѝ5|4H-M 0  ЍO-\MX0P8  P0( G  `PRR0J J0pR  0pPP CJ 0P@  8 @ 8 8@88 ,8 80 8 : `v q`R 0z S,0spqs p8E R :[,@``v@[P Pp,0PPE1PPP0PP 0P,p00C1@@@000~`P8@ 8,@t 0SO(,p,@ ,08q0 (,p`(0Q pR ppW8` p@(p@W@ ppW8`,@" p BR`p@@ F`0 V (0  B0s`Tq t@A@T00T@0p 0sP<@P@0$X04 X <0@P X T @q Sx!Ttq0L  P@D0Hp  Q`Q@ptPUHPD @Q PD@DpQT:P @Xp0@$@wPP@pQAP0@@u@T @Pq@pEPEq@UPD4P@LUHDLp|P00p, pw : $X`D0 !vPQ|Lp 1q  pyb p$ 0 `( AR  p(@p`GT`:p@ p Pဠ(p p`GP`@0(@ 0@T@P0:,@  (0 R (0`V0 `V(RVʛ\ЍK-M4\008P?SŸPEP` p@ @D`FTpG0`Qp 0ЍЍO-P9X /  Q.,  ! ! B0S0 S0BR @ P T/@ @aa$uV,` $P  QX@ PQ P8 0p  q` RQ(X3aP dP/ \ PD (Xc P^  !qQQ@Q ,  Q`XT@`-, 0 l[\/  R,`@X,0D[     ,A(Xڣ0 ? :X  _ _Pj8 8ԯ   0W0G00 Q PPPWb Z0aСV\ VPPdPQ D  0u  0p$   0D g 0pV P / 넯 ,`x_PP lX @($ $ 8up4@P9$e`  a @pPUG/@TPP PCA| }8tpD@,ZdddT P `@XdpppK$WG,$ 0!S!`q 30S0@?3S P  P CPCA $WV D@# G @ P    Ѝ@PT~P D" 4P ( PCA  @T(QapP` qpWMGxPP PCApp1zzzzzy yyl PxLxơWTJWTV W |`@@@@` pVpW ':p`@0Q1P0#1qa0(t!p`Z PP# PqD % Z% PP H 1\0 H P,@@ T !U``` `  R00PtPP P t0P(mpjbjjaxjiA-0P Jpa``VPS Xa``VV<1oj00`V%`AVPa4 (40`BVPa4 (40    1'njOJ Pn`"qpWpr`V  0x4O-p! XS T(D$<XE @ T T' Q0,[S qP0PU00S0000`VP 0`VP[@,`` V T1p00PQ 0pWXL@-^:J00`0S4?:00?:0S0C^@1,0 0(0AS@1,0 0(p@-M@P*J\ R!ڐP r`P!lP0gnj Pn`l R /*P 0 0 @ 8Ѝp@-\JP\@ T،n@L@@grH-  0S h0/+0 #'/*8P , Z|Xc(ccH-8!?: 0S%0@S 14 (400AS 14 (40 0 00S `0/+0#'? :8P , Yaaa/tG-x" R d" @  " Lb?:@`X 0S9 S|n"QJpP p! V @1@qP ڟ ql|! ? QFZ8ꛟQJn0"<p$P p!  @1@qP ڟ q   n"Q ]?:  q d  X@ @\a`t4$h@-@dPPDP ,   @@d,/0H-h@ Q pP QpP U  P00H-@ Q pP QpP U  P00H-$@TrP000H-@KrP0@-Q PSZd000\^@, T@@@!\@@@@ @-R0QSZ\^@,0T@@@1\ @@@@0p@-0S( P ^0@@@@0S `0 0@0SUPPQPJ^@ T`,VA```pO-M#P Y  wrPCZ `p@P1DWGP ЍO4PX E@P PpPTV8P  u,!A!W1Ru@ @PZ0 (p00P 0S0jp@p" W P P @dT D|upS H pGW `[: |KpG|[*p?P p尡 : @P@`_P1 pPUp Z 0p`!pp 0p B Q( 0A pQ 0@.PPPЍP@h 8h 0H-@ ,Pp 0H0L0H-@Pp 0H0   O-TM`Qo phqPC[ ^P @P G PPR0@[*dTЍP$0 @ pR> 0` L  5qp 4WpCI 吇(+$P @ P TU8  P PP P P PXppH$p qPCK $pPC P  Q$`$P@$V`FpPCYIKP3 @Q! ||h p@D$pPǹT@CEt!)+ $$`pPC  APQ J $ ,Q1(p@P0W1P@u pW1pP.  b@QpQq[@D| pl H !K[ PEKU*Y$ p(`P@ $P ,@ 0,0P0(  0`Yp  0@` P$ P@T @PPR P( A Q PQ pbTЍ D0H-@ 0Pp  0Hq00H-@Pp  0Hc0p@-P 4@`p  p@Pp0H-@Pp  0HB0Q 0H-M@ P UQ U PQ, 0 Ѝ0H/ P@$PUPp@T@O-MS `p  "p01Pp0.P 0P000pE`/P *P@`p|qUh HD 2/`P$U<P,.Z@>zP [ ! D.Z  0  0C AHDp/Z *Z@`` `Q PQ`Q'qr P P@7/@DT PH`DpP PPЍP qpֶP@7/@DT 00`B/P[^ ([ 8Q H-M0 R!R Q L ЍH/ $ R p\,H-M<<000 0Ѝ.K0KH-M0@@ (ЍJJP0H-MP@PQ PQ  * P Ѝ0dQ\QD  <x 400 Ѝ0`pJTJJ J IIA-M@Q,@PA PL0 @? 2"!1K`p@pA% a!a @ papP `V $Pp`Vp fP]P@ @Ѝ赁NTd  @paP `V $Pp`Vp nPPOЍkLc V A-MPQA@PPX `0 H!2" @ pA0p$4|q@Ap " a@qP* aV$ @T $P pp@T WsP P`V X PU ^r`KPЍ-?L*Sb U 0 O-DM46lP%ZPw $4:p3pP@ @4:P8 P Q9 21=QA #Qz Q/1  8084U<%%!1KP@%A % a!a@pQ +`P =P P4pq`o1 8084T<%% @ 0A0P$\4@$A #" a@QP8  $P01   808PS<%% 0CP@<#A ?>@pQ `P g ` P2   PP.  P*  P& | P" h P T }P @ wP , qP P   ! Y P P P\P=T ,@ q @Y  p@V ^@ ,=pG w P`Q6@pP@p@DЍV ^^DЍ-?L*SkLN,_ $Q C^ pP ^_ HR _ V 2 d ' ƒ c c c O- M` XP @0p    00.R A*R0Se p%+\P p  00S@   RW%S ,S  RP p00P000+0AGS`1  << 4  R P    p   0  dQ00  00p  d [  Q`P`p0\Ph        c p@0iQpp0ppp!p3 QPp0p0000c00h PnHH"0  ` + %~!\P  p PA` 0\Pp P.H% -,Hp@0 W:P\Q P^P  P \[$ `@ P\ @ $<p n/> Ѝ%p0%p0%?%>%t%+%;p0%{2}%*[ 0H-0 ^^ \^& 00NS* 000 0 ^\00@ P Q 0E  C ~0 % ,  P P,S 'S\S/{ dS :)Pa0 !  S :@b%aB 0   b0%! NP0 P 00}0:S ' 0000 0`ĬO-Mp@`PDpQ$ %QpPp1@ Q:PsPplP T TX  @0@@T`ЍMH-M 00 0ЍHЍ/O-sMpQ `PP T [ U<[ 00@4@PpUP, 0pp$Ps PJ PQ$ %QpPP1@ Q:sPPlP Z Zڠ 0@Z @8PHA T p@T` Q R+c ,Pd  4 @ `@%T TP`%V `40 P:,PXYPI 4,0P% P0 T-`@ `0P`@@Q* 0F@XSe qP0d.Z00 0 AqR Pl00P`0Z \ !F]P?xxTxxxxxxxxxXxX4`xXxXxx P @ qP @  > pP7&FVQ \888,48<8D888888888888\l|888888888888888888888888888888888888888888888888888888888p4 P @ A P @ ~V !Vo@ Z4 0 pP*,P W,`WP 4,0` 0xpp 4P4( PP*   P 'PP'PI P @  P @ A  ;R ?R%Q Q P- @a@Q OQFI/P88P@@ P @@ APP cPT*1@P OQ!80!0! !P  P @ P`V @ P4 10 P*,P P @ P 0 0p 0@  PQ*   P +@p>p@<W9 ˭p6Ppp2@or.Ppp*PWpp$pp!p W ᲮppP}P}PA~V OQ  p OPq  P %A@Q" OQ}a ARI/A AR y@40 P*,P _,`hVPY 4,0`T @4 @] APT:VO%Q Q    ;R ?R eRP P @Z ,p(VP 4,0p  0xwp444,  ,ppsߍH4(4( MH-M  0  0 ЍH Ѝ/ MH-M  0  0ЍH Ѝ//K-Mp`PQ``P# P Wp*PpTUP  @TpT Q# X+kX)X! T tXXy P XE X9 X6 Ѝ pP Q  (P <P  ]p(0P  ]pXЍ<4., )ht@ CF EF 8Zd JMc #0vP< P @ppp Z <8,P < R  0 S P'@ TP@PP <  0f4P8080 PS*W$P  ,@P@U@ p R@Ua pPU;< f0@@ @I80P. 8PP  Q @Q p\Q P UP @PU p\Q<0QV0PE 0R  , 0 0 0 p0PA0Q , 0 0 00P@UPP%^T ^URPu , 0 0 p 0pu?QQ Qd PEE/QD (4@LXF  , 0 0 k 0 5P2 /, ) & #  @Lp W :<P 0 $C84Px4PP <p 0 38i( Qt<p s08PVuu,p Up pP< Qupp~<,80Q <  0S Q p<0PP Yz0R < K Pp\pP@ ppW <4P80<Q < 0 0S 0Q  pt<0PP84 PUR <0eK lP/@-@KKK@KK K0K@K  $P/v9 0H-M@+0  2"!1KPp@ A% a!a8 @ pPpOPPЍ0赁NH 8 !` P/p9 0H-M@0  2" 0CPh@ AL ?> @pPePPЍ0kLH 8 0!S/w9 0H-M@0  2" @ PA0P$4\lP@APH " aP@0PPЍ0-?L*S`G 8 0H-0M@PRP 0Ѝ0 ]P PJP&KP> nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- P+ PP.P, 2PP(P! K P P"P PP P PPPP P P P PPP PPPR0Ѝ0H-qPpU@@P1 Q|``,P | p` `Q  W|`pQ  P|37`2`F``fehfH @-P @pJnJlJ jJ$hJ,fJdJ(Q(/Q/F Q R/$ R R 0S/0 0S 0ˀS0000 M <@$0pPT/Q R/$ R R 0S/0 0S 0ˀS0000 M,04 <@$0pPT/K-@P P P $ RpWPHP`q&0V`v`fVP8Q(P(` (2/8 (` P $PP QQ @R 0 ) /+ 0 M,@0@4@ @@@@<@@@$@@0pPTH-`R @1P8S T, 0PS(00 0$.*P$(3/P `p8`@ jP P$ (2/`H? 9`0P  Pp2"TpH0?? 4Pg:\P `9N? /`PXVU[ PE`  A? ԏGpP8X?|pp 0PTX \0 0 P`@ ```L9 `C Q? 婑`FGQ?XTp``0D  0 B R{ X0 PpASk  jP`yPv ? sP 0 % |SH`Q`dph` :L Q? `E?l`/ 0p࣑p`F0Ql7*VU 0PE6`$P)  ;6? `U  EV*R  EVR  EVR PEP$P ~7? `Ud  EV*R PEP$P)y     ` $`P`P  Uy V00E *S_  PE(_P$`DQ  `P9?  `P`PPP `U $ RQ `@A`P`P:? $P$`0S PP`PVS $`QP R25`7 V0C`0LP`p;? $P$"`0S PP`PVS $`Q$P (R25`7 MV0C`0LP` \ X P$XV`PU 0EV *S  `PE`PP`  HY`P P`$Q ,0  zH0Tp?? `PHp  \eT\`0pV aHp  \UT\`0Vd V)dHPed `pBTp P00C\ Q  LjTp HP)ed d `p!Tp`> H` TpL` G ))()4dHPgf d e0 `pTp Pjpdh T0\0Bt0BP <\Q?TpP`P` Y( P(`P `XHPedd 5? Tp`D$XQ 0  )$`pXP:P ? Tp0P  P 0PH`DO? Q P V+`0Sc 0CV*S  `0V 0CS  `0V 0C S  ``@` E ``0 YU \4 Q?`PXb Q?\DG? <8\P`P  `Q!P#*XP Pe@p00 \Q(*`0% pS 0C` Q:XD <@`n??PP <@`@ \  p`0 aV# ! ,2 Q `V ,``P \  `PLP ` 2 Q PU P P@ B P`1@ 9F`T0 X9 ALVc \ 0`e@ITp?  LP` P@ J? \T P 1pV*`0ZS J 0pS:\\`0P @P:X8 4@  2'a`PP`V%P` PP  `P@P ` 2'QP^M? Tp`^?? 1@ @ `@9岀0F9`C@ \K? HL R V*0  PQ A0S:,L Q P?XTp#`? |? P 0@``HpH9`CLTp ^ DHAP0 `PX@P@Q \PN6 X `PH4P, 80@B8 A PP B 0 R0N\QH Q? P( )R ( PQ`P<4L Q?0 )`FTpQ?R  `PE)dHPed `pvTp PL0PQ?Py=P? ?\ ?P  LTp `0PSLQ ?,P PPXTp`Q R !`a``a$` `a a ?,Q>? Q    Q 2P R?  R 0S/$0S\ 0S/$ 0 R 0$/A-MP R $ R\ PЍw R,2 0S0S@@T:S@?LRl/@ <@00<  0bP !d0P @l@PE0``,@pV003WfST*@`Q: l,0@ S Q `Qpp3VPPaWP R*U:PlP0@0U D Pr OPQ 00?K? M@,P0P4P PY PP`<@$`P pPTh7Q R/$ R R 0S/,00SA0?<Q@o/K-pQ 0`S @$PPUP8PT (.*3/pP 8P ( 0( 3/P$ (2/8 .*MP  R@ :o=RTp B0pG 0P T0p YBp ( 8 h8Q R/$ R R 0S$0Q/ / R 0S/$0S\ 0S8 0 R/ Q P /Q R/$ R R 0SX00S/;Ƞ Q C? 0QD0D0A /Q R/$ R R 0S$0Q/p@@/O-|M000RX0\0`0d0h0l0p0t04, XP0p`pW@```Z 0=0P5 P1 P- P) P% P!PPPPP P PP 0e X V XV6P/P+P'P#PPP P P P  P PP X 1UpPJugPLJnPHJFdPDJaP@J$aP(:JaP 5JaP0JaP+JaP&JaP!JaP JaPJjPJP ,op$(,@ 0Rc3  4p80pR `V P`P``0T T Xp@L`@,$To@ X0pP0 $@, 0(`Q :T``@ `,@0K: S( q!0`B @K  X @@ PD  P $@$@ [B 4ర[ R UPpK [*X0pI `@P`0 V:pFQ0#%S0, 010Cq! xZ @ 00  |Ѝ0p- 00 @  z . O-  0@  ᛶ ,QP @0S 0  pWpW  ~ 0  LQP. IpY  ], QP @0 0 IPH  P- , R P0 @0  0pWpW  * 0  LQQ0 p 0 00Q ,P P [$PF  P- , R P0 @0  0mpWpW  ۵ 0  LQQ0 p $0 00Q ,P Pg,P7   R!+pWpW  ᙵ 0  LQPI0 00 0  00 8 0q pWpW  d 0  LQPPtPg P^ Qg QDP tPtP? l80 ` 00 1pp t l Bt lQ\ 0R8UP @Cl\ pWpW   0  LQ2$Vi PcP! t P*tPV P P`l3`lX. 80 pSW* W W% WgWfWeWdWc Wb Wc  W^ Z  800 00 1pp t l Bt lQ\ 0R8UP @C_ l\ pWpW~  Q 0  LQh      B B , R R` :u Br0p0pppp1pq  `lb t ` Bt T 2/4VA V \l 0P8U BP l\e pWpW  ӳ 0  LQQQ P<V V[  0p V LD  pֹtP\l pWpW  ታ 0  QLP: VQ:0Q: 000  00#00 3 00  00   00 00  00 (ЍЍ  <pp0  000  4pp0 00` pWpW   0  LQP`oЍ  @0 07 @0 0P+ \PJ8l 0 B l\U pWpW  ò 0  LQPQ(Ѝ@-\ @T$@T^ @ T9@L8T;A@L\*\0| p@-!!$2T3P%0 PU $PU^S p@T9@@8TGAP, P P%l@ T#*P @LP@T PPU `V$PU `V,@T0@PPTU T0p!&!'pO- M , AQkZPPY  @*R:1\lp` BpGQ``1V` V *0I?oV 2  RgYe Vc&)o ᠒  0 &$`@ @@ !@P @T@T  H 0  LQW 8\ W p ,\`F P,\  C0V  y 0  B0s@ `R' , V&*<l@P 80Al0 lPP8 0 C, l@V`l l 08Cܰ,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l 嵰l P,R@ T@T 8  , l@T@l  0* !CP,p5R\1XApQ*0I?oQ 2  `R?Y=  R9Q7Q@@`Y Q00 o`8 0 p\P\@T@T  P 0  LQV` ЍA-PQ ` P $P@TP9 @8R;! ,P*PV 8 ޯ 0(/+3/PP p/+p̯ 0(, `3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 ឯ, @@ ᙯL DD ᔯ 启 0 b $ 0 BP`kO-MKP tP "tQQ P P:8 lX@H` TP Dp$"4 p@00H Q , @ Ps`Pu:lp t@Ap0p` A0p@@p!Tr  Rl# ``PpXd1` `` `Pt b 0U` @Bt*P(:0E`080` E@DH`lTX4P @@0l0 pk'`p`  BrH`0  KPl r6l 8p `pl pX0THpV Ha%`P*l80 pp 00p 1pp t l B t l P:\0P8U BPCl`\"pWpW!  ᐮ 0 PAU PЍlP#Q.\ 0R8UP @ChplP\`V`V  Z 0 @ATPPPQ/ \ 0PR8UP @C5`l@\pWpW  ' 0  LQPPPd4O- M lt lBPt; tP tQQ. P0 P08l`X@pTP!p4p0 P` d`Qx Hp` 0R#*l0, p|G 0CSP`Q `` px `dR *ePlp@ Qx RZ:PXd0lt B0rpP0pp0`C#0v`ppX5 VLc 0 Q0``  bOKx`Pt0Fxl 0C@pF0t0xppGw_ `@ Vl`8XH0T!D@4P 0@ P PHP`hP~ 8l0 pPp 00p 1pp   P%\l 0P8U BPC `l\ pWpW   0 PAU`@l h Q\ 0R8U@P @Cl`\ppWpW  ެ 0 PAUPlt lAh tP ЍhP 8l0 P0 pp0 q`` h lP#Q.\ 0R8UP @CplP\`V`V   0 @ATPPPQ/ \ 0PR8UP @CZ`l@\pWpW  L 0  LQPPvPtO- M,@`x @D|0RlDl@4@#1!PTt`8pP3`P` P P P\ P PX@TT@TP@T%@T#@T!@T@T@T @T @ P`U@T:  ` P@H P p P  U*0SR  Ѝ p@-P@P@T `@ ᑫP P 0 0 F0p/X Q/O- MR: p~P`4`%0a.&`RP ~p`R'p.  ~p`R'p.  $4`3'21'R@cUg 1C@೟ 0PP#%3 u`a0%G %[`#;@P@$`% P P%%C u q@ p$%G @%[p$P@%p&'S w`aP`%'W '{Pp`%@'@@p 'S w`aP@`%'W '{Pp`%P' PU c ppq`p& k  ` &00p!`P DB'@ppq 'ppq 'ppq 'ppqp'p' '`ppq 'ppq 'ppq 'ppqp'p' 'ppq 'ppq 'ppq 'ppq p' 0' #pp01 #p01 #p01 #p010#0# #p01 #p01 #p01 #p01 #R-:10p~` P@.  Bppp'Rq 'ppp'q 'ppp'q 'pp`p&q 'pp`p&q 'pp`p&q 'pp`p&q 'R \00~p R'.  Ѝ~p' B.  P G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" 8 G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" ` H-P! 0  @^   @`AQp#pP` pE  H-P! 0  @^   @`AQp#pP` pE  @-<0@.@ @L0## O- pR .*@P A xQ8xQ R*R p R ~zP , @ BK[>:RL:LL p`@vpGP0@P 00@P@ P@P@ @ P@ @0 P `@ @```0 W997w  [njK0<@RRG R5:0`P0` 0@p`Pp`@p`Pp`@p`Pp` @p` Pp` @p` P 0p`p`0pp0  BRR 0 R 0!0'<K@ Pq5RC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`SpqRC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`Spq/ U/ `/h#XX X080b$0 ;0,+  ꌯH@H-ˁb ;, R $ (  H-P @  Rp"` ` p`  ` s0pb3Ǡ 0B S S0 ppp‡0 S0 pp0 p``pp0  @ $4pp0 T0000 #4pp0   {H- R0  0  R0   B@-/+ 0S# 0@@ 0@  @0 c 0C<" 0 S0@00 0@  @0 0C0S0@00 0@  @S@00  BO- M@/+P ,0 ̌S8p`0`V  PPU p p0;S;S<S p,p @  +嶉̌R<JXPP0`pp0`V/  ᰀ@TR TR R  WʶpX RPPP( 1 P=J`RPP`0@@0S/  pWP WaPppP P q```sps Tʶspssps@R P`P`P`P NQ;Q7Q3Q/Q+ Q' Q# Q Q QQQQ QQQ",0 0q@ W0<0S100/+ RQ  0 WR+p0   0pp0p a0 AR0Pp"0 0 0 pPPp q0b pB1 " 0p+( W<pPp@@pP@@Pps0g pG3p8 Wpp0PP0pPPpyp0a73 pA7p WpP7p@0@0p0P@@P0qpc PC1Pp1~0 ̌PP0PP @UA@pP``p`PP`pg PG4p b[    r Z  P  00  P 00  ЍE?