ELF(@4J4 (@@@B\\@0 6QQ O@@@( @0 fH!@P@Q?H3{Р -L"/̀@݀main() returnedl߀   ! X(@@T @@ 0/|xT (/// P-)M8@-@PL00S @0080 0 0 0  #"Ѝ__~(^P/00S 000/A-M`PP @ލ0s ypP i00 0@T  h@ r 0R)0R %OoB>_edA(^\ 4S/0!8 00 (   !/(,@-TP|>!0 !!X0T0P0H000, !  !P/^(^(,G-bM0S;!pPPP3  @ԁԑԡT9 ' @T P' 2  P PP 00 B4R 0@!@a0C0 jT P "ЍG: @P P P P @ P PlPP p 8$ 0@ Ɓ>_ _(^Ł(^)^2_^(^@-<@P$P@ 5+^,)^(_1)^@-l00: ST 88S!~0Y@9 00 ]@݀@B@-0@0PS@!@R." 4Sʀ0! 0    !B? SLN5h0 !! H5D3<080+M-(,M)^o)^)^@B)^ P00  /$$@0P  000/ddP<0 P0/S/0CQ/@݀s@-@0S7`P`xP) sP' nP P0 0008PЍp@cdWPX0` P0RЍp@ @P8P0Ѝp)^)^)^p@4)^@݀` @ @O-M %pPu匂 ?gL傂!7WGRp  FP000p710d7d' `7P\7+RJP7尤ᴴḔἄ e U `P& 6 0::Sf0/ṅ6P W "01%6PQ P!! *!& 1分 !&f06#6$1  1# @P  *PL6Lf0H6UST$1)0C$10!10C0PU0S 9#9S  @P :I)$1*0C,$11,!p1c001 1 @P :|5*$10C$1 1 @P :$1Du*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1t*0C$1}0! 10C01 @ P~:$1lt*0C$1j0! 10C01 @ Pk:$1*0C$1X1! 10C11 @ PY:$1)0C$1FP#Gq㰃 uGW#G#Gx#xGp#pG$p`3`` \3\!T3 0C 0p 0G ! 0I 0J G": G": Gt: G\: G0p09 G 0p0 :GXp!jH!p0 KG<)K$1Q 1!0!>0>00!10B#6 !$1 03/03/03/ 03/x唲+ 1H0HH010! ,1,! (1(!h$1(! 1"BME Ѝ)^@[@0 DSBO@݀ᆳ)^߀AiP)^??쫁,`?)^` )i)^(Pdhހ|ހހހ@ހ߀@_y_h߀l߀@@|@@- @0 *PЍO- PܱLM P 1 0LЍ 0!$ R qW!R!R!R o@ bUTWpp , ``< `008Pp`@P'   <  $ ( ,  ^ 005 05: 0PR0 0 $ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/@݀` (p@-dPTU@ $ ``06/Tp0`$ p@/(/p@-0 P T@``06/0 ``6/`0p@ /p@-P@%@0 T000S 0d00h00p0x0h0x0p@蘆 S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` @݀)@A-0PST@ Sq  Bu 00 `0*b6/`P   @p0  `p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0   0 7/0 `p 7/ `px0 7/`` 0 6/ ``H0 6/000S00 0 00$0Ѝ@S+^j+^܀p@-P0 ` T@003/U U ,5  p 003/+^|@-00 u| Ѝ 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,A-0`PT@ Vp V t00 3/\0U00 U0 `P5/AU00 ``6/+^|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A|{+^ 0o/8߀/0@-0M P@ 0P 000 Ѝ0.@p@-0@Tp@ttlx$0dP 5/0 dP5/0|0| 0p@|8߀x[,^p@-(MPy@t1Pld`1`0: S#L!L1  00 8!0,0 5 W0 !00V0$  ( 4000 `0@ 6/0P (Ѝp@!   A4 00  f/0$ ,0 0( 000x g^Ph 0 0D0 0j(Ѝp8߀)^@݀pA,^\2@1,^.@ 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,@-@-A- 1@TA0P`dp 7/U {U+ {U U$ U A{{U  0dP5/{O~0dP 5/0 4P5/8߀[,^p@-0@TxxNPpPP0 4P5/ 0 4P5/PA{ ?{={8߀[,^C-1M@T&Ѝp\0` dP5/ 0dP5/P {{{}pPP p d09/0 49/ }0 49/ 0 49/PU zzz0 dP5/0@?L$8߀,^[A-1@T  PP0` dp7/ 0dp7/ zzz}0dp 7/0 4P5/ q}0 4P5/ 0 4P5/Pz8߀[S,^O-,1P@`(y,y0y4y0p,#z( z0z4z_z]z ez 3}@P0 Tz ,}(Pz (}(Vz $}[P0Oz Cz (y ,y0y4yOL=z8߀0S@- S S@@Wg,^00@o/@݀` @-a@PЍG-@Ђp2`RpP0CR_P2R 3C7CR0 0 $ G2RR 3C7CR008#8S800 0 &1414$00PL0$0! 0R0015!1c$ S  1X0$0 05$0 0hl60d007 101000;P008#8S308#8S0xP0 p⑪ l(P8p<⋪151`P5008#8Sy308#8SsSW HdHd,^4E_ ,^@-@`P@h `0 0X 0P0 P0H00004 4[P$?Ѝp[J[LP<@l<@1,^@-Xz@-Q@n0 0R/  ]@݀` [lp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/0/-/-/-/-/-/-/A-PpO`0@ 2/ p 0S0@0 @0000@A-P M@`0 0 0  p7/0P * * p7/0P  "( p7/ Px 000 00@0L1 R `   P $  Ѝ@0X@p0$0:0d0 00!S   1 0 0S0h006Qd  &|0000100 0000 8/0$000\0` s,,^)^,^ -^/-^<߀U-^ J^ 0 /<߀/$ R/P//A-`0S @+Pp  5@P# d@ 001Q0000!D0  ȕ,0  0Q05/ 00(0@@Ѝ0S   00C0/$ R R R  /` R X0R//! !  / /_W@@W@AW@EW$o  R0" //@- o|-^@-@(00 S@@@݀[-^A-Q@P@@DT@ 0S 0S`T pH`T@T@ y` 00 p@-@P@%0`000```0P0 [P0| [Pd0X [P<04 [Ppp@)^ [H߀F@-^F@F@F@@-@A@-@@-@~ z0 0@-0 0@p0 0@j0P/dH߀@-<0@TP Y0 0 @QH߀0P/QHH߀p@-0PU1 0S S, S, P@0@ 0 0p P @T( @ 0" P0P0000C00 0@$0P @@H߀RW SW 0o/L߀///@0Q 1CQ -1CQ00 /// W@p@-PP2Su@P@u0P00X !7/&!0A`YSp@w@v@w@w@w@w@w@w@w@w@w@w@w@w@w@w@r@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@v@v@r@w@,v@w@w@u@w@w@v@w@lu@w@v@,r@v@v@w@xu@w@,t@u@u@u@w@w@w@w@w@w@r@Tu@u@lr@s@t@u@u@,u@(00 0u00(100Q503/ 0s/^[[=0^/^d5^f_?_)|^/^[S^/^/^/^/^Q^c/^/^//^+_"i_@_/^/^/^^/^/^/^/^/^/^/^/^ /^/^/^/^O^^?_m0^>R^T^x5^0^/^/^/^/^/^0^ 0^0^.0^X^[@)^ [//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O - mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ 0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P !"8`<` H @ 0 H H L  H 00  0(0pwwwwp@-@$0( S ip@4 ,00,0/0 R,00,0/p@-(0cH80@ TD8PUpp@-2@02 P<0S0P20C22S =Upp@8 p@-\0!C !2 Q02(0$! " (0$!p@R/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/ -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480G-pM@TB @ T T T9 !TX ``0 P0 R =R  Ea@P 0=SPXĚ@@@$@,@4@X 0  SR0U=S@&@ ^P@@PЍ P  ᷿P ⃒ cFP@7@- 0@P P0P R S @g Ѝ0@-@0 |P ቿ oЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X@P0`(0 0W<PN@ @0 4/@\<TE<P @> 4/@L<G8H@?1 !0R$04$0//s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQh߀l߀p@-A0S! 0S\X l\0_03/UA 00<000S*0"*030103\0"#   B0" 0%& %6 " ! \ #30 00C 300000C0X$00pCBl߀Ai!i 3^1?/ //?0 0!0S 0@o/ጋ//0/////?  22//-P/6ᨌ N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  (00(0/O- R\bY I* b$\" in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0H00S/@-@0  "!$0p03/0 !!(l߀03 /0@-$@4 .< 4 @ 8 L < @ 0 < /p@-P$@4 40<080@0<0L00" @0200< @  00p/$ 0L 0 00/1 1400 001/$0</p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0Tp<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@40` ⏿1018700\n:` !.pX:W n0000 0 00 `L<`刂0@0 0S101ߍ@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X.:1011017: 0\! O-Pp!00 Q00S@M 46CSЍO*t ⑾000 0$00 L04P0C0C00kЍlPPPP 0  Z0ca ƾ0 J<!`P71\Z 0 }`P 0  3/ Z`  `0}v V  v L0 0C0CL00" 0 0 0`0`20@-0t 0@@$!0   80$ &08@1011@2/L00C 02/Э@ $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/SP.!6  \* p@-PjVC0 L00L06&0 6&phPC  P 1  0L00L06&0 6&p/ppP 0@- @ |M l Q \\ QQSH0t S儽0  !0 @j|Ѝ00!R 10/Xp@-@P *Pp X0 S   0@-4 0S$ @ XG-2p&xM &  , !`LP PEPELPQ`8  V001! 12 S@ : V 8\A! 0"@L!0000 0 2SD400V` YV#  t 0  !0 PipxЍV@@0 :/P t Ƽ0 !0 P$@ixЍGNV X4^^@h@ @@(@@`BO-`P|T& /Ⴙs~]0pL p4y0$p00 Ѝxl߀[0߀pЌ/@- 00@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00{P 0S#020 0nP 0S"020 0aP 0S"010 0TP 0S|"010 0G Pd 0Sh d0= Pf 0Sj @03 Ph 0Sl 0) Pj 0SnЍ0Ppr!000m0 Pn0 Phj`!0@00e0Pfh0!000c\0Pdf!0:0a00Pbd 000_0P 0800Pp 0800P@ 0700P 070 @^K5^U5^_5^f5^r5^J@^@^@^z5^^T^5^R5^Y5^\5^c5^o5^w5^5^5^5^5^@-H00S<00S0 00000ЍTހXހ00/O- 0@4Pl0\h`TD rXq pY > R7: R3* L` Y  L\!TWX# D p(p W*Y ) p 0S p  ``0@[ ЍpWr `@G-Sp@` A S5 S11P  @D`F@0p3/ L03/X(@`pGP pD03/ P03/Y@Pl`@03/ L0G/R8P@03/L0 PH03/T0 $l߀@- ^ 0P \00C Q0w[5^A-Pp4`@P 0Pp 0<0`@P00 (@0 0,0 4G-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 0P  `FP@VU0,00,0000,000000/O-0p  tt`0  X2d0 ЍO/@0@"0 S )4S 04PSz @T@@|@T@V @D P T*N0IY!80 0 @ `FV@DP T*0Z*BY! 0CY!(0 0 A3A3C?o20 0 @ `FJ0V@DP T*0Z*BY! 0CY!08 0 0 @ `FJ(h t Ѝ[5^l߀[5^5^C-@Pp T Ǵ Ѝb2"0S@0j0O-M<`N@N@TpP3 :T3#X0 厅?o[20S 0 僅PB 80P&; 00X0Ѝ`0@00 0SPT   0ZV: V*S 0S!>\0> jJD 0 0 p[6^p@-PN@N@Q 0A p@0[p0@- 0P0@SP0S   0#0G-p`@00hTЍ PZe 0 `TP1 000 IP`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 ЍO-p , 0  (0MP @0800T0R0S R(0p,0001000ЍPU @0A#AR M<< P P P9H H0P0\H0 0 BH0P B`0 0 0 H`P``B@6*a"*U:bS 20 0  0 P PE$0 00009 O-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T P%@Ħ P @[H0@@ ᶦ:S P%0:0PD0@S ײ Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xA-PP`@pU\\0.b Q   \ *8  00GS0!>000P-//G-)0PS@XqM` $ R ॻ +(0 PVPV1 0 0Ѝ R  *P0V0PV 0 0 x$ R m +(0 PVPV1 0 0["6^X6^6^//@-M`@኶PT#T,'H0'<UH/, 2?0Rr pB```@Q```CPPP T@%PP `1l pl 000T0 d @Ѝ@^Ѝ6^6^6^6^"7^I7^A-HCM`PTYЍARI  !pŸ *Q   0"?D3S70P 0Sh "X!\1- H 8 (    WT3W0pW0! 1 a  G RET3T3@T3  plh1h!0S \1*B0S L!60S Q R6 < SPP 0  P1( 4 S& R000< 000S00&R ! R &R ! R Q!PUPPP(0 0v 0P(000S 傺 R 0S (0L0Ѝ0 vt 30 Y0 Y Y ( Q`Pz_P0 0 lY 0(08{4p@0P/-    B B  P^^ $ B$ ( Q !! B B!!0S@0P//O-PP4LpQTX4Q9 @䀟䠟fU*%:1 RP$Q : 0000?0@03/@Y0Phw%!1XLP L0뚟@03/@Zl߀ E^p@-0PXdT4S N@l $60L0V L0?4`003/03/+pl߀p@-D@[P\y_0``003/03/`k\4P_pl߀0O-P` @P\Q pQ00܁U00SG R= Ѝ ^^p Q@` WW0p0U0 WU0 `` 0!&Q0 !SL   0-  @T00 ЍO/QᨰT ``  U Y00S`` `t!& 1!TL  00 @l߀A-P @`pTQ 0 "A9P 0`PR  V`p@V0A3100A-`P @py%<@%[dP_\[_P`h003/`003/03/`hGd4P\4P__@.l߀G-1`S@!R0R 0 P\  0 \  1!qW0`0ó?0`PQ 0 ^ ` 0S0 SR! P YY S 0h0hS 1S 0h  PU0S0`000T[P/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B  /O-`x64M@00PXcT6pHP 500(0(00 00d|$5T"0P0 (60 00 0$01,0$01 0S ` P` `(0S" 0`S0PS0 4pp0V :#dRW @p&: :6R01 0p0P `0 &? 00 0V:U 000 Uc0SP0P 4 4 0C40S+ 05P0' b$Ѝ%:  0 000Z P%60q0W X [  D BP < <P 0 -  @00@0 00 0! 0皿   뚿$ $0,$傂 !R4  0?  PXYP $ <P 0 @00@0 00 00皏    뚏Q R0lœ\l% 0S 00 Ls0 @  0pk 0  f@.sF^F^F^0 #!R/080/l߀s@-@Pq_Q %60`P 8C0 00<YzxЍp@Sa@.O-q3Sa100@-4S[0,4T儁勰U !0 PU ,$$#2$$0 SQ8 0xd00V0 B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$` 6/03/00  !!000T(4xDU U0-40-4|D Ѝ|0 3/VBnl߀h߀10 P0  044-4/@- 4@S 0 4FP $0T O0(4 0@0/l߀@-(a  ) @ 0 4$(4@T 0R0D4 p000 00S 000D40P0D4$TPp,tq000'00$4$0!*10,$020 0 Ѝ.h߀@-@f^0 4``p@-@Pp 4S n0 4<P Pp 1T 0(4p谅1q*%g$T 0S0Q D$,$ ,$ B  B  Q@@TQD$h0 0T7X0x$R x$p@ 4DPD$h߀.@-@P@ԜO-0P 0UM0 @   P@LP u PUЍ   T*600 0 01 00q00, `  $1 T4` 0 0 !V! B!! ! R   R  00  B    0S ` 0 00W0 pq  y0 {@.p@-PW,D@@@ <g@{p@.p@-PF,3@@@ <V@jp@.O-`B]"Px] ЍO8_@@@ @aDp@W0S  $DXQ @T0,03/03/XP{P  +' p0 000$ B$ 0$#60 B$ @ > @.l߀p@-@0>00' 7D h@t1q $4!*$010P,$020 0@01 0(1C0 0@@ @@@1 0000 @@j0 0000@@ @@@+000@0@0 @@@ ]<0,ЍO/@..G^HG^jG^G^l߀xG^.h߀@ H^(H^@H^@#H^.@-)0@ ۟. @G 0H4xO-$M8(0,1@`}PQPP(PE(0V6#:$Ѝ0 ?n@P0 0000009  HPtphW T: ` 0 Jp@p+H^XހTހBH^@0!S@0L4 S00P4 S$0;00;010?/xp@-0`S0@TT!* Sp0XT S`0dUP0SH_P,}$EO0?pdH^H^@-@ !:0? 00$ 0DO-n0PP04 Y`nR@` R Rph1ě{`1dX Ѝ@18!L{T(1 !P{X X[#0$  U /FVH0Q   P  |($"(XR#  UJ뚿HXH B/JZHH^x[H^I^ !:!/ *A- p@P` X0 X000 0pmЍ p@-@P`++`%L 0+T$;;L4;PdkXd ;/0SPLdkTd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?px !i@@@G-p0匐0@N@N@`THPFO0?0000?%: GP(e%U_[JD꜌'I^O-@ᨐ娀zT:00ЍO/ 06Wx`!`1$U?PPT:0?L0 HS @03/003/ zJl߀0$4 /0  ")//0 !Р!/0 ! !/p@-PMFP# @,`ܜ~0t00 \ 1(Q$  ,0(&#(0 <@0?6/ߍp-HހP4002/ RB>00?0 S/Hހ 0P/Hހd0qp/@-鹤P P8@ 0ASA00-PO-\2\bM<03/ sr @R0S0(("S  & PЍOf=pPo 0Sl v@tЍOcP71@Q0@į 010 SxE 06 SPH1@Hj 0 >$1:0 0 0 00`@T0@D@p b00 rjL0000L0J^[O-pRMS `PP1P000 P@  0S1 S9% DF Fd˂0 01/1/ Y 1! IE@VSP S0  003/03/Y 803/`J$JQJd$Ѝ00?[l߀J^0/\0/0/T0@-@0 @RS ,0 Ѝ0000\l0P/0 S/@- ^@LS:0 0CS(0 Sl0P/0 S/@- ^@LS:0 0CS(0 S@- @ yE00/0p@-`!P @P$P`l00|@p@/A-餀`@^0PU |5p R0P R 0L(  }$@A ⺷/J^?J^7@-Pd000@T ;T 0PE%VE$ @ Ѝ00S 0ES:@/0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/0@-3@PdM *QLdЍ0  00R( 0 ,|  0J^[J^p@-H!@0PS }?!60#Q0P(?0` ; S00,0|0YZ2Xl0%XS40L10H3/H14 P3P0P P3` l0P ⅗0 }p$1$ @ WJX0H0/ @ 㓶 ) B$ H$  ))`, 0徲4 #(08 <#L! H2/H! l< "`H!mV0p@@0u[A-H1P` d0dR PPVL@DDpDV4 !@TA[J^J^X^/^)|^]^O-(`pᴛ\@_[00H1VH*0XH1H1Mp K4 d$t"<402P#  h3`S002ձ02ű@202(0@HL1<03/DQ S9@A WT00 00pkЍ*p@-L(0H@P#04OP3 @l3$0S$@p@*@-`MtP>p͙@ʙT 10'*"*0*00(00,00 $0$00Ѝ[p@-PP@00$000H1D 0P$P \`0H1A V`p@gk09SVSN㾞Q~P|0Sy 030 30303:303:33030400,0.04 ,$0 00$00202H120080$0<00L!H 2/0H1c-& c  00*00` 0C03 aS_S<00S 3S 0l3l0000 0 `~ ,00*0020 00#0-000 0#4>`jaK^K^@@11p@-l0(@!60XXaP300$00p@jPP p@9*G-@2PZ H1ЍG~ T`D00LpWvSA$SARA@SASASARALSAp 0 00000 R!W 0S@00L0S03d00!C=s ЍGpt 0  0H1_H*0 a H1Xp$P0S  ppx3 d00xC0 00 2@0S *"*0S 0S$00H1 fp4 0Cp4ЍG<`K^(^K^)^KAK^K^4K^0K^K^KAPL^p@-`L1H P0@3/P P4 P@/ L1 0H3/L1 0H3/P@ P PH10S( T6c@00;00E0@0 0FFH1 p@;L^5L^0@-M@ PP *p0B8#8S 00ߍ0:@ <000l$RH!     8@-M` PpP`-*0B8#8S) ' Q#H1B 0,00@400300r2L10H3/H1J4 H1`. ߍ-`0u<[@-@0  N6> C"l3t$(0W?0,0U?000P3@>040@op@-醗L1@0H3/PPP3#P DOL1HP03/pP30P3P3;P3nL^O-Mp`]P@ @aE 0pTL10~H1 H1% H1  xSSfr=cr`rTPE   pP`x%՝l~ ,H1   ,5,NP `F~<00,(`$  PZ0P 0$Ѝa@0  k_Q Q P\  Df@ t0Q9D1S /0T l$;vl D1  H1  H16^ ?0UW P3<P3>0 P3@0P3P3  t"> C E1sh3 l dP @k ,1s2h3h3000? : S?/0 <8 p#*0 R l3t# !t#/  P! Bp###` l{P3@ E0 ?Ꮡ E!l30l 000000et3S lSp#R 0MKIl#ph0   " ""   00H00D000h0[p@-@"QP `" Q Q0L00QP0 <0L 6#p@ /0L00P0 O^O^p@-P@`Pp0D02( 02<06# 2/p@ 0,   , /  ,/  A, 0/ @  /O-@0(DM`<0P 0 0hpz [G 0 \0$ pp + t0S 3/$0 $_02\ 0:/ ]0@ 87忍P㸗 NM0@ 7對P80!0d R2  R00p + 20\ 0< 000(h0,00000$0$ 6哂" 000400S 2G 2p`(`X0 02 p  2( t x@0'x 00 S0!< 80 S( 2@ ĠŠ0t0S $3/,0( 0_0 $2\ 0 =00<0 00L <aP0L0[) @000h 0&h` َ2 K<0 000'000 00Lx0S 3/  [P 2  0"0 4  p@07/" 0"004 00040@ 0C S0 0Ӡڰ2ok P^P^Q^?Q^p@-@P- j  pR/ 0 Pr  "/ 00 0/Q@-@   _Q^lQ^Q@-@ 0xQ^Q^A-@PڏD0S0 p`8 RSᢏ D08 R0ڞ< `V< < 0< X X <00<00 R p0Q^A-閏@p 1SD R8 < #" R0Q `P\po`00PP{ 0A; 0S p@-a@ ]P0 R p   {00@-@MXP 0T0 00p@@0 @0" <Ѝ0Q^Q^ 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,p@-  MP@%0 `噋00 00 05~@ Ѝpa^uA 0/@-@ 08 000!3R@- /@-@<P800080<0A-`ᰎPDP@p80SQ 0Aop0 0ATI}P <00Q@Q<00P }P eᆼA-80@SP <0Sxpܨ`<0S<` Ө0(S8P<  @< 00A-P@h003/P` P P;A"h003/pW h003/O-0P`00@T p p 4 ЍO  0S0 00 0S     0R <0X2)QA    Q!PX 88P 0\ R 2/P \   0  0;; 00X0S000 0,\ $ ` @$( ?Qpqp (p  QP X 0R| R\ ` $ @` [Q^ 0QӴp@-@P`% 0B 04@0 0^p@0`0S 3/ 0 pp@fp@-@P 0<X00X 0@0 00S` p@$00X0S0X  0@ 0 0 04A 0 0 00 R0S 0=@Sp@A-`P@0pSahhP 0\ ; 0`0R`0$0`0\ ( ?Q0010(000C0 0 <AA-@p`p0<00P P h0 03/<0P0 ⻻~A-@`帀 0,à!>0 ,#1R0 @KAPMb-  2 05S=00 `a09#80 8802 0<<0A-@`Pp<`3  A hG-pP声@PPD  ,`0S00,0!=2?408`<00 3/33@  60#S 1RR00R0S40\ PS Pუ^0,0;200R80 0K0C?o20 $$ \0&\,PU "440 $$ NEFXPi'TDG-p`P#@PP 0,00202?Sb40003/P3 PP6O-`M M @LP00SK000H/;,Pv :00070\"\RS007S= ; p0S700c Wed0S  PVX 孽Qd R  QG0 00000 0S@ R*7 p0S';pW*0 @00R D@000S0S00ą p 0p0p00S W ^pW*Xۍ ЍGpPx AWh W` WT70PWD@XX^S^]^)^R^S^-S^BS^NS^ZS^gS^O-|@4MPp 80S<0:l=S8姽08(QD`V< #" R=啇ԽD`08 R)ʅ80 S-d0S 3/ `80SOrp 0pR00 偶D s< #"0^0<` `00SQ  00  `00 00 00v< `V A<0 `$ <0 0Q Q<0` 0 tS^S^vAS^p@-P@`) PUdp0S \P0 P/ 0 /p@-@P@Kpp@-@`P0 @T=p0S \@ Pp@-P1 P#UDP3n0 P0 0@$ 00(0U4,P$4<pS^S^S^S^@-@ߴݴ4۴<ٴ@D@@-@ ,Aʴa0SS^p@-@P 00P`baAp@詴A- a@TpUʀ 0! $ 0    !*b 0  @ 0! T0t l   ! 00 0h0 03/@T \p P (,F/P 1?R, /8#8S00  R 0 0 000C00, 3,0/?Q0, ,/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-Z - Ѝ0P  @pnp 壂=,គ0帢,<zpsL!DH1003/h#- _?0QR 0x 100100100 0/@@@S^T^G-@p`My`1Hp@00L0<0S7fouP,$0 Ӷ$0 Px^M^ t Xp~oP PUݎ @- 0X@[A-@pp0 03/` PYV 0A^P0   Q @-0 03/P0S/A-P(Mk@P司(Ѝ0`P0$0(0 `0 03/ 0 $0 0008i/  @0P: p 0 `p*08/0P*0>0 888/P< 8!&P j? 8 P +(<03/ 403/r@uU^p@-P@ 0 $0 (<03/400 43/p@M-d}P0.X X%,à1 0")!0 <"#1o\Q 9MbPCMU^@-XM@X  ~ 010 H0XЍ6$p@-P0@$0 3/L`V 1SSpp@-XM@P`X ~701H0T@9C>H0 @H0P  $0 00 XЍp@-XM@X  p~< H0XЍ0@-P$@\M h\Ѝ0X Y~ 0 010408020H0P 020U^2p@-$`P`XM ̵`XЍp,0@S QS 0R`,@X  $~0T`1 hT020`H0hTP`  塵P,@ U^V^@-$@00 3/ 40S 3/00 3/00 2/p@- 0@ `4P4P0480(0p P np `PU 09 0PA-@p`0 03/ 0PPy99 09U W 09 00<0S 3/ P0p03/7/PP| 0 4pW  7/PP L巶$0 ,家\03/$02  PP$05 0  4PU3 q币$0  0 NP 傶 0 y P wPU4P0S8PP$0 0 0 [XppԀU 0 9 0g 0 9 0ЍA0 0S $0p p00 00 Po PW ЍAЍV^7V^NV^V^V^V^hV^V^8AA-@`(H3l/Lp@PU  0R0D0 0 TP]03/T 0S& 0P  GP_0S/p@-0@0P'0 " p@,@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`@X T 0  Ѝ0 P`@DC-Pp`@X T 1 00@ Ѝ0 P`@DC-P`p@X T 3 00@ Ѝ0 P`p@DC-P`p@!X T !3 00@| Ѝ0 tP`p@D@-0000  0Ѝp@-0@0PR0 " p@Wp@-0@0PC0 " p@HG-p{0(0S@P@P tP`t `wGP ~0S00(0 3/0000@00p@-P0(0Sp@`` 0R000 Q0 (03/0rp@o@-P{0(0St@p@-@`:PUu0 p@,0/0 3/Pp@-0@Q0`p P 2/P D$ @p 0`( "4`#/ 0 /T!\R TR /T@ Q/ 8 R //᠆,@ G-`0$ MP0K p  pp0@*4/@PD00p8@0 4/@PF81@ 00v@P80 p兮X (iw0 Xd000p0$00(h`X0l`射@P$0 0 00e wP@P $0 O <03/ 403/Ѝ Zrp@-P@<@X`TQpC-@$0\MPp`x( X  w< YD00010<@1`1d`H0$0 00p0 0 ?P 2"0 2"P \Ѝ@ 0b0?o0cS2   $ $0` 1011SX v 010 80t0H0P X  v 01$0 080H`P 0  rr2 6$G-@$0XMPp`x@ ?0 S㣤030# 0 X  |v011 H0P-X  mv< YD00010<@1`1d`H0$0 00p0 0 P 2"0 2"P XЍ@ 0b0?o0cS2   $ $0` 1011SX v 01|0 H0gP X  v 01$0 080H`UP 0  2222 6$21B31 a1/G-0M01S`PX1 y Vw$0R p00 pp0@0*@4/@PJ00p8@@0 4/@PLl1@ 0@0㹬@P>p@0 ȬX (u0Y!d0@0h0l00 41`0D00(p0$00X0@P$0 00 @0㢬@ u@P@P $0 ጬ@ <03/ 403/T@Ѝ@ rG-XM`@X p Su0V100 H0PP% T @DOoXB@T 夠X  4u 01$0 0 80V0 0H0w@P  0 HHPXЍ   =P6$6$2 2 Y^Y^p@- P40 S" 3/P@000S@  3/@P`04`V  H 6/P@p 2/0  3/a O- pT1PWp!0`4@ MT 4/P@ 03/@1S< @P  ֭ߍ<1S R0 \1$0      `席V@@   0@P0 0 3/qZ ($ &21T1 R0Q 0 4@T) 4/P@XM < @PX0S Hn@Z 0 XPHZ 0 偬03/Y  X  R Y0  @Pn @PR040S/   3/@PGH X1000 R0D!00X,104@P2\1S S]!  0Ht05`1`1S@3@0 !z@P000'  T1 R0Q 0 4@T 4/P@ 03/|Y^Y^Z^?Z^'[Z^Z^XZ^Z^Z^Z^Z^Z^p@-P`@v  0 <W P= PN0 00( 0DH1 r@ LXP `[1a, 0!?A1c LT1pX0H!2 SD!4D1p 6a `'\`` HDaTHspP  rF 6@A `'<`` HDa4H0 L+XP' `["(0a, 0 ?A1cT1[gfff[^=[^p@- `P`@0  p `d XhPlHm@n8o`0pqa t x|p@!R0BS2l` ` XdPlHm@n8o0p(q rsa t x p `d XhPlHm@n8o0p qrazxe[^C-lM@d p$X er02XP*00 0`40 ` 0 0 `h0&hS `P r$0 P 4^.$0 00S00P080P$0P8PX0 0 3/ p4P0`UlЍ$X rr08,00X0VP  OP 000 0 Q PPC}[^@-0000000Ѝ[^C-P@d`Ѐp\MX  q$0H010 0 )0  1 P$ 0  TP0  1/o"/`V<T0\ЍG'p@-XMP`@X qL0 H001`?oT20S $0$0 00XЍp2W@- 0@8 0 0$0dM 0 03/$0P$ P 0 R0 0Q P0SQ0 0dЍ$0 X @q:0U210$0;P0P,000 03/ `P$0` 0Q p zP0SQ0 03/T .P 0 0 X p20P0 02FPP 08 00@-\M@PX p010 PH0,\Ѝ02O-$0@pM ,PP ЍPP 0  T1圐 Y!04`VW  6/PPo$0P ` 000 ``0*0:/PPG00`8P0 5/PPI7P 00㎧PP;0 `坧X pp00000070308$0p 00PP$0 0 00} p 03/PP $0 d <03/ 0403/U PiUq xP|Pmj< !4 4tpp000`p,(p(Vr$0t1ST1 R0Y0 SA 04`V 6/P` 0T堠哘(l00$0 0 0 0*@0;/`P008`@0 6/`P4` 0@0ڦ`P@0 X po00@000`40 08$0p 00`P$0 0 0@0ɦ@ 0 pP000 $0`X po082000p 0`P00 3/`P0 0j  h孨X1 e 00`P VV0[ 坨P1 0s 0`!$0 J G  00pP% 0  PEP 08 0 sP$0         Ho28#t0媢T1-Z0 3/`@lPHP $0Z (@ <03/ 403/V x~0 h0 n0 c0 0 00`Sؚّ[ [m{! y Z  X V `P pC$dPo|Y^ r[^[[^ \^D\^(\^\^{\^\^\^\^\^\^)^\^\^O-PpM`0 0$0 0 h@ 0 `@PplZ@ Ѝ2 0 j@P00SD$00A 08 S00 [ @b’E0_Y 28d1 000 0?@PL00 0L0 @P00 0<7t `00 0/0 @P 00  0!00 00 @P00  0 NnwO-P0M@ 0p`# 0 0 03/P F TЍ$0 P0 )0 !PplY2 0 媤P00SG$00D 08 S00 Z ’G0埤ᝤ 28\1 000 0|P00 0剤0 P00 0ytt `00 0l0 P00  0 m00 0S0 P0 0 0D\^C-P@$\M@>R`>:p^X  m 0@  0#01020D@H0W@P X m 0` !0$01020d`H0B@P X l&0160 H05@f\Ѝ@A-@@ pP``0 n@O!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-o O-Po@29P)i_01jaV!j1SK/9}o p\`JV ͝r{z{{Ah*$pFKP KpPW $00J9[ 倞1KPJ1  P ፝C-MPpxohQ@|10x1o0t1 0h![?d倥 0l 0h1d!,o!0 r{#o|!0 z{o\!0  { i%4j?0ᰁ10ḁ1ā @KJ01$ F40 00\` V1 㘁0l!1D1/p10 4P5/P0 4 9/U 0 4P 5/Y ^ 0 !0  8/` 0E(?ESc3j(/C#b?0E,A(jP+1  P !  `0P00 P(00 000 000YP 000 P (00 000p000xYP  f0 0l0 0bU4Ѝd_^0A_^_^@`^Mb,`^=^t_^I`^~`^l B@`^`^@`^ B/O-MA 9090:08 0800 aq᠂᠓[0000LS\ 0 1\Ѝ0S @0\0 0S 003@ @4 1 = 200/@-D 0S 40@/0S p`^@- D0Q d@/Q 0Wa^0/A- @0PS ` p 403/dU00 A/ R 0Q000.5a^N  0O   ! "`"Рo0:! nP!: lP< : ? P \* 0\ Ѝʑ:” 0d^b^d^*e^Se^e^1B0A-SPp @ሀW@0000W0Sbv000S00 0@H 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,hyhy@- 0(0C*s` Ѝ1 @P0 d0L`P 0SQ dQ ,Xs`P,pWQ dQ0<00D00 87 H0R1 R2 0SH01H0WH01H0 0ps8 4\001  @ 08 0@@0 0s S#4  4 Y2H02,00@008000@@0 0S%40040A-@$2PWD`q@pWA50@0 80R S0p 0 r?Sg8 RS808 ~xDpTXDL; ** * RD01 "0D20LML q @T0@00 R"4@P4 ,W  ,@ 0S#, 8 R,  0 ,0000001  @ 08 08 @@0 < :e^/-0*T00/-0 T00///- $00/$00/@-@$00 3/$0@0//@-@$0 03/s@->0`@ P  B` 0ŒQΌ Q @唒0T00 P05/P  0 Ѝpe^p@-0P L|00T0@4`X 6/TX0d` 6/p@f^O-,M]x0@ d0SS0 pࠟట d0S ,ЍS CS 0C$0(0PI(0``03/P7] 0PP0D0 0 0P`fP  &phBB)f^#f^p@-@$0 03/$003/0$00) 3/ $003/$0 03/ x$0 03/\XP$003/Pp}PUp3/$0 0 N'p@-0P`@ Y0 0T @ ` BT0 0p@/0@-@ Y T A-0@HDqDDa`PU P PI0  R00 C1$003/P00P$003/P0 00`(d0 U T0X 4P5/T0 dPX5/POf^PYf^/O-@,M d1!Q \d0S TX00 P0H 5/pP \,ЍO4d0T 0C?odP2X5/x0d0SS0pd0S H,ЍS CS 0C0(P` 0pPP3/0 0|0 0 0$qKa h p@0 p7 h00T^X^cf^pf^~f^0>Bl?BWu^x8>Bp@- R 0@P5/00 sp np@-@9dP8 5/0dP 5/p@ X@-@@s@-@00 P0 5/PP `嘑00Ѝp00 (`06/00 0 00f^O-` R܂p p9 d:/ d0":/0 d:/;`0 d:/0 d`":/ 403/ 0 d:/ 403/ 0 d:/ 403/d0 :/ԡ 403/@D @0 d:/ 403/ 0 d:/ 403/ 0 d:/ 403/d0 :/ 403/ 0 dP 5/ 40 3/0 =dP 5/ ЍZ Z Ye9 dPT 5/ dP0D 5/0 dP( 5/= dP 5/'O-p S0 09 d`6/ d`06/@0 d`6/x`0 d`6/ d`0"6/ 403/ 0 d`6/ 403/ 0 d`6/ 403/d`0 6/b 403/@Q  403/T@0 d`6/ 403/ 0 d`6/ 403/ 0 d`6/ d`0L!6/ 403/d`0 6/a 403/@  403/`@0 dP 5/= dP 5/ Ѝ`V `V YX9 dPT 5/ dP0@ 5/@0 dP, 5/= dP 5/'O-p a졟⁀9 dP5/ dP0!5/@0 dP5/`0 dP5/0 dPt!5/ 403/ 0 dP5/ 403/ 0 dP5/ 403/Q 403/@ 403/P d`@0 6/= d` 6/PU bY dP9P 5/ dP0@ 5/ dP@0$ 5/= dP 5/'O-0 0@d@t0"409 d8/d0$8/@0 d8/!`0 d8/d0#8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/8 403/@  403/@0 d8/d0"8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/H 403/@a  403/d@0 d8/d!0 8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/X 403/@*  403/(@0d`!6/40 3/0d` 6/=d` 6/ ЍX OZX JX E[ 9d`T 6/d`0D 6/@0d`( 6/=d` 6/'p@-@9dP 5/0dPl 5/\0\ dP5/08 4P5/90d p@/G-P@ep|0 4`6/`pW 0;@@ 0@<@0dp 7/@-0d@ 04/d@-0d@ 04/dp@-0P R@0H d`6/0d`( 06/ p@@pA-P@  `000dpH 07/ PP0 4p7/p@-@PT 0d`6/  00d` 06/ p@`^O-00pS (Y+0d`0h#6/40X#3/d`B?@#6/`4,0HSX$XJ 403/CBP #SY`k ` Ѝ0d`"6/d`="6/ `㌢ 403/P `V <d`H"6/404"3/`  0 40 3/C0@SC Y=d!8/00YV40!3/0d!8/|tX 40 3/0S3 3/?d(!9/$Y 403/ჰ[+  d`9/X0d0 9/ 403/ B?d9/Rdp 8/@0dT 8/`400 3/0d` 0 6/ `'G-`40p@!3/o>Pd(!:/0 0 p0840 3/?dP 5/00p 40 3/pp40 3/ <dP 05/p 00=dPL 5/  8 8;000( "(02[f^f^p@-@ 04P5/0 0p@-0 d@4/s@-`P2V@`00F00 ` 0 6/P UЍp@$ R@0`<SUH'8008080(040,0Ѝp@]3 0 00$0f^f^g^_B^Bx\B\B@-@kQP0S00 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,A- 0 @ ?  0FJ3?=00 P@`HH@p 9 x0P4R0^P@JF@p0d 8/0 dP5/A-@`0p4P 5/0P4 8/`{?0@ 0%3?0 00 02d%VP0 P0`d/// QX0S/X0@0/-0d$ /5g^ Q/0gg^D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/P\`\p0 48/  U 0PE- U A豊Pg^g^ 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,p@-P@`U 0p U /0S  \bPpt x0dP 5/0dP 5/Pg^p@-@PT@h@@pp@-@P0d` 6/0d` 6/( d`\06/T00T0spp@-@P`\00\0dP( 5/p@`@-@$X H00H00X0@ ep@-@`gP\00\0d`( 6/p@AQ G-@PQ10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPZDpPp?/Q  寉0L0GP奉0 d:/ 0dp 7/1 dp7/P0<0#!H 00`@00  00004040}P  <v0L0H00H00X0( $00040(0(@ P T0`^T0XP0T0@`0dp 7/ d`x06/0d` 6/@``p`X0V0C?o20SX0S<0 0 `Fg^g^h^P-h^O-0@4P, 5/0P( 4`6/P  PX0S   P0_ X0@0S X0<0X0H0@(u X0L U l X`H0p+ L,p0< 4:/04< ;/ 0 X0L00 4p7/H0  <0% 0L0/ 0< 48/04< 9/04< :/H2$p 4 << 0(p,pLpL0S@0SP0<0aP [PX0S  `  X0L P0 X0<0X0H0@(S?V\n \8PhV C/P` XpP X` `0HP0H0@% V P0S+9`P I YE0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@C-4MP)R@P?堇 0P 0 P05/`P  `4Ѝ0p"RP `ׇ0P P5/N02p0ltNPPP 00S lp1@ T@  X0@0 @`VX00X0\@@(p@-lP VP`V>@l`PUX0 U0 X00\0`0:p0X0(A-L@`8>lpPA@ \X♾@(A-@L!>PU `80lpph0⛾([p@-@p`lP⌾p@X0 @-\0@S ` 0\00s00`R`0(0C#p@   t nX0/d0S/p@-`d`@PD/ኴh0 0!T0$LH @   !rp@(,\ P/0 !8 00 (  , !/(,p@-P@dPF\0 0T ?S5@092 03/Ppp@Ph^ P P) @ R%uBXuBuBuBuBuBuBuBuBuBuB/P P p0`Rl/d/`/\/X/T/P/L/H//</8/4/i^h^*j^i^i^>i^]i^i^i^i^i^h^j^i^-@-@4т؂Ȃ Ѝ@ Ѝ/Jj^r^A-S@ 00MS 2 03/xcxsx2 0 3/P0S L 0B S񟗈wB4xBxBxBxB\xBxBxB(wBxBxBxB30S' 0S P000  00 0203/0 00020S 0SP0002 03/203/ 0S P0000 000 0S2 0 3/ d0Sy v 00 0$0Sn2 03/2 0 "4 R10!5[Qd`V 0 0d0S 00 00000Ѝ 00 d0 `S pdpp0 0h ?0G 203/P OXj^Oj^[oj^Pyj^A-@DpD`lP ?2 0 Pj^A-p`<lP@1W 1W 0W% @h1W$ 1C7CW2  03/@P1 ,@ 10S-@ ; !000@3 000\0S#@ `L0|0 cR(0L,p\00C\0p0$0S 0@000000 @(A @A A(@j^Q @-c/j^0( o( /p@-@8M峃N2!! Qi Qj QQ CQP,$  R C$ R0S,0 0,00$0$ H%0(0!$0S2 03/203/2 0 3/P 20S 3/`P ld`凼0ⅼhM0  00l0P 20S 3/H塃8Ѝp)^_j^j^S^000DXQ01 01)|^X^/^~k^p@- 0PQ@ `M ` 8堂U < 0 啂܍pS^k^G-p`@ V@0s5 S2 r/ PPE_oRP! Q GP P Q GPP Q GPP Q GP Y U @`FPY P 9/P@-@$L0@00/X0 @-(/k^@-L<1 S  000P00 Y  Y Y 0S[ S00 @SG 0$00000 0R 0S4 0S 0 00,8/0=@00@000 0<0J 0 00,9/ 0  ,:/ᴚP0`0S  Rl S0 @S| 0 00,8/00S0  10 01>  0P 00 R&0S  ,0   \}3/0PP1>  X㰀  X,0   3/P0S00  ,0   \3/0P 0,0 00Y8   ,03/   ,03/   ,03/    ,03/ P   ,03/P   ,03/   ,03/P0S   ,03/   ,03/   ,03/    ,03/ P   ,03/P   ,03/   ,03/P #P 0P 00 0 00,p7/ 0p 00,8/0P000 0S 0 00,p7/ 0 P<<00;00;001 0 00,`6/P 00 0 00,p7/ 0p 00,8/p 0  ,8/ 0 00,p7/P\ 3/   ,03/q3/   ,03/   ,03/  V00YX 3/   ,03/]3/   ,03/   ,03/  B\ 3/   ,03/F3/   ,03/   ,03/  +O-M$( ID`8@ 03/ P400\00@;P5/P 03/@$80 `0<0d00X000 @% 7R0P0($0P3/P6  043/@083/ߍ`d,03/P\0P0 P X \`,,0 d3/P0T CR(BBBBBBBBBBبBBBBB\04\0\08P 043/TR 0pS0 000 S; 7/80`0<0d00@S\000\00X000`\X ,0d3/PP'X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0OP/0C?o\ `X2 0d,03/\ X@` ,0d3/\ XP` ,0d3/\ XT` ,0d3/@<@0\0T 00\0P\ `X ,0d3/\ XP` ,0d3/\ XT` ,0d3/\ X` ,0d3/\ Xp` ,0d3/X\EXP U*t0 S3 1* W X 0lx`X d,0R"3/P @GPQ\ `X ,0d3/ 0 T pRhU p($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X`0  0d,03/\ X,` ,d9/,0\ 4 0 `0X ,d9/P@=@ 0 SSi<p1A!T <T ;!7/T\000\00X0000{m^@-@M. > 010K/0  $!(! 111 1014!, p1>  ލ BO-PBDu  Q)R, R  u@A u`t0StA(1$!t0aVKO0SA OtŨtV t`tVA dt0 S1lBBBBBBԮBܮBBBBBt t@T`t\0StA0 t0S Stt 0SS0S htp\\\ R^Q Drt@pt0 0kt0 ft0 at0 \t0 Wt0  Rt0@ Mt0 Ht0  Ct0  >t0  9t0  4t2tAth-tq 0 S#tQ 0 At$ tQ A tQ tp,m^m^m^EX^)|^S^)^TX^o^m^m^~X^m^n^n^_n^n^+n^6n^ 0800P 5/P $u @ 8$D0<4>`P2嬢42 4GVuG 0 P Q CPP`P$0 PP 2 ,42<0424 242$42(484,;/P00@4$0 00  1, 041<4141$41(484,;/P00@4U 0S R !0R "0R@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4$0Py Pt0 ڻPvt0X4Ѝ)^Bp^p^BCBp^CC0ChCC̵CC CHCCC|CCTCCPCPCp^ q^ 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR0\A-`pD>BT P (@Pzp@-a@0 oPtPp[PP 011D 0(1S5Q  sC t^b@-@d01p@-`P=@P w P p@s 0t(0 &P p@y0H1x0p0p0@1l0D1=`s/P0P PP@s0H102p@лBp^ BBS^CLCC1,^ 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-@`I=|4S@ Pჺ8@Ptp@- 0 R\0S 0 00P00 Ѝ \p@-@ =00S @pTPt 0  tI@P xQ to0x4@ 0DPx@xQ t\xDtفXCO-M`<@fr` tkP  f P ЍOr 0(P000A>h 00S(0404pE>L00 9/PB4Y 1000  L0p0 7/pP@0pL4D0P4Y0SSxr 0L0X0; 9/P@10<100:00 P0P   0 @00P00 l060pP0<00 0'0 0 ?060 wPtr.(D0|4ЍLRr4X4$4\4)^B$Bp^Jt^et^\BB \,BPt^B q^yt^ 0R R ?R//p@-<j1S@ P @P$Q `pO-@M`P *0 SP*0 SP*0 S 6 6PU :Y@00 0 0Y6Ѝ0S0`pX d0`\h0Pl0UtT=S3t 8: #8;/T=X \Sx < 0`;/X=\p`T=S00| 0> 6/P p `$ (, d  0hl 0W*0p4W Q0CpT=X \S3t 8: `#8;/T=X \Sx < `0;/X=o\pT=``S| 0> 8/z0@-01 0P Ѝx\p@-@T=X PS0@  ``\6/0  yT-X=\R B 0`6/T-00X 8R B `P\#85/L 0 ^T=X \S`PA0 @ 5/p@0  N^u^O-CMPp:U@a 0h#0P$  "PP $J0$=P1S 0 # PP p `ԲԢԂ0 T-X=\R(  09/ P\X T=' S  ` 09/T=X \S  `09/T=X \S  `(29/T=X \S(  `99/`VS  ``06/T=X \S  ``06/T=X \S  ``06/X 00`` \6/daT-X=\R` 0 08/ `VT=X \Sh 4 ``06/T=X \St : ``b06/T=X \Sx < ``06/X=\@`T=S0| > 006/0 SW0l l 0-POCߍ$Q |$]&C]eu^^u^#E\G-`@:Ph~o@ X P G@o 0( 0X= \ R R! R pWT-0R @ 9/APqpP0,=T}9l \0S`G0P xo GW P ^01o)^TBp^B7^}u^1,^G-p@ `APCQR iU010! A-@` 0$ pD\:l QU0 A\ P QUG- @$`(p,00 N\:tl QY PPU0 G V P QU/C-@P@M$0,r&c 0`tЍ-P p@- &P <@4[& P l1  0p@诃p-@-@xP$hMp\`?&P l1 0040 000p`00ƒЍ-G-`&P0p&|0@U  Z 40 00 pYЍ0 00:/p -vd@-@($0$!60%@Ղ-@-@`pP<M$,(%(0 00Ѝ-@-@dP$TM`Hp%P l1 (0 00ὅЍ-0@-P$0M 0 0 影Ѝ0BB@-(0 0600㮱ЍBB@-@K8 |1R0@-80(@!60$$|%$h@蹲-p@-`@P-8^ 0 p@/p@- 8@⒌s@-P`8AT 0( `4/@P OlЍpvdv^@-p@-8@]l1L1!0CSL1Q.etp@p@m0S$000S 0S 0 d=;d=//0S0 d=;Ód=//Q9 )R4 -09/00@-DM000,00(0\0 0T0@00P0<$  0A<0 P hDЍ0w^a1^<"]w^A-@PT=X `S80  `p\#87/T=X \S8`p8  #87/pT-X=\R8  08/  pW0 tk9<l=D=Sc  50 ,h9l=hml]衆w^x^G-@`pPT-X=\R` 0 09/D=S+6XT-X=\R0P  5/x0PX0 `Ik<T=X \Sh 4 `08/ 0 6k蠆/x^Vx^000 ͓0\SeEGp@-Ph@V1 01  hp@VG-@}`J#1匀01!3R R11P011S 4cPP 10CS1cAPp@-@mP 10CS11cp@*O-`p@0pPh=Sl=SX=\pT=Sl 06 ;/l=0l=d=   P Ѝ T=X \Sl 6 ` 0;/T=X \Sl 6 `0;/l-9T-l=X=Rl 6 0\;/ P DyjT-X=\Rl 6 0;/ 0P4xVzx^@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=Pl] ЍP =  -0=X T=\`Sh 04 / A-@P`}X= 0\8/  D=SpWj<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/x^p@-]p@1-P Xi= S-<<f=0=W0>03p x^F"]x^ 0!< 04 0 (   !/(,O-p`@P㔰Ȑ0S # 0ֲ  f0ƒP U ]00000@@ T Ѝx^\ P/0 !8 00 (  , !/(,p@-@P T┖9S 9S 404 0@a 0 (p@}BPgfffBD=S/p@-@=P0C==0CS=>3;3p@c=A-=PS`p @PVD=S@ 0 =@S蠆A-@p !P`P  0P Q- 0T  \hЍ0A S 0 h 0 ey^By^@-@00PPЍ7@-P@@=S 0 5 00009Sd=000 PH=S Q  $Z09S B(B(BB(B(B0B(B8BQ  Q  Ѝ0  DG-0Q@p`0MQ w0ЍQ o 4=3/|7S ( h70?0?h70?|7S 0 0@a 0 (Y |7S H/ox" "0`" 0 S 00 /0TYq /Bwy^PgfffBAp@-PAM@`X# SfP00C0S0Aލp S;03Qd + Q  QG @=Sa2Q 0Q*$0CQ 0Q-0S00?601|2QY 0Q m|X2QG 0Q *0CQ@=S d= .6M042QF 0CQ0Q 5>8#8ST` .0SS`   /  ("(  f@=S d= 0 GP6M0100@=S d= N@=S d=N0@=S d= N09S >S$\:'0 SUL S*0C#100L 00;.D0QN0 mN0N0%*FA-όpP 0`@PU ,Ѝ0 PP!@-0  ЍA-`@0Pp8=3/h7U) 5h72A9#9 @s@-H-0PR0CS@t 0@ӕn R 3 0HHc <@Ѝp@S @0.@ӕЍp<"]"]y^O-@lM@=S D=Sd?`< ,0D-=0>0$0=S >S3;3lЍ9S9 YU 0S990090C9Z0 n06 p 0 P 5 0 03/039Sb.030@]  o\P303TW ?9S7PtU 0PU 0S000000C0b Z0#(P 0 S30 03/5pP2 0 媠t PP \2(傿9S0 d=00 0H\ʔ# 0 G  0  ᐦD9Sㆍ P0S ` P 0!:> *00! D20a08/>0 (00D100 00$ 0C!C195 S' 10170< :0(0 501ଽ,0 P( 0h!dUe3(*d=    qP0 0HYX0S S0! 0 0  b=0  0I  0OPD10=   =0C== S-"0 >0>0ph ̏"]y^A-0=@S 3/`pD]U' PP `V|dT=X \Sd 2 0``6/T=X \Sh 4 ``(06/ P NV^A-S@\`M 3` <3 +`0 `ЍPǦ bV p )20E?o2P0S P   +WP `pPP3<30C-M M@p|$cPPo``$A0Vl  V7* V  V @-R zv$VE ? V Vv  V@=S0 S0N0B Sh*$AS0N09 S06M03 AS0N0-l#VP)  V * BV H RV=d= $#VY  BVd= A G+0 ᤠ0 ۍ Ѝ Q  P RP@-R 6  -&+ P P@2Vd= d= S0N0 S0N0 VAS06M00 PqP0T 0C. PM 0SP@=S 9S H=S S S@!}0>039 0000 P0 00@=S2P 9S#P{ 0P Pt P9S9  09j }PP c:@=S_ > :S0?Tӥr*F%- S/@-@pP`,M" * @u*"0 I,ЍC-3@@DM > H=S  CRP-)9 R L)"" JPP> CPP@ )[0 l U C8*@PV0@0 \P3@ > Ud=;d=DЍSP- 1R >  =H=  S9S PPn PP`0 S 30| Q ;S d`P{0 PP` V@p * !(#4K]$ 0d- /p7/@=S/D=S/QG-@@=S`떟p  43/=S-D]UT=X \Sd 02 `:/> ?P=0 .:^^XW3XR=3 ,=3/@]GO-@`@}W,=3/PP0@= 2,F_oH-娂R00S989d=0d=9SCC(ClC(C(CtC(C|CPP  ?;< ?5989H-R9 ;Sږ_%#>  ;gQ("( ;p0 0 )0 @9  )%$ מ  d=   d=  d=6   d=  :S0?ӥ=t ?9S H=S)> L <H=S $> CN0\V ; 9S 3   9 : 000======H=SX S`3`3ڎۮ= ⨽  P& ,3a P /a  H=S ?V  %00C0S00\0ӕ ꠲T-X \R` 0 003/2[d`>0.>0R 3;@030)9R032`T=X \Sd 2 ``06/W9SHQ P Ѝz^  -%3<"]2D 1y^y^8 z^PS 0CS>02lN]p@>S 0CS>H=S >S02p@O0z^C-P`Mp(*P@ @P EЍ1W0CWE1Wg 1W 9 -09 dx94P@4 =$@=S( Od1W8 1W  . ᅤ@P#@= S8 9S    S@1 Ừ4P@3@ @ 0)^= 0.+3 ;3 0 T-X=\R  0P5/p 0pU1<)S { S  BS T=X \S=h 84 `P#85/= d3  d=0S P0=00S0 ( 0=T=X Sd 02 `2 9S588Y9S-2"8'0^PP# Yk08 .%0< 0(320@@00` P! (dw:"!(' (& (ʔ0!.0" ( (.70 p07/0)0RSК +P 3 #*8S00C8" ᕇ?ͅ0 0 0iX44[* +_ 8$P 0/,)P U0%ZE'K+~Qp  ⟟ 0H(མ=[)0D%d]= -JZ%4]=0= 0E%>=~)0 S$RֺP ]X Z Z Z TtĦ Z0S xZtZU)pXG%^P K+Q 0 /؞0H(མ=[)0#V]}= -JZx#I]=0= {0G'>=^e S0 0 02_0CSyC4CCCC4Cd=0d=9S9Sj p43/Q`d=0d=\H=S >Sl"PP 0>M9SJd=0~9pS 4QpPEUP#D랄 U >^pP>PH 0$ 0 0$ pH" 0i2p 02"0000H-Q0R RK RE2H  0M> iD Ppp:w>  }#L>ZP 1>#G'U  001  ?& #22?2 ?"LP0C.>2>2?5?3 S 0>.#tu\nD"]Dz^"]"]h "][z^iz^zz^z^4z^z^z^z^{^.{^)^<{^O- @$MP(  _Y,] W?&oTT=`X Sd 2 `P0\5/T=X \Sh 4 `P85/0D=)P0D=T_}0 DNP 0)PXA  B#JY0p 00 pp% YH}0wQ R)Y0SH=40S"X0H=0 000l0 0d1!H2# 0L=4X( 0(=y p X0H=0dp0 0 1!2# 0H-P=R0&SS+ 000  P0@S0.S0-S0 S0H=00 C000C 2# 0 B2# 0 B2# 0 B0P=s%H=S% S% XH=̥̕S L}dx:/9"b0AgiXPd4:9ȏ"a@h 0DWX>% s" )+5),|05p@05\r0404043099!= 0 SP d[:0㠠 0I10S S2 ԊJ베YH0X 2PJ0  SBQQr  `RQ"< 1?0:H=מS0 d=  0 P0 d00d= d-H-R' R RB d-P#Qb?d= x#Qژ0d=h3)Q8<9 9<9< (S:S$Z/d-P-R j>0d=2R 9;998<92R 9<9<  : (0 P0S909 0 0h 0 uPg 0SdڴyZ !> 2 t=2(x=6=⾠ᰠ Kz144=4!8=141:1:141=1=1=1 =iM@p1X 0>9/  !>p`1a  8 >p0T8H2$43/02002U`gp!: b0@00 Q00D+C)C:C *C*C,Cx=C5C~^@-@4S@/G-3PA@,p0 <300U XHbV  g$P 3<300UHG0ᰠ = >Z2> `H"3<3O-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03\"A09/p(p0 7/p/0 0\00 p:/W .pß0 \p P 1?A3c0h+\t]t@{t Hȁ1@Xt@1(@jt@mt1(Mb31S/ !*! 0  ! S Q0$@=L0K<1h t0L ,0L0H00, ), , (, ,06,00`1Y1810<1t1D1I6  111@1 01 10 1  - 0 ≏pP0  03/pP3 0@00S-*⹉aRs Sh00SZ=9 R =?A3c2#d S 0"#!0 "#1R 0 34^I+^MbHȁ+8P]p@-0 `"6 0?H1Sp@pP 31S ^pV 1  10 ᧉp 10 10%1G 1 10 1:+O-H!R BP %!`R %! A(0q 01pBR0  R<" 0" gP@PV0@S @DWc AN!p PGQUV: !K !  !-! -!8!R:-! -!90@PES AU    R<1! 0 $03/p !  !  !0@PS @DP BR-!Pt5/ ! !  !$!R ~$專'Q(A(5!@ 0 2/4!  #! #! , 2/"!R "! $  h0Au0,0 ЍO/ Ѝ8P$VCO-H1S` Ѝ@eP  tPg03/81` SP0f03/,!03/03/`81 S 0S @0{ 3/1q0+ ``n 03/  &1S 0!&11!aV5 0V`!ؠ0!:/10C110103/`103/ 4 R $ Q P$x|  PQ0x0 x8!R0 !Hd `V03/03/`0S`VmE O3/0>  3/,!0 3//!03/0!03/,!03/ 03/Xs03/ pW03/0p3/ 0nE0 3/0@,! 3//!03/0!03/,!03/, 2/d20S  $0 R Q x0| 00++P04S x00pHS q0x003/ Xq 10%1 10S 10 1X 10 181S3 0CS-100-1-!03/03/'at!`&`'   <)!" (!`(a)! 00110$1-1-1 -10-1-!03/!1S0!10"1 %1$"!00 `Z'HȁX߀^^@-@K<4@A-p@`0S @S0C0\0@3/\03/\0P$3/t00S "SRP x0|00 ! P4Sx00x08X߀ A-P0@`0 p0 7/pP p8U `0H3/ Yp` U+8 `#88/ }`0 83/ `0<3/U `0(H  (3/U`0) U@   `0 3/Ѝ0ES `083/ `003/`08 3/`0 3/F$`0 3/C <3/ `043// `0,3/ `0<3/ V  `0H3/C-`ph@(h  0 iPP 404 x (lpph`t ЍX߀HV^C-@0`pMtP0`BC   4p - ⚅081@0f-10-!3/t:AP0 | Q S'  S  h D @60S t0h$0P n@81 0CSt,*0S0@00000810C S񟗽꜀C C@CCЁCC$CTC C CC000e00 0M  \iC0  0H0lC=858eAl105Pp1(5t1 8{ 0 1 *10*1@  d d ` 0p$  $004Cx 㚽@1S0H1[0< 0Q0 @Ѝ000d00@000d00000c00000 0003/c000 0003/ct [Pt0 4`x6/  `R006/,cZ0 006/cR0 003/dV03/PbL03/PbD00081 SB b81 S803/0` 3/ 03/03/ 03/,,0 3/ 03/03/ 03/ D B @000a;0 03/03/ 0`3/ 03/03/P,,0 3/03/0P00 0000 03/0S` S` 03/ 0`@R`B)^=^H^tzCX߀V^'^^^TC8,gCdoC$]J^LpC̀^݀^^^^y^ ^ ^^^Y^^b^w^^r^0@-@PtM0 0 00tЍ0p@-HP0S p`@\?P 0ST00p@- 0 0 t3/p@- @tP 03/03/pp@- @^ዃǃp@-A-4@@``03P`=#=\p"07/2",p7/$00 #002#,p7/ @&& 0\"A/p@-4@@PP03"P=#=\`06/"\`06/2#,`6/l"?0 \` Q- ( "(R0#6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0'A03 \P05/2 ,P5/2P,` 6/ `= 0@S! = P03\` &N6/0 _`xp0 `rVA葔H=$P@ 4=0P,=#Pꦁ^ԁ^^(C'C$]^^#^O- P\h p(` ,@,4/ R@ WdC0 0 ,P5/0D(0@0O-P\h@RpC$P 00d10`0YPP Ѝ[ t0S 3/0 \$8/  ,0,3/ t0S 3/0 \`$6/ ,0,3/[` d0L ~[ 0002c00000  ^P\0O-Q x5pph` M@c |03/}㯧0 ,9/p +40\89/ k0 00 l0 X0 $0\p 7/0 ,P,5/t0S 3/0 \$9/ r0 ,,9/t0S 3/ \0$0 2 \$C\#<;/. 0040p0 P2 3 p +4 0\89/3,   $p -0P00P+ 00 0400Ba 03<3$Ѝs 4 @ppP ^8P P#8 MbPxCA-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`z 00 0yPP 0S  0  0` iw08 _wU P 0,t p@^t^\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/-2 \00/@-2 ,@4/p@-P@2 ,`6/”0P\0p@ /@-P`p@@Đ$0\ pax Ѝ$]@-P`p@@Đ$0\ px Ѝ$]p@-@P0 \`6/0 0 \`6/'U0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&`w 0!!d0    !0Gy(,P7@-@ &^0202020 DR2|0姉@4S000 0u2S " ᭉ" Ѝ0@͉ CCLC@C'C(C@-@D &@v@-&vPp@-@P&w2020p@-@4@SS&v 0@P@-@&@w/@-00 w Ѝ(%]@-@8Đ<0\ @/@-84< ,@4/@-00 kw Ѝ(%]G-p@d尐PV㬀ʀ 0! $ 0    !&v 0!!d0    !0G(,P7@-@&^ 0202x02p0p DR2h0000 0#u2S " " Ѝ0@$CCCC'C(C@-@ &@u@-&,vPp@-@P&Vv2020p@-@&v 0@aP@-@e&@YvP/ 0\R/@-@ 0^   \R@-@0U. V? 2 Ѝ@^1^T^A-PQ+ t@pT'XP SP J`0d 1\0 0@P 0t000 15Ѝ@ꃃ^^^]S^ 0`( "4`#/0@-PϠ ,@ / 00@-P@M0 00000 0 0 0 0R 0R  0R  0RPU @Ѝ0X%]@- x Ѝ@- p ЍG-M P@`  000 00  p`V .   ܍00#000#000# 00@0# 0 v p@-@MP `  @ @@ @@ S ~{x u.   ܍p@-  Ѝ@-@ ЍO-MTPRH@` 9 A>;0 00 (00(p00080 @D < 4 , @  :0,0040 0<0 0D0 (!$0  8  @ $@ ",$  ,4 4< <D D  $ 0T 0 (00`00080@   (( H (,4<D  T.H (ߍO-MHb@@p L P ( 0008 00000S { (x 0u8r .@ ߍ[ 0 P0# 000R(  " ( L0 "0 G08 $0 0 ",008 40< U L O1$p!40),!- #4!'<! !@p@-@MP `   @ @@ @@ x  . #  ܍p R R R @-1 e  ꬃ^O-MH`@L @p    S 00# 000#(000# 00 00#800 <040,0$0 @Lj 0 !0(!00! 08 ! 0 6pW`@x u r o.@ ߍP0 00000 000M00# 0H00#(0C00# 00> 00#80900#$0400#,0/00#40*0 P0# <0@ @L :0 !!0(!00! 08 !0$! 0,!04!0< @!0 00 0000 0 00UpS/O-M0@P< 8 0 , $   0000 0p0` 00 0 0S  .0 ߍ  (p' p`&(` <e p (` @PS/O-MH`@L @pai e a  ] S X00# 0S00#(0N00# 00I 00#800 <040,0$0[ @L U0 !<0(!700!2 08 !- 0 pW`@!   .@J FߍP0 00000 00000# 000#(000# 00 00#8000#$000#,000#400 P0# <0 @LJ 0 !0(!00! 08 !0$!0,!04!0< @!0 00 0000 0 0P0UpS/O-MX\ P@v ~ , y0 (0t 00o0D0j 0D0e0Dp 0`0D`$0[P  _, [(0WT8 00L0D0<04008p@`HP[\0 P0U0DSy D3D/pD+`D'P00 !)08!$ 0@!H$0!@@ 0J040  >2  >2  >2     ލ0 0 000 00pG0  0000000 00@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *j%nD(hT$ *h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P%n% ! P"..@$iD$a.@$i.lD$). @$ . @$dH.(i.f..f*b. *l.*b* .. @ (@&(h.&#a. 0#i4#f.. !a'p'0iT%b.b4#b!bt'bT% "0l! `&l4#lT%l. !lt'l$",p' ".!`& @$a.fh'dH"`@ ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:aOZPa!e%a*ek!l,l., ,a, i)i!0l!b"b$. ",c$#c4.P%P%`4 bX%`$"c("  a,b$".a4#b8#j. P0~000/ /00 0/ /G-@`pP0@M 0a800,($@ @@ @008 <0a,($@ @@ @T00L0000/]P.]^^xT^^̅^^$^T^C-RUMgpp0@ 3/ P  000",`0( 06/ `P P lu" 0dd G 0H"TLB` 00008 0,9/ P W" 0 ) 0!$` (P C"00( 00!`  R 000X0( 008/ P ," 0  0 ` 00008 008/ vP ! 0 Ѷ 0 |t̶`P (aP l!0088( ⼶00 ( 巶`Uߍ0]^^xT^̘^^!^Y^^O-Mße?00H0P L0d 00SH0 0[ 0 0$0 0 0 p003  0 03/0 @( 4/ 03/ 03/8@(0 `0 d6/`㖛) P T2P 1P s!0 <<E0 ,,@ߍ(0$0 ,0:00640280.0< )0@ $ 0\ 0D P0H L T0X tL08p4T0H00@,PP0D0(`$ 0\0  0@00<003]3]3]3]C-@0S !&.8PP &> 0S !&> 4&>ş 0S " &> %P0 05p9/5 0S !x%`P \5 0S !<5(( ş 5 0S " 5 P0 04p9/4 0S !$sP 4 0S !h4PP ȭ8ğL4 0S " ,4 ⹭P0 03p9/3 0S !#=P 3 0S !3xx ⒭`ßx3 0S " X3D< ⃭P0 0$3?p9/?0 0S !? P ?0 0S !?0 \?0 0S " ?0tl OP0`B&.0808/&.P &>0 9&>/4P&.0!008/!P 1 1!P&.0t!|008/T!8P <1@$ (1 ! P&.0!008/ P 0 ߬0 ڬP&.0? 00@4/? HcP ?0P4 ?0 $弬Pߍ3]d6][^xT^3]_j^4] 0@-ALM0 P0`5/(@ 8@P @0 ▬@ 0P00 (p7/@ 8#P @0 @0xP0 (P0 p7/8 PP 0@, lPLЍ8]3]}^xT9]^9]^p@-`@pMP匳 ␴ ⌴`a R ℴ@Tٴh FpЍp07@-7P|@~ Q@00#47 b0 P Q0, Ѝ0r00#4p@-@P`\00M 0 0 00 P M  0Ѝp@-t @0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 80 p0 P@`pPtЍC-pp0MMPSvX@`P `Բ0 (`(0ֳ7 `ҳ `γ`& N 7 (pWIO0"R%U` ⩲7 (⭳  n7 (jh f`␲0 `0咳7 `⎳`p 0b"!4b4# (007  p0h 0p0`= 9Mߍ`7 (dἳ ( pG 0O-MpP0?0BpP 000d  07 0001 0D \n D0Qd 7`D ^R 奠TRPPPZ 0Dd0? 07 Z0 0@i$ d0  0d P0T RP0P Z0   d7 v0 $ dZ007 PV dRP PXpWZO%Ѝ:]$E]s@-`@4a P70 00Z?Ѝp衉^ 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,G-騁(M`@p"41P- Pd0 @p   k 0!,4Q000 p, \aUP! N`V,10,1 P  B 0 0  08< 0 0. ,,a`(ЍG/D0N @- 0*D/@- Ѝ@- z Ѝ@- Q@ ATPU 03/@P$01`0$0@00S$0@0ꤐTXD0@0 `@|0 pD0S`d0W0T0S @`  p@@ww w\@-00@T P@\^/@-g 0p@-P_@,PYᦷቷ 0!p(p@-PK@P0,`000<00@] h崷8@P PU0 @eYPpp@,$p@SXEDHGDEDȋ^DD1,^^@-@ @,^0S@ s<00,@FPp@-P<@L0,`P@008 00V$  p@!ꀙP^ ^=^(@-oO- Ppp`0DM$  0<00,(Pp`@፟ <0400,0@0 080 000(P$p0 0P`wDЍ^T^o^P/P0/(@- 0,ضP@-0 @  00]!P RP `PP |G !Ѝp0 P 004P0 PP$ !(l^4FDv^\-^4/0|'R02IP 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,p@-P(0@Tp0S @같p@-@P 0T 00Q 1S 0<1e2 L.:1S!!1! efR(0003/p@?Z같^LɌ^h  0P 0CP@@d #/  N @@<0P 0CP,0P @#// ̇@-@Qc>0T@DD<0T T 0 +2'2 05/cw^  0lo00`0S P[ 0p  0벰p W` 0S2001n8^0 Sd0001c00fN8Q0S00d0Q00@Sg/1!|115#Jh01 RC 1GS  s00aR310@0/1S01 ЍO16 "6&0- R    R    R   "-" R   .R 0  S0@008Sh0 S, 01 h ^0S4 0!0pT 눐到0US|M @TP Ѝ P @  0 0W   5 p^ύ^X^̍^)^ލ^p@-`@PPp@0!0/00007wnS00q 20|7S S S0< 00CSUDVD VDVD$VD0VD|7Sx8D!0 0<00;080p0808070B;0;HI]^O-@0`pTM0=^0 Ba yqw>0S9+ 3 0 `ap7  0 Xap7  0 Pap7  0 Gap7 0 ?aY0ZYpHH0SZ(PDOaX 20PT TЍ0 p0P5 0` ap7  0  ap7  0 ap7  0 `p7 0 ` 0pSP  07pB0pX 00 0 0ZSʞP  `P( 0 S0 `` `p7  0 `p7  0 `p7  0 `p7 0 `po`I]@B00 S   P 0@/V   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p $+P`ЍJ]^^@-0<S !"  0 , y Ѝ0 ʑ^J]<@-@ P0@00K]/O-P0 ^P<@-@PP0@00,Q]O-`p0$M0S@ Hy S} S Pr n0S0  ֵ00  0@!G$@$N$aA$!G$t@$yN$aA$!G$g@$lPN$PeA$PP%G$PZ@$PN$ PeA$ `P B W1[  k R ! 0   [0G= 0`JBP%G$P50@$PpN$PeA$P   %P%G$P@$PN$PeA$PK[ A00* 0  0GS p`  Z KR%P%G$P$@!@d!@!@0!>#`1# $ ( #$0  #(#< 0$Ѝ0 R@-P@0  <0`101(0 0C` "&ЍpC-R@P<M0 & `p1 01(00C0C ( 0ANh P 80R %Ѝ}h$"P//O-Q0 0. R XB Dd(0HL@@A0 PlQ!@DQPU)T* p1  K0 @Y  ZIJY ^ . .,.0 , ,,̠  @P^ ΂ a\aNL^Q !^UIߍQ]f^A-@` 1Q @ 00 >0S TC (`PJ`F@ V `!J`V@T*Z+ P1  2K 0 ,B0 #"$!qQ PAq@QpppW0#0P` "4 0"8",  0>P1UP N@aTaE1DQU@00>01S0#0}$Iߍf^Q]p@-.0( ,?L00L0S 40040Ѝ, T0d0252P5c $YX0Zp0S1 >.Gr0p>![D00D00J S*1 =-Gr0>!FL00L00S SD,D0S㺟)  };5?|Q 2  PT<`0S ;!0:1h7 0 000T0(08U l7 I#l78l70 000T0(5   nP! T $P 0`P00 0\P  x8Xh'* 13/?S PT04$ d|wW 7S 40040  0 RY-1 5,%05 &D00D0BP*1 4$0L5 L00L0P 2P P00S ! l$05 H00H0oZ1 4($04 D00D0^0 S ! #04 H00H0MS x RP 1 3  5`00`06h7 1 |3@#03 `00`0$x8Up W , "pPU 1  T$E :0 00 00D 1 2t"02 xW % bP   9#P0P a6/1 JR  1!0, H2RL00L0㸁qἑ  @D0 p:S  0 3/P1  101!,000|7S0 a86/h7 1A $10H1t!l00l0|7S0 a6/X 1 000  0CX ! 00 000 e^^^ٔ^^˔^^ǔ^^ ^^5^H^[^q^^^^4^L^{^^^^^^.^X^o^;^o^^^[^S^^ܗ^ї^^ϖ^^^^@@2^U^ ^h^^Ǖ^Е^^^^^t^^̘^^^D^S^[^^PP^^^^^ 0 S% 0CQ  0B000 $1%000 |Qp( 0 :0S0GSX 1 10x1l!0S ! 01|7SPDDhDPDhDhDxDhDPD! 01!7S !R 0L2:W W㐑C  H2H"p0 00x8U,  !PP` 2 020000P ,r1"  TCV $30, a06/pb ``sx8U d |30|#|3\,PX 3#03r P  30#3kh00h0D3   TNC dd 7S/W) W7,P Y20,0Y 1P$  T-C 0 Bx8U<10<1h00h0 1 3/|P  , 0 a6/1 858%pm000Q7S 13/X 0S! 05%000|7Sp x0p |7S񟗻ꜦDDhDDhDhDĦDhDD! 0060&7WS 000x8U   PP 2 020a6/1&  TB  0S |2 ›7WSY 1'  T}B 0 <x8 U<10<1h00h013/U 1 3/N1S 7'd00d0|7S?0 a 86/7|'R7S 40040- W0,P 0IQ*1 T8D(Gr008!L00L0xP 1S 8(Gr08!p00p00S"0 $0000 0! 0A S*1 09 )Gr0 9!_L00L000S/ S  S   0Q 0S!1 9)Gr09! 0@>C1 4Y&!`z 0> $ ( ,R  R  p0CS #l E p1.Y ?!M 00?\0 Y1@/P?@ L/Q00Z 1x/?2 0A@0P !& ?/_0 I  00Q 0p 1p d:D<08 8 <0 pGWB#h I!   1*: 09C1 4Y&! 09 $ ( ,R  R  p0CS #l E p 1() 09((ppgYFp !чЅ$$́1(  T?0 40P0F00D0 0C00A00@0080,P .0,0(01S  T? (0LP0@80< 0, a6/#x00x0m00 /Ph72 1S  Tm? 7P0~0, a6/#|00|0B000040?(0?x80101x8M? M? x861610S @000D0049;$0S 45202, $0P C.0004P <.$04020|7S7S 400400LS1 $6$&Gr05!nL00L0꺁xXX 1  T>0W5 0x8U<10<1h00h0 ሕ 0\Q:1 `5H%Gr04!7D00D0LP*1 4$Gr04!"L00L02P  P P0Z   P0S! T$0GrX4!H00H0s0ḡἑ 1  Tz>0W 30x8 U<10<1|00|013/OX㺯ᴒK  PE202k4wh7Q / < 67Qh7 !s30Sh77!66h71  T2>hǔ  2ŸP0W04 13/20276h77S40040 00CS 1 1!00 1fL00L00q00101 JP400401  T=0 |7S S 40040 1 3/x8U "0q00101 P400401  T=0 |7S S 40040 1 3/x8U} !y^D^S^[^^^^^^^^^^o^X^=^PǕ^Е^^^^^^^^^^O-lM 00PR0 = @ 0`  Y0:0|[ 0S!R 0 T?[ 00 000=p 1S ?pH00000}'  h'[ (D@DD(DDD(D 㠅  yP 1 4=h> X>000V t\uf $TP$] 1 =  0 =   QI SQ0=Z 00 0 0S:x8 㠃  $0'P 0  P ! 4<0P H<< <P$[Jo᪢Z  P   PP` 0p000K|7S0E00S0S !R 0 <0ppW9p090!& 05"# #^#PQ\ BQʐ 0  0 |;|+p[0001010#8S >!0R1Ɓ!!@R@PCQ4UB  @PP 8. 0000000Q<<0 0 0000 P)""#"0 N0S00 E000T @@ @TЍUJxS ^- 0 ""0 IJxG $OoP/B χ166S1 000@ T0!01R !h@$TЍC\TЍC1S <@P  PP 1ZS01Ɓ! BC@2괁X @P  PP 2 01 S@0} p l01 R0@TAp # P, @D("(!p7 0 0S < B )  00/ ARD DDD,D00000p N9~0p :9?o2xN8v?th728o"}0l:Su (0TЍC/8V]DDA- MPp<#%@`P0%`Sb BS` BSJ? S#* S~  S< `⪎0pⲐWC嶠C  O@0Xp8&S BS6 BS  S7 / BS|7SU cPB 13/<%S r Sr`A0W SQ`8#=0 ᶯ  (03A0AS)7S4`%WR0SO!V&R!I 1?0|8|7S3A0AS13/4P` W53   R<   ЍR <3W"0SDD0DD0D0DDp'  |'S|7x'R p' p' W0S08 w~0S 㴀u?0XS  R0\ Y"q?0Q  \ W "= s W "= m W0S p7  h78h7|7S7S03A0AS7S4`h7|  8h7x  h7 H 3Wt0Sx( 0•nh7< 0Wg0S.0‘aW_ (W?B0CSY"= |7S$ pG  ᢮x'/o"W1  0R P00S00 ¡VYY6Y 00 S C  R` -%EOO-?@Q`|MC p3C>6CQ m3>6Q$ ?QO 70Q8  |ЍOq2`?Q0 00 0p0PPxx0@FSPDDDDDDDDDdDDDDDD4DLDDDDDDPDxDpDDD D$DlDDD$DDDXDdDDDDDD0S Pp7  1 CbR.0‘!1R7|Ѝ!h7R00h7!h7R44!@R8PPH<0 SP:XJ=0S|7S<xh6 >⟳PXp:3/0= 8PP <0S00$" 0#0 Ҭ< X/V > PP 3S>ñ:3/V 4U > 4 `PPXCs`~!R<8VPP8Q|7S xHݦ 9FP 1Ps 9 @P lhQsa!*R8)PP80SS*|7S9 iR B0<~P` P@0CS|7S < @P 80S$ < |'R R0<0 S < @P 8(1#3/ ,8  |7S PkpP P !PP |x!> O!h7R 331Sh75h7!R R R5q}4{5y1S p7h7:qyh7:m!h7R33g!h7R22p'P50Rӑ 10h7GPX!0B8#8S ǕPPp1S5 U0p'0 P UX㎀:P1S $ "ґ0z*!0B8#8S Ǖr"!18p7l1019q W -PP 8vx7 ?o`2x`QQ 6\Π x@Q@A0 S |Q 0x !@ RR! 1?0|8 x0@`P|V` e 8♫03A0AS7S 0 S|7S c.PPg 13/P`!R8zPPWW pP 03/P z186S003/1zS$ 8#8SW $03/SW 0:03/W pPs 03/Pn z0W 03/!Ra8{PP  8 C 0P> "8Sp7P 1 0SN <^ 0/@ tB 0PpDDLD|DD[) 0PpDDLD|DD0A!1P9 919"l A!0i979!^  ̥ å 910!^  ̥ å 910iiii9ii:ii87ii8i(o?) \D8V]XV]e^* *^V]0S108p'1D!S8P#8,C("(R"-0! 8PP8` V#=0  h9Hm! 87S (#8 99! 8Px 8  0BS^ !R r39S0SQp0  Q ARQE0X@ 8⫩8 R@ X P:3/>00S J0 ᴐJP-PY@:3/Ue媞0Sn@Yp0 0CR00h'4PS4400Rh7H PP B 80  J  㸩-kP h7~N#2000@000S@@W` 0PP0T0 TPP  > 0S p7  h7 ;h7h7 ; h7N50000> 0 j <巯h7P:: x^1l%Sp58 S!V&R! 08#8108|87Sk|'R8%S x(0!S`R|88[ x(0!R7S|7S|u|ЍO{0 00 0p0WPP |ЍO:ꔆ!B"P   03/PJ"|ЍO$^Yʀ 0! $'0    ! @aRa/#FP7PPWa/s 0!'0 !    !D0C-DM,00 `p\(00 00a00$  P<0@_oP0(0`0$  0T00<0 a ,MoP<  kDЍD^O_g^^^dV]@-  0H2$,p(`0/0,2  0408 lPv 0 00졟!18 $ 0,p(`40lP`0 00!18 $ 0,p(`40lPL 0!X18 $ 0,p(` 40lP9> 0 00!18 $ 0,p(`40lP$w> 00$ 0,p(`408 qlP0N@$ 0,p(` @408 _lP  <<~TЍӞ^ EM*_ԙT^D Eٞ^^^^^^^V]cn@-@wPip@-@`PUp0S00`00C0 t `G-@-0 0E MЍ Ѝ/^p@-PP UlU` C@P C0000 (  D@P@p ^?^.A-1P@`p x8 Qᔀ4' 0.x8 S Vde0 rTЍ V0 glcTX^S^X^@-1@P` x8 Q|pp' 0lx8S 0 fDT Ѝ@m 0 h6T ЍX^S^h^@-1@  0@ i#Ty^S^O-1020`003/0900*= 20T100 0 0@0 01 `a R @`PpЍA7JW]B^ " Q!P R 1 B0S Ѝ7SD@1  ~P0D DPw<G?0L Q ꫢ^^Ǣ^uW]Ң^A-`P8p3/@P\00\0  s@-`8 P3/@P\00\0- 1 D"0 = 0x +00x822x80!L0003/090020T100`ЍpW]^4K]A-P`8p3/@P\00\0  x8 0 0x822x822xx80!x8 99p@-@P`[@pp@-P@P xG GƟ1S 3/pA-P@p`000 ⮟ ⪟ ⦟0?0?x80101 M? 061071 N? (Q 4$Q 0} 0 1SA/@-P ` pk@P 00 0w ЍA-|7PSS` h7M @ iN@p=0 R0S P@xH*jA-|7`SSp@ h7] P i^P0S TAT10 R0S P@xH0S i V1Sp1 !0D D0 0PߘAЍטW] ^A-pymP|7 `S 0 xHØT |7SS @P ⴘP@1  0 000W]4^C-P@@@`pAT ݐ  P01S℘P1 0, , 0 Ѝ@W]V^G-p@W  `R 0S RȤPpWPU ⴤP 0R01 S  R 0S R ⠤P0 P0X@C-p`@P" 剤P@TW Ѝ0S xP1 ) 0t t 0 !   AT  ]P0S TP @W]W]V^A-P@U+ pdP ЍA0S0S i V1S1 0D @ 0!X<P ЍAЍX]k^@-@xP 0x8i <P 0<8HP0H8p@-|7@SP yn)089,8xxXP 0 022220000990w>018|7 S13/p芣^A-1@` !my~F|7]S11 P8889,8xPPp I(# Bx8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGgQ AR(X]^j^^@-@xQЍp`P 7P P 1  <10<1ⶖ)P 1 h\ \0   D@  ,h7X]^^^X^^ϣ^A-@M|7S:in  `;~VU!0!V&R! R s0 QQ0Ps ܍A83/0p<0!SPRqC57S &1R6'S "a|7Sh7 8S|i^ P/6S jh70h7܍Aj0SU? #~Q A1 0 `~0Sp7  |7S 1 $!$n2+~Q A1 ]0 W0S1  Mh76h7p7  1 l |@h767h7}V @AJA$@U^v^^^X]^ ^+^V^u^O-P`|7MSS00 0ppp*1 0"p0W  ЍO @T 00Ѝ0W p|7S2  0S 4"|0 0Pm:00x8S| 0 0C8C80Q Rn P1S: 00! 00 00HP 0SH1L100P10CP1<:H1S 0 R B0 Y 1  0 1P Q䑄13/0Sʐ1  0 c 2S 0 ᬑ9/000a)Sʐ1\  T0T E3 sNS@]X]^@^P^ɦ^ ^^S^C-2@SPpM !Ⰰ8#8X 0 a6/ЍCa< `Ơ 92<2<! !000w>0S:? n0001 0 G=P202n0001 0 7S 1 l!lh76h7? A `!H10S hǔ00  1VQ01S 3/9-8C800ᬁ0 8/: 0S 3/ ЍCS1 T h776h7`9^f^X]^@^^X^^^o^ܧ^^A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3֞@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 0, ,.P00Lp@@X]^p@-PiN@ @P`xhVxHp 0^ 022220000990?p@ ^s@-!]1 @R0Ł<>H`1 00|!|1| yG 07D180$881]PVW,884h0h 01 00 0in  F { 0(' 0' 8' j^6D'@7<7Vtx8 p  p'    L ( @ ) x8 ЍpY]j^A^EEX^E A-`jʀPtpQ EQ00C20U U U ,U UPPH$H@|V`h@&h@@@`p@-P@ /s000 0u t      @v w 0  " @x 0S @@p0Y]A-0 0SP@0p `.|'RREREPREREPREPREtRE0 0   003213030 0ܕ  ؕ  0Е  ̕ t0/C-@`M{3PP000Cx Ѝp0 `ݐ0=0 H02 |7S0000(001011 `߽ X0P   D 00L7SPP7HWLW0P7^]^a^@-205 2S 101 , ʠ,ʠ\ 101 S&0#*R00BS00 \   0R!  R  (R  B/o"S0|'Rt@ 60R R  R R  1 0S "N)R0Y]O-0LM ShP@p 8hg`+ |7S 80] 8R` >0 S c39Sn`$7R 1 8>0 07000`㲢 $7Rh7 4@V80  3S'H0L0S#QH 0P H  0C IRvn2@P0400M6LЍ>0&S c3)6R0Yڸ |Y4 30V 0040  B    04@ 0PR 046P4v4@T 2U 0      $D"$ (0 00 #R,H L R(QH0 P0H0 00BX0 B 000 (00(00 0|7S"tZEtYEYEtZEYEYEZEYE]E  5@P000w 0 0 >  80 0 00ZD 06 R0 R00R":)0R  w  #"!# #"0( R00 V 8 ݓ > ٓx 0 08ϓ  ˓ >321303(Z !%%*0(@00 000 0J$0(0 0C00$000 00  Z 1 Y: c(`Y  3P`PMH10I2  დ 0 101 00 00 I0, 0a1, 00(0080(0`0 C0000 00000($0C10 8000000C001 !0110/1!P`4V [8000 0徠000Sl V` $0R h7 |7S8 0 R 0@0080 R (03/P1 8L  810814@Pꖨ^4K]LY]/^^^^^̨^O-^0 @- @T@@ e@-@T02 @D @ V0@- @LA-h7`pPT 00x 00 000S R  *00 00 P 0 h0P0 00 @0P0000@ @0 00 00 0@9P09#40@D@dQd è@_h7@\ "0@xx 0|@ݑ0@00S R H @͑0 0 00` 0  0`0 00  0嵑`0000@ @0 0䦑0 00 0圑@9S09@#40DDAdQd 8M蠩^wY]{Y]Y]Y]Y]^Y]Y]Y]Y]Y]ũ^@-@ u Y]O-P1$M`pPT n0"0 `=d<[55@P000O hL H~q[ 40  00C0(0 QHLPP  2@P H BQ B0 00 `(0 0(0@01011011 `B 0H00L7S@P7HG0LGP7$ЍY]ީ^ ^O-`Q$M 1@p 0)0 `9⧊PW9  W W W  1S 0 t000@0WW W1| W  0 4PP 0尐00(0202{hk"PP000 @ x8?0 00|7h'S000  0 ;0x  Gx7S00j000짟    M? 0#40券 00#300~ 00P#3@0  6! |7S   0 0Y w>0S*0 000>0h 0S0000B h7 l  g000   *0  8I#8 CR,X SXSx HoᨂZ  R㈰ 0 UPP 00 R㰀岐崠 \%0 @, 㢏0S 1 5 0:0Z(110011|7S0 #R H L RQH0 P0H0 00BS0 B 000 `(0 0(00000=00H0 1 PW|'R  S3Grpq珷 0 1 0100L7SPP7HWX0P70LW弈2_@$Ѝ + 0 D%PP 0ᰐ00(01018S>HHPP |7h'S000 (  0/  p' ; W00  . x ܎000 G_ih7  40S  HQ 廎0 00 00C0(0*3MPP* h'00  0  ;Y00  岐0  " 101G!h7  40S0 0C0(0k 101 0PP, R :01 kP0 Le0@00_z^Y]ީ^^}^3.^^O^Y]ʪ^A-`p+@P 00(0K0P 000p4  0p@-`P+@P 0; 0(0 `  pG-p'!=⼐`0G% -0p@ PP 1S 0`#`000Ѝ 厍0/ |'hR    0  + h  ʍ0 Sw0S 00000   00  00|'RV00 0 ! h7   Yh72h7h7 :0S*0 000>0h 0S0000B  00@10 @( #RH LQP  /PP    N  00001H   CR0C00(0 0(00㲐0+  ' #붑+Z]^^O-@fMP|7h'S000 0 0  ;0h7 . 9) S!  " 90 9p9S!  ! 90 9`09h7  h72h7|7S\hw`u@ !PUPPZH(0S PU0J${Q0CS*e!0 Rp p!  0 ppp 0 Ⱑ PH!h75h71 0l x08 S0R 0C00 S 0S  Ѝ p)Z];^d^^^@-`T1P!pR@MX1\!^0 X1\!1S a200 @E@X1 0 6Ѝ@-. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 10 4`*V1Ѝ@/Ѝ˫^^-0 /2S/p@-@Pa0 6/p@? 06 08880 8077090(10101/* * |E؏DfE@-:@0S 3/ Y:S@0/p@-`@0SP0P    00T ,P1S 01WppDZ]P0/P 0!/@-@ 0@'^0 R  xG^p@-<@P0S,)@T P@pi^ QA-0@P PS tW`lp0FUATO B^R0F,C`$p0FU;U^^r^^C-1@pg 4!1000$OxX倇X }E~EEE E`FV}E@}E}E,}E|7S S 0 8:0S 3/ Ѝ0 a6/c  |7S S 0 a6/3V(~E`~E~E~E|~E|'R/I032+L3Q' zh7  1  !h70d!!p740!h  i j9k9 0g901 \0 E|7S!=0S* 9'w>0 01 9i9 00\0 *|7S 93/1  |7X `S499Ѝ@x829009h72h7ЍDZ]8[]^֭^^p7/p@-@f_qp@p7/O-P`㼁qMpw>@VAM VO VQ10@|'RP 5) 6) 7) 8)0991  99 0894!4 079069059000N9 O)PQ R   0 0 `VpPx8S   19ЍO0: @h0: 0\ 00: 0590690790890Ѝ[]<b[]\]^^^ \]x\]@-h7"1 @ i|Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@^V^O-pM`0`  P,0@0 00P 000 0_o`@IRPPU!R:"R :"R:0ЍC-MP 0`p` @0 0 00  00P 0 0@I?o2P0S R0 Ѝ0G-@M,00 p@P(0|10A0p$  <0`oMPJ<1$ 0<0  A,p(^MP91$ 0<0  A,p(NMP)0'00弐$00 00A,p( < 9MP0$00 0l0 0`0A00,p0(0< $MP  ,,C@ЍO_^^ET^E^w^]]G-0` 0S0@YP Yt# 00000SW D0``P 01` 0d` 0 d`Ѝ@0@T@AJ0^0\0᳀0X:0ꐚ^@-  0 @!  Q3  4儍000 P1#9P00T0CdX耖C@BC-P`尀p0@ A0 e0S HP `0` 00夻 Ѝ萚B^O-P@0TM00p1W:[I (PC 1 0CЍO耻0S`0 S00qp0少  A$0 [! P p PQ`1P 0 c 0pP0 0PFЍ萚c^^O-@0P00MP@p.P 0S S S 0 RH*101aQ?0S  3P ㊠  0 ! 0 pc 0p000! PA0 0S5 P 0``պ0S& P `` ú0崰崠0C@0 ṺGo`0!0R x⮺ X@Ѝp0 p 0c  0᛺ꐚհ^ΰ^^^^)^@-@@$]]@- ,4 4 8 #8᧺ Ѝ0^p@-@0M SЍp@P` 00 0⎺Ѝp9^-$M840, (  0 $Ѝ0@-`plM""@P@ !0 0  ( 0  P0000C0 p0!0x@0 0C0000 0d@S2 001 00@09(唨H0L 0 H0L 埨lЍH02M0PЍ/D@P 00S H00O-0HH!DM 0 0 ĬP@@`p\0  0 0 a 0,@($  PJ0  0 0 a40@,@($  PJ 4 h 0 `    a 80@,@($ PnJDЍ@/A^0H^M^ED_O-l`,M@p 0 0 0 0#TTX%XU *0 0 0 ,ЍO&%0 0S 0S*E%@P` ݧ0 0 0 ,ЍO00C0E?P Ƨ0 0 0 00C0000}PP' 0S S S/嫧 0$ 0 0$ 嶧3"0XU$S 嗧(0, 0 (0, 墧m$L P0YP [ {1,Ѝ0U 0 01P0S1300 0 Z  0S 0S 04S ϣ2@ 4 P`0SȀX3B 8 0S R $R  RQ  BRE(E(EdE(E X *  0嘣᪊ 0@! 0 004 0 004 30 R S 80< 0 80< ^ 0SS b0P`0 0p `P^ 00٦@0D 0 @0D 0S 0CSL00I0 0S0(徦004 0 004 ɦ3 =20 R S 姦80< 0 80< 岦 ) 0SP`0 0  P`P 00処@0D 0 @0D 咦0SS S0@/@00p@-00@4S 3P1 pR0 0S``Ң2@ap0SL P 000 010S100 p@/@0  BR/ $R/ #/0 0S/IA-P@1S `p 0 @1 @T Ѝ0S 0CS0@q 0S0 0S @@/|@- 801S@ R  R 0@/@-@ D0Q  0TS   U@ @/03!"/03" /0M0P@Ѝ/0M0P@Ѝ/L@o/!4! #4! B#4!0 P/60S/0 @-@Ề!.   p@-@PD`P@p00S DqP/tp@-@PP s#p@-@P i#0 @-) @ 0<p@-@P#S#p@ O-Q$M0T `@Ph pP h0$ЍT@ @ ` X0B00S @T  N00S 000S00 0 0 0@0P`` @Z 000 R0 ?0P0  ?0P ` 0 0`G-p`P$@P[*U 4 0 S H0S 4 R 30 ⌆P SH0Y 0S 0C @\Pb@P Ŷ  " 0x0p0PPH0"^Zv 05 06 06 }"R^E!>00000 0/6 0@-MP@ 0Ѝ0/,0/@- 0MP3p0pp``P@ṹ 03  z#,0 , ? 0 Ѝ@g$ 0#000W1 /,0,Gpᐹ 03  Q#,00,0 03  F#P,00,0,0 0 0r$}%Ѝ0EA 4 #4 # /l0Sp p l p0 0S  0 00/A-@M|`pP1hSl l0p BAD>0P1p00`0101S0@@aq@-@Td$,d,lH,l $ . O-@pHRH2DM p00 @@ѧ0A10bA @奸>  8 EF? .`pPb!1 00a0,P($@ @@ @E000D1 0<1 00a4,P($@ @ @vE1  00a40@,P($@ @@ @eE0'40张0  00a80@,P($@@ @POE040p0 00a80@,P($@ @ @P:EDЍu^H^̦E}^_a^^^@-@B0 0S P@\0X0S@S P d0`0S  갚p@-P@0 0DS P@ 00S \0X0S@#pDP 00Sd0`0S D갚0S 00P0#///0  S /0C\ B /p@-Ʒ @dPPRL0$!p@ݷ 0S  Q@D0R0 1p@-P@ q}0!S <S21pp@-@Pfp@p@-@ PJ00p@-@ 1@E0@s5A-CP@ `eD Gt@PT00S0S 0S h0S 0S d0S `0S X0SbD&@/ᰚ80S/A-3`A0ASMCp&DP@TAЍA00S)40 000S P 0S0000],0 0003/PD@Ѝdp@-M@`۶DPP@Ѝp@00Sl0S 3/0000,붶P^D@-@$1@Qop@-@P 4DŽ001Pp0S 0Sp@ p@- @P8:@P@p@P@A-`dQ%pP 000pЍҦ@PA 0 000 ` eP Wq@pkP Ke@q a1S0 ` Y1@0D RA0, L(1 q0p(1$1i0@-@M00CS0 pЍ0@j ; L 0@PS   (10C(1Ѝ02iC-0`SM 3/4 0pC @ =+P 00ЍCȵPPUT^ܵT T0 Y W 0#   Q @SPT Up@-@,0P `0,0EOt x0Rx0t 1x0 0S  0 00 000|p@O-@,MR||`SPp踠 0S XP R R0 00R0P00080S000 X P 30Sڸ000ܳYʀ 0! $#0 ##   !  0!\#0 P#H#   !Ḑ\㸐 00踠 P 0SP00 00X00帠7 `P帐#0   R$"\ d \R \ \ d X d 0`0H0403 $d0S00 0` 00\0X 00h0` P0S ( ` 0# ' )【0  |pP#᫴ 03   lPP,00,0$ U"P  0S0S  S  0000Y% P#,0 yg3S0S00hX 0 P 03/,Ѝ d(,O-4>PQtM pC> RF 35Q X@ 0'@mW=W26W`0ST 0. =0P@ \=\-WW00W0S T#`1P@$=Q 3C5CQX U / <W ,W !BW -P9    R R  @ TW( <W% 1CW0 @sy 0y@ y0S P y!>d600 aPtЍ0`0 0i  00R 0g`uDWP@  ᑳ1Pp;W 0 00 RVQ  00 SK D@ yS0QX 0ST0 @y 0ny| @jy3 P cyP _y R0T0 X 0  tЍO00000 /@P 6060X`\00` E``90 S EEDEEEEEtEEELEEE4E9WW 6C 0CW 90ST `eH9W `X90SgSdE@E ElE`ElEE 0S 0R Tꀐ0Y8(WW T800 80 0 0p`P T"@P7P 0| 000?8`93 `!>8 崀000000Q7W1CW 70 SPW700 0 0֦`P `O S`ElEElElElElE@ElElEElElEE`(| hV `P}`32  `3*  ` 00  0`3 P  PP `&T``V 0E,0   `3 PVg`0 `P`P5P0Vd0K0P eP`Z ̄E0t01x0@t010S ؐS{S ؀0ؐ OZV P`0`V `000d030 !0S`0 0 R ` ` Z00   `3 !0S P003 P R0`@ 0S  !w`00`0|S3 2 L@0S 0S000؀S 0 Y܀{Y VP``U p2  P`/P `PPP01|`W| 1w  *w @\ R0@1 0@P_WD1W26W> `hD10 SlEEEEEEE P@ &T 010@0jЍL0S# D 03 @P 0  80S 3/@P vrn0Q(@- 0@R0S  R P `Pү 03 0QƯ/p@-`)P 0@0L0`0D00@0 0<0(080,040D00040,000@pE|ELEHE@EtEE00 000080Ѝ8G@- <0b",4b4#  #$  #(  #< Ѝ^p@-@0M SЍp@P` "448 #800ݣЍp^R=ddQ 0S  0CS0#0/Q 0S  0CS0#0/p@-@PT # 1R !R BsPpEp@-40 R@  000 <  q  6 Ѝ@-40@ R  000 %  Z   ЍX0 0&-$M840, (  0b$ЍC-M 0P`` @Lm0tp 00P 00 0 0@/?o2P0S B~Q Ѝ`C-@MPp 0` m0` 00P  00 0 0P /?o2PPPU@ @T@p@W T @<Ѝ @T b @0`O-@`Pp3DM ,@0P 0 0p(`$  33ᄃ 0P,@0P 0 4p(`$  n3 0 0 0'!,3 4P0P,@0@ 0 8p(`$ W30 400!2 02 0P,@0@ 0 8p(`$ @30 0 0!2 0P,@0@ 0 8p4`(`$ *30400 0 0!(2 0P,@0@ 0 8p(`$ 30 0 0!1 0140P ,@0@ 0 8p(`$ 20 400!1 0x1 000P,@0 08p(`$ 20400 0 0! 1 0P,@0@ 0 8p(`$ 2 0400 0 0!00PP ,@0 0  8p(`$ 2 l 15T@T<,DЍH^^` ^E^%^1^PE=^HED_J^U^0lF00p@-P .@lh 0S Q 0P @@@040p@Pp@ 00`0 ,O-PM@p00`6#21 2 yP 0S , `6 V#2!12  Ѝ 0䥟0G` ns0100S pCWp  Y 000DpCW#  R R  H000 [ V 0$0$0> p"( (Y DIY .  R H , , | p VY `400000S&pY  W   T0qGY`_ `P `P= 0$00 .pCW # 0h0h0T|\Sd Z  [  [ RDSS S 0 ?i0 00 JZ 0S0 C "44 0C(",400 0000 (0 B C( Bi 0P,0,00  q!B pP0#$$("(B&0 0C000PP0s0 cR0 R000 _W" | @:T$TNW  Tp@}PW  R` 30p 200Sp ,W|YX !>000 ( h40800 $02R0 00pP2YD0 0 0 O 0 0#$$ (0"(DRD pP p00C0H0S2<4 0P9[ @  !PQ0 L d` Q)P@0  1 0 S!00 P X0\ 0 X0\ W, 1@P@ىH0L 0 UH0L  `0d 0 `0d ܉W  0 ЉW 7Y (Y0P H0@婉0 @0 0 峉P@11!>@-M00pP `00卉p 0@P喉ЍLU勉L@1O-=Mm @P=ЍO"h*P _ 1$!0 1$!j0=<@0@0@0S S I 1$!0 1$!T<P<0 0 0 G<0 <   <<P$0 0 0 0S{P@0@S 0 0 0 @AT 0$ 0 0$ 0TZPP< 0S0 0 0 |;`( "$`$"",R a(!"4a4##<S3 <1, @000@S SɈ0 0 0 ~3 :0S  P!448#8T守(0, 0 (0, c<(S塈0 0 0 V Q0(0 CY< <0;00 ,000P 0<P 0<0}1!0 1!20SP<G <0 0001S0_0 RP0< 0T 00000Ss <0 @p0(P0$400010C00ST^ 80S@W 0|PPQ  |0<0Z Z@ 0S@/00 0SRQDZ Z 0 0C0PZ Z X9c!>570Sq $0S @E0S[@@D 0\0Q$Xp0P0$0mZ-@0 0և0 0 0 X 0R*+[ 0 4$0$P  Pc0K#10$0  0%0$0@K@ \?cZ|XP \P \0 0,c |000@@@T@ @ Xb!>5(0S0SY[ 0R: \c|X-0P0\|P@ K b |n0000(0DYY00C $R+YYY0 #"  02R0N -0IS  S6 SMD @D4a000 |\b!>70 0S,400傜လ0P ᝜0S ᘜ0 b ᐜ000 |3b!>70 0S  bW|v0P0 t@E@F@pT \30S@CA@$@ 0<P`j0301H0H0S 0CS# 2P0P0SD0C ND 00SJ Py嬆X0\ 0 X0\ a U T  X     [ #X0L0L0Q  R UF hUC `U@ XU= Q: H0T0T0S D0CS@p010S _X0\ 0 X0\ j< 0<S 0 0wIX0\ 0 X0\ Th,00 S 000S < P<0S 0 00010 p0t 0 p0t +, 0 P0L01# 0<3/||1HH]]O- LM j@P`pp8 lh8 (p000`,P$@ @@ @+(' 8 (p0@04`0@,P$@ @@ @(4 0 07(p008`0@,P$@@ @P( 0 07 (p008`4P0@,P$@@ @P'0 0@7 4(p008`0@,P$@@ @P'0 064 06(p008`0@,P$@ @P'0400 06 (p008`0@,P$@@ @P'0400 0L6 (p008`0@,P$@@ @P' 040 0 05 (p008`0@,P$@@ @P' 0405 05(p008`0@,P$@ @Pp' 040h5\ 0\5(p008`0@,P$@ @PZ' 0405 05(p008`0@,P$@ @PE'44 04 (p008`0@,P$@ @P/'040|4X 0p4(p008`0@,P$@ @P'040 0 04(p008`0@,P$@@ @P'0@ 040$0 03 (p008`0@,P$@@ @P&040p3 0h3(p008`0@,P$@@ @P&040$303 0<(p008`0@,P$@ @ @&0402 02(p008`0@,P$@@ @P& (p||24  0pD08`0@,P$@ @@ @&,2($0 200pD ,` @ @}&p1$01D 00,`(p @ @i&1010D 0,`(p$@ @ @X& W\!\\0@S50@ T08!0@T. + 1d@RDŽ/0LЍ RPP CB! ,0F1H^_a^^^Ȳ^F̲^ֲ^^^̚DG^^F^Ț#^Ě.^9^H^R^|FD_dd^n^8G{^G^G^H]].К1@-@ @Y| A-p-@PP0S PP 0 0100`10a0 0 0F|] 0X *0F`FQ0C000  @-@0S 00 0 /@-P(0dp`LM @ @ 0 P@  0 P@PP"   0 (02,0(0P@ `"0  ````(e0 ((rLЍp@-0P@1 01  p@ 103!"/03" /P/0P7@- Ѝ0P @R R00P0S0l00S @-@ P3D8#8 ("(P "00 /Ἓ!> 000]2M0PЍ/D@P 00S H00p@-@`P@P  pA-@ PR`   P PRїpYP1P 000\ Q ]0 0!0;0] 0!@-`Q00pPg8'#TgT%%<)@P VP Ѝpel00100S 0CS W  @#RP @000A-@MPp  `X@P"0 R@00S'X@ ( +]G@P `P 00@ЍHP P9`XPS1@P P00pEA-PS@` pPl0 A/4@墁8!< 8!<孁1hP/A-p`0PPQPEU `f @ T T@ @U@  ]0PEpO-,0,M00@010 44`Q :$01 000 BpWSN0 0 0 Y}(P,Ѝ0000 000000#![@ 0C 0 (08#<400 00000@ ,0@0,0VP! *0C S  U R R0 0 0 7P 0 0 0 UP>PP R0 0 0 V7P`T p` @0P000010 0!00 0000S #000 0-0"> 00 000K1$ 08#80!$$ ("(Q:0ɱ pB "4400  8#< 400P 0( 000@ F`Pu0 0 0 倀0002,0@ ,00,0 008001HvO-QM00 0 p@ `G"448#80SP:0P0 P 00000TNC10@005x0| 0 x0| @Y ( ^[뀐$y[ 0S 0R  @Pn @Pi $PP$c |mp0 0 0 ` 00S00  QHLQ RH0P0H0 00@V*-PP 0 0C00 0000<@0\[(0@ 0(0T[ 00"44`8#<d`m0g0 0 0YP10t0P@ X`P [p0 0 0 3P p@0 000{0PT@pv0qSSq 0   R  X  [g0 0 0 r0 sR 0 V 0SS PP DpP Z`H0 0 0 S@0X 00` sR} )PPx3uvPpT @P H0S Y0 0 0 'AP@0D 0@040 D 0PW0X   p T @P HY`~0 p0 0 ~LjP H ~`0 AP0 0 ~p@LX`0HpD S 0@04PL` 0@00 0@0D  W0P020  #RD  3? 0S#lPP W~014!0 014!~1P80S l80$3/PP l0 0l XP/ 0S 0S)  PP$ 00SPP ,0   ,0 0,000  0$ (0S 3 VD~0 0 0 O~ sPXO 0Y W D 8Ѝ 0S80S X480$3/`P} X0 0 00S U ~0 0 0 iU6 3 \U}@1D!0 @1D!Z0  (U}@1D!0 @1D!} P @"44D 8#8Q0 %0%<#*T}@1D!0 @1D!}(P 0<00  0(DQ ,   40#0 @0A`V X0  "50 @000PP R c}1 !0 1 !}`P 0 0004X 4e`P03 <30S ,0@0,0 "44 8,P#8S J04[ 0R0  Q}0 0 0 {1P00,0  @ 0 ,0@0,0 3  420S 20S c ,00,0 0 $ 0  PZ3  10S 10S A ,00,0 PP  Q U$|0 0 0 |0U0 0 00  0$ P PW RT }N R  lPt03l l1`00l00|0 0 0 |X1P1H1`_]^C-Pp@p0M00S0TЍ0S  S` S0#03R0S0S 0 00000 000B00SQ QR W0 P R 000*A-PpU@(M \tPP7@4 000030P0 0CSJFKFKFKFLF  @P0S@ `0P #Rᡑ1@0S  2R`V\t`(Ѝ20ዑ0S0@0 @ 0 00S00 0 P@+ Q' 3S$` 0V V;@00 0 B ^ R `aP 0007@1@ 0@ 0S 0 P@` 0V1@ 1 0 `aR0C000 0R ^ Q ` -@Us@-0@ SP% S( S- T 0S000 @ Ѝp0S`;P 0P0@000ʐP00P 0  00O-,M00P`Sd@ |&Sp6P*,ЍP Pb00CS񟗋OFUFQFQFQFQFQFUF SF SF SF SF SFUFUFUFUFdSF$SFQFUFUFQFQFpRFQFQFhP 0h0[9  pP7`  V[`#0Z*[* `V'[%ZZV0 [V `F` ,R0 PV`hpd@(V CV`Jpd P00CSQFQFQFQFQFPFPFPFPFPFPFPFPFPFPFPFPFRFPFPFRFQFPFRF,RF00000 CR0ŕ0S@@0S@@0S@@0S@@0SKKM0 00+0 0p0)P20SJJ P0SJJ   P$0S 00 `$%Pỏ1P 00岏opPj  P0SS' @]S @Z ! PP0 CRyTFUF8TF8TF8TF8TF8TFTF\UF\UF\UF\UF\UFUFUFUFUF|UFlUF8TF8TFUF8TF8TFUF8TF8TFhP- 0 gP  0CSTFTFTFTFTFTFTFTFTFTFTFTFTFTFTFTFTFUFTFTFUFTFTFTFUF00 0000D600D1356 R R D0$00  0 np$j  0$*f p@-@PP `p0Sp@\OrPp@-@0x`S   !00C000C0PUp@ R0 0  吆G- PTpȀ`H@Tp@W< 00C@S@p0S00C0S0 'y@0D 0 @0D 2y @1!  1 0O-@pDMP!0l 0 00,@(p$  D 0!0 0 040,@(p$  10 400!X0_ 0'> 0 080,@(p$ P @DЍH^_a^ij^p@-@`M0P0@@ @0 dP ! <@@T 0200 R00C1 2"Ѝp@ӳ^($@- P?>@GA-@40"0R S  B! "2 2R$2S0p`P"0#Q00S qPP@UP#00C?o2PA$ěO-Mp0 # 44 8)#8!H'1  CRD4G3x0 0 0 FCY 0I0 Y V` "2000#?0AT1 0x0 4 0 4x `P 0.w0 0 0 x8 0S:Fw0 0 0 wЍP R\ \S @ p R  崑 T !A  Y"RRx$06@Pr       !<  0 0 1!     !0R @A4000S0`0 ``0 `Vx   Ru  !Rypw0 0 0 {w 0`}1p01W 0 !1Rp!AQ ڴ! Q"Ƞ,Ƞ B! R.10C100C06w80< 0 80< Aw g _$\ Q   p V! B!  B W[ R ` ``! R l0!`w @R  B   B  `  pW,0p0 8#< Რ0 00@0p0 0100 01C0T 0V(p,@`X v0 0 0 v0  0 > 0p0@p00[ ᲑIY ڴ!YN  Q !) A!ᴑ Rm? P0`R Qa sv0 0 0 ~v%1-//-/-/@-@-@-p00d0@ ` P  d0 (00  0 ( 0 P( fP b Ѝ1M  { @-vܳ^@-r^;p@-@P0S 0S 0Pp0Pp*` P p$!>C-@pPM0 0@@ 0 0" A"440T1`V T+ 0p Ѝ0S0S S0S  S0S S T 9P 0 _@`, 0  02# |0R0@l@ uh0l 0 h0p0l t 0Sp0 t u$H]]cF1-/ 0!< 04 0 (   !/(,T0M000S ~S 0S/0S001Ѝ/ \ P/0 !8 0 0 (  , !/(,0@-S@)@p0`000S ~S 0S/@P0P d0  0S ៊1@0ᘊ0@0 Ѝ A-@pP`@P oA-@P@`@pf Y|$p@-P`@Kpp@-P`v@?pp@-@`jP 0001pp@-P\@ &pO-@`p\!DM 0 ( a0,$  @P0 00( 0 a4,$  @P 4 p 0 h (d  00 0 a8,$ P DЍOHH^>_G^$G-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 H_]0E$@-p`( PSQ M $ @p :OP0 aWP 1Ud (0F0S*0 #R7H L R3QH0 P0H0 00BS(0 B 00T7P 0(00(00 !$$    h 00` 08 XPЍ @S>SB 0 #RH L R    @P P 0 (Q&(",$ !$$ 0S(0DS 00 0 0XP0 0ts0 0 0 s(PT PH1G-p@P`W1  @P  05W@9@00008@V nU js@-a0SP@ 0RPd0C500 P0  0P Rd  ++d ЍpS Ѝp@P P0S0Pd Q  0Sd00 00  0`( "4`#/@- "44!0"441@- ^N Ѝ 0<P   /  k,꼞(G0M/ X1M/ p@-@Pp`8`tPPp0S:p@i 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,@-@0:0@@-@0 :0@@-0 00   00vЍ^Pp@-P x@pPp@-P@ yp@PO- MQ( @ '    PUS   RK0 00 00 0R010 0! R010Q0;SPU 1 R00 1`? 0`R00 0R010 00C 001 1 iЍ HRPU  R  00 000 p0`0P R" 000 0 0 R00 0R010 Wp 00C 0 MRJC\ C^B&\\Sgq! ! !