`ppW`p V 8 O-DMTp=0{< 0E>:pp? @;X Ϡ0+ˌT 0@ p0 ``0T PSU YP!Y\k `差y 00W @X 姠  W\ 6P 0P\{y0W'Up!@`XV @* ` Q   `\{V:P`V  Z\+yJ 0  \;Q !pAy\;`+0`;0Q 9X0;!`A\{ @`yW(Qp1A @PU*0 X@K@0 @T000@\{T:X@K@T0 @P`;!AQqA1@ papX +p0PUP100 @`9Sp!\;9 pSQ0QaA!@ R @* P`V  \;R`:X + RW``;p APPP10)pppp pppp!P0!pITp@pT- 0 ` P ! Y`P[`? ;000 [ 0 K `0>#0 R  ` 10 0." =̌W7 >0 \?;0 `R BV @`F`B`` pW`B`Y /+ pv0S apGVPA`PY @PI啬%P尐0CY 0{` @^  0p0p``PP "! 0p21`r0qcpaP` 0p`S#3tdJ$ Q !0S p0`PPp@`Pp0C`SʰPDЍ  差 @ @yW `R00pyqQ\;XP[pl{R pGYl{ 1p00G0O-Mj>:kp?;W`  @$@p^*p`PĆ\# P`kA$p嶐b@`dWᰂ3p` p!``$` pf@9専@D q@$PbpE`gUB`PP@P!`@@`$@PdpP P L@ppp@-@`P P 8@ppp@-@`P P $@ppp@-@`pP P @ppp@-@`\P P @ppp@-@`HP P @ppp@-@`4P P @ppp@-@` P P @xppp@-@` P P @dppp@-@`P P @Pppp@-@`P P @<ppp@-@`$PPPPpgntsp@-`PP @ `Pppp@-`PP @ MPppH-@`p<PP P PT atadp@-@`\P P !@ ppp@-@`-P P @ ppA-d`c\@PP6P p P pgntsp@-@E`D$PPPPpgntsp@-`PP @ P ppp@-`PaP @ Po ppp@-@!` P$Uoploobp@-`PP @ !PI ppR/0H-@!P< 00H-PP @L"P- 00Q/0H-@?"P 0@-@!@M@-@!@m@-@!@@-@z!@@-@t!@@-@n!@@-@h!@@-@b!@#@-@\!@G@-@V!@h@-@P!@w@-@J!@@-@D!@@-@>!@@-@8!@@-@2!@@-@,!@@-@&!@1@-@ !@Q@-@!@lp@-@`P P 3!@ pp0H- @P P!@ 00p@-@`P P !@o pp0H- @P P{!@\ 00p@-@`P P @H pp0H- @nP PT!@5 00p@-@`[P P @! pp0H- @GP P-!@ 00p@-@`4P P @ pp0H-P!P @!P 00p@-@`P P q @ pp0H- @ P P @ 00p@-@` P P J @ pp0H- @ P P @ 00p@-@` P P # @ pp0H- @ P P @s 00p@-@` P P @_ pp0H- @ P Pk @L 00p@-@`r P P @8 pp0H-P_ P @E P& 00p@-@` P P @ pp0H-@ P P @ 00p@-@` P P @ pp0H-@ P P@ 00p@-@`n P P c@ pp0H-@[ P P@ 00p@-@`H P P =@ pp0H-@5 P P@ 00p@-@`" P P @z pp0H-P P @Ph 00p@-@` P P @T pp0H-@ P Pa@B 00p@-@` P P @. pp0H-@ P P;@ 00p@-@` P P @ pp0H-@ P P@ 00p@-@` P P @ pp0H-@w P P@ 00p@-@`d P P Y@ pp0H-PQ P @P 00p@-@`H $PPPPpgntsp@-`PP @ #P pp0H-PP @Pu 00p@-`PTP @ Pb pp0H-PBP @pPQ 00H-@`p <PP #P PT atadp@-@`P P @% ppp@-@`yP P @ pp0H-PP @P000H-PTP @ P00A-W` \@PP^ P p P pgntsp@-@8`l $PPPPpgntsp@-`P$P @ GPpp0H-PP @P00p@-`PxP @ #Ppp0H-PfP @Pu00@- @P $ gA-P! @ P Py`` `ܘp P # p< 0 0g 0 C @-P @Ḙ @U 0m 0딐 / @-P @ᢘ @? 0m 0< א MK-M$P @$ 0p0PJ` n P  0P0 pЍK Ѝ/ 0E 0|l ڏ H-P`pV" E P @`P!T `C h!@$!4 PeXd, > p@-P @Q p p P P `pP #\\! P @@` PpphdT` xcH-@P PQ  p P `pP"\\! P @@O`X@xc_ cQ/ 0 S /bQ/8 0 S //Q/|b^ H-^ L0 SQ 00S P " b0^ Q  0 S//ap@-@P PTQ p C P ` PV"@pxa] Q $ 0 S/Q/a,] K-M@P, P`Q%V# Q   P ` p0TP S07/@ Pp Ѝ`{ \ K-M@P' P`Q V!   p P x0x p0 P0`/@ Pp qЍ(( (0+ 0_[ Jz P 0(  SQ 0S /^H- R 00 S Ro^Z H- R 00 S R̗oL^tZ P 0L  SQ 0S  @/  PQ^ Z P ,00R  @/ R]Y H-M$@P > PP  P0PP, 0 P# p P `0 P  PL  P Ѝ0]/H-$OLX4\H-P Q H788 80 0a$$ $0 0b눅 k h K H-P H 0 0o e } @-@lP XHѐ<P OM@(,0H-@ P PT1P P 00H00H+H-P 0 S 4  PQo"0V  //p@-@ PP ` P `V:<P P Pp P P>p@p0H- R PP @Q P  ,  @00XX X0 06DD D0 0.00 00 0& , M ̃ E B 0H- R @PrP  R000H-P<@P /P P PpP P>P  0H0p@-@ PP ` P" `V:<{P P PprP P/jP >eP  p@_pp@-@PQ@ UP> @;Q <Q >Q&H`P, g&Q&=`P! a7P m2P p &*`P l$P tP ;Ppp`p0H-@P<pP| P P P Pp PU:<Pg pPb lP] iPX sPS tPN  PI vPD eP? rP: sP5 iP0 oP+ nP& =P! "P 1P .P 0P "P >P  0H0f @-<@P+ /}P& pxP! lsP inP siP tdP >_P  ZP @T0H-@P  \{P P 0# 0 K-`@Q rp0 PCU pP<Sp0!S0-S0-SV000S ppS   0-R-S >RppS /SFPPQ PpP` p(`>PX` P\ b`P/Q PY $>Q; $>Q5 Q PQz  Q&  Q@  =R(  P R0!$PP"Q qR  PR "R  PP>Q  0 0QXx y y p@-@P&U U[ <UT `Q TT*P@PaPEUL`QD(((((x((((((((PpU% mU3PpUP;U.&P`PtUP;U&>P`PtUP;UR``<pP >P `> Ѝ`it kt t O-GM  cEF T 1/  0PQ aVk Q 1/P@`P pf T 4/ 2/pT 4/W `W WqWq) @`@pP Q 1/P``P P  2/P V 6/p V 6/Gߍ 0 06 0 0- 0  0$ll l0; 0TT T0E 0TT T0 0B o r q o @q Lq \o q ,q o q tq o q r g@ > A /@ j> ? ? > N@ s@ > .@ @ > A R? F> @ A K-P: P`VA@V U1} U1x 44P pP' 4 , !$ ,,P  Q,Q 0S ppQG E @@ @0 0},, ,0  0< > > b< y> > @-@' @$ H-p H ꘩,H ,H-$ M| ♃ᖃp@-@P ``QP P Q < `R4 Q ,a pdd d0{ 0<LL L0c 0344 40 0+ : D= {< : 2< W< : < < 0H-@P P H  Q< 0H 0 0 9 < ; @-@D|P*~ 0 0,9 < < 0H-P@P `ZP P D0H0 0 0|9 y< < |@o/K-S" p`P@W  GP   0Kp,) 0 0"8 *< H< H-Pp]@P `W  MP  `~` H-P@:`P oop,WP@P @ H-P@`P oop,WP@P @ H-PP@pQPP T@ p`P  @I~pH A-@P PQ P`@V pPW P  P#~PP (`W@P 4Q/ 0 S /Q/ 0 S/H-0S L RQ R0SR}H-@P  R  `PV U gP  p}@U DD D0 0|,, ,0 0s,"8 `8 g8 7 <8 j8 Q/ 0 S/PP 0(  SQ 0S /R,H-^ 40 S 0SQ MoH-M$PjP@P* !0 EP P\   `p ك"PL  PF"P 00!01 0 0 BP1 `pP+ `0 2P Q NP Ph` pPP \M` pVЍV OPYN6 6 6 } O-Mp(` P@pW=Q@1, A tQg U P V T/* A U UP V P* A3! P V P* A2!0 V T7* AP z-* pGZ@X$ pЍ R U:05p `BV  =R p0`5 p AR<Q Ѝ6 @-@P zxG-M Pd P _Pf  PU%:p@`* wPT $  oPL & gPD ? aP> PEUU+  00U@p` `$FP& ' >P =U ( 3P =.P L ЍGt8 ЍG`@Ѝm2 1 H-0S RR KoP P88 80 0P$$ $0 0Hr/ 00 f0 R/ 0 0 0H-@44!((PTPP0|08@-@T  R pQ  0 S/P/8Q  0 S/P/P 0(  SQ 0S /0H-P 0$PP @  0 P xPP h 0 P TPPPPP000 00 0` Ȥb:ĖX. . . p@-@@@P@P),``"p  / 0 Sr9_ R 00 SQ 0 S/Bo/0H-@V@P 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@x P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pt800 @  0  /UUUU3333  ਈ**B"6 S 1d8@HHPHXHtH|Hpc? b Aa-lswr0 -00w !=-  S -SxsSr -   w0-0+00 S-SxsSr -   ,w0 -0 R0-RxtT /G-kP) pymP6  p;lP.*@k`qPqP`@pW   pP =PkwUp@qPTMm0H-M4"424R 0PPHD@P< 80*  h@po  hp ttd PP|PxPQp \PXPPTPPP P\ࣩoBK h h?@QPt(P(d(0(l8 0  㭨Plb(U 6wP L@ &gp,wP L h hd L@Ѝ0nr0 i X 00<O-MP@R D "P vpXsЍ`rP+V -V `0V  p0VpTp xP0@ Qa@"Q#O*p`? P0Z@I" 0v 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Qm00O-MP@R D "P ivpXsЍ`rP+V -V `0V  p0VpTp xP0@ Qa@"Q#O*p`? P0PZ@I" 0%v 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Qmp@-M($`P4@`P 08PpЍpxO- MPQ@Dp@`PuVpu  0qu4`0@uP Q Z:8@<` T*P"P @`VQWZ :80< S3P @` ЍA-MdP`dp@|@@` R |0RЍs" S<@p@-M(0@,4PP`pЍpO-MPL0H@X"  `A@?u xpP6u"P 2u"/uT" oPi b ARE0!X    t            $w t!'/w '%w u'*w z wTp'!w qPQ( xQ*Q@  D  0L p0 Q'! P! ` L0 Ѝ P L  @pD0 W 0  0 Ѝx ! I  ( 9  /mNAbb/bO-M 0 pWpp 0)̙S Pؙp  @崹 pp0\YSPP `V@ WN A@-P`V  h`P+P -Pl H@t/ 訟 z `J G p? Q  ? Q  @@=Y \ P p0 R @@f 0SQQ$pG@য় z J P@ >Q > Q @@=Y \ P 0a R@@k 0Sqa`q8`@e@@ @Xq qp-V@@P I =bPp@r `@s:V +@obP WV;Q :Qd& Q \P P :P [`?`t@```Ѝܵ {t U pDPK 7>Q 1> QD P&=ZW \R P 0a R@@i 0SQa`Q Ao`@Tu Ppp@T  kP(oP? u  0S 0S QPZ+ dPR :PN D H ``}P*ppWL#PoPu BP)[' PP:PMQ p-P+Pe`pP :P P  ?`; @Rd[O X:P)\TP :P 4Wi(WppWD XP :P G`-P+P:`:Q :P?`P!10 PP  `P`@`PPP`P:P 4 Q  ! A-P+Pp,hb`baap`d`Tx_^\a`Ha,bbh_T_ ĺ 4|<c h_]] \[& 3 0H3 a K-p`P+ 00P!-Q@⤂@PUP% -U -PR)p"p2 0 <<PU (("@ P@::U 1A -P@@-`P P `P! :Q1Q @:P P>A! 1 @0P00 ?`P:P P  0\:`:P ?`P  0dhVLhWW,dWhPWжgVUUU XfDU@U@V@x@x7|PJp|+YptpxptOpP$l剝P!jiP" eiPl$QQPP/|h!0P0 @43El  0/`{P`Y  WA[ [    0 0   022 " xg eTs w^ T , % y < ;ym vQ v yx t O-tMM$̵`@p pPDHL @@0 Ep  p@`,\\p,{ $@8@pT? ` pPJ C EpXDiU U&W```W` 0 P岛P:JUpU wp ڲp)`i/$[i@_Wi@ Pp fpIi0P @ PF>i#>PЍ6댵K-(M`pP ppp p$p  0p pf}P@T  0P @Tpp?}(Ѝ O-MMPP`P R  8P  0@PpA(WR PI D ;G@PWDPT NN+a+SB КD ]D DSDP pNHpP  P|HpdP DPP$ @@ @@' PPЍۍt 0P(@dG  P4P y z @- MX@ @ !0 0F Q ЍF똰O-M0  4j - 0"P PU  PRK  - 0 P @WP 8 (0 p &p P``PPK BP[ U@a880` PK R RprQrQ  @@ T-P +P.!P/ @P/P  P  0 !!PQ @PQP  Pp  0 `   -P +P&TP- @P,T"p 0*TP! @P3T"p 0`do `doZP p z ZP! - 0PdP pK@W 0Pߍ lh@- MT@@    ! 0 0 Q Ѝ O-A S =G-!M@`0 P;; @p<;D@vP7@4@0@,@(@$@ 0@ p@zP$`V @pK:P;`V  0:ppvPcP@@\z<P!ݍ G-@PDe0 @P p`0@ZA*` p00F Sa0FSWFA0FS7F V W0A0CS:ppP W @ 0X4@dLppt\LLLX2@ 0 @0@0 J J@J!P%K-(a@`p?PU ?U` ?`#  @0&7`P >U.:W$ P p?0.P V*pW:V'B71@4P1*p@@V *p`Qpp:,?V35Y>1>= U===p@-<`P@`(00 @p,H-M0@P`(p( rp Ѝ<:@-(Mt 0@0@@ ;Q 8@$  0@(Ѝ? k<O-dMB@`0p`P" F `PXxxH[  0@@P} `,Pp  d  0@`Pf @bP#  P, 0$;P,0p@P<@XYZ X  \@]PP[0@ p`.P4$P( $0F P P(, 0:P 00,@<YXZ [0\]d( F PA #\@@ #kd@@@ `RdЍf넣 ( C)  H-0Mp@00 0  P``P :P `o 0P`0Ѝ6d0Ѝ O-UMB@PN`ttp[  0``P} @4 pP$  d  0`@Pe gaP" O$4 0K:P40H`PDp ppP 0`EaP4,P0(, 0P 04 $ 0O:P 804HD 0c0(n(Pi "X@@ "c<@@ PRUߍ1 ~  y /5A-M✀PpQ!pP `ᄉ\ @"2  0P  PЍXp6G-GM<@ l▆ ,1P7J\+`$pP P\@ ᐆ+pP'c@+#cW@JY!6P \@0` p"2  0P  lPGލh5A-pM⼀`@pPl? JW!pP \P\ @"2  0P  lPpЍp488@-M8@8@ [ 0Ѝ2ӿ 0,Q p$/A-M✀PpQ)pP `\ V@"2  0d@p (PЍp꼙3O-EMMR@PY@PjJ<8u` ӔpZ xp|X 0'[qG W+  RUP⠰ W+  RL'@P  WpW ,bP0(bPPT@P(JY)8P @ T p"2  0g@p  @(  LP@P0PP@PEߍۍ)4Hԗ1H-M  0kЍA-xM⼀`@pPt *W)pP `PL\ U@"2  0d@p (tPxЍp갖i0O-M` 0L! D1H0 0g&9  @@` `gb g 8_ cb b 8 >/p g!f!c!"@ pmvmzA-MhP@? @p !pC , 0P p``P=>p5 , 0`PP|P p``.>p& P\ 0 p`` >p@T P P @@Pp  AQPPЍ + 0PPP=pPG-MM`Pp@ ~p  L"Q3 gGp fP S(QЍۍH L"Q* 040D00*69HtHt_0H-,@+@P PS@P07O-lMDP'40 ᘅP?Ja =`PP@ (pP$P @`}P%JPPwPp(qP( @lP  ᱅P H@ = @^PPZP&`lЍHH-M @x\taP@P`P@U Q P, `\P PЍP T\`P  L\PP!p?pP& PV-PV+P`  Q QPJP+Q`P!EPP#PZ[Y 8GT[?QL Q 0 !R/?Q ? 0R/Q /TZ @>R/Y0H-MP @=DP*JDU ?P :R?P:Rp  P0 D  P0  DЍ0ZY/ Mp@-M@`0T` P P P J 0` 0PP  @@`Q Ѝp@ Ѝ/T@X0H-I )\  PX0BS# A0,,,,,,,,,,,,,,x,,,,,,,,,,,,1+R -R& !3 P0 S@@PSPQP@S 0301  0O-DMPP `40,(( ̂pq@o Â< :Q7`P@`@T,zP ,P [P]QQQ{P }PV `FVQ* Q :  R  c ЍۍO-TMM` @pP~P\ `Y  *P0S/S 0QpIpQF P HN ;㤸P1HP. =P 0S  0 R! R  b P 0@0 BSpP` `pw{HN ;㻸P `p `W PPTЍڍ*p`V*Q W P   RS PUP pP0E EQQ ?Q [Q ᰐ!Y Q 0 ]\ \!Y[`Fp   pqp1!Y H  0]R `r P-Rp- ]W PPw  p3``, p`P N+0pPpPP   p Pe  mp_ p [ ` 0@0 4Q8^p@-@P PU aPU` P pH-\50? CR,0!|Q 0SS *SO-M@` 0  YDP ӻ P< PP wHppPPǠҷP W   `Uw  0  0   QPHЍDO-MM™`܄ ؔPQ$ /0`Q @W'*qp@Ӳ Qp/Q TF/Q`0V*/Q Q    P20 @z$ 2/Q!    Q :.H/V/Q   4   1$QЍۍ  Q Q 0pp 0 Q@?z( 2/P   PV*/P1O-MM@0< lQP@ @H@GX8@ **@IPP X:8L`P0    Q 00 @Py$ P2/QUX QQP    Q 004+l@ @C 1/@P @pxp7/P $`<`*F(P 4@0p<`u(I pP4@0p7/P   U 0R0*  .R   .R R .R R H Y RYP H8P $P HL@@QT I@P/31!@(  0PH@H5尰@P:[ orHP@ @`v` V ` V P#@@  z?PYV# [ )V$(P J`r  V  P3 `r` pR,`+D @oD R P{ RP HQ \ P QP ᰰPor:[1D s5r RD PD,pR 0`{Vs`rPD V D 5 @ .R(( p00 p  WorH@ P0 0uP U P U L@ P# -?@IU! [ )U"D%P Jpr  W  P3 ⰰ,ppr [*, @ B/o"P { R HQ S  Q  @?orL0P:T@ D {P<`r UPp[ ` r VD r`{ R V <`嶰@P1xP~$ P2/PwX Ps H<`m}괐YL@QFP$ LH< @0` Pf$@T   $ P PVP?P/ MH< P0F0P@IHob8E4/Q/ *tEH /P㸠 PP㘠 ꌠP 4@ @W@U 1/UQEP $QЍۍI.-$$$n 0H-PT@P BP(P 0J 9J O- MHP 8P,P; E% 0DP@" 䴟` TP#Q$D 0P Q 0 pp@ QDP  PN@ -PP %PP P P c嬃嬓C`p @  PP  h=P@P  Z=P@{Py   L=P@{Py  >=P@pPn  /=P@dPb T  =P@XPV  =P@LPJ  =P@@P>  <P =P=A3Psl <P =P =03Pb ^ 10P! T P M J @G D A#PP P P P P2P ЍI P@$"H <-b}  P_P|F Oom@ lE UE E H-4P $0P 0H-.0"S S, ^\S P  @"T P @^P CP: S #S 00 0CS   \0#0H-RM@a` %P դPRލD P  0 -ppp x PP 0|\nPDg%PQRލt|X'R O-MH`@pQ VBPX ,@ps8@p@<8 @<8,x PH6p4` H ǟT T@ Pp`,ps Px, XBY >  psT 4 㳱Pf P$G`Ap0 @   `G(P> U 0 HHLp]spK P?  RsPC GRRQ RRQ RRQ RRQ RRQ RRQ RRQ_ RRQX RRQ RRQ RRQ RRQ RRQ R P(RG`QP PG`(Q RRQ RRQG4Y :T [_GP[YY I4$pPYuc4$ ´pP PGGP G GPG Gd LG GP& QQ G`"   Kr4$pPP  >r  8rPG`4$p(ApGY IP ( #rrp rYPz  rs`,pW1: ,p$`p"$ ` )A<"AY `p,p$ Ax G!PG@A@@V .W AG rPG@@@@4PV @ P@`@[@  U2@ @PV ᮵PЍP qW0L: ; '; ; dҮ$H-M;0Ѝp@-MP@Q@ ``+  0P@ЍpF!`<v` ᰯ QO-MPP  `frp. Q  [rp 夰@K   RQ )ppr`P  p/Pd P4 .PbP_ X, TZ X/PW&[R! \R R %V  q *R$q *RV  p/^1 ^1 R  V 00 0  @.P  R pX T  X/R q/QT /+P T TV     @p^0A!A?oo2@|Y]Y8Qp@0V PP P\PpP_oR=p\Q /Q IQ 0V  pQ9 P-UV @@ @P\YP@U |0S$ SQp@V 00 00W V   rQ'pp @P@@ [^<p8p6Q pP//+pPp(pV  p@T 0  P/TP  p/P Pp$Ѝ@@-@P PT TP T 0P ;B0H-@lP8P X8P ;0T 0T 0Ҷ<O-MBp`@ 0 ,mPP u_;`-Pc``nPP `  0mpQ  `PM PPG p p  `  <    0@lp) X PP1   0plp @  0lP  `Z:p@@ `L@@`` P ߍ0LO-MBp`@ 0 lPP u:`-Pc``PP `  0lpQ  ҩPM PPG p p  `  <+    0@ilp) XᒭPP1   0pUlp @  0:lP  `Z:p@@ `L@@`31 P ߍcO-MBp`@ 0  lPP uC:`-Pc``RPP `  0kpQ  DPM PPG p p  `  <    0@kp) XPP1   0pkp @  0kP  `Z:p@@ `L@@`᥮ᣮ P ߍp@-X`@P`R JP` R*kP pl p@-X`@P`R P` RkP p p@-X`@P`R 2P` RjP p   yj,MH-MPP@ 00 @ 0 @@@ @ T  @MР 0  00S} QKHЍ/Q MH-MPP@ 0 0@  @@@ @0T 00@MР0    R   QKHЍ/"XMH-M 0 00(MH-M  0 MH-M  0 Q R /uO-,MJ @ (#P8Jif`8 R :R|R  P :    p PJ\ @,6P D&6P p9X Xv: PX@ Xp ,(  p 0p ,p 4huPJT P DHP@ 4(xPp dP PP <P (P P P| Px Pt Pp Pl Ph Pd tP` `P\ LPX 8PT $PP PL PH PD P@ $: e7  P2(& $"  $(,048< @ DHLPTX@@%  j , 00pp 8p4 80pp ;P @F.P 4;P @<.P *;P @2.P ;P @(.P ;P @.P ;P @.P ;P @ .P :P $@.P :P{ (@-P :Ps ,@-P :Pl Z piB`@-P :P' @-P :P! @-P :P @-P :P @-P :P @-P :P  @-P :P Y `p  0@ Q0!  /S` `6^  3:S3    ϟ0Bp5Q p "UUp 5zUpG @  0@ Q!0`/SPP V``3 :S003`00L0Ap S   <pG@3T 0@ P>pO  `  ` 0@ Q !0`/SPP<V``3 :S003`00Lp ;Q t  `P` 0@ Q!0`/SPP>V``3 :S003`00Lp =Q N  `P:0@ QI 0/RPP6S003`:R  30 0FpA4Q-4 `P0 @ R{ `P 0@ Q 0/RPPdS003`:R  30 p0FcQ 00@ SQ@n` lR0T: :T*0 A1P@T0U:9U0 A 0@ Q!0`/SPPV``3 :S003`00Lp Q   5 0@ P 0/RPP S003`:R`3  0Ap@ Qp0 0@ Q!0` /S  V``3P:SP3  0L Ap Rp0 C0 `@+P 8P @+P 8  P|M  `P80`@ V1p` 00Fs Q1 FR0 %pr0c#tBwpp#4#11C 0r  0 @ RR Bp ` P8?0 lp/ 0@ P 0/RPPdS003`:R`3  0ApcPp P @0Prdp@+0A/S<@!`0`p`0@ V:T@`  @V0A`@ T T. 0/RPPdS003`:R`3  0ApcPp(.d! R P.0Rb/CaP 0'̌ S0U::U*0 AaP0 S0U:9U 0 AaP0 S0U:9U0 A R{p4-0  @p @$ `0 0C P\ pPU \!0C0@0S0 $ 0`0pC W@A ⬰P@p P V   0 Sʁ0A@EQd 8P 0 MR`0 TR RS K@@@@@CR 0 RF Pk`` @? R6 ,;00``@/Q 00@R @  R @ R @ `Q ` 00@ P*QA0A S *@0A8  p $(L`AVK*MQM0a a0p$( ,($  pɟ      T phɟ B  } xR3 800``@h JQ. e 0B0S 0 B  p\4(R2?d A;Q<.a(Q50\ a $( pBQ JQ, ax| m `   P pP@ P$(PkpzUH0ĺ* 4 5PP  5PK ( @5PE  5P? ` 5PA  5P<  @5P6  5P0 @( 5P6 @( 5P.  @@@A.a p$(@@@A>a 0 $(p  <0 p 0!a(Qr  Q, Q3> B)0GK/;!`lqp'qqpWQq ""q R3$$40` # pA@q? `/{0Q"d  G 3cc#scb0V03R0!r`PpfAB `r B% I,pb8/!bB(3qRB1/0!B1c C AQA"R3/>0pA )`G?Kk;6#@LsP%Q7sP0UQ>sp'r6sp0W03b4Pp`eA W B R:4 b0 G B 4 iDQ Q3> B)0GK/;!`lqp'qqpWQq ""q R3!40p #`F 5p0Q"d  G 0`c#pcb0V03R0!r`PpfAB r B% I,b8/1B qRJ 0Q0 R00 "QߍQQ )\P ף$IX P|G$h4   D t k xK-0Mⴀ ,  @ @@BB000Q Q Q LM] @I]0E]*, Q0Ѝt,0 RB/R/K-@T$ `&PpPEV QG 9PEQ G 0S  SQpp@-R 0@T@ 0R@B@Q$*O-M@`zPTe*p=PpP8  p1 z& [ Z P yP lpp P ]  #= #pЍ舸(@-MQRЍ@%TP @PЍ * *@ЍO-uMMXp  W)@AP` Z@p7 @P:)/~@$E E堥GOpW dE`E\E4 0 K px  E匥pEE@PJW_P@Puߍۍ40 ꀵMH-M  0 ЍHЍ/MH-M 0 00iЍHЍ/G-MP@R `UYYWJ9j0P @ P :0p` aa`` - pUC, Y  p`X ^P" `p Y{UiPL_Ѝ` Y 4`P д @-M@(P  "( 01/`p) p 0`VP <`V%(`p eP @`ЍЀ` p@-M@(P  ( 01/`p, p 0`VP <`V(eP @` (T`ЍЀ0H-e ,Q' @T$ E ,Q0 Q  8 P Q P0. (*  &PU* 0 ,P 4P 8P 0H0H-(P@PậqQ0H賭$2Lc@- @@ᬭAQ@覭1c0H-,@@៭ `QPᘭ01bO-M  `P0V ` xQ9`p@ V `W%6p@ V P`pV 00 !.`0@0P080C?o2k#0PC` Y*U .VPp@ VЍV @ P  BPR P P  P 4  R  *4 8/` 0X\S 040:8 R РS /^xBH-P`@D @p᜼V  Y ˈ 3ܬp@-@P`R' 0H-  |`V{Pa@<lD` `\Q`S S %QQ|Pr:|P Pm U 0AnSz`1 (08@HPX`0A%0-Qi ^Qe00 0`?Q`00S 0 00 00R  4q0000 3q0000 _3q`0`00 0  # WAq0 S S} d3q`0000 `z `P`P q` V0 Vp =V Pq0#SP)0q`;V_ 20000U 10A@,\, ^ |2010S0+D200WA%@00q`;`V`cT@SPQ^"PvpU# Pt@dT@dT 0A \Z ( &Q& Tpa``00 `"0Dq@ @>0A 10  =Q )`` " 00000       蠨LĨdl P L pO- MP`U 7 p @  0 PV. `FPp(p(V `FPU P&. V `F.%@V D%%@ Ѝ0  00  U: A-qPpW2 !=@EaV P $QPXLP+ V(`41/P. V<  $P@`@`P= [pWpQ 1/|tV@V X   0$PX@/>3VVUdVL$UU$A-qPpW1 @EaV P $QPXHP* V(㋓`01/P- V;  $PH@`@`PpWpQ 1/|tV@V X   0$P劸X@迿T,TSTx"SS#G-@Pa `? P\ qPpW  U` "= ,@ QU Zh!PC HP U' $ P1= wpWpQ 1/U(PP   1/P $@Z $81/P />3SxR@R|R QQ l G-@P_ `PZ qPpW  U` x @ QU Z PB DP U& P0pWpQ 1/U(gPP   +1/P $@Z $81/P 꿿P|PDPPPOpG-R`SPP 0/`p{G`V @@ P ˗``@@T p P l``` `0`p`@ 0p@``PNNNNHNN0NK-R@SPP 0/``V ppGw P u``ppW `Fv P `l`` `0`p```0p`  P@PxMb!?_p@-P Q @Sp@p @TC Spp!9!"P/㐔PP- xSppȆ!"P `P gSppu!"Pn@P VSp+@pp@-PE `}\kH\E 88 Q,  Q' P:Q0`Q 0@@CQ PP@\Q@:Q`VQ`C`Qp@P ڕ00  p! p GFF HHGp@-V" 0S P:S`@T V P 0`@TVET@V :RV :Vp@PppH-M0  0ЍO-LMM(tt` W0H4W XPU p@ R 0S Q:Q |Q T @DQ:Q @|Qp 㥏P4 0S 4@ ,VJ 0Q'HP ʴ 0Pr VQ`VJ$4HPp(0`KpU:H+:Q@P`HP P1W Y4 ppQ 4#Q 4p$ 0S @ T  R:RU |RS QA R :R |Rp$0`0`0`W9P P P :P \PpY p p,[:4`,@KPK ,K40`(PU PtY $`@0SW4夔`% %$0`, P @ 4@,( @P 씟t4@ P p@:PtPP  0PSR@S@Rn =R @R @Rf @:R  RD@H 0$H@Z zz$:dZ  G B 0S:S 0APpQ:W:,$P AR $p0`4`P PApCP ,D@E$P4A0`p G0 @  @0@@ @(4P,pP "P WJh"P  @ؓ   W," XN@4œ@D`4忓p@@8P pD 07/p P 8p@T <@p@1/H! #PP  a1/p#Doᠢ  1/   HP LЍۍp( @P 0O@(P O4^X  Y(P 0O@RxEB $A\W P/D H-0 R ^  R:R |R S 0C R:R 0|R 0H-PX@P D888  00000H<;;;;H-LP <000 0 000;x;`;`;`;O-$MMܳ CP@ # 笓嬃s pRE P |P 0SL l# [ P   AQ 830 000@:R#R'P\@o" R`PU RP!"  P P P Q R  R\R    ` Qv pAQ\Q  PQPU :Q  P 嘱 J`D:\  P6Da B `00S :S|SB0PP P `` P$Ѝۍ넇;:::::f:99e9t:@888,87K-@PP `@:P 0S R p  0SR@GS@R =Rp@W dd`P P]W\W P:P| 0Q-0@ 00Sd 0@00S_0@@pp ^W P:Pb p@W:W\ @p`V PEd ᧏Pe Pd`p]WB@@2QE p:p@ppp p p p pp EV L  DP  K-@PPE `@:P 0S R p  0SR@GS@R. =Rp@W) dd`/P P@ p`V PEd P Pd`pW:W EV   P  ᷐p@-0S> P:S0`V S P @0`VSEV@S' #S0@S! 0S xP0P/`0@E T:a@EV`T:A@E6`T`V`#0pO-MMp$ P @P( / P,D 0t  b4 `IWbKP``$pN4 ($@VQ:QL@`P@F` P$ -L )L $L=K$N ;K$N/0 K,D$N `Y R 6L4P @PFLdL:P `  P ̀ `AР Bpy K($:P4 ~ 4P  P<$PK} _ q )zH-  .zMH-MPP@ 0 0@  @@@ @0T 00@MР0    R0 K QKHЍ/dzyO-$M`xxrp ` චTP"  0 `币GPP U: @ (P  E p  p AP\ qp X#p &Q!&H@v00 ᦮P"3q"  Q$ЍE8 P9$ P2 @P QX" 0# " !  P PHP  P*% H "[ |,pp P $Ѝy-Hwxp0 +b H-8lE, , ʧ x*`k`.@-M$@;0@03P@Ѝ0*@ /  + A! 0  /= @ /  + A! 0  /=@ /  + A! 0  /= A@ /  + A! 0  /=@-0M@Q 0  !   0 T  PT ,0 0#0ЍH- M JP ЍH- M  JP ЍH-M IЍ "K )K0!KG-MⰀp@`PA$Q Q僞O㬞dQ`Q\Qqpq)@t 0Pa!Qލs8/K-rMⰀ` pP@qAAPOy\AXATAxahaD|l@0Z 0-!Qrߍrlrp@-P@`v ( 0@ pqH-`@Ppb  0@ O-MP p0Q@( 4<T<`VU  *@P Q AQP Pp%Vp`0 p`WzP)!l $4x,8DP00@py`pv`ps lkpkkphjpejpbpP[PvVA$Q AQBP BP%`    <    <<尀 < 00@,0 R P0P l00g`00 `@m00`@i@-^[ 00@ `[ p)$8$8- , p-Q*-$][ ,oO `@PJpp W  prp pjP8-Q ]Q$ 00@0000i@ 00i@00@00i@ 4P|P I z sP; @PcP~0 R 2<&`;@RD    "@\d$` ` `X @  6/P X@ 嵐P P`[$tp @P`Z :sp @sp㊲(l`Z PW p$0Q+* @l KpRp( j@P W Pg*  PptN QZ* 0Q:  PN*!p p QC* p5 4P0*00 Q2* (P *   Q%* nmb b b H-M,`0@pPr38Pp$ 9`p 8  "! @  "!*9`$t@#8@`ЍO-DMp, P@MP `T@ ,QH  Do᠂Z @@P <,,Ty$sDo᠂@ 0P P$ ,<, <,   @,0@/Q/  @ LpUP4$@  K@p 0 `@P@>P ,  .Q) P@` (puP p\  TX  8@4`0@0 @ P$ @!Q .QQ     KyP @T  ,$$@I0@P `8L ,P,Q <P  $/<Q QP, ,   0 $ r<QP& <@<[Y (@pWp @ )pP" Q  \0R 0  B   RLQJ  \0R 0  B   R Lq , $0 4`CT0V0R TP5WT LP2 00 DP!(PT"   DЍOk Lz8 `P pEzWpr@P, , DЍ,e7P H-R:Z%A-@  Mp`FPP-2P P-P PzU W, ,LP/P ,t P6p p7`6VPPPddp@-d`@`P (xPP (n(l(yyp@5p#  "K-(M q`pP @P p; ;$A 0  ղ P"% (ЍAQ 8@LP$ 0K $ (ЍU "m \U R/R  /00 !O-MP@R D "P spXsЍ`!P+V -V `0V  p0VpTp xP0@ Qa@"Q#O*p`? P0Z@I" 0/ 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Qmp@-@M@ P`   0RP @ЍpP  0`@Ѝp0H-P4@t  !P0P4P0p@-P`4@t  PpP4PpG-MMd`p 0r@P# 8  P rP(( P 5PJ  *P  ppPp Q p$p>P P`P^PP (׈(#x !xxQ@PPЍۍMnfs;0H-M P5@p   P  14p  @*Ѝ0O-Mp`$@ KP W  PP@'rP V PP p p`P`&Y P uP: `E 0  4p `FPPP w 0ePPpP 33` p  P\`   pL@ p` Z*` pp W * IQ  Tq`Tq@P`(0 0D`V `V P P  QQ,w` GPP$PhЍ(0H-@ w P PwU 0 O-LMR< 5LЍX <P0;qP X@ P@%<X@`]  YX <pP X`:/P<0  S pPVH<H `!P$pDD@` P9/P<0  S$D` @U<@DT` P9/P<0  S$D` pU<pDWP `9/P<0  S$DP @V<HX DPU) P(:/TP4D$@刐pp Pi,  X$PpDV$`:/P A  p'X* `V* @P8`Hp4@ `2/HpPQ D `PV:$@,8U DP  X*  A < Q0X H0A@TA,8 Q1*@ P82/HpP' 8 B <@,p 0Q R0AP Q:$@Hp  ,Hp  $<@P P<@0`U R0E` U:DP$@Qg:@ pP `2/PPHp(Z[  @< $@PY `h8 $@(`  @ PI @T @    R  PP00 @p0CU3RU4p*R, @DK [3U3 [1* :/P40H8 p pP  X*D`2/HPHpኀ Xz*Dአ6/p W8T*D:/HPKp WH*D:/HPBp W?*D:/HP9p W6*D:/HP0p W-*D:/HP'p W$* D 8/ H <40P<ZZ8 `D9/H P<pѪP:p<(` 40DQK 0,P U:[D@VdU:@VY40D$<`V @ 2/H40P`Y8I@ h' 2/HP`Y p(`40(` p @Q0,P [:UD@V [:@V@DPE Q 0P  [: [:P 04 P U:U: @ [  tLЍp@-@8P! (峄 `V PPU 0# "  0S/9nP* P!` P 0" `V PPU 0# "  0SpnP P!` P 0pP(npp\ H- P@U !P `'p&pWmP !P  0p@-M@ PPUUU  0P#" ```PP QЍpO- M@P pRR$$1  0X  0p! P J `0`F`V @ 0 T 0S $0YV Ѝ0H-@DP (ƃP(00HA-@Pp53``P (婃`P  (囃 xP p ` P VVPP4p@-MP ` 0 @@@p@ P@`ЍpK-Mp@`P P0 0ppBP `P FPT"PЍ<G-Mp@`04  0Pp PpP `P FPT"PЍO-|M`P堰x` $P Y P%P,0 PzQpA ,L<pHT<4 $ <$ 4 << T 4 d lHn 0xi 0s,j\0oWm#/ p~ ` P0@C(mp| JpJ.PSG m̌)PG?[;5#msPQ%Q7pP%RnPpP\̌ s01S ( `ؿ P 8L[Rs00 Ba /@!B BpNp Y/Y/8nJ@R3/>@) G?+;2#mps Q"!'p0#2n0pP<| r p1Rp P Y:I P@! P`堰gQ VQ, Hp!0  㖐 Y%*P p [PE<7P Y: P Y: )@P"d 0Aspg@G'v Cr r0 0`P"d @pJ0F0{p{gi``f CpqRd 0`P"d pJ0F0{p{gibCq@tP@d@ `5 Hp0 z Y*P p [ P$ Y*Q  [$h Y*Q{  [Qp|GQ0R0d Br Yd* - Q 0 Y0g \! @ G-M@pd}x`P P  0 ppP `P FqPmTi"P:}Ѝ p @ G-M@p*}Kx`N0   0Pp PpP `P F8P4T0"P}Ѝ \ H-p0PP<  ᭤ |  H-p0\P L@ <4,, @ X آ̢m 0H-R P000@0@P@PUS  R0tuA0  'K-P?|HDPD 4 Y ap 0IA| TDXO@ P@0S Y10! @ P@`p U W`1S!0!U  B`PPpPPp1S10! R04K{_ Nlllll$llkkO-MBp@{lQ d`" BB!!<PW}:PD W*  " 2 r B 0p@f@W P*0 W*0 W?00333AQqP@p!Q 0 p@AA 0\L? `Ie)YI@T0p aPR` 0`0P0! !P`S ``1P01 !pW p CAp P 0dD{Ѝ_ N,kkkjjjjjjxjjiiiiihhhG-@P #{0!0ES  ```FFaa0 0 `p`p崐Qap @ pQ0@P` ||q pXX! zHPh0hhghh  ggggpg|gXg\g0H-zP   0@P@0S   1P1S! <, 90:2!QP4z0mNAffHfffffftfLfOH-00 ,B DO-MP A܁Q@p`qqFczOzZOXPTqXq\q! lzd哐 p PPQ) @XPP[ cP5 `7N P`Xfqq0@"z0OJz0PEZOX`UTqXq\q0 A D@@bzЍPP(0  kjiA-@儀xP@p`qqFyO zZOXPTqXq\q,,,  (  K-`p`FV+PfZcP PXP$``PX0@y0Oy0`FZOXPVTX\hO-}MR(Pp`fPn @fPo |}ytpP ddd"d2dR 0PP0 <ey4P  00 &<`0D `.0`@ps0pP] 1/`GfP8 ` *H`.0UP HP LH1/n@& nXh@TPPLQ H1/mAhP =h ;htP@PP}ߍj $ 2 0lH@h # = P @ N   P/eH-MppLKˠp K%@I%`PI%p@0K `S0L!Qލ&yP d/0$! /p@-0M@PA0 0$` PP g <P  300$`P .0#P P 1/00SQ 1/0Ѝp[ u H-XM$p@P;  `0P0Hb0 gbH-P@Cb`P  >bP p5bP P `P  H/aP Ha0H-P@bP P P aP 0Ha00Hbp@-MP@`P `aP P ,00 bЍpЍpĻ H-p@`P P`P aP `P `P H` R R R#0!/ R R / /   /00 //   / / / / @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/0H-PP! 0@T 0\\ 0@PU @U S000O-MM(Z`pPQ00PߍڍwKP*\*X t`P`[Z\Q:XZ^pY iYi# XZu(q0  ဃ@TJ P T*0S; (I qPRJ P Z0: Q:XZPQQ Qj QQ~: 0S ( p[q'p BPh X`2I Z' p/0P8||`2 0LP p P0"'00p @ p P P20 t&w00p  PVpP Q:`&6 0 ۂ P`J P^*P&P6@pI 0˂ PPOJWM & 6@pG 0Ẃ PP>JW<%5@pG 0ᩂ PP-JW+%5@pG 0ᘂ PPJWl%l5@pG 0ᇂ PP JW 0%05@pG 0v PPJW$4 0@Ge PPJpTpp[ `@` H4Z@$00  pFPJYI`p [f0pSa #? Ip s0*P|J P PO:x0 o 0(S`2PP P%0"R0p0P01P PP P p PP0 Q0P0^pY 0*000 0  @hPP' @pP P KPpS@[A0  0PPp PpX YpPW W WEp[9   0]pPPp!0  0  @}PJp P:p0 <`OYP 07P Qp pP0 P  07YPP p|@ ;  [     >k c "'  r .[   G-1MX@P C/< YP C`Z=pC 0S 0@P P P  `&`$ P P @P Z0p  @P P  %` ` P1ލ O-GMȡp` @P  W pQ P PV P@V r@P5wp  0徽 p0 P 0S:pp PY Y `͵0P  wPGߍ  H-M`PPJp@P Q R 0S R p@@`pЍ0H-@P UP0P#/ᔩ 0H-@`@U PP `0O-Mo@p8`PHY. U<@Dp@8PF 8PPPP! H@T @Po`?