$ !$lq 0 W #`^q\ R  @C   0 0 000 Sk0 000> 0R00 0R010 Wp 00C 0 2Q02 q81<081@1<D 0@1[D (!, (!0!,4 0!4p000SD0S0p0pp0 0P0 0  0 0 0 H 0030CS  UWPpPPPp1 !0 1 !p W`0000S0p0pp0>G- P@$p`x0PHA p0 0 0 p,  Q Q Q R00P Pp8 #<4 ,(8 ( #80#8S S 3 00S  0PY Y,0 Q Q 0@ (00S  0GiO-@PDMppDUXDЍ`0V V X `XV0CS{F|F<}Fx}F{F{F|FV  0 ;S0000 "440HPV 0 ;S0@000Sg1h0 0#2S S . (<. Zg!0g. t V0 0HK AK 0 ;S0<00h10l1V 0 ;S800S0 <00 j^ ^@-@00CS R  a``  B BnI00C0@0CT市:^p@-La@PVo80< 0 < 80aoP!R? 11c R P!T!S0cB1C0S0T100S 00S 0 P1R0`1S *01Pa0XPP!UP1H1;T1N1C1UP1U0P000p2P11T1`XhPO-CM0M00n0 0 0 o X!J0 <H060`0SP%0%* h0nP h0 QP%* +PU n1!0 1!nCߍ  9PP0P 0#2S S0 00S P0#dd0h&h`F0T00$0040 0#21V,000, R0S% n1!0 1!n0S 0S0S0S 0S 0(``F 0T00$0(0, R`F 00 RP0 , 0P 0,  QxPPUy ,00C<0080<0 S  0SlX:P  0@0X0b\_8@`,0 @ 00$`0P00n@@$0SS S 6Y; 0S Q[:@(pT +RT  Dd!S d0`) hP ,0h00 h00u  hI I$0S S' 00SQ 0H  h[ <0800 0000 P0xm1!0 1!m $P0 hpf~f0 00h00nPxt8m1!017 !m 0 tpPb0^sm1!0 1!~m,70S 00SZh"    "44!$$8("( #8 h6 P   t0 0000p0 0 {nP \6m1!01@6 !)m 0 (pP0 m1!0 1!m50S 00SZh . Vq .Rq "44!$$8(,"( #8 . K. G0 @ 0p @pGW4 00P @@ă "@ēpGV097St@l! ! !$ !$l0pH00`F001W00C @ģ1V, (tlX1\!0 X1\!lp]~ 000p0fS  0Rjwl(!, (!0!,4 0!4|l00IY-Xs^lH1L!0 H1L!ilTlel 0 0CS0S% 0R!Bl`1d!`i0 `1d!Ll0 @H0  0R6aH0S 00000``0 b91 P0@0@0` `0`04 S0wP 0 3SH L0SP0\ 0 -P 40004 V<  0CS00S0 0040TG!>6 l 9&0009hp0060L^ hPc^ܛX^^^HPțH?00S= 0: 0 h*pP2 w  @T, d13 0x00D1;Sڬ0`1+%80S#0  0$  70T00S S070 1EkP2T"0 P2T"01Ok0@ 0!0CS103/X\( `0S(0 1( 000Cp!0C(0( 1R ( ^00S\ h!\00CSz  !0QSQ@ p  Ql0Qh\ t0CS`20l1\0h1V0CQVCPS4! RO:+RL( R0C HQ L!0CS20Cq``Fj1x!0| x!!| 1!j1!0CS0X110C10    BR901!Va0 BR1011 01Rh]$0S $0SX40S 0hP 00      0 @ 0@oP DVj1!0 1!aj 0LoECj1!0 1!NjX0000< 08P_x5*jX2\"0 X2\"86$P50#Q0S~ LLR Q0L A0CS0Vk@08 !$!01i1!0 10! 00 0 00/ i?0S00 `0S !+0  @1  ~/ ;SS SSS000 10 1;0CS4Fe 0 10101\1S01\15 0$! CR$1 0C0 !0CST01@01*`10`1!8#8R0  @0z !$10BS$!@@0 0P00 0P0;Z0 [ ; S1 $0S1100S 0S$10 0;n@11t11h0 4P 000000```oWP z 0R$0S S- $4RX00<0 08000h P V. 8țPH@-0  0'S(P L@Md1!0 1!Xd$0 gM; 0`( "4`#/ 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,@-@0:0@p@-PAT1PD1AP \DwX1+8T@1D01@ xSx0 S 0; S0Ҳ;p̴^`]PO-0M@S0 S/`̠Z4 ?(0S S<` P`p(` +P P(p !R `0d  SP3P# RPPUOfC  )0S 0S0S ᥏ HXڼ; 0CS0!0; 0CS0!WD0 0 0R0100`VʰlV 4F00P4%4158|F00P8%8150<01H00L00S8%0P`0S p`-`&P0%T00S 0 0C1!04!R4!4180P0D00X00@00T0PP0P0 :0!0P$0  10S|!  0  0B 00  00!0CSp0aJ41l,dpV`!; u ;SvdPn !41dPRPePe 0_BQ\ CRa@PP1 C QP@U0000S VP`0 Sȃ0SR0P J ;SGP P@0 PE 3UDڠ!410d 0C 0C?SPȳ0S! 0  0 !R: !B\: \*  B \  Q!XP0;0 0U#00S P U1E P 0U00000<00S 0  00CsC Q1S A0CR0U,0 0U 1  H0L S 0 0S*0S\1U*0!00C ?,0Se|9, 0S 1,1 0C?SR\0BX RڃQ0``! BR  010CSPP8P80ЍHP30 @&QR P0S0S0S0s  hm=1ShPP11SHH0a8c`x80Px H0q8'ypqH0L S7D!00C Sz:47P0 RP 7P0STP 41R !00S01V@`@`]0x0 00$0t BRP1 P8D0;V PF03 PE UVP50k80rPcP0<000000SQ `PM8\PI LE0S(0 S<0080ph0 R[ YP  T 4 1`P0H7  0 ph + ip"jk   @ f1ppl40S 0   p l `0S `(VA00 00d4 pp1pGh@1S1 @qp$0S+ 1(00` R:(  (P4A`|q   $0p0C$0{x |qq$0S(04p- p)W&5`0SP@P0 0"M0 $00C$0\ K\  C p00:v80U0402 l`00S0U0S- 0 0 0 P2o``P 824 00S<07aG`024"0 024"R`" `p)W00/0CS202000000 000000 ,!0Z 00400 1S ! Z101 0弡1QQ0- 3SH L0SP0\ 0$0&PH?s0SA010_](Gݴ^^_]^P`]H<  0CU4 00 ?0000 Z 0 SM S0(0$0L0$ (0(0G0 )PP_0 0 0 0 0_`P@ 04 00S0 P1 0 0 0 1 0CS0 0 0 0 0 0 0( $00Qr 8R0r8 \0:+\0R ," R   !BRĠ# U 0 BRU RZ 80$_X"\ X"\._80 (  倀@ % 8080   8080W  h:80 !   D,"!R Pe! Q, @P,Q(",$("( R" "! BR ! R !!$!  Rg Rp 0S000S00!0 CR001H1S4tL0H1^004 0 004 ^pP 0R 0!R R` 8P W0;,50D40p0(pSV S /`p% !1N   80)80Y880rP800 0 0 R 0 40< ,0 00 Q 040<,  x'|t!x'xpW|GpGqv8HPu 00!0 CR01ůU0S 88P[(8#<t$0p(p0S(0$ 000 0!0ShR0+00P P`2 7P 2P @0@SQ;SN>`Se$00( 00Se(0 (0( 000 0S0P 01 XSq5]0 0 0 0 @0D 0 @0D ],0S, 10,! CR,1 1t1000 00k<0S !8R @0`S`(`<`)0 00400@-1D @0C100C0 0R100  d蔞hA-@0p0!R蔀0 0RP`|,cP 1T010`00 0 R 01 @ @! 1蜞h@-0 00   00aЍ ^h0 /|10|1/O-4M I F SPPQPU>Q: Q6 @X1J0 H\-P|ap 8 80 c(#"$ c$"a8! #4 a4#CQ 0 CQBQPE`FPVpQ[4Ѝ Q A0 B^0"Ap10GS1qSA BPP q0p CR000AS0 0PP 10CSQ0 CR00 P0CS0BS0P 0 CQ000 CR00U 0 GR HQ PHPGQPꘞp@-@0P DR@ѐQp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R ?i1M  0MX @p@-PUp@`.0P 4 ?"0Pp` d H Q1Q44!&010p@p@-PUp@`\0P 4 \X\0Pp` d H Q1Q44!\010p@@-0 2DX 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,@-@0  :0p@-T0@00SDP@bn `vT$3Sp0p@WHD^F@- @FA-0pS@ S P0S S0S0S0s0S0S0sT( PU  0R 00 PP 00(0 5 0R` R: 6P 06 00001 @  00(0p 0;00S0 000! 0 80SPTA*(V 0$ 0 0$ X 00!/XA-p`<PUAv@T P P (V0 0 0 (Vg0:0JP|X@-@01S001X0SlC-0`S,M"P00P0S@0@SLPP PR \10S UL 0 SpH ( 0R*T ,Ѝ 1 0T0!  00WP@ 00SP00S h00@ C3SR L0Lp 00 S00/f]hFL0Hb]0S,4! x!/@-@0M C1<01,0 00 0S0ЍhFb]h@-( (0 NЍFhP Q Q@\ \2SQ Q @00P1Q0 Q0(00S@080P1/G-@0SPp(p3aP`2Sa 0!QQd2S01封1S10S(pV`aP`2SP ̐ Pw7P>d2S01`o`y1S10;`BU p0t  0kV *F80 V1Gh"R l2S0vPp2S<0h2S l2S0_HPp2S<0P4c]p@-@PPpP1S#0S X @ (`R R X!!Ff`Pa 0 0< .X1TFS!P00p@Cz@-@|M0t2p S' `0PS Q Q  ]  Y  U  Q D M t0 02 |ЍTQ  FX@-0S6& ЍS6&h)^0b? S /A-P(p#0X`8@@ TL3K@D0S@D0S@DV x0|  0T@ D7X0 P1XVL 0   @T8A%815A0S0 S0(0 b/ R /0SA-0`S0MVPTPR 2q0@S0@?oR20S@[ P0@S PaQM M0000 0 P 0 0 0xUP" Q 20`0@S010@Sʲ0TpD#TT1X%XS 1P090d0Ѝ  10CSa0Tw00000090P2 W R. 0@S0$ 0p0Q0 0 #P00S @0G3WS .!>20 2 0 $0*<0 $D0W/H_]hFL0Ep@-0P@(S1 01  (p@SXA-8pP(`@S!0@@(ASX 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B 8 =0C=@-@P 0E;@0:z P@ H 0!R R   `]PFO-m0@SM S( / x`P t@$00#.0#A0@.H>@$00#|4 00 PU `0S l 3P  3PP%@-0@ 0@00 00@@hU$$00S@ Ѝh^P%O-@R@=`SpMnMm0S SR 0(68.0#p  "`0`m4 p\a 1  QᨁCP1!0 1!P @ ^00;m1 S 0 0Q!A`000@0@00=0=P1!0 1!P ЍO(68.0#t  " "1-0R:P101P 0 SH 0 A SS0!\ 0  %Ȟ@A-P`ATAAp@O-Q<LP0T 0 P0T LP!T1 1X!C1S01S01S000001S ;S L0 0 0 L01;S嗵P!T11T10P1000110H1;S0;0103/\|Fh`]Pp@-@Q0  p@>8P ;` S DP T1X B R*1C1S014cR :fLx0| 0 x0| qL<bXLX0\ 0 X0\ cLX00z00|О@-@aM幢0  Ѝ@`p?P HQ.L`0d 0 `0d 9L;S6S00 ( 1( 1S D  B0R#*Lh0l 0 h0l L0 0 B !  x01T01Kp0t 0 p0t K<|Pp@-@PQ0  p@苢`P 01; S !R D0D00CR:001||P@-T@#$HH 04004 000V@0]|xPHx0 R   R-  R   R   R-  R/  / b /ОPgfff@- @@0 H Gp@-@TPա0==09#9S p@ YP 000v|@-@8`@ 0S-//A-`@Q F.`pP!P+0B8#8S1; SQ0A?0R  0?!0PC-MP00`0p0 0` @|& P  0`  00 000 0@.?o2P0S R0 ЍO-pM 04@3R埵W X` 0 000 S K@DTp0X0 00P$020@3@T 0X2|p3J+0 S PP(0 0000UTP -0%0HL0$0S Sg 0 S030#Y0S -0g^P 3 ߍ(0 H L  P d T 1X0 0\00S0+0` d0V! 0C80(0 ,`(p 008P40$@@ @ 0!>4 ,`(p 008P0$@@ @md> 00!T> 0L>4p,`(p008P0$@ @W> 00!> ,`(p008P40$@@ @A"040= 00!= ,`(p008P0$@@ @+x= 00!d= 4,`(p008P0$@@ @(= 00!= ,`(p008P40$@@ @040< 00!< ,`(p008P0$@ @ 040< 00!t< ,`(p008P0$@@ @ 0!0< 0<4 ,`(p0@08P0$@ @@ @ 0!;0< ,`(p0L08P40$@ @@ @; 00!x;0<0L 0,P($@@ @ 0 !(;B0 ;L$ 00,P( @ @z 040: 00l!: ,`(p008P0$@ @c: 00 !:4 ,`(p008P0$@ @L040@: 00!0: ,`(p008P0$@@ @60409 00!9 ,`(p008P0$@@ @ 0409 00!9 ,`(p008P0$@@ @ 040P9 00D!@9 ,`(p008P0$@ @0409 00!8 ,`(p008P0$@ @0408 00!8 ,`(p008P0$@ @0 400!L8 0 <,`(p008P0$@ @@ @0408 00!7 ,`(p008P0$@@ @0407 00!7 ,`(p008P0$@@ @040`7 00!P7 ,`(p008P0$@@ @l0407 00x!6 ,`(p008P0$@ @U0 40D0!6 ,`(p$p008P0 @ @=040`6 00!P6 ,`(p008P0$@@ @'6 00!606 0<,`(p008P40$@ @5 00\!5 ,`(p008P40$@ @p5 00!`5 ,`(p008P40$@@ @$5 00!5 ,`(p008P40$@@ @4 00!4 ,`(p008P40$@@ @4 00!|4 ,`(p008P40$@@ @@4 00!04 ,`(p008P40$@@ @3 00!3 ,`(p008P40$@@ @z 0!300T 0a,P($@ @14 040 010 f1 SRBA@0 0 0 @0;0`1k 0@ Ӭ@P  A@P T0S7@S=0f1PG-PU@' p@`000S S@ @@P0S0S0s0 00 ᇬ@sA-PU@ `0pS 0S Q @@P Q 0@;Q ]@P p@-@T P\0`SM:pSu=pp@-@T PA0`S$0SI=pp0S p@-P(@5 p/A-0`SP@p0S9@@+0S ;2XR* 0RW 001000@0ռҼм7@A-`@pP000S S/@X=1D>4:^ 嚨@+|hG-`0M0@Pp0S6@ЍZ U U @%  @  /aYPx YpGW>G?GL?GPBG?G?G<@G@P0S0000W@P0S@+S; @PpW 2Wq @PpW 2Wq @PpW <2Wq @PpW 1WqpGWm@G@G0BGPBG8BG@BGHBGPBG@G00 0S;   ; 0= S00 000`0`S0e00d10200a0 000AID1P!@@2T!#3=P022l=T0814X0!\!1 l0 1p`|00t00 ` x0200002020K1111*@*PL@-;@SS'8#8ST? S0 T9 ;S0(P ; SQ 00?00;w@0; S0P 0PH00 B P (00 9 P @P;SNp@-0@(P0 Qp@4@P p0S p@-P(@ p/0S/p@-P@p@p@-0S@ `@ Pj@P @pO-QMp Ѝ 0S S1`11@11`11@1P 0` %0 0 00  00P 00 0 00?o2P0S0S* BR񟗽HFGhFGDGDGDGDGFGFGDGDGDGDGDGDGDGDGDGDGHFGhFGFGFG S  S R| V`S0 0SPP/CjRP#US@@Ӗ/CjR@#Tthpl̚ȚĚ@- @ g_H^*^/^p@-@\41P!4 P301108480pp@-@\41P! 00P300x1084Q80pp@-@04Q8!0 S 0U0C:x!0S30C x15x1%d!d02S414pL R 0!QP!U:0ꤞ;S/0p@-HPH`0D0@Tpw 0S w @p^A-p@`{Pj0Hq < \  41+ !  41,812#4100FS`؛p@-@PUp@  BR +/A-;@S0;)`@Q80;p4Q$0H 0 @hPPP 00!0C,2#41000eЍA4]04Q0GS0pP0PE<P4Q0!81 BR<10041,000x10   10BS!;S0;/814!R41,000x10 / 10BS!/O-4!81`R$Mz;SwPAB@s 0!qȁ?A3c 2#!0C!0#Q!40Y41:8 0%Q%Q$ UP!U03(0#02 0 \+1!ƒ  0k0 SP0 @PD0Q#_@Qe G 44!0 0$ЍOMb̫gfff0@-M@ 0 \?A3c 2#!114S 1100110%151S1%Q51S0!1 aP301108480Ѝ0Mb@-@<41000x1080p@-0!@0CSPp@v0;pA-`p@᐀PUT Vt0x0S 0S R00 嚇=P@`PpG-p@PQP_o0RP`VU 1RPW Pp00S T \:Y 0L0C 001 00 0o$ x`pA-`p@T!P @00PP0UP@p@-D@DP <4( p@`]5^8^=^(00S/!Q  B /( 0P/ R/ 0 P73C/0Q@@/-@ "  " " " " " "    /@-@Q  088700 @0000C0%0 / P/%0$0 0Q: QA@/ 0Q: QA//ᣋ.@-%0 $ r.13S@@T0 0S 0S3X Q0$  @XR5/p@-@`P@ VU2 %0%00( c&$00$0D0403$ 238P<`2%0 00$0%0$ 0 00$0%0$ 0 00$0 0400,0000(0(0$pA-l@Pp`$ $0S 0 p0V00$0000 0 0p@-P@@ UT0* % %  (R%$   $ 8 $ 4  #"#8@@-@0S 0S <؛P0 0  0 .P -/ 0!< 04 0 (   !/(,A-@,p`Pᖅ10 00S S S ,00S  (0",$( "(x0P p@(00 0 0 (0i3 ,0 0S 0 P\ P/0 !8 0 0 (  , !/(,A-@P@`@p彆%ap|A-@pP` ᕜ@P[A-@`pP W@Lp@-P@Bpp@-P`@@6pp@-P`@&*pp@-@`P101H 000Ip1S/v,uG 0O-@P`DM!2 0 0 0`,@(P$   0p!t2 0 0 4`0p,@(P$  40 0 00'!2 0 08`0p,@(P$ @0 0 0!1 0 08`4@0p,@(P$ @0400 0 0!l1 0 08`0p,@(P$ @ 0!$1  0 08`4P0p,@(P$ @0400 00!0 00 0 08`0p,@(P$ { 0!x0 0p0 0 08`40p,@(P$ eDЍO9H^X^\^v^^R^G^4vGD_-^0 ^ \  H  z C-DlM (p.0 0 0 (. 0SP * 00hP 00 QP%P *p$BU (.0 0 0 (.lЍ  3P P 0S "dd!44h8&hV#8(.0 0 0 (. P ̫S AR0S   P  !>! 12  0 $00S ( , I`PUh P 0XP  L0P L0 QP%P :U 00VS| 0 8 Ⰳ''0 L3u T⼄'04p 0L 0xp 0(P\k *.(0, 0 (0, $P2!0$0PP4(.80< 0 80< (."$X-PP$`0S&2R0S $ S0S  S &1R (0  (0`0u Pqt`V x00( 0 6/p` Pd 0 0R: (0 `W - 0$ 0 0$ (- 0 Pܡ PL^@-0S0SP0!0@SP R \\0 00 00ڕЍ 00H_]wG0EA-0`0P@ Xp X/@0S  RO0S  -@ЍV0dS*@P@P0S S @d0# 1# 0# 0 0d `X<4ȚĚ̚plthC-0PS`p,tM S+ '@!0!3 $$(000 0"(PT00d 00   0(0  0Q5PtЍ!0!0(@0 0 000#0%( "(0$p (ޔPT0d0 0 0   0 Q_5o 8*080G-pM000 `P%00S'0A0@@DH$H0P'}0P0P PX%XRP PЍJ *Z`C-`M00p0 PPA0@@DH'$H000 #P 000Ѝ' 0@DH0$HTPA-`M00p0 PPA0@@DHq'$H000 P0 00Ѝ!@DH R Ƞ$H,ȠTPC-`M00p0 jPPA0@@DH$H ᰑ0QY!0I0 P Ѝ@DH$HT#P0@-@|M&' PU U   "  0 0   |Ѝ0     `    O-MPa0@p (0` 0 00 0000X@h0 00poᨂPX0 OpP H峀4pPЍXpa]|@-0@S S 6S 0S0l00l06S   P8b]O-p$M000 `P2P`- ؀6S@`Ph&@TA1@@D?H;$H0 & 0 Q PX %X& P 0 P$Ѝ0C8#8S`O-$M000 RpP$Pp A1@@DH0$H` ᰰ0 }Q PXᰰ%X P0 P$Ѝ`Fh&hVp@-0$@ `TPM Q Q@x@T@l !p  7/P0 #P 00@0 P00C0Ѝ,a]0 QQ$/@-40, ($ Ѝ,@-|Mp0@P`` H 0H * 00X 00 0000h|Ѝ08@-40, ($ Ѝ0@-|Mp0@P`` H 0H * 00X 00 00007|Ѝ0O-p0@P`ᤠ夰M0倐` -X `  &X 0` R1  01` 0 1 0100PЍa]^C-`@ 0R0%0 * 0 +PH Ѝ 0Q0%0 *$;S p0pQqS  0P  0R@@T PE0S& U  R @a(0 0 0 l(ᐥSPEUp 0I  07pL^(Y<8 @-8 <(@<D0 L0B0 !00C00XG-P@`(pTG 0 0 0Z 0  5$ @ ?0 D @  q~0X@1O-PTM000 S@  p * ,0{Px},0 Qp%p *`5;W P8<8400 004,L0P 0L0` `"44R8#8 0 i00 0  0 0 V |1 000{x'0 0 0 'V |1 x0|0x0| !44,8##8G~'h0l 0 h0l 'V |1 000 0  ApTЍ}6 6RQd*0 d@@0 00 $0L6T?D& QRR* L  @PK &< @ 8 <@@@ @@00x000(00@00D00H000[(0I@000@0S 0 00 0ST} 06i Q  P $(0P03 8@[ $PB}V |1 000D& 0$ 0 0$ &50 0(0$0T  @00 0S0$0 0 0 0 0$00  0C 000000000P#40 000000S0 0 R0T Q   BR$_T    BR 0 0  "000D00D0 0T 0 0SP 0pp 0 0T$ 300I 0SI!:_ R @ } 0 0 0 000SѠ$ p+ᴰ0p(00pYJ  &00000C0@0TF(0: 0R0% * 00☥PP 0 0R:P @p%h0l 0 h0l %V |1 000庡||0P 0r ޡP{ 㗟  @0H0 S L^X(Y@1̟0X8XП@-) @0PЍA-`P"| |@@Tp!p@ 0RD0SP|AM|00C08@<00S %(0, 0 (0, %<PTx%004 0 004 %DA|0X@1(YП 0 /0Xp@-`f|PpT@TP`@0Sp@4|S% 0$ 0 0$ ^%@@10X(Yp@-,@,P{0S 00p@{|0X 0`( "4`#/P/:P/ zp@-@P:z@P:p@-40 R@  000 M ႞ GЍ@-40@ R  000 6 ֟k 0ЍX0 0&C-@MP`Z{ 0` pp0 P 00 000P 0 !?o2PPPU@ @T@@dp`V T<l{Ѝ@T ᵟ@14-$M840, (  0 W$ЍX1M/ ܸA-@Qp`{PWP۝0d 0T00 p` P @ #RH LQP@\@V !`VQ  h@VTI L@D .PVp.WWTpL>W AN^ pApGW0N ^  p 0A0CS00L-\ S CPALX 0 0QNV.Q TR0 B <ǁ@-`P@M 8p.D( .h`?( .;( `p0p5Ѝ葷^0@-ASS0CSꔭGGGSh #B -QGG(GLGpG#A 0 0 0 B#A 0 0 0"#A 0 0 0 0#A 0$ 0 0#A (0, 0 (0, #A 004 00 00 Q Qt#B 0 0 0 k#B 0 0 0 @t#Q Q QZ#B W#B T#B Q#B XO-PM'U@50S 505%0(000t5nU(UL p0( 㴜(E0/S0㉠@PE ( p:0(0)0p`\(0(K1P440P,0( HDP9 PPPH0 `,(PHU d40S .pP'L$TPp0#50/S0C@PЍ1PPO 0`00:0p0PP|13p000 0( :,PR0 <030S00P00PHP0 S |!  S |!  X "X H|!X,tGGG2xtPp0P7puPP 0`PP 7U`ꀀH  R X񟗉ԲGGG@GdGGGгGGG   Ru|1 000l 000d 000\ 000T|1 000K|1 000B|1 0009|11!0 1!0|10!  ! '|1 000|1 000|1 000 |1 000|1 000Рܷ^a]^^؟4O-M @0(PPwpPQ ,60S  60S 0E00U   R 50 00Sၡ  10SF  .$0  5Jx!0230+000 0UPS[<\\vL10SS0+wᦝ d|  0086lBύ00d0 pP ӛ弙tvD0Bύ1堖L^XРa],^n^^^P^^ѹ^^<^414GO-(PWMPEuP |1܏ 00U0  8$(0 8$( |1 0 00  0'S (QP 0 00400S0% p *  D0qP D0 Qp%p *-3W  FP00 p 0 : 0P(0 >0S 0@. P$(00L.0H@1(8,(0 (8,(@0mB?! !0S0: 0C R-=0S 0@. #0J. #200\-`10SZ00C S񟗞G G GGGGhGG(GGGGS GпGGTG0800S 0p004 R   0ОP 0 Q`:X x<0e@P8<P |1 000T6GGG`GȿG/U  8$(0 8$( :|1 000 |1 0040004|1 0$0T 0$^ T^ 8(0 8(|1 (0,0T(0, |1 80<0T80< 6PP P 0 R 0 3SH0L0S 0 /@P @Pԛ0 R0 0  H0$P H 0Q:00S U  88<(0 88 4<($$0 4 $$ Zr|1 @0D0@0DT U' |1R0p t p t Ξ@P   LPx | x |L|1 000U4084(0 084(V\80S UA U ᠞P 0@`S 0 * L0⪝P L0 Q:: 000S 7000e3@pPP40S00S- |3@Jr#U 0ST0PP 0 @@ 3S H0L RP@\0@0@D4@DThwN30 "44(8"(C80(0 0C$0pC0SS `A00CS00S S@ @ 00SW0WS@@ W 0bPP  d`P PPM `P`0S 00CSd5@@ 0SghGGGtGG85PPk @Th0Sf  0R0% * P0PY P0 Qo``VO 000W 0 P3 0SW@$00C ,0R:0   RR4 0$ p0C000 B$ , CR7 G0 R# \?R?^R$\ ^ 00CS7o R\,\0P< 80P< 80 0p0pG00S` 3@@@S 0000<$0 0 ?o2R0S $P@'`11,0T0T@To 000~OD900T,1@P2X00PXp 0WDpGW 0SK J u,1p8p W{`00S$0`S 8&P 008 0bP P P 0  0 00S PH0\0\pW DpG0 0 XL^Р b]x^^s| 8ǁ<ǁ,Yc](Y0001`0`@T ~OD@@`'`m@DЍ/^ʺ^(GD_1^G=^к^ں^^^^^ؠ^|+^%^44^B^РP^Z^U^1X Gp@-P @lqmh 0S Q0P@@@040p@mPmp@ 014LG-T@`0 0 0 0  0 0 0 X 'R 3SH0L0S(@PG  0  RV XV R R R R 0S 00) 0+P,0:S) 0R% * 0P 0 Q% *P)Q c 8$(0 8$(nЍ0 #0C?o231 pP+ (MQMa 0 #R(H L R$QH0 P0H0 00B/S00 B 000T\10S q?H!H\(0 0 0 [ 0Q@0( 0 (  /R0g@P  3SH0L0Sp r]p](` )0, 0`1 01  (xXL^PXРb]g^O-0p'S(,`($@P  P \ P \P  0 ЍO@ЍOܒЍ@-0  XC-0@p4MY@2`PPQ7P)$R$$kV 00SS*4ЍC2l0l 1`1 ?@P  \P  -4Ѝ*Ў@P 400   0 ⊔P (k@T>kpP XXᮎ@k ἐpkWT 40 Xpp`d 000U 03S H0$U0*`B 004 0 004 `Pdp03/@41GXO-`pDM"40SE PH4,$0$(PP30S  .0000#0H0U  ᅇHP `e1TS 0 P20S  .0000"0  0L00 M0[0tUP>D⿇P  &Pg ᵇ4 nD00X0002`  1jP0 r>Py d1S 0 dDP 1(0,0<,0,iP d` `0 81  p0>W* P0>1pU m G`LY  @^[d1S 0 d{H0U ņHPF;P $0S(PVx0yd [ꤟРHb]ɻ^ ^D^XЍYIXPXb]d^pb]8ǁ<ǁ@-p@`v0P p@L Ѝ@-@ db @Gdp@-dP@d0SA?C p@@:d!R1S A?CSP XX@-@D P0QQ  00S 0R  4Q DA-@p`"P@P I^"A-Pp"A``P@  `P U]"p0S AXp@-`DP@Tp0S  PUP $4RPD@A-@p`Y"P@P ]t"p@-0PS0S0S 0S, 0S00S% 7"A gP@S"p`00#d00#h00# l 00#7"pAIXp@-P"A`h8@PT#"p `xP0 "pA(@X 0 S 0#/00P/Qp@-@p@ HP 0!S p00k01pꑼ^$b]SRG-Mp4PQ@ $Q !BQ -P,    R: R7 RR3 RR/`V,Yd @4Ya 1CY0`9  $ P1PЍ@X$ (0S,0S0 $Pp H. 8H Y0X0 0\00S d zY 0t0 0x0 $Yh00^00008 900P 09*  `F $K$0 0$0 (0$0(0 ,00,0 000 00P!D3P`1P!!Y  $0S D!Z  R0 $00 000 000 00 0HP1XY p H 8 X H/ d d 00 08 t0 X RPP#0  QP P Zu00 dP^iikii O-p9PQ@`M #8Q 6C0CQ 5CojuPiku( iJi(i? i i Ni0Kiǯ> ~$niji ߖ>> i i %i ixˀQi Ti >!i O-O낏D6pP@`dUT D* @QP6W@R@ Ѝ0S0 0SpDPN PT v0 `0 00`S`$4R@@00S0 0S@DR  4Q 긟80S/G-3`A0ASHMpDP@$$$THЍ00S/#Y0 000S'-cP# 0000S .` c  070 00rFUPXD@0㬒PРb]^@-@@@G-HM`Yp3DPc@耟萟蠟T LQ|1S  00 0HЍ00S!X9G00S .`  00000bPXD0@Рb]^@-@|1@YlQAp@-P` ]@P@ VP @pp@-`SPSS:M k0@0L0`0D00@0 0<0(080,040D00040,000k@pGGLGGGpGGGp@-P@)l0@`0]3;]SS Mp@S|0008C00 0/p@- P@E!>00000p0 @-@7     @-@ M Ѝp@-@hSPSPp@-@0Q$MG 'R`l P'RX%("($( t S 0Sp*00S-0000010S00S"!10!0!0!0!0 0$Ѝ@ S000CS0pS000CS1^C^A-`@P200SD0CSpW"Op/o"\ R\ Q  ^ SPR `P H000S D0C40GS SV`##S@ &S0F0 P   P V 0 #   o`ЍGS S %SV000 00 00 00 00 00000V0S  "0000T\QRI p@-`@M 0 C^.^ P?R1 D 000 C0PU'X X X& X"XI `0 0<000< LP`ЍpA ER PPC/C-40@SOM p S|1 0 0 0|1 00 0Oߍ R@D  Q *40S $0OߍCS S #3R t40S h$l0|1 0 0; HT, 3`P2 | ⸮4Bύa`a`001411 0``1}P t30S 0t#tU|10 0(0 ST#212L PP `7 s2P<2034P09zP 20S 0" WT iPOX20S p0h"lp ,20S 0008"@000000 00000000 KP1B110 0141P /P d10S 0!#2) p\10$0$PU! X ``׽(1(` `< <0@ 0000 0S 0 1(0(P~_EU T P0 <00S P0L xPuLWUРDc]m^^4c]b]Qc]̽^gc] ^9^ɾ^b]pc]^?^ 8ǁ<ǁ^c^@-@ SG4 @ 8G0O-,00(p S@(M s@P 0<Sk@P 0R 0 04a(!#2"$a$"1  0`P 0 K8p#<40h8( #T0hT%S@ 00S 0 0000000 0S/00S 1 10<000 p0%X00#8S 000S QPd01@ R S 0S0S0S d0QP 00T  @P 0P0Ѝܠ8b]p@-0 MS P Ѝp@8`<P 0S$ 0R zzPPzPP0S0S0s!.0P,zPzP PS0S 0 @@8zO-pPMHhᰤX$ &h*D $ 0 0 H+0!  D! # " H0,&$$$H( "( 0 ATX $ R  0 8/Ѝ R5&R2& R/ R R R R#  9P R R R R  'P 0 Sr 0[sd   @0O-M0 00S PЍ0`S0S/P0S' 0@S(00S 00x4pDPP 0S 0S0sd0 0S0S0S0S090s 0S0S0s X3#21208S" 00$`0D `0 0 X0Pp`0Q0W0S `DP R 0S0s`V t!>7l0吠 x0(0t 000bpP 0S10 0 P`0 @4`8`c3 N4`Qz SDSR 0,%S 0S0S0S0 0`pPe0b0S0S 0sS0SQH 56l0S (0t00L0|0 t7P -g 00000SP 46c(#"c 0 V Q 5 0S10 0q rP P1P0PܠO-hp&h &TT$M 0X ' "%X " A  T0zS) PAQTI$Ѝ R R d  &R&R Rzd   0P 0C @ 018E 0AT 0S0S d0 6S 6Sd0  dP @0S0S d0 6S 6S Z d0  HP @0S 0S   0S0@@c]0S/ 0@-S0S   Q Q> (0# ,0# 0#.$$ ("(0  !R   0 1(0# ,0# 0#.$$("(0 0 (0# ,0# 0#.$$("(0 0 10)0# F0# ,0#.$$$("(. 0  " " "0  !R   0 1)0# F0# ,0#.$$$("(. 0  " " "0 0 )0# F0# ,0#.$$$("(. 0  " " "C-0@SPM0S0s  0 0i!0# Ѝ0:0haPP U,\PMQPJHU"PPpW\PQÅUp50\S0CT* S 5 A%CQÅQpÅpRQP'rpÅ0W0pRSpp5U0Y0pRS'p5U0Y0pRSpp5U0Y0SP:0e^E]p@-@08M S8Ѝp@yP`.t "448 #800 8Ѝpo^ 0 /xEj@@- @(TF_ ED;>A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00XG-PQ Mp@( Z% 0S B/``0d 0 `0d @@ ЍP 0v@P; 4``( H.P# P0S 0S0s  g 0 v@P.UA`/00AVX H0S |1 X0\0X0\1vAv@PA`O0 0 0 ZU` `0S  TR H0R SX |1 X0\0X0\u(YO-7M#p帠21(20HP00DlPS0 00ZXS$ 0S! P O`P``l0D 6PP l0 H0WOl `40PB AP3PDlu0\00C?o20S O`PP 0S 0`0SZ 0@TV 0S0S0S 0SJ  l$6tpV6l/LP*.1PL0 V XIP wNl0 L0 `ER @PP 0S dN`5(#2!12ЍPP0`S`W 0S0S0S 0S PV 0 y@PP00$04 0@00p@@00TAODTW9 < H [@P?<0$ R;l`03t 00x0S- 8 lC@P' 4 l=@P!8 40R030S ` HPp`p 0s 0@0P1D0D@T AODW 0SHD? A? 00CS 0  0CSY 00@S00@S 0  0S0s 0s Š0@0P S껠0@0P0s 0@0P0s 0@0P 0R*S0S0<0s0 X 0<< R<R R | r@! Q RwSR R QRi  #  R_ H,0P,0WY  0>0 S0XMX HpAR 00SP^bXtP P/Q|1 00/؟p@-@PL0@ 8Ps P H@spp@؟p@-d0,`P( 0 0@M 0  0"` `P P!fPP d03d010!"446Ѝp(0 @-HL H  < XC-騁M@t`W0ʀ 0! $t!0 l!d!  , !Q#PTPV  R0S  0T@ @ @H@T0 SPPPPPU 0 0! t0 |  , !ЍQ H0R:H a P0H000H00@(,X10SR@-LMPH <0sLЍ$P0 p R0 $1aUH@T  P ,$P" @TPCPH @L00PLP PP ,$P @-/0U0L0 ꔊmuHX0-C- 9)0 9)|1 0000 0 0  0N H>(   m RJ0 0 0 |1 0 00 0_D|9)0 9)R @ p=02F?! !2S`2]8(0 8(U8(0 8(0'S(l0`Q A0 0 0 L|1 0 00 1Q QP P$P P \| Q\ |0 0 0 |1 0$0 0$ 5ly0'S(YlP _ 0 p00! !0(  lP <,0 <, 0p M6P 0 0 0 ?6 P 5 P50P0:0S1|1 000PD:`V P `0 0 0 @0D 0 @0D |1 80<080< Rj99LD00H00 \0 $0Dj$0`SB `pP0T 0 P0T  0S |1 @0D0@0DV zh`hh0S   S 9)0 9)L 0( (0R0 0 0 |1 0040004p+TX |1 0 00 a0 0 0 ,TV`, 00@ ! 0(3/ P@P  PP(QQ Q$`00  ,ZP P!<,0 <,&PQ |1(YH 1Рe]^L^ğc]O-p(0P` @M y@00`Sd0  |h32. 0)0BP@d0 0/ 0)05P@d0 0 1b"!4b4##:0= )0"P@d0& 0 R"(`P A0 0 0 ЍO00Q h)01 P@hd0? (0Z +0JS7 33 `P 3Z0 S3Z Z +Z ЍOh<Zd0)02   hd0 )03 ᶃP@Ѝ(YR/A- M 0(P`0 2pP)0,  ᖃ@P 0 ᄀP[h Ѝ1M  s@-(Q0 'QPttip`0(@TD Ѝ0 d,W0 03W0011p@e]0^@-`P,MDp05(0PS3R!(RR S: 0 VdW0000;) B R꼐H H0S; [( . L. 0 0;00a|;<3 0&&'0 x000C0吰[PU[g0Q@Uw1P< 7@0Q0  2b 1 P" $P|;<3x0S00C0xP |@@;<@30 &&'xPP`10 @\ |Av@P|L$@(0@$,0@$00@$T0@$X0@$@$@$`1@A1QqU}1@c $EP $T?@P0S! pP|v@PL|0St 5G@E @C-@A0@?o;<3K2000x0ZPpHb_d^8b]1iq^^A-`0S@Pp唀0 S 0x̀ R 0 S030SVPQ R PU xb4ZO-` MR0Ѝ0@S000CS0 B S6 0S30S00S-Uu@0D 0 @0D t5 PŋU0 .  .P@P  8@P0 p0 T0# 0# 0# 0# 0# 0#$ 0#015 %0 5 %X5%x0 50%$%0 0$%/PK c`P 0C GP $AP0S 0'S 0 3SH0L0S(``P 00# 0# 0# 0# 0# 0#$ 0#0010 0X /P /Y`7706 P $0P R0( bP /9` 2XTP00lh0dS lS5 /%` /000 002 08#8Q XdQ  lQ0 P Ph5l%0 h5l%<0 0 @0 0DQ5% 0 % 5ܽ 0@$0x00 000030Q10吠@0@`0Q0 D   00 D/_ 0 P ЍO(Yȟ_^^0Z@_xb^O-B0`0N0 0 0 Y(ppGW ?0 0 0 Jn_"/W0 0RPP 0aP 0 RPPw0 0 0 $ ЍU 0  R 0 0 0 0S00 gP 0 0 0  [@ 0$ 0 0$  0R*`-/W0 0 0 (0, 0 (0, 00`S 0S 00 =a@P{ w[0<< 0H@  #0ZL^xb,f]03" /A-0@(S`pZPP^7[([( 0(0C00(00@ @@A-0@0t0Pt00`0x0x0|0|00S -PN 000S -P@  ݼ80S ppq-P81  8μ<0S ppq-P<"  <忼p0S ppq-Pp  p尼@Pppq-P@  @塼P -P -8P -<P -pP -@P -7A-`pPZ@P UHZ0[7VP  j@-l 0/G- @XPp ``P @<,0 <,]|10 0 ]2`3 0  G(Y7@-0@ Q)R*SP SFrP 0sS :R0S Ѝ000:Ssq@- @♻00t0x0|0qp@-``.Q00S@P P ,00/U00S00=U00S0t00U00S %\P ,001U00S 8P ,080#U00S <P ,0<03U00S @P ,0H@0[2U`VppP ,0p0pA-p@`0 ,0P(4# G Rğ)R&PHHHHHHHHHHHXHxHؽHȾHPHHHHHHHHHHHH0H`HT @Ѝ R  R  R  R R @T. Q00S 0S0S0S 0S0S @4P)@&0S  *,P7@ST  Q @T0t0@T0  R0 000 0 00?P@T0x T0T R/@S0S 0S0S0S{ 0Sx 2%@Ps0+P  κf0 000 0 00pPT1= TU 00TQ1+P8  ᭺@D0 000 0 000PT T3 T၁.#W<@ 2W@p@y+Pc  XT3T0@ST@@x0 T Q0 R000TT0 R|0L*@ܠ@-@0PS`pM>+P7 J0ES* ,0 00000(000Ѝp@-P`!+@P / $P 3+@p@-@P+@(+G-hMP pሠ1p@P0S( 0`$0 @@@0 0=P @ P &4P@9hЍRsZ 0S @( @{0 ,0" r!.$  ,00( $@*ZP@@Z`P H0 3@Y@ZZ 0(<$0G-pH pMS@P  )S *@ `FVP P @pb@pЍpaP[ P @00F<S4HHHHHHHHHHHHH4HHHHHHHHHH4HH4HHHHHH8H4H4H4HHHHH4HHH8H4H8H8H8H8HHHHHH4HHHHHHH4H0 000 0 00s@PZo@P9V,VV0  R0`FV񟗙`HH HHHHHHHPHHHHHHH 00`=0 0 0G@}c# !tct' q哴 (0@0(0000@SR ZF G0$ 3SH L0SP0\ 0<[ RP ;R0 V`0d 7`0 `0d t< 0CS00S 0000 0008#<40 0@ 00 <000S0  Z  0 000 00Q Z < 0Q Z +  @ (@ {3TH0@@0T \`0d 0 `0d f` P @0S 0S0S 0 00@0 P0 0 J-`@lU0S .P0 0 0 7"X0\ 0 X0\ -<Q0( J<<0X0 @0SH0<0t0S)0s0Sx1S49000@09000S" 00< D0,`PP:D0H0-!(     R  b> l8 4b:#00X 0Sx1S -P DP@U<S`P `0d 0 `0d p 0`000T00S |1 P0T0P0TD0S @ DL Q@ D PB'P tg`0d 0 `0d `?'0dp H Pb60+PW H0RStp H xPIt60pP> H0R:3_V]h d00l 0p 0U  e5Jύ.0)PC Ԑ@  Jύt0)oᩒY1 |50S .d j@53T%T1`00>9Xu`0d 0 `0d U |1 X0\0X0\Y1`PoPlD0 `S 4 R000<0R00p @ 0<01 S@<0SD 44Jύ$ 1T0 P08RP T`H00Y@  Yp33:$ R*X `d0D0S qR Y 0X x0S 0SX x0S0S L0(0@ 1P>LPpm0 @vD`P@0S~sd<,0 <,opU@ T0<<0 |1 0003SbE0 0 0 PT |1 X0\0X0\3`@P x1S 0S  @S0S 30SQ00SM 1 0R00S  @ P @=SD<Q<0PQ*[ *0UUߍT@Uec X ( ,0 < `` W` `0 0 0 (`S  R$  / P *$ PP0<10.6L^ԟРHf]^,ZH(YV W? R  S RF 0`0P @ $(  $@1,``0 3  00S 00S @ ,000,0 $00 p\S $aZ0 0 0 e` Y*`aK0 0 0 VTq |1 h0l0h0lh00S p0(000,pG1Y pppW@00(00S1 0  , @,00 #  `" R t20S @ ,000,0@8#8 0 0C40 0XT, |1 `0d0`0d#0S ,0R  0    0+NP@#Dc`0d 0 `0d 7`0 @0pQ@PWcp0t 0 p0t 0 0048900(0@0 ( $   $ (@0S0  TP 0Y    @P 80MP  80  0 0H8#<48Q#80¡0<pC0±00,000 040 8#<4$ 00 SPs @0 0S @唕  ( 0:x0| 0 x0| ET |1 p0t0p0t*W`pv0P @ $(  $D000@ Bp@`C>Qf0 0 0 U |1 X0\0X0\A`00 ~Q +P/80< S001R  ! @0pS001P0/03" /Q/C-@M |0(pP ᗍ`Po T0P4`嘕00 <08PP= @` @0P4`8@]ЍP@B(0s/@-@$Q@h Q0(02O-2CS0 'p000#5T\0?0000> P#10@T ~ODT|P`Hr @-4 R0R 0 0f3 Ѝ䬟I0S!p@-P%0@6S ≰P `L6S0069M00C0p/@-0@0,M`S6S 6Q0C?o20S 8,Ѝ@L@0 P0 pt0\ 00 00P p$pYLrLoL|13p@-0PM@\`P ^(0(S00 nK 000 |0 00@X0<8@400 `4 L@ZYPЍp0  @`@c]C-1q嬑1!$M0庇w$#2a12\t1P00@TAOD4w3"`&ab$$Ѝ10 XAHd0s! u0@0P PH$P м}$@&TP  @T0s u0@0P000oX0 0ꌠ|PLHrXG-|1P`p (M0L S200S$@ T7  p  0  0 0 3 200S]@T p(ЍD0CS  R   ` Ra R H000@ 00 03 eS #212 00 020@T D@DT 3"(00S& } 000y!H0 0 @D0CS  R` Ra R H000@@^0@-M9 K咆叆00000 0|0c007@P  ``/XP0P $剆0@ Ѝ0@肆ꔠ@2rr]xI^rSf]^P`HLHp@-P@0@0d00+0?00:<0?00 0400S 40S3 !0 0p0ud0p@-P P@§U0 @@@D@H @Pp@0S/G-@`Qqԁ@ R HQD0PP ᠧDY>QcC 0 0 0 mP ፧01 0S@00@H00C Q6 I I I I Ih Ih Ih Ih Ih Ih Ih Ih I IQ! D R  i 0L S H0`S@ A 0 0 0 *D0S < HMD R  H0S ꌠ\f]^X^^Q|Q/P/0p@-@P p@G0@-@PX0$M @I|1U0 3/P>J$Ѝ0p@-0 M @`5EPI|1 0@4/@JU $ET06 Ѝpp@-0@SP M 00S]P  P0@o Ѝp`IP 0U P ID0P 4   H RDD0P/@- Hh@7@-|1@`T2pPMm 0CPI 0PO 7C0CPVP P0PPЍ1P$ 7C 0CP# 0PQ P1P 0P,0S0PU 0U P0%U?0040 0S0$p8 80-00,0000 0 0$0000000 000S0PU 0U P`0%U?0040PUP `0 PP `PP 6(06 06$0Xp\00p rp,p$I}si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$P IVHx00Cx0,Ѝ PP 0 `O-Pd0D0S 8P .00 04Pb]tf]j^^^^ ^Sp@-@ P@P*@P*@@p8P`5P  03/@?T@=O-PQp`Mߍ0,p00 G`P,0S 40S  .v$0J0@0[ Y0 P40S @$P7 JapP 40S #&<DPU! 5 00SႱ 30Sw  .K4500|#0iP KP P P! 0 U  40"P GP  P . 2ld0dh|Ph20S& .00@"d0 pP [7o5 婒RYO6060S %`0fᶖ 0PVV6 1P00P@00 d00Q%060`U 6` 5 `P`0U 0  R, Y [060D+U" 5 ⦡6060S 0606%0 0306  06a0SU0SРf]^XL^^ ^-^M^^^40GS #S 5S S 00/S S S/O-`0MȐS p( H5P ?@P PP0@PPU[?0VI@Ѝt3 04 0 0$00 $0 Pc HAB34`,0  `H0,0DYPU 20S  .p"p0 ➠`@(0 0(0000@⒠0@00 A0B U0X 0 0S0W<002101@0` 0(00XPP00 YV P `0,`20 Y3P 5`(0  ``0(00 00@;0a@0A` 5 B⒠`(44( :00b000Y0``H 5W |1 000|1 000H@P4T$0 P4T$H@HРf]^XA-0 p003A0AS@`~PE%DP5 0  P` Ѝ@-PЍ0200 [ P YRP[U  5(0  0(00 00@0ɑ@0A5 BoP*4 4( :0 0,R0 00PPV |1 000|1 000AX4\$0 X4\$P?0S 50RPP0 0$0S0V<002101@0` 0(00pp00(0$  ,0 00 0$04( , 00 P)@0<8404PLU? P0 0  P040PPM T00S .x4 4Px0P.?x@8HXРf]^O-`OM p0007`00@P pt0`Q@$ 0R 0BP  0R^XV 8$(0 8$(`Oߍ@0   PP0S |& R p. ⸀0;. 7  00&0pq"0( 0, 0 6R40S80S<0S$ 50S %5P0QPt50S  .00L%\0@0S(50S %0 JP40SX $S쀝0XSF 0SCpW@0X?o20S9 p40S `$|PT0S . 0,$L0S .0 0# {0S .@ #0oS/C 0 0 0 900@ t 0&pP"t3p0p;P 40P 000St ⷴpP 0P00 t;W 0԰P0X 50 00 S 20S @ .JD500h"0 ⺣P 820S .-"H0 0$(0,000 QX 40" C  Q- 00C?ot20 p$0( pp,p.1帀 0P2 PRP  0 R 0@ NV Q 00 %0S Dp0 0  0p0S0 000 S00 00 @0 @ GL^XРf]^^^^-^^^^^>^s^b]s  rG-0P8M ` . 0 0U8Ѝ` R008ЍGK 03 X㣹xq@y `P T X8ЍGƹT .` J 00 zPM0`` 00``0@0@0S `p.` `(0 pY 0h |1` 000H @agz<d0 $ ^r^Рf]"^PMb()Isp@-@D 6PPp@ GDp@sO-@Mp`,;PP- 0S # Ro @` .pp0.   0"[X XC P~20S ",%{=/ 00$ 0( 0  0R p0?P pp 0RP FLA 8$(0 8$(',Ѝ0S00S x10S .@dX!h@08XaT!XP10    0R  0t?P p 0RP F =| R 50 00Sa  l00S .@!pXl005 `FLX, @0W`0 00$`Рf]^-^L^XB^?^ڀ^`^-/1 -$01019/8b]/-/-/-$M840, (  0;1$Ѝs@-@<<-@-p0`0d 0@0S P(00   0S9( 0TP(Sz<P v<L@:(0, 0 (0, E Ѝ1M  Ss@-儼@-哼@-80@0SrP 00@2,ꀠ@-@S@-S-/p@-@8P8`rP\ኽp|s@-0SP0`000S1P Ѝ~S 0@S0mPP0S 0S0s )0pS 0S 0S 0S@;50P 0 1P ܠ-/ 0!< 04 0 (   !/(,0O-LM0\1`0 0 0SO ~SM 0PS/@>0S@:00 1  @P0#212$0 040p0p 801@P0P 0Q0[0S$0`R #2!12LЍ YP @1@ ܠ 0O-`@p\DM!t! 0  0,p(`$  @P]` 0!(! 0  40,p(`$  @PH` 04 0! 0   8 0,p(`$ P.` 0!| 0 t   8 4@0,p(`$ P`  8㠾 DЍ/^^sG^=ID_O-Ls`4M宽0 0 0 帽30,hPP0 @ 0M :4Ѝ0SD0S S?0S0S0S0S  `P-0S0S0S0S  NP0s. `0 0 0 k (0QQ0 0 0 \@TU 0` 0CCP ZPU =P 0 P"0 0 0 -0   0$ 0 0$ ;Y B:@P0T 0S P0T hcP@PTp |1" 0"s0  s(Y0SGC-0`SM3PP00@PS/P@ 00S% T, 0p 0S0U0S   0P Q Ao `0 0 0H (Ѝ@0(p0p/f]s0Hb]O-M0(000406#@21,20PS` f 0 P  YPP00 Tr"`10`6 p`P000$000:S0` 0#0S9@P70S Pw94< 5, 2 "12Ѝ00`0 00 #R3H L R/QH0 P0H0 00B'S$0( B (00T 0p(0(0(080(00 0<0040000 80P +9 (-9@4$0Q00S000`00040<404000:Sp P pw 0SC0CS@:0(p3 80 9@Pg ( 0д 809@PZ 08 80 P  ( 00:S80S% |VV F|P"NININI Q NIOI(OILOIpOIOIOIOIPI$PIF QB`e101o R|1000000000000|1000|1000|1000|1101|10  |1000|1000|1000~|1000u|1000l8@Ӻ0040004mTܠXsp@-`1@P M R8@  0 0 @ ЍpR 0S 0S @9@U 7/@7@-Q@T0 QP   jK Ѝ0P 5LP0S)T   Ѝ0@P@iTdTT Ѝ0@k@DT\ Ѝ0@ \ Ѝ0@2 A-PpR300 00000 @P& dVʀ0! 0     !0 0zQ@Ph%@P lЍh0Pp0  6(,ss@-@P` 0R0%0 * 0{9P  0Q0%0 *7S @׹0 0 0 x R  ! Ѝp@`忹0 0 0 ʹ 0ڢL^(Y@ 0s@-@@*" " A@-0@S00S SS000C0S@  0iP0S0g]4c]0S0S0S R @-01/0sp@-@PTQp@P 0S 00S pS 000CS`2Pp D@pp@-0PS8M  .⌽00 0^0S 00S S 000CS DDH$HT o` P8Ѝp@5g]^@-@.P P @0S00S 8#<S000CS/@-|1`S<<ⰵ#QB#/ ` @k 3 k0  R= 080#8S>n0 7/,0@ 3jl (0lLpq0 0,00 <0aP6^ܗIA-@( 0  R    RA~ ` p  =P ,]@[  [Li00 8/,0@ (0LP%0 5/(0LP0 A/h]=^7@-@(0HP 05/0<0(0LP0 5/040 Ѝ07@-(0$ -  @ Q 4 Ѝ0HP 05/(0HPڅ0 5/04 0R408 Sps@-,0@9!;0(0LP巅 05/}_(0H`宅0 6/0S#PU 0S , P(0L`噅0 ;6/Ѝpp@-,0@ 15/(0HP6 05/(0LP.0 05/(0LP% x15/(0HP 05/(0LP0 05/(0LP  15/(0LP: 5/(0LP~0 S (0LP~ 05/(0HP~ 05/0<0(0LP~ 05/,0 wk]l],l] k]@  WW Pp Ws@-@(0LP~9 5/@P(0H`~0 6/0 PUЍp:A- 0pP(@@pD0(0 `H~ 08/(0H~ 08/0@00@0(0Hp~ 0 7/0  D00D00@0Ѝ D #D  I 0 D00; (0H`c~ 06/ D0, R0  R1  R6  R6, 0D00@0 R  R6  R6060D0(0H`;~0 6/0 D0< D0 +D00D060D0600A- 0`@(P@`D0(0 pH~ 08/(0H ~ 08/0@00@0(0H`} 0 6/  D03D0 ' D0 0 0D0(0H`} 06/(0H`} 06/0 0 D066D0 D00D0Ѝ0A- 0pP(@@pD0(0 `H} 08/(0H} 08/0@00@0(0Hp}0 7/0  D00D00@0Ѝ D #D  A 0 D006 (0L`} 06/(0H`} 06/(0L`|} 06/D0?, R R  R0 0D00@0 R0D0D066D0 YD00D0 0 00 0A-@40$003/,0 < S`P^(0L`;}0 6/(0LP3} <5/(0LP+}4ITI0I`IS8  0"S4 ЍpS  0"S (0HPz 05/(0LPz0 ;5/$03 (0H`z 06/0V>00(0L`z 06/!S  0"Sxp@-PP xl]G-Pzp@`@  ⒰<0