`@W pP 7`@Po` Rߍd/80S  8 QP" `p PP   R 0Sp 0 `cs 0S1fcQpSP 4P  ` PD@H0 P4ሏ qڀ0 a< Q;Q  Q P   P0 S p SRP`U p UVPHpSR UV`<@Q1 D 0rPD.Q QP PE  PJP WP `0@P8> p @P H E谝pp@W2 H`V/PWpPP' Q @@~]Q@s]# R R RUQPQOP K ]], < 8X' @<0偲 @Du8@P P?  ( ",  +!A$䐝Y& S Y p<`,P @00Pp@U*P  RP pqʀ0PD P4 UkU #Nq 0㏹A H0! ;PvJ# `PnJ4@ ppd\(P$` p \C4<< ( " 4 +!A$䰝['  P [ p<`,P @ Pp@U*Q 0 0SQ q rʁQD4`\ \ p 0p 0 BP@P4 0pR   P PP($` PPN# >$ P 4 10@P0 , PU \PP Q @@\Q [P0@@[Q UM [JPHIi \ ` 0 ull @-@ YPt  @ H-P P R  R' R R.Q*/0S  PPQ R#p R QR RQQ Rp@-@0T S p S0P `V \ \ TS^ R8 R0SBP0U S @0@PU S P0= S SVJ V \J\000S ```SP pD D0S0 S@T D@D0SD0D R^0 S D0DPU S K-MQL @`PpPD PP9*P $  EP P PYJY'yP 0SS 0P X QQ P PPЍ7|O-\MM0X0p 0 p 0000 0$0(0,0{@`Tll {@Pp X*0FPj X*0FP` #P P P [ pp P P P YP  xP8 840P4PU ppW  ᲒP ZPW pP Z@Z  `ZzZT ᜤ ,Q@X Q\Ѝڍ/H < O-Mp W  PP @@ @ D`PP PVZ P: 8tplhd`\XX@P3 hH 0zX@P' 0@  PJ !  0jP t@P@TbX@ YP( H 0FP 0| V PJ !  07P P WYd1St@*Xx@d1#^*t R qZ?[X` P @P R P P `t@}TLdPF 0000000p0l0h0d0`0\0X000X  S S S&0pd00 `0\Xp00p0pX  0@Px@|@@@@@@< dQU*@74Y@T3 @Ѝxp,dQ%Y*P Z[O 0p00P `V`0P`0S ,@@TGY@Q507ЍwK-XM,PP @p8pPP @ .P 0WP; P [P&\(` 0  PP ,LPpPQ 0  PLP VV%v W`0p,Q$P }W xP(` sWD(` VVPXPWߍۍ된 , X < O-4MM,@Q0s @P$ (  , 00 `PN 0 8z`P=  0  8 `P.0 0p(  !$PU!0 #"(p0|?  /r `VL0P4Ѝ؍] `V$P`2꼖 %Ĕ O-wM MLp @ Q@@@@@@@@i`Q Q RQ !QNi`PupP&  0 HUPJL 6/P 4`&!  b , PU U  D`@PU%HY"*PE P U!U !UY U,@ (0rPA &% 0b(D`EP ) @L`I`T%$0% bD`0 (UQ D`p@UEQC  oU(lUiU <HP! 0{TPJ`L !TP ! P NP  !@+(D` V P ` `RUPi W" %^ P0 Sc T U^0U^U $RR RQ TUN , U` ``t`` RP U  `p0` P !`Z P(Zo pPpH   @1D`VA PQg ر@P PL `PdPhPT0PPP帠PP\XP pP P P SY `찟W $,  @Q RD\T@ <@@OT@@Pwߍ ۍ׋SAT@ !T Ȕ l 4 b0 H-_@- @o0 /o0@ QA0C3S 0 3 .0\0 0.P P .Q R0O-LMp(p,p0p4p8p?p㠑@piW   )P* @pP: D O-M B T0$p`P@pdh|p @R T  (X080 0 0 8\p`` b*Dp0p0p0xPL07ppPphXd,pguPPDX@h P P Xl4 b*0P0P0Wp(07pPpPpWtpgppw<xἎ  '|Pa*0 0OA)A7ppHw`0au`P `` W匀`\`  ` f0 bj@0@0F 0Gp00p0v 08pc5PpPpPv`4P]p`p`pv@L`kp@p@Pv0@@dIp0p00vPP0c6pPpPv` P]p`p`u@< `kp@p@u0H@dIp0p0uP0c6pPpPu`DP]p`p`pu@`kp@p@Pu0@dIp0p00uP0c6pPpPu`HP]p`p`t@`kp@p@t0@dIp0p0tP0c6p#' PaP'`Pd@8PZ`!`&@ld0 @dH`%`&0PdLp04`$`&4dPa`#`&Pd@PZ`!`&@c0H@dH`%`&0c04`$`&cPDa`#`&Pc@PPZ`!`&@c0@dH`%`&0tc 04`$`&XcPa`#`&P@c@PZ`!`&@(c0@dH`%`&0cs04```&bP a```&Pb BPe[```&  4`(@@0@$0B`05@@@$appp'p`b ps   @pPp  * P   @pPp   b$ $`\I KP* SI ,Ѝ ` HIH-M@hp/ `p PUnfh 0@@ @`.p[w <00 @P@ЍO-M(Q:px P`P 2@Ѝ<(CC @$Z  $ (*PR,"P(P-Q(  }KQXᐋ ` pP:P P!*HPY& Y P1 3P1A2P1A2P1A2PP` US @ 0U08`PEU8PPE9P R R P1 3P1A2P1A2P1A2PP` US@0ǷU4:`PEU:PPE;Pk /@- @T ,@T  T  Q*! @ Q*  Q:@Qq A G-MP$PU (@0 y 4@: dI`J0;p62A@A4"0$372'- A@J0IR@ 0 R 0 "00008 090`@61@R ,0S SQ* #Q*Q: QЍ0 0AЍ@-0@S 3/@GH-Lß) QN: @p`P p`P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'" @D T( QO: @ p`P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'" @D T,@  T: T T     MT/: DR@!(  ̌ Ȍ Č 6@  T :@! !0$  'T:! !@   DR@!(    T  ! N  L$"pA!p@! p B("pA!p@ p B%"pA!y7X؏ LO-lM0@< O!pIXTP8@Pd *3ˉ2gf20H-@"T \L P R0 0 K0踍@ 0H-@`Q`p`"T \\\W `V Q( K`:,< ; .0O-dMMD WPD`0``P V >P pL 4`@DP$@XHp<(,Ppp P@XHPH  0dH`\ /| VJ`ll2  0"@岰_![[ [ [ <[ [  0Ja1` 0"RPLCH`P ]=pP 0ἽQP-6PQVP!4P 0a `P 0dЍۍO虽{P GcpPPW B`PdЍۍ{fP  T80T:  T 0 T6  T0 T2 T0T01\ G000000000p0P0H0H0  ~2UX~[~U~Y~S~~ ~m~k~?~׉t~0H-@Y\ ~p0 \G0qMp@-8M`HP`@I4@PH .07d00. @U PE $R04P8Ѝp@Ѝ/bxT= _}O-MP`PPx@p0 RQS QS 0@-T@0+T@0@ P.T )P@pQ10p0PC00A.T@pp @ p!p5 p @ !.Bd0X#"0 p0@` Q *PP@00@`UP:A) Q 3V Q*``@V 0 30@ V`:AR 0P @0P1`0`00C@d`.UP`` Q ``e   @ Q  P*u P „ `V  30@PV:IU V * Y 0 30@ Y:@R  0@.T P+ @0@1``00Ad.TP`` P ``x ` !.B!.AP` Q  P* P P@T  30@`T:EV T *PU 0 30@ UP:@R  0p.W p% @60p1``00Ad.Wp`` p `` !.ApP@ Q  P*p P B )T)P)\` $ 8 |`+ ++d PP@  `  0pЍ ; D{O- (40`00pppPq@p`0pG`rg``p@@@ @PAp@`0@D``R PP@ BEPF2U<`q prgqoq' 2U c prg|`qbFaq& G2UX`QpTTTTTTTTXTTTTXTTTTTTTTTTTTTTTTTTTTTTTTXTTTTXTTTp PR q`p0F` `.UPu``( `dPpp`e PPBpp@  @ iPaT`p pP0EP E`PP@ 4 `PP@.@`,5 O-lMD Q@@R l   Ͱh   c!51 B(4r 0! c51Aq(Rd `Ad`\ X TP LHD  @<+p 0 D a@\p) b%!AqbdP@u p 0C a@p* bd%!AqRd`@]up 0CPup`W4Z Y ,<0@ D!HϠ0R0PQb$ 0C(01L001P T 0Xp1 0cEPW@#o  C @!bU`F(VFWobUaFaQA: \h0`0d0q!aN0PS00@7SR?2c1@P@SRR/"bQ@ RABj/PICY C<Z ?<W ;<lЍQigMbsEYJvrrqq:q@qp6O0m@-@|P 0 .SP Q0* B/o"0 AP P.PA-M@@!J /+00 ( @Op`PBЍolH-M@PYPK YxaP`F tYPB `YP> LYP: 8YP6 $YP2  `pP,$ pp &`PV3opP $0<H`pTpvЍ艗0 0+ @TP PD+  ᆻ  +A@  / ?P,J|o`+ +R     +A Q P / ? PJ@W: A7@ p :7`  ?0+ d `@` P+    +A@6@{P: 7F?+ 0d `P P+L    +A` 60?0d P P+L  `  +A` 6d ?0jP PZ+  ᜺ 0  +A `   / `P?J> P:K SP  P-:  ␿ +A  W:` _6P + p+ ?0+ d @ P+  => P +AP : K@pPJP+  P:  t +A  H!  d `?0+ @ P+\    +A` d @?0@ P+\  ѹ`  +A`  5d ?0wP Pg+  ᨹ  +A` @T _+lPd 0Np P>  @DT  +A   @  P*Ln O  p_`    +A P* 0P J  P * P  g `O _ / 0P@ P J P     +A P@/N@ QW: 5d P?0+ P@ P +    +AP8_ p P4  Y t$?+ 0d P`|P Pl +  ᮸W  +A`( +\  d  0X` PH   ኸpW  +A   P- :0Pn@ p`  |p P  7P JP P P  S  +A$ Q!* 럎 O _P :@ ` p ; P J$  Q:P :\ Wyl/ K1R/0 SP PJP P :   +A xZW p  d `>0+ P P +  Ϸ  +A` `VvP J! P* pPpPb\XTP ᪷+;e*{M+V;B Y    / 0] P< J P5     +A  k3 d3 K \3 9 K   / ? P J  2XW: 83d ?0+ @P P +   `  0 +A @O _ /k W:;+)K᤹>+{B0 + d {P@ P +  ׶$  +AP  P "*쭟 +\@pNV=+ 0Pd w@ Pg +  ᩶  +APWW;+U)K= +A UT 2@  2P +?0(( @/@ P (  a  +AP t(K1R/0 S[U :K A ES    / 0 P J$ Qp*倰+\   Q 7 Dp,TS  p@W+ P   d 0` P     +AY    $Q: SQ `O _ / 0P@ P~ J Pw    0  +A /P@ P` J PY     +A KQ1+ Q+7 ✏+?A p`p`+0+ d .@ P +  `T  +A`k{)*W:d  @;P;KP[PD[ ";S*{ k P@ MO    / 0 P J KQ[!d0R1@C〠+\` d 0p P     +AT- ` ꫪOE W: 0P  02 @?0PP`P Ps P  ᵴ  +A` / ?  P\ J[ +R O :    +A / ?  P8 J7 +R + :    +A _ o  0 P J +R  :   0  +A /`VUUU7KK    / 0 PJ P  `  +A` 0S?+ 0d @ P+\    +A` /-?0d P P+L  ϳp  +Ap /P  /`  /d ?0`i@ PY+  ᛳ  +ApbWH: /@  /P  /2 ?0P0@1P P!P  c 0  +A @   /'PZHGFFW(*o`?+WKC0+ d ` P P+  %  +A` P*<$p4? d 0 `K[ [ V5XPP`X @  I5@`U `F P   @  P +A[@C P) .V  +A@˞⬫*Zp:.f@PP+0; B+@Q*WZY    +A@? d 0P [X0@$0  lEPP .``0S Pu`VZ.`@$ `@Q    b  +A  P ;:  @E @ϸ嬫 K|P@ 7@ PP  .  +AmWv*o p` d `?0+ @ P+\    +A` d $?0 @ P+  p  +Ap  P * @+\d 0 ` Px  ằ  +Ap P : p Q HTZy:@ pR uP g PJP P?:  d +A {$ P*d 0@& ` P  XpG  +A爀@  W Pt.@ p Z|Կ Pp ׳@ P   0U ` +A 0`P  0p 0PE +AZ6z>ZMԿ Pp ᜳ@ P   0U ` +A 0`P  Ͱ0p 0PE +AZZ Pq:   +A?P+ 0P PV:)   +AZk:Zh:?0+ d `B P P2+L  s  +A` d >0 P P+L  P`  +A` d ?0 P P+  -  +A` PP   |  P:.   +An p` P-   +A$ 3P+  P ϟ ++ 0;A+`P[0D==p=Su*P[0So@! :< !  ! @!  !$#       " s/9 @!  !$#      @ "$"      V @!  !$#      @ "$"   @  #   "!    ! 0@9 96 @!  !$#      @ "$"   @  #   "!   @ !"      *KT*Р+Z@D[KJS+K:*P[0CSKHo@`ZD, Pp ៱@ P   0U ` +A 0`P  Ю0p 0PE +AZZ  Pt:  A o  p Q*Q]: +; +A /  / 0< hm @`Blm${`<@{Z5J ( Pp @ P%   g0U ` +A 0`P  P0p 0PE +AZZ P:   +Au4l43W    +A P\+ @P;  @0 @*+R 0 B0+@XPJP+@K`Bk*V:`  @;P;{P[pG{ ;S*Ekt$U*,倰+|   R 6 T@[1  @PT+ P   Fd 0Q` PA  ჭ  +AZ    P$[U:;+# K +;B ;+ K+;B  &   / 0PJ Pr*K'1R/0 SP @PJP P:  ‷ +A :XGH Pp ᢯@ P   0U ` +A 0`PP  Ҭ0p 0PE +AXX .4.-Vt    +A Paĕ @%  /+` `(+RE 0 B0+`P:JP+`kpB{*W<:`  @;P;[@KPE[ ;S*! -+W     +AQ$4+A @0@+9(+R 0 B0+@PJP+@K`Bk*VJ:`  @;P;{P[pG{ ;S*/====*V    +A P" @2  @0 @'+Rv 0 B0+@ PkJ+ BR+\.* P+0; B+  K[!*U:`  @;P;{`kpG{ ;S*['U#    +A P: 0 @ m ,0 ̱ ldPߍ ۍ^VUUU; serial; refrestry ; expiry; minimuP&FF((R8&` O-M(,P `@p0@-&P7J PP PW PLP P\P P .PP E,P R P W R)  R.R 0S.  P*c`@Ѝ@   B Ѝ.R  R R U@O-M@P[O:" ` B0 Z 0 0* ` 0S*R' p` P P,:\A P:pGWA `P :"A   FЍ```Ѝ "0/|[ A-PpS`@p@DT`%ppV P pW(GA-PQ!@ 0Q$  0Q$  0Q40  p Q$ p ` Qtq(  S p`%ppG`WVVJ R p`$PJ PpG W`VVJP p`$PJ PpG W`VVJP p`$PJ PpG W`VVJ  X $ (,O- MQ)*@$pPP $P(,w(pWJW(W$P(,, W0G`P `ϯp Ѝ `HX  ]$p `U  P V(VJ,(p , 0;0 01$pPJ, `P,`% ˂ 0,0 U, Q `( ,  ,q Rq(, (p P(  Rp$ (,O- MQ)*@$pPP $P(,w(pWJW(W$P(,, W0G`P `&p Ѝ `HX  #p `U  P V(VJ,(p , <| 0 'pPJ, 0 P,0#` , 0U,  Q0`80,0   R,ʮ( , (p P(  Rp$ (,G-MpQ pp:X@PUI`pP&'``b?p%Pp`A@Qp`EEDQ' @P@@@``@Q@T!pP唠%` 'a``Qp== )@T371 QЍT[ ) ] G-@`  pP0QS @=QR A 㫟QJ  18pP T W=*AT W5* A!" p W*T W'* A!! p W *pP pP PP  T W *Ap  U: Q @ Q=QQ @T W*Q O-00S0 0xS@PUR0q*p`0uP @PU8u^Jpupఀ PPPPPఀ P  0pK0 W P"S ppp0ಀx0pp `pp 00C S003020PU @ \: x 8 H-pP`<W pVx 0VP@.Q 0 `7@R0@3""  7@  R0@3  @ T õ/do/L///O-TM`2 |#$0plu ` P Z:8 P<32 ! W0)PP4H P $k  A$`Q` 2D`p02 @ Pe3  Ip  %GX <2Hp02 @ PG P3 I P P@QAU 1M`02 P@ P( p3 I p p@JP 4Z[XU 0 P$1S`02 @ P % P3Ԑ P @RP  00P ppWJppp pAEP QTЍ3YE.‰%I$ųMn: @ e m Ő X H-p@`=PP(A3 U E  APEq 0 .S R:0pS\WR: S\R   .A-MM`P `+@P J +PJh>oBPЍۍXȾ @-Mr @ 0@PJP*Ѝ 'ЍXp@-RPPp@`PP  p@p@-RPPp@`PP | p@0H-@PP  0Hp@-Q P@[`P OpP P p@i0H-P @PP :Q bP y0#0H-PQ RR0H-P^ PA@?PYPP\P\\\P\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0P   TT P @0諪00H-P @PP  D`P @00  $ O-M-Mp@t@2+`ᠦPpP P P P0 0 00 0 |@x@@p@P DQ:*T T T@ 2+T -T.D4:D46@`P3D4<@.D4<@)D<@%#x|0jP:PPzbP `bPZʚPPZi W 0,P |jP*RBk@x  ( 1 x|$W- Q@k !:B pjvQp`c1,0xS `^`p+620CP~ x|0DO@`<@(kpg`wxpl` x 0D|,Q jPz*7P2  Q D'W%xP| 0<@DxD xWF ,P[ |0 jPU@j @ M0__ ___,P ~ 8 !  Q"8<0P(LKpg`w |p @ Z|x0xVV,P |0 jP@j @ @x| 0 0 `00@ 1@  |xT&0D ? ,Q jP0<@Dt ^aP `a$P]`0<@P9||"Tԭ x Я 0A-P@pW ၠ`P P )PA-Pi`fV)bP- ^P1  QQ 0`p@Wp@T p @TrBTr2S QXX X0 0CODD D0 0DG00 00 0E?xX8v0 0 '0H-P@P P Q080QQ R:0088 80 0e$$ $0 0f\ #<&@-@! oO- Rc p@`0S00CSSP1DDDDDDDDDDDDDDDDDDDDDDDDDDW.p!W)0V S$`pWpW0T S@pWp p R[Z^\H-Q> 0P*r-w--x)  0vS-S rS  wS xS S //H-\:  P/P/ Q Q/@-@P AQ @ R RP///o@o"/ /o@o"/H-/RR 0 0p!`jH-4 /RR 0 0pP/P PQ/Q /H- AR*Q *QQ 0 0pT^H-PQf0H- uP @ \PNPLP HPDP@0p@-MP@ AP =`/`-P ЍpQЍpP/0H-@P QQ P:PPU:0HH-`V p@PaP p`VO-M[# Pp@aIP @[X  P*K! !@PK Ѝ0H-MMdd@ddPRP  @P#  @@FOp mwH-0 G-M pPdpKXBX`@`XPA`` AB+Q8 `````R000!01U0P0 PP0  0N N 0 PNp$  @㾠 40 0#TPލML넕   ux0 m R 0 KH-\$ (xLd(3Ơ* 3&!%  G-0MPR   `$0 0N P+ Q$ (xL`( 0 3vq:& 3&!%   0Ѝ Q A a Q1 A/3` Q3 A/0H-P 0 @PU @UR00000 O-Mp@PR D P"P+X]`ܛP+V -V `0V p0VpTp xP0@ Qa@"Q#;*Pp`@PE"  `00F/ S:a0FVS:A0F6S P RJQ Pʑ! `0R`SX RЍЍA@Q00 O-M`PpR E"P  XЍ@\P+T -T @0T `0T`U` xP0@ Qa@"Q#o*`@P?U  p 0hUK[ [ @pI" Y!@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" S @T "/P  P" S&! @T "Q/@X QppЍA@Q{L rQJQ H-8L MH-M  OЍH Ѝ/G-Pᮑ0@EQ`V ^P+`pPVPt  KP F  B@TP@F 6 깞 @Z p@-@P+L@ <`3U  4 p@ p@-P@KPu`Pu` V P14`㮑p@-@- `@蝑H-M?   ЍG-MpP0_P @   0P `d  0 PZЍ`ЍO-KMC`Xp@V( V@@TTC@y /r.` @2P P( Q Z:h0@D?P* C P $`pW?  RW4$R$p$ALPAK 2^ 2 [p R$ PR@PJAp P.*@ d(`W @(ppPP Q* H P(P}  ( u@pƆ XY(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P *pPP Pލ3) H-BMhp`@Pp 0&p  0!QBߍn3D) Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0S4(00S00H- Q 0S AQ:Q B(G-@pTWo᠂P` P0 P1*T`P P@pTW(H-@QSP`p R PpGP`W@A-PA@T  QQ*(Ap`PJPQ`@蠅?@-Q 0S  AQ:Q @(@ㄅ@ MH-M  $ЍH Ѝ/@-M@ 㤷p TЍЍH-R 0Sb 00S0 0s 004$ O-M`P@R E @"P=XЍpP+W -W p0W `0W`U` xP0@ Qa@"Q#M*@`pQZQNZPEUP@@D"p00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PRՄ@pX QЍA@QtG-M⤀pP`@Q$A A" OK T |x 0dA`A\Aqpqp@!Qލ1," K-rM⤀` @PpAqq O X\qXqtTqxaha|p8Z 0|hp!Qrߍl1t! MG-sMⴀp@P{`1A$a a O \ |x 0da`a\aqpqJp`!QsߍGЍ/81 MK-M⸀`P@p!1Q$q q O `dq`q|\qapax@ 0pp!QލKЍ/1 $ O-MP@Q @@`ЍpP0Q  P}ApU/W CP%p@ hU 0 0Pm@]P ( R $2/`P Q ,0 0m l;;` cbH ::`:<:@ :O-MXqX1 @Lp0R0PD (Q(a(q(((P`p X0*P        ЍO~l<`;`s`_`_H-@PP P`DqpP* $` PV: ` P  !0p`P0PP`p PP Q `ApP V p  7`777t7<777O-TM@R  SxpY `P @,@ Q PU PQ$$$  (U Q P"P$0 0$( @18 0($" KPM ZRp P@p@ XJ VAQ@@0! -PQ  040|0P  P QKK0S  | 3/@x Q@Z@t@P h$Q(( _xxAT@TЍ ` 5`5 5 55x 85 544$x؞ 4 ܞ @3<3O-Md7\ p D@D  420S${Pq QPP! ``V*AT pW W P HEP @U ;\\pppHDQPP `4p`W*V "P  R  2/P nU  @@ -?Q 0 0ektlЍ4 *22 P (2 22t1l1X1H1T 8100 0x0 ܛ 0H-P@m}P00H@-0Sg.)@RT@ @0S\  H-\ ; R0\p@-@@@ꄚ O-MBPP@ { Pt3P `}PЍtPJT @T@ P X,!A@1̡0T  T L PUJ\g>l 00 {S(qap Q R PUR& `V# R 2pUppq00c00 S5 R `V  RXX0 # Ѝ-00...x.0<.(.U-U| 0-,,T,.H- rHAꡨ@-$@@r7@\ u0H-P @P  P P~@P0O-M⚏pQ `PC   ?P P:PI   2 PB  .PP; @T P_`PE 'pP`p@TpWgY @@T `zP: |PpP@ P PP PQPPPP UЍUTCRSB0 O-$MРP) `pP Z Q.  P R (Z p0 +R  0Az h 0%'-x"@ P \\"@ ?;R0(0P $Z( <!0zQ1@ %'0 0p P p !!RA~@XP ppqApZpppW RBr P 9 P g@ X (( P #`@ 0@IP .0"@0pZp S@ 1@ @$ЍY`)pP( &0H-LP@Pm<jq0000 @_0̑  &H&p@-L`P@`R8Oq, 0@Ep` y%H-P@:ppP u`V`  P x `X 0 P <<  ?;R0(0 &p%LM %L$@-@L  | P 4440 0/+S T ( $ LL|$$H-P@ppP `V`  dP  Ztl0l 0 8 P PP P0 0{SpTp(p耏 (%#dKYL l##JJl#A-`P@ЀP pWp  P  pth 0 P LL L0 0{SpTp(p` $"DJ9K t"IIP"0H-`P@PNPKpD0D0 @@T 0H0P i!!p@-0Ml`P@`-X*pL0 P U 0Ѝp0Ѝp̌ L!0H-0M@0 PP nP0Ѝ0p@-@P  %``P 4P|UP l P T x<44  0p@ !l GH| X p@-@o*  R 0'``P PUP  =P | 3d\\ 0 T@DPp$ A XFGh @8 Q  pP H-PP @hppP `xV` h P P 8I00 0 H괉 \(EF8 O-MXPU8W Pp Q{ 0 07h @7P `0P@ 0Y @7`P 0P1 R0JY) QN@z PXBg㚯, $P(p>N/8Pp@0S0`Vb`` `V 0pP@`zP8Pߍ'\`,@$/+7`  PU Tp pp  0oBC,/7`8P+ @Q T /+o, 0 B(P p  0` @7P 7  0 @7P 4`0PTPTP@`-00 p K-0M `,C $, C $ RJ0Ѝ0H- X\ @LA@RP R0H-P@$Pn|P "X +Q `A B0U0PUO 褄 H$ O-pXB `Q ЀA`FPR Pnjo `Q ЀA`FP\ P^Z`\PVP @P\_`Q`*PQ@`\APE `RPR @\OR `\P @QРA@DZB!% \ !$ R 0H-Pd@XPLxm@P  0vP@ k0  O-\MⒿ@ P4 T@:Q@/P uK?PP"l  K.hP PP/Q.QQ/Q @㉫PKyP @7pڮ/5+ @*+PPp8yP<P8PJ D uF  h  g > T- (3$,,X"B!`%0Q&`0p"`xt'0`ă#0r)`*`wq+`tr `huP$@ D!`wpxt`Arp` daS 1Q{\yJ\w^uJ}^sPqJ1PoVmJVkTiJTg4000@@C$P@H$@0@P0p,@SX@HOoB  ,P J 0 P D4PI X:EV V@0 R R<^@ <`l( Pp$ PX0 1pP^@= `PX@v `PH0PDpP0D{Ağ0PH`P4pP0HPD`P @xdpPT84`@&D{1T0U`0` X0pE1`0V 00T 0T0PPP^pP<`咿\X D00S ok0p<` R p\,꒿@X<`\ 0pPX4`04p10pWWppB pPp\<` P P p0`0S`<`?;  P8[0` P BP@ P8 `0RE H X pL p(P$@ Ąpp(P$@ XDP pHT@W($@p$pćp@ XD w [L  <XH 咿V R P 08 P<` P 02 P V 0SS0P 0p00 P W 0S S0KwP \ЍP PP Q PA QpW5  LP [P pQ4X@PHp[*Lg B `XP ` qtP `X`Hp sp1W'@pP`PXPPu  YXpI>T 0 0 R @P5Q@Xm`X ˂X > U~z00p0{P P00@`V# }Y!Xq@Pp2UTPE0C 20@_'0'PJYX0PPXQϠ ˌ p`2 P @ pQ`P @pPW `V@#Ϡ 1ˌTp R CD CFX @g0>\2 H 0 PL@0P[( ! WWX  QP  Qg H ps@0LTpPXXPF" P !FX@?; !0>g2 H P 0@L@0PE@DU) ! WWX  QP  Qg H pCs@0LTpPXX@PV"DQ `VDP D" R /+P2@SUWp"R WY`-004P=O-|M@PQ <Q ` Re >R `0 A R+A"Q#:Q`@PpV xYP  VT pPpHh0"0nD @P D@DpH OK RX0";@0Q <Q8

R3 p9x`张张K  xnPPpZ @  nn P 0 A R+A"Q#:Q4 @4pZ  Q|Ѝ(00Q ,Q;QQxAtD R[P' ;P,P`$P ,QLP P0 xpt0$gpcv밠 @0 >"d0Ao R % /,0,Q J<@QH0N S4p0 (((% `Q%`3P D0F/+0+QJj<PH a\  $4p `,p, L, 00$04!!a"R$4a  3Q$P F-) p  0pREWC$0p|SD0+p+pW0Jr9r6rT.@* O- 1qaQs#@crc1Wpp3S@pW WWF=9\ Qa\@d@UVrls@_rᦿp@pF pPSP`?01G`pg`fl0@cAACi?SCA?1CB@X؀@B^ 1n`0pCPNPPU@@F}y\02PL`PU  pFmHi;W%Z)\P ף(\Qz*$I$O-$MR"X +0QЀ@A BpT pQ T  P0< 0 0@< Fmi 0qmƟWDG8?WG(/ 0CpJ00=90<5ĥS 0CCx? (( BSw? `B 0Kmp%P0 G`>m."D㐲(97 @AP{p { oc 0"m`.0m [/@! `@#4$t!$T! `p"2' >t0Sx4. Q`4!a  3SD3`H @PH @P@᠟m P2 ɏpZPzd 0T'@Q.0T@Pzp z Oc 0l@.0l@P[p{}d 0T%`Q.0T & (J/0 !# F[ BQA! A@ `p{ d 0T(PA.0TrpT$Ѝ{p(_d 0TPE.0~Tp @"{Š. Jr0pAAjWGQ:@qG!BPBrpPW P0Prp PYp`"1A "#"0`#  !"q/&n`V>0003 P @pp30 0Tp p P1@DPT $p P$ЍE.=k9:Y`bu(\)\°Q(\\ףp= ףSc$IųtO-M$00, ($p" 0  Sp 7 @|CTbo302(j2C7`qcVBo302@jPtUEa_lgPf'RjX`WP`@rpjoXzoTЍ@aV[M CEĆVFn 1 Kj[p0#crc1Wpp3S000l!pa2aS003Q?o20021[K0 V` `zj<\#*+ [ HRj pple` ``r`\WXpp3XEP;L P;{jpAf `/00b  P 圀Wp@,$ (Ph05/P |PxPt PpPlPhP 4 q  0!P"0 ( '    0!P"0 $ W p@ 0W0Pp@іP6 q0FSQ- 0S(CP%ʘ0@ ?" " RJ0,$ (p84007/P XQ \PLPHPD P} PJ P (p8,$ < 07/P 0  Ѝ,PX ,PS,(@ UKP, ER,Q/+ ppGHW Q  0P8,$ <8h04/P |PxPt PpPlPhP P8<mR@P}<Py8Pu04h@kꉈ*UUU)\P ף(\8G-xM4`Vt3 pP!g  0v iR0 P0  1U01P W PPAH@iP:Z mT mD   f tP xЍw4 D8@@MH-P   0 ^Sr~A @-@4P P 0/ᣟl0H-PPk@T  0d 3/P m0 H-ph`@1P PT@ m D P` K-R @pPT&9/P pG§PP`Vpp@-P@`_T P ||  @@PDP  A#q B0S0S@<plp@-`@P.T P ||  @@PDP  A#q B0S0S@ p4,(O-MPtll\qpW9 PP @ `U P P#Q P  1/1/Y p `PPW:#W*`@@pW@xxp A `PT P@UЍt|pXXPh\L0H-@  A#q B0S0SP << P P4Pp0|x<O-sMАpq #P`@$A AQIOrtVp|  0`FdA`A\Aqpqaxap@kT!Qsߍؾ H-M0 0 Ѝ訽 MH- M 0  0 ЍHЍ/l H-MЍH-|pPpX@G^`P`u`pPu` V XXP-`^` P  `0Q`0pp0Qp \ X0X /X MH-M   XAЍH Ѝ/` MH-M00 0 X ЍHЍ/ O-M`p!W!V@P  YR ]P pU$.Q kT @= *P[p IgpC0 ,^#W  adpG*P P  SdA^p ^IgpЍMH-M  0 ЍHЍ/MH-M 0 00 ЍHЍ/H-M `)pP/ PuP+  @,᎛PJPjppd  \00PPLpp@$0 p(,   0t`pЍ蜹 , p@-@P,]`]&pp@-@`Pf RUP TPcp@-R@O|p@-P0@QQ [P /j p @QZQp 00 B Pu`Q  VZQppp@-P@`\( 0@1]p O-MMp@P00Q`P Z[P i _P  Php?P: ~B`㠖$f f*OSdf`f\f_iBp x, D0f`&6Hg 0`PJg@ZP_PXh@@ BlcBd8g 4(`0@崀开帐,P$ P0`H``@T%TV p? J`Q:P hXP开. TpgT * TT& 꼀gTpT @P@@d`pv@ P *p`0p@0F P:$Vtv @ZP.Xlld(40DLp 0DL| H|@`*V 0FpP QP `䀰0F Q:x`pPrpl$  p`pf P `0`dp83Q QP1P0`@0@ Q hp!`0@ Q:+9hp$PQ pl$ p_ Q PQ `   Pd`  ` @t \P`0 A R1`0 AP R: $QR pl$ p R PR `p`p p`pPdddd @@@d d d d d @dd/ aVPX0px0Q0 ` [Cpp[pF XCP `  0)'P[ HȠDpP [ PH JPpD4Ldd`:d     P  @{  Pt `td,d`A HP P `d;0ϟ Jd`hpLVP `d T   P `d :  ]  Y Q `P `d`P `d &  E  A Q `ϟ d    :  6 P `BfP `V Ded`<L@ BXxP `偁  0 Ppc P R @ Aq4HL P p PH *İP-`{`dHDNPG/`V  X D \GPL`4 { VCL= [K+k- P]p cPQA110@000 B0 POB`@  p_@`VX<`@L A[  WLD. [,DPw [u0`K Rp 0`Pj [g EQ 00Lp W A, D<@Q @D  P `@>  P `x @8  P `Q `倁Q `倁P `偁P `TP ` `0 Pp<`@0H\`XCP `| Xo {\` `[B2ep00`B/pGQ:p P8A `'dϟx  P @ 00BB/pt `D<@ B `XP `PP ` IP `Sꔯ 8P `P `P `#P ` q-xBo؀vd0 0`pG PB ؀Bad0 0p1 1P| `|P| `|= P| ` `` ?hp\`ZH [X J U P X@ Z < ``L`D<@<  7@  P `_ Yd> < F @K; Pg`  `  A 8% p-`%   R  `P ` 00>{:dL 0[ lQ R/ R@ R0("0.!r!0@W+  08R#8S l0P8 ` d8R80Q |Pp 8z d8X @eZ`L`D`<@ X QRT Td/J@Dp\`DTB T?0P0 +:Q, hRP g$ F V`/ P:gQ hRP FgP    Q :P hRPggP     0 Q :PV hvRPgW \pRW\pTL TP 1:Q: hQRPzg05  F V`P:gQ h1RP U gW gfff4 4 g HR>RP F:Q hRP开+g % 9~~ F V`P:gQ hQP  X  Q':TPv hQ0n  D Lp0W?\<X T0  S 0Y:\pgnQ hT0]PNH4X p@ W pWD`Qt:P) h~QP开gX TX(000 BS0:gnPW hZQ0P00O 꼀g | 0``C 0S 00:TpL0Q# h4Q0P00gp!~ a0  @VS0R 0qX\`8ATp0L0 04X SA    :gnQ hP P  "`Y 4GP9=P000R02:h\pgnQ* P0P00& `G W pR :gnQ hP<=0 P  00`\p,S:P@KO 0D! H0 k%Pd 0 R [: 0`p\! G00 0b\0S 0dS [  0W0X  j 0S꼀g KR:\RP /:QS h@PP开j4gI F V`P:gQ h$PP H\'%00g\ ( S :Q hO P hg꼀gX XPP @<QPQӬ \<dcsR:P hNP开)g' F V `R :gQ hN P '  꼀g KR'R(\p&  F V"`P:gQ hqN(P \p#a% \pP :Q hPNP开`g Gg⼀B% > T<ڼhpTX# P0:Q: 'N$P开0 @F V"` P:gQ  NP O$ hpQ MPP开@gd꼀gP `D$ `尰`pQPThp*XQPhp8QPhp!hpP MPlQPTXQP d0QPHhp] PPHP @PpP P ߍۍ PPhpPP@@PPT" M넇 \   <  P  t   8    H        \  , < H-`@Pp\P 0@PO-4M`Pp000@0 $(, `VP$ %P@p Q * 0 @ R0A :$Pnp AZQn   l , , ,   ` H L , ,,,  d0  8L L @*P2 0@ ` Q0@ Q:p}p0A P3@!p0A P:$QDW+:i @@@ca [ YWUpp0A P?!p0A` P:$QOW6:f$Q@ W : `00p 0W` p)YJ* pY : p p00p 0Wp$Q W :  00p 0W`ppW* W : `00pg 0Wp `@W* W : p p00pI 0W@W* W : p p00p3 0W  /  s@W* W : pt p00p 0WoW* W : @_00p W0Y > P b  @W* W : p> p00p 0W  / A @Wj* W : p p00p 0WWU* W : @ 00p W0WA* W : @00p W0W-* W : @00p~ W0 W* W : @00ph 0WW* W : @00pT 0W h   @ W* W\:wW* W : @00p+ W0W* W : @x00p W0rW* W : @d00p W0^@PpW* W : @L00p W0 FW* W*@$W|* W : @000p W0 *Wh* W: @@00p 0Wp@'WP* W : @00p W0@@pW8* W*@W0* W : p p00p 0WJW* W*W* W*W * W*W* W*T*0@PTTX:\PI X; 0 0P10 !R0!hhhh00P p0p000 P 0@P0@4Ѝ@H-R R RQ 0p bp Spa A`q0`Q`BS0V0 P0a0p  "!1@0a0$ @ PU:PR0^Ba/a`E0p`pf pSW U0a`V0HgfffK-M@`V`PT Tp~Yp|YQ Ѝ }TpoYpmYP iY@3eY@Ѝ RF Y`ЍG--@ VP@P(0 &,B0`L ' "( Q!UP UpplP `UGX X Gn`GWP!"+G@Q '"00@0r pPu @Q P USPO P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P}:  G`fS"O-M-PMp@P@`P P? PA P`@;Qq  ;H VR R ' @ PD0 qV`@  PЍЍO@`@@V@H HLP (*( P,p  ,B @D LHD0APA  +3@@ +QA+A ; 0p 0+ " 0 1@ A  C0 PA0U0 @0EBL `q ap S4@08@Jp@ B@c0 VQQA`Q0( $Pp<@ 4X8\@ p`@Q@p `@p CPN 4 BoWR< P0PR P  Y h  !)H Y @> i0 "Q (# "2. ` Q 0   Q -0 +`!S  $Q:8A  ZW Q1 I    *+R 1 S 5C C*  U/ ;; A0B 300 0@GZ,p@`(?aCoc?yPD??$@@?@ 0B E,p;! ;C 000 0@ R #+ ;:;C 00`0`@  S0+;1C (,p3>+=;R  BAK2@KJR& !  BK:KD1000@Z@,pXBA Z,pH `A2A Z,p@T@D0P AHP6JY4 <` @pW= @,p A8@+0BNAB0@;  R +!;;;; C1@;0CNAB000@  R@UP# L36`aQkP (@ W,p{J @v @1`t8 (@TZ T  J@DK Q(@R 9P 8P @88@8'@P P QP 8p<0pSD0`'4p  S4@0PWP o  pPQ ` `  `PP:@ (@@` @Pj VV b(@P  @Q+Po8PP$MV4 RI R 1@@@> @p9Q\013D/@-8Y @P! $(P*< 8P <p_ 8P ( P#P6 Tn(`Ph@8, T@0W@ PЍЍ[[ 0PJ d@8T ,pP` @P`@8p0PPDPPV   A8(@`FP  58 (P @P   %( P`W`uP @! AN(P 8@PQ@P pD4$PQ D @ @ 8P @0P< Y BoD [JR $P PPRm4P fp YXPD6  P: P  8PV Z.  PZ(! 8P@ (pH@ `PK`40 (P ,pP@ 8P 8(aP4/0(,pi,p@T@D0P f`,p0(`4P: Y8 P 8(<P-@* 9U @1P%9U9D,p0 (t9QR1@@1@[1PPD4P 9U @1Dm ,p0(PDk l hl k l j Dh R ":S S/$/ /0H-@PP:P QP@PP@0H-P`@pR:pPp)P p@Q   R@U0 12 [O- MP QepB`  @ ?P T@-P 0@` `0V00@RP @ `PA ` P @PQ@JP@PZP J0 `P` 0`PU00PW Q @ PQ@J P ЍH-뀥A-RM(P@RD@,  (  `㲃H  0 $` `````:D2D/NH-ؤH-p@-@PQ P PQP`P  #Lpp@-@NP`P  LpH-MkЍP H-MD" -=)@/  qЍH/C/hX H-M   0@<pЍMH-M 0 00RЍHЍ/0H-@ 00: P:P P P! K& @0000 0S P/!C/H-P@Qb  @P `Q PQpAG QGV f1O-M-MP@`0`pN` t p l d@Y JR:*Z Z Z +Z -Z  xZd0x!I x0Z\ 0 0xSM$` xl0 Pd\00x  0 XH 0 C RPP ! 0PB 0x000 C R *XX! 0BP `` TDS R p`@@T  `R0Lp@d x 00S S B0 x 0X p@@p@LJ0S @0pxp0@0S @1 Cp R@L:20 C R*0S  \` ph@1AV VPpGࠡ`Wh@ ` `@pVPVЁx0 @@L `pEQ[T  x0p+S -Spx00C Q0Sdp0x0 0R C d70Z d`xpx, 1BpQxh@@0pB@`0D Q `x`0 0C0pB@ Q:`F0 `0O@ F`NLRNlpQdph@Qpg@`T[ \0h0T PS 0P0aPTPX0Z @LP IC%Px2 P x@xx) Px@`xT`P-0ZhP@@X@ T B+ ! 0 PX Gp5Qd0L hhpQdR$ R4R;ʸ[ &p  L 5 [  (A6Pdp pT3`  p  0 `,Pp/`PXHpr(@ hp%`Rh|`!L !B pp  p0` 0P PX\0 `h@0S*   ! p#Wg ϟ#SG@0Ltp A ``t`'jP +W `@00psEc /    p!W8 lϟp0!|@P`0U% II0P R `APUG8TP@@l)|@P|IIsl Pls |@DP@|0, 0Pk| PPX4ph<@*,Q' J+( ? (BJ@@ 9@ZP ;D0w.P"lgp@0@"t@!* tpP?  0 !R1`\ǚ` pl@H|`P ` @PilPX\0` `PA@[P4pBU@P!<O U!0@PP4U28<Q0  P p_ P$N U @Q l0q0pS*`v 4pl8|PhUXPQ lUPljM M M eA|@|P@`P|L   T |Q2 `\XP0 0P. PQ- lT0"Q Rl U pXK  `1\0 @`\0XM 0Q @0 !R8<Q=l! RH@PPH~HL L 4p  0p"4pr X0Q@Pm l @PdU Pl PeP!aL X |lPA|4pQ b.PPh X`Q pQAH JHV f1lP.l`X<  BQ| R`P XhPQ pQAH JHU e1l`P@P4p!8X@|00SP@P4pR lG p0pP* R BV@ O-M P @8  @P 5Y`R pW`QR p9><Q Q` ` P~  !  `2`Z V @` `f( P Z  `-@PX @p QA [ P PP PPڣ 1J"  `'PK[Z)8`  `f6 @`R `s`ЍlZPH-mK-P RPPF @` 0pPw0%uP'%8p Q!8PpW:W*`qp'8!!8q`Q:S \EP P! CP O-$MP@`0PP  (P0A S:@0Q0q 0xS P0  p0p@\7 PYP  ^` YN Q#\*[0 Q@ q @ T2' 0: 0[ "\ pA0q 0 0A1 !P:F0P xP Pp  P7 \ :)Y. P+ \*[ ` @ 1 P pW1 `P :\  p@0 0S PY )Y`$Ѝ pP ` 2QT 7Q $Ѝ$Ѝ4 3 O-MD@ NT `0P@  0R 0S@ 0 PR P RS Q S==0@S R 0pPU p0Q  P( R 0p@@T pR R  0Q0Q  /o0PC R C pQ+Q -Q p0 4    @0DQp $0p `DK\p0@aQ @0#`BDV:@pG0@ `Rd P@pI^p ЍS pR ] @Pd PO[Ma Q QlLP  P U0b`p\ uRP U V ` U  `PEcp`PP4@@ Po D `0g `Td `P`^Pf P( P([&_[  gG"b@{`;pE 8@ Pq  Bp8P![9Pr`bV: Q@ U`:Wp FX h 2 @=@ ` v @ R G"@)@Y!@IU4VD` `T `p P PE7X p@ `@V P P P @ P> PB PUAU9E P49aQ `jY"@@U !@0"@PP" j eP Z!@p@ @Q @Q zF"P@!@0 ! /K-`p@ R  P0Q P(  YppA PI`V0 A P PUpGpH p Y @D` 0 @P `@Tp980H--M@P @ ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A 0S10 R: P(PࠁNE0S " R10\  R/ R /0H-P9PP8PP7PP6PP5PP4PP3PP2PP0 @1PPfed0cb a@0PFED0CB A@0KH-0S $ B1 !R1*PQ n@`rp6@`V:0 pppW: 0 Q  RA@-MQ @ R @P:@ {@ЍH- a@`P TQU  t\PU P xxPtPEQLUPP $$ # J$Jx L # # 0H-P @!P:0HѹdPPQ T{H0!S A ,0Hn ! A0# " Hh" HH-   "!rQ"(?or0S"$0""0"!0S    G-?Y ϠP q @a @@P0^U Y `I:P `! >!P : V7!P: PQ& 0!S  PPQ 0`!S `d! P$! ! 8 dF Ft! F\ 4FP13P1"0"1P1 3P1 3PA/A /0H-@PPP@0O-M` @R@` [¬P4 P[ PA@CZ   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` P P@P &Pr r&apW" RPP +qpWHPa pqpP 똡 猁PP$ fPG pT !P:CQ 1 0RA   A@[ p`WP pW3P pPP HPQP LPЍpiLMD \ MdKL    BpB K-` rW WPF  V:RUPB 1` fP@VPPR5Q:UPR:LY! !P: ᵷlPPQ \]P0!S 4Q$!   P@ @ 0P/00 R @ PA/3/G-P @R !0p`VpAQ B:PI   @@3TAPA+P0 /A 0 Pp``pPpVpp PpW: @` V*p```PVP0Pp0 P:@ @R p@- P0`3P@H1P3TD1""1TB1 3TA1 3TJ  @b R@P SP b 0A5 S>0 R N+b S 1@2@@pK--@P kRT2"pQvV  GH&a@N# 0[C'q0Vv ?oRR0&8Bs R#4B #2@ #1@! R, `@T)w ?oR '(br@T"$2P2`""0`"!0`V" p0 `T @` `@pp0 @ d"7t `W`p`Q 3AA5d# 0` @`pQ2 D+B 0pQ103Q1""1Q1 3Q21 3QJ pppC R /  R/H-MP USA@A fP3 ` @ArP3JpQ Q& sp%   P+LP @`  `\PT  P00@$ 0( ,@AAOЍ   @ Ds0H-@3@PPP-40Q A  /@- aR rR wR:<?0,0 e@BT APx%0R +R$0+0 @p@-@P3 V3 0P QQ 1P Q 1/pPӼ K0P @ P C0>0`aa3 ``pb@ p@-@0Q QA 0H-@PKP H7@ @H0P @ P 0<PPP 80 1P%P1 PP;C!$P  5/PP0 @ P0l    Q/0H-M0 ?Ѝ0\ \ \P /Ѝ4 `Ѝ Ѝ6@  //O-OM`P?<Pwp&P3 @VQ   qP ?P?P{?V 0 p x|Z zҰ pDp4,  0P8P0  ?V qP P A X P 9 Q P4P PQ *Q Q4@ <P3  P0!! P$00jP0 p|@P73(, 0<0 R5PX Q V0 XA/Q o12307p 3P7 25< $1$(1(,1,010414818<1<@1@ D03?D0 <@Q?<OPAP p0>P->P3Q&@P"l ! 2/@P(sSP !D 0@0!NSuqoh>e>P@.`>P Oߍ4$$pP  p`0 P  p`0P @<>P98>Pah d UT0DA-@P㴰P UQ `pᨰP U  &1!!U>P>PH-4!@ P =PPP 弲@P  @!寲P U=PQ NoppWP p nᒲU =PP/0H-@Pဲ0@-@R * 0 0@?==,H-Q p=@-@S =,  0@@-@ u=,  S 0@c=G-M@So`pi $PJW $( $ ($PQV !R WW(0Q(($Q U 0aP;  !Q(PU((U$QJ(q 0PU(00S09P  (0S Q$ $<,Ѝ(qPpP  0PPjQ !R 0U :pW $Ѝ p|Rp GP C (QЍ0H-Q <0@P P4P  P 00ZP@0A0O-M@(0!P5R(P%p5Xaꇑ ᘫP.  pؑ ` " $< =paP !( ![ PD  , U , 0 ЍOXbЍ@- 1@3/, (P0G-M4P @@ 1  3/ 0  `@   ``! 00'  (P0)` 0* `+#  ,"PP-!` `. 00/'0&  1%02$`P3+`4*P05)$ 6(E 7/"`#8.%0&P9-:,;3<2=1>0?7@6A5B4C;D:E9F8G?H>I=J<KCLBMAN@O`FpDPE@G`pp `G`@0`Pp@Q0` A/p APP`P@U 8Q 0,`eP ލm;Oj;,ލa $80p` " (12/ Q, P  ` F P, Y9O@T p Uj@Ѝ$( 2"p'>9;9P`69 ` &P ` &P pP 8 ' {b1d 4  ` l 4 $ tC D 0H-@Q P'P 080A-M@`pQ P'PW 8PЍ bP ` P r 0P!@ 'P 'O- Q + D Ƞ # @!D!Ƞ! %@%h%LP ` @ ` #X 0#4 0!4Q P0 Qp^ z^  D@`@P0p@P`0p@ P 0p`00p0` P0@`p0@P`p0P00P0P 0@P0 P 0 0 PP00P P0 @ 0Pp\3 00s\+ TPP@`PPp@`Pp  ` @ P  p @ P ` pO-M  Q_   Q Qp^ 00 s^ ` X |PP Dpp@@@ `P  @P@@@ `p@p`@0`00`0` 0P`0 ` 0 0 ``00` @`0 P @ 0`Ѝp\3 00 Ds\@'@@P@@`pPP`pP @ p ` @ @P ` p @P d X L# `!dP!X! @'D`'hP'\p#x 0#4  0 p@ ` PЍp@-P@Q `%`'`p" %p P { P tP mageg`P`pp@-MP@Q `c%`T 6Ѝp "    $P @ !pb1   ` 7%P%P Ѝp  Ѝpb1R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/@-Rq0 @5G@-@ / ?!BC2 @ @R*R/0Q:/H-Q   !0(|pdXL@4 0"0"0"0"0"0"0"^O-MPR pW! Pp!08@ p0 o2W  q pYpo0 Wa @0T 00 0  pW; pW:BpP- `P$ TD[` a o2`   #_Ppp[p Ѝ pp @_P  @q 401 B S 0001Z+ @p@ | Q"0S0S 0p @l_@P@ @  R H- 0A1Π\1>-1!!K-M`qWWЍ@P ᑩppW R T T  0_P U P W4pЍЍ 00 !     /p@-`ye@p PV fp py4`}eu4`pA-CMLaP@`,fQ$9(!1,P00 P P:T4?-$  e,Pp ,fp  9ep T fp  e ,4@ d,e$4@P,PCލ! Z,O-DMtp` @@Q P"P XXw P0S@PP%3@ QDЍX(P 3 p ,00 ( 040 P(p0S p $0 8 8 <0 P `PX  "P 1 0p7 0cPE  !P0  1`  0CS&:PP  p P  PJ   D"u䱄帲 P\   5"  P` 0XP  #"TP    !  BR *0  0 رP 7S 0pP@ 0! A 0 q! P ( PQP"!P P PR  pQ!  ! X    Z P_od l  O-M@`PQ p!p eUf Ug +P P P  p0 P   r0S  P  r  A/oᢲ AQ   P 0 ]pv @P   ,![GPc P P PP:2(42 Ѝ P PP`  ` P `QE  ] PP 1 `%P  Y     Po" ,  XY qWC P 2! P{ `W qQ  { qPW U㴠  Ez !01 P P ]  PH `[ K K  P6 `QW|  P( `QpWG  + QU;  2! P `UP   QU @X㴠  z P xP `/+ࠠXP崠  a`PO-M(p `Q R QQ Pp  Wp   Mp   Gpp  0P0CUP0P1 Q @?;0  P0CUP0PB Q(E Q R QAʁЍ ( CWR [ K  `(PY OKp P  `Pe [I p PQ PP2 QPN  9W㰱 ` 갱 `   0tP((R   0ᰱ `aP Ѝ(('Q P    P  (( ( (   O-M,pA To  2! MP{ T`P@  Qp9 P P' aP\ sP V p_X ,0@0CT@0@1P   - 1OK@  0IY*F  @;nYFG    U -_p JT$ apD.P P p尀? 3 P P0PpP`P! P. /P HX`/P   P .{y.@oᠲs |d @-R@QPTP'H-XMppT&P `LHD@@ ] '@ @. < U TPXЍE໳ $U T p@-MtA@DP IPP" UH @THЍpᠳDP! TP<P6DGPD#*P>0 : p  P=`p2`PU^ P 1T ,T O-tMPBp Q@p P `lhd``  0'  ,'@  Uf&bl ` @l@h@d@`@  ' llll @ o P ZI H`FZ PGZl@h@d@`@ p` ~ @`@&?@U:%pP`` @  kW`pdPp@`:X @` \ &  @ ,  ( <@@pPtЍC๲p R R (R P T O-TMȠ@ Pd*`p @  LpHpDp@p$  & @ P U:H V ~*P PTЍ} 8P O @- @  T @jO O O-M tQ g@ P 찍谍  @& p\\\\@  I 0 p'  P$@  9 Z @ 3 P@`y h |  & t  PЍ | p@-@PG ` Vp p@M M @- MA@  p0 P-   |th 0 Rq Ѝ ЍtS @-@@ᙱ $ @pL HL 8L H-@H PE `B p$ #(HA^O-dM(0@Ÿ, Pp0 HL "$@X@ @0,THbP\PP`` 0 pPp "`X %Ha`h!T fP"e< `z8e' PXD %a8 #i aX @`\e<P@,d(i#nʌ k a("i `a 4`dH,`i *d,n "|fl'f8T#afx.g R   P@ @@@  E PP  pR PwU  @P! @ PQ  ^嶰ᴀp@Ѝ@Q M@O-MPp,  @Pm  a 0t @1 @ `  $ PO  `x@ @P HP㨀 `X` v@T@F  " ( vpQQ @aP  @Q(  ` @ЍQ BP  rQ/      A Tg p 2! P TqQ.  A0T-  `~  q Wh @ 2! Pc WP4  cq`W3 p0[p 1 Kw ! @ ᴀ@E Pj [ K1p  4 @d @@V@  pt @  P /+@`Vp@ !@   @70H-M ,@P( @ @uUЍ000/( P @-0 @(@" $@/,O-0M$ `pP@  (,V0 pPD$@g#%"A4O`P,"q`pq (p,pi A p( p p'p p  (@0 p  @S,@@0A$((" ! $%)@@PsA`y''  cqAv'eCE$L$   $`c'@p@  (p  @' @$@ p 0Q ` pP@0 ` 0ЍA-RE ` P?@Q @pa(W0 (LP@D @T:(p@ >@P@@D ?T @T :0@P@@D ?TT ( H- K-@P6 `P? q<W (7W (7g)7!( ?W (?'!  8!@D((P ( 2/ Ph!P @-0 @P(@! $@/hH-\H- P @-8@ @4Pj!@DHL@/O-Mh $X T pP<,`@8 H4\ 0LT0@D@(<@ P4P@0(0 P`L|0 0\Xl ` 8$pxp,PP t `p h圐堰 P p@` ᐰl` G)I +) i)g`&KD`&+G; ' I4 $@ "0 @ 00p` t`0d@匀` @ ` ` 0 to0! 0#2%>'aက0#lc@(0#`@'.`$O%A" "LC "t@ 0|0|x x0@t@`@Z@td dhl @ppp圐 0xP!p0S |@L̅"tP`bp/#D "ࣣ"0@0@P 1Qp'@ p'1FI>0$%CqY"3#M~&P@ "pP "Q 0tP堰吰0 Y0 w)y)Wp%[T+Gp'+Y W IP$K DP% @   P@p P pd@P t P@ p xP| 0OpP%P%R(^&Ap hP%LC p"% @p&^p'O(AR@%\S@$P@ p@@P@@PP0x@^P|PpPሠ[ @P:TZ. T Z7 XB JMT  o `9{xK#T  [n o `  98cT    ^  b*QooA! ^ 0`)T  >7ooAP*`!a9>8.^ nrb9>8.@n pN18g9'0p0@?/P@ P PO ` o R 0^_(㆐Q  ЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /3@- 0@ Q* / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00////Q/R Q/U/Q R Q/R S Q R   //H-Q0S QP Q0S 0Q@-Q0@S Q^ Q0S@@R SU/Q \  \/ R#%U#/!00Q /0H-@Q0S PUQ PP0CU U @SU@0@Q@0@-Q0S AT Q@0CT SUQ/RU / Q#/ Q#/0H-QSPQ00C@QPPPU QPPS P@p@-@Q@S T 0C`PUQ PP@DUU PS `TPUPPpPQPp   ///H-P Qs R US  R/ / R S Q00Q/ S#%U#/!R  Q0///-R/p@-Md`@ Px`2222PЍpX 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/P /l 4 H-[@-D@@4@@%p Tu@x>d>////// //G-(Mp`aP`:=P1PqL ,0pPP@T PAL @PPTPPPPQ R "0pWp 0pA pS:%$ $ T H< (9/(Ѝ??????>>>///O-M$j@q`x P PUPe %P T4 ` ppxZP8l@||H0P (0*X= 0H Q 0H Q: P Q 0A0@ Q: {`yyvi`s@`q`o `mlkligke lQ `P [/XpX 0 py  n wp p> G 0c  ppu  j 0`8p0x``0vPppRJJ`P @PpY  N 0`o[  O p`Y    0  @p0/ Q-Co" 0:! @z`' @z` @pz0p`p0r{p pRI P P) POp * &2&b @Sp 2. 10a@S p 0Q0 p Z p:p  0! J0  Gc z `: p0gL0R 0`\r ps `0   Y+ I` `Z T`4 BRS  T034 T40 Y  `S T 50 4 YZ T4 BR BR0 T40CSP T 4 4P0  Z T`4@Pʵ @ 0000p0 TKH``TPЍԩ -%Oq'-m A-dP@X P`ppGX`WڼP 5/@@ K-@Q" QL QI 0 Q0C pW pBqW s`V`PUpW`W, qW( `V%P 'P pP`V QPP R R R RQ O-MM pP( @t@ PIY!  0pQJ`PUqq XP  4PP $QЍۍl O-MMTa@ PU`p Q RЍۍ ' 2 ' 2- qpqpQ'`0HX'  0cpPJ`PUJqGq   0 `oP`` ``T  O-MM⤏`Pxt  N PP Pʑd `a || Xp0  0t) U\ďh@Tu PhpPX` R 0RYR R!RQQ L!RG ̌P? p. J.-̌P2JP P  Q%Q Q QQ  QX ̌P  @PZdPh+ ď̏h 0S PQpb!pW 1pP@`sP@ ` 0d0`  PIQ `XU  >dp0VpJ΍TpqPpuf【 K P AK.,!J!တ XGQp U A `FU  TJ~d@PP`T̏hX\QP\P,dJ(<$ x_P H L Qp @ Q Q l!1v/0< Q 2 QD 0 18p4qpl@x`W )Pt 07/PU qPE_PPc`  l00 ; P4 X0N\D`<@PQ@pP8pPsxt`P\PPPPq `@\ 0YP P``s L|0 / i\ 0pP*PHX`a8P `J (V`J 0ЀTt$4 0J 0\X`T夤XPPdPpЀXP 0Tpd 0d/|@QA)@ (/"|e*P PruJh&0I*P Ph`P\p% aL  _PX01  JP 0 \h ,0&P`aL  T_PLX0 aL x ^PX0 hX0Y 'Le! @+p`  )PJ`  X0m P 0o+@P ~ P``儍h 2{0 dd- `\T\`'LFP``8 {0 - .` XЍ \L($!  X0L P`` z0 PP, ્r`  \hYJ \\PP _ P tX$UPS``刋h z0 hh+ zA`\h x " XPh 0 0Y $& 2 \LhP% hZPP4  `  XP 00ZY P%  `P \`L  L v\L X0 T L\`P 4PY @P8PcxtX$HTPPP@-f@ p $|X66PPgP5J. |J| *PJPP PPP P(@ P t PJ i  )PRu> N(WpPQT@ptlJ^ : X2d  'PPp@DhP`q (PmPA hl Y`@ P  @X0{hPq R:q 'PPA  ,T hI q  R,#J'PڴA Xh1 `a   XP06h0Y $$Pp` y0 xx$ ϋUP` $@\`p`!! QX0 `a  p X0 R n$` "\ R   s qW )P6t xl0p00 07/PU qPEP P Y $@SP C$@P>p` x0 # h/p < RP笂h``$$!Pp` x0 PP" +@Pd ` Pp` fx0 ! 0p$$  0 o`v`QP X ($D@Y$@|htQP=H  RH Z \$@PLP <'P#p$ <@U @=P`` xXX 0  Ί`< &QߍۍCPTPOON \ #P;QP SSR 4 T "P$ SQQ t \1\| Y)Z \8ZZ l ^[Z>Q[R [d ~^ ] JZ | H Y 1^+Y dRX G-8MMp`P4=@, X0  ;3 P 3+{3 /}wPH30 D @4P8Ѝۍ L ]xNEMx / /0H-@ P8 0 Q 0P 0 0ʚ;6eH-(p@ P$Q`` R 0PR@QP@FP@ʚ;P  QC/Rq/0H- M@ &P P&p  ? Ѝ0 Ѝ0PPP Ѝ0 /0H- M@ &P P&p  ? Ѝ0 Ѝ0PPP Ѝ0 \L/MbO-$MM@HPp   T 0  0  ``PK L ;`P8   ; 2`P(L  0f`p%  !P4 , si P$ЍۍPȐ А 0!(/<  | #0t#x s0/?r s0wpprPPP`2` LK J@ iX J VIO-4MMp0`` i R 0.R S@` QQ.AobP0;/ P@ X 0\ Pd(ppP# R($ X 0\ $PPp$ T @ @ p@ pVY (`U DPO $ @H P .PP@X 0\` P^(=Pe Q Q Q  X1 R 04S  R PH$P PI T @RT@(P X 0\ PU q [ KhP0P4ЍۍПpPPP 8h 4h<P0$ R  d , 4 O- MMAp`@ $P P Ѝۍ4cP $ևP `d+0pSPQ1 P@Q$ `E|FP  @Q ER @ R``PK  y` `ᥱ D` \ G-MMH@8 `p !V   0φHPV C P 0 ``0+pKF UgU PE.P 0`; 0`@< 0z$QЍۍ BC O-TM`刀xp A .%P $ 0r@X YPPPPp W@/P WB WmYk `PP I0 P0fP`JPxpgz`gW|PPL A QI A0fPBJ@ ffpff P @"` I Q'x p ppfzffvf@PLV | PpL   @ETЍd AA-P`@p p@ Q)``f Xpf``PifPf qE ?>A- Pp@` ` A0Rp RQ$\fYf` APEGpOfE>O-MMLP  *f cU  _  L `@@ lVA@lF5 p@@@_P P0pBA<̟<`8 … `,(@ ed d  8PQ `` w\ H@0_D`S`@0`P)*p WPq0 0 pCWS `4@ @4 TP `v+0PP , \8H` @0($$+0PP #P;P  P&  }PO  vPx  oP  hP P P,p)   P PX,p P0  P PX,p P (@@@@@@@@(@@@@@@@@@@@@@@@@@@@@@ P P(QPp P P Y Y{0 PO Y% ((;Y$ P  xP ;Y yPJ@Y@fP( 0@ P h0 WP  Y;Y yQJ@ @?P @ ᠥ 08Px  1P,qH l0 P0hP P v @H54  0B @ <0PI X PA &u_^P& 4 y PA u _P `D Q 0 Q Q0S 0Q 8PP:4T Q Q QB4E< ,R >P (0< R(P2(P<GP(P%(0P x|8dd  P|Q@|a p 0rapφAq x[ |3x#%5v 0UUUP[ P`P vJPv.P t4P1 `pHpPP a .PpRW :P@.PPV*GWp ODQ PH@P0QARP   %Qߍۍoarpaip6.int <\^ \3d4ZL:5C A: 8< 7< :h2j1V2I1K-䁙PJJ `Q vP@PU*p 5AX xp CTx'|p #aP a0H-MA =4PTPP|Ѝ0p@-pM|``lQ #`@@U@ P5 @l QpЍpۙ G-`PJ pQ v_@@T*p X" r3P@ 0@ PQP# R!R 0sP@ 0s 0@P O- M`@ܡ X 'P  ,t,Pp  P P  @Pr   :Pu  3P  ,P  %P  P  P x P `  P H P 0 P{  Pw  Ps  P  P P P  P0PdPj fdd` }[ PQ oMId bHs:    Z& P ?P? ! KrZ P ?P? ! 