+*R T R 0(0Ѝp@/0 R ` 6/@TЍp0@D( 02/A-P`pfu@ UF01SD  |40S 00Su0 00P4P00 0000S  R h R  A@@ 04/#P  tJ@-@bf4QT T@0 R@ /P/p@-0@SP` 0P`4 R   p03/P p 0R  4Q000//?o2\0S//Q1S ///40S0/qA-P,@`p400S0T0S0 =@QpW 40`S@ 0< 0 00'0@S @  @O^@-@e40ST   @@@,A- @!PR`e0S8 S 0AT 0S 0S p`003/U0S 03/0 R   2/8000S 0  2/ 00 0*tp@-8P@0S0T0pP00t0 0$/ht0 0 0$0/htp@-PJePST`PpWP@0PW p@謚#pv^ 0     R [$X(\,Y0]4Z< @ 8D 0/0 0 /  $ p@-p0`P@ P p@n`P000PU P@T ^`P,0 0S/ R  B /0@-@0, @0 0 S0  0 0X0 0S/ R P  R   00/0/8- 0000 0tp@-@PH P` 0H0 00P0000000ptC-0`pP 0@5/pV 0 0 ЍC/0 CR3d$Jp$J$JT%J%J$J$J<0S0C 0 P0PEPE0cUP!009/000P 05/0S0C0 P 5/0 0S0: 0 0CR 2 5: P 5/0  P0A5/ P/t; S 0 0//tQ/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0`(0, 06/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q" 0Q0 .0 /<AQ(J'J((J'J'J'J(J0 .0!0 .00 .00 .0/5Q0 .0!//A-3A@Q)J)J(J)J(J *Jd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0V:P 0Up%p%*`Pp@-0@000\P 0\0`P 0`0P 00P 00P 00P 00P 000T@t\Q@- /6Q@-/%QJ 4A0&S2&Q/ ,J8,J`,Jp,J0,J0,J0,J0,J0,Jx,J0,J0,J0,J ,J0,J8,J0,J`,J0,J0,Jp,J0,J0,JP,J0,J0,J0,J0,J0,JH,J@,J0,J0,J0,J0,J0,J0,JX,Jh,J@-0 .0!/   /9Q/Q$Q !0AS h00 S 0;Qh0 @-2&Q>0AS/h0 S l00AҒ!lTX 0 AQ   R 5` R  R  d    BQ / d /O-p<0@@`PM  d03 8/,,0 0 0S<0@  d03 ЍO/P`]PEU.J.J/J/J/J/J/J/J/J.J.J.J.J.J.J.J.J.J.J.J/J0 S묀80S0C0 <00<0\ d0P22,c R0 A S:0Q0a BQ0000가W  s0 S 000V ?o2W0SE <0!0!SH<00<00P0S.01؀0.01SXEXQ<0 d 1`Q A02 ";/0 Wd0#0@000;/0 d2!cR0<00~!03/8Ѝo]^0S 0S Ҡ /0 A Rh0 S l0Ց#"l /0 S 0;Qh0 $Q  /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 ]0 R\ 0Q Q Q/@-@(0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@O6Q 0A R4p7A,Q4Jd5J\3J\3J\3J\3J5J5J\3J\3J\3J\3J\3J5J5J\3J\3J6J\3J\3J\3J\3JH6J46J@6J6J\3J\3J\3J\3J\3J\3J\3J\3J\3J\3J4J\3J(4J(4J(4J\3J\3J\3J6J pS|4J\3J\3J7J\3J\3J\3J\3J6J6J6J6J\3J7J7J7Jp|Qg nQ` oQ00}Q[ ~Q00P( hPl\Yp<0<<00000@00D00H00L00P0001010 1010001}<0 z 00000@00D00H00L00P01010 1010001<00<0\<0000T\ 0O00000F00T S=S0C0`0S  0S 0d00 00CR0*dp( hlk\ pp(Ap,App@-PP@ p`E(0 0 000@$080 \ P`dP   } y ux Ѝt@-P@0 080\0`0d000000_Ѝtp@-Q@<0 Q Q <0pQ *Q!R0 ,R0!R0 ,R0!R0 ,R0!R 0 ,R 0!R@P ,RP @PS 0 `@06/0Q/!R<00 ,R/<00<0/A-XP@Q`1`!PEU0T p07/`0S T uZ0Tp D07/`P T0 P[`0S  0S 0d00 00CR00d0A-X`@QP1P!`FV0Tp 07/`0S T 8Z0 `TD06/`0S T Y[`0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00[ R 0PD05/`P  [D0d 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M:?SF@0C4SB@JtAJAJJ>JBJBJ>J@J$@JXCJXCJ>J>JCJ>J>JPDJhDJ>J>J>JDJ>JDJ>J>J>J>J>J>J>J>J8EJPEJ>JBJtEJ?J>J>J>J?JEJpHJ>J>J>JHJ>J4HJ*SS ʌ*S ʀ*SU  SW $Ѝd*S \8$ЍCH*S ! BS;  SPl`h0S! AP)S7 l$ЍC7Pl`h0S, .PPl`h0S, ]PPl`h0S! RPl$ЍCl$ЍC37 l$ЍCAl0S 8L0 hxQ \PQ S00 P W  810 l0d S031R`SP101cQ2 `"6/Dd 0`2"6/]0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRC0A0d0>X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0 l0<S03 T X BS `0 S 00S0 d023p <R 3S0!0C0 S0! C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0md 0l1RcP3PP11`Q2 `"6/d D02!e`!1DlQ3$ЍCFlQ3$ЍC}ld 0Q3D32`S0!2P"5/0S \0Q0C0 S S0x l0 S03SqP0Cl0S <gml0 S0C BR 0]l0S SX \$ЍCX\ 0N HPLPphl@P@0 0`` 09/P6 `` 0` `  0` 00 ``009/P0@0 070S)S)GJGJGJGJGJGJGJGJQGJGJGJGJGJHJGJGJ HJ HJ HJ HJ HJ HJ HJ HJGJHJ HJ HJ HJ HJ HJ HJ HJ HJGJ,HJCQ P^40@0D0HPLPpPPPPPPPPPC$P(pC pl0S0@!0 0 q  8Kl0S S S< 0T 0C 0 S S     l0 p S03S0!R 0CQccPl< T0X00J?u&p$c>^l?p$?^E_X^^^^^^^^^^^p@-PUpU- @\W0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0壏 ^A-@P` 0!0`3/Vp4`e%n 0!0p3/ Wp]p@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@Pq]Pr]; S 20/ <8#8SA3=8#8SA@At210/>08#8SH2AAP00/<1 >8#8 S2A0A`01Q%0CQ 0CQ 0Q1 /A+AQMJ MJ(MJ0MJ8MJ1111111 t1Q 0CQAA QHNJxNJXNJNJhNJ8NJ@NJPNJLJ NJ(NJ>08#8 SAA QHNJ8NJ@NJXNJhNJxNJNJPNJ NJNJNJNJ0NJ0000/000000000}00y|0|0ut0t0qvPs]/+^'^/^3^7^;^?^C^G^M^S^X^]^b^g^l^q^v^{^^^^^^^^p 0S -S"0A(0,D R!#(,0/0A-@M(00 00p@P A<00,p$  `< @0PL  D    p A ,(p$00 0< ,@Ѝ?^G^<0S/@-@L0@RSA-@ S  pplP`pP   03/@NT@j @ApWs]W^J 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,p@-@p`Pp@@0S/p@-P @ 00 R PD  Ls@z 0P] 4pDPJ@0S/@-@q@7s0@04@ O-D0Z S(@3?:pPa0 S.  S`lc`Fv @ 3]V`@ 0  >0@0000@X Q@ T`` 0 @)`@X J#@0 800@P  Q Q @ . @@a0D8#8S @DH$H 0D8#8S00T0S; S Q< S 0T0+ 0}@0S0+ 0Ap Tn 0S c0C S@0@ 0; 0c; S( 0 @0D8#8 T:S00@2T@ 30D8#8S@DH$H8T@ /T@ 0@H$H 01AyAv01 $'*@-@(0S2 $0S 0S, P`p40 CS4 ,0 0, !; S  Ѝ0 0 3/Q Q 0 0 %04,0 v 0!< 04 0 (   !/(, RP RP //A-PRx0UTPS@UTp W `W` 0 `U`RT0 0-l00p3/`PTPTpU@ IR ᶇAR ^^\ P/0 !8 00 (  , !/(,p@-@0Sp@{0PS 0p Sd :!t-T0S` 0Sh0T03`!PMb@-MPRX0@S `j-?-x0S 0$ EP`V% 00S" 0p0CS00 00P < p00` 4 P QH孇<7T@Q0 wGЍ vP^^t]Q @-އ/^p@-`P0@  `PW0(0p vHaJaJiJp@-P@PPPQ(Pp v@-Mp`PQ0@S 00,B0S$  hPP7TP0S1 S P0 0!! !1Ѝ@,h0U h0TyPP 00`SPU0P00 0P *Q ЍPMb"^p@-@P T0S @*@-$ $@T 0T0 v@-@<d>P X0SP0S@*p@-@PQP@p@- Q000p@-@PQP@p <8#8S@ /: S/>;:S0P0S/ 00S/@t]@-Q HrJ`rJrJrJrJ<00000000000000000C-0S@P`p 0 RB"@TP`p000P@/ "`Vp`WS0CUEFQ 0C2? 200 l 0NoX9 X6^3 AoP ` V >  P = P Q ΁ Ƞ,Ƞ\ @@dPTlLoV  \Qڰ 8A; @ T P B^p@-0@SP S`( ` < Rp؜0000 0O-,M @p P@DQa|ܡt%,Ѝ0PU Th PUa 00@  0^LAoY YPQ, ` 00V@D"* + R,= R Q . ("(R  \ `* Bo[  RQڰ  #" T8 ^h^p@-Pl@PTp003/\@@-p@-Pl@Tp003/PP\@@-@P@G-(`p5OPl@TUЍ0Z 0 :/PP\@p@-<0@0QP`?o2CP@Dp謩 (00 1PP D/ᬩH,  ,001PP //<0 60$ 0 1PP //@-P`x˼@fǼp0lpp000 P$ց0@@0 P0tp0 Ѝ^p@-PP@0S `˼`0Pp0p謩^@-PP 0XP\0p0@`0\0p0T0SPQ 003/P 0\ X0`0R`0p0`0\ Ѝ00S 3/`t0S 0` p0t 7/Wp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@H4N3PV *>C 0CV #PV V >C 0CV t300 P0ST0S g lpWX` 03V0t0 3VV3V! 6C0CVP 0VlPUe 0 0RnM0Pi2V`lPpU``PP xrxxRdtVʀ 0! $ 0   , !0 00 0 0!d!0   , !$Ѝ0S S S$ЍOvPU X0SP0S0 QX0S$ЍO$ЍO\P Vp 0`00MM\PP $ЍOtP R 00S0<0_P 0 0qW `PP0S 0010S0  0;/P\p2vt|fW~fdWcW(,$ 0ꬩp@-@` F@sPP@ @ @@p`V X0S P0S@0`$G-`QT@T` PL @PlpWXPVL@ L 8#00S 3/PP\p^^@-@LTT0 TQ S S @Q @-ׂ/^p@-@PX9<PpLP 9P X0SP0Sp@p^ 0`( "4`#/R/`0  B"11P/  R  ,(0 0//C-Pp@(`V Ѝ 0䐕9/@C-P@pW Ѝ 0䐕9/`p0S@`A-pl `R$:Pp@Q:AQ  A8/ 0| 00CS%p0 C0 BR%0P&<019P*Ѝ0 PA-`l PR :pp@Q: BR B8/ 0 l00C0C%\c&PQ9`P*Ѝ0 `RQ\ Q @-:#:^:\:0/|u]A-Pp`@@0@Dp@0@L$<#@`W )G0pG`@A-PlL0pLALA$ `@`W G0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh !$ X F!Y P0!`pW:X  QY Q  =H 0P|u]S/G-`@ P p #$Y@PW F0S  H00pG@PR/G-PQ`0Fh pY@p`V8h G0S h G@pG-Pl @R`T  V Pp`#801U !0S  G0`0PEp pV h p`G-@ `p,Ƞ 0P !VP`W 0S  G0`0pGPp@-@P,P"$R@0S000SR@0S000R0@@ R@@ S0 00p 0A-`T0@Pp 13/UT0LpP` 0T01A/0T0A-@p`0S  dPf p A d Q0000000P̩QO-P`p@@DT 0 8p0 SX Ѝ0 #p0XC-RP`p(@@DT00  0 00 0 X ЍQO-P`p@@DT 0 p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/(,O-`T)@tWʀ0!()0 ))   !0@S0VP`P0 040$c0@04 00$00 , 0 4 00CS||~` ЍTc40, PR@0 0  ˰P  Z N \  @ ^0STPX0 000V`0 S ``00ZddS`0``` `uSM 0dr l0LMp1˱hPL|00 10000000 P 0 T 000! PYhPQePP MPEd 00C0S% 0R0P0PC#0+0 0RS0C2x05A05t0x50t50p50l50h51101YL%0 Y1* Y  $TR?  =BGSA S S @<Π` P" AP QY  0S,0a#0A13!8#<4("(R 8L $(!#8"(PE  ᾐḐ ḐP \ [꾐 ᾐḐ Ḑ吒01 `@3 90  BQ RZ    0S{ aLx@|m( Ch@`p0Kl8!0 IYR TP    Bτ000000000000PTP  Bτ00|00x00`00\00d0(,u]^ԋJԉJ4J R0T0: @($ ,0S XYZ0H00h j0ha0I0 0i 0$ 0Jp EX[\ΠY\\ˠˠZ ]`\ˠàU U RT  U $PȠ,̠ TȠ T , (0[, (0x]K^d^|^^UUUUu] ̠ S /0QT0   R: ,0 30,#1 #2 R0/ R,#@-B/u]O-@P L0`!P!U1 P Q0"0!`V800#0Q00P0qpP b0C  2 `V8 0x  "  Sw  " 0S  uB0P0   x]Ј]T]S/O-`4M@AX0 RP0_! @ S 0P p j@p4Ѝ W LD  @ @J$̠̌$DL ^@ @$$DL0 DH @ @,  ,Ġ 0 @ Ġ  , @$@P@0 P( !   (! k   R  D   R W@TqȁSp p p@PH0@T @BpGBQ  !$ !(   d   Br r  R5 ""$, $""$,  Q Q ! ̀!1! ̀!    "  " ( E\e  RQ  RH N ,, ,,Ġ  ̠$̌(    PZ j ,  ,Ġ 0)̠  ̌) "Ġ "$ ,< $(, ))$ , H,X ? "   R $ A 0 pPU>T $(  $"  "$,  $(  2 ""$,,m[  |$ k    , $ (,Ġ,  @ğ A@@S0Q  ! !  @P B  Br m  Rp M " "$, *"̠ Ġ "$, Q Z pj ,  ,Ġ 0w'̠̌'t| "Ġ "$ ,<{Y'$,' ^ "Ÿ  Qpp A   a$  Rc P 5 p' Ġ 't |,|  |,Ġ  \Q a !|$|(!pp7̠, $ (,Ġ x   "  R   @ 0 @PUp[  ! ! k   , $ (,Ġ,   Q, $ (,Ġ !"̠̌"$,   ,, , $( ,Ġ$ 2 "̠ Ġ "$,     ix]Ј]T]O-P`pVA101!00 `#8010 S$1@"pW* Ѝ 0"00#0 R00`00Y b@D Z Y B? !1pW:Y  ! !QZ ! !Q  ]? `Ax]Ј]T]O-@P,M@PpWwC^s*P`! !"PV`PP "( !P ", ! S Z $p0~' 0p RhʈS:0 02 $0Y4:0!448#844p R20!!Ġ000 0S0`0P 0"00#0 R00`0PY*P0 0t 0c PRx `R ,Ѝ裯( 0:0 B0c 0!00#0Qa0 !    R h@P"    S0 "q!d0p0cR2 $00 1 0YX:0!448#844pq Ϡ( 0<P!̠ !P_q w0s00 #!0SJq   !0S  2>0 `0PY*P0\ 0txp0cPQ`0WO 0PE0s00 #!0SQq   !0S 0`F = pG 壯(  0: \ !Ġ ! Ϡ( 0< P! ̀0048!0000S  =0 `0P3x]T]Ј]00 00000100/JXJJJO-@MP8@PpW2C\.*P`!"PV`P)( !p), ! S( p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  V=0 `0P[:00!448#844pQ 0S  3=0 `0Pό\00PE0 S 0S 0 `F=pGO-@P,M@PY C\*P`!"PV`PP p S"!  P )", * 0$ )(2 *    0  0 XS:0 0>R0S  <0`0PX=:0 ^0$ ^0!  n0##C$Y00cR#\0$00;+Z0K0c[3];$; [ "BX  bQ;0@ 0P0S  <0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `F[<Hu]T00  ,0X00500\00/lJJO-@PM@PpWeC\a*P`!"PV`P8  S"( !y8 0p", !)$p (|'"ኰ0X0:0 pS0S  <0`0P0 !448#844p Q0S  ;0`0PX*80 0txp0cPQ`WЍ P00PE0S 0S 0 `F;pG O-@P4M@PY C^*P`!"PV`PX p S"!)ᇨ X *ᇐ", + 0$ )(2     0  00 $0XT:$00 (0>S0S  \;0`0PX=:0 ^0$ ^0!  n0##C$Y0 0cR#\0,00;+Z0K0c[3];,; [ "BX  bQ;0@(0P0S  ;0`0PX0 0t x0c PpR`X4Ѝ0PE0 R 0S 0 `F:Hu]X0S  0R   Y  Z0X0[ 50 0\00/J4J,00S/  R 0  ^]R  Q 4 R  Ă\?   //лO-pP`088UV@6 0 .Rv ;RP@*YC0S@ 21S@@S@TS S# S@0pPEV  0`;P?T ;T@ '  Ѝ QCM? @ R \?@F? @H$H@pPE00C Q@4$0@DWP pV@D  0p` 0P@P A0@S 0S a0DS @DH$H@DX W@;@T@л]O-8P@Up=0`P40a040,($@@ @g<Ѝ^л^@- 0 Ѝ@-0 R  @ @b `@ 0ЍЀp@-P@,000 080/0 0 !""##$$+0/0 pG-@ MP e0`ЁZ@ /P0 0$(` 0 b3r~ B1|8Q >\"fFp Ѝ4 ,0 Q\.\\! B"0?pP \f0, 0 0 0S \b 0 ebH _L0H 0P0001@00xnh0SA 0;  R8 0p 0A a320! r0  P &#8 #61S0SS$ 0S 0<`0H @R000@0@u00 SSX000L000)x0L <Pv^^^1^Hw ] ]@wDwP P /Ի'p@- P` @P`0S 6yD]M kX@.H|000:0pp@-` MR@@P]/0  `$!1/@P00 08SH@F@ Ѝp7@-P 0 I@PM@P H00 Ѝ0s@-P@<`-` 0ЍpA-0p0000,C R#C` @,0PPf" 8< /_`\, d`40`00RW00Ѝ000`O-@p0qM@ 0 @00@ `PL@@0! &@ nZT`0 D`( XP? 1-20 0`0000; 0  !?{@P0 0@04P 0R R 0S00V xㅟx 2. 0$ kp 80080  1 10 10:00=0;$000 0P p  t  p  x  |$ ( p``` $ 0C` #00,0 0?@Pt0 0/lp0P00ãp000p 2000LI hp 00p0 0SEXH 0`0AXp p4 @k4POo |@Bc4P) T+  p@$@`-0 0` WP @8V``TXPP >00d[*N0h0@X . w@qߍ@P  V X [ О00@edAb*^^/m^q^u^c0@-0MS0j0P@ ~@P rFЍ0p0 000t@|@x@@P }!ˁy^^G-@RMЍ ptRRPPe U p tR  t x $ | ( x2tRP-*80#U0 D2``00@`  P 2 P0S F00 00$00(000$2PEJ< 00p 0&000[PP0' U`PX0  `JV UXErX0000 (f0S 0 0R\0  t Q  x 0R| $0R (0RXXE``]0 R< r9 rq4 $ rq/0 r, rq' r$x r!| r r r8< rqHL rq r "sr 00 CSR-/-//O-@4M0S 0S-p圀L Q00 000S("P a 0SL RS R H0A0 0AP 4Ѝ0 `1 .4,P 0P`E\#Q\0V`!L^QƯQ ` @, `<P(%  $(P$PP 0 00PEU` %- :Z0SV  A-0Mp(`h0S @ЍP 00$ `30 @<121 @)@,)`"30@P4 00$ 0/0, ϠQ01:0 00R0  Rp%* H@p0 dPT HT  ,@H0 0C0000 00C0[C-p@`P800CSʺ0 V0  =# C!* R`0P 0S = C!P0S c> Pc>O-P04M,P000QP4(`400̚?P0P,TR PH6p@W\vp 00#20ᷚp0\`60X60 @&D6 , PP  Ớ4ЍL0]$00$ $/ S h0S+B.0]% 0 ,P ,0000 P, 00Z 0 , 00/ 0  Z _R Qsu,P e> 0X& 0 0,0 P 0B0 0 S0  N0 0 0 h0B S 0  `* *0S0 (<80 40 4$ 0C  ?o  20  *0 ! -4S S *00h0SP .0-400, (0`60A00phS<^P0P 00\/@-01"\A@P 贼]0@-PQ0SU L0R @@T00APES Q T 3=?000QS^T ?6?0000-A\\^CQ Ӂ0ѳ 0ҁQ/0G-@0P00pU5` os 0R  (: {>C 0C"4 W0  !1 /@+b! T l0<#\0r#C0u?0ppЍ0T00W0;k_kų@-P @ 0 Ѝp`00 0020050 0{2?0   P 0 nrPd00ꀖ0@-0S00R0100 P PP0 S .0t@00 S 0R010\0000S*@R@@A@ȗ] G-P`0A S0 00.SR0 .QR 0@0S Z@00V@@Ѝ \.\ 0Bp@ X .X2Q^ZR@\0= QLB@0 A SR!R@L0 㸑L\  S Rp*\@S_0 0S00TQ VQpX T@^0C@ 0 \0C R.R @ X R "  pW T@R0C@0 )/)0g W1 `V00C R 0H aSc~00Wm*00p  V[ȗ]C-@PM0Q s.R R 0E $2S ZA p a0 0 2`P 0P 庁&  &  &Y@PPĥߍC-PM@@B `ZSX `ߍ p /W0@ pG W & & 0& 0PTpEP0 @P T@o P XU RQ@AOoB$RQ !QU@ 0?PPET ȗ]O-`@?00CSLMpLЍ@0 pP0R I& E& A& 0 /Q 0S*p0 PS 0 C  '?0 \QX A \B 0  ("(R ! @ B}$  & \Q,? Q, ? 0S @\0 S/  @-0Qs.\ \ R 0 #@aAON/000S/ 00/0M000Ѝ/ 0P @/0P0 @-@tPt`t0 0x0 @`@]NP0 00 @`@SN(  Ѝp@]Pw$^^Ț]/@-@ERCR@RPw@-Q|L ?ЍA-@ MP [%0`S rBL S?xO@x $ !08` 00$0$0 0040X& 0L00!s0X0P0"L0X0\00M0400X0S\  0Pld 02\0N00$  0 pP tP Ѝp @$0 H0 0I0 0J0 0L0 0M062.*&"pX$0\0800sX08X0 L000 =X0@0000H0H @0p0P-c< 0180@ZPw!!yؚ]^ 0Q0vA-` @ P80 rGLppF\\:K\pd LE01p `0S7:0 00P 0 \-Ѝ\` 0\P10 00H0 C2 000\0 >0>00C000\ e1ЍA^O-@L8`P04Mp ( 0s $ @ ZP4Ѝ0 =1\0S* Pp0G0d0W80H0\X0Xp(00$0h $ [p[ $ld0 LT0C)@Ì @)0`,$"<3PP,0p 0 B #0, 8 [0 000H 0\p1P9$ r 00(0Pd0 23h0$0l0(Q 00#0  $0H;PP  AH0 C2 000 0^p@-@P.O P b<0 0`bo`嬞{OpPw@-P``@P♞M@S0 000 001 0!400傞ЍpPw@y@-P9L@P4rЍ j9O@y0y@xp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0z@0 0C?o20p@@-D@<P$+FЍ0 0$@y0yA-0Px0 0؝l@\`FT 0S < Ѝ p;N@@y0yG-P|@xpU*D0"HC \ ! `.V x*x 0 Hy-   1 `00C`0`0  0`0 1 /@- " Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0Ts,M 00P 8@0000,ЍXPQ'L00 d0\PV l 0CP 230X l0CL30V00R d0\Ap0Y0VRp0 00 00 0IS0'0 00h00 r 0 R:0#0n P [X0 ld C@T   V0&q000 0SPP\0S* P 80m)00$0 0 S P #0 l $0 B$"Pd0$  S:P  W00sQ "" 000000 V P 0l0Ch0bHy h00\ %S/G-@PP`M/ `0S 0"!030\.000pl 02 B"0$00Ppp`0 00z^!0 {0X!0 d080: >r0"\!o0C00D0l $`$0 B"00M$ 00)!0 50P   Vp.0Sp((! P VЍ]E^a^C-R,MHPy\0@Sps: (000 0 l 0 B$"`P= 0000s7;0@S  R # ! 0Q( q. *BQ00* 00 0 !Ġ !0 00t0 P ,Ѝ 0 0%RP00 200$ $ `@-M`pP0 0 0o@P ЍU 00@-@  11 c0?o0cCQ1! aQ\51:  P0#03Q0#S 1S c0?oAO-@P`4M0pQU4Ѝ{\ 0F0Spἱ弡X 0t0X0SP\0S\` ' 00$0 7(    $ l0$  0C#0P0Xp P( $ p* P0X   0 (0 0 0 R 000 0"R*X (D0)Ġἒ 00' 0),0( 0# 0 ,0 00O-PQ@p`$M @R H0`00>0CU\  9'0[*0 [3:X& H0Y 0 0`  " B r  /oA  W0 H0`00 $ЍX11   " B r  /oK W0H0 0`0X1 1 mNA0A-P@aq(M00T\0S *Q  (Ѝ &00 0 90S Q  z    l0$  0C#0PK0S s& S000R0 @ 0:0 20#400@000<@00 0000%@0 02$00$0C-@$M0\ S:0`,q`0\0PS *U? : 0 &x&UQ 000s(0S `U P 0 P   l0$  0CP#0)P $ЍO-X M@Rp@8`L0P1 R hhhq Rh0p0l0t0WP l  l  0PP ЍX00Ql 0jPP0[pG00X RX0 00l PP h  0C h  00Cl0 L0 0 CS  dT00l0$ BL,p 0C#0P$ 0yXPHyM!Ѝ/O-0lM `00L0p P地$  8@0 F@P )0(    CR@lЍ     P 00S@|IPM@0  / 0.S,R R(0.S%0D00R0 $0ZrLS(0S) u  F@PX  0B?oQ20S F60p0\P P8 P000 @  j0000($00 C/oQ" R0 00000,0 004 00 <0\0SBH00 ,D0P P P7 @p  80l0TP C)CL@H)0c"$<3PP<0L00H0SE,00,0000QQ% S000 0Qr240SJ 40SG  E@P.0J@S00 0000 S 0J2 0 0,0 S00 0S 0 00 0  P>  8P 00S5  \"P/ d"P)08 ,0$0SR0J000 B00 qC0岤 BCL QR ZRPDL00D 0RP( $0 R S R  u  uE@PX  0B?oQ20S@ 0D)X  0B?oQ20S $50p000  0DP @|O-8@LM00 \0R`p:,p Ad01000 0PP 0 \LЍd \002\0d800000@ PP0l@000)ASh0   )0a AD48"03$PPhp4 0@00p pH0 0I0 0J0 0L0 0M0 0L0<0\0<0800s@0 00S 0 $00(00 J0,0, 0[%:04S W0S{ L0 X0r00L S0002 S200<0 0PP0<0 00]h m04S3 .d8000@ :P+l@ A)A)0aD48"03$Php4 0 0pp80 0($ 00 0 J0 0 P 6P pd8P0@ 7Pl@4 A)A)0aD8"03$Ph0  04 0 0 pG [ 04S:  pGPh h+04S# d0@ 7fPl@ A)A)0aD8"03$Ph0 40000P 0CO-`p844,M000 4@P @DOoB,Ѝl A)A)0a$"03$VP00P000S pQ @@Q @  P  P   P{^^A-@pld0Qp CT0AP(`P 2#53Qh50L L)L)0l13p$"PV 0h  0PPPЍ@- 0$ 8 ЍO-8@$.000:0pp@-0`P"n@P3@P .00p7@-@t0P0p00x  0 000 0|0?000000 r 0000 0 1 Ѝ0 P0QP  000S.O-@`p04MP 0 0l3@@0!1 `AV0$ ( `0c"`P |0< $00"$0 S:@@|A  0$`P 00`E@P ݀qn0.0ifcD`]0403S]< Z@k 0Hh2Se  CbS_@0S\ |03?SV3S$04SP*2 (/QHDRQD" $(0D00020|0 0s- 2 S*:@ 4(Q,":@ < h< "b"#b#D D D R 2qH0/$04S,. DH0L02#T0T0@@CD0b X\ | P!$0S3<@0k.`6&0AL``PT`Q8R 儐0 0  F0S:2YP#|x0f0?o0cl00Fh00f0?o0cd03VSp``` 눀 `X< l @ B 0  `Pm 0 0`P` yPZ PT yPN{M o0 0R r \R0\ 0 0$pR`P20(010000t010@m1100 0 10:0000l0$0d0 0]4Ѝxc|j00`@ P T P Ԅ҄00`^^ ]^@-0Ms0nP@ @PP v,0 00 |00 0t@x@`@P Ѝ@P spˁy^^C-PRM@Ѝ R `  R@ ptx| @2s|000x00000S0  R0i -@   @P 0!P+@0LM00 @`0&00 0A@>T +0&0 ;@>T0 U@P@P s0 ;p>+$ 0R b000 0uy0S0 $0= 00` 0&000@@G>T?0100S8 80 @P20Sw k+@+]G-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0SЍ(,0 sq 0   0P08< rqHL rq0 000 R@ 0@P00 8< rq 0 R 8$sr 00 T0V HL0 0L00000 r 0 0 R,0@@P L000L00000| r 0 0 pR,0@v@P~| L00 0L0000ЍG20Sk iC-0@p0S M  RP- 0G0P S 80`\pH7@X!V0 /P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-@$M0S $Ѝ 0SPp`\ Q00S8. 䑟 P \  0 R0P0 R H0C200 00 0OP 000 0 = S[ 0d hpP R b0S"   PESQUP!\ P R0R00P00 Pl A)A)0a"03$ P p00 0CSP1 ' <[0SUO-`$M0S S@ pH pP 8  \000 0 P0S@$Ѝ00S\0S0000@00\00 0?R  -pd0P0 l0  \SQ00C01@ 0<@PW 0 \ \ >0>00S H0A0 0 00 0H0C20000 0t@P0S; 0S0\ xT [ ܲ0 00L0 0>000  . 0u<@0T003 0 - 0  H00S 0 f@Pn a0I(# 0 C8RP 塲t000 #8 800#( 0(?<P @ [>$ЍOa@8@6^M!Ѝ/A-0 @p0`SP , PW((G-` P@U(@P pp, @P 0 -0z0@ o(B@s@-@0P000CSiG#SR`88 d0l 0C S c10PQ0`P 0##sr$ 0$00#sr  Ѝp@@;8l A)A0<)a21 # Ѝp^@-0P@"X?E @804"60(0"$03E1EЍ'^h^)^00\ <00C SPmKhmKhmK(mKDmKhmKPmKPmKhmKPmK\mK 0 ! /+ 0 0 0OG- 0 SS   ЍS @ 8pL x @S  @|=0S I`  "` !M 0 =mO-0tM0$0L0P 0<00S40@ P$08p40!00`0S0000 0#200 0022 0$0X0S r}L Sz@T00H夂0X@0q0s L0ld0S A A! a,3 1T 0 0 #0X 0000 0,, T000SL: PPL0 @S  @   0 R=0d l1 \SQ0h p0D0@P80010!@0$0\0HX L00$P0X PP3l\X0 A)A T L)a"31$PPLT L00CS0@08 S  8 T8 000X :b0PTD00UQ0V(0< 0,0 0004 0C0$0 \0@T 0S S0 00 00S U   00~0 00  0~tЍQ 0S0  0 0J0fp40 @ T 0d00e0&|00d00e068 6L0d 0Sl B B b32T 0 0## 0 0 P1  d 0 dl0 0m0 0n0  {0400S*Tild 0S B B b3?00 2="0 0 00 P T PE 0(00,00S ( ,     0 R TP-0m0000?(@,D000@0(@,0@0(@,0P>T<^S<^A-@pM0@P`00 R@@00V T0zL0 0L0800"0 VT@`00R b0 W@T@M00N0P P000Ѝ@-0`P pMX0S, \0R@#8*x Y P @P.00h@l@ 0!0\0!" 0080H00 080 000  0p 0, k@P  0 000 SЍ7@-@Pa"P ʄ囇 Ѝ080 000 W0C-0@P8`rrd!!L dl Td X0S  0SL L l3<'0#"L0!10P  000 00HpX0000(0""p 0 8080C  0M  00|0L0 8|0080xp000h \0000000 Ѝ 000  0SL  0SL L, l.3 < 2#$ " 0mG-0p` M8P0X0S, \0R@#* 0@Px T 0PP(0 000 ( l0Bd BT 0C!#p00$?@ p 02 @ 0 00e  | XrL R:!q0n.ke 2- f8c6` 40r&YV@" $X @P0d00t@p0!# 0, $00@P  0 Ѝ2=@P D]C-`0MPP@ PU80 000pH L0C40S@ PP: @ H0 0I00@J00@L00@M00@L0P\pp 800sP  PЍ@- `P@P 0   0L 0 0<03100{4 0wP Ѝpvd 0`( "4`#/p@-@(0Sp0PSNP 0S0SpO- 0 SC&P02#` 05:(#0P 0 @ 00 000 00$00002 0`pC@ 0Sb$0@&S@@T `㨄0S|m`#p!t$$(00Dp0(0#00$ 0eA@P $`?0V0]00!"$ $0( ,Ϡ RQ #Q#0 g@P0  "0 00s"n!#0Sz x!w0  U8 0(< , P\㲧 00$0 `000t0`$0  0`0 09cvV8p<$w 000$ 0  !P!$ 0  !P` p($,0X 1# 0  bg@PV Z!0尧T!@@U0 R壧 P0R 0(" 0! 0  1T 8@@8080T#pV@T"0Sr 0*`u00!r! 0\ RX3 0  8@@808&ꨙ^1uO-DM(0h04 800S0`Sp 0S DЍ0地00H83 000  01 0( $Q  0 0\0:Q P @$,0 Q( DЍO6=0 (P Q QN QD'00040000P# 0 P*0S S 1H0C200<0000P  0P0*U00  Q QP QX Zn0SU^&00000 0 0;00@PYP\ 0606P LP0[eUP!00 00:0 @P P\060 %P  2Z&700 0( $ R 8S  0Q\ 00P$ B0 Z  Y #ROY*  R$ QKڸ \RA  00 0( O#80080000070 P 00  8Sr0RPl #000 PQY I 0 $@R$$ 5 3, 5$  000800<000Y*00 0Rm* $0  $00CR\0X$0000$0)! $0 00 0 0 0$0 a% 00 %$S R0 $0 0 P000PE`10S0|0S8S 00 wP 0 + %0600wP ! <0S )!  Al000  P 0 PmL(8F$0 0,0SPv$8sQ,D^O-P $@p 0}P0 !!0Bq   0S !0T0|!ȟ!0 T808$00STq 0S 00|H@o/@-M@P` ! }0 0P ⑵@P O7Ѝp0@  4/@P2V@002d0  4/@P H17 V 000( (0^i^i ^P*^ԣKC-p` 0TM P pK@P  7TЍ@0  0V@@A0D`Y @!0$p 0000410X0X @ 04/@P 86 塵(00 091^i@Q^Pg^Kp@- P0@@`m<04 @ 04/@P T6 ^i^@- 0 0000 0吷Ѝ @-0 000 00 0〷Ѝ@-!>000!44 0gЍO-@Pp`LM$@@T`Wpx6X P0 7 |8/P $P  LЍ  4 ``:/P 5 $P $` P  `880080`` 0( $;/#PZP|p0 3/Pt0 Sx0S $0x 00$0<^$^ 0傤Kp@-@P 6p@ 0`( "4`#/O-P@P@)J000$X<V@P 0 叡 000L000 00 0@00407 @P tTix1v0C1X/xT  1 Tt #T 000$ 4 @H0S000Đ@ H @ 0 0L@00008AL 唐4/#0@?oU20S@. 00(<0Qd* 10 1 @0 tx Ξ0 Tx0 0 0U> 03d@P@P[ x嵞0x0#P P R R 00U>000 C3@0000 x08A4/P#P00p  0@P R 0R  CU80000008Aᔐx0 4/@P f#0D?oU20S 0 #T Tx0S0S0T2Tx0S @0 0C0m$Y @ 18|00 0 8A x0 4/#P@@  P#P@ 0 T0C0ex0S @T ] @[|P x0 00 S00  P  x~60Q &(10(1H*w6@T{ 0S0Y @x0 00000|60S; 8l&,461("S80 < LS0C1001008  0`000d00<00L 0  ! 8 0嘒"005 000 s 00bR0d`0Y I  P:dd0 00 0`0 @<@:$04 8R$ 9980!pX00`0!0ᙛ+@4\10SL0  @U. "0 0`( "4`#/O-p0P03.: R Q# Q3#8#(, PU0 :8x7K0 00 $ u70S#<Ѝ8,( ?0(? $0,<80p 0@|0@x 8    08 08  0`H|]] ]0@-@ P0 M0   0CT D P  0 zЍ00@-PM8  @:86̚0 00 q$ VЍ0@6Ѝ0O-S,M,Ѝ@TP`p0HL R PFPP UPPӔ U|QR X\ R P8 `QL!Pш X@3 $0r! $0!WP00 00U0P00H0 00000`00X0-1q81r\ PP\ hP! T pW?W0r! (U-181)^/^Q5^^C-DMP` p h <  0$ 00 0@ "4 00 00 0 "0|0 0 P0 S 0 h P hDЍ0L\ \0? 0 0 90#0 0 0hh 0@-8@ h0l P 0P3<P<#/G-@q&00000`P`0dP Y0000Pp"SR \ R3#. 5 %5 8   088 H@ꨙ 0`( "4`#/O-$O@ q '0q00q0a@S 0F  `q0F0q0S  0 0@0qqPU, 00qq0,00000(q,0!⚰눐!0!  *P!X& f! -++:10 0 4 6P !*!0 0 կ4 %( 00 40  ++!VP^^G- MPp  @` ?g@T Ѝ  Z @0(01ɯY0 R00 00@@4fTP0K00PPW $ P0Q\(0 R @0 000O-@,MP0 T0P`pX ` 0 T00C{ S 00   @P` ᙖt? 0 H0P RS K?|0C!0 S@080<@``  " )  00400`5000@@ ?0S0 ?0 ?@?-Q P@@0S   0R00   R`` @P 0P 00T 0,Ѝ̼p@-@PWo0 KFp@oO-2MsHoQa0S 007&}oЍ@āT0S_@qo\ PD 00 0do0  $! d" S R- [03 H0 $0X\ RP(0` R  X000 R 000n 040 0%@0HL RP0P R 00 !/ %yļyPQp@-@ @QE\0@$0@0$0ppPn$@nTp\0$0$$@p@-Q@pP @QE@pnd 0$ 0S (0, 0@@nd 0$ 0S (00, @@A-p`Ptn@T 0S p4` 00S0C04y$0S00  0S00@Anf$@ļy@-@ ;n@T$y^@-T@0S 6n00*%,G$0Sjn $n@<$yyA-p1MC0S S@"L1H1h0 4Q4 !Vn R100 0[@P 5nЍ̀PU!@k0@0` PX0 h00|400#0@0p`T$4n@0SP000]]y^XKļ^y- $\/p@-@PP00SL0 D(Up  ; p@$r3^]A-@P`p"Ws0 A*Pp0@-@P0M 0 @0P@Jh0 `0 @0P@@0D 0@0<@@3;P (-*Ѝ0$^y^zK^{ ^@-@)'@:yA-P`p @@V0L0L000唀@0 0L5 0h,hpd`dPTP03e3a 0&4L 0 yz,]7@-P0] @P @P000   Ѝ0@-@p0PS` H`HV 00|03 8 6008o<080S 0S  V 0 : Ѝyp@-P@]0S  0S y 0 H@QL\PP 5P 10S0l#0p`zy 0`( "4`#/7@-@00Pnl000U  Ѝ0@^ Ѝ0lA-$PU0@$0ᔦ1  Ml` pv1SlA8#6#S"@-P 0`S4 Rt13U @ @Ѝp $`V@ 0@ ג ! 00\4A4/@P& U& 7T 0S 0 0 0U>0' T 0@(T @0 0 DR23200   (T @7T0S   '.^H^O-@Mpᜎ,4@P0S0㨎0@0\<`3IW00 Q, 3Q00 3`0 0'00C0@@0SPD0@H0`2 |#101Ѝd#0 00P30 04008300P0@0 00  0tZ @G[ @ R 0 P 20 030000 3SH0L RP \0 0@`0 ,00 B R  R@0 00  `H0GS4KK4K@KK40u400 3SH L0SP0\ 0 㾍0`@0<  0CS0$000 $ `L430W0D 0 3SH L0SP0\ 0 ㏍0`@0<  0CS0W00p % ? `LtxP|@-8@NP(0, 0(00 , @{7@-@ Hj d \P\00P0b D00(0[ ,00p0T Ѝ0{KL_^\^h^@-4@HdjPQ(Op@L{0/{p@-PH@Wj00p@j{@-Q0   0P0"3 c 0ЍA0C-P4 $0# @ 06@P {0  000000) 0/@P 2"1@P 00' n9@  <1 4W?o20S 4 k@P 1011 Q 0@4Qq 0A  101(0S+p@x tT@1eeO∀@ y@P1@010@00&@1:\@LHD@X@T@P@d0`@h@<ЍS p@x tT@1@eKN∀ @(0S ?&  000000t 圥0 R00句tp@ሀ@M@Ps^O-P`1 @ Ѝ跺pᜡ圑圱 @P4qdVʀ 0! $`!0 X!P!   !4i0S4;i 0! d0    !tT% 000 垨g@P00J8G0/P0 R (@- 0@P(,{\|^G-`@PP @ nAP0@0P0000 000CS0 0   i@P m0Q P T 000C S    J@PO `@At@T 1P @@ R 0P `ηV0"R0(0S1i00P0 0P0pl ]^^^^0@- 7"^O-PsMⴃP0T 0 P0T 嘓f딣@TUff0S 3/PPdKfU X3<ЍOQ 0S  0 P4 P 00 0P@0[00 - 8`h0S" 0!X Œ"U< P[ 0S0h0 0  l (0R U4 0 0 0(0$ S 10 1, 2!R <0L`R0Ca0`a``( R 0dSd0(0$`V &0000S8 R40C BS0( R)0  0&R 0 ㉎P 00@1004 0  0;/P Pp00#P00S 0004i0 0 0 0(00dSd0(0d0 S ^A-0MP0`0 0p` @0 P 00 0000@v?o2P0SbЍp@-M\  LP00  L?\@ R` 0`}@P  0T@@  @P =`Ѝp@-k0 0S0! 40@- |@P P /мO-DM $0p@00D $0N8 P``8`# #R H LQ\P AVL0S0P0\ 0  0CS|Vڸ, BVL $8`P E800008$08 $0000$0 0 Fa aF!(L000000(40 0 `P a4( <000CS0(0 ,  PP,  0k`DЍP 0 0<GPPV 04 (0 00C/S00(0 ,  0 ZPP,Pt0P030# P03S t t0PS?0St p0 PS!ppPpp PR00S ?0S  p x  PR!?0?0x0x0SppW ?0SPxP 0~ GkP h P0r05'Q5S0 c0?o 0c 0101{Vꨙ ^O-6LM$3@ 0080 0p圀0 |W 1 0 %W000D  ,0 WP@ 8 ```# #RMH LQP\ AQL0S0P0\ 0  0CSO{VC, BVAL ,@`P0080000<0  0 `P aWq 0<0 D0000CS000W 4  ZPP4 N 8@`& LЍ@0000@,0@ ,0000,00 Fa aF!(L~0 3SH L0SP0\ 0 {@0000@,0 <  0CS00S@ ,0 00 0 L,0qP 0 0DPPV 80S 0S L8~< W00 04  0CR0000 4 PP400'R 0<W0O 05P2?;;0P4;T0P&p #_[[PpT[tPp?;;0 4;PUtĠ (P,pP  0$ 0"ıP4P0 P$ 0$8C22 0<0:t0p0x0000|0 08l0@00X 00PPl4 0 (00,0'S0 c0?o0c 0 0$0(0SP :000 0#PPK0T`L!p\0  0S q p onml0 YL `0S00000\0 `p0p  B PP i g}U  o v z=v|(^^^^Pм^G-PR M 0GS `2 V Q 40p @P00  Ѝ00(0@ 0,0000t0 0p0$0x0(080,0<000040|0<80l0D@0H000SK@0LJ@pt VT  7<$(, 0 00@SE@VK @P6ZLKY `0@P)Z `Z" 0S& p@-`0 CSR!0@P P  0 P  0 0# Pp 0&p pG-p0M0`0@8 ;8PPh "\D00D0D  0?U@ (v 8PPP# #RH LQ\P AQL0S0P0\ 0  0CS?vU3, BU1L (PP00 00 0$01  3PP Q 0 0 0,,nPPJ z0Ѝ(0000(0( 00000#0 EQ QE!(L #RH L0SP0\ 0 Rv(0000(0 <  0CS00S( 0 00 0 L0,00S00  R,0 Uꨙ ^O-00)@P|0\0|0 D lM00圀 p ,0@@mU`< 8  " QRHLP\P@@ @D[L0S0P0\00C Su[ A[L ,<1@P yP<0000<,0<,0 00 0,0r0K! !B(L< 8@@@ QHL\ࠃP\ NTzHL0S0P0\0  0CS uT<0000<,0< ,0000,00DA AD)0 !(LQ0 3SH L0SP0\ 0 Xu<0000<,0 <  0CS00S< ,0 00L 0 ,0< 0C 3SHL0SP0\0:+u<0000<,08   ATL ,<w@PEY4Py?@ X808 00U0@00S0T0S@lЍ<  0CS00S< ,0 00 0,00 Lt0<0 m #R'HL R \P   B[cL R0P \ 000B S t[<0000<,0< , 0 00 0,0^0 K K !  @004000080 0 @P AU 080 X0000CS000 (  PP(  4px@P[,000B[ 0 ,<@P P 0 0 X=PPX0 080 P000CS (  U`P(  4;x@00002 0R$78 00 00CS000 (   0`P(`X\` `HL`'S R00$00PS;#S R7800C?o2080 Dp000CS000 (  `P( PP" 0 0D`PDp[`$0S0S P00`X0 `?o2X HP 4wP0%'[FT[ꨙ ^O-0pdM00 ,0`0SPdЍlVH$@&圀t00t0 $0   V@ 8t 8PPP# #RtHL R \P   BUL0S0\ P00  0CSUsU\t , BUL $8PP Cw` 800008$08 $0000$00 EQ QE!(L0SG"w`?P V8080 0徲),00S0U0SPq #RH L0SP0\ 0 r800008$0 <  0CS00S8 $0 00 0 L$08 ? PHLPP\ 6 $8%PP,00(004 00 023PP nQV 4( `000CS0(0%  @P  0vPQ  @Q0$P000$0< A A! 2 0R54 (0 00CS0(0   w@P P TX @@D' SR0 000HS# SR8Io4( @P t@0000@,0@ ,0000,0D0DA AD~0 !D(LVBt?@0 00C?oR20T00S! 00@@0 3SH L0SP0\ 0 p@0000@,0 <  0CS00S@ ,0 00 0,0D0 L@0 z #RHL R P\   BYpL R0P \ 000B S TpY0@0000@,0@ ,0 00 0,00 I I ! `800<` 00 063DY@PJ <0 A000CA SHP000+ 4  &`P4 " 8 t@`T0S  VD Um*?,000BY0 ,@L@P P 0 0H`PHP80S <0 000CS000 4  @P4 x0@?S`8sH@ `< 0@0 0 0C R 0  4 @P4@ D0 B/oP" R V  L@P8s@00 D0@P 8sD0T`0H`SX <0 000CS000 4  }@P4  8csWP 0 0HB@PH`<HP0 000CS000 4  W@P4 P 0 0H@PHP`8/s`pW H@P =p~0@ H@PH` V  LP8 sH@h$0:f 00 D0K@=TuD0T`0H`SY <0 000CS000 4  @P4 xP 0 0H@PH`k<HP0 000CS000 4  @P4 UoP 0 0H@PHPH 0 ?o2R0Ss  n0 D0@P0@ H}@PH` )U @@@YTꨙ ^@-0S00b Ѝs@-P0S`@P I  0KЍp@-@<0 TK 00CS 0|@K@-@08 <6᳝0@ 001/P] @-@08<7᠝0@ 001/l] @-@08 <6፝0@ 001/P] @-@08<7z0@ 001/l] p@-@P3K0 '"p@jKA-p P"@P&@ 0`P@`0  rd030000 @P0 hV WЍO-P0Si@`冋ᨋ`Ve 0 0p`00S00 0PNP & @00S(!``0000S 0  0 Ѝ0S- 0 00R0S @ 0S 0  0  00p R W:0L 0C0000p0 0 0ꨙ[+^@-@8 0 ,S@PF^G-`08MP0@0CL S plLTpLTpLplLTpLPlLplLplLTpLdlLoL, 0 @ 0T@ #圐0 00D (0Y8 P@@$@# #RH LQ\P AQL0S0P0\ 0  0CSlT, BTL ($@P pF$0000$(0$ (0000(0a0 DA AD!(L d2, p3  p !  @P A , 4000CS0,0 0  PP0  up@8Ѝ%P 0 04QPPT  , 000CS0,0 0  dPP0 00CSoLnLnLoLnLnLoLoL 0  0 0C?o20 0T  0  1 0 c># C,0!0 0 0 80 3!@P8ЍG<TAꨙ ^0 X➳7@-P@0LP! "00S, ,00 13/$ Ѝ0W^D] )^@-@0S @ C-`M @`P* 00 0SS S 0pS0 IP  "P  0    0@ЍO-p0PDM,sr`l90V08 $%P00P0H $08 `@@8@? #R3H LQ\P AT5L0S0P0\ 0  0CSP\kTDX{+0@P@ TX0 @T@ T0Q' 0R, BT&L $8@P3 .o TT0S ,sr 0S 0T0  0DЍ800008$08 $0000$00 DA AD!(LZ8 0 3SHL0SP0\0 j800008$0 <  0CS00S8 $0000 $00R# @04 R S z00000 0(401  3@P A4( <000CS0(0 ,  `P,  0n@fRSDP 0 0<p`P<T 0nTN0K 00G 0S S@A4( 000CS0(0 ,  s`P, 0 @DЍOzS@ ! 0@0,T ꨙ ^p@-`P@M8  ;8P00   08 H@   0 013/Ѝp] A-p`@M8 ' Pკ번   P00  0H X@  0 013/Ѝ] p@-@ `(MP0/ 0 0$00 000 P@P A m(ЍpO-0dM 0/H0p0H0 <D ` $0X@ 4q 8PPP# #RkHL R \P   BUL0S0\ P00  0CStiU, BUL $4PP bm^400004$04 $0000$00 EQ QE!(L40H^ pZQ #RHL RP \ 0i400004$0 #RH L0SP0\ 0 i400004$0 <  0CS00S4 $0 00L 0 $0\4 0 3SHL0SP0\0h400004$0Q #RHL RP \ h400004$0 ,000BS00S4 $0000$08<00n40  p^ Q( #RHL RP \ h400004$0,000BS00S[4$ 0000$000,000BS00S4 $0000$0;00 &40 pw Q? #RHL RP \ 6Yh400004$04Q #RHL RP \ Bh400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0900(,40p|  Q? #RHL RP \ 6g400004$04Q #RHL RP \ g400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0800,f(c80<0zs _0ZS40 { < #RHL RP \ 3g400004$01Q #RHL RP \ xg400004$0,000BS4$ 0000$000,000B S00S4 $0 00 0$0408@H0L0zs 0ZS40 k #RHL RP \ b*g400004$0` #RHL RP \ g400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 f400004$0 <  0CS00S4$ 0000$00,000B S00S4 $0 00 0$040HmPj4 0k 3SHL0SP0\0bf400004$0` #RHL RP \ f400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 ]f400004$0 <  0CS00S4$ 0000$00<  0CS00S4$ 0000$00000,000(00 0 QPP QX 0( 圀000CS0(0a 8  @P8 X ,jPdЍ<  0CS00S4 $0 00 0$0p.000 p0 p0 ( 8@0s ?@c00H~P0s0 H ?@ct ,0R01kꨙ ^Mb] 0 0Rp40 (0 00CS0(0 8   @P8CpPTp >X;@@Dp6'SR0SH#SR8ppGor0( <`000CS0(0 8  q@P8 S P 0 0 0<8@PF<0X` [W P00`X00P @_P ,P0%'0 0 0PP`@P UG-@|0s-P pr`0s 8<0sqHL0sq0s 00|(,圠p|\ 0>0 ^0P3j:0S!S"Pc PPc"^"؀ 0h13 ^PP!  0KE0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s Q003 PPЍPO-0DM 0x$`pT0|0T0D  $0WP 8 8@@@# #RH LQ\P AQL0S0P0\ 0  0CSMEdTAڌd, BT?L $8@P000000(4003  3T@P WA 4( <000CS0(0T ,  PP, K 0h@DЍ800008$08 $0000$00 DA AD!(LF #RH L0SP0\ 0 c800008$0 <  0CS00S8 $0 00 0 L$0pP 0 0<PPT 0g4( 000CS0(0 ,  @P, J P0g?@P@ 0  |@PT4( 000CS0(0 ,  @P, ! P0ggH@_WDT#ꨙ ^O-0`TM0 0/P0:00pB[P0,0,00P$0 0VK%X00X0p0, V0(040[@Ht 8 PPP$ #R^HL R P \  BUH L0S0P0\ 0  0CS#cU", BUL 4HSPP" f $aTЍH0000H40H 40000400 EQ QE!(L.H0 @ #RHL RP \ 7bH0000H4020 3SH L0SP0\ 0 bH0000H40 <  0CS00SH 40 00 0 L40,000B SH 4P(0 00 0401[5 ,)00D008@0 00 023PP mQ0[L0e D8 000CS080 <  D]@P @DfPP< P 0 0D0L@PL00U@8D8 000CS080 < 8 D.@P<  D8 000CS080 < 8 D@P< p0@P@eHP0 0D 0L@PL00P 80DP @e P@e$0[`F0$0 Oo 0BS@T0` 0(0S`ÅPUꨙ ^O-M<00pD p H `0 @0/P0:0 <,000>00,0PSX040(pH00L00$P80 ` 0SPUژ+t`H\00\0 0S`1<00`S   T0 ,0pSd 0 8PPP$ #RHL R P \  BUH L0S0P0\ 0  0CS;BaU/ڌ a, BU- TdL PP< /e 8<0S i>00C00Sxʐ>[>tD0$ U 00Ѝd0000dT0d T0000T00EQ QE0 ! (LRd 0Z 3SHL0SP0\0Q`d0000dT0O0 3SH L0SP0\ 0 `d0000dT0 <  0CS00Sd T0 00 0T00 L d 0 3SHL0SP0\0`d0000dT0<  0CS00Sd T000 0T0852D0P-P <0S Pm` HL 4PP   T\`$ A# d XP`0 0C0000 00C00 0 0=000=  d B00X0 0`00\000 00P63\PP Q,0Sl `X 圀000CS0X0. h X `'pP% \dP<  0CS00Sad T0000T0 | T0d_PP h 85 0RK` Xp0 00CS0X0 h X `pPhp4 }(ypttx |x\ R00 @040R0 4\ R8Ioᩒh lPR0p(00@?o2(0040@(4`X l000CS0X0 h X `pPnh 2P! 0X 0`0l]pP`40lS㜀 @0S0Y P00X0?o2 pP(p UP` X0 00CS0X0 h X `XpP0hP\:cPP0%'V0`F 00000C0 0000 0So0 `$0p4S SP040 U<a圀A `ga <40$0(0S P0hH0\bU 00 Y0C 080080d 0 L`0$00 ?oV20SX 0 F000 0C0000000 0S 0 : tP Yia0X 0`,0‰`P \bPzꀰ,PUe{^^ ^0gLO-dM000&@`p0pl0p0H $ 00圐 $08@VP4m 8  p" QHLP\P@@ @DWL0S0P0\00CSQ^Wp AWL $4@P ?b`400004$04$0000$00G! !B(LZBb`?@ V8080800S0T0S@dЍ QH L0SP0\ 0 ]400004$0 <  0CS00S4 $0 00 0 L$00p40 j #RHL R \P   BW`L R0P \ 000BS ]We400004$04 $ 0000$0\0 Gq qG!  800,000(00  0 @P JAV 0( `000CS0(0  PP  ,oa@-,000BW 0 $4@P 2 0R p50 (0 00CS0(0   YPP pP TpXP@Dp'SR0000HS#SR8ppGor0( <000CS0(0  "PP `P 0 0<PP<YP 0SW P00PX0?o2P @P ,`P0%'WvWꨙ ^0@-00 8 ЍO-lM00p08-@0唀`x00x0 H 0 000$0 0$  ,0@@ [P< 8  # Q#HLPP@\@@DZHL0S0P0\00C S\Z  AZL ,<@P n` ` <0000<,0<,0 00 0,00J! !B(L対WRL` `?@0[ 8080 80800V00@00S0T0S@lЍ0 3SH L0SP0\ 0 \<0000<,0 <  0CS00S< ,0 00 0 L,0 0<0  #RvHL R P \  BZHL R0P \ 000B S [ZS<0000<,0< ,0 00 0,0y0 J J !  < [ 0P8@@@P Q*HLQP\ATFHL0S0P0\0  0CS [T <0000<,0< ,0000,00DA AD0+0 ! (Lɽ,000BZ0 ,<@P    ATL ,<@PX$0@<0  #RHL R \P   BTL R0P \ 000BS %[T<0000<,0< ,0000,00 DA AD! h@004000080 0 +@P A[r 080 p000CS000J (  PP( A `4^@P 3SHL0SP0\0 Z<0000<,0 <  0CS00S< ,0 00 0,00 0L>,000BT0 ,<@P +ꐤ 0Rp` p68 00 00CS000 (   PP(3`X\` .`+L`HP&P'SR00 000S#SR8``Foobp080 D0000CS000 (  ^PP( gP 0 0D&PP[D0WP0  0S'V P00PX0?o2X HJP 080 `000CS(  'PP(  4 ^@`P0%'0000 R p 68 00 00CS000 (   PP(pX\p `LpHPP'SR00 000S#SR8ppGor080 D0000CS000 (  PP( a`P 0 0DPPD0ZP0  0SW P00PX0?o2X HP 4];P0%' `TT&ZZꨙ ^@-4 0Ü   ЍO-0\M0 0 0 0@0 <S0  D0 00,00㜐$0+0 00<0, 0`SPw 8 PPP- #RHL R P \  BU#H L0S0P0\ 0  0CS&YU4 4 0 x0?R*00h, BUL <P\PP \P0000P<0P <0000<00 EQ QE!(L=P 0Y 3SHL0SP0\0PXP0000P<0N0 3SH L0SP0\ 0 XP0000P<0 <  0CS00SP <0 00L 0 <0P 0p 3SHL0SP0\0gXP0000P<0e<  0CS00SP<0    < !              0x00@0 0L00H0000 07 3xPP Q0S[ L@ 00$0CST0@0# D @ LB`P H)\P\Ѝ<  0CS00SP <0000<0D P 0@ 0LT`PT0$0UHL@ 000CS0@0 D @ L`PD 0000L@ 000CS0@0 D @ L`PD 0`pSpP00SIPL@ 000CS0@0 D @ LPD 0 S*_oobVppH[W[ 0k 喹0 08#800C0 0C00 000 B 0SY !8888RL @0 0 0CR S 0@0 D @ L{`P8D(0@S`HU[HP*S0@0 D @ L\`PD(ppp,kW04 004 0000C00000 C   A0Wa0 [(00`p 00 L 0C00 00 0 0C0 @0P HZ P0pG pG 0 0C00000``F`L @0 0 0CR> S 0@0 D @ L`PD0S 0!  0   0 @0S- L @0 0 0C R0 @ 0@L0P0 HZPxS0@0 D @ L`PgD0SA0Uꨙ ^O-0M`000Pp$ h,`` 0 ,000\ 008 @@D@+ #RH LQP\ AT!L0S0P0\ 0  0CS.AVT"@ `0 x0?R: @, BTL 0D@P% 'Z,P Y OЍD0000D00D 00000000 DA AD!(LaD 0 3SHL0SP0\0 UD0000D00 <  0CS00SD 040@0000001 000 0 000 000000 00xx0pt00<00$0 09 3߸@P @4 L000CS040 8  @P <k8 EP 0 0@Lq@PLX <Y@V@4 000C S 040 8  @@P8 0000 @TX00 SJX@4 000CS040 8 4 @[P8 0 S*oᨂX <7YZ0S c0 *008#800C0 0C00000  B T !8@888@4 000C S 040 8 4 @Px8 0 00@S<XH@0,cX0 ߶0 0000C00000 C   A000X0 `{ x0 000 S0Ḁ00  0C00@ 00 0 0C0 40P <X @y0 H H ᘶ0 0C00000J 0000@4 000C S 040 8 4 @P8 T 0 0 0 @ 4P0 00C SST040 8 4T @fP8T ⩶@4 000CS040 8 4 @NP8 Ph @4 000CS040 8 4 @5P8 0@?S%@ 40 0 0C R 4  8@4P <X @@ 40 0  0CR @4 e4@@P` T88S? L呼P9 &,Hp0 ,ZT H0!,P001x C60 0hd,P YL 0,0@4 000CS040 8 4 @P)8 _E<0 H0PH0T0,0S040 8 4 @P 8?@ 40 0  0CR 4 ճ4@`P @=PT>ꨙ ^]O-DM000'pL00L0<H $ 0P$0 0`S8^ 8 @@@# #RH LQP\ ATL0S0P0\ 0  0CS%STڤD, BTL $8u@P W800008$08 $0000$00 DA AD!(LVY3V?@Pl0S0 3SH L0SP0\ 0 R800008$0 <  0CS00S8 $0 00 0 L$080 p #R;HL R P\   B[fL R0P \ 000B S R[v800008$08 $ 0 00 0$0A0 K K !  ߴ0000(40 h0 墵@P Al00S0T0S 0S> 4( 000CS0(0 ,  g@P,  0MV,000B[ 0 $8@P '0@?S`05VH@Pl00S=T 0l 08 U6 @3 `4 (0 0 0C R (  , &@P,l00SR TP 0p  L]`0 @P 0UDЍ @QL L  L> h`L 0  0-@lЍ, BTL 0@j@P U@0000@00@ 00000000 DA AD!(LK0S0T?@00 #RH L0SP0\ 0 P@0000@00 <  0CS00S@ 00 00 0 L00@ , PHLPP\# 0@@P@0 P Q- #RHL RP \ $P@0000@00"  @Q00@00000,0A A1 ˲,000BS00S@ 0$K0000 00 ; 0s@0 F  #RHL RP \ @P@0000@00 ,000BS00S@ 0000000`:00@ 0? 3SHL0SP0\06P@0000@004 #RHL RP \ O@0000@00 ,000BS00S@0 00000000<  0CS00S@0 00000000@ 0 3SHL0SP0\0 O@0000@00 <  0CS00S@0 00000000@ 0 3SHL0SP0\0 O@0000@00 <  0CS00S@0 000000008<@ty '~TY@0 N  #RHL RP \ XO@0000@00,000B S@ 00 00 000408@HL@ty }TY@0 k #RHL RP \ b O@0000@00` #RHL RP \  O@0000@00 ,000BS00S@0 00000040@ 0 3SHL0SP0\0 N@0000@00 <  0CS00S@0 0000000,000B S00S@ 00 00 00040HcP`00CS@ 0h 3SHL0SP0\0_N@0000@00] #RHL RP \ |N@0000@00,000BS@0 00000040@ 0 3SHL0SP0\0 RN@0000@00 <  0CS00S@0 0000000<  0CS00S@ 0000000D2 04#0`80004<0 2`   3;@P AP0S <4 000CS040h ,  @P, _ 8QQ #RHL RP \ M@0000@00 ,000BS00S@ 00 00 0000R01p0 0008h@0s0HaP0s0 P ?@cW4 ?@cP0ꨙ ^]]MbA<4 P0 P00CQ S040 ,  @P, '0@?SP`8jQH@P00U | 8080S@0; P `< 40 0 0C R 4  , U@P,O00 H0⃽@PGH0TP0S< <4 000CS040 ,  3@P,  8Q[`P <4 000CSST 4 T  @P(00H23 00@P(0TP V@ 0 0XXPӶ@PXP0S <4 地000CS040 ,  `P,  8P@`3 0R :< 40 00CS040 ,   `P,``X\` [`XL`HSP| x0RQ   R=04 RQ8800C?o20<4 Dp000CS040 ,  `P, $0P0" 0 0<DO`PDp[` 0S 0S P00`X0 `?o2X HpP 8FPT G$0P3P0%'T#p@- P`0 PP@0 ыp0O-M @0  ( , R 0 @Ѝ    0RL ( 8 <  4 D/p`00`0408   D0M0PSXr 8 @@@) #RTHL R P \  BTH L0S0P0\ 0  0CS"KTL000, BTL DX @P OX0000XD0X D0000D0L0 DA AD!(L0S@O?@00S0VT0S 0S S XV@ 0 3SH L0SP0\ 0 cKX0000XD0 <  0CS00SX D0 00 0 LD0X , PHLPP\# DX@PX0 P Q- #RHL RP \ $KX0000XD0"  @Q0D@000D00A A1 Z,000BS00SX D0000D00S_40X 0 3SHL0SP0\0 JX0000XD0 <  0CS00SX D@0000D000T00H`P0 `00 0 :3׭@P Q0S TH 000CS0H0q L  TPPL h PN;0sX0 F  #RHL RP \ oJX0000XD0 ,000BS00SX D0000D0800X 0@ 3SHL0SP0\07?JX0000XD05 #RHL RP \ (JX0000XD0 ,000BS00SXD 0000D0700<  0CS00SXD 0000D0H700X 0 3SHL0SP0\0 IX0000XD0 <  0CS00SXD 0000D0600X 0 3SHL0SP0\0 IX0000XD0 <  0CS00SXD 0000D05008`<@tv RxTVX0 Q  #RHL RP \ IX0000XD0 ,000B S00SX D0 00 0D0408@H`L@tv xTVX0 h #RHL RP \ _HIX0000XD0] #RHL RP \ 1IX0000XD0 ,000BS00SXD 0000D040X0  #RHL RP \ IX0000XD0,000BSXD 0000D00,000B S00SX D0 00 0D040HP #RHL RP \ HX0000XD0 ,000BS00SXD 0000D040X 0 3SHL0SP0\0 HX0000XD0 <  0CS00SXD 0000D00Q #RHL RP \ lHX0000XD0 ,000BS00SX D0 00 0D0 0R0100000 08@0s0HP0s0 D,?@cx(,?@c0ꨙ ^]MbTH pP000CsTH 000CS0H0 L H TPPL wW@EP TH 000CSST H T HPP`@000 300 uPP@0T2p `@T H0 0 0C R H  LTHPPL900 `0 PP1`0T0STP 0H 0Tpp嗱PPp0S TH `000CS0H0 L H T@PL  PX2 0ROT H@0 00CS0H0 L H T@PL@)pt$ #xpd`,hx |,0\R  0 R0 4\R800C?o2,0 0SG &$SR0p$0 p0@?o2p$0,p,p0p$pTH \000CS0H0 L H T8@PL 0P<0" 0H 0T\@P\W` 00S-,0S P00`X0 0?o2p `!P$@ $ <0Q0 0PJUc0 0S0R0S 09)  匆(P0%'p@Rv#sr8$srHd5 3 @P XIT0  g  (00@ 808 0S0S0H0 L H T⬿PPL  H0@?S`@PJHP@TO-@0lMx/0 0@@00 00P0\p0@h00h0Ҥ U L0 (0  <   (0⻾U`< 8 " #RH LQ\P@@@D[L0S0P0\ 0  0C[/F[,N, B RL (<@P JP`"<0000<(0< (0 00 0(00 K K !(L^00SlPI`?@@00S0T0S@TT 0 咅pX00H0000H00,000BSH0 0000000,000B S00SH 00 00 00040HsPp<00@0004D 0 04 3ء@P A PxV! D4 000CS040 8  ᢷ@P8  @BP` V8080<00S0T0S0U ሹ,0033 00 0@P,0TP0S@WW@ Ⴙ #RHL RP \ B>H0000H00 ,000BS00SH0 00000040mH 0 3SHL0SP0\0 >H0000H00 <  0CS00SH0 0000000Q #RHL RP \ =H0000H00 ,000BS00SH 00 00H! 000001000 08|@0s !?@cs00HoP0s0 ?@ceaD4 P0 P00CI S040 8  ᫶@P8  @AD0@?SP@AH@ꨙ ^]Mb P D 40 0 0C R 4  8 |@P800 P0⪭@PP0VTPK D4 000CS040 8  [@P8  @AA[.P D4 000CSST 4 T  @P@V D4 `000CS040 8  (P8  @A @Z 0 0``P@P`P 2 0R $5D 40 00CS040 8   P8`d hTPX'S R00$00S#S R8HoD4 Lp000CS040 8 4 DõP8 _`P 04 0DL⋦PLpY㜠 $0SX P00X0?o 2` PⰦP @@P0%'T  00@PlU U ሷtЍY[OO-p M0` |0 00Sx$@hAᓷ3 1 H`P增 0 081   E"   E$EVP  0P 03P 00 P" [ 3 000 0VPP PU 003 00 0H@Ѝ000zS0P*$ỻ^^E]G-P `Mp峴PL0S@& ᩴP 0{003 RP@ 300 ,H0S0 TP@ 0U&Ѝ <P0SH0S ⽦@P @0 CS 8:8ꬶ^G-`@0 S_Tp  SXHPڜ0H0S0S 0 PPtႶ@1 3 00000 00 0 P _\UU0S 00   zT 0S 0zTeT L _]Ѝ0 P<O-0pdMZ@dЍ%`000D $0e8 P@@8@# #RQH LQ\P AQL0S0P0\ 0  0CS:T, BTL $8*@P >800008$08 $0000$0m0 DA AD!(L 80  #RHL RP \ :800008$0,000B S8 $ 0( 00 0$09 6304000 00 00垝@P XA4( 地000CS0(0 ,  lPP,  0R>@=2 0R `54 (0 00CS0(0 ,   KPP,`P T`XP@D`'SR0000HS#SR8``Foob4( 0 00 !8808Ѝ0@- Q@80 h0 3    808 0&8808Ѝ @-0S 00 3 ЍO-M<0@8pDZ00S>>0 30 00C 040S4L3,0A`0 : S 0003#0 #L#32024P n0n<Ѝ$0^ $0 0An0P m4P mDTU Tf]@^k^@-003!z?` 0 Ѝ^0@-qPM:Ѝ0@@80@ 3P@z?00`0 Ѝ0^C-M8`0@XP:@őD  8TAVp pϬQ @$ @P@ `8Ĕ< Rd`Ѝ^^^O-p00@ S` 00P `ƿ 0  0QP_ p(80 00j`(`p Vw &0 '00C030S3 L32  B \%D1R.=S+T @v0P SX0rpppZ ڨ v0  0 v~00C00 ST0T00! B!00 080 0c 0ᨖ`` V" &P00 0S ЍU TO-,M 0%!`0 @00〖PP`d\%1R=Sd `1R\0 嵏ip1>0S100! 0 $=$S 000W0 00p50 00Tp4$04L3 $2   0: S 00C03#0S #L#320C2T3S! !,ЍO TU ^v]G^O-4M 0`0d 0h0 @0l00?  XP)d\%84R=S d  ?0( p#T S`00 Sl` Wb w%P0S 4ЍO0  0@@[ %0 %000303L3 2   \%3R0=S-T @up0"PSX0b```X ڨ u0  0 u}0h"000ST0TPP101T3S!  !80` cpW!$ w bR0cQ4 0P`, $ T0R3, 00SG$00$04  04L3  2 ` `$080aP0\00~$``Wf $P $08 0C$08 4 0S4L3  0  A 0 %%000303L3 000V(00Ss 00lRPà 0@ 0oH$ 0$@&31`TU ]^^^O-p` P,M?@ᔠ0؀Z 1\ P$0 0 T0 C)C$)0c<3"MnP $ 00\ Ó\ j,Ѝ00?0 0 ZP  0 0p `z$0kTU s@-`@ PUЍp80 C0ST1UP! 0PT 0 U"000/ 0C0O-@P ` Tp Gg 0ga2cwʿ 0 {0 0C R S R0  ЍO'O-0@4M2$0L32pPWX 00 S' T \%4Rj5Ϡ," T0/ C,    )`C)0c <3.m0P0,0t0`0S 3S0S00 S b\%3R=Sb00 S? `0, 0 00T3pS !!! \0SY0\ 00\0IT0Q3? 0,00000 ,Tj4Ѝ00ł." 0 04 S`0?00T0Y p80S6I0S B`0, 0 00e p?ና 80S# C$0 0$04 $ 0/4 $L3$ 0 40040T3S! L RQp0Ss00nR310 p0 S, $0 0C$04 $ 0S/4 $L3$ W0 B 0!0400C40 pGa400400uᕁ(T3 pˏS !!!0 0S  s00`R31000,P i pDTU TO-0M Є00T0@H 00p SP; 0T !`e``0 Cc ca5bS4D $P<0`@$!0c ĒP`U08$<4X000 0S  ?ᰒ0 0000 0sP 0 啒0 0L0000 0P0 0 Rh  h    ʯ L 0 000T0ЍL0 ^^QMO-`LM4000p@ T000 $40 00: S(P,@ 0'0@0,[ N 0EI? 0B0 00D0R ,P 0 X*Q6@ ,0U0P#@!0H#0  PS03 00000&0 40LЍL P* [Y0 LԜ\*[X 0 P%Q!$+KQ3((HQ34,R8< 080 !<SD0༑0S015 8:#Q< 0*0 0 娑0S X! X03 Y P  Y1 Pf L320[a L$2\ (\0,QH30XM L$2\ (\0,QH30X9 L320[2 SD 0C0AD @zFl>M^^O-,0`@p(00P  `p L 0l7t0̠\ HqQ 1K^Mt0 0/W0 0 0#Ϡ80![ K P0  @?,`Ě@0A 0V 0S@L#" R: Ϡ!800L#" R*08G-p$0P` (0@  `p L 0l6t0̠\ pQ 2I!0Qt0 0/V0 0 垐0#Ϡ80!Y I100 劐 P?ፐ,`JP0A ა0V 0S ?lL#" R: Ϡ!800L#" R*080O-@pP4M ů 0O`\%Ł4!RX  0  0 T 0 N)N,)n"3>i0P0 ,匣0P0 S 3 S 3f004Ѝ;^9^ ?0Tp S`  00 S4` X hP  , f0 0 00C030S3L32  B T3S !`f` ,kfT0[300 Se8 `  bX )P" $08 0$08 4 04L3  0  0 00C030S3L3 0  B X00!8 x bRPa4 \0$ $ 0Z*$?A$ QL  0A 0 080aS0P00 Q  q!`RRX 000Ss00`R31TU @-M@0pp04`PP 00pЍ@Ѝ蝴]@-(MpM`0@t t```PP (?@Ѝ     :p0,QMH^O^A-@P 0 S 00 p  `V00 V K~ | 3A(O-`0$MЅpP H@!> 0 @Pm!   0@M PbX 0 H@$ЍO  I Y T0 T3?Q\ 00S P `0S@ $ЍOl 00 h Y  # 0 00^  .T" 㕭pP `@0S 0 SE Y @ 000;  $ЍO $Ѝ誴]O-\M00@ 00sc<0`0P Cs cq6rc4D $`<0p@$!0c $`pV0‰刐0 00000P T 8)0 1000 0 00 000"T040 0S  ?4 0` 2H0)0C 0L3T  2 0QS8$<4Y< 00<S S<0`SD@$! 0 Í$ 4P0 80S  "00p7` 00 0<0pP0`0080S 00S" 0 00 0 0Rh  h      0 0000S! T0P C)C) c1<62 8<0DeP00) C0ǎP0 P0 , C P0 00S@^P00000 00f0P$0Q $\Ѝ0S28 0B 0D00 ?L0 000/0S 0/DS0J0T0(0 \%5R:Ϡ*" T0/ CT    )pC)0c <3.f0P$0T0,0p0S 3S[\%5R=S[ ?@008 T S`0?0000S2,0, 80@00 SfD088 N0L0@ Qr,0 A!400C400S A40040(d 0TS̠80 @0? QnT3S !  ( T>0Q3= } 0 0 Y00S>>0P3v r0SP$A$ Q LH 0 @ iTP +b(6 00 0s cP000 gP0P0 , P0 00S0$00  <0D@$0C!d 0 ދ$ 40`R0#l00S t <0@"0TR40S Pa^^]X^H^QMTU T^^^O-pἠ0P4M 0 ?ᤋ0@00 !0\%0$01R 00@o&!! X0 00 `"P ? j2*!, ZS QS:dP ,l 00\ Ó\ za4Ѝ $0 R  X   !:,aTĴ]U O-P0@Ḡ $M<0\ `#,^ 00 0T ? A)A<)a>21,, X:@ 0@PdP l 00Q Q a $ЍH  0 0 P`aTմ]A^U O-PḰ@ 0$Mڊ0\Ŕ00`0!\    ?  ?` a2! Q,S QS1, X:@ 0@PC >dP l 00Q Q ` $ЍH  0 0 P0aT]A^U C-`PḀ@p 0M{ 0\Žß0.SX! 0 Q   ` ?0W0M85p@5pL0p00W00W0S? (0Tz001<0&$00 `001`00p0$0d0 01010000p$  0fpPUP08 c00\`dT80< L31)l< QR>QR!<`0d 0001 O i`00P 1`80d0 L pl<000\0<827,< P0 `6:d000000 0 00bpPd0T0<d Cb0)C)0cl1c"8 <`Dd0!0?o!2R0S 崞pP 1Z_Ѝ]8u@%@4L0pp p0W403d000p0 0 bpP@d00T0<d C`0)C)0cl1c8<`dT80< @31)`0 QR>QR!8`0d 0001p(0T80&"00 `0010 0p0$0d0 0101040p0"  0pPP0405@50%0L050(0T{00 `0010 0p00101 0 0pPad001p 0 0T0 C)C)ct00<21 0P0 c0c Cl1n1s V  V  Rh  8 #.38,P0^*85 @5 L00000 00R  Q RM (0T )\5S0 1<0 1<00@00 p0010`0p0$01 01010000000<00@000pPP 80 B2 b081") !0a''0001S 1$ ^ Z0P 0 `B2 b6<>"p0X Q0 :1S 1000000A\8e@4 L0```V 1S 00`0 0 xap(0T\5&S0! qq p0@01 0 0@p0$01 01 010 0`p@ypPh''000Q0405@50%0L050(0TW0 p0010 0p00101 0 0pP=1S 01p 0 0T0 C)C)ct00<21 0l0000 0 +0P40l00Cl00 0!00n(0T1 `40H0 0p001 `@000 0 0HOpPx0"d000 000tp`0T0x`| C)C)c2160" * EpP d^pP0 0a0T000000`  F 0f Ϭ2f\\d000 00 00  0Pd0+ H\J?o< 2 R0S R&0 T 000<0嘠`l0Vd  0  2 `Pd\[`X[< 0 bd0000000%F^P 庾d H00 1d[000" 000 K4 00040S 1S0!0Y@ P0 c0c Cl1n1s V  V  Rk  8 #.38,P0a*85 @5 L00000 00R  Q RP (0T\50%S0 1<00@00 (0010`0zp0$01 01010000000<00@000kpPZP 80 ` B2 b081 0嘀 00 ~0p !0001S P 1T f[ Z0P 0 `B2 b60>" pPB Q0k*8e@4 L0```Vw(0T\5&S0 @qq(0@01 0 0 p0$01 01 010 0`p@pP0p  1<00gyXQ0405@50%0L050(0T0 (0010 0p00101 0 0pP1S 01p 0 0T0 C)C)ct00<21 0l0000 0 '0P40(l00Cl00 01Sg(0T1 `40H0 0p001 `<000 0 0@pPx0d000 000p`0T0x` C)C)ct02160" * pPdZpP0 0a0T00|0000`8pL0d000000 0!&]pPxd00H0H 0l0L R 0P00 Y0P0`040pT0x00040<0@0ߘP dYR(0T1P pl0R 0 H0p 000 0<@<0@ 00 0 0<@p001 p 0000<00@00 0BpPp0h0000 0000T0 C)C)ct0201<" "8pP0 d3Y080Slx`00V;:40S 04 h@hh0YpP080L S0H 8001d YrYp10QXPx(0TH0 010l02H0 0 0p001 01 0000 0`P dXp0 pt0!R  !  0  T B)B1) b082 0 pP 000004l0 2H0H , R0:0 h@P 0S 0S@$Ѝq@P |0pJHp p G pp Ԁ뼀00 0  @<p00 @W  A Hཀ0H0P L" l1.Q0*  M0 S 0 S@ 0p@ 0 | p| ⎀ |  '  ು@P  {     开帐s -@l@jA-P@00S> 00CS:< 廤PP0Sk@p?oV20#S 00W: 0R R 0000@ R@ R@0`@-A-P`00S-@ 00S@ 00@ 0 k@P 0S 0S@Ѝt@Pp 뼀 00 0 @Pp |]@ @ A HHp k@O-lM0P8000000080H0000 00Q.80S0008 080}<Pd00`00 00p  0` PEd0 75#T20T20$ ;60 0RCt ?0 0 0 0 080<000P0)#00,dQ@Pd@P dSlЍd0000S0$000$0?L0H0SP0(,0 0塜d00 ,07<00t RWd>T0, (0S,0$00$0t 4pLT0?X00## `0`V(@1@pD40<0@ SP0D 05L0 R00S 00S$01pp0 0 80000C0 0"} T0 C)Crq)0c9s 0 p@h  R$ !00 R4 $  * 080S04 S400S @" 00 0000S $0! 04 A0T 0 0X 0 0pG` 0@00S@0D00D0400C40}Sڤ0 00\0C00 T0 C)C) c0<;2  0@P\ ( 0T0R0S,0S @0,Ǜo00? dR(@(@H0S d`ST@@S^A-`P!0[ @pjz0 Wp0 P  $0 Q D 0! 0V`0 P ( ,0 Q @ @0D 0 @0D 0  UP0 P 0 40 Q$ H 0< 000000:00Ѝ    G-`0M0@pP 0 v00Sn p0@ 00@ppp\%1R,5S0 0 0 {0 o."p1`\%R  0 ? Ϡ ,2 `x 0{`0 C c00T0 ` C)Cba0)0c03"9U0P   \Ŕ P\x 0@{ ^}W kR0Ѝ0  {,R0 TTO-]M 0 0$0@ C0CSRP]ߍ0S1  ;100`pS00|h$0\5SB\\?@5D0L 04;$Z$SØ,.1  0 Su0R:$SZk00S(p| 0)QY 0000 P0  DbP8,\(Q?00 \P0T&/ 0T & 0 000PPr  P(P(8Ŗ0 @L ,QYP! 0PS 0ᗉ )R 0Z:0 0 (00$01 (0S$0 0kP0( $ c2# S,P!Q$ RQI P S1Q\Q\3PR= (08<$ $0 H0ï (0ZX/  0჉10(0  X$00 ( $0K PP 10( $0Y #H0d( $ . ?= 0S 0 S100 0 PP 0v0S ᡺ 000000S0    00 0PP 0 a? R02! Q., S,Q, US180,08 0S40800<0,0 0St P0T 0SX0 0S`04@00/\d ` X  !!@   L/ X  !P0Cs@0  ^  !4!¯Y<  Y ^P Q  !P0 C 0U00 0|P 0Qq1(( R@ 0 Pe1XXϠQ(0 0$00 0PR(   $ $   0, 00802s0P0U0 S0&t P0 00Sp00S/0S tx0| \%0R  ! 1( H  0 T0D C)C)0c:"@h0 0P00DQ" 00 0 0<00S00 0@ 0/0  X* 40S<0 0"40< rs \%5R400 0!! 0 40 S<00 P80, @0ᜠ `9;8^0D:0 000000S 00000 0040 S<00 P08, Cᜠ c3;P0):00S118% ("6600Q$00Sh 0_P 0 b R320 QP1Q SQ ☀ PBᜠ b<  XS:0 BZ%Z b^3P2Z0U P11(0 堃S$0  0H0(P5$5C2000 0 0E00_= 0P0^PX 0Y'0%0 0 0.PP  0 S100 0 PP 8@L0    1ptpt1Ԁ 01Q00#S $0U( #Pن(0 0$00 0 H000 0R     L   0 Rh  Bh    R  V000b\%L0R !0 !07 P L l0 ^85L50% 0@50 08Q Q0000 0S 0 01H0L 0ɟH0LX8L0@85@50L0T^ ^HXp8Q Q000 آTS0 ?H0L 0ȏH0LTPP 0 R !/P !!0/00S1/P11/A-PI0pMT@@P ` B2>0@@ b@ "<1@P 000 x9SM@Ѝ@KG-p0 `$PGL@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000-KPjOC-0P0`ppd@T 0 qOp P ЍT80< @31)` Q0R<4Q0B@ 5  a3SxlØ|h3 N,t3 p9#$+ 00Q000Q 00SQ  B2C 3R0  XP 300W0 0$ 00Rp00p0 $0Z @o0?@0\^ ^ CP00 S 0 V0   02#2L0R W00` 0@Pt 2뜰40 00800 0(b@P#1(#1L0R5_40 2&CIP0& 0 # 40 02 X c ( T( 5 B0S 00zxW 000S W  @40 @20  0 &CO@P4 00"X 0 ,0,,0(xK( ( $ 0S( r K p  0(@P 9S 080S }@T0$ S12 @Dƀp@-P_0P@ P0  PPPp0@-@0@C-/p@-P0@ `V V 嚏00(,PE ` \V0E/ !SCE?000V `S000p@\ 0O-DM( 0K`(0 h1xP 0Xr QRsQ0 S0,0hf4300000 `$0V@Y W0?R0 r00h S W0( 0Mh0 00Sh00h0 00h00009S@ 08@T @ 00\Oo,YBDЍSP  B20< 0 b71" 5@P 00;,9Z t W?Dt<00 40$0 0R40 <FJ|0C0'0S 峭 W0 0000`j <00 9<SJ0$ S SJ W0<J(000 0<009<SJYJW W0<IZ 0 @P  ~ 0  @P 9S 080S @lTj0$ S00^O-P,M0` +3300@ QO pW U0 p00} { lɈ` @ `Ό4\P0P  004Qh0Ah0 0c?0P B20$  b41"0 1P 84t<$0S Z  X$Gt0@|00 0P^00*`0 C# c.4,3RS" 00 00CP  004Qh0Ah0 0c?0 0 $0 0 S  0 0Q]  0 h 0 hP 0h0@p P0PL* 0@p 0D00 B?r0T 0Y0 60Qd0X0000,ЍMO-P0 0008<Ĕ?QrP0 C c00 0 ♕P d 0#0X  0 h 0S000 0p,pp000傟 08 1B00I> 0008<Ĕ?rP0勱 C c0 0, WP d墩W 00 0$ <0h00 000S"sB^f^^^M^G-p0`@ PU 000W Gh R 00 0h Rh9S000J\MO-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MR Pm p$`W0@*F,Ѝ ,0W0*\0Q.00k T0 C)C)0c03"DPd 00\ Ó\ ,Ax(A0吸(X0: 0 TU p0Sp/0@-@0M 0@0@ @@@ㅜ|P|0 0@0@ @@@wL0 00@@ @@@ jЍ0@L,^3^<^8 p00CSp0/@- @@L-M yPjoЍE^@-0 R  @ @0b ` 0\lЍЀO-0,M H P00 cpۗW XX@?n /h+p+ 0 $+4C0P0 0劉  0 l %0 ! %g@4\%R0 004\5 P  p0|t4RR  d0h0Z 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3k  A000T0P0,(5 0S0 @0@00T`0$S> ) %> 1S 0LLH30V0P$T40X4S E>0X440`AQLY$5S0P>$ \| $3\`P P]P0 F800pH0Y40LpIT0 C)C)0c 03"$C0Pb  00Uk0 ?80`$%!0, R0 b0PTp ii0 _."~\5P S 0 0/ Ϡ , pPx 0Mi`0 C c00T0pP C)CRQ 0)0c73"BPP ḃP$[0,Ѝ"   :?ᦃc]]^8 TTX^h^N^^0O-PRp@040x 4  X?0 0* $?]BPz40l0?\%R*   L&\%\%DR) hP)H  VK0P ؇@4 0nj  P0 ʇR   %Rh?SX@ %  ' C  S> ) %> 1S0P$0T40X4S E>0X4h04 Sr>0400P008T0<P C)C44)0c"03AP440$ R:L>4 5Ҡ  0Z0S000004圀AEP$%,0R0 0BL0Yh$5S0Pŕ, Hni4lS944S@040T3$0P16\1,10 1(5 0S0@0@00P :>0 $  * PP$0`p0,0 0t D t a /o bH T  BL 8 48P EZO   <Ѝ000,20V؞0800P00 0800S40 B  HLT0 C)C4)0c"03AP+4 0Ii0 4=804d$%0 , Re\4S  5  0 000V0 0 L円 T h倆в4P _=U P q(l00:0@ķ]8 TT 8T^X^h^N^^@-0S0kP@ Z@P 媁 Ѝ 070@P XX070\`0u/Pp\h0Y V;8C^ Xeˁy^^A-P00`SP pxY@P pY@PHt0  В`@ЍDG-Pp3 M/`++  h0$+4P5 5h 1 500Yh00@\%R=S04, 030304040 50@h0" " 200 004 \% 5W >= Ѝ:T8 O-,M@40AwNp PL30Uo[P ,Ѝ800`H0S40L`GT0 C)C$)0c"03 `9P$ 0g0$000S<8 PQ:G-`MR RPpJoA(RP@  XPU!@4 (W@P0 R@j0lP  Ue 0S 0 0R\cxUU 0ULj0 @p0&00 0儕@T:040000 0cPU3PPPPE B@T0y o0@yT`P & 4Ւ RP 0M`P=S0 @P=04=S:0 0S'0SM@(0 ^@PP 0 0S 50ó 5v=S  0  @P Ѝ0 5< 00!0000V1 400S00000\4S Mu/V4 5 0 5=S U␜=S 0 3C>00~0SUP{010@X@V@T]X^^N^^^A-@`81pPP 00 pP==S IP0 <=0S @= SK$%0,RL1ಃh寃P 㪃T"Vᣃ000:0O-p@P=MS =S  VTtT`@\ VP4VT 00T RdX'X Tރ :P`凑=S 00D2C^P`Ѝ  P ~T0P`~ 0   ],^Mp@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0P 9 ;909  000&00PP 9 ;90[ 0 }00p!1/0  J00S 0 Ѝ0Z } W0 0 00ЍM/O-0\M0,0 0 0) 0% 0 000 ) S RP0Sc0$0$ 00 0 ^0W:$0S$= 00嘠 =<000H p  (00Z08@0 @0<5  L8 $  P ࠱DZHDP `l:l \kWhQ VW08 l \0  Q^̠^Q0 ^V-  0`X V%  0r(0 V 0,000 0P(0S *#H0 .`n`@ ?ǐ0:P00S"<0S #H08<ř  ß   . ?ࠐP0S 0)a08%0`00`F0 <V`!V 80DSL000 SH00Q0 "66 00>00S`00000040"R4 0 40TrqTQR(0@ 0,00 ;P< H0C200000 0'"0R4 0 40q[ @0Sg0H(# 0C8RP\ r000 #8 800#(0(PI $00,0 p-\Ѝ~0, 0 ( @  1/|[ !p@- @PO Pp0p@0@-@Pp?9S ʰ;S  0"`PQ 0 SL0L02 k0P0 0 $ Ѝ O-需LMP4  P3t:Pq R0030`5805N:dP `< . PS!QS0 D p@ @`>8E R@(@@@Z@@O:0@(p ,,p0pL W p!$Y0$p Y$p B:8 @:P80% @DWT $@0,0 $KdP 8_78Y 0嘠0 0 Z$   0 $ R0 8P F7 45LЍ(@@u@ @Lp@  ^ @ `Z>*(@ L 8 <@ @<:O-@P `R0 pM0 ЍO= 0 P0?:P= 0 6S ЍO*0\0'*㸰: 0 0S  ዛ) R 0P0 1R H0 C200 000% P0S  ЍOЍO-需,0 0/\*0 ,\0 0 ) %o,0 V00P `0 B2>@ b6<bP0:0`40 `FV`00!c@P 436" 0 @P6<Ѝ8e`@`L`(04S 6oTQ 00 0S:46@-P`\@P0 0@P    0 P0 zЍpvdG-!0P`XM!0 0S  XЍG0 ?_0p p 0 00000.0>000 㚍@P: W000 09@P-$= 0S)v 0 1@@T0S3j 00S00_@P  0  0@3 100XЍ2 3pP 0   00>3@ƀvdA-@P0@P l20 p\4SQ^Sl4̠  ^P @Dő L0 ? 8<őH 0 ?00@-i ^`  R ^ 40Sp4O-|Mpᜠ0W@P娐`$0p 00$06e0@0 T 0R*Y   Q L B Pb<P" P VUq\PMPP\I 0 00|ЍP$8(L0 C c2#00000P C R 01!01/P 0R0*@0 @!0L A1 a<20! 0 U8PY40 0P00 400Q00000 0P0400CS403U c10Y 000 &R00S P0Y00L0 C# c 9!300 v0 6SnP$8(L0 C c2#0g0!CXT 0 003 UC0 0000$000 03PP 0 = 07L0 C c#3800 9!600< 0 ~|2#T20T2G/P  0*H( ( 0 , /($(0, SU( 0(  00P 4'0Q0YW@ď000\0@00D0T00 S00!1 0001/P0Q00WS@ď D0T00 S0 1 A1/P 0@00 0 W  R@ @ CP R ' '1/P 0000 ƀ@-0S    P (000 00 0 <Ѝ81N p@-0@00P`06/ 000`06/P t00pO-`DMl0hp$00P 0Bc 00$00 0"R 0 01/0f? 0004 0>0 @S0$F F6S0JBS @,@Ay`F`$0pWƟ ?$0D1 0000,0 0 0圇`P ; xDЍp 00 t J $   01/$#08 0 ` 01/,Q O.$`$0`S 6CP  8?P<0 00ã 0P/NM;N\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-Pp@` M9S$ 9S000S0(0)9+ 00000 0000 8/9 ?o209S%0 0R RVoBh 0! \\0`厐DHq hQ Ѝ!]!^^@-0,@00V@"4/ЍTxTw^0@-@0@0S00000@@PD @DPPP  00^08S00P0000^^^^^p@-@`P(0P0  FZ P bY000@09#60pO-P@p0KMP0`@` ?U :Kߍ 0 0 P O00!Q P :V& ' R(.\R(, R\ SP) .RP PO-P1DMp000 @0d Bw  =w 00 8 "1/ d 0T2$!U#Q0 D$ d(UTI,S$8(2^<,VQ   PPV0 4  0Cp 0000 000 {1@P0 h 40R `Fh 0` l  0v vDЍ8O- p`0MP,00, 00@0000D00t00 ~@PD09H0 00 00CS@,00|00000 S3P |0S080,00S@"PM@`00`0|0S08000\0H0\ 0S0T0R00S0P00000P000000CX00ST R ?R3:@0X@<0@040X0  8000C$0?d00$?`0$0`0 W00 L008#8@0 0h0X0L S<0S0 X0T0< L00XX @60tP @XX0tP -0X t00?@P $0 00t 00ഀXj & R  (0 P(0_ (  R ( Rn 4 R      HRPXPbPdz0P S A0 [( RE 4 R  R> l0^Pl0740SI 0SF\0X080L0 000tP ,\0S| 0 ST0(R00St0,00 4X$X(0h0@0C(0(X @8  X Q :  0  <0S\540XS@@)@@@@R0*#d0@圀0S0@ @000t=,H0S 0S0X 0c0T0(0(儠0"ZQpx`,0x0@00 3)H0S@ 9S= D0 " P@0S $0d `0U0 0X00L0$0 @>0P0ЍỀ0XS$0 80LJL00 L0 0 S 0 00SJ E x0q@P@0SD0  \圀P@(0(儠0"ZQ@  x0q@Px0, 0w x0q@Pw0SX0$ ( 8  C(0L 儠0"ZQ'px` xpU@P9  0 0 ŗ 0 `p帅P @o{8^^@A-Mp@ `0. 0?PP% 00 T 9 0C8C8900000TP00 0 9S00003/Ѝ0 B?PP 0R    A-Mp`0@8PP%000@@ 0 9 0C8C89000090H P000 9S00003/ЍO-,M00`pP0 0 00 P *0 P0 00000 0 00$00 ?}@Pj@0$P@T S@@@@@ⴀH X  R R& 0\P0@X@Ǒ!$@P@ T@ S@@@@@ 0I-V0 XᴐǑ@őPS "440 V ~0@P00 R ?R *  1/,Ѝ]^^O- 4MPRX0U0 `0删00Jp ((妍0 T @?4/@P7 0 00\ 00000)b@ "4400  00C00    U;~@ Q0 00P05/T@4Ѝ 4ЍO$]^-DMLH ,  0嶐DЍ0]@-0"GP Ѝ@-0 \ 0 00\ЍA- MP8@<`P^0yᨀPPP)0P p@` Ѝ 0 C@-)@0= Ѝ@- @ 0  0)0 Ѝs@-`@0 0DPPPP L0 00 ЍpO-|0p s`0$H @4  , 0# #88DLS 0 K80 0 p=@PX0|0#880'00 Rd0X00$00|0 *P\P-Ѝ z0s8 0@@z 0 { 赐@*0 p~@P 嬰0 Rt 娠0 Rp000*P\P,"sr AQF00 0U 0A  ! 3F$0!EU =  !$F0Y$0? U7  ! F$0!EU$L  R0 B0 0C%A Qʸ 0! 0E  0!0 0!E[0$0U% 0 P00Q 06c 3c 0c0Ks *c0 `C0 00C 0pG0Dp0C-P`dMp1ȁ̑@0%T00SdЍ,0(@0P,0Ѓ(0,0(0SX0(0X , 0(P\0P0 )(0SX@ @S , , , P0X0S\ , \ 0P0SP>0! 0 R00R0S"000P0000S )(0X@S, , , 0X0S\ , \ 0UP3@^ 0 !6/ ! ! Ep@-PS`@!V 01P 0 8 0ap0 1 Q000 !  !AR !  B /A-p@P`j0 00A0p@-@P`Y0S00p@S000 p@0i /-@ $M0 4  *( 0 0 00s$ЍN^ @-vP00耝A-PĀ@T 0S 0ps 0S 0  ᫿`Pᢿ@R0  0S; 000C0^ A-PI P P MPp| `P @Op p9=77I7T ^@-@ PyO0 0p@-@PT+ 0S Q 0`00C000: 000Ap@ Lu. 0 0 0p@7 0S&ꀝ`p@-P@ 0 0 0<6Pp@ 0s/ =0( $ A\ @-4 00A A"1S@ ^\10,0//O-(0Ip"AR0,0Paq>4`0AAbAT+W5 m@P`- 1@ S0@A ,CPQW`pV00C00S0S H  mo YZ @V000`@3O-tMp0圀P@`@ᘠ) ` 80 S6 ?8P 80`1StЍ"PR0%VZY|8 0`0 < 0]8 V_80I0 08P "SR 0 !5E80S 8 0J0 0p `?8$:00@ 000R   06P ; 0 0 0X%  8 7NKX PM 5V  G7 !OB7h0 S=8 Jp@ `t^ ^G-Q`p VZ'v( \A0$pp P(00@0?o2X0S/ $ AP0# pB"   40U0X (00(0XH_$p@p P(p@_,V0h )/Y L@/DP )@18@AS8 80< <@@_ȟބ]@34@/0@-`0ML@T LPL   @A0 0,0 0X0@@jЍ0耟@3^ @-WP@UMO-`$ lM@ ^0@pP 1@N@pP0 * 0w$p @v$zF  lЍP@p  (70I00 00K7P6(, Q0   T469 6(P, ZY 0Sllfy Y 4 b4 4 R Ὗ( ,"&{ 4^_^]g^ A-?Pp M     6  %:&p`@T @0 ЍMW4J4 4a4 0D0 06O-$MH L $P!AYp[ `4!C20(2>B"  YV^ |f$ЍO#0 AT  QPP SPUR QP  RQ  R R  0Rl0@P 0 <$!*᝗ߛ  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍOf0 @ <P z2 I2 2X    0 ,  4 @, П[G- P@> :U `D`(00@0$V0:Pp$01S!0 H0L 0 H0P0L T 0P0 T %R0XP5\p50`P(0p~^^ПO-4MX 09 98t0:cR 0P?d*%(0$ 0AT,0@T ``DF`pfW 0 0 0~3*$ߖ$!(0S, , " 80S< < # 0P 003($ Q( (( ,( A( $,0S8 80< 0@<00"S040Q,400400`0 000000000\0$0`09 0*@"*0 # 30 #6:,00$0 0! 0 0*qh0 d!>!0 \    ,  d . 01/pPF ᘚ04Ѝ0U QZD (@J2 0B!:d0 R  R Z x i,d2^6 d0$0 00 ۖp,0W N 0h 0 0,00 ``DF`fNПP[^O- 00S #6:(00T  $ (01/#P1 0B!_0S@(060/``0T:0ҙz<Ѝ0@s 0,  0J0S Y7 `P, ,20峙[ 50,$02P  , e/ $0  0  ᤓ,[0,*0, 0,e0, Z 00 0 0ПP^0@-,A,Q0  M*ZP & Z0,0,  P0 qP0$( R*0 000 t0&JP pt ,#004 ,0  $ 0,,Ѝ0@PПD]^#p^PN~^/O-pP@@0T00S  , f<(0  ,0`TPE   <ЍO-p@P,MP` V,Ѝ0 00 `q 8<0 T0@P`F0S/p@-tP@ 0Sp@X8 R<<8< ( R,,, (  П 000/C-p0@嘁$MpP`p0p0SP0  P0 00PI 0 R0! $  4 Q` 0 H\ 0i5/P2H\ Q \  R00QH0 0 S DI!P R 0H0R3$Ѝ̿]0@- 0 ЍTN@-@n 00 0@s@-@`Pa 0S0C 0Ѝp@嶶0 000 `2(0S, , " 0 (۶+)0Ѝp@Y4^ 0 偶4Rp@-@P uU qTp  p@O-$M00`$p` H @" @P 0HP$Ѝ P(0,PIPP0#20#000V P0吗0 H0H V00S#1s L0 00Dp 0 40&  zP 0 Pe0 HZ`PO-8`Cp<@P@ Ѝ$0!SS 80  ut U0S10 0Cp JPXhhߵ@T0WX0< P@U(ϵ 0#"SR3 (@00_ 00 0帵0 000QP (0SR0(0b( P,0,۵-(0X0 000 8S4̿]^@-@P  08   0R  08,0 3100S/ $Q 5/p@-@PpPU  p@ p@Rp@-P@ @T <p@p@-`$0S 0$0P@P   0I8p 0C8pO-M00pQ`@HPrPP U @T00@P 000U## 0 @-P@ 4P 0% 8 Ѝ&812U 0*0).0W 0 DL 0D0 00@^O-M8@0PpH. `+ 0 S00P  `P Y ,,h,, E24P ` 1`Ѝ0S ,,, 0  1/(0, #60 6P ,O,,^O-p00@`0PHj+0 Q0 00 0妏`P \,O,h, 3P ` 1` Ѝ0S E,+,Q,. q B6P 0,+<,^p@-@ 0S 0 0P`P   07p 07pO-`P 0M 70pS3#L2H200L2H2U300@T 0S Y@T? 00  06 [- r 0`"v+9 Rn U[n WI PC0 0  B+Y AЍ 9!J+Pb 0U 00  @@`{,@P  - 0&63PL @0  06  Cp  Y Wpk+:++u+ D  -Y[ :U  0DA'V  0 L6NpMp p+^4^=^A-@P0` 000U i   pP   00CS0500 U$p pM 00O-`pM$ P@T70`0a0b000Pp>0S .82<082$1<0S$10P$1}:4P8<040P0 H04 8\ P 4V@d\ b  Pc a\cb R t p  l 0 , c R$ Rd$4,(, (,J(,0 0  V H8 0DAPP 4P, 0 0 0(,',+(U,P8U  0'3,+( 3 RH#P~(' ( 0P0 0H0P4H`0 Pwh00 004p Pk00u p0 20 00pr2pY 0"2X0HT 000( ,0 0 R00@2`P \01/0 R`T\01@ \0 1@Pc0SH000#10Ul0 1#H20H2l0S0 2H000x d00d00S c0Sd00d0 H0P4Hp0 FP H`Ph 4& 0j2l,0P P4}E0Pl0W3J꘲H^]PT^^^i^s^@]}^C- @ pPP)l 0QR0S U D1P  P 0@0S ᰏ5`P '&#'JT 305:U ! Ѝ^p@-@P`q  p@9QG-@ 0S`pPU@# * 0 @P U  ZX 0 pX 0pA-@p@`@P1 ΄0 ?@p@- .    Ѝ0.   Rp@-P@ 0007p@裗00꣗@- 80000  0 ;  Uc0ЍH^ 0 d 0 d 0 e / /A-D0Dp0Pc00S@a၏0000ZA @-,0@ ,0,0t ,0 1,*,*h%& 00S :^%0@ 6, P0T80@-`0`PCK0h0L0aV1,@ m+0 P]^0 0@-#@~3@-@0SjP O2+0  K$T3^_E냓#=( 8=*0B"6 : `wЍ^ī?^O-P$MU p0E0`#O*DW`JSZE(QE NPE@@ @TH#` 0 p 0U5 0 0000`P 0F?o T20S# @  TJ3 `DU1 3`PE00 0pP  V $Ѝp4 0S/(0(0 S;3S8#0/l쫁A-p b@MPA  p101UP00 001 000! P i 0 0P$0( 00 00<1 00 $0 P  0 ! )1BPPp[000P P0:PP0 0xP00Ppy0 00X)30x0(#0:00 T Pwp@Ѝl0?(['^8^(C^x|TT8A_$OA-, N0RȠǠ̌' @N@  0 `p0PP ||ci000塎UNP(0 100 0 P HiЍ ]H^s^O-pP1` 10@0A@@00 Up0T0<W) g ЍO 0$P  # @ P$gPp$(X O$ Ѝ(^l[`G-@ጠHMT:HЍPp000!PpWZ``X`VEMW@ 2!$`[@-. .   Ѝp@-N@N@`P@ o p@4  O-@@0$M^00`10 NP  ^P  P(`00@p5ApF0Y0ތ`$Ѝ0  }$0P0S  0` +P D( zI "@0 ;j(l[^O-N@N$M@00Pu`P%pİPAeX0喌0 00  005$0PU (`0 `  )v$Ѝ H 8"@0 z^[lp@-P`N40@N@ 0Z p@vl[p@-8PPpw@w0P3#plG-p`䀟V@0 0SP%PU!0A0 0S0S  A+  0S 0S0S"U `FPP 0 }^A-Pp`V W @X$T@A0S0Sލ"000x""`W@0 0p|!@-@ 0-   0R  0-p@-0PXp0 :"@p"0S <"y"G"Rp@-@P @U < p@O-VlM4, $0 00S@lЍ40L0,0P00T040X00d0XPX` PLXo@$0 S 0$ 0CAP0``X000 00Cd Sd05$0(000 P(0X00\0d080D0<0H0S  0008 R0K 0H0S LqX.7Sd `0< IpP] 0@ P 0  Q 0S `0L$ Hk@000p >`0 HL P r #Rl4 0/\ hZf 0 6C0,0 6,0_@0S `0HL?$0 S @v0Sʌ!000d!!@ 0S l( `0R $@Hp 0Q L@D`0 ( I @,0DHD0H 1/Pb L`0H I"HD  01/P #Ph2 d0/ }LWX D0 @D0 0 &X `P 0DAP LD 0  !D D!D 00 0Y D 0  !CY 0 "D'P ED00 ]0 ? H@n 0 pP0 pp0p 0!pP 0D00 0  ~  00@ᬨ000 LKD%LP T 3( H)ꤩP^s^^O-4M\$0X0 ` !:-PXX0U@)X0 pCW6p  $ ?0  0 ,   @ 0,p4/@P #T$ U  Y4Ѝ ,T  @5T , !,1 0  !@ 0/ PP^/+p@-,P,@0 p@@5]@-`@ 0 ```` PP  " 0@0 0> 00 0 0S?!ЍpA-p` 0 pppp @P ? P!x"pX 0; 00X000C0@ 0`; 0! 0XD0 0 XHW1 0S1  ( 000ЍІ 0S:0P//0 R:P3#//kp@- P@q00e^p@誧 )^0 @0 .p@- 0 @`BH0PS   DD00 $p@I&p(0, 0 (0, $0Sp0Spp@/0C-00p0(`$@ @`<Ѝ(O#_xN^G-M 0p` @`,P0 P 0 0 0 0 `@?o2P0S0S 00S00Ѝ R 0000 0YP x0A /R0C 0a000/P @-F]P010p@-@P` ! 0P 6  P R0C P 0C0060@* 0 0T 0P3#pP 0Q pp 0R  S01 R  S0100S/0/-0 0R 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B &0Sp@A-Pp`e@P 6+0H10@0P  0 A"&D;$P 00S 3/000L00L @ 0@A-00@SP  Sppp 0X  S```W&0X   B YWW 0 R 00W K XFVV 0 R 00VA7A-@lp`I0S #S Pᠥ0S [֥000p@-P@Pp0S xp000p030/@-P b5-@ $M0 * , 000 00P Y$Ѝ^(A-P`pP @d*0 1000000 @ 0@AA-P`puP @F*010 000P 0 0 @ 0@A0-0\ ^^ P Q : Q*C-p @P(P Ѝ`0S 0W  0S0S$0SH0SU % 0QP0  00 I00 P000U X `F,p00 `p`` j P0Q00Q0000C0 00 O-0M0@0`S@PT @` 0 Ѝ< 0R:)=0#Z00S   X < V@00 R0V0" 0@ 0 0CQ 50C *0 0 0` p P 6  3P UV00000 0U0 0 0@S0#03R0#S  000 0` yp P V00 0S0 PU 0S:p 0 V  P%W \ Qp!*Q Qp!Q:W  Q *Qp!*Q Qp!PS*QV \S:PQN*V V  BS  S: 0 P` p: PP0S6:0P V 00 0 `0C 0 0p" Pt V0 S 00V 00 00C 0P 0` p P 0S0 SS:W V 00 00C 0 0 p Pp= 0S*VPPV00S  R*0S*V00PO- <Ѝ   (0/Y(0ꄰ0Sx@,2PW`,0 yv @``C4  p`#Ppp@-@PTpHP 0 D B0U0"&00 $00S 3/ `G@@-P@`p@< T@1V`!V@1 P  0S*0S = 0S*0S Q R 0S0S$0SH0S00 @ 000$pk!` Ѝ@SA-P@`pS%S@< T!V`!Q! 3@P @ 0S*0S 0T 0S:+Ѝ0S 

40 0=vF00000 00P 000HP 0 D B"&0DDH00 $00S 3/000$00xO-2@M `k0r   0PP 07/Ѝ4 R 7/P@QD0  | 8  $QvS 尾0r 0 0 HP   R^ S [ 1q30吾000 80P[ Pq T0H0S  DIe0P  0  I000:#:00 00H0YY 000 $0 03/0 `F(,0`0` 07/ Pm0 DI)0P0H0-NNNp@-@P0S@ S dS003/p@ `ẽ00CS0^- 0 ^: 0R:  0 \ P00O-i`0@@ 0 (0 $0"` 2 Q?Up0 0S?#03@, 03030300ߍ(ʁG-M`p` P0  c妓 t1Ph1BU/PBQ<Rғ @F ! 0L@CT04 ,  0000<0@0D0H0P0008  0000000 0JЍ1L0 0S S 0CS Ƞ LȠS QP0@HDH0 S*NRQ0a/Q/0S //C-Mp0@`00 0` P<0 P 00 000 0P?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0Rb*^ 0 B 10^ 1300,0堰0#3[ 0I: $ ^^80@4 60  0 DP Y 0 03/:#:S^X  0 - 0D %6SP0S 0P 46R*T0 x00 0Po 0 i[0ʠ,ʠ 0C00S >0 0>000< 0#03\03@ Q03S/O-@$M:#:S0>0>0 T*!`#60 0 0 PP   ZP000% P 0 0$Ѝ R* Q R: R ! 0 $p  PR0T :0 000 R R:J`H[ ոW и0T:W [ [0!W00S 0 (,0 D 0PJ` DDP QP̿]O-TM( 0aP40< 0TЍ   PHL @\ 03:N@ @@| 0C400 #@3 S:<0S03:QT0Pp0@0<0  P0P$0 0 0(0S 80 0D00@00<00 0H00H0C-0$M@؄SP`p0 0Lp@07/p `P ,0 `00000 0p0s$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0   00O$ЍO-,M\p `P0T@ P(X0S0 0S0G| 0 W0w W:<0S ,ЍZ P0pG0 0SPZ p0$080$000  KPp+ZX0X X0 !0L @0 ." @    !\PP   QU@TQD+E 00 "> 0D(ԫ^@-X0S:0 0B000 $FR0\^A-`Pp@P@PUPD0S TF P  PD^A-$aP0AS hm0!>00000000 81nP 0`8U 0CS*F뤀p0WLmW0``N@N@W\0jЍP< 0 `gJꈾԫ&^O^[|^O- B 2` APp LD pmW@@pLF@P%q(0崁!S00@0D 00@0 61A@0婕0C@@@ r0 ᄠ0 S 0ppG@0  S0P  D  @eP 0>0000000x (0D0 , I d 뛩*@7^DB}(ԫ/p@-`P@c+0`P @ pԫ0@Dp@-@lPQ`00 1Ġ  S0 Rp@E@^  @- 0pt0S(ʁs@-P@ ` `"""&*C6 00#  0+ 00 0Ѝp@A-@ PP` ""&*C6 U`" 0pm P(,`0p S 0: ` S 0; 0ᙈ`P Rፈ@]]@-@`P0pB0:020 p Ѝ0 /@-@!0:00M0 Ѝ/"&*C6u0S/ 0S/ 00CS0/@-@ @-@ P@ @-0@S000 0S/@-@ P@ 0Pp@-0P0@*p@߇݇@-0@ R0 @00@U A-@ P ""&*C60S7 0⼇ P + 0; 00  0:0 08$0 00S) 0SA0S 0 00C0 A 0 ; 0(0 0 00 0S0SPU 0{P `V' 0S 0x0U 0  :0VV181` 0 >>rRo P A0S 0 `(0`^ 0 01sQ99 0 6 &! R  010@ 0"61@ 0"601008 00000Q 5DO-M 0DP @@pH렲2 a  00"603S P0 PYYHP PCY  PX ("($($ W     " "{ 0⾆0W @(0 0p,0:  0+ # X  [P`0L PY 0 P0 PD ЍP  0*PY T  R * R + 0`ᧆ  P ` ᛆ  ^@]]G-p` PᔀUY GA0Ds 0 0 0 04 0  0 0bP0 00)Ip@-0@ RP0 Z@00 R STpP00J00FTUpp@@-@@_p@-@P0p@g`@- k @- c @ @- 0S Q t~P0Sp@- 0@ p PoP U  0R pp@]000 //000/ S0/000/G-@0 P0LS#%"&A6p pXl`P ` *6/P0U00000Ѝ X`P `*6/HZ(ZZZ@-@QPЍ@Ѝ /A- @@Q P`Up/ Q 000  0 (P+PT0@/@! R!/! !A?T tP 00S 3/~Wg 00S Sp@-P@`Qg@pg@/@-|@|p0 S 0S``&0000P0Q &0( Ѝp0@-@t0tM@@@0 @ LP @崄 @4P00S 3/@TЍ0萾p7d]O-ph1,M`\1PLL1H! 0006001 Y,A   0 00  0 $$ P Y} R 0 0 0寄$$pU0e$,Ѝ d_ X 0L e0 !bPEzDD7,^4^@-PfMb0@e0 06S 10 0Ѝ@ipu 0 pYP 0S  p 0V P @Ѝ[7O-`0M  R0 Q @K Ppᒫ Y$[ TثЍV PU@ p ( ,"&Pp@p@P0T@ 10 R0PP[0 0200 0Z00S KV  0@ @0 0T  0 Q00S+ V 0S 0 0 0 V  00 02a T 0 P0  (,,Ơ[ V ,;V u`,@-0 >b Ѝ[O-DM `@fp PEVW0 0  (V0 +]$gDЍpG-P@`ĐZJ7p&9E7P @PGT 0 pPd0@@G@DOP@28@U@DOoPB@8>^ƀp@-P 0?A3c S 0 Sp@-`Vp(U@QpCU 4  10 10  000pP/@-aXT<H0, P<&@(q,@ R 0 08A- 0@S0p# PU# JP`P᭩ 0S `U 0S 0  ; 0 B 0S4P0S`P(V ᾪp@- 0@  P P >0 0p p(0, #6 )P (O-(EM 岁7 5@5 `nPP >4Dt#4L 0 0PP噁 0S 0SDUBp40$0000 ` 0V R 0 `000@00 0S$1P. y0 P%SPPU/ 3 8h 0Y!!0  !!   " ʒ 1/ Od P cP P (,0 ,(0)80,S (0! *P4ب{- @ P <Y  88 P/ 8 <D@   <D P   (,! p D 04@ D 坨<A ;  `|</a@0P<0P<{:T P0R$ 0 R00S @ @^8]O^D^,`@-P P0XA`hA<0@@@ | @ P PЍ(ʁo0  48 h0Q8 D 8 4P  BP 00 4000L 8 4 L T  T 0$000/@80  48 l0Q8 D 8 4P  BP 0400/ 48 $0Q8 L 8 4T  BT @8@-04040@D 8 4 D P  P 00 00@8@-000CS OOO$Op@-X`PP@  `U@ 0,0@U @`Tp888O-$MX2XRPHaT!L`D@!pt``Adq.h1@0 p@p @T pT0Pl0 C$?0x0A C$^?000000 C$R ? 0 0BĠ/0 \ 0000`0C4S0^000S0000S 000 0 Q   \ 0  PtP 0 0`@ P 0900H 4< R80L0$0@H@H0$ЍO^(ʁ@88@-8@00(< R@@ 8L @ <00@H@8O-$ R <@Tg 10`0 1~ P 1< @0R!80L0@0< 40!S<018 L 0!4 @0 pWI 0 SEHP> 0S;  P!0005P.0S+ ~! 0$0 0$~p~W @0 ~~101匦ph~0 S [ \0R0S ~0 @0D0@0Dx@8L@]]O-\MP P%9A0ad~@0 0 L~ ^P ~< @0R8D@ 4 R8< D40@ s~ p.~W U    ?PPE0S ` ~ V~(10(1@ Z8 D @ H~\Ѝ@88@-@`00000000/000/0000//0M0 PЍ/00M0Ѝ/P0P00Q0T00/@8p@-@ }P0@PD00|`HP !L0 \  h  t P 2 p@@84O@-@  00 0/0TX0P/@8@-<@}%0 $ C4X0@ S X @}@8A-`Pᐽ A0Sl} A R 0PA 000pZ}000i} }0 0C0QAg@8A- 0@Rx1$u1$0@00P}P`0 Se1$lAi} Q0p}P 000000.X}3S  0RP@8@-p@ l\ `h Tt H < 0 @@8^^^^^^^/////// 01>.2h !0S000C0< 0S0 00 00000/D@-@P R00 O-\M`0 PSPS@#@2T`Z V0!:3A00C 0000@0  V00 [0S ` 0" "& n'(0, 0P0ÂoV 0S Z'(0, 0P0$@#0#6(00#6C0#60c400,0P0P00 ,0S$0SA`d\Ѝ0B,0P\"(0Sr'Xn*@6P@!@1p(0S`1`!@D @@0S80!PpLX@1@!p@DpW @`1@0p0S 8040C $ @@D @@ D0<0C Q<0S80C[ 0D @ 0@D  N A@ @  0K00$0[ `V`t `0S pP0T00Pp#6$000c0000c(0{0K640 6,0<P `n 0 ppppP` 08 0P00SP0TPP000 S00R0SL 00P`\ 04 F@D@0@ @ @T@1T@10S (00T@1N0VSP10S (00UP!, 0ES0%#`F :0T* 8  08 ,00U: [@P[`PP(j{$0* S$00`F  0w  0@R0T0 0P8 00000 R0T0 08 0,;o00@0P 00S0So0P60S/Y+*PP U P10Sp!p1E W-PX PGE 0KS00 0[ nYP1 P!Pp1lE 0  Z PP `<A K@^^h^ mzh08 Q @-$J7P0/9$^/0@/9/0 \/у0P19p@-@`PH1ƒQL"^!^D*Q p`V`F`7 P L@V ^@o#PpA@AQ`V`F` V P L@p9I^p@-P@x2 Q*    0R p`VH6`F`V @ LPp9I^O- 1M0S6p`@ VP40 P44T00Ѝ,  V 2`Tp `2S ᆢ \ J P Kj^9^^^0@-@X0S0/"R\:@\*QL0@0C?09@- pP 0 0  Ѝ9p <0 P 0 D R  P///9D@-P@-PA@-P 09@-P 09@-P 09@-P 0902P 00 /902/902 /9@-@P02 9O-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 0000xp9P7@-P0"D0HPBS 03>4000 @ Ѝ0000D9^l'^0@-d@M 0R0`Sr]00 00@0P0@0  Ѝ9s@-P0@D0S R500Sx TlP: XC5`A P<;54`P@ЍpDt]4^j^`^^^9O-Pp@`P63 ЍXPT*3 `HD0S0S X7* 5P0 !}P XpWpGpŒ4 P L@W *D0SB  B S P `% PL0@ BpPAp P (2`]^^D^9I^d^O-,MP`@` V.P 0pP@00㘠N@T ,ЍX PPE%&$ $    01/@ 00@0/@- P00 QP@- PA @Q0/S 0!  U06P`0!R0P`!R AQ:R 0 0P`pWv#P `p S 8P`P`P `0 Ѝ U000S00Q RA- p$@`Pɞ&w 60 00JЍ l00S/P 0 4\ Q/8< Q<  #  H00CH0/8꠯ P00S/P 0 (Q, Q/8꠯0P  /p@-0@` PU` S R   00 `800l <0@8@@H00H0pQ 0 P0S  0 (꠯P0P/@- T000 T0 @S꠯G-@0Q00P00CP0v)P'P""R,40Xq0S)4VD140P !s$`vL00CL0$ T00CT04:P03 `Nv000P00P0v`0``FV`C`puv, (+A0H,P` ` %@=]^ 0 "D꠯0@-P$0M 0 0 gwЍ0̟QO@-(0 0600XwЍ̟QO00@-  /0 0000 0D%@P0 S 0` \ -ZP$D6p P @0S %$0P000CSl,O$OxOxOOxOpOh`P0S |%h $0T T0,0h0X 00J#\,:`P h@h@p0S@0P4 4Ys`.PqP@  qT %P04p00`S 00 ($ qa@P qH%@ q$0$ 0P0 9. !`340XY Y" @0P $30X !R!<@P 8qrqH%p ?4; fj0S0F0Yz 00@2,2P0X020 0 4C#"#04>0CYCF 0TI+ +ı!(0b;@P0S& T!0S    t 0l!>P \\-!h@Pp0` 0 @0S0D0(0(0,`p00000L L P Pp@MxpzP\p@0@p @@-Ł^b^@=^^ ^^^^ ^!^LO])^O-1 0S H0SpY+[p젟䰟0PUL+pOC@T P 0! 4  @ C`  7pV  X*+8 <0R<00# H00CH08@E^@=H_Y^O-0H0SG0` SPQ@ 00 ppW R00S/ @T p 0$  0 0S0p #R<00# 0800X<0@800 00 0T0 0T0p(8@ p@=p@-TPL0S@ DodX40 0P@T@@op@=p@-@8`Po@e{$P$Pp@o@=`p/p@-`LPo@( F0B 00C 00TATp@o@=00 7@-@HPot@ ,0 6 @P  Ѝ0d`@-@QM }0`Uo@!N@@ , 0DP0P3P#\P#P2U o PЍ0Όƌ R qo*p0 0P0 DoPP00D@#F@[oP B+00C@#FD00S("06BS-XN, !004 0 #6:S"&0:///0R/.  0 @-@nH0 0@o  O-$MPH0TQ@`LpP0#0@ 00S 0S娖N0S R0 0 6 0`P0 H00\XTPLp$ЍOz  O-Mp800=<;0z 0ý$`0@S8 `~@P80L$0`0F8`3 Y@Pj|`V@ XaJ@P j 0T 6ShP@ 03/h0 i`<p#0p  ddh0t Xx00LVʾ89040h|00(S`9,hPN@P006Aߍ2)0400\040 @` 4/@hT2V i 1| 0  0冲d 0#03"0 `001 $0}hPN@V  ( 8T`lhP (0 @8 4/@shT @ 4/@ hhT00S @ 0  0X@ @@  AhP 0  @4/@HhTZ  蠟0 S0S !hP 0S00 ;/%h[ x hP 0 OP?A-0`p 0P` !`!0 =R?c#!$c4"0 0R0 0 0C 0gPN@Ѝ @0 4/@gTgP  0 8/@g@?A-@`Q@Mpz 0@BH1(0L1,00 @64000@68006<0 +@P@gP  03/g뤀ugPN@@Ѝ @0 4/@xgT *@P<`ZgP  0  3/@bg=@?>0O0000/ᘱ000/-AM 0 R 'R R, R 08P#8S$  8 00C8#8SAߍ ꘱0A- '@pP` $ '\  \ \#Q Q@0 Q Q@0 pRS*  QQ0Q0꘱ O-p0Ms0@D00S PC0c PA0\Z%Z ЍPA0@Πa@`0@o`0IP0 S;:00N@@T' R 0 `0 B0.   0R @h `@@ BPD  0`T $ PPh PP Q /CCꔿO-|M pP`x Dh@TPH 000000 0 000000 00($00(0 000040 080(2<0}>@00  0D0(D1H0!0LP00 0T0T0X0\0/S@)@T& 0`@hP`0 }F0PT00PE 000 @%P @@ %P0@@@|Ѝ`Ps@-@P`AP Ѝp@pЍp@- D@P 0S1(S"3 SR^O-0M3S P@P1S S   2S X$9 $ P $ Ѝ22 0 00 00 0$ pP $E  000,080400"R0`l0XW L0L0 0 8/PL0(0;Z` 0 QD X! 3P0P*CH00A $Vx僂Q%0&0CS$ I 000`0 0$ MP $o00CP $e0( "R"X10  " 0XL082$S/@0S,0 40s0480VXK (0tpD01W00  P tp0t0g 0S2 9A0 $0S S00p 00L00 H0P$4 80 ,q 0Q*, 000S0 080@!fP00( 0;0P40  0 L0PLP5S7S 2$0$00h 0 P0 <0(0s(0D0 0 P(\ >0 l0 0 BL<0400S08/D0400(000'(Q$M0, Rf` R \ S01 P(Z+D0<s0D0D0P0C a00D000H00 4D0P0d 0HR:0R050B0005D00D00(  (   . Q 0 0A B440 0CD000S $ 0,p1!00 000L000H0W 08 S0002 02000l0hp|0l0 $03/P 0@H0 p`POA-@T, TpP` T$ R!PU|vP   RHi@P  Q 0P @]0O-x0bM 0FSP&bp[0 0`0 $_PP L PP0 2S  B 0SP<Ѝ0S @ T 0@0$ 0  7P  0 00 @DP@D0P@Dn 00 0 T@-P@`pP  0 00E(PX0@0X0 ЍG-X0 `Ѝ0@S P `P 0PPPS*0 P000 S S S 0 B Q  p R R0 R 0g` RQp P   W`   `{p 0妸00X $p0 $0X 0  0<`P0 ;` X0V X  R!X0`P 0X0 0\0iR 00dX0"Up\W L! >pP 7^P P PJ??//Ἷ@-0`*p"*0C00@ 0 `0 8q> 00. 0.0 0 (03100 >0#60ЍЀA-P@U 00 ` 00000pU`  s`A- $0p0 $0 0@R`P:    U@` P 700 00$00x @0D0@0D0S/p@-@P`0S000p P PA-@T1  0`/ @+ P!p?@P0|0000 q 0  0 0%@P 003/Ѝ@@-$Ma01@00 0000 c PP0p  JCW 0 00 .  00mP$Ѝ0@-PMP 0@*"*0C000C0 X0  00. 0.0 PЍ0@Ѝ0 -,M $001040 00000 P$0S,ЍA-X0 !@ 0S10$#@0P,04 R1D(2@`Dp0F@B` <`FR  0H0Ds 0 0000 000H0@ 000 0 @@ЍP$0 0!0 00 /(,@-0`iM0 0 ?P 0 iߍ@P p0 tpPd U00> !0ŁƁŁŁedAO-Az 4MⲴ(a$sS0S a 3 D PD202 000*0PP sQ0  00 倲倢 0  ptAT \nXlDP`<DP|P\DP D0/S]0`00FD@-0` 0`Q s0!00  "0PU ` Pd0 T | 0. 00PP;0 0C4/,P000 P0@P@ 8 8P<`P#$ ,{B00   P0T0P0S PvAT00hЍ_R]_ U_v_-_]|___r5^o^______@-<0DT 0 !0  !0@- ! 0 !@- @0S 0@ƁŁp@-T0PO`d !0UF Ϡd 0!T@!p쫁0@-0dM0@ 0 Q00 P00 [ @`T#ʸS@Q  ' 4/0 0 &#: 4/?&6 :  \ 4/dЍ0G@D꘲xTF'^Z_n(^^w(^S^PV^$TT'^%^/^쫁e_x_0O-P`p'DM,00> 0 00P(`$ p0,0> 0> 0 00P(`$ pͫ'0 !d> ,0  00P(`$  p師 0 ,00!> 0 > 0>00P 0(`$ p墫 0 ,00!=0= 00 0 00P(`$ 勫 0,!t t= 0 00P(`$ `v0,0 ,= 0  00P(`$  pb0,0< 0 00P(`$  pN0,0< 0 00P(`$  p:0 ,00!D< 0 00P(`$  p&0,0< 00!;0<$ 0 00P(` pS0,0 0$!; 0; 00P 0(` 0 ,00!P; 0 00P(`$  p0 ,00!ʟ: 0 0 0P(`$ Ϊ0,0: 00!: 0: 0 00P(`$ p帪0 ,00!`:0X: 0 00P(`$ 壪 0,0: 0 00P(`$  p只 0R!9 ,0 00P(`$  `{R`: 00,!t9 $0 04P0p(` pdR, 0 00!90 $0 04P(` pKR00$,0 0 00!8 0 04P(` p3%0,0p8 0 00P(`$  p&0+,00! 8 0 00P(`$  p (0,07 0 00P(`$  p)0,07 0 00P(`$  p*0,0@7 0 00P(`$  pϩ+0,06 0 00P(`$  p廩,0 ,00!6 0 00P(`$  p姩-0,0;$0\6 00!H60@6 0 00P(` 吩.0,06 00!6 0 00P(`$ p{10+,00!5 0 00P(`$  pg20,0|5 00!l5 0 00P(`$ pR30 ,00! 5 05 00P 0(`$ <60 ,00!4$ 04 00P 0(` %70 ,00!4 0x4 0 00P(`$ p90(,00!44 0 00P(`$  p<0,0$3 0  00P(`$  p>0,03 0 00P(`$  pԨ?0 ,00!P3 0 00P(`$  p0,03 0 00P(`$  p嬨@0 ,00!2 02 0 00P(`$ `嗨A0 ,00!l2 0d2 0 00P(`$ p储B0,0<$2 0  00P(`$  pnC0,01 0  00P(`$  pZD0,01 0  00P(`$  pFE0,0L@1 0  00P(`$  `;P_.P_8__4.P_pXWCH_hR______`;P_%_3_D:P9_=Py^"O_D_H_P_X_`_p_x_____X 3P___d]_ 5P_|0P[g_P9P>____ __d>PY^t6P$_/_=_N_]_j_ {__-P_AP_4P____2P___@1PO^_F'^_S'^_l,P_pЧF0,00 0  00P(`$  p弧G0,00 0  00P(`$  p娧H0,0 1 00!01 0 00P(`$ p哧J0 ,00!x1 01 0 00P(`$ p~K0 ,00!101 0 0 0P(`$ gO0 ,00!2 0 2 0 00P(`$ R 0!`2 ,0<00P(`$  `> 0!2 0<0 (,P$  `,0$02 00!2< 03 (0 0,P p;(8$0 0 00!T3<0`3 0 0,P 0(0; 0 0 0!3< 0  0,P$ p0 (00!3 0 00P,(`$  p姦4 00!4 0 00P,(`$ 哦5 00!(5 0 00P,(`$  0!h5 0p5 0 00P,(`$ pkDЍO- 1UV010#| 0[tU '}U% 0PHUP#* Ѝ0YS, jE zEYU 6 PU| R [ !0 M@ 0I0C0@v4;U0I0C0@UB RSO-PR`,M020 ,Ѝ֞T@p̠0S@DU@ 000[ X z0  0  0媨 T  T[ H @p ˁ O-t"00a,$@ @@ @P՝ 0(00 00a,$@ @@ @Pĝ 0(0l0 00a,$@ @@ @P峝4Ѝ_^_UX_T^M^_Zb__#__q^_P ƒ #60 P *R  P 0 / 0CA-50@J`P ,P(0p, UP1p1:PUp0S S0 0!0d P0*0d0E L0 0!0d P0:00 __@-L@P 0S  00P 0000谲A- x@p `PUpP9y>00ST ~+y<0 80x__P+_0000 x갲0@-M 0000P 0`1@PP8 @P 0 @@0@ 0 @P 忾Ѝ0S  @!x!5@P @0Dp?@ @Sp+!@@Dp-@Pp lx_0S@|x0000傾@P K0S00p 00=@P 갲2_@PPO-䒟M0S@ XQ 3x0S4t,0 a,0zXz}P08 0({rP0(@8(0H> C'ᡢ(@HL (,P 0L P H BRP =)Q -HP PH8( , <@H 0L pP Q H =)A -BLP H!HP4O>lN=NA-pP0@ MW 00  0 0 p'`P 0W!P0`Hz/ 0< ` d Ѝ0 0 0 k^Zb_T_O-`M Ap0PRHPH 00, 6:@D S0`#P#!+*L0  3`V c,Pа 1HV`PP.P gHU`/ߛ`P $0000SPWPPSHQHUV] 2 FRAPX W Ѝ%P.0n0CS)uPdvP vPdvPdvPdvP@vPvPp"z?0J P`Z``0@"100"J000(0> CJ "?P.001P .PP0SPPWPUᇵ`P P 0 0=0\1  hPP b`0S PF UP 0P80S101?1?11` P@V@@pp@-@HPME@080C@00S  0 Ep@8EM@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PEE @0 PUKEttp0@00\PS 0  P@D403PE1Ep萼M8_^@N02p@-1Pa@\p@-@@RTp@-!2 A!R!!r`!U "!P "!001Sp!AA2S^ 20Q 0 0C0CSQ Q 1p00 Q2-  a>Q 0 "Rq0 o`/O-MAQ$ 408@|9ЍO谏Q3$0pS40$000 00?o 2?$0GS!0 00G?oR20S0G?or20S.W1D`xZ 01x0#D0)D4P$0(0U L0S9Z0S6 0S`0 S/D`080 ``P 01@FDT?<02l`P ;D ` C1@,0000,0 0S` *DC<kP00 R 00 0L0L@T WD3$ 0R 0 S030#R0S 0@0C`0@023'X`x XuV0X@\00P XP@T` 0d V`0(0h000l040p00| x0P00P xT`嫒 0V000P00P T`嘒 )0V000P00P T`剒(0S V0000P00P T`x"*0V0000000P00P T`e@0000 000 00t0C CD0( X8` ? 210030 10 *11 RPP0 e?0 &;00d hl`` `3 U 'Ѝ3 D?L0P  > ~_@- `P1 @00}1 >!?T 0 Ѝ@ ЍDNG-p`Ԑ3 kPP 0 X@P  PU3aP V  0 `> b>0 ,00 @DN@-@@ >@-@>@@@-@P 40 @01 DN031 0gkggO-T2 31M p<20@1 X>똁1X``ӄQՈ0cV.  P` n[  J ʢ0?Sòʂ?1?11`11P1儱00U b>ЍS`b/c. ! !0 R0  Z (P!RQP`p =002>U pkpl p  "qEŠ  " !DNO-13A1LpSgμPPZN넁`pU/^U 8 nQ020?SP !Q011QP? QQQ ?10 ЍOO[ 00P 0SW ( R 尐U P00! ЍDN@-@Pp`P @ 0 W311001  @ @ 0@j 0@P Ѝs@-0Sa @1S@^ @A1S P1Q0``1SЍp0S  R R    Pp@-@T 0`QT@dPT\<HPHPP5=UP@pT 0d3HPvtR1MR  !Ѝ/0Q`/wt@A-@PxM␀ Pp`x ~dp` P<T HP  n,<xЍdzHP 0 ?nRt@- h@"+    00(  03 3ЍQ-//-//-/-/-/-/-/$0 0!0 00 /(,0M0 000  c P0 000 cP000Ѝ/0M00 P000Ѝ/ M0 00#0 $0  00#$0Ѝ/Q7@-P@ h+<`0 R 0SP D00000S !0"PT T< Ѝ0Np@-XP`@ PD03 1pV T( %P p#pNO0 100S/INMp@-P@;1p@<N@-000S ፍ  0# ЍM@-@0S0 R000000S 0s0000S0St00ddVPX00SL$A@n10 0 0 ЍN__]MpOxO7@-@P ; ph04t 0e00l00p0000 Ѝ0TPp@-@P, 00 00 0X0$00(0tp@CꄤP@-@ (@5 20`@7@-@`P0 0 00h1S\P\0Z_00 @00 0 $00@0 Ѝ0_^ __0_@-QaAM0 0$0 0S$0 S*:01S< `10X*00q01+;W  ⠿0 { , :!(0,0(0,e  厈 ⣢ 0R1!0CQS B0 00 UP t.S1! B0C 0:0  4ezOPNPpOPN]B_q_A-P~`P p吀H0L,A0 U P#H0LTp0    0S:|03/0Sh:@NMA-M 0P`p` @r 0  00P 00@ 00$?o2P@@T P :: u:ЍN@-<0DT 0 !0  !p@-00P@00.pO0@- ! 0 !A-p@t` P⷇0S C C S S T00S $ h0l0h0lAN@-00@0hO@-0 @0 0兇Ѝp@-PHM` P@ (‡P Ph@9( ^ (s $ T  i9HЍpN0@-A4MP000S$ ~9]0S- S3#RQ. ⁇ p+00 000T!h0l0h0l410000S0P=P04Ѝ0 Rj9 ,aR !0 60Vy0S: S>c4@P0,aFV@ R[pĒ0VSB 4! 4p`,b4200 00< @0 @@ C 00/ 0 000p 0`P 0 0 `10/ 0!#4#0 !Al℗ ///x00CSx08ЍT `[ `A-pP `P' 0   ( H @ m/h8!&`0@@@%+3 1 0~3Ѝt]_A-PU@d0p00`h0K/%/]p@-@d0`P:/ %p@t/p@-@Px0Sp8BUpA-@P pP /X0 @ 0P  V/x0SP/'q@0x`X03V00  D/?/  P(  S% 0T 0EC1 00  !V00Tഁ贁p@-@P 0S TP |Tp@P\TpPU @Tp[ PP U PTp贁A-P,hAT h0pS ``,\0$ 20S$0 ,@A,]A-Ppᘀ,ATA,h0S ``,\ $00$0  eP$00$0$0S ,@]G-`p_AT s,P0 C;00",`4(0 00 0\0!$00$0X00X0101 ,0S 0h0/]O-M 0(0 0P$0 (0S (\ @3S 3 083/@P803$00000 0 0S 0S| 0 @ (;ߍ 00S0#003 @ 04/P0`3,00:00 p| SP 0SX S@3S 90?00@03 @#04/@P30C3000 Z S @ P  +1 1 R!Z PՕ0@ d0 000 0lh0 0\00`00 00!)h0SS  Q  R0Q @>0!#4# 11 | pq+h003/P@qPdpP |+0 0@T+X00X0+@@/ @ F+X0@0X0X0 R0X008 0P@0PP0@0&$! h+@ 0 R 0R PUf +Q 0#$# YZ  S Q Q  11 0R!ŁV@|5+0P*X0@0X0X7300)+ p,RW Y T0@,0@`S 0 0C 0 000@*X0@@0X06300x0S  ** * @* 0\00`0= @3S0   631 0$0P3S: H@Xp0# 00@hpPpӀ h50`0xPt*0030@015w  8@P@0!S&3S XHpP@st@ #T *@ 0S 03# @04/ 30C 0@0p00h t0 p00m*耍 0 (*&*0@hTX x" @   R S8@  [ O*Z "H*E*l Q   h T83 S 0*~X  X " X @  B@ |* ) ) *)X0 0Z!0X0@00C@00h0 0S] 0 @0 0X0P @ X P" 0@0#X00 @00C@0)   )) 0S@08) ) 0#03 @04/@ )~)0耍000 0  R   T RI 'R 00'@ 8^) ) 3/  $!0X0@00C@0 !00 00X0 0 0@@@@& P0n| 6)000h0 0S 0040()h @ 4/@40^)T Z) X)2贁]@-,0 00000 00Ѝ]p@-P@Tp`MP f@G-`p3aM(1 PUG&)P (p@-P@``( @I @p@ )p@-@PP( 09 0p@)00/A-@P@pT|`(h0000h0(@]00/0 S  0S o/p@-@PP(X0d`)P(jX00X0F(p@(0 @-@L厖5PP@@-@8X0 0dX0h$Y`03$!e$)H@a pP 4tP 0@ 0'X| 0i|O-p`@嘰  HQ:/PDPWe \   0P ?P Ѝ0S 40A3/0`@00@`ŁO-dMZ@$ ` +0T L0P $0(`aT Q`P8p$p* dЍ PL`P$0p$p R1 00ᮎ`P H/~{P0Sx@!PPs!(PPm00h( 0;0!PP^1 00 0000P 0 7PPM=0$ 0C0:P01T01 R Lt!F ` !l  2/`PH0T S*P S:00S18 ,0 0Rn pP :ptP 5tX ZxP P`SG-M@` 8pYP+0{P@@0/S WЍ0 0 S?@# ,* b咪0 C /  C1$@ N00<`00 @` NV@ k`F q0W@C `F`^O-,M00`\@qĄ 0L0  iN0S* C됔̔t4L00P100/0 0,0 p00 00p0P 㪎,0/pt0Q0*#P$00 0^PP垔$0L 0P0P0 0PhP|P 10(0L0 C5<0X0pPtPlPxP"N >^PPX0`QH`P aP0S X0$P0PX 0$020 0PPe`1$ dQ0`1T0S d20X T 0$PPd1$ 0d1d`1l H0 0000C01\1 $  BX! 0D 0TRg:D0,Ѝ H @k y[10S B` 0 v`10`1PQ\`lX00X0 fPPP\`^X00X0 X0 0dX0$!$$H CpP tP dM? M E/oX0"0S R 0P PPE_ _P~R~RŁh00S/ P 3/xA-P0 `p00l 0 0010 (@0P Ѝ P'0%P 0@00 0 0CS 0P`V pZPp P'0P 00@0G-PM" @@L a0 @@9 xQ1 010;0 @00`!PpH(@T `X,W/AU1@P {000` S&Ѝ 00S S S pp@PPxx 01@ 01p@ 00P!0 R P0p _ _d]S^C-PPMD (@T* $` 0`V@% @T5 %g0Ԑ03/ @0~p00~p 00@ 0 ܈@P 003/Ѝ 圩 D0 a(0003/@p _P/(0S/P/ R  00/G-Q @8K0,(Q!PU $1L048<0L0 1 111"  "J` X#z뀀z <0<0ʅ$,0SfF,0,0[P帅lP`0<1x8N4"P0# P00P0"T0T0(SH( `0pQ h1d0l1=0c?0h0040043 `004040pW 4p40q40q40!0R {"40p"0, d001k"10 0S [0[00[0x0Sp p0t 0x@t00H05`0`Sl 505`0@1d0Sd d0h 0d@h01 R @@0=f 1\D03/2"(Jit4w0004Z0Ide"8c"  8 A]"J J(0$ T 5@ "5`0`S G"<ЍME,(40g40peWct! $ ZT@ ,"PY s @yI,I#@ _L_ _QRSP0O-$MpQ0I`P`v@T ,0〰X2 < P#@PP 1T P` X !P P`#@0SL㟉=V 0U? ;00@ @PN `0V(: `V 00 ` @P0 00` 00 00@PQ  @@$Ѝ0 0S S +0@P P`X s|P8PP|0S/@-@h3/0|0h0O-a04MPS@ !J!0S 0081S LQX0Y3T P0Q ,00000>0#6040080>0#60D0>0#6000<00@0080S ҴN 0/1000L09L0!5@ 0 0  0PpW*pWL0<L0 ꠆0P ?. T.`1Sp pP0  0  pW ~pq!0R f p :T0  W 3 [0 lN 000[  [ 0H6p3pGo7r$| wGqP $5$0 1 p 0Z # 3W R$!$,$WpW /sz tD DD0ĠN J1 0嶤`1H!<1d1 D1l0 p07/pP\T!@0AX0  81 0<1$0@1(0D1,0 ]pPGb l0 0,03/l00S 3/?l0 (0$ SKo [m Zj 00 Lp@07/ 0 03/3 0000  0 0pP 01I 0 03/G0S`|GX D#啰WH4 pP _tP [Yk :pW      2/p ttr7H`W1S r l0q 00S p0Sᶱ$@F$0p  $@G0tp0P  1S 8 R l S 2/l0 000S 3/l0 0 1l !D03/<10S IYF0S(F%"# "  TQP0. pl 000p p p $pL0 0Z000C0, X 0 Y_ 0S KEp4ЍŁRP _E_S0@-_MP P@P0 {_ߍ0@-(000000 0ЍP@- $0000000ЍPO-ȄlQ@cU4"Q!Qt"Qt"Q$"QD"Qt"QT"Q|"Q`0S (P@ Z0S l0 S 0`0Ѝp ` Z0S10Sp10$0.P `*U 0000P0 ? R002   00`00 (000(00 0X PX (ᴡ0 P>X (X`ਡ0Ph >`p@-Pa|@T 0Sp 0P T  P06P0C 0S P0 P08P0^A0C0  l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/ᠲH-|fA0pSM \P0P:P00Sړ00P0 *  I PF0l 0000Z8@ 00C0 O .6 0 ~\0 1111I0Z0W0S H81S 뒏kCz56$~0$0^4G?p 180S 3/q>amT0  p[0 00[ 0 [ 010S0 Z p 0pYచpp[  #M $u p0 0000 W W&Z Nd` 'aP *5 xp,Z 1S!! !1 0S   2 R @@00lZ0000x0S p0St t ' x0Sp p0t  0x@t0L0pWp  x0S pH0S l  sL0(0 =?~1S x!'J : 01501 I 0Z0C000000Bl DW   0 `[O\0| P 0wPb 0S 0S%p@ % -%l Q Q B00  N A 8 4꠲ _SRH! _@S9 _Sp@-a@P{P0   CO-M̠pZ@` 0  V Y80Sr l6X3QWWp1x0 $00000$0SB 0 `$'p9 Pn 0S$0' H0S* [$0Z R( R2 $0 R-P * !P  00C0VJ 0000 %@H0S P80$0$0S YI5  W^%P(. =B $0Z R R%@   B V /  5@00ꘐPY$ $0p0$0~Z0S 0U 0` @(P $[Y 0S00S PS 0 0 0 Ѝl30(0(LP( L30(0(CP( Z0S(0Z0S(00(00U0 `([P 0U0 `(NP 5l@@ 0T P5P =5@ TH2@H0PS (  (J /u ᎃ|`(;(X;((X;Z X ( ;X (60020Z00S   00C0p0St t ' `1%D婀 D% Q @Z,<(>P ׶D  |@ %C B/o0"S R0 400 `0_0Z RP0 C;00"4 0a  RS@SP0@-q@M QaT0P0` ,0 (TP X ⭝Ѝ00@-P0dM 0 0@S0 0S0 Q  ?o 2Q0S X dЍ00@-@0SMPS 00 0R  0 000?o2Q0S  ?o2Q0S ?o2Q0S Sߍ0p@-5lP@0U5Pp@0`P *Pe#!5<50 Spp@R@-X0C50S[0  J 00S @BRŁO-`i0P$0A <ЍN&@P $9i. > RR⚜>$10|0L0㑯48<0L0 !80 !!L0 ! `  \> tqE 001P NDP  D1 <0<02 Jz,0 S.:,0 00[00 00`[000 P055 l`0<10x080C4P0$ P00P0aJT0T0(< ( uhd 4R =0c?0h0d  0400h0$  0`00,00?! 40!! 140S  3/10 0S [0[00[0x0Sp p0t (0x@tH0 5"AAQ  RB0BS  R lx505`0@1d0Sd d0h 0d@h0,3 R @@0Z 1\D03/2022! ! R ! ! ! !20C22S Wp20S PP1211S ,][T0  V! p(Jh?p4P0D 0 0Z 00400 l0S `0l 000r5AAQ  RB0BS  R #5A0AS l0k Hp@ @ x$N9,04pZ0X0S5D0DS Y l0 QHL8%IP@`? _#_e _^ _L_ _H5QRSŁ@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- 0   Q      0 Ѝp@-QC 12@@g@00@00 00 !!0400000, !  !<<P 0 [U@0kg<P<P3S (,@-@0M 00000 p0TP `yP00P0D00S 0 022201Ѝn _H?Qv _A-`|p0PS d5 @P U < p0S0@U@` <t@BQp@-P`@0`S LT <PUTpp@<0 3/t@BQ@-@l<j<p@-PP@ e<0S   Upp@< 0|@-0@0S R 2/t 0@-(@ P0S   t$0 0S/ R0/0t 0_PP z 0O j 0>  p@-X@P0`S @o8;@Tp@ 2<03/@t@BQ 0_@-0@T0 3/@tA-Pp `# @P  p `h00 (R $@ @0@0t _ R 0$0  tPA-@`!PP0q$0开0PU(0(0SAS 0 0 3/00PTp PDU(0 S 0 0 3/Ptp] _ _]^p@-`P3@  ` g000p@-@P@0S   G-P`X 0003 0@T@T. 0pSW00  @pW @ 7/X0SpW M CW E@ @@A-Pp`ᶵ@ ``p/0S0@@PgA-P`@p0S 0S   唵AO00 00S<0 3R W p>Wp@-@P@/Tp@-@ @ _O-`0Sp,M@PTXtdP ` 000 00P0X` 00  00 @00 @`P dd,ЍZ  .$ \0 $$0w[?p`p  `U 0S $  0P 212 2<22@022 02TY 00@@-0C0P $p!Qd\2  T^LP1S  < N,$/e _% _V _0@-@H0@0184,@0S vЍHp@-40CrP0[;P0UgLpp@-@00S`P00#;#P0oTpp@TL-0 0/c _ 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,00S/A-@`8ăPq4PX`00S P ՓP P4 0,,( $ `فM _] _UW_d^f _0 0 0/QO-`PC1(S 01O0ಀO~ㄐ0I0SaO py@p0S p0I0SOa岀c xOxKQG-餀PopWUpP@@ t@_!8R#8 @L A@ 0B092S R B! 0B0-Q0@o/Q 0P/,㠳@Q0@- 0D0R@00,$00P Cu C-p0MP0 0`` @0 P 00 000 0@X?o2P0S  R ЍD=@-@08M@@嶶0 00@ 00@@0@8**0|0 0000,00 (00!P0 0H0$@ @000'> @00|\8Ѝ@QQQQQ _QD=xQQ _@-p p@p@0@@SC 1X01s@ Ht@@<<80@r@QQuR _( _A- 0b@SPpbwb0@X4100S *0 !!04L0H0@000, !  !(,7@-PQ+u@ U0310/0|@T0@g $P@\ Ѝ0xU 00SA@P 00S u U0 #!R`0SR@--P 00Sp@-P@bPpTUp7@-P@gw00 Ѝ07@-P@]w00 Ѝ0@ 7@-@00POP 000U  Ѝ000/0@-P0M0@000TЍ00 0 @P 0 P QQp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@Q?0S P00 0000@-" 0@ 0R R@0CSpXQ\XQhXQpXQ`XQ`XQXQpXQ0S$@i0 = (6p R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3Pv@9p@-P0@ o PpP0X gP  BRZQYQYQYQZQTYQYQYQ8P0R8P0P0  Q8P0@Pp@-@`Q! P08P0Z0S P0S 0 000C0"p@P41041/41!0CS41/p@-@Qp@p@-01Q@101`41Sp PP/@P/|0S/@-P1SO-験MsQ[```Z  00 0C0Ѝ8AT@ T0 0V81S,8ANZ- Ph`0 !0L @0;/2 00  00yr`P xRgd㡰8APU 0RT `0SNPX㊰P䡟  2/0@ ! * @r`P 1Xp  2/ `0*2l`P   0*sXYl 0000@ :0<`0⃒0S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  1 0 2020 20C2bV) O`%#p#1[  00/p@-@8aP 0PE| 0Q"000PUP001S 00S  R0 0 0S0@0 @@0p@ A-,2Q@Up` 0S 嫽Uu20t0u1 00$`V;0 0 `!00  0 0 0 004 00 0(00/1S ! !! 1 00C000C00100C0C  ): P g Pe:0S :Z0S YP 㐭00$P [(^W,0 ЍGRQO-PM`pDT 3RU @t,0/\ *0 0 0 0 0PǿP t #Ѝ@T  ᠰ4/BL h Q4p 3< 2 @,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S L0P0<P0<vno o ZPM10H0S@]1 1]X@00#]! {@p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S 0P 00=P 00S  x t l@0@@SC 1X0100 1<0S) 3/$QuR _ _h] R@QQ A-0p3a 8Q@T0S 00(q 081 0*yqX@p03hl2/@-@1 0S@0A-Q<2@sn 0  BR 800 1@0S 3/_NnP 5P0PSJ P0   1S!!1 ! | :  P01 P  !=& @P0#8g0$ 0P2u00C00S  M XWN0  Kt(!0b0?o S,!0b0?o S |`79HaVR _ _G-@QdqLP00`P  衔 'P03P0" eF7S  =P ? ٲ 00C0  0 /K   0 000P00P0Ѝ O-`PpA000,P0   P 0 0 a U| P` 01? PR161US,1 SJ P" 01 U(  \( \ ,!(! W B ! t $ Ѝ\ X  QU JP (! R (!  B ,! 0R $P A- Pp`3@2: p@#@`5<`%J2 PP   㚎0@D@P0Q @@,p@-PP@p@Tp``FT@@P  ю B 00S0R0S/ p0Q   0RH     /  Q` p@-P00@Tp0 P @`p@- P0Sp8 P`@0 QV  Pp!!0p@-P@ث@0$P0p @-@000P ī@@ C-MP00`0p0 0` @H0 P 00 000 0@P?o2P0S R0 Ѝ$0S/7@-D 0P0PP0@EU Ѝ05 _0/ -@-,00 ЍЍ/ _)^O-P`ԡ,M @T pMP VPPp OP @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #\0S 0 PP 0x P 0 000!R00! 0V0C0@` _ z _F _7@-P p 0P@P Xa Ѝ0Q000 $!R@ M _ _ _?_-@-<00S 0,0,4' ЍЍ/`{_)^G-`2Q" @P"PX  P$0S00SPqP @U003/PP80S 8KVU  ( 03/P00C0!R 00! 0S% P $`X!P B Y0000000@0@@000000!00C0S______ _`8_M-,A,a Pa$q X l $ R*  ' ~< P   2/ P RQ  < R (, 0 X(, P0@000 0"  `M_DP0 /$/O-Rp@M50"T@TP:  ᮩ` P1 !R  !1 PUp㔡 P10 U"P' PP PUP7v0 0 00 0PP Ѝ0Q@D0 nP PpW F0P0U0000000XpPP IPU 0  0P  ]` ]_@-Q`M P0 ( 000Ĺ@Pm s@P xЍcXp PU@ 0  @P0P S  !  00C0` O-DMB,0RbS2r0,0 `002@000"S2002000} rU:0p`p"(00 <0 T0p,`$  <R<0 Sb 'R2  P0 0< ,p(`$ Q0 00!1<  0 0,p(`$ Q 0E 00!1<  0\ 0,p(`$ Q 0!D1<00 0  0,p(`$  @Q 0!0PE 00,p(`00$0 P 0 < @Qs0000DЍ  P 0 Pg _Di_@j_p_@4_Tn(^nQ^_}__^_pQ_]@- @0 400`$0 P qЍ]_4wQ]_@-X$0 0S@c   0`@o/@-P`0 H 000㑸@P:@@FЍp@-@/000@;@-@'00C0@3G-`PAqT: pW @P P  0 %PP  ? 0S  屈P3P0 奈Ph pPP  8$0p0@@$@i_@j_]`i__@__0   p@-(@ P0$00p@, PO-M0`00W( 0p4pQp @00(080  2/P+( 0 .`__+__C_ _B_g_lA____.__S___y_#_ C_Y_ ___@-pM0Pp0嘶a @T  0S$ 0S/ЍU 0S@00 !R00! 0p0@@@  PU  R000@  P 000`A-P`pI@P  dd4@PЍ @@@@ 0㈵@P@0 q@C_ _A-0P3`q 00S,@Ѝ/dP@_P.Z@P㬳 @@ 0T@P0 P>@@z?` 0`_ 0 k 0 0 0 0 0 p@-`P~` P@ɵ00@0  @@0000PU̵p6/0 `p@-@ᰵL0PU  R8 00 嵵p@S 03/P` @-@0 00Qp@-@@`P00  ܤp@Qs@-@`0P000@ Ѝp Q@-$@ ⡷P Q_O-M0S0 P0 Y`p/ᑄPp 0#Ꮌ)  `pW @@T /yPp\3\#PPt8  FpW ţY0 Ѝ0娀(SX Yu  㪣+U FPPr@堄Pf|R nP @O P \T(0$ 00 PPP˦@P:(0⠣@P+0"R00P@# p1, 30100 0000($ 冧0$ @PP,0S) @RP(偱(0$0?$0 Rn AT  {T&6w0U@ 2T$ y$ PP@#Y wP `|P >q@ y pM4q 0S 0S^_T&_^X^4_._^_e_{___0  厾tQT_$0 0!0 00 /(,-  0  /_/20C22S/A@- $0 0壣 Ѝ _']@-<0DT 0 !0  !p@-P @τU00p00000P0p-0000/G-`@#202P̠ X4 CX$S\U  PlgU P0 S,d pZgU 3d 0 2dGy]@-0  \X40SX4 0 !H0  !Ѝp|0@`V  +g00cPPP#g00Ѝp@c `g 000 Ѝp@dMP/0 0@o//@-D@ @X4 CX$S\#E@foA-P`@p~@0 80000]ȣZA-P`@pk@P 0 $0000]ȣZ4~@-@f9~Pf(@ㅡ/ 0  0 x0S0 0l0 h0S0 0\0}?r0}?}r00<0 R / /ᘶ@Bx 0/ᘶ 0 ꨶ@-0000(0( (0$10c00Ѝ]?o2P0S 0000 09P0S0 0Ѝ@-p0 0  ^8 0@0000@00C@0DSR@-@TZ0S[00[04'1'd@ p@-81M@T-  뒴Q H 0  P@@  `  t!00P 僲 0 x0@Q 0l0300@ @@x DDЍp@褧]RDS0uR_(̹Q_Q_0O- a 000p(P$@ @-A0찟,00 000p(P$@ @ @PA/0,00 000p(P$@ @ @PA00,0`0 0X0000p(P$@ @ @P@<Ѝ@Q_tQ#__Q_000/p@-00CSP0@@$P,CU ဗTpp@(zRA-0 0 2#PU 0`S@T Al#pd0S R@D$ 0R @TAKDSRHA-p᭳@`00H\ 0 0  00@PPTPU @1 0 0S ᵳ@ᱳ@Ѝ᫳ 0S 1S@DS@-@M`0p0\ 0 0  0 0 @00TPPU@ 0S@1S1SЍDSp@-P`a  0 00@S @R@T  R@@QJ 0SP@PpPRDS;90@  !"P/ R0S//DSQp@-@ @PXTd0P1@0P !0@@T@DpRp@-P(@p`5pRp@-`Py[\ T `@00  RAP @ppRDS `0S  0  /DS 0 倪p@-@Td0QDSh h h0d 010Sp@p@HRA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0  BR {O-SP ` (ܕ`ؕpU" 0 㒣*@T 0 S8`0S" HP0@l}` R l0UV#1!0 ST  SL0 P @[ 10S P1 Q@S@V @oYQVT T R S(@0`00pS V `0P @$00@01 00001w[00[0@`@`p `p - )d0Sh h h0d 1 RA0Sd d0h Ph@x @V (+W &RDSH@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0Rp@-L0@3P1S P0 00SS000ppp@-P0PSA,00S ?LaPpp@XG-0PPpa|@P @T {P03P0ATAU ~YL0<L0[WὤTG踤 0 `0匲0@埲s@-|R   D < | ,2,BRG !"|0 !" 0QQP1 #"10"RR"Chh0 1d D03/ფZ  0 R0Ot1`0S00#0X1``0S/00 /0 h/6& *P01:h@ 0t0`0/0? ?,0|`00000BC0*`OS4  a Ѝp@\CC L_ _<DSRSD8@D=X[0@@-H0 է0@Z069pr@ 0 @0 @ s@-@Pၡ`~V x`yVw`xV00n |PoЍpBp@-P9 R@*B B00CSQQ8QQ0Q0Q0Q0Q0Q0Q0Q0Q0QQpQ B0! p6`3V/@0T T02S SL0  p,0 00CRP@p@-L0@P P`Pp@* p@0uw 03/@pCO-TM@  0  00 >Q  PzT T u(0,0 0$0Zp`< g @ *  0  :0#::c@004 <@D@8Pu 0B@P0 L  QS0@  QR03@0B  x0 10 00S0l1R0l11 tB0ZO000Ѝp0 >0!0 y>0L1O- M`SP@@ D H L P T X \   0$ 0$0, (0(04 00,0< 8000D @040L H010T P00 %(0V`00d0`00` `d`=>phpH0 l00p0L!>p00p0P>p00p0>p00p0[>p00p0T >p00p0`0t0<1x0c^c^Y\剟(0B(-R #够- . A. 001Vq1`00` Fd`=1 1mRs qVs00 0& Z h!Z|2[/x1k1P0C;00400z0 A 1 A0/h2p0l"/`2 Z0Sz pCSWppp'pr00 $! ! ! ! r"&" 0r &0B2D0V/p2t"0 0p0`00` d`u= 0h1P]=p00p0T0000 0S00@00ip0j10S  b?A0V100`00` d`J=00  |0 SW 0@DHLPTX0\ (!@0@J0@0,!D00D00!H00H04!L00 L0#s PNs10S7 $0 |01f0010 0Sh00h0100Sh00h01@1 0=[0 100S R  V 0X00\0`00` Xd`<Z 0BRS000#0s-( (!!( 0!!0 00X 080`00101 01(01(r` @"D !HL  $ (,8"04<(X0h\ l00  ` p  R00=9B =C00P20T2Ѝ0`` d`U< 0` `00d`M<$0` (`00d`E<(0` 0`00d`=<,0` 8`00d`5<00` @`00d`-<40` H`00d`%<1` P0d``00<q qqqqqqq  ppppppppp1p00]0]\]x]]]@B@-@P`t Pt t Pt T0 00000 00PP t 0ЍpRO-Q,MP@\|,ЍO7QT@@`Vp: FZr@RV6 @PH >00O0$`@ ;00 Q@ cTJX@D:@@u 0ގS6 xP@0DATu @ imX` @u0`8-6,Ѝ0V01 0@P0V@0 T01 0P0T6lPP& Z00 @@0P 03P@ F DX`F0070Z0 CSRL@ 1@꒯ P@'T#0F0-@P V0$0 0 0v00@0 00 00@RtQC-M p@P0S !PU @@A)` 0 |r@P`P Ѝ@@-@ 0 000 0@0㳞oЍO-LM00|0P80;@3p `Up0s  80`x|000tpLЍO6Y00(0(00S40OU 0S0U U0 0B5 ǍP 1L0:`@;0 00 Z,0 01 0!@A$<0T 0Sv :ATr 0 0L0SZ0S 0 00080@ 0:P N @U0媿0 000Sg(QQQQQQQQ(Q`PP110$[0x0/S 10 R 0S 0SL 0S0`0`@0(0Z#04 0S0R0S  40SW9 0000  poW000 9 co _oW$ 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@?oH0WH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0% d0d0h0h0l0l0p0p0t0t0x0x0|0|0000W0000000000000$ 0000000W0000000$ 00000--....////1W1 1111 1 111111111 1 1$1$1JυJ?W81810N/N9<1W<1@1@1D1D10Q/Q9 RRo1 1 oW  11222/W22!2? !. (2W(2,2,20/80 <0$ 8c.[ 0S$S 10 Rx ?RQ X$ {3 P 00 80  80 80 80  |80$ $w80( (r80, ,m800 0h804 4c808 8^80d dX80l lS80p pN80x xI80| |D80 ?80 980 480 /80 )80 $80A/A80B/B80C/C80.80E/@ 8@0F/F1080G/G70.70/72@0@ 0 Dp7070 k00C0$0 0$0(0 0C(0,0 0,00S [00 0SY $0 C00,0Y * ,00 U=0 2 LЍ RRR1`00/1`<10/1<10/p@-@$Paq100pRp@-@`XPcT110$000pP1@0@$00Rp@-@`PPGT1100,pP1@0@0R@-@ᐘp@-P@መ凘p@-@ဘ@-@}p@-P@utp@-@mp@-@`Pᖘ PpR0p@讘pp@-@Q0` ~`00p R0Q`R p/O-MPp8厚`pu@w5xGuYw !PWx t  P @  P  0 ƚP V ЍP  P  PP    ٗP   ՗P̗PǗP @u ᾗP ẗ]OZO널Iⱗi[O XOᵗx ᴗw ᭗ ᝗PzO-MpP`8w@u6vHwZu ᇗPXvl   wP @ sP  0 %P  ЍYP  RP  NPEP    >P   :P1P,P ៙w .v -u & P@- 0  Ѝ"0@-00  Ѝ@-0t`q@uP$0P 000 Ѝ7@- 0  < Ѝ"0@-00 2 Ѝ@-0t`qŖ@u–Pὖ$0P 000 Ѝ71L0#400/s@-@`00 0Pؖ@PЍp@^՘Ѝp@-@PT@#D`qM"1  7kZ 団ЍR0A-a(M 000` 0P.@P p0 垧@P ?T@(Ѝ1P0 ` $0R  ~WP 0p0z/`00 ✡0 008R_(0310S/00S/㘵@-d03" " R @" B"2S 7'@T*P p@-P@Tp 000000@p@-\03Q0S m@T 00@ TpG-@`PT1 TG TGUE h1*FRA:0CU= ߇p81P3 V 1 0SP|% P$ V* W%003A }8 @Tr@ 0V00CS  @G@@^ ᝇ@00ES 㒇@(A- `@p)70P 0SP\Z0S=ɌP ͌QX 0 S R^   ЍS0@-M p@`P6@0 0S @ P0S \Q S000U0Us00Ѝ@-pP`#匩@ጀT 3S t0 p0p 0 00 \0 RP0Q ZK0 N$Ło^MM`ف|ȁ0@-M 0000 0@ᗗ0P      P ЍA-B@p B0 pṔ`嶔V1U:᫔`媔V U UL031S ( ,02 0P0* P A-qP`A T"@P<\pI Pppu O@R@-QM`phP@W@T@0@ 00 0@`PP POP M@JT D@CTP ЍNO-QM@Pp帰U @PL000 @@0 0@P=00CS@8 a0` L0000 0h0 00P 0 0 pPw+?o2P0S@ 000` 00㱖@P 00S0P ``P`m Ѝ]G-QM⠐嬠;0`S6p  9@P000 @@0 0倖@P H Ѝ P` fh02 00P0000P 00+?oY20S@ @@O- DMPPG 0!@/ Pq B,$o 0   0,p(P$  .0 000@!. 0 .  4,p(P$ @.+0$ !00/>t.  l.00 0 4,p(P . 0!0. 0   40@,p(P$  . 0!- 0 4  80@,p(P$  . 0!/>͟ 84 0 0<0@,p(P$ r. 0!/>4, D40  0<8@0@,p(P$ [. 0 !, 0   84@0@,p(P$  E. 0!/>x̟x 80  0<4@0@,p(P$ .. 0!/>$ D0  0<8@4@0@,p(P$ .0 400 !+ 0   80@,p(P$  .0 400!/>\˟\ 80  0<0@,p(P$ -0 400!/> D0  0<8@0@,p(P$ - 0 !* 0 4  80@,p(P$  - 0!/>LʟL 840  0<0@,p(P$ - 0!/> D40  0<8@0@,p(P$ - 04 !) 0   80@,p(P$  u- 0!/>4ɟ4 840  0<0@,p(P$ ]- 0!/> D40  0<8@0@,p(P$ E- 04  !( 0   80@,p(P$  .- 04 !/>ȟ 80  0<0@,p(P$ - 04 !/> D0  0<8@0@,p(P$ , 04  !t' 0   80@,p(P$  , 04 !/>Ɵ 80  0<0@,p(P$ , 04 !/> D0  0<8@0@,p(P$ , 04  !\& 0   80@,p(P$  , 04 !/>ş 80  0<0@,p(P$ , 04 !/>| D0  0<8@0@,p(P$ p, 04  !D% 0   80@,p(P$  Y, 04 !/>ğ 80  0<0@,p(P$ A, 04 !/>h` D0  0<8@0@,p(P$ ), 0 !4$ 0   84P0@,p(P$  , 0!/>ß 80  0<4P0@,p(P$ + 0!/>\T D0  0<8@4P0@,p(P$ + 04  ! # 0   80@,p(P$  + 04 !/>Ÿ 80  0<0@,p(P$ + 04 !/><4 D0  0<8@0@,p(P$ + 04  !" 0   80@,p(P$  +8 40/xx! 0  <0@,p(P$ o+ 0,$4F! 0 <8@0@,p(P$ Y+ 0!/> 00  0  4,p(P$  @B+ 00/! 0   4,p(P$  @-+ R_ _ŁR(_)R_1_8_@_p'RE_J_S_\_f__s_____ _8R___0! 0 0  4,p(P$  @*DЍA-AP$p`0S S# S;V @TA )@ V P )@0S?)T@D@!d0T@VS`)@\0PU L0S FP1T@PRSA-pQ@0S S2 SPT PUN  @`V@=T vP8 `PU@ @T`dPT`0PU L0S0P@ p@`TP@@`RS@-` V@Qb,  xc ܛЍp@-@P80< 00 #30  0 0 0 004 00  24 48<0@S. /EH0 LP  30 0 0S 0 @0 D R0 0``#00  00000 0 Ѝp@ZO-`ᑿ00 004Q\ 0 S L0 C B  B00#01BC, p,q t0 Q8 0P 0 S5050/S05 5 08@D=O-QM@`_0KSPYppG WU XR$ E0PH 00$0 00㍎0P8T() 80` v`$ , p`[ 800 00h @00 0 0Oo `!#BP@T00 $0 00$0 0 0T0P $00Ѝ000@-MP@ 僗P 0 Ѝ0G-@`P,@ЀpĐ`P?0W Gz}XO-QMPp`V @P000 @@0 0@P Ѝ P}Y` 000 @@0 0@PO0,@+. 0` _0 000 0 pPP`"?o2P0S@+ 0000` 00㻍@P[PP!@ ^@PU 00S.0CSP|pP @  _ bc|@@h_p@-PN|@ _x s_pN|0O-DM(00<P`p!0  <0 a0,P$  @< &<0 SX h10'>\  0< 0a,(P$ %0 01 0'>< 0 0a,(P$ % '0 0< 0a,(P$ %0  00< 0a 0,(P$ %`0  0X00a 0,(P$ < %DЍ<__Ł__Ł_@_  0  /Łp@-$0@S,a$0 P R$  Upt`0@o>0/|0@0C000F0   0 S p(C-@e`Pᰐ1qS2 10" 28. h R R R ' W믍X0@00P0#*1S0Ap@0 0@00002S000000SP ЍCC000@_@-@0( R (   B "R    B \!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GAcP0P 00Q2@@P TPW *p ÝW 3V  GP 0Sꔼ@p@-@P p@//// 0\ CSR0d 00P0Q#7Ó7P0P00d0\0Bp@-TPCތ%0C0\0(@T@ 0S 0A+C͌Xp@-0 10@@0  /_0/000S/@- 0 00{ Ѝ`ف _bD]00/00//O-@1`Q@S20pp 2  'X0?03" B"2S, ЍO00S<<0 X <0 00<V 00S 0 Ѝ]G-0P@s pp? EY ڜUPJ<`P WVV `Xo? 0G<f?0 X]?0 A-X0QPcpp `@`  TD?@A-P:?`@ ᇜ@V`;pX# x@;0 "S lV@0 A<;p@-P @H0c   U0S@>p0 S pP/00//P/ 00@o/P/00/ /p@-@Pgy@0000p]Ӆp@-@PXy@P 0000p]Ӆ#V@-@>(VP>@ty/O-1 刋P㨋X%N@ \p[`R03/@ Ѝ @PR 03/@ 0 @O-1 刋P㨋X%N@ \p[`R03/@ Ѝ @PR 03/@ 0 @/00/0@-003/ ЍC-0`M00p@PUЍ 0R P 0` [0 P 00 000 0@U?o2P0SH00S 0 00,,_03/P =ŁP][_v_@-5_@-qI ]_@-P P dF``<PATL7 Ѝ /(,-2(Ł_&]__@-@ xxt4Qڀ  !P H@, ! >]_(, _C-PDMp1 p`@T+0400000 ,00(00!0 000'>@$@ @ @0<0!@P<0W0 00PSPDT`DЍDYPp@@PŁ;RŁA- @M,(1 000p<`@P0<0A0,p(`$  l!0P  勐@Ѝ<     '.A 0 ,p(`$00 0O! P P\oPT@<`PpqP  cPU@Ł&_R]._P]_l_X_s@-`PW 0@T T0@T  S  0D 0 0 "P ((3$xo`ЍpŁPd]_Łd0#(1<@ ρP PQ00@0!!3// 0S(0, 0 (0, "0/p@-P`|@TpC 0SP0 `00C0MA@- Yp@-Q@Z0S P0S00C0 0 010 p@_ \/ Łp@-@dPFp@p@-@803Q 0dP 0 0Fp B@-0 @ 嚅P 0S(031!1 0Rp@-@00C"0!300 P p !A\  Q` Y000PUR0(00@@@#p$0P @- /Ł 0`0?o s/0co0` p!/0@-@0M 000@0@@@0P 0x00@0@ @@x PPL坿C7 47 ,,Ѝ0@*AR_T_SpLRYRCR_p@-4` Q[ RpT0劊@  0P8+Y%`Tp@-@[i;RPpd;0p@ 唊Tp@-4`8SpP0P Y@  +X084@p@TO-04P@ 匡@0D0H0L000000000111 1a   p @w@pD   p^ypp 8 p wq^&  ` qfa@^$ ( , 0 40 @P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08@ St]p@-PU 0 R `0 ˉ@P U x KX000000Ppt W0T0 0S/0 ډTG-`PPp@U#P0Z00 U00 t  X @T 0S P x W0p0p@-@0PQp R00  㓉T0S/@-@P`P" RS . 0 000 00 000 00 0 ^PP  E2 1"  P0E0A 30Ѝp0Q0@-! P0S0Q@ L >̠ TP00000 00 0 0 00 00 0 00p@-@`P|@Tpg A7@-@P B | k Ѝ0G-@Mc04`pP0 000"!ġ       P0?S$P(P,P0P4   L0QQ 8QQL02 SR|0p!!!!!!!!) Ѝt]@-Pa@j9 i?,10(1T0 41 1 00000110010 0 k@Ѝp0D"! 03@0A-q01P0c?@0010!(" !0 & 0`0(0 –A10101A-0P`q ( ;@oT  0.@P 010 10010-A!  !!! 11P $P A-@ 0S Pp`P0 8P0@F0D"0!!3  0SW00S@ p0>S? 00CS(QRQRQRQRQRQRtQRT P@G a 0 S 0 0000@OS P@@  @@O-Z0$M0C 0 0 $Ѝ0@001S 0FƧP4 <00p0@0C"03 ԑ Z `( h`P  P  j!QP!g 1 0S  P  ` P1S01ą`$ 0  0    @0 0qW Z RP R0p Q2  kpP pQ   BV 2}V `Po Z$ P@P gP7 0 Z B "VRxqWZP P R[ 7|@T 0 0PSPA?o22zP Z0 SPPU    S R P Rl  B  Z P [!P Q ! P zY0p` T0p1x1ZS|!|!|1x! 幆t]TSG-P葐dp@U" PH1@T' L0S` ZR` 0  ``ǂPXP @T YP @TUЍ`0SL``z 0  ``囂P XP Z0 CSRd@RSp@-xM@?x ` PT0U0000`0 0(0$(P lP, 000@P0 Vx6xЍp@-P0@1P00Z00l 0000l@ A-p崀`@T$ L0SP0S 0SP`PDU @UVA F26@PRSSG-1`pAZ0S'P\W iP0SP0S PR60S|PP0S G0 oQU 1RS0@-|M@t P\S00P |Ѝ07@-P0@60#R00SP  0$100\ P P P $r Ѝ0@A-P`p@TW [0  d@p@-xM@`Pt  S0 0 0`xЍp01 10/O-1M`p0AtPp31\P0  kDi8Sa:54c@㇒) l 0R[0"? R (`pap0` 1RS  P[ 1 ` ^0& ЍO/G2  Po \ d20 d2ЍOYP k`  0  00  2ЍOЍR_O-p1唑|MSA僿P0  lXO  X^%@8|ЍO R (alS  hft R0! Rp 40堀尐1!` p$jR0  ZWpFhp`0STP 1`@T 0c/ 4/|ЍFcR_p@-@HP`" 50S Zp@W@!p@{RO-p`PA$MZ0S P R U 0 .SZ [Pi?!00!00000!00000!00 0000P Pg8J?Y~ 000 000 000 0000  000 000 000[PPP04P0ptq$ЍkPPp  㸕0E⣲@03 !! W 0QC p R!` Q0 !!  Ru  U  R [  l Q W  0 0?PlZ*PPL p402S SO 000 000 000 000OX 㨡P0HQL1`0S2ڜ01 Y[  ) lP% !0 R?PP0 1P0!#Pom St]A-`@Q` 4R{pP2! !! ! ! !! !0 0F"0Q!V31 $0110102At]p@-@P0` $㉇` [p@ __@-APP0  P08P0匼剈  .!p' :P0|`V0S 0 00凂 夁00C0лVP08P0޻a7P0S^/000X (P0XHqL1' 䀟P&  03/`00S P {z?V` 0 t`DVP02P0P0 :P0 |`$__t]?t]]C-@1PC|MT!atR 40T!md2cX0d201S" H1Sx  O` R"P1嬁p0P ? 1 ` X 0 8/Y0 gP  0  |Ѝp@-@ 314020SS`@P`Pp 03/p@ S 宅p@!@ _p@-@P@`PN@  03/@p?p@-@P@`PN@  03/@p>p@-@P@`PN@  03/@p>p@-@P@`PN@  03/@p@>0A-PpZ0P01P0?`0Sl 00C0|@Tᒺ 0SP0 ៺ R\ AV  T ` p000G-`1SxMpA 1 0t N001Wpp00 0 0$00(00,0@ 0N00 Q :P0  9ၾԆ!0  R (! &xЍ%@ S`40` 㠐p0`1RN qP 1 `@T 0c/ 4/$_A-Pp@ Ⴚ0`V S R @0qXڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/(,A-D`DpP@O0S J00U@`00TŁ00/p@-0@00S00P00R-   P 0Q 0 p@$Cb 0 U}&0C0d03OP  ,330 0`np@4h]p@-P@GU  Op@-TC\  P 0 P  &}`@`3p@-@P R` P0==Q`PP0  p@P0=P0/G-1ȁ`S0Sp YP@H DP@@D P @P0Y0>00X@MP9L24b0`M@M7:!#:  : 000@0QP1L0LPMP MP?aЍY?@Lq``TW?Tx L O`PqLPL0 40 00LP!LP VPP ru0 s` g rbV`-HP >@Ꜳ-Ł-(__>_}^-_^)^zd@_C-@QM@ЍP`pP :@P `L qOpPXV D0a0CQ R P I0@pD@P :LP 6LP 0 /L Pt$aLP\LP'L0y0 cRY P!႙L! &ခ"**p 00 LP L6#:p:00_>_}^A-QMP@`0p"TGP# 0 x@P(~ l>@QaT j>W ~~ЍQqGP5KPKPKPKp ~WKPK~ =@KPK~r5^_R^>_}^'_-_o^_O-x@0SM800880S NP8 830:OP>@xDPP l8dGP0ST g@80 0 0S ~?CSGKP+0000000000{0 cR[0 01 90 `, I~T .KB~KP pSKP`NKPTa1~L/~H-~8pw?oT20S  K 88DDQڷ0 0R`A*S 00B80 (0PP0 08(0PP H" JP X KPHKP` ` 08# }V J}}8 wP[V ( 0"5 006 #::000040# 5d50YO匕}8vPRd9FP5X% J@P}J4ʀ|JPJP JP4?aⴀ4P^# 1$0$0 X8FP   008XP `D R 0EP0 hP,8EPP 8EP 8B0P D RE}30S >}P 8EPD R 0/}0h0 3 *|h$}D30S ЍPU<T+ J M`P$I2PRd JPJPII 0 10 6#::`0000PII(```C 00LPPa' # I@PYIIPIP xIP41h?a|1P=1 1LP l|@1PU~50P00000q4!0 (\j 8MF 0"6 0 8100 00|8PP8 t|q|00-Ł-0h^;_L_- *_?_>_}^^,__L_X_-_g__^_ˁ(_r5^o^_R^-___P&^__/ Ep@- @RP` x0tPS|0|Pp@cx0Q0R h R t|0 p@tP|0p@-{}_p@- 0@SP`pPup@;S h0S p p@pPpP00SD0P 800S,01@o/Mtف`ف 0!< 04 0 (   !/(,7@-h@hhPv \00@0T D000T ,000T Ѝ0v ___3_ _G-`P0pP&$ sQ!D p@ D0@0, ЍGrЍTt]O-M`uP8p X^@Ѝ0唰P&$ @Q X Q$D@ H0@U 0 $ X@?Tt]C-@:P  ЍC$x0TP` g  p <0P&0$ ]TP  Ѝ0]D00S/p@-P0` D@c0 p@MTtL03"R  R P2@@-/0#202/P /@-@P@D 0Q\M)H L \ %*Tq R!0`0Z00S0S80SP Wo0 2P 084`s$3    0` V 00V*๯PW} Яz꒳!Q0000`08, >, N> `0`0`0QE8尯8`04 R`M40 040@o  0W0 0440@P4 0p;`0 $ RW 0SQ Sh000 Sh0000H00800P@T( 0 SD 0 00 00(08P@Q ` 8,P 0 Q: B`<`0 = `0P@4X8Q ` 8 P 0P&#h ;0 0( P0hPE4P)U0S00 h0$ 00 _!_bO-M Qp0a4S  s;Q0sV$@0P@T0p+ 20p' X 00 1$JP` (z=84匰0尠 T0 000 00 0kP0pЍ[S 0<P0Z Z @``0  Q4QB P 0P 0  XP X `  (=4 BT * B8` B ;40KS8+`  =P4@@DT4@8s0@8@0PPU(00Z00$0p( 00S @8! P08004Q (0PP!_O-$MXp0 H$RLPT   s@&UQ RQY`X`Y00S0p``V @   0 0 0 k@P $Ѝ00 00000 0j@P  00`0`S@80SX @0Z 01  a@P 0@00CS񟗡R.<0  #00 0 0 0 0`*0 0R `30(,  0$ 0S 0$ 0$  0S 00 $ S0 0 0 0 !b0{0 P0R 0000S 0 0 \0 RL000 Rm00000 0S 0 cXxɚ;6eʚ;0 &p@-d@ 0$ 0S 0pP P0S $000SOLp@3@ȁXHȁp@- xp0p@Q0}/’\ \#3$0WP7 8@#4h03/p@0/HȁPMb@ȁ@BXm$_0S0/0C-DM@`p(00<  0 80a0,$@ @@ @P}P00H0000'>a0,($@ @ @<08 jDЍ$_LR$_C-Mp 0@P`` 堐/0p 00 00  P 0 0Q?oY20S 0S0ńЍ80< 0S 800< /Sap@-@X@0`0@0Ja,PU #0 ኪ_`p@A;aPV`@-@PP@L@-P@.p0S 444a 0S@0 Z( 0R0000 R'`0 `㙗` 0S 00"#! "#12`P=3 $103$!J)0 3/0 00000@000MbxP@-f$_0p@-`Q@P0 *0`, dup*0` p@d=_^0H-@`,M0尩P0S@ XX$PU? ,ZO80< 0 80< ܩ ,`P @ _H D?Rp pӷ1 000P1D H圖pzW  7` !0  t1_@0Iy_p00 0P00000pM`pC(ᏩM0SH 0R 0(0 0 ,P0$  R 0(00$P 0r8(P$`j(| Q 0   P`Vᤖx$_$_RP$_C-@,MP` 0 $0(  ,0p@0000 HPD` @_?U  t000000 T0 PP ^Ԩ,ЍӨ00_ $_%_Rp@-@`PPCK PpP;K00p@-@X0M 0@0@ @@@ ]  00@@Ѝ@蔨%_xhȁx0SA-@p`Ꭸ@Tɨ`K Ps@P `JH0V P@t@0T@SP P0PT TPX0\ P0 X0\ 堨U `J@@H V P@hȁx@-@dKX0\ 0S X00\ @P0ST T % zT@`Jx0SA-"<p8`'PU bJ0@!`R R0S QJ Ѝ0V PP0UPS 0 |0@ 0@0 T0 0 +T QeJP V PhȁxRlRtRlȁ@-@hѧ0 0S 00 @0S   $TZQ@9Jxp@-@6QPFQpp@-@PQ@p0-@- p@ 0P` 0b0`00]PЍ@Ѝ/s@-P@䅧00`V ὧ`] 0  0Ѝp@f]8R%_p@-@8P岗 3 $!h&V^00p0S/p@-P@D&P,0S  (0 0@0(0;^p@耧0 0R0000 000 @0S/ Sp@-0P@0% 0R 0(0 0 [!&P ^ppp@-@PPp0Sp]@-@X0HSh@G hp0S/ R/h l00hpȁy @-(צ 0   q0ypȁRy ,P!00S//忦yyA-xMⷦp@TxЍ&Rl00& `吀0S p0StA"J QQ\00\0x J+t0000x0(0\0\P0 Rpȁ0@-@4M P 0 0S$0 ( @P0S00  00U & 0@T4Ѝ0W0 0000 0@0lYP $0P0S 0003/(@ʚ;pȁO-@Mq0003/#0 @0S P00$ЍOcX0S9-HL 80<`Z [PP0 U0p\!)R@0&PoP0Xƒ:* P U  0B)W0 0 7)0  1) Y 8H0hpP0 @ |0 `R1#e(`6,HL``0P SЍ0 )\00\0ʚ;ʚ;ɚ;p@-P/H @  0 S0S@pH@@- Py Q 0: /@-@ gP cЍ0 \Q\ :/ɚ;0@-@MP aP0 Ѝ0Pp@-P P0 @H0S00305: 0(ppʚ;ʚ;@-@ PQ  bЍO-`DM00  0hp]hPP <UWPP 0 PDЍ 0S0 0W@0@C@0 #PP ?o2W0SuPP SgPP 0$  0Q 0 (AQ0S 0 0SHUafP ʹPQ( ^0S( 0L\ 0S 0 S0 00 0 PQ ^0Q 0 L\0S 0 Q0 00 $%_ʚ;p@-P(M` `@P0S00 0D@Q 0 aP@(Ѝp@-P,Mp` `@P 0S000# @Q 00 aP@@,Ѝ@- R R S12S1`01 0a Ѝ@-0@SM 0Q  00a  ( aP Ѝ0@-R@P$M 1` _T U  ]`P @0P S:$Ѝ000S00 :0[,%_@B@-0 ЍA-@QP  (£0!'`Ap0 'R pW=) -` p`U姣P0 S00 10\00 1 p 00 00\ @@S0P S0."? 0A忣꠶Hȁ@BZ{c /pȁ?B0p@-0M 00000` 0PV@PP  _0P@0S!Q Q  `@0ЍppC-P `0EQ@P XP\ ` b HUp0Sp0 0@S((0,0,0p0 pRpȁxȁ0`0X00CS/@-@8zX0S000S(0S, , " y@-@BX00CS@80@-@00S &R, l00& 00@cEpȁA-X0@0CS 4?P$0PP 0S%$0PPs P H0LHPL`QS2PPpX1RB 0S0@ tP@0 00\\S  SH L HLP H LPPP QP H LP0Up0SH0LP PP BRP 0S H0LP 0S 0 @H H0LL0SH0LP P BRP 0S H0LP  yʚ;ɚ;6ep@-P0S H LA  RPH LPL0NHPQ^8@<`0@0SP0 HP80PQPUZ,0@T`0P0H@L` 1ppʚ;@-P8@X0 CR2   R* S .0 RS ^0S 0 AQ0S00  00 S0 00!Ѝp 0S 0ll RR H0L`00P` Q00 ʚ;ɚ;6eA-@T`PV`S  0bS \e S HL PH LP Q H !L P R 0@ 0xxaS \I S HL PH 0LP Q H !L P  R  0 `p1S J`$V0S( 0S%0S"0S0tACHLp P Q 0HLp P Q 0ATɚ;6eQG-%P(0p`V N`CX@ p 5/PPp0SS t00C>SlCUPЍ!  $RQ XC#P0 SQX  Wp   W  t xW0 W0@ o 0 00⌠A 0^P]@-0 ЍD@A-1`P F?o2!R0S0!RX00CS 0S 0SxxS 0{HHL@LpH@L@PPp^P@HL@P0ɚ;6eO-\M00P @?o2!R0SpFb`PKBb`PG}̡̑0ATy`=888$0P0S X 0BQ0*SR#PH0 L0 H0P L RP 0 H0LP !p @U 8\ЍS 'H0L Q 0H P0L 0CSP05Qk9 100[(T 8uA@W9p U@p xP U  0t  00 t  00匀P@@Ϡ0H0L0P #0 RQ @ U U' p T 1AHaP H L H PL  QP H LPɚ;6eĠ]C-P`U@p,M0S U ZP ,Ѝ p03P  @10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@vLp@-@`P.0SpiG-1C0(q!@@XP`X R00GU 00 CQ'Q QC400 0C?ƒ10Q0 0 QC400 0C?ƒ1 QC80#` Pp@诜@-@7@媜$A@@-@.0@@@-@$@嗜@@@-@@厜A@@-@000@肜p@-x1(A= 0XP0 0!` \ \`\dPd\`dP:C$ `ȑC\ \\dȑPdȑ\`dR&C!*`\ \\dPd\`dQ#A 6/T3/@0 3/@` R0T0  l-ȁMbP]*_T^X^+_PT*_$TR^)^$0$$08S 0  VꜲRSȁȁp@-@PDƊT 0S 0AT +0 @p@@-@L-G-`Pᩊ姊븠p娀U%0S" 0 @T +0d0S\0S #S`0S Ɋ@@ᄊ忊彊@ȁ@ȁG-P `p@PIG 0S0 0010SH 10SD EVC9G4sH01,XJ&0 03/D6L\+A0q1 -P`jV<0.G;d\TG G 'HW 7/pP 0R  v P0 4S 0S pC+_ȁM{+_ȁ*_Hȁt+_+_A- Mp` P| @P 0 P@ ЍU H00S <00S VE5/01,GȁM0]S^@-$M@P8 `pH0 #$Ѝp@-PM `J @P 0S0 0ON,0 03/8t00\0h@ 安nЍpȁȁH L0,ȁG-@pWbPPU`0S23`0tq?PP \光UP?+0 <z(8(`P-@sPЍ b000i50S0S<0L 0SI 3/PPE0e0<00<0|!L06,lI4P 0(0S 3/,Y/0S $!G P0`0?)@0U0C0   S( 0S%J-P  EP  0R C P 0S0 4S  +0$0ȁȁ@ ^+_p@-@Pp@@@-@P 6@-@P -Ѝs@- P`@P 0 0@ЍpRF+_@-@P @-@lP@@-000 ЍRS@-000 Ѝ SS@-000 Ѝ4Z@-000 ЍtZ 0Q/P /@-00 0P ЍRS@-00 0P Ѝ SS@-00 0P Ѝ4Z@-00 0P ЍtZ0 Q/S/< /< /0@-S@<00<0p0S 3/P/<   /0@-S@<00<0t0S 3/P/x0S //x0<0pt 0<0/0p@-@Pp0t0ṇ<0`0<00Sʸ0Sp@>=@-@0P|0S@/|/A-`@ᔇpȀ<0P 0S#Q003P0 000=00C0j>ᴇp@-@Pl00CS00Y>p@袇//<0 0S /0@-S@<0 0<00S 3/P/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@ <00<00S 3/P/)00/0S/@-@3/00000p@-@hPp`Pl01Sp3/h0PSG-lP 0h@S q+)0`S0Z 3 #pG Shl`T  ) P0!!00A-P@l`hpT1S S@ R Th@l@}A(1GQ @p@-P @ PR0P       PU  U p@xwPU lP  80R 0 PPU ]P 80R 0 P@p@-P0 0S S- S@U@EpN@P00C00S8 R@;@P000 R8 R@@p@-P`@P P p@@-0@Si00@G-A_P 0p倀0| ``@lT BP BP @B+__Ɂ_@-@6@x@-@0包,0@T   B B  @@p@-M` P@P U , PCЍp R 0 R G0 QS0  'PPPP +_p@-MP` P@ Ѝp U @P C-Mp `@T ЍT P W  PP @P0 T B 00 b B0"\ /-L \  QG-@T. TpP"!bIUW :T0 pG PW T0 pT0A0U!O-@MPP 80P6#bP"ᆡ  80P 0Fp 080Y0S:PE pw V    r R:V  Gp 0PBUPP5Ѝ 0 0 0U@@ pY,_0 b B30 @-/@ 00/,_O-PM @0@#0pS0D0UPPQ" 0   @ ~ 00 @P"  G됚!0H00`0@0V RЍ  IU1!pd?X  0 PE p`P5 0 0 0,_,_O-RMP`<p W0HЍV ,580R#"  80Q  Hip㛠!0I@ 080T R00C0 @t Y    0 CV1!p0T~?Y p `F @ 0 0 0 -_0-_A-P` pW:%0@ `$0`rb@-@$@$7@-@P 0P S #p A  Ѝ0  7@-@P 0P S 0 Ѝ0O- RM`8pļ0000/P/0S/-0\ 0000C0P0S P 1 !L0 @0C0000 p@- R 0@ Rʠ7PQ BP P0 h00R Pp00000C00 0C000 0 p._._[ S# @-0@(M0T (Ѝ@8h03100P (Ѝ@^60 00 !0 0 0  5(Ѝ/[ S% @-0@(M0T (Ѝ@8p03100P (Ѝ@J70  8 0 0  (Ѝ/[G-p`@V4 PPU00C0 0VP1R 0S0 P0p`F0000C00 0C000 0  g[ 0S\* A //O-0SQ0+ P@p`V `p 0T 1!Q ^ 0R  _P 0 @T   0S  R `F P0 Ѝ  [@-P`pᮆ@P0  @ Ѝ@-P`pᛆ@P0 '@ ЍA-@`pxᾄPPd3y@Ѝxx@'y,%yT0 @jR\ 7=5\ |7N6G-`p0S0 0@P202O=@P0 Sh=@20C22S +1 0 /= =/(=/0=7=/>=/M0P PЍ/  /M0PЍ/@- @ P P R:H 0R PQЍTVRPA- `pP@T X@0 8/P Ѝp@-@P DPp//// /$/4/Q Q Q  <@o/<9@o/</<!@o/D0/P@/@/H/P/P/@-joP/P/@-^oM0 Ѝ/   /@-0Mp00 @0`0wPPV 05/Ѝ@-00 ЍЍ._A-pP` P110Q 0PP00V@ @000Q 0P@000WGW p 0  0 0  0!VLP0 00  0!ˁ@-@ Jw@c-ˁ/_O-M @ 8PRPQ u`;w0ZV 0S 4 44 R@ 0 SJ2 *Q P 000V 0S000S000 S RSV RS 1S .w Ѝ301SVO1SS  R 0\ 0S OP V 8 0R CP 3 !E2B<0貟 01S - 0 / a0S 2 22 R 0 Sll1 1SS  R 00S P 䱟 0R P 1 !{1<0刱 0Y  q 010 0 0!0 S  KS % "+ P P  K㐰0 70P  P 000 00000  ˁL]h]/_H]v]7/_ p@-@P`u;p@$vˁqp/<0M 40000P0000Ѝ/qp/<0M 40000P0000Ѝ/@-T0@006@ 0   PЍ  Q @-T0@00@ 0   PЍ  Q @-@yuT00Sڤ001S 000P0\ 0S@Du@ < R0 AT@uˁ  @-@P@P=u H0D00Q@0\@mu ˁ  @-@P@P u H0D00Q@0\@Pu ˁ  O-@P' `Ppu0Sڛ 0S/ 00 P$ 0S 00C S@Tlu@h00S\001S V  0P0Eu Ѝpˁ  O-@P' `Ppt0Sڛ 0S/ 00 8P$ 0S 00C S@Tlt@h00S\001S V  }0P0Et Ѝpˁ  p@-P@ Tmt00S001S 000Q0\ 0S @P@htPp \ RP !R P<J4L@wtˁ  p@-P@ T't00S001S 000Q0\ 0S @P@hItPp \ RP !R P<J4L@1tˁ  qpO-MpЍ8A Dp2 10T/10 0 010`V.` 2V @T 4/p $ @P @00 0;/ 0pS EU h X000)0T40 00PU QU L]ˁA-pP`P ^ 0pA/A-pP`P p0A/@- }@P00$0 0000/dA-pP`kP p0A/A-pP`YP p0A/@-KP(@-EP(@-@?0P 0S @/A-aP0P a0A/p@-P"@Pp 0Sp3/pp$.Ppp@|qpO-MpЍ8A Dp1 10T/10 0 010`V.` 1V 0@T 4/p 4@P @00 0;/00pS TU h X00080T4000PU QU H]ˁA-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`P p0A/@- @ vP@0/@-@l0P 0S @/p@-P`^P 0p@/pA-pP`OP p$0A/p@-PA0P p@(0/pA-aP4P a,0A/@-'P8@-!P8p@-P@Pp00Sp3/pp4Ppp@\/ 0 6/O-PA(0娡M#F0@9ᤡ @Ap`@Dxqa lw-hq d 0\! `  H7/$08<` S, 0(7/X= [$ (0R7B@8 0 @` P7/8 0, 0$ 0ЍO/[ o 0p7/#$\ QĠ<7/ЍxT]TW/_O_\/_/_/_/_s/_|/_@-]P0Sp@-@`P `8ql 4q0t0p0P0 0T0`\PpX@-@f  CXA-@lP`pqH@T @ U@ 5/@Gq@-@XI P 0 0fz @v@-@lp`@pXbXXXwG-<@Y800P$A`Ϡp? % V0* `V p0 W$PO-@8P<M Q00Ѝp(0 S:80S (0 P`Ϡ01 F 0f800x00|0$ 01/ ?;; 0 4;$ X *0X  R$ f  ̠>Ɍ8  X ` :X 0*0 600 ( 0$8 0p@-( \:P80S @<4;$< 80(0$00600<085/p@p0@-@MS 0 0C?o2QP R\7 R4 P@Ѝ008@Q AP"u080S  a "!008S/_/_@-gM"Q`@! Q Q"00@lpo `VV@ Y@oT H@Ogߍ <# sv 2Q9 3C7CQ% 1Qk 0Ql @1QQf/!@1QV 3C 5CQH 1QY  _gߍ@JQ f/ |8S@E/ t 0 S0;30?`aV!  0S @2  @    *! R@T P@q  gߍ@Hgߍ@J K_ wJ[ @pd@hd d@edA|dA-0pS<00@$b /o bP c0?o 0cT0 `$0 ." S  R Q 8$NL!P3 - R ("(  R ("($ R 0x lW  XaV P   0UAS 0_0_)0_;0_O0_0_,^b0_0 60/80S/A-(pPW {{W0sf/@ S  R8S`-P  d /o0bCQ b#PQ 02TH f/h2 P 0R*WEVs@-P .p5 `@@PA@0 @4@  P  |*x @P T H040 ,( Ѝp>_]l0_@ 0_0p@-M0@P0( `P0P P <2 CP *P0  Ѝp00$0 P0 zd@hd A-0(M pP0`@P. 0 @P&`'d)0' pp)q ap (@0T p(! * *  x(Ѝzd@hd 0_^p0S/@-l0@ 0P 0 P0p0Ѝ]@-`DM@:PP `& l0 00S p0StP : p0pS0l0@0 0p0,pP$00004`P0tpt0DЍ00@- R*0P ^$#3$! ^3"Q Y( 04  A [$K [#3 ^3\ 0< l S0P 8  \ Q,N ^Q,RRQ   P \Qdt ^QRRQ  yP` (o 0(3/@P`0 (M@P```ṕP#PA-`p@ 88S@ @@D@D@DP@DSX PPTVS0SL 0 R 젟0Z0 G B [ L0? U*R00H  0 P@" P:  0 Q L 0* P@0 01_1_^X^1_ˠs@-@@pP `@EPЍp@^@^O-DM`P0 (00 <00`,P$  @\8́p@-A@ <`P[0 0RQ@+\p8́p@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \P[0L$PBU 0P[Pp p@ 0 p@|f~f8́@́G-p@`P[L 0R$ pY+ 0@@T @E@D@ T @!T% [ [Y@T@ 0TT 4[#  P [8́x́p@-@T P,0,h0[[ *Q[ppp]8́ṔG-頁@0MS㠠$ Ppx1 R0S! 5S-@Z@W 00@ ).[ ` P@U`1e[V @0@0Ѝ 0`` 00  00  00P 0 0@PEUP!U @ |0@S 0 6T0p`FP@8́a0ŁQ/p@-P0 @AlP Q QQ ~ @ 00H0p8́a0O-@T0Ѝ]A-P0p01A`pQp 0 S 00000V 0 S 00000A~Sa40040Sa40040]0@-$M 0 00@0T+:0S PT00  @@ 00S00 00 000  0 $Ѝ0@ @0 0S 0S PT: 0 00p@-0PS@ 00  0R :p 000 0 @p 0 000 p@-0SPp0@ P\ `R` 0 `7@-1PS0@ @0C0H00CH00S   t0@ 0D S 0 0l XXX0S0P<00C<00000S000 Ѝ0]5_0S p@-F@ P0Rp/@- M 0 00Q0S @@ 0\ 0  0S @ @0 \ 0 00 00 000  0 ЍO-M@P3sUP0@S`8@H(0t t  0@@X $ (0 @Y(Xt   0(00 YR 0l TTEL" 000000000T0 x`GQ |a0儠SFQ؀`V`00@@ llP`0`00@@0SpkQ0S &Q0\00`0@0\@@S ЍOXQЍḾ]5_́́G- LQ @P<<p @0a00QF0  @`0 P@pW`*0` 0P@0 |0 P0@0 0 @P0@0 pl0 @P0@08 PЍ @Ǵ́5_́(Ձ5_6_(Ձ6_ց6_xׁ 6_h؁dh /G-x`@pP$|L P0R/d0SX 0S ~kP  E 000PPPd0h3/tPL P0R:p00p0 p00SpP PU000Pt n  P e ("(R   PU! ! !   BQ "R"PPH  BH L  L !R  B R R 0 0 ! ("(!@R R R 0 0 0S0000H 00,0R:< 40R**P i  dPUPl (( RV^]*6_A-p0@ p W x`|Pp0   x@OOW*:p Pp0 xOX03/`P Wd0S h3/03/`P t0@PPP W xOp0 :p0W x|O0$pS0P0P00`01t0@D000000 0 0S00H 0@0 H t $ 02S0SP<0 |0S<00000p0:p0,  R  0S*#@-@H ,0R:< 40R(GpP p@-PQ1Sp1@S0 1 01D\<0 00000!!""00040ph؁]A-0Pxp0M 0`Nt0 *  `y@P@T, 0 R  0S" @0St02 0 0FCc@ 0P: l  X @@@ 0  Tl   @?@0#3 ! 0l q 0S0``10C1000H00H0L00CL00Sp0@ 0p0|n!@0R.  H 0B, S:<04 S8 S 0S000N )0Ѝ0S   0S0@0@0՟0CR0S   0S0@0@0@][6_]>6_2]m6_p@-P`@Tp0S   t0@(7@-@ NQT0S; R!0 0+R +@NX M\ `0RX `00`0\ X 1NMX 00CS0X MtxP#NM00QN|M Ѝ0  0́́́O-@Q` 1 `|Pp@ 0S 0>S  T` Ѝ臁 1 3/ p ՁG-0 @0 0 p  (`,(0, P0U(0, 0Q U000C0000Ѝ 0$ 0 0$ P@ 13/P hPV 0 =,P][A-@PxpAM@`E804P"8%< 40R:AmM\p@-@Px`#MH0,PU< 40R*p@VMp@-@Px`M0Pp@LMA-`@xPpM? 00+0`@`E0PPp8A.M//\00S /@-X <!t  L  R0S p@-PL@MṕO-PP@4M;T4ЍO/lR` pR cR sR SR0 RS 0S 0,0,pW4/"Zl L H<00 4/4Ѝ0`t(L4/X @4/<080804 ,4/P0 0@$4/4/00-4/X 0S 4/ 0S 4/ 0S 4/0SE4/V|4/W P` 0GOQ  0 `$0P ZP4/ 0@4/4/Y 4/̀QȐȠU~  4/`p0W:P4/ r 0 4/p` 4/6_6_6_6_6_ 7_ 7_S7_7_7_7_7_8_8_)^88_Z8_~8_8_8_8_8_+8_p@-P` 0@Tp @A-PxpK`V  `V`V@K J@P` B@P` :@P`A-4@c0(P  Q QA$[ V`W, p\0@  1a1 q!1Q<1( >01 1010 G0110SFp0SRK`(RU,2P0@0,2 \!01000x0SllPP0P00@000S0fK밲@Ѝ$H~Rց@Ḿ8_ՁA-`ph M@iPP L0 0H00D0@0@0 0<008000` ЍxׁA-PhJd0\`(BpTAD(K101#KJ10C1@́p@-1@P  13/p@A-@p000`0S 0;S 0S  ! PU  0RP Q  u(0, 0(000,00000Ѝ $00 $0́]p@-0@0S00S) P`01!000C00aP0A!400C40p@0 ꐼ@`Ѝ 00 U00S`C 0S. z,@T@p T @@⭖ 0R#T d  R ! /@!bCQ00 0@!@ x @T 0 0 `ЍGk?@1c  bp U 0 0^gfff9_@-@ @@ 0 4 00"  |@`ف E] s@-@@-?@-@P0 @ @ @800S @ @Ѝ0@ Ѝ/D́0Q   '9_?9_@-`@P d0 P000S   YЍpD́-?@-@P@PF 0  000sCmЍ0@ Ѝ/ 0S VFP P@@-0`Mp@  WPE0 Ѝ0-@-0 000 DЍЍ/-@-@M0 4 0 000 +Ѝ@ Ѝ/^@-P`}10S A3S  lfPT ?i#T212@00@00A0S;$10SA000S 1!0Q000 Z$p0 Pb 0 pp0 0S d0d 0Q01^T/0 `pف`فĹ<́a0z9_|فS^)^R9_-@-`00/s@-@P`hT 0 ,@J0 `Ѝp@_Ꜳ^-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`pp)T 0 H@ 0 `R"$00S Ѝ@F Ѝ蜲^`ف-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`T 0 ,@0 ` Ѝp@Ꜳ^-@-  ЍЍ/-@-00J Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppP0T00 0 \@~0 Hy0 0SЍAЍ蜲`ف^9_-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``MT 0 H@/0 pvF$00S Ѝ@j Ѝ蜲^`ف-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/A- @TqToAAP(@A01 010101hA-a(P!R Ap@1!#880RoA$1 q0$12020AwA@-`R( q@_oAT0  (0Q!@D!!R Ѝ@AA@A P OA+A Ѝ ` `P 3Ap00S/@-`0`@0S@0D 0 @0D  A@0D 0 @0D @WA`ف|0P-  !T LD.!      /(,l 0CS@-T0 !< 04 ,   !/9_(,@-ӀP 0Pp@-75 0P@35OoPBp$0 0!0 00 /(,@-<0DT 0 !0  !0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P`@ O@iP1p@-@`C@ @00/A-@Pp` 00$0@p#0 AA-P@`wp 0S00  0S00 x0SAA-@PpY` 00@000#0 A[A-0P@`xpx00Q ` 0 x) 0S0Ѝ?  @[ꔼԓT?/0 0 1PS/ /@-8 @?00@-9_G-@R`pp? 0SP!R PP Q PQ  P0 00 0q?PtTp@-@Pv?0S` p@?0U* `V 0a@-@@ S?p@-`PP?@Tp00M?`0S   0S?p@ p`p@-@`P/?@T 0S@A @e?pP/0S /O-p`?0S R 1 ЍOE?C??@Y:@T R A&?$?0 ЍO`0 S   ! 0S 0 0P0P??T  Ѝ9_p@-@0T S Ppx0T p0APdP IPpL0`P(0A9 ppcL@BP@- M@ ᾐ 0 R0 00CS0 R=9 = 0 Ѝ@- 0 ?A3c 0ЍMb@- M@ ᎐0 0S 0  AQ0S00  00 Ѝʚ;@- M@ E0 0S 0  AQ0S00  00 Ѝʚ; \0R*PRQP/$R//</@BLd 0Q P QRP/( Q //</ɚ;Lp@-P@P@p@-M pP@0 `\0`^Z\k` 0 R S Q 0 Ѝ\ S0 C^  0\ 0 0/ʚ;A-qP M3 B=T t13AT \=@ ЍII@~=000 {_==0 000@0 0@P! /00B! 0㨀!!3BaT=T W-P=p@^=!  <0P P@ᣏRʚ;@- `@P0 00  Q00t0  000 0S0  AQ0S0$0  00Ѝpɚ;6eʚ;@-@^   H0R  0S!S 0\@tɚ;@-@^ 0 R0C? 0!T0R0\!S0C-@` 0M0RPЍp0" PPX P  R0 AQ  R0 X000WPP 00S 2aTP Ѝ000 @ 00@- X( b0A*(P Ѝ @- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-P@ 5 \0P Br4  0 Q Ѝ0@W00U -,^ :!!<  12X0 0( X 0 p@-@P4`Qp@51S!A-@pP`40 00@5ЍO-s,M@0PXP`$ 0) B4  4  440 L#C8."<pZy?#ßpX0N40 38<p000Td0a@P] ph t4d0 H0 TpXpg0F1PT0`@VL0X0P0\0$ \0`0apUP!>pq q,Q02012410Q'5*5V`F&p8!qU.0P`Pd0 h0PS0  0 PSI d0 $SPB 7@,Ѝ\J  B(xp0EQP! 0@A 0 P. h0 00 0< X0O< @@ Qp P`FpGd0 ZL3( @,0,@SI$1((0(14 ہ`:_tTT":_܁L@-@`z0$MP00 00 0`0@pN0 00  0|0|`0@0p `0` (X00P0 `0@00 0z$Ѝ ہ|TT):_NN1:_ (;:_-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 C//@-*B:_00@-M00|0|@| 0x00c00PP  TT] <崖80 0 Ѝ0@r]ہTL:_t]X:_IJTP,,00 C#' ,00/ᐼ(00 Q0000$  B',#  /(A-@PM` p20 0 0! 0?P W 0  \ \0P  PP 2Ѝ$ 0  0 Pw_lTS^p@-P@2 P2> A-@P2x0 3R ` 0SP` p!VU A2S0A-0P3w0@ P |2p `V 0 00002`03/Vf20 0 0 Vr@-@F@Qs@-0PQ0 6 0@S <2000`ЃЄ, 0S o2)2B  Ѝp@9TO-0Pp,0 `0@ `F`! P (0P@0 0 PP PUP@(p@-P@1000PPp@2/G-1P@p0S 00 `@ 2 6/1 0$ 0 0$  $0RP@€D€@-L@L03/@1`0d 0 RS`0d D@1@€€A-`pP1@"^\Up `0 0 P0 @0 00dAT1D0 000  0@€D€ 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,0@S@- /:_@-@q`PMU:,A0 µ 0 0 @ⷵ @0D  i i  i {i0  000 0t000d0 0T00000<0Ѝ@€:_:_T:_:_߲^:_:_(T\00S/QA-H@H@`PQ0p"R0:A0ꔼ€@€ 0h 1|j@€G-pP0@@X\`&V\UPX0LLP 0PP`h0TpXP\`0 €@€€C-`0@0PSX 4/X  Ѝ|0#2q12`03"p'qrX Ġ 0 0  ЍCꔼ0@- @p$TG-P ` @R 0Y 4/Y p0#2q12T03"p'qrY Ġ   Ga GUꔼp@-@Q8@TphP` L P0RP0 0P0L |Q /p@(K@p@-`xMV 0@S x P u000(`(0/ a/xЍpRO-M` 0100 RB 1S> 0S; 8@pT005 /P0p 0UW000S  X H0 S00/PWxH@T8UP00 Z H0 S(0X / Ѝ0XL P0RP0 0P0L 0LP0PL0 000C0T R 00CS0TZpLPL P0RP0 0L P0 0@ H80<$P PXTpW R* '08@-@!@M8 R@Ѝ0@ oP00S 400180S/DЍ00@-@DMP @ VP40$S 00S804000@ 80]@-,M@(RP . `0` 0]pP#`,Ѝ0 =0c?0h0 ``0$000`00!`P I.80S .$#$8P$?$Q$p.:_:_TG-424p0 @M0S#@! 23@  Q@P 0?SW0ST 0SO 0SLX @T T= T@@Ѝ8@TX J.0S1.W5 $0@  8`80@P P@ JHTp(.0P 0R:Õ[.*H RL0O.@80S0P L@ 0WP0P0LP P000004.W@0 f bO-lM3q0@0D08P80<0-(08 &.00-@TX @L P0RP0 0P0L c00C0-0`h 0S3P0   H  $X0L ` F 0 0@ H80<-00T X```F`y-$Vd\P -"\  H 0;/~ XZ B @  \   ) P0   ; 0  0  O Z  b 0  08@:_O-X"0X2 00S#` ЍP80S 8pX0Z@0 Z ` P  ⡱  P0+ J`P0?S0S R 9PP0 ,`00CS0@-T  7  0)0`PP0X,U`Z P0SV``V``@8C-M 0`p` @噱0P 00P 00 0 0@Jt?o2P0S RR! %*ЍC-M 0`p` @i0P 00P  00 0 0@t?o2P0S RR ЍO-!  ᚮ 0 03/@P0W0>  T@ VT,TLTTTTTTTTTTThTtTTTT0!, Q *" Q: @0 @001 00100  @v#000 S &@i9 00C 2 0 0 00 3/@PV 0  "  00 0 0 3/`P 00 3/@>0@ 0@00 0t 03/`P 0 0 0 08 0 3/ (10 0 0 0 03/ 0@0 0 0 03/ (0`S10 0P@0+@ 0 03/0 0 0 0 00 @8~f}f3{f@|f@-@-P p p@-@P 0P @ 003/@p@-@M P CЍp@-`@0P @ 040S-@  3/@p@-$M@P @, 00PU-@% 0 10 !0S! S S@ 1-00 0 00p q: 0 005/@$Ѝ0A-@PP @ 08Q-@ b00 0`01/@zЍ@-0@0! Ѝ@-@  xnP0000Ѝ7@-@P knP P Ѝ0A-2 p\` RB@ P Pp 0@ ` G-@`p W T0#03V0S@P (0S0P p(0SV @ 1!H  @@ PU @"P-dM"h0 (00@#0 00 ,8tdЍTA-0P`p@0 TЍ@- #Ἤ0@-ᵬG-P1p SB@>(21X`1U @ T 1P Ѝ@-0550 ЍO-`p0#MPܠ" 0$0P Ѝ(0Sn[P (0S0PP@o[[ VW @T    A0 0$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40@P  0 00!0P 0MATW W0 @P  P{ 0 0000000 {-Pm0 @PP (Z1 01 0 ⋡ !0 0PPQ`0 p@   [ (TEp@-0PS@`M  P0 Ѝp0000 O-14M`@PX0`0CS#*qP  (0Sh[X\00X0 00 ` X 4Ѝ-&  0e&[  &0 X&]O-0` HR@4M, p[P  p@P!@T  f@P @ s @0 @P "i@  b4Ѝ?@-@%'0 0x0 @ &p@-d0d@P%&r"0@3@#V%pp@-d0d@P%&"0@@V%ph0p@-Q@ 1CQ 1CQ pP%&0000%ppf@p@-d0@P0S S p80`h0pPw%F%p0@`]]p@-@d0Pe%@6p@%p@-@d0PY%*p@%p@-P@Pd b@A%pp@-@P` 6%&'00F= 00'`P000@0 W%pp@-P@%A` &0H0`P &r0`1:0@9%pG-0SP'@  p;PP srF $h0l Y^:0 h0l w$A %ЍX#x0S `$P000p0t 0 p0t p0t `0Sp0x0 t S PP #`PC-0SP,@ p`$ph0l  y R< 0Sh0lv v$@P$  ĪPW!x0S P$ Ѝp0t 0 p0t p0t P0Sp0x0 t S PP #P 00&G-50S`6 Pc`P.00p 0 0(00 0@ $9| 6@0l000y0hMv%+  @+(03v00Ѝ]@;_H;_0 0R0,00 0 0/s@-P`00@t  PЍpp@-P@H`#U88wP@P PP@ @$pÀÀÀs@-@`00P EPЍpQ@-@ }@ f@-@P@oЍ0P :0Q:///0/P$ Qp@-$PP $@*}#p@z#x#0/P$ Qp@-$Pp@#P $@*##C-@`00PUE4V#\P@ ۊ0S 0S00#T5 0`>#840S$pw#5#(PU /#-"h# P;`###1a@ ЍC꜊ EP ЍÀÀÀC-PM0p\!Q# `!0   PP  PPY .Ѝ@^@P# P0 0$" 0"804(t,0"0S``T0`0 PPP`("U0S FY;_ÀÀÀG-SPM@pPtpM `P#@D U x0S@P:  0 0 0  R0 0200P  e@P (^",x4@H$L@]"P#@$"P ,e(H"PЍ(G"0(8@, 40< 8 , |"b$x"(@5"H@TM 4@TJ PnUh @P0  RS@ QQ> <@4`0p"40S@  @00( 4 D0G"0($PL0B""(!(:"8"!@0SD  D 040S8)"(!#T<@(!"T|0@P0S 0AQ 0S 0 Z( ,(,@ɚ;6ea;_ʚ;ᦋO-P`p(@T 0(  X !$Z ! @ !HV(@  W !$[ !@T 0( u `,0pG0@0,0!v0@-@M0@\ QP#!0  `P@   o@ Ѝ0@-PR  `@P PP $4!0 `yP $j!  0PЍp@P/p@-MP@`ᆨP V0 ! 000Ѝp"RS+ P P $ cP2U0!N0P  RR   ' $! vBP2U0!-P!SSp@-,@,P  Vp@RÀ\] ÀO-,M`\ s p'  PTXPp [ PUU(UUUU(U(U(UUU P00\T X ,ЍOP 0 P00,ЍO3??@P $0 @P+ 0SP  $ [@P![ 00$ 0 P$ 0PP P ,ЍPP#@P P0T \0X ?  /%>2   4"  R0@`z 0S4#,S  @P  @Pz0qS0p'vw  l@P^ [ /|UU\UdUlU $0R@PO$ 0RP` 00 0)`P3  Z 0 B%ZRUUUUU   ! PC_oRU PSPS000  ` SPPSPPS, 0P` =P`N@Og;_0@- 0@SP$M  P 0 P    $Ѝ0 0 R  //p@-@Q0P0 aioP@p0@0 0@-@ 0P  P ЍC-@$MP P 1` z?0 0?&$ЍP`p崀P`0S$ X*1` z?0 0x? V  V rPPPaXx;_@B;_@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P 0 S tT  #T R@PE@00S 0 @ YP0P4ЍŁ@-P@`P 0 0 `ЍpO-R@|M8 PP 0 @+Y 0,Q@! 0000 1/@P0qlX X@` @P V  |Ѝ8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P(0  R tT  #T R@ X0B 0 R   @kX (( R LP0XXP  !@Ł0@-0 0Y ЍC-4MP 000 0$03Up1@00 P(03`T 0 @ 0P4/@P 0S tT00#T0S@  T  0h3 OP 0PED00S 0 @WX0P4ЍRŁ@-P@`P 0 0 `ЍpO-R@|M8 PP 0 @+Y 0,Q@! 0000 1/@P0qlX X@` @P V ؿ x|Ѝ8 `0㘱,03100000(0X?h10SH(0 0 0 @ 04/@P (0 R tT00#T0S@  T  03 kNS (0X0B 0 R   @LWႿ (( R LP09WP k @ŁR0@-0 0G ЍO-1PMp0P P. @@ P @f#΅"^0@@A-Q`p Q! QP+@mP@@2P PP   QP02l@'20cC-`pP2 T Ѝ S @ R0P0@A\0 00b(0  #)l 0R P A-`Pp Q@2@R0 2 S0S @000a 0@  "kЍG-pP4P` - @ $\ݚ 0 =PP!k2 02PP 0 ( T @   00Ѝ] |]]G-P R `0S0R@7@ 0+@P'U  V @"`һ0p @PjPP@ p`0 U@ W ᵻ᲻O-TMS 1U81U5Ux5U`1U 0@P#@TЍ0 0@P0 0t@Pz003 @@3 1P00!`@$PSpW$0Y3pW$_hdpPY[`3Y4P0pU0,0 U 1 #$, O,0@PUp00P00S X ! 1, =@,0pPE0U0T0S V 1 !, ,@%"T` 04{0$00P ``p0$P ``p0 0nl0 R< 

P0< 0,p(`$ 1c0 0,1 0'>< 0 0,p(`$ c0 00 0'>< 0 0,p(`$  c 0 00 0'>< 0 0,p(`$ bh0P 0'>0 0,p(`$ P < bDЍ E<_O<_V<_b<_n<_}<_<_ B0 /@-d00P Qz 0 Āp@-@PBoPPVP e( P p@zW R00 A-\0P3`q00CS@@0$N@T <Y~A-@` *0p DPP !Ѝ@P` 0 PP 0`P  `0P1S!!1! PU020ge( ? P ; Āp@-@PM TP0ZPP+@@R@`V& YP0@0@ @@@0  %tP|0 @,T@Y PPPHL0Ѝp80f@0]À<_(Āh9U^,p@-@P`Z0P ( R - pU  @@p@-pPPM @P Ѝ U@P0S00C>S@0`S@ 0S@ x10 0@-@M P P ך 9Ѝ0@-PM @P p@P0`S  ⵚ0000Q  @ЍO-@$M 0Hp0` PP PP<@Z 3 P}@P  g (  , ^ R !W$  RR R0R Pz㺷@ ,DF<C0j/ 0R( P 0W`0" 51 00 00!  ru尡@OpP> @B  =P $ⲙH1 00? 0@0 <000000 P  Px0 00 p;L0 T# $Ѝ0S@P]vof`rτn0X@Sk/1!p@@PEV/]<_<_o ÀĀ0p@-P @`M P  PAЍp/G- p0Pa@POnf` 0 Sr$0SH PU10 c /o 0b4 bQP  S  !R!0C31$00C$0< P  bT 40  ?oW20S@   @)Ѝ!U   0ZP @P P0 20W0P"  #P<#(@@- 0000@nP 00Ѝ0@-@PP$M  LP 0 XP 00$Ѝ0O-2P MⰰR`0S: S: Y` =@ $`P Ѝx2 ? P `P reU(`; p 0S{:$ 0REXc00 40h!  @ 1@11ᨁ$0 S`PU Zx0S P x ,|0 00$0080匰$00$0Y A(6  VU U D[ 0 P `P   P0 #R< # 0S000@@ P0P(`(`d 0  @@ĀR0@-04 Ѝ@-@PM  jP#Ѝp@-`0SA 1X03/5H0HSp<5H0HS p@ "!p@DERC-$M@`pldPP @ \0 0@0 0h00<0p `0000@0@P _d$Ѝp]IUA-`AMp+ 1PT @P*0@& (_@P! 0  0c?  0 0@P B@PЍ@-10/10/G-Qp`f`P@W0S P0  @,@P fPBP P0P@@G R Hk@@p@-PA!'PPZpavSpp@-@Q @PE@pKP0$P R X@6P@3@s@-@Pa0 `@TQ  Y@Ѝp@-@|M?T@$x Qp` ~00`0@ 00$Xp0pP@ T @@ |ЍRp@-@aP1S @T 0S 0QU00001501 0S 'psPPO-03p@WP`ᄠUu P 0 S H P 0S@P02P0|]C-`PRp`$M` V000 0y@P $Ѝ P0CwP0 4P0%@t0t 'H0 \ ^Hp@ #PV  ȕ<@@V  |]<_@-`PV  c@P  ` 0S  @QЍp o@P 0 `bC-@MT;0 p0I S@#* aVPBP )@P U 8Ѝ ;@A-`@Va&0P @@P ?T03q`P  @$A$QT @@-0P@3UQakqPPЍp$Q  Md 0R # @-00@P ЍG-pW@ PP F0`0Sp wb@P0S t@/A-MM R 'Pp @U 3: `3/PEX01 IP 0S 0S 43/ 0 ۍЍp@-@1P 0c i$ Q$180pbp@-@R 0`1S 0PS P@pP@L 0@0@P0 /P0 //@-000D v Ѝ䈩@(@@-000F/j Ѝ@@/ B00 0CSr//Q 0S P 40 P0@1S///0A-@Tt03@`P |0S 0 R0`h?d0P0U TpHw0AD紱0Q00C0 R0 QꀼRQ0G-0@`p @M(0 0 <0a0,$@ @@ @P<@Z<0S% 0 00< 00a000'>,0(0$@ @ZX00P000a0,0($@ @ @< Z@Ѝ<_04[U<_8ZU^C-M@pX N0 P`㬀嬐0 V:ޏT` V 18@`0XЍ0`1S 0 + b<_0<_C-M 0@p` P妓0 a 00P 00 0 0 PWV?o2P0S@.0S@*fXPU@$ @bpU*0!R0X nH@Pΰ@$ ǰ@3XЍ0@-808@ P 3ᵰ  @J,0WU^0@-M 000 00 0p?@P@,P 0R 㒰`0 S |Gᆰ @ R \@0`805 @u@P Ѝ0@-0 000 0 000@PЍ@{Ѝ0G-M0 0000 0pPPWa  00R PY| @Ѝ;@P P 0x0 x#S X  0 @ `V`PU# Q  @0S P gP d T @ a0 S 24 QQR@0G-M 00 00 0pcP@ d; `P Ht @Ѝx0103P@刀' 0S* S@u`a t`" P L@@@  |PUJ Y@E C TQ  @u`V 1S 70ሀ0"4|QꀼRA-L0C@1S`H1P @ATA pWt`@O-TMxPtd$ UpC?|0S |%@1 0H1,4R00L1PqL10,0, 00000(00U@1<10 3  ?? 00081 0040t3 R p0t`$0Sʀ0pD@p`V83, 300* 00` 00"p000j 0?o S c $0Q;W 20S0pp 0H1 J 0 pp ` $ 0Rh"Y0 00SX `R81S0pBr Z0A(P PY   P (0U  ֭ Ѝ X `?  P1[ 0`8  P!0 !0 0 eoYQ    oXQ 1  o[Q  `  ὏]p@-P@U`0M  `PPP  WP 0P0\0Ѝp@-@PP4M  AP0D S# *a/b(0 0 00<4Ѝ@BO-p0EM31, 0 ? S0@3%:a V P$P  @P81 00H@P @ U  Eߍ]@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  PP P  P0(ЍpE/08!PR/p@-SP@HaqP@10D1@A `0p 0 pO-0@SP 0S 0` Q d280ST81[0S @F `0D 0 0@ 000 !@ !@#88"(@#4<@"$#2>@""#1?@@0D?Sp@!@D cD8B\!s%1&00 0   AVU? Ѝ[U  0 L0Y% PР21p ppp p p\0R 081<1 SL0p0R00PA 0WV4EUSp0S j5$Ѝ0S[[1S L0  X3 [" [H0S1S(30S[p30S 2 [00[0TH0S Ō2r0 p00|2p1p0@0ppb2 0婌0 " H 0 "0      00X P000P0 L0  ` R88L0 L0R` R77L0`H`H!"!0H 2R R0 00000 0 0 00 05X 1  0!`a 0! !!Qı  5P P0 4P0B [H05<<_@Rt]T0@-P@P_0@-PMP @ P0S Ѝ0A-`q@PV 0! ! ! U` 0` 1 ` 0 S `3:0 ! !0140@-P@PM TP0S  R PQ YЍ0O-pW@` ME 03/PP PP OpP 0p0SppWV 6/PP|"X1@0`0X1\10\1`1 0`1d10d1` M 0 2P Qt@00n9 0 g2PW#P]pa1ZS^/x1|! 0A|1 尻p1`S PW` V`0p1x1S|!|!|1x! W7 vWV4 XW 0 0S$ 0 ($ AQ(0S 00 $ 0(00 $(0S 0  AQ0S0l0  000S 03/`VP Ѝ` 0@3/PP Tʚ;@-0,Ѝ䨋@D@s@-@`Pn 岥@P00 噥Ѝp Bp@-P@ B B0 pԵP pεP h0T @DTp0 RO-M0 sP 0Sb0@S_P@ ts`P\PЍ<L0 P13a|@TP 0S 1 S2xhy?o20S P[Pyp h0Zpp Sp ppZpG۵ 0 p`刷PP hAPR@- @ P0ЍC-__PMp`@PP PPP1 00UPP 1hЍmph~1\0IS HWV@-@ 0 P  PQ  Ѝ0C-M ` 0@P&qPh 00S'@0$W` 0S! PP|@lP ~P lЍ0L0 @Q0P 000 0ض@P|` Y 1 S 0S aVX@P ?P 900@,p@R@-0MS80PS4 p l@P%`P@ @@@1 00〶P 1@ЍQ *1 @@p@-`@P{v0SP PS0CPx`|`0pVx0s0C0P?Vp0`S ʀ0hP0U0 x0Vx`|`PP@-pD0O-@`P |'1Q>C/1C  Pp@,\1QE 1CQ [?0Q Pp@s0S1::8C81(Ppd0!S0  00!!0000Q0S: R*0 SP0C BS009RLP s@s@~f}f s@-@Z)0 0h0嗸@Zp@-d0T@`Z0\,0(@P@UZpp@-0PQ x0@Q l0QZ\0S0 R00Zp R0*Z0\0pp~fTf@p@-PU @d0`(0p`h0Zp(Zpp(]p@-@d0PZpp@Zp@-P@PZ!^8^hRp㸣pA-@Pp hZ\00tp00@`0_Z00F= 00'`PPqt @-)0@ hp$@A\  \ R/ C-0SP2@ p`'Z쐟ph\ 0R S( ZWP"P #PSW0S0 0 0 0 P0S00 S PPY Ѝ\0 RY  PyAp@-` P@Y\0S0S E`Yp 0pNO-50S8Qp@ Q1 `P)00夰 0 0(0 Ph⇶p!RYWKK0 ]Y$+  P{,0300 Ѝ`L]=_0p@-@PᒿP D0R dp`zY+^yYZp pL]@- M0@ P 婽 ЍO-p0M `PcP N D1R 4F@JY$$880S   $0P0S X0 S)%RH0 L0 H0P L RP 0 H0LP \p \ X RPP PR YЍQL]ɚ;6e@-@LM`p "P P0U(P?oU20S  'LЍp@-dPp@d| 00C/(0, | 1R@0@@1B @@VpHQ!8 8S0 00C0C0CQ0C0C3+C? R0//p@-@ Pp`[,p@Hp@-@ Pp`Np@HC-M 0P`` @V0hp 00P 00 0 0@G?o2P0SЍ B000= S//-@-0 000啶Ѝ Ѝ/V^ 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,HH@- <PHp@-@,P080嬵(⪵p@H}s@-Pn10@T H}P4唵(Ѝp@ DtPЍpHLA-<1P@4"000000D1 PhP P U D1 _```fh !`F000000000UL!000000D15 !_0 ? R+ꘝU\U|UUU\UXU U P D00000 h3P U  _?0S00hPS0C_p@-`@P>V0 P @R00PU(`  0 0000PP0C00@1B  PVpH0 @-#PO-`@pᄡXStM 0@!B @ $5 tЍ0< ,#" (120!Q/[0, R) D!& $w(P 1 0SpFZT c+<02[ WP ` D1 |0 S6W( )` dVd`# *P p_oWJ<1( ?0H!MW"P|J `D1pG|0 S_|0 ` S&T0 0h 0 A000pG000/P D1|0 Ss0<@ CHRP]p@-_>_>_">_*>_1>_p@-@01111111111111S !1R 101! P[[/ 8h(╮0⓮X⑮`⏮⍮⋮+)p@vRH0 6?/O-BDM R N f p0 $``e 0P`|;!<2 ,0 00`(P$  PpD(0 0 0!1 ,0 04`0P(P$ C0 0 0!1 ,0 04`0(P$ C00000 0 0!D1 ,0 04`(P$ C 08@0, @@!0 0 04`(P$ C0 0 800`,@(P$  PpCx0  0p0 0h00'>,`0(@$ <08 CDЍH9>_UU_@>_G>_Z_K>_Q>_f_tUW>_- B 1"011 S!1 0 !q 0$t1Hp@-@PX0U00 00@1B  pPH@-@$;0  (@Sp@-@P LQ 8CQ > _? = 0>;0p0<0|Q h'+$p@p@-@P  #c/0000`0001S 0RV (pHd߀RLA-P`p0|@@ @@1B  lAT 4/0 #P@ P Hp@-@0P#PP@ m pPH@- @$^HG-DaP@ H8& 0 4 0 T 4 T ( ,8q ( ,3 $0000S P + 8 < 8 $ < $  R P @ } zU <0SPpm P @14 0 LS 0000?Y$0!D1  L0S81  UP hEP000@1 t1S 3/P0000  P  9\0 6 V1 C/oS" R   ^ol090DW1 C/oS" R D15 0L s zD15D1G;< P1 S S RQ1 S S R VeP1PC_oSRPU   0 9  7T!U1R%2R1 S S R V@  & U1 S S R 0<0@T!0B?o2R0ST1 C/oS" R D15D10<0 U  P < SK1 S S R 0S b' U@ PM1 C/oS" R# _ 0 R P E  @Q $0060S0>;+ J L1 C/oS" RP N1CoSQ0 \ P P pS  p0L P P  l@p0; P P V  @ X Z1 C/oS" R #L 00 S   | 1R:i  P XN U_ H1S I1S J1S+ ) U' 0 0830  :/0H1PC_oSRPU  P PEUP#U PE0 S = H]p@-@AK `P k@pH@-D1 M2D10@9000 00 P090 Ѝ@-D1@ D1L 0X1SY1SA-`@p*AP P | 1RP 0@1B P U Q XP IPHp@-T@p`<?P,00(@@U-pHO-0?2cŸ ?B3c 1#PESYL0S800ڈ0)V0S 0  L#P& 0(PXBX!R#U U#U_ `iSQQP 0 S BU` 0PP[B0H SQ00Q00SK xPtUAQ> 0S  R8 HQ IQ JQ  R+p$p"HRPgfffQMbO-M=@QP`q/ <=Q+ "=0S-3"=U C=U%0CUl=U Q0CU 0CURD v@19@10=0S( -3$ h=3!1P <Q ek0CQ,0CQ<0S<U P<0S SUUUUUUUUU8UUUUUUUUUUUUUUUUUU(<U %40cS KS V0CS{ hP 0 :/nzh{ SP 0  9/YTd;Q \;X;0S~H;0S<;0S P? ;U y 0p1S 3/P %[ ` S] 1 0SY [0V Z PQ(  Q# D:P7 Ѝ:0SoHU4UUUUUUU9U907 0;9U 0CU 0UTX xD v10S 0RS;Td9U \90S<H9U 0CU  09I0CUC000 U (9U 0U0!0k8UO >C0CU .8U 8U0 +DU8U 7U@ 0卤P { ! R[   Qu0(03/38U0 >0U> >C0CUl0S00007U& t7U,Y_ V|P  v :9|000| 0C0;P|UPPbv0 0Z - RT 0H0HS ^PP  0D @0D 0PHdP `^P!,ʞ,fT^Z@X T ЍO, Nu YDs0S ! S [0 0S00c0[1 0R[0 0S00L1 0S[  $0|00@1$0\1(0S`1 ,0l4U D1"    2D10R810<1D1  0;; 0D!"0D1 +uN 1p8P3 pD12D1~PPN 0S" l003/ 03/P  8/y100?qPnt0D!  %<D!080 <0d}P P4 100100@[00[02P0S ! S[0 UUxeGPP 1 0R8sP6PQ Pu c1 0R[0 $PPT0 -K=kP R vSz)+ЍOu) Petrt0ht@f@^t HRuttt@B]>_Hg>_Ct gtt,Pt nt ot st@jt@wt@tt,@Bt @HtH~fd߀d_p@-P@U0  @  @1B  E0'p00sPHH/H!/p@-81 - U1@PSPSPU 0\ Pp<0 xP 03/T1 S S R 0<0l1S l13/ #PH/p@-P,0@TprP @/@-@PD0@PP  80P  R 00 0Hp@-PPmL0@T 0S 408 CTT 00 0p@H@-@P(Q$08 TT 00C 0@HA-@coP/=pPP` uqPQ00|0p @R 0bPQ 00400S  R  0?H]@-$PP ݪq>_>_@-@XT08 CTT 0S 0,0S   "H/ 8080 1l1S 0 0//L 8080 1l1S 040//L0 6001/Lp@-PX0X` 6H001@0003/000lQpHLA-pt`P@@@ @L @ Q@P0/@(0, 0 00CR QD1 WP00CH0 /@-P0 @"6 0<  $0000P0@<Lp@-@Q@ x0`"6 0h Q0000X00X0 0$0p$p@LO-0lMS 2P"0 & ` 될@, 0 XpW 0X0;r@P@  ,Q,#N>slЍ Y@T 0HY0"lЍOr| R L @ Y<  @P  r@T0@@ @phdRd #@@P r@T0@@ 0R0T0S(@#@@LHO-P @ |M0d2db 6X20h00| @U  k LpWO R LQ 8 X] gTidRd #@P@1@! r PWO @Up@@TdR@1d@# r P@8 @ D!L"$ L\ "P R (  0  Y#p@@ T ( 2/ @T Rp0* ? R} @@|Ѝ K@P{HLG-P81 6,10q$`A@ 0@ 1 | R    X0S $ Y0S@ 0@  L0  S#  0@ T Q iY @ 0cL@  BQSD1  @LHx0p@- 6h0@ 0R1 R p@ Ph p04N p 0PL@]HT]p@-@ Pp`j0;p@Hp@-@ Pp`].p@HA-p`tPN @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @H@W^Hp@-d0PQ0A TT 0SlA@OoBU $Gp@T@LG-Q`Q3@ThhҦVT@ fp00SS@Y R !o0p@p@ E0X`=p 0h fl0AT T ` ^`$v0qL>_:6_A-@0` F@PP x0x0q@l1S XPH0@`l1̀0003/D1;D1PULHUQp@-4Pp@$^0S@@՘pL@-@ $FT@ Ɍ0L,sr/p@-Pl0@"6 0\ \ a3 $# 0$0p@`LHA-\A0` F@pPP840101@0@$lc 1810<10D1K<@1=`1\1El1S000( .0 03/P @ 0FP \PЍ00   g0PP0C0 HL+T0p@- 6D001P003/@~@epLO-P졟`3䁟q1 610@ a 1 Q[  S L0S& pq8L0SP.9P1 0S [   1MP < # X[ `oA[ L R8LPHwUl!R 0 03/HLPG-,4( 6 4,0 a4PR"@T 0 X0@0X0D1;D1@D1  0 X0@0X0D1;D1Ѝp"sP d3R \3Wk 8>C1CW $<3Wl 0 $@ 04/p@z 0 $p@q0n 2 Rj@ Ypv2W, 1\0CWh||2W" 0CW 0TR 0 00<0,2W0CW20S0S00@0T @0 @00@0T @0 0@0D>SxhD1S0 008X|00D1  0 1W )1W 0CW X0@0X000S81< U1ST100C?o2 @ S8 X0@ 0 0X0 .p0W T00SS%X0@ 00X0L`t_O-`Q_@p0 S S0S 00078凡 P P PPB PE0UP k R A00N \ᡡ:50C0 `F00 0pPU0P0V 0R@ 0030c00 [ 00>_0PPQ/@P - Q^00@Ss00nR\30l S0 -0 ^  0CSs00nR\3, /p@-@  RP 0 BS 0 \0C0P 0CSs 00lRQ3\R  pp@-@P.pp4031[  10 P /-[  \a 䵔@- @ [0  P p Q  Q\1P!  S[ @ [ @@s@@at Rp@-`d0@31[  10 PU 8g0 @p@p@-`d0@31[  10 PU 8H0 ғ@p@p@-0@1[  10 PU 0+ (@ٕp@O-@ 0S0000 000HL+VH0H00v p`F0Sp0P 0 3SH0L RP \0  , Bv R ! 00CS 1 \@_]@_@_@-T Ѝ@-N ЍO-P RP@ @ Ѝ0S@PETUT 0S     @ QHLQYUP`C !ZP 00YPZ0 P 0 0SP@PpJ^? \ RU [; #RHL RP \ 1  3S@H0L0S<\H 0P H  0CS300C. R+0 0000 g[00C0@ , B!R \  0 =000y0PZ 0 D@P> ` /[00C0 00 000O00 @o]Q^G-0P Ӓp@P: 8  0 0  000HLTH0H0`夀VZPP P  0 0 000HLTH0H0`Zn@]@_/-/-/-//-/-/-/@-@VT-@-A-PUp1p!0@W`DS W c c`PW(0G-p`00 00@PP) X01 0!00000P XI Y 0 000P Y J0S@GЍ-/-/-/-/-/-/-/-//A-@$P` Pą@ p00  YX  #Z`Wp  ZPG-4pPPP8 `@P 000 0 `PPy@ЍC-,pQP`M 3 RP0S PЍ05Y@U  00040"@8P 0  5 0S20@T@ ᰓL2WT W" 0CWe P$+4US@P PU PH00@D@DT 8P$ $ _0p 20@Ty@1PD@DT 00S H0 0 @T 0S900 R:0 Z@T 0T3 0T0 3$m-T@P P $8 \*oPPUP W  b4PwPuiiip@-@PPPU@` Y`PpPp@- p0Pd00S P0pDP<@%80 @lz5"0]@ŀTƀp@-P`0` 0@ 0AT 0S`0S@ 00 0pƀ@ŀA-@Pp dX, 80R) 0 R) *`00<00@0 0$0t`|`p00S0x0 00P0:0%`P@@A-P@pz0`,PVU  AYG-41p!,10RC*Q`= T PP<*P00 /R0S /lVPPu@ 7'`Du@ 2|L0PP 0,`8$0 Paᐃ<ᓃ@<:;$"R@P?@ŀ@_@-@P u00@-@<;l: 0S \0LS   ,P 0uu@Dmu@ŀŀp@- 0P0CS`@ 0400,0?o2@T vpp@p@-@P 0S 80 31R00 pp@-P40@AT ,1VPp@@ŀ@-0 00 0待P Ѝ0A-0SPp` x,@d|TPˑP (0S ទ@v 00 0@Pŀ0@- @P ,0S@uT p }Ѝ @@-@ P$0 0\  ǏЍ7@-P @P 0, R( R@   R t #!Q@l5T 400S ; Ѝ0@ǐ@0@- n@P$0sT@ 0$0(0S  Ѝ Bp@-0P p`8@K<0PJ@0P pO-@PDM TP\DЍOlQ @A@A`H1  j @00׃,ap0 !@(0 0 <00,p$@ @@ @t0 00< 000'>,0(p0$@@ @a0\00 P0< 0,(p$@@ @O@PP |DЍ@ŀƀMV^TA_A_'_]p@-@P8s0 @P sp0@-`PP I@+TP ЍPPp tdr0XS   @00C@0e `V40040^V ƀ@ŀA-` MQp 3/@P2@P 0 (00 0D1R 0@ Ѝ0 @P   0Q$ p#Ѐ!0 zv@BP 0 @0@0@0!R pq 0 00 803/@P  0 0D]DRSPŀƀ@ŀ@-00 0 Ѝ䨋@D@G-pP0 M 0)@Pⶑ@P o Ѝ0 (00 01R 0 ᄑ@ D H03/@P$haj P LUZ0@@00 0 P @  @ /T  MP 0`P 0 0 0tV @x0!0R:i@@1PPS0P1@01@QZ00  PD]@ŀƀ@- 0000 00hЍ䨋@@-MP `bPp% Ѝ(  ( V00S  0*@P .@ T(00C(00$P @@$ U0 #@0 0@-@MP )P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0!0@ !0fU@ W qqq 0000S 0 %P  0  000000C000C0$  S$ 01<1&30<0<0T00S7 0S 0 ?o200@0HpW81 [ .pP 00 0S 0080 3/0  ) U P A1Tpp0T@t0S 0t 00900#0pA-pP`@0 0S@0d00T T0T H0'&@P2$塀P @\pd@-@ 0@pO-`ܐܠ`̰PUV Mj0 00HP0\@P `N@@ p @@Dᕨ\0八 $`"0 ,0U )\d[O-LMPD00p000 D R Y D (Z`t    ""20x0x \20\2p0S@t0p@3040X0404 P }4S @t004L /DP p0S LЍ00 ?o2Z0S 9@00SL t0 0 R800 ZBT@0S 0SP00 R0S  2t0 /  3 Pa@Y2t0 D 0001 DR   Z;8 10R0 D0p 3/0@S000Z1;ò10PD0Z[pZ`qzD0(0 D0S0b(0`(0 0003 R7000S3# RQ- `# ,  , R% S 0!Spx 00(#0@>0H 0P$0  H0`0  @P(6<00 $ @0S@@ [fZu0o Ti p2 0{b W p00K BO@C0`H01`?0 @崦$06@0<0S,$0!$0H` \p 0L00P4040T XP00 0C0000 00C00 R0000C0 0SK (0p`D(0p(pp,TZ(`t0000  Z p{ [ p p0WpS@@TK + 0[00Sx  @@0 p04/'@(@#@ @p0[PXVI0O-@`'~0x@! !@-@xx@}x P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,0Dd0 0!!T0    !/(,@-@Q Ѝ0l  R:` <P#!, i` @K)P 00@H 0TD@D0<0RH0G-`RPp0  ( 0d} 0 R Y<8 PD @R @ BPS @P PPP 0L00H@40B300\00T0X000 EY```0ST0S@L@T@PA_G-PR`0 0}pP@}@P,  EUPp(0 0(0@QpWT0SPLPT@0@TP0@Q@PU7A_A-@R0 I}p0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@PA_A-`@PpTXU\ 00 0RX 0SUI 01QT0S0T0;@U: 0#! RQ&  3SHL0SP0\00<0CR1Q 0E 00080 080@P@0P00@pL@AzA_@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@pQ/T RT 0 0S`p@-@QL0LPpS  Q QP0 R00S0T@@0Q 0 00000 p@6p@-PL@Q``UQ V 80@|0`0S0C0000800C80Q 0S L`L0SP0  RpT0pPEd0`]L`A_@-@@0S87@-@P1 @ < 8'0D0 Ѝ0A-0Xp@P` U[<S !P  P71S010SP0 R0p@-4$P 4`0?RL1S(@pP ,!80R 0,1010:01 010 `8@P 00000111010044P0P041418181@1@1D1D1H1H1q00 P 5001111001.1010.0000003/P -V 101qu@-L@Q0L00P0T0PL0SO-p(0pP U[  My@`(0@P U U(0 JPP 0H@L0BÌ\PTX0S 000P B GB]A_@-P `@P   #CЍp7@-P@000T Ѝ0900@0s@-X,`0 ( P@\  t0@00U Ѝp&t@-OP0P@-FP/ R/@- @@ᅾ@軽|A-P`X0@0X0ЍV,@p s@000W T s@#@X0, 0X0ts@-P`Q s0@00V xЍps 00S/Ł屽7@-@00Pj000U  Ѝ0@Z Ѝ00BSp@-P@`yPP  $0S0$S0ĕ`pA_p@- 0PS`(M  y@P- (Ѝp0  |@P0~V" 0;;0@P R 0  R ! z@P  z@ 0 S@ R  jy@P _|p@-M0000`P @P P}00Ѝp@-Pp`s|@P @{ Ѝ0@-AMP@ fP Aߍ0s@-P`R|@P  @{ЍpO-p`P0{P (0S {&@ Ѝ }@P {00PY 00 u 0} !* 4S#@k,u@Pd!401  504DT04U0S U0P`2y04 8(040B=00  0  0 1 ::8C81@PlPTP +0000ez3 )}@{Y~ ᶵ{40#. -3y|-@+{,03 }@@ @_]_]@-Pp`{@P${1%@ @P%0!00$@ K0@1P pPt@Xz Ѝ1$ R 0@4 101 @ 0@-AMP@ OP Aߍ0G-L1p30Ma0$000P 0 @P/$0 (00000 0 @P*$0r,0 WP@ @T (x@P , {( {0Ѝ, d| ( ^| G-Pp|UUpW @0 S0S``F``T@[PzzP y@O-`RY0pPP Ѝ@ T     R R @ 0xP  hU0pW@@IYW 0JPpA_O-tM  ᜀ_ 0X  qR R? R(@JG]` R7`@P  A0$ (P;! RCP 0 0 0$ 8A0 04/ 0@0BPS 0: pP  #P RFUH30` v@P 00V ]tЍ 0`   ^%Q# WP \ Py?UT P00XP P@U@ @0 R   @\ B_ŁA-PM`py@P 400000 0<@ByЍ7@-Py@P O@.y Ѝ0p@-`PV M  V00 R0S@"  zy@P0CV 10@0  !  Gv@P <x Ѝp t!@-50S@,M[5221P0 q ` 0@PF0 000$000@P& (00(0 (00(0 1:11:1010 S;305<0@ T 6$ z0 }z $ y y 00$00,Ѝs@-`Px@P19@ 00003/@nxЍps@-`Px@P 00403/@WxЍp@-`P CP0p0  uP ЍUP 0 S05 @ vPT00  vA_0p@-M00000P0` H@P #0@P P3xP wލp@-p PP`IM  Cu@P0 0000 0@P # 0@P PxP qwIߍ@-`P CP0p0  uP Ѝ RUP 0LR0  vPT00   vA_p@-0M@P` 8= 000 00 00`0 0 4,00003PP #0PP 0Ѝp@-P4M`p t@P&043,0$0 S0 0 @P$0S 0@ P [T @ u@4Ѝ @P B_O-PPlM%  (t@PhB00S@c8B (8{P_ ( 80,00< (0 @, Q00(0P2 , 000 w@PA0DT:0` S;# p0t @s0Sp 2 H0=t@P :`0P @X0 S$0 00  H0P #0@?oV20S@ P TV0`D@ vlЍ 10@"X0S 0HL@P H0 d00Hu@P`0`0S  p $ HP@P 8 (, 8<0RP00@ S00S @P000ɚ;6e B_@-@0M 0 P 0#܍@-@0M 0P 0#܍G- pW`P_0BS-U@3PP 0L00 H@$ B# \PT0X0Y P}s`P 4$<W@ W ` 0 R $R ÕP`0311  U``pV 0 0F0ERd000  R` RA_A_O-Mp 0K0$  $  aM R2 R(@=2YP 0S* P0 400"0! 0 $008 P5Q>QFd20SO VPH  Y p;A@P r@P @0U XP 0P ,Ѝ0@P 00 0 \`R^00S  @P  RM0S @P p04AQ00 0004/0@P0 0* R tT00#T0S  T 0 0$;0| nhVW T00S 0@  0RX0I@@ B_ŁRA-`MpP wu@P 0 0 Ѝ000!  @t0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` !rP3$00` (ЍpO-LM` $ %u@P0P S;# p̰0ts(0S 0 P0t0U@LЍ2 0q0P" @p0P  0 D02 r0PP B_-/-/-/p@-^- `  R0S0000 0 0h 0@@0 PP00@@0P !@100D1 0ppO-P0㈰U`!R `VP R@ R RppG'qZY08/@0;7@-@00P000U  Ѝ0@ Ѝ00R0 0S  0Q 9 ] @- @-p@-@0`PVp@0 `劵/p@p@-@P0S 1`0D0eHe@0L0@0pp@-@P Ī P b@PW@-@NL-p@-@TpP0P R  RpPp@ R   R4Pq Q  101pBB_@-C-@M`dp 0p P 1 P`00ddd dd0S `ЍdpsC-0`S' 0S$0S P@,0! C0001,0 (00C  @#0(00M  XЍppYB_RB_p@-P@e Pp00Fp@-@R 000S0S P A-@pP`V ˳pQp0S 0`V`x` 0S  0S 0SD娳@jA06P AM@-@5p@-0@SP 0S%Q0S 0S PUP0@Pp0S@`+00d :p?P p`B_@-@P,N80 S 08  @< @胳Mp@-@PpP; 0  p@u(0 S 000p@-@P$400C40_ p@qp@-@`Pܳڳ 0 ` ҳxp@t1M/  \@-  0S 0S00 o)/kB_A-@`pPP 00S0pO-4t@PoȲcs0S 0S: 3 hPU5|3PxPU>d3hP00UC0SX,34PU 噲(0S 00S 8 R4 S 0 0S Dz Ph<0880廲XwJH &Jw[Pb    00C000Sᔲ P00S  4S 80S (0SZ 1P Q@00ig )    pY000 00(X0X  8  80S00@0000000.ipPU000 ;xB_MP@NV0S p@-@T p@P1` 0 廱 0S /O-PM0S@i@0%@e@`0@0  埧p 60g`PR 0,0X000`b4$@P D@T ,aP]O[O40@ᑧl@00@0(:O@00@0$0 00D0, @0*_@P 'O\ JTM0 0$paO@00@0Ѝ @O-pDM@0%@(@0@0P)- :60`P @ T0,00`b4w$@P  0 @00@0DЍ0S&@!._@P됰[-=@ 0R %)@N008 0 `P @0S $Φ$ 5$0$0@0@01`0D0aHa@0L0@0@0 DD5@00@0@P  `00S p@0@ 0  0Sm/ 0O-DM!2P`p0'>`B` 0`,` 0 08p4($ P60 00!'> 0`,`0 08p4($ P0 00!'> ,`0  0 8p40P($ P 0!'>X ,` 0 08p40P($ P 0!1 ,` 0 04p0($ P0 00!0 ,`0 04p0($ P Ᏸ``$@e @0`@P (lDЍv^^B_B_B_PVB_0@-00PSWP`. P @ Ѝ0 C  SH$10SD @P0S S S @0R00 @0R 0 0@0 @0R00p0S S S *@@0@ D@@0200S @*@O-pM0 0CS@U#0Q 0Q`$@0001[ ! n@P $ [Th8o R` $Q (@T R 0P0 I D ;/p Z0I   "  S$@ Q 0  B3Ѝ 0   r ao0 4  B4 + mm0P Y0 00@(@P/ DVO-S4MP`  R%Q@ TppTpWh%@D#1\%0T%$10 000L;0 00S@⦤pP 3  L30@@ !0 SQ 00t- 0S7*#" pp 0 1tA00 ST[  & " L  HPp$   D  p\ TX@ T[=  4Ѝ mP (Q bm pp0(2($ ,,0 0' 00$0044]$ 00;m[  RO  R R @@  @X @  r @ FP L2  2/NZy pP ,   B  , ( B@ (Z |r0!S B R8BX |P< R=/ P@H@ UP  1 @ @  qP 0  2/ 0 gP7 =; 10 10S- *R9 i R R(=j98B_A ]B_P P// R0@-@d 10  000R  0 /0@-cMPa/i@Pcߍ0R@-@ i0S R0a/@-@10  R 0  /0@-R@cMPa/ cߍ0PM4P0S Yjp@-@`P4Ou 1;^Pu]ps@-P` L!@P @JЍp00]00]s@-P` l@P0 @kЍp@- OP00OA-@`p PZ@P <pO 1]@]@-P` p @P0 @ :U `D`00@0$V0:Pp 201S l0 H0L 0 H0P0L T 0P0 T %R0XP5\p50`Pl0pB_B_ƀO-QM 0|ЍOVQe00Y 0p hW01h0#0 0 S0?o2?YR ua@ ta P@@D 0pЍb|ժ@Th2`SP W00Z0S@x 423'Ph  u/0 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HP#%$%U  0&H & 'L ')4(ª  hP{U70T' 00S0/ 尪_p0  `PzH0 h00Pr0 p00PjL0 x00Pb0K000|@000Jsn#P$. 0 ]P[ǀƀHǀ0P @-P 8P/ 0!< 04 0 (   !/(,\ P/0 !8 00 (  , !/(,/P 0%%#3/| `0R 2"-D | 1# H LH RH P LR P ƀp@-P`@TQd00_Qhd_000X S<@@ @DSd  I F0SpP!pB_B_p@-P'30% 5 ! O-3#CLM   {_0S00   @ D @PlKfP$P\3 00L3 XPP PP00#3A^0 03 PP PP003^ pR࢟ಟ(Kg V 0 &5<[d V2Q" 0 < 00 , W[p\W0P@"[0   2`  2eAL0,00! ! (0 0 00`$ @p'1圑 01 00` 0,p(@$ @X 0XQ!T1 00` 0,p(@$ P @y 0E 0 0!1 00` 0,p(@$ @y0E 0 0!0 0 00`,p(@$ @yqLЍONAdtVƀǀC_p C_쫁@C_FC_SC_LC_$ǀXVC_lWZC_cC_jC_yC_PVB_  @- 0PMe$VC_000 V-P@P\^\ lp@-@IP0  ႨpV^p@-``BB,ɠ ɠ,ʠ,V L\ 0$000 0T00pT00T0p@SW@-@P`"^H^ 0"00000 00 t00 0C_C_!CeǀO-`pDRDW($0 S*'  w^@P9 ,000ק S p0S M0$ 0C#2 BS*p@TX@) 0`00^02 3 00DA!?,婧 @ᥧ00 0 ?P0 |@TW 0#0L0R    ]]30000l0  S   $ p P p p0l U cn%埧ƀDp@-<0QP (]@P :UP00p@-@Y]`@V]p@-@000p,^05000  .00;0g0)000 Q :00`P =>09#900S? ! 0R9ڜ  I S `P 40083/0` =V0 %$$] 0S 1pp@|Q t  | x x |000900000 0S"ʸ]w0p@ {]xS0000 |  @|    , 0C1p@]ƀ0ǀǀp@-@P`ᐦMp@ʦƀp@-@兦0  _c<00 0G PU 0 0宦0p@/0 奦p@W]p@蜦C_p@-K  P8 嘣l0Sp p p0l N  @P  0P >x E4PllpA d0ic1p0h 壣P00ƀ@-pM(ppP,`@P" 0 "0V060000$T0#T20T20SrP V 0 0 0 ЍV 0 0 0 s@- `P @ P@P0 ;P @k00ЍpO-0Dp`8 P P @밀4P<0Y%PP@0 ;P P>00 Ѝ gP   10 fPƀA-P`pᷢ 0M@P 0 p 0 0(90A\A٢ƀ0/202/@o/ 0R:****-//p@-@|Pv0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@蘢ǀ@-P`pAT 0S *-P A030#A(0000S  ЍA- P$`@ZV Z Q+ a 0R010 ` "0 S(0 1D 0 (a@0\0C@0DU *AD 0R010 0A XǀDȀ20C22S/m@-@0Md`2S D!0,0D2N, 00N   44N 8N8$<<N $ ,@@N(,(4DDN040<  HHN8<8 D$$LLN@D@$L((PNHLH(P,,TNPTPTTT X 4m&0 00000Ѝ@臡@ȀxPDȀp@-]@L !Pp@& PT0QP3Q/0@-@P|@0S0(@\DLP00L0P00CP0T00T00Q0ǀ<DȀ0@-PR@X0\M0 P 0 XSX0# t0\Ѝ0 0 P4/0O-0@48 Y001 0QS *1D!000@ Ѝ 0 0y "!Xm0L  0OP D!00000I aD!000$@TY)00pWpXpW D!@000 @iD!@000~)?p[W D! 00 0D!000i80@@DȀ@-900oЍO-$M00L0 $Ѝ2` 0S*"D!000@@ DH0]X RP z8 1sU  P@S0S% 1I0"0p0@0p01 :#:0 1!c 0  SP U  TD!(00(02 0P@ U ?D!000$`V5D!000X UH0P0`|$D!000DȀO-X2P 0$MS ao@pDH0S9 y@-Q@*S0S( 1I0%00̡L001:#:0 1!Zc 0 %S P iD! @(00(0~$Ѝ2A81T V !D!$00$0k2 @ *0.SY Y+0.S (0000S X 0 0CX:00-"@ *M$ =@ T X0 0000$ D! 00 0+DȀO-Mp80 0 0S:RP0b00T @ 0 S`0cV`V``V:H0SS*Wt xU` $@ 0 ᣨ  )*# pV Ğ P0(  0P0D00`0D0HT a_PW 0 W: .R7 .R4  ! `1 ЍO  0P0 Q L    L  00L00弞0B kt*@!R 01a@ЍDȀǀ<G-P0 S@pa` Z0 qa Q11 1<G90S 0 0 /1M0Ѝ//0S/9@- 00 Ѝ]@-0)  0DЍ]@- 0  Ѝ]@-@1V< P0 P 7 ЍO^ P  0P  ' PP0n; H C; U0   ЍD_7@-4P @P ; Ѝ0P W@- D!000@3@- D!000@(p@-?@@t031$P@`P ;P ;P : 0 000pp@-@031$P$Ppp@-@kPpPe@:uP :P :p@L?$00S/p@-@P$$Pp@-@$0P@:,0 R P/20O-@Q1DM 00 @@@0}JX1pTa 0 0 @@@qJ z〜mO0@(0100p00,(p$@ `@ @<08 DЍ$D_+D_3D_;D_CD_A-@P0S`Pp0S  ! ;MQPW\PQ 0L 0000 0C00S  ! Mp@-@TpP`Pz 04R00 0 4M00pp@-@`T @K@0 StPzٛ0S 0R00 0 0 8000R 0P0@@pp@-@Pᶛ00C0p@O-`40@SPp0J  0SCQ  0RPDS 8 ! L(0 0S1zₛ1000 0PS,嶛Jp `000000 00 00 00 A 0000S0  @ Ѝ R RQ 00 0R000A-@p`PUddJ0Pp `P00S 0 000$ 000 00PA-@ `PX00pQW0S0 R\S  ! 0< 0C0 00C 00 0C0 0pAJD_p@-P @R0`"  0Pp R Rp0SP/0S5:/ P/O-EM@1 `Q1P$ @1100(0,0`V4`88X00,0V@,P 0@,0/00@@0(S,0 0P m8U i8g8Eߍp<1p@B o=Ts@ p0, (p@WX=0S6 K@  H@P JUJ0@TJ@>880 1=PT P&=  [H@Pp@1X術! peH@P J0(0T,0S C, /  C70(P(0810CVS81ӂ@n :@02H00< (L0L0 000  ,p000 0S0(0  (0(`p@-@P,Pp4 80R8000804 (PL@-@<L@@{8@-$0MPU @` 0p p 0PP EP >WD>W>W>W>W0( 0 Ѝ0 R\0 0 0  l( 0( 0( 0 (P0 0S0(0(P 00 0 0 O-`Q$MQ P3QQAp0 , R#0S XQAPX 0S S S PP PP ]$ЍXWPp P00 P P P00   s000 %P@ :P 0S 01Pp$1P00(P,P00000 0 0S S吔`PPp00 00Pz 0C(pSztCWCWDWDWDWS ;T 0#P@@ 0@ PH0  PU00P0(`400080@4000dJ(0PS 48 Q8 0 804 0(0U |p0S R  0  0(0 @ P31U P [嘔0SӔ0[U  @ ( P0S0Sj 0 v 0R  0R\ 0@0 0( 0M 0S"0SAU 0(   @0( 0( 0DP348P808 4(@4`0 8 04000 ,0S(p(@0 0S 0 (00U0@0 (000 0 PP 0Q1!sr0 PR 0P0 0PP@P0 0P`000Ȁ Ȁp@- k6@ g6PP b6p0P00p@-P@ `APp R04 0A /R' /Q 0B0 0A0070 0R99 R999 00R .Q .R: :0p '  ?p0/@-0@ P u10P@o1T0P  P  P 0P @-$SP//@/P/]0SD 00P0/0 /0000PU3 0S /0 00 P>`Ps0 P n/0P i/0001$@pW 0 =p0@0 /RF 0PS P0 U p 0 Z/0 P U/0P P/0Lm00;0S $=P  0R"  ! ` !`S P0 r0 P 0 S !"P PSx Yt 0LP00 00 00S00 0 0: 000 0 0 0 /R RPPL \ 0Pp\0L` 0h0 P0    +  Q  000\0 h0Pu hPj0 00 k070Sn \媸L.0L0h0-[P0K00LP0L [P0S R0S 00 K0P L&P LP K0S 0K0].0 00000$00S} 0z 404 000000$00$0 0 0 0 00 00C0\0S /P 0h0-h00S 0 L0SC V- /\2X+L%.L`0S 0 hP h00Sh0S `0h  .Ph000S0].P 0` 0"hP -0h0 L*P-O\PL J-sP0LSd 0S0'0, 00 P K0S 0K0-P-0 00000WS 009? P  K R K0-P0L00P0K0S 0K0o@0 00 0 0 0C 0L00<0Sh0Sg 0P00(06c0$0 S$ U200 (0@ =P >@LP r-Pp- 2T0 h00['0Tph|0XPlxP(0h ?@[ 1xx100S50S 1 80100/P0 `@R0 s {R}P` /U 0X 0X 0S P80凯 J 0 S i*,00/U  ` `70/P0,0H00/U,0X 0X0S TP0 SD*/U ,  (D00/P 0,`0D0!/U X X3 0S0 yP*3 0 S */U  `0 300 /P X R  00A10 0 S:91?*/U  X X 0S >P 0 S */U ,00 ` y/U X X 0S P 80 1  0 S */U ,0/U  X X 0S P 0 S *,00/U  v `0 \.I 0 S ,0J*/U \e@ }U0 {  0) ŁE_@l_d_E_=_8ǁ<ǁ(_n(^q^E_F'^F_4Ɓ8Ɓ!_w(^d_E_E_E_<^d_R00Ǘ0 0   K00( 0 00/S+00S0 00 .R  .R0/S 0 00+(0 0 /RV 0PL0+0P0 0 00SL L0P 0 090P0S   SLP K0SI Z+0K00L0Pi+0 P}+ 0L0S? P P  Q8  T4P K0S+ :+KP0L0PJ+0 P000000 00Sl 0CS( 0 00 00C0>)+Y'+s%+#+J R 0CSP K0S *0K00L0P+0 00000+ 00 RP R=0K0 00@LP *L@L0 0P00 0S $0 Ѝ P R /c 0S> /U X X 0S 0iPD>5= X!% 0S /U X SP.>=0$ \G 0 S */U,0 X X 0S /U X 3P>=@-(0M00 0   00   @ Ѝ0@-0M(0000 000000000  @ Ѝp@-0@P0M| P?Pu/sPPPo`p (00,0P0,004P P$P(P@ 0,0P:48 $09PPN804 Q0C00 0,0(Pɀ,.Q .R: :9,0`*0` 0PS <00U0S R 0S ,0 0 PP )U00P ,0 .00M0ЍpA- 00S : H0pP`900@  0S P )@ WP@.@P )00E_E_A-P@M`@P P p,pp0@=U4PPP00X@Ѝ0 @-DMP p`k@P,@0@00<U4P@P004DЍ0 G-P`ሀ#p\@0T00/ 0P0TᏋK)P 克@ ,PV  6/P 00S0P00P0j)P07@- 0PC @P  VF Ѝ0F_p@-P```@ P@ @IK    0!pȀ @-@| Pw<0(K0寋孋嫋P S@("p@-PD"@@ H"@p p@-P9"P@@@ 7"@p @-@."@A-P`P 00媊묀p@T00 0S0PPP@ 0S@ ΊV P@Ȁp@-PQ` T00S Ppl U @ P Tpppp p@-P`'@Y0 R000@00P0匊@pp@-@%P 0PA 0R 00/ 0P0up@'0A-`@VP p' 0R 00/ ]UP p0000@@@NVA0O-pPM0@'`бБ/>Pc+>0OBAd@ 0P - 0 S  0 '6 X ,P3 )9P3 !  8 p:X 'X) i/oV" R# 00S0ЍX0S(0S 'P %P ڔ00CSv*(x'`XVPgfff@-@wD0 !!|0x0t0l000, !  ! 40 @PND/F_(,tف^H_ 0 I0I0(Ip@-P`6 +0P0P0P@0̉ȉĉPP0`K 0 0@0DPp@ɀA-Pp0`V@@ @P h`00 N/ V?U 0WI=.Pd0$0d0PP @ɀ0(vI 0 (I0 (I0@-0MS@@WPP@ 0  W@P@ {WP @&Ѝ00@-@P0VP !0S S0`@P qp  0'P 8`k&VUP Ѝ0P (`@0@ R/"A-P` a1@S0101p F@ 01$@M 1R xQ1AqA`A} \ ^ \08 @#8 Ȁ p@-P*000@ 00,0$ R @@0@O@pȀ@-@P I4 0$R 0 :@x*Ȁ<7@-P@P !0R!0R Ѝ0@-`p@PP ЍT$ P*R0*T @C-sMP P P9 P0d3qpTDH3 sr+ <" $$"sDS P* 5@88T yBЍ]qB@@2P `P PP` D0SO@ 3/@d00Cd0Tq 5P,R0V* d58;%K PU D0S< d0 0d0D03/@ :d0T0Cd0-VEpU,0S#gV |Bh pQ@TPZ\BL BP04 B BO@hPh0`Ah@0P  $ 00$0$0$0@}lP0 `90d00d0 o@P hCˁAF_-F_dF_F_F_G_-_^ɀGG_bG_G_R^)^G_G_G_p@-P4)`@P,P `ᬆ 0`  @@p@ȀO-dM0P匰00 0P`0 9P dЍ0S 0  9@P 6 3 00 00PM80 ipP` 0T ;PT0P00L$(07T$ X8P $P C0S $ 0!P 8#0 000^0A~8@#!PM  P쁟10S[ L R$pW UN@/ ጭ U # 00 U # 00 ϭZ #Y #΅ Y0U# # 00 #0VM>P #0 0U0 tP0400ӅV*H_RG_Sp@-P`偅\0@T Q   4 嵅p@' R R @ȀG-@G`P4 P000Zp@00  0'00' PP) 0000A0@p0ppyVt  0P440qPP !PP 0[0p0W0PVP`V < 4Aa W "(H_1H_7@-d0P@P  P N?U.00,V? ,B Ѝ0UH_IH_O-pQ`0$MP!ࠟ ܰ@P $   [ P N?U.0  V? Bp U lV?U T?X H?{P.$ЍX^UH_sH_H_H_@-@? @H_@-$0C00S@`فd0P0S R 0 R 0S 0S/00@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝp@-@H0  9PH0 0S010H00A PA900Q00@@@p "0O-DM 00(00!1@p`0< 0800p,`$@ @@ @u 0'Q!18 P0<0,p(`$@@ @_0 00!018 0<0,p(`$@@ @L0 00!08 0<0,p(`$@@ @9 0!0P8 0<0,p(`$@ P@ @' %0 T @=/DЍO 0@0 R^޺^SJ_]J_fJ_ O-ptQ`PM@@ǪP 0m4PP'W $ d@T`@T#Q m2P P0 D t0P s 090PЍ @0 D t0P03 0 3000 ق @ ƀ O-`P0HAM @ B2 b0" 61pN[ 0 00@ 0 3pP孂ؠd@T`@T)R0t0 D 0P s t0҂0pЍ J @)R0t 0 D 0P 9 @ƀ p@-P@v P00CS 00 Ñ"`0St t0x 0`@x000p7@-@000 0Po Ѝ0O-P`㸀M v 0UЍ':@:@V@ V d? & 0PP Pz 8\1 pJ_p@-@P`'p@M H0 /p@-@DPH0 49H00S0 1 . p@4 p@-l t0@SP Sxxtx0t H0; Sd0S0000p@!CeǀA- t0@SP Sxxtx0t H0; S``d0S0St t0x @x` d`0TpS S rPP  0S 0@|!Ce@-0@  R  R / R      + 8 R Q 0;0/O-,MP0S`0Q@`,` pKP0PU Wi@@hP V   10'0T` V`pl@,Ѝd da >` d V Bd 0p@IɀG-Q-@BMp(1S@ R`  @810z>00BߍP O?@PPEP  P Ġ Z  PE @P  H>@P B>@P  l Pʀ@- @d000 0000p0`0P0@0x0|0p@-M`P@0(@0 0`P{ Ѝp p@-M`P@0(@0 0`Pe Ѝp P0/]J_@-@aM r|q0U d40e H0`0L 0/0 4 $3;0$S-! !Q p  ;\0 0X0;T00" ";=  ;0 0h0t;`P`0FSX: 4L:aߍ:8]]^aK_J_5_^/^J_J_J_'K_:K_)^QK_@-@P (:0S:@0^/^C-`00VM@YPj 0 P1pdPUV0t  < 00 0&R0S 4P ЍP@PT0SdPU 5ƀK_K_p@-PH}D0@T0pPh@d00d0ɀ0P/p@-P@ pz1Fx01000.%/&.%/& h Nd+V`U +Z# +T 1|0pO-p,MT@P`P NX0WP 1U㰑$10S^  !?@0P $0峦<`00$ V [ ! ,Ѝ$吰 P1 ! Vn! 0S  0 J9/P 0 0V+cV  h0UNR@TPPP 05/P +`| 0V9/P Z@ 0@-p0MPU U@ UPЍ0Ѝ0@  /00Ѝ0@Dɀ0 0   , 6::0070//0/ 00/]-/0 0/00/00/00/00/0 0/O-Q$M0a@P qBL~0 l僁0S@\@p@T'0SY4!01 , q~0  0S80 S 00BQ0B03!`P`O~  !P0   d-`}0S SV(  P S_-0/0040/0H0/-L/0P0/T0S000/p@-T@ $0$$@@T@U}p}< p@-P@}Up@}< p@-@,P} 0 0 0T}p< Q3 O-M  @ (R09@PBU1# (pU< `5 1P``0 X@P 0:@P( 0:@P  ,:@P@  :@`0V 0U ߍ`PC-$M@p000 00(00@ 0 ( 0P1 0  !00 `0`1-` 0-.`P  # >$Ѝ8  e  @`]p@-P@`M$ < !|`?+Ѝpp@-@P`M< +!! ,+@-Ѝp@-DMp `P@P 0P,@@00P0.4 @P {DЍ -@C-p`M!*PP*0@S+   0'00P`:0PK0  000&00`,0PK0S@! @*P"-ЍyKxdpA-P`p ;@P0 Ѝ0 du@ p;dps@-P` ;@P 000du@ \;ЍpA-pMpP`@PE?`00\@4@80-4d@P pЍHP0S@00000 00!0$0100! `(0 `O,@P !)*@P 0`F0`@-Mq` P@P 0,00000@0L-4@P 0S ,(,0P@Ѝ@0@0$0, 00:#:D0@0)@P{@-P !M`#q @P 0,00@0000-4>@P M@T ,+T fd=@ЍH@0@0$0 00 +8+D 00, @0L+@PF/ G-M⨀`P pH@P B@P0@0,@@P($pY +H0SD00 SD0 .R0.S 0t00S`280x00L0 0P0,L|@P}0d``PSx08x0V +0tS00.S @_S0 .R0.Si 0W@R0T03/@PL0 `@P<U `PU 0R'S)XD X 0S#YH 0RD)@P 0 8 *0@X03/% trЍS@@UV R+P+0X03/ *U {8 * vt@@@8 @-DMp` t@PPP6 @DЍ0,00000@0+4@Pp0!0S RW# S+R@ , J*@_R@, )@,*W@C-1@3p MaYP9+ 0;@P,@P'L10S 8 BM0<00@00000p+D@P (0S" ,<O*,(0P(@dЍ  P @P0P0$0,( <0P0T0< P0)@P(,ŁL_@-@P@ y< O-5LM@` $ pPt3P p `$p$P Y LЍA8* $0000x0pYpSpWO |0S00oS  %(p0|0|p0G S*| ` 5P7 0S V 0 (:P T `p (D4Q (8,(Pf0((00P0(v(0P0 00 `F |0S 5$P @ 00P00?,P :P0y0 M85 0|000M80ByDXx0S | |60|XBx0S O&y~ $0  @002 00   0S 0p0 0+P^ PY0x M8M( 0% 00001 0! 0 000 |0+PV   p [+ 0 0M800A ;%S0xX0T0U 0 P  Vf3040w 00S |00 0` $P` `p-UV0 gPN  4V5300 ]`]J^< w],L_TL_@- 0 0 0000 wЍA-pPM@P 0@00<@@0)Dv@P PЍ(`P (0 @@0 0P+@P 0 0@ u@T(Pw0S N x< s@-P@PЍp0w` @00!Q@0@000wG-@ĀĐ`0 0| PP Q Z pp 2|0| /!bR 0MZ@TЍ F,LW^QP{L_@-@-3\M` @P 0P0 SPWWԸWWTWWĹWWW`WW̺WWPW, `@P,  /\Ѝ P @P 4@$ P @P$ ( P 3@P  @P(  pv3@P( p3@P  e3@P@ `@P@ @ O3@Pp@ `C3@P @P@ 00000p@ `*3@Pv @Pp  74`@ 3@Pd @p!+`3@P P @Z@D ]@-@M 2P ЍG-P!MS$ ` p!&W@.  @?@0Cp 0<0,0 0@ DT Ѝ@PW T0O80 TPP Ȑ  P00/S S 80S@ + <P+ @  E_@-PX0M`p @P 0 0 0z@ Ѝ ]p@-@`Lj 0P@P b3@[p @-PM p`<5@P  04 00#0F@4Ѝp@-@`L6 0P@P .3@'p O-1MPl@0D`@ 5pg0 0P[0$0P 00 00P-U$@UT0H H00p@0 UT*0 0 0P@0 3/0P` P P@@0 3/0P 0:0Ѝ E_@-0 000Ѝ @G-p`4@P.0P( 0S@!R#PZ%$@@ᮜ0S&  P  @4Ѝ @T  @ ,TPPG-0Pq$@'@`qP  PYPPᴜc'$D' Gq0@-Mp 00000` 0'@P 4@P0`P0S@@!"@A%T3Ѝp@-@MP `x@P U?000,@@0%4@P 2@Ѝp00+0S@@!"@P %,0s@- Q@P $P@`0005Ѝp0 0p@-M 00000P 0`N'@P0 @PBЍpO-5,MpT AP> a$$45@P 0 00000 0P  000 0@P $ 4,Ѝ $0R  4$0  {6@P$00P@P$$  =4@ C-p0MR`P0'rP 0 3/@rNT T+ du40000 000@S 2@ @P0/S 2@P0  OЍA@-p0@ @`UPP @ (0 S@5 Ѝ@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR00 0BS` !0 !  S00S03P R30ЍpC- pሐ?P@``V`31P01 0,@PP  Ѝj0p@-0P@ 0P 000S 0 p@ Fp-p0ASG-Pp@d `K/PP00S!3 T` TSN @PH*0p@-`M 0000 0P%@P@P T0P00L@$@(0$T$@P j`Ѝp8`dp@nT  .@P0 00S030 0@P 0S@3:0@O-P0!M0#q` 0000 0%@PbUPc  a3@PW  a@PG@T0SG  |@P  8 @P  =3P 0S-@+"$ t 0$  u @P  0r0X  X Nr 0 P@P" 0  j2Ѝ-@@@- y Ѝ@-M pP 0`%@P @P @9Tq@Ѝ@-M@ 0P A/ЍA-M P` 0p$@P @P@T 00 00@gЍs@-P@P 0`00@P .@ Ѝp C-P0M 0000p0 `$@P  Z@PgpP @Ѝ0@00@<0"D@PE(`V@&P$0 00:#:T0> -: S'  S"  S0 0@ S+0  S0P00TS-sr-@,<u!,P6V  00 P-0T+S S  ,<"@P ,<N!,,P0< (@P(,P0< (@-@# Ѝ@@XЍ@- c Ѝ@-!  Ѝ0 cC cp@-HMP\0  1 1 0>@P+X@P$0`800 @4`0 " <F@P 0$S@0S 0R@4 < @$1!$g@cHЍp@4 $ 0PX P> ]]@-; 000c0 Ѝ@- 0;0 00Ѝ0 c  0c000@-DM $@P$P0@,P0000!4@P 0S00, 0P P @DЍ0  ,3!@P ,f  0c }0z0 cu@-0S@`@P5/0P @ 0,Q@ 0P000 1/@.ЍpC-pM`/PP 0. @ 0,Q !!1/@P  P@Ѝ@.00@-MA0 0@PЍ0C-pM`.PP 0. @ 0,Q !!1/@P  Q@Ѝ@.00@-MA0 0@QЍ0C-DM0@`p, ` U_E_A@P"00P,@@0 |Q4 F"P 4P@P W!DЍX@ `l`@`  T@P N@0@-0 c Ѝ@- 00 Ѝp@-@M` P@P0P,@@00Pj 4@P @ЍpP@ @-0 c Ѝ0@-MPP @@0cP P,Ѝ00@-MPP @0cP ?,Ѝ00@- 0MP P@00@P ,,Ѝ0@00@- 00 c` Ѝ@- 00X Ѝs@-P@0` @P @R Ѝp ]@-P`-@P 0 pt@- Ѝs@-P@0` @P ^@' Ѝp]s@-P0` D0D0 0@P V@# Ѝp] ]0@-0 c Ѝs@-P`-@P0 9@>-Ѝp@- 00 Ѝs@-P@0` @P @ Ѝp]@-P$0` L0L0 0@P@0 =@ Ѝp] ]0@-000 c Ѝ@-PH0` b@P0 00@ Ѝp ]@-P` &-@P @0@,Ѝp@-00 00 Ѝ@-P`  -@P 0 00@,Ѝp@-PD0` @P@0 @ f Ѝp]@-PH0` @P0 00@ O Ѝp]G-M0`@S11\p @ ᾿0s)ᶿ 0s0Sp" 0PPp Ѝ0S  )PP 0s≿!(^PP  0RP% P0UPP(P0 s` 0 s pUZ0!(00APW  P0PP ]]p@-PM`?,@P 0 @0@0c e@+Ѝp@- 0  0@0 TЍ@-0 cIЍC-LM@hPP l0S ()P(0 !R0 1S 0  0D S:LЍ/``0Q*!!?@B@- 00 @0 Ѝ@-P` +@P 0 @0 0@s+Ѝp0@-0  Ѝp@- 0MS@$P0` @Px/0S@ b@P!\@Pq #!s@ Ѝp ]p@-P@W+0P @ 0<Q-@ 1/@$+pp@-PMf+@P0L` 0 0 K@+ЍpG-PMG+@P2 0 @+ 000  0- @`@0! 0 J R! B @`pXP0   @Z*Ѝ@p@-PM+@P0L` 0 0 @6*Ѝp0@-c 000 Ѝ0@-00 Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp*@P 0 @ 0 @@00P@0@0S 0 j00A*ЍŁ@-,0@31!$ p@-P`Mt N@T\0@&0S00P0@P(Ѝp07@-<P s@P@ Ѝ0 ]G- P  0@J 0S10C 000Ѝp **P 0  P `D 0SP 0 PX)PG- `p0&J 0 S10C0 )@P 0  @ PT 0S@ 0p_@*)Ѝ@@-@(jj$0S( ( (0$ @jɀ@-@, 0Wj,0$ @R$$ ((0jɀD 0S ( #P QS//A-@5jxPx` 0S0hP 0Xp (`0S Q R$02 . ɀH D 0@-@ 0 (!@GjD ɀ00CS0/@-@P $ 600C0u @ q D 0M0 0Cs00Ѝ/D p@-Pp0 0AT 0S P 0SP@p0S000 @D A-p䀟3AT i`Pi0S @000iPU PPhiX0 $! 3`U3@103 P000 @ɀD L031S  R R0SQ 0/A-`@P 0S00 p@(PP 00 Z(V(V LBiDPD`P 0$0 viJɀH @-@M @i@ i3|0'0l 0 ` `0 X 00  , $0 a ЍɀD L_L_WW(L_1S/p@-P`thAT`+i\@Q p0S `` ```@` $ɀD A-p` J P0@p@pPP0PPPh 0 0! AhɀD p@-P@`h0P 0 1S 01  0S 0 0000p@hɀD  + ( %G- PP0S0C040S c'0SB 'rh00bGh`p젟fh3}?@T hV @ $` R   R  R R R < 0S  B p ppp3``}?00G?'D ɀT @-P0S003@oѠ@-P003@oO-`P@7 PpW@2 ̀g `&뼠崐@TW030V@@0U 0S  3R  P $@ @@P W 00  hD ɀT H @-I0@-C@gɀp@-00S-@ `P2@P V\ 0hP#@g@P (gp@@ @ ɀA-@t`pg0@00Lg Pp `?0S0P0P0]ɀA-@`pggP|g&@TUFT0S0 R @S    ɀG-0 `P;0@0S6P ,10S00PS00& 0S) )&g@p 0S00NgpW@0;00S0C0% 0S &pf0l0X5g 00% 0 3/@Pp0% ɀH T 7@-@dP00P1S  E+U Ѝ0P-@- (#RA-P`@PpCZV@(TT@Ael 0P R0o5/p@-@@P0SSpp@-PX0 0ATp 0R 0RP @l G- P@d `U `D` 00@0$V0:Pp Xf01S f0 H0L 0 H0P0L T 0P0 T %R0XP5\p5V`P0pL_L_l ʀP@-@ P lT@npP P p@-0@S`L Xf0SP P Q  - `A0SPE 00@0@@U04 @ V @ 0@╾U@P 0R0@D≾0S  B2 S * t0t0"#R 3<0T唥p@, f0@,00PpV@ʀʀl ʀ<PMbL_@-@e00CS4qf E8<@0@ tZl p@-0 t$@-G &'f0p P 0p  Y  D L0 I0 0 0 O-,@ 0!@L ( MKJP`Pp Yd0FoSVYZZ 0S [ YNZ 0`Y@ 0 F00 0  O-@2M0 2Pc0聖,000  00UP48<40F  L0 000 00, 4@ pP  P RoP[P; P` UQ@K0@01[D00, 00@0P yfygZ-d 1y 000 20X ,0D000P\K0SA 00S?  "  + P  YX0 0X0Y, 0P0[P0Lr P i P@ 0&@ P -OY 1P " Ѝ p@-PP@`k hYX00CX0Y pP3p O-,M\`ကP@`dpPD0 0%!X0ЍS@@  C@PY 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H#DM  l嬑嬡 00S`0@00 00$0040 0S10080 ~ p0@X ""Yt0  0p000 `X" Y V00S 00S @Dh0@DЍ0S  3/P0 S    X0 00 X `` C-4MT P    ` Pp0 0$ 0PXz000 00# U@! T0 0C04Ѝ@-4M`L @  P  pH0 0 $ 0@<I00 04 T`4ЍA-`Pp\10  -P@0 00 @VЍ0 001/ p@-@`}PP ` !PP p0W X00X006XA-@ M0 P0  P0唀`!gX0 Ѝp@-@`PW 00@T p@X^@ A-P`@W R   0J RAW P   0 R Up 4G-P8M`@\`pU+ 000 00@T"P0!(@,00 0 ! X  / Y 00 ( 0 D, 壑8Ѝ@ 0RM_@- @`P DP 0P  P ]M_eM_kM_uM_(00S/@-@M@ oŁ~M_O-4Md`pXP\[ 1 00000YS@) P)@&0 00U@! P1$ P00(00 T11 00 `0@ E  4ЍM_A-`PpX 1-P1 00@qЍO-P^0PSP $0PU40%V Z1 Sl0<0P0 !0000S#000H\SH[ 80  000*40803/P  0Rn l~j(0S80S  o" R 0(0S  0R lb @0?o2X0$0 V40"&0:D0D 01L0X0 000L00000,0P (0S ,Lo<L x0& (0S~ PL` 0P0 0P0SD 00H0D P`S,0`p @8\  0P(0ST 0$04 PXV``,0U`V Ll $00X0$ 00000004040P (0S) Co0`T00TPS 00 0 $0 \07310@0S  0P`0 T06P0$0P `V40P0U`PR0`ǟP0 0`0$``00000@0S606 00P0P0娆0C00S|d0<0 0$P4 0ct0V $0U40+00 1 0@{ 05rt 0SrZsQ 0 Z3p0000000p0Pv 000 妠@0Sf <0S T`d0X00S 80S8 0 P0  P /$ 401/PKnPT0Sn ᕢ(0St @0 8nX n600 00y %6p1g 0@ `0 70zG P00ld00 Vd001:# P `V op 0 0/  A!t3!00S V 0# . R  T P! @;*"*X S 0|000*sr1`0$ C 00080S|0"^P0 >0 0S#6  m0 80Z m0d0|P倠`F0 $04 RS00V00S< ᎞$ <0  Eࣝ 0<\) 0  Cp012t 72\ q\PU0p b5PᬠR Q\ SQQPS2< 8P<00P 00 0gP(0 0X x0 ?o2"@  D UXWY% 0@ ᘿ 0  ƽP0Sm0P ,0L!~ꕽሽG៽ 0D0 0 "P  (0S@(0S0h0k lWP_lOO-CMD001@ @ 041$0810009309L0081 0H000L00p,0ᓸ0`S L000 2EH0  d0ShEW ,0S 408 03/mPCߍW5812 0 Sp{PP) ll`n눐Y `q,00l0p,08P 81 40/03/PP Y007 0$ 08 81 0SD7 $01 V$00 81 000S 00 <00@`D80 0PPP9 " R$ 0 P$ (`,l@lp6 010 S0 0<0H0S81 000S  P0jT0 0b 0H 0E <1SP P̾uD0S H0  0S0000 0S 3/H0  ᲷP d0SGGl00+S [7H`Di`V`069W% ,0S 408 03/R0 0S 00(`,S Zj ᅾh$ֻy(0P0,0T0y0`040 U'V `V 80` 0S4`080C'8`0P(0 @ p 0(`,0 00h 0 `  01/9v0 )V. `0dS00V#6:X0\030*V 0p\000\ R X A!E\X00CP1   h\B?1Pa&X  R 0 R"6:PNƠ/ 0X00 000B?*AX000b\0 X00X0`0X0S%( R \(` 0C,6`ßgk0X p0P05/P⽽k(0U0 0pPX0\(p0(0S  0P$00 @0PD00 R Z  R P  \`40S  t&  <0 0 S 6  P0 Sd 101PT0S @`$T0SjDP_P_@-0 000! Ѝ 0  /A-@0MPb 5,0F00 00[ЍlOA-@0MPb ,0F00 00BЍlOO-$0p@P`LM 0  00 000B 0} 01S LЍ $&/ ^ jjx1 31p00 PP000` 0Rlj Ƚ0S 'jQ([ 1 0@ & (  6,  ?(#$<8 0(P8 R  p[q @  COPG-@0(MP3 聓0bpFa @ 0BT0 0T0CB ᦚ0000 0$@ b62< RW1Q00Wrp @0墾(ЍO-0TMPS@$0 8Q$    $  # Q $ R0,00S$0S 04 8 TЍO/4 8`#6/P TЍ0S0000C0D#D SX 0 0 00 00000" R0 0 0;;020S#`(030  ` a 0Q2! QP#Q0a po0pW` a7qp QV|QS1VaDH8 40%Pqp D8 40 ?R+`h10000 0`. 0Pu(0 S00 ,40唒pPjx!0 00>0`00`0`F,00<0H1080<1 81!&RW2:8a"1 0(0 000 :#: 000p [8L"0  ,dW-00000C00 000 0C000H < 04 Hz[P_phkXp@-@P@0 p@@G-P`$0@p3/@PZ@00@800 4/@P 40T00SPj0Vw Sw P$03/@P P 0S:P n0S{00S@0SP 00L0D 8/PP H0U00S @@ 0W1 V5 P 0S O P 0P G 0S 0S PP 0S P<0 P0 Ѝ0P P P P@ @SSA-`Pp@ T W AO-P @`TU  T 0 0 06/@ ЍG-销@0H?oP20p`PS V TXTYGO-DM,0000l0Ph0t( PZ@ Q`ሠ$0 3/@P0S@800@ ,0( 4/@P80V <00P p0l 5/PP<@ Pt<0Vy l8y80 R R<PS 4l<0S 0S PR8<P JPP8p@Pw000p00l0P 0,0 0@ (04/@Pe00 00] 0R S@V@ 0  4/PB@LS@HA-P `@0p0S 0ḠW 0ᱠT0S A0ᦠ0@-P @ \\ 00 0O-pM<0 P0@0 0D08`HLP0I@P* 0W0V0 4  0P0Y0 4 0  ЍO (P0S P @Ѝ /A-@` Pp P0W040 Ax<@- 00 00! 0!""##$$ F@-==Qp@-@ Q  88|PPpp@pP_`]Qp@-@ @Q\0@$0@0$0ppP|=$@=Tp\0$0$$@Qp@-@ @Q ppPb= 0"= 0"p@-Q@pP @Qt@pJ=d 0$ 0S (0, 0@@|=d 0$ 0S (00, @@po 0S/S 0 / E/0S//0S-/@-P_//@- bG-`@0S 00s  r PPl 0 r 0 pW S S W  P UȀ- //@-S@-0 @ @  e@  4eP@    dHd@- d0@-0   d@  eP@ L  d$d@- td@-@MeP eP/@-0^dp@-@Pc@pc  ? Ra0  /00S S S,0 / 0h0@-pk0t]]]cc\dddA-pP`@ ~P @A=: <900   P0@0 <0@0<O-@`Mu0W*} .0㲳 d 0㫳  0.0㤳1d 㐃+1  0♳!刑刡ƒ1!0| #! 0 /#1ᐳ+0 @UX0*P 0 0@P 0 0@QX0 㸀娐娠Z@0 S: 0 0C@ÿ2<0+#! ! 0QЍ:;,nmO-Q`0"00p@P "( 0!p2 S0^%> X@P<2#!@TP0 "p"1!@TP0!!dƒ @TΠ1#P<++! 0΂p'' ᨁ p 0p !P00Tp0&@TPp@TPpP 00 Tpq@TP0G000P0p?T @.0 @ p坲. 0 ᗲP@< 0ᐲ< 0ኲ Ѝ:QO::mnP/G-(p$`P@.Q<0S00$00V (`吀?`aV $'0#$+4P W8P< * 㕻%!  (($0 8 V (00100 @ D@-0@00$00ဈPp@-@P`-uPP`䗶 ᥂Pp@-@ .0!( :@ H@-0@0!80@.A-P@?| !l`Rp. WT  T   WP  P %0SX00S 3/050.A-@`PP pa.qԭ.p@-0@pPP.˭@.Tp@-0PS@p 0x 0000g\-`1.0 $A&@h.0@e Ѝ@և4K^)^0/G-P`l@.U 1P0偭0SGC.0S0p 0SڤP夐UnPP -.03/- Z#Z P &00C0Z $00.-p@-@PPpp@p@-@P-00P 00$00h0p@-O-M00pQ  (@`TA  0 09 002-l 0U0Ѝ0 @00D0 0̰ 0S<0T PP Q $  ^0B0SQ0 @ϡP ÿ@b V0S`0   0 V@!@1@ 0pH7/PH0( `F4#H0p@-@Pl`f/Q$ 0R0<0(0(0,0,00 0 4 480w0 0`qX0< H00X0000880 00(0S 3/"zpQ_WEVO-kMAdğ` Tq 'D$T <T NNT P $TX $T #B/&BT C#T $&B! BT#D Pkߍ#T' BT'B2+B B R# R!  lKpPX3T -16T !7T 26T P#T #T #B %B "T !Be'BT%B 'B B T "T BT T "x2Tz 7C0CTP0U55L 0P` T;X2T020Sf/E/۰p|+0 700PP1 TT *60 0! 00 P070+`t10SP0U880S9SuE/⓰@t+PP  _P+0$02 0SP. 0tPP'pW+@T 00+T תT_{dЀwd~d(udd@d@gd~mdyd|drdAhd gdedg~O-@P`lpM - %60P0!0 0ApP Pl` p~(0S00 3/x0&  ,ЍO0 (p(P  Wpt UPT<$',P* 㰠8SЍR 0#2Q  P0p 0$0 "Q0* 0  a Q_^Q_^R_*R_O-@|?l`吀P Qp4*0SU`V` * ЍX0S  U%0 YUT0PTP  YP0PPP%0`X0$Q 00 0 01/`P % 0 /0 8S0SU/A-@PQk>RG-`pL@0P `PO00i|//*01k*_⏍t勴0  ͧ 0 ǧx嗩  0 1l * p00Cp00S  . l=*x剩TQ 0!400Q)Q (]T]R_ A-@|`0 Pᑮ<P 21 0 1@0/1: :05:1A论A-P@᠀嗱0 .P`lp)lFQdPQ)䁱 R))dᜱ001,^  ϞC-(p`P,@'P B b0 P0PP00h<9̠12`@P]0 h>0Ph ЍP@-p@-`Pp0S0P@ DT 0dR0S$D⹬PT01#p_O-M`8P ypp$]p@-@pP/Pp@ip@-@P`#@T $@DTP0S8 0 (@Q 0S R0@0S 8 @P=Uzp p@-40@SP 4B\0,0S S 00 008@Tp`0 6/@ p@-@P` ႟+ 0P6 #::0t $00000@0`0  : 0p8]A-Pp@3A`1`00 0S60S50S 0S E`LP. Q 50S0 x}050 T,Y@-@bBXD0S 0 H0 PЍ@%@-@K50S0500S @~@-M pbPPA㴼900@<0(0@P`1`00^lxJ}PPPPPPPPPhPhB 00 0`S 0 ( `: 0@MPЍ W_t]-\M0000Q 0S 3/\Ѝ G-`1@p31`00l 0RPZ50Sx#}0550B R  00 0S#P> 0 0 0  P0 0000( H/o6"Q R  R   0 0 pPP #P 0SPU  P P O-1DM00P`p0 <0 a0,(P$  @<e<0 SB 400 ,00  0000a000'>(P0$ 0 e<0400 ,00 0000a0(P 0$ d<0400 ,0X0 0P000a0(P 0$ dDЍW_hx4YW_3YD_1YW_O-QdM@0 | `dЍdЍO=dQ0 00000p0 6`P`W0_YPU@A @TP HY 01H0#0@DT0P Z 3 #X R+   6 4 8 < $ ( ( <0 , 8 0 D@  RH  H l X  P  p J@ HrT P @D` O-造Mx@P`p )0` ᅝ F0l ,1 0(10$10 1H@00X/` 1?o2P0SЍ 8YC-M 0P`` @U0xp 00P 00 0 0@`?o2P0S  BP Ѝh@-(@,000S S 0 AP 0S Ѝ@QЍp@-@P@T $@DT\/TpPP 0S(@0 ,0 0wPP ]W_88YW_A-0pP@TU,`T`1 ڜ@DP0W_A-@dp`P0S$0C(@@ R (0S $0CS `PA W_p@-@P T-p\P S@$<0@ @$K  j p W_ ˀlh @-<0DT 0 !0  !0@- ! 0 !A-@`XpPU 00`0S 0U0  03/=h p@-@P0 0 0 0 00 0 00  p@O-\$,M31`00#212 PU F 40"0#!",Ѝ00030 2(i`.P[ @D Y Y h;Y ;YH:YH:YH:YH:YH:Y$;YP:Y:Y<;YsYB  83 @p0K\ 00 :9 0P(00S 8T 0@008 3SH L0SP0\0/000"0 |2@p d2@p  L2@p 82@p 2 @ 4 R ppj9 76=n<0C S0! 0彜P 00 R  9  L9 @ jP! W Y40S g,1  0000pCp(0/P0 *<(/ Q80S 40S 0 @pW 0 5?pP220:00l@h 4/W P@p 2/   ˀ G-P4,a @T@T $@DTG)'@@DT 0S 0S0S$$)08P0(S KpP XN<9080400k<(@ ˀO-@$M,00@T $Ѝ`(@DT L <0RUSL (≔ 0 0 0  H0PP9 Vg000pppGm0 0 Y ``0 0V` F/ Z0 PPP# 0S,I;0 0 0 ؾ`0 0 @T @DSP0P P060S500C?o20T0 La0q P3/PQ0S  MbA-@p `PBM 2SJ@ @(@0 0@S  ⨙02 100 0 0P`5BߍD6Y@-0  Q:0 0(0 0QS Q   Ѝ[D6Y00@-AM@0 0 0 0P00! ! 0@忙 [;Aߍ0A-P`0@ #R-H L R)QH0 P0H0 00BS B 0000S  (  ( 0Sp p䆙 A7 $;-CM       pCߍG-P<pö@|`? PPl00P(P$P,P0$008P$S( (0 { 0 pGa ˀp@-@,00,0PS0{0,P@8PUp`0 6/Ps@-D0@40P0`{0S  Ѝp@/Ѝph080/h@-@P gP @ _A-PT@HqT01x`31`0050S*w0500S 00000P ,P ' P "P 00P 0000vPG USB O-@4M3p1``00v50Sxv050PU :W 52CW >0W >C 0CW H4ЍOt80 S񟗂QYHYHYHYHYQYOYHYHYRYHYHYHYRY