7r(PP P P  ЍU-G-W-*+-*-*)+-R,,,K a,M,:,),A-HM\aP`@l3h##<10 "=p Q9xq, sW qx|0x#40%0000,0(<8@( 0xp 0 xP T T000HЍ?T  pppHЍT)H-@PJPQ vO`p`V*p q Q/' Q/8&K- \R 0pP P U0pUa@V@@TÁV C `@ `@ `@ `@-0@@P @L` \H @-@P @ LH @-@@P ̩ع @-@P ©/@H O-QM@p@@P P`aYP  , P$(`#X:zP(`U#Xt* P P|NPx |P PP `|P PX $ P$8 ( P U:$` q E Z #P P ` V:  ] F ZHPQx* RuA ,(`PE$ P$#X: @ @_ X`   0W G:1pGWB:`GPpR; `FQpPX V(: PP FP `Y:  IPP &^Qߍ(巨 ^N @Qߍ @^|H p@-M@P   ~P ` ~MP ӲPဨЍp Ѝpu ЍpC O-M||x|| p@T ,X@@0(@|Ta TudDPdpHHHHD$D885T pU sU X`VDQL PQ Q4' !R6 (P` PPm pAhV@F5 T&2 /oAo"VT`F`A@DfHy V*P U*'D<P0LfpE  XPE& 0j85,%!~%Q t dTH@8P DR(T섟pʤt@Pp$o0S !<34010StpaVqtq X(:`P 'Pq Qူ1Ȱ@ aZP PH@A ZP ! B гR @@s娃pQ  ',Qq  Rၰ1P/ 'Pq.*Qpp1%Ȱ oZPz DAPa`fZPq ! B @@r@Q p@@`^p HZPS @ E@ Q0>ZPI ! Bp  ddqd pXA@P8P,P@-ЍP 'PqnjQ`1`Qp"VP @@YP A` PpPp$ЍЍ\{4#$`T |& !hfH<8\TXX0D x&  \%%ft`L08"#x"lt<@o H-MP,$a$`@ P@DQ -yP% &yP P pyP pW:PNcpЍ  !XX X 0hЍ44 4 L 4 `DOHeO-M Q = R  LP @ P XQ , P  , 0||p0t|p0d, PPPP|P p 8\P0  (  :R 0`B6V  `0`P``R ` ;R`ۧ0r0vP@v0@PK@ `|; D0 h+Q ` H+ @@k` 8Q (Q + 0 S ;000Q @P) ˟ ;0[P,P *   ,j`VhVPhZP(P 0  0 R0,P  `P`FP  EPPP3 R@ 7XP) F` ` P  UZ#P$ `@ p P ) @U@pH P t p @T@XT) `  890y@$ T@+ tzPv P 80y@T@ ZhRz`PH@|8 T0pXP@V  @, H@@8 04XP,H@ `V@ W  P  D 0য়  R`P @P"PP @4P\@DDLT`hpxhR RT& @UP@y* @ R P` 0AS006P |PQ `;Q`ۧq@vPv0T @ 5  R00/䤟  R& 0`AS006V ``P``Q `;Q`ۧ0q0vP@v0@PP A6P 0Q p 0 P :RSEC@\$  L4P0<^ ( `V ``B6P @R P ;RPۧr0u@u`S PsPm,2 0$ Z><AЍ753皐P) @P P p匁 p`PV *PDЍЍ @BЍPe Ѝ\dHL0 ԧ |p 8z  \XD(5 <5 d  lthp0PlD@t0,hX |  pd$T< 8,d$\p@d,l`p<8H\L(l0H-P @@ D R08PlUP  !      P0sQ@P000 0 00$(<3A-0`TQPD @ `NQP= P`P-p`P,PQ!0` P0P``0P0P  P( `Pp(dpH_/O-MP稱q娡娑威 p P AT `Mx@hdA`T  , PQ!0 00 @P(P P$ |x  `1P0PP0ЍLPLXLH- v t( @-@P !R' R  00 !0!000T \hA0`  00LL @  <@(l\\$ 0PP/@-@\P PQ@  P U@UQx`UH-P)   0  , 0xQp  !R`!X0 P 00<< 0 htP/@-@=  R  1S 001l000dA0\00HH @ @@/(xH-PPU+ ``AT& pqP >U [+ (P  P0㩜P . P$ $ 0PᕜP   0PP@P P  ޷? Ѝp@-M`@ PpPЍpO- M`pP  Q @0P0P F D@P. 0  0P% 0P1@P 0 0P P  z @@ ЍO-MP 0 @po  @<`tp P0pP  RQ 0S R Q Q  0֛PAp P  `0 v`r@@`@@80@` CP:@0p  ⸠0@P pḠ<@QpЍA-MP`pQ @"@!P VY,\\,\\\/H!R*"DPD 踶0"A(/ $p``pW`ppW! `WC `pW W4! !2/p W'!  ЍB?P " @}@W 0"P ! EG 0P Ѝ V Vp$p   0ЍO-$M8rPp@ wQ p  @  U U  P 3 `PW p@U U@ `L P  YpJ   PA t`Q*  0p`&p`Pp-`( pP@ ֵ1 C 0q pƵ "   `8pp P$Ѝ}  Q xP O H-4QP8 N <~H-<Q $P O } H-xQ`P TT  R 8  g ҜTHL XO (/0H-Ml  P\\00 @  0PP,, 0PЍ00Fu2uA-0S  ppp2  P@`p@`p@ R *PU UH@-M @UTTЍ o@-MlP ЍXX@  @ 0 p P Ѝ@qq V{@G /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/}*/z*/w*/ct*/2q*/n*/k*/9h*/e*/b*/8_*/\*/Y*/V*/S*/ P*/M*/J*/0G*/QD*/A*/)>*/{;*/|8*/#5*/2*/)/*/=,*/)*/&*/"#*/ */*/*/*/////^*/ */*/<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ */*/ */~*/{*/x*/Ku*/+/jp*/Om*/hj*/ig*/vd*/a*/ ^*/[*/X*/U*/R*/O*/p/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*//7*/>*/ 4T*/ */6 */*///*/@-@u@*/*/*/*/ps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchroot= o h2?YPF"xC4F| LO!w< S ZYN)!]c i6HoQ|2!uܺ2!j"H0 3kduf!2!H|00*!, W*![ `X     r " t   \! p! 0  R!   ?   m  FM0!D"Jj!TB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/netbsd-10-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written f0..Q..& (/@@Vx//Z/@@`/f80L0!0 m0s0@@" 100@@y/unblock and -DNO_CONV?0`PDTL% unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdoutclose%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0abcfGgHhiklmNnPt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-10-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted onUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupHOMEno previous patterntrailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNSusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory ././@LongLinkFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.LinkFile%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %spaxXXXXXXXXXX/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-pv] directory ... G GGGGG$GG$d8GH%HE6HZJH_HyHH#H H_H^HFH<H>H?HHPATH=}-+?=###%%%} Cx"!t!-fY QdQQsW-cQQmQQlQQr aj!MpQpLnQQv Qb    [& STT TTTTT"T'T,ThU 0T5T|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-Current option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALLeq!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %spgrpbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefcinputrcgetoptsfdflagssetvarumaskunaliasulimitwordexpevalshiftPPIDNETBSD_SHELL20220122 BUILD:20260402190042Z SMALL#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complex%s: invalid field width%s: expected numeric value%s: not completely convertedUsage: %s format [arg ...] : file changeddd  dd2! fd/"d d1!  0! d Cx"g hd:/!P,f3fXz X8fx?fgJf@eP!PsgB!PeTQf U!|XfLf e07Phkhrhzh h@. @hhhh]fafefifnf#mf3vf#uf3}f2|f3f3f# hh!h)hhg g@ggg$ gfgh ffSgYgff`gggfgKgogwg@f@g f Eg=ggg@gg gfC$fCfC$fCUf8h?hFhMhUh \h@ffff]fafefifdiscarddsuspeoleol2lnextquitreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... owner:group|owner|:group+~&09@OV\n"chpUu~ !| } ȁԁAuIuQu@Wu@]u@eu@lu@tu@}u@u@u@u@u @u@u@u@u@uuuuuuuuuuuuv vvv"v(v4v@;v@@vEvOvUv`vgvmvsvxv~vvvvvvvuvvvvvvvvvWuvvw wwww(w/wvv8w?wHwPwXwu^wewywowxwwwwwwwwuwwwwsvwwuun"|||=|||||||}} ! } } } ':\iZ) R8*%Uj T p% ]"&&ׂ8'Jdr X'"'#n"|||=|||||||}} ! } } } +~&09@OV\n"chpUu~ !| } ȁԁn"|||=|||||||}} ! } } } +~&09@OV\n"chpUu~ !| } ȁԁMACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfsflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] (109LV;kpO"?` 8@,` At~8Bq` BD!` EEFÌGqunknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgekeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s forceUsage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:қ-T  ͜   6F]rޝ,BZv !+!#+!$&+!1+!23+!4+!5ƞ6+!8ў9מ9ޞ:;</=G@VAjBCҟDEF$G$H$J:LWMhNoOPQRSРT٠UVW\a8cBd}efgơhơiơp͡q+!s+!t+!uv+!wx*Tsע3Khʣ2B^x~פߤФ"1DO+!+!+!+!Yqƥӥ*LLLeЦ#>Zbȧ4_+!+!RM!?Ũ+!ب+!)L_r~ѩ0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.bad disktabInvalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:!+~&09@OV\n"chpUu~ !| } ȁԁ*!2!z3!*!2![-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]returning to single-user after filesystem check dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!returning to single-user after filesystem check pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/netbsd-10-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@    untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedgeometryPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-10-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-{+5"d+.#D'F'E',E'DE'\E'xE'E'E'E'E'E'F'F',F'LF'lF'F'қ-T  ͜   6F]rޝ,BZv !+!#+!$&+!1+!23+!4+!5ƞ6+!8ў9מ9ޞ:;</=G@VAjBCҟDEF$G$H$J:LWMhNoOPQRSРT٠UVW\a8cBd}efgơhơiơp͡q+!s+!t+!uv+!wx*Tsע3Khʣ2B^x~פߤФ"1DO+!+!+!+!Yqƥӥ*LLLeЦ#>Zbȧ4_+!+!RM!?Ũ+!ب+!)L_r~ѩ+~&09@OV\n"chpUu~ !| } ȁԁSFH0eCZOSFU0eC`Hah!IdontNeedEFIjo(s*K>;9!y|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+=rGy=iG};Mt?  mWC 3KOO $ yD<#*=(/ 9 3Dh&C K \ M}-^ o -чH| -чH ZIчH2! IчH3! IчH  2IчH~ S'@ )Ѹ  *1@ )Ѹ!ȁ1x )Ѹ!$![-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRdestroy[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglu] [-i index]gi:b:lua %*s %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuUUID changed[-o outfile]o:/home/source/ab/netbsd-10-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u 888::;;; +;7;C;@O;[;g;o; x;0;@;;;v!Х"; ;; ;@ @g!Z<ziK'b yi]]]G'o7$H'h!]]G' @@G'J@pG'?H'*@M G'^@G';0G'>DI';HG';HH';HH';G';G'n" @g!?CGJC?C#UC}x!n" D(D DL'D(D DL' (D (DL'2D(D2DDL'1D(DkC M't (Dt 4M'JC}x! ?C}x!`BEJE@BEJEJC}x!#UCD++`,,`,-`,3`,D456l8EBG'EtM'GM'yGpGM'xGyGK` 1HO'0HtYG'8HN'7H8HPNG'nMN'mMnMHO* G' !O'=H(O'CHxO'BHYG'm~!N'^Mm~!N* G'Lv!(O'LHO'$Z?JBJEJHJKKhjAMAMjKK kIIJ) JIIIJJJI%s: getifnamein_status inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVIXTXeXXX! X@XXXX@ Y*!Uz3!+Y0Y*!9YU>Yw*!BYFYffsAadfo:rwt:uvOnly one -t option may be specified.from_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@realpath `%s'getargsunionpuffs|%s on %s type %.*s: %s already mountedrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]asynchronousautomountednfs4aclsposix1eaclsextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount arguments%s,%sadosfilecorentfsudfefsnilfsUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node strdupmount_puffs[[}Ft!T,!W)!c,![V WX VW;!V@[[[\ \\\\ bnorripbgensbextattbnojolietbnocasetransbrrcaseinsegjo:rgetmntopts%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsusage: %s [-o options] special node Warning: realpath %s"%s" is a relative path.using "%s" instead.[[}Ft!T,!W)!c,![V WX VW)!@)!;!^OV@s,!@WWmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %sreload[[}Ft!T,!W)!c,![V WX VWW W)!@)!;!^Ws,!@Oh`Yn!V@Wdsoftdep[[}Ft!T,!W)!c,![V WX VWV@kernfs on %susage: mount_kernfs [-o options] /kern mount_point [[}Ft!T,!W)!c,![V WX VW)!@)!;!V@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorGsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath unknown %s id: %sinvalid file mode: %s[[}Ft!T,!W)!c,![V WX VWO;!V@m]ShXh  !bh hh@qhxhhhh#!h @R!gghggg h@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac23Aa:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXwsizerdirsizeleasetermreadaheaddeadthreshtimeoretransConflicting version optionsIllegal value `%s' for option -%cconndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsgetnameinfo: %saddr=%s, port=%s, addrlen=%d, sotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d Usage: %s %s %s %s %s %s [-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-I readdirsize] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path nodeUnsupported socket family %d%s: error = %d rpc_callrpc_getport%s: reject, astat=%d, errno=%d recvrpc%s: short write! (%zd < %zu)sendrecvno : or @ speccan't get net id for host "%s": %s;![[}Ft!T,!W)!c,![V WX VWV@WWg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point %s: can't read disk label; disk type must be specified%s partition type is not `%s't"uPuuuuSvjvvvvv w+wawtwwww x)x[xxxxx!y WTWTbSS-mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number%s: can't read disk label%s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file SSSWTWTbD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@ٍBCFIL(N5OˏSaarbcefhikm n1o@rOs`uq1м|^t0 Non-system disk Press any key to reboot q@@@h pp pp R% ` @  $create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] e\ \ \ i\ \ $\ n(\ ,\ 0\ ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). |NAMEFND|MODECHG|REMOVED|TMPNAME|EXTRACT|EXISTEDdfLnqSsTtvOb{;[{!IiMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGUGHRBD M@dmCLS1@2plbatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecPFPF0* XXX,,x<<%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname      4=1 > L^ kq          %- %A %Q %c o@  o     18 Qg     P P * <A OV g< <     mn!W^cj = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)hw.disknamesswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node N!Ri%s%j p]"H?-  4 ***************************************************************************************************************************************************************************************************************************************`       S^I [!,R {Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260207%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldReading `%s'Writing to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)Խ!,$}hߨ!m" p" [w\gDL""s" Y2!!uXn-@n-Hn-Tn-Dn-Ln-Pn-4j-n-\n-tn-xn-|n-n-n-`n-unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... NetBSD gzip 20240203123456789cdhlV(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlV] [ [ ...]] compressed uncompressed ratio uncompressed_nameoK^pp0J  < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY__24RSrs   "'(229;446:<<BBks *0/000 %& #      8 : ? ? gi{BD psvy0WX``   ;?__KLn : ; N O U W q z      ) ) 1 1 4 4 7 7 : ; = = C F I J N X ] ] _ e u      ) ) 1 1 4 4 : ; D F I J N U X [ ^ ^ b e r     ) ) 4 4 : = E E I I N T W _ b e p      ) ) : = D E I I N V X _ b e p ;>\HHkp""((++35:?ZZ^IINOWWYY^_[^}w  7?T_mmqqtx,/<?ACnou LO}FGNOXXZZ\\^^~  ( ( ) ) * . ` c d i j o r s O!R!!!##'$?$K$_$&&&''' ' '('('L'L'N'N'S'U'W'W'_'`'''''''''''++$++/,/,_,_,m,s,x,,,,&-/-f-n-p--------------------........////@0@00011-10111111122D2O222MMǤ",?x./ko77==??BBEE@O$/SSgglouu  '';;>>NO^46$/K  669;=>@            4 7 ; > H O Y o##c$o$t$')szFW_rUU  ::??EEGIQQצ _)#*#./000>0A0MNƤ0k`u'$u'8u' SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. S-?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t` \ ĉ ݉ LESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLINESkrklkukdkPkNkh@7kDhcxndatiso|^LESS_TERMCAP_DEBUGNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 08bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF8utf8invalid charset nameinvalid chardefchardef longer than 256.less-history-file:.search.shellLESSSEPARATORLESSHISTFILE.lesshstLESSHISTSIZE"%s less %sCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s option!done|doneNon-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found(P)/usr/bin/.syslessLESSKEY_SYSTEM/etc/syslessLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledCannot use lesskey file "%s"Warning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variableLESSMETACHARS; *? '"()<>[]|&^`#\$%=~...skipping... Cannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current fileMark not setInvalid mark letterlog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parameterssearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filequit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollwindowquotestildeno-keypadold-botfollow-nameuse-backslash... (interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sLESS_TERMCAP_Tab stops and then D"D#D%D'{}abcdDgGhHilnNpPqrs tw xy !:#=\ %lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] !!R v2.)!2!:.?!` 8+.G!` |".S!\!&.!m!&.~!!'.!!\.!!9.!p!(.!` ).!` *.!` ,.!!<.&!%.-!4!%.>!` %.H!2!d,.Q!!;.[!l!.x! <,.! 8.!^!\.!o![.!!Z.!![.!p!Y .!` w .!` v!. !^!-.!o!..'!` /.2!@!#.R!p!0.^!` 0.j!` 1.d&!h&!m&!q&!w&!z&!~&!g&!&!&!&!&!p!!$!+~&09@OV\n"chpUu~ !| } ȁԁ)! )!)!*!3!z>Y*!NAME=    !"#$%&'()       !"> }lȀ 1LL_o  +~&09@OV\n"chpUu~ !| } ȁԁcdtPdD8$<d0 (08<`x4|+~&09@OV\n"chpUu~ !| } ȁԁSCSIfictiousp \ '(@))1o+----------------------------------- - --------------------/boot@//tmp/usr/varȠ  8D$,tx(@2!~C C 9!9!j3! Z|   !! !I!{+" Details for index GPT part - +~P,wI!I!I!2!z3!I!I!+YI!0Y*!9Y |I!>Yw*!BYFY I!!J!SFH0eCZOSFU0eC`Hah!IdontNeedEFIjo(s*K>;9!y|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+=rGy=iG};Mt?  mWC 3KOO $ yD<#*=(/ 9 3Dh&C K \ M}-^ o -чH| -чH ZIчH2! IчH3! IчH  2IчH~ S'@ )Ѹ  *1@ )Ѹ!ȁ1x )Ѹ!$!Ф L!L!L!פs$ L!AM!kM!M!.M! AM!OM!p   Tx d      @ p    X   l!P" # %X)./2345778 J.K.HL.M.M.hN.Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.1_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.1_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.1_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.1_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.1_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.1_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/10.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlolo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICdtbgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-30s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES ntpdatepasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/netbsd-10-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeselect(2) failed but no child died?-s 115200 -l /dev/tty00/sbin/slattach /tmp/ent-mnt.XXXXXXfictious------------- ------------- ----***************************************************************************************************************************************************************************************************************************************`       b:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...]  Copyright (c) 2006-2021 Roy Marplest@v!b$ cХ"d!eu!f7v!g0y!hCv!in j!kQv!l @m[v!neobv!p\ qr!smv!"tuv!uvv!w+j!xv!zyv!Av!Bv!C&t!Dv!Ev!Fv!Gv!Hv!Io7Jv!Kv!LۧMv!Nv!Ov!Pw!QS!Tw!Uw!V$w!W.w!X8w!Zf!1Gw!4Pw!6 Yw!jw!|~qw!}|w!zw!w!w!w!w!w!w!w!w!w!w!w!w!w!)!j,!{!w!w!!{!w!x!x!x!'x!!6x!?x!=x!Ex!Rx!x !Xx!^x!fx!kx!{x!x!x!9v!x!``||LLXXiy>A!!t! @~!7Lv!O!"!v!q"?x!!define 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt CM! !k!!!PT@P HEPT$ @CD@DCz!!!!!!%!-!!ƍ!5!! =!control_free%s: no terminatorcontrol_recvdata%s: no arg buffer%s: no argscontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: writecontrol_writeone/libexec/dhcpcd-run-hooksexiting due to oneshotforked to background, child pid %d dhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 9.4.1 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinfreopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPED%s: carrier lost - roamingNOCARRIER_ROAMINGEXPIREdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sdhcpcd_initstate2PREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with itdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: truncated read %zd (expected %zu)dhcpcd_stderr_cbdhcpcd_handlelink%s: config file changed, expiring leasesInterface options: DHCPv4 options:Compiled in features: INETusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid00000000-0000-0000-0000-000000000000machdep.dmi.system-uuid/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop_event_add_rweloop != NULLread_cb != NULL || write_cb != NULLeloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimerebindpersistentinform6userclasswaitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrclientidnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfiguredefault_configread_config%s: embedded config too bigunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %sinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporaryoption %d requires an argumentadd_environ%s: no assignment: %sinvalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deletedif_missfilterrt_buildif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtopbuf != NULLlen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initaddr != NULL - %s /home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %d%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeif_initrtfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpfBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sdhcp_bind%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: if_setmtu%s: VIVCO option too big%s: DHCP message too big%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_readudp%s not founddhcp_openbpfdhcp_readbpfdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s%s: deleting IP address %sipv4_deladdripv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa/home/source/ab/netbsd-10-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cinet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route( Duplicate address detectedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B!.Wu.V!.!./!8/ئ!X/ x/Ħ!/: /!/ʦ!/BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~Ѧ!'զ!8!@!ަ!8!H!!WuV!!!ئ! Ħ! : @!ʦ!r"n"l"!<WutV!!!Tئ! Ħ!: 4!lʦ! !$!(!,!0!4!!P8!>!A!! W! *L S K! N! [! ^! H! h! x!?<{!!!!ƍ!!!!u !!!! !w !r : !!!"ϧ!#ۧ!$!%!&!' !(!),!*5!+?!,E!-L!-Y!.`!. /!/{F0 !1j!2n!3t!4y!5Q6~!7!8!9!:!;!<!=!>ƨ!?Ԩ!@![ \!\!]!^&!^8!_C!_L!`Y!{d!{w!|!}!} ~!/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumcntrlgraphpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%s%0*jusnap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444   +: UO+Gc9ca.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmesh-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%#jo%#jx%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZE[ sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Could not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/netbsd-10-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank 5MS7) bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9#$ !     rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb n^G^M^Ikbskcub1kcud1^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdbansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxonbitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswslacscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom  # "  !""$  b A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe     `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check inflate 1.2.13 Copyright 1995-2022 Mark Adler  #+3;CScsA !1Aa  0@`@@ deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,need dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c             (08@P`p  0@`  0@`/home/source/ab/netbsd-10-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/netbsd-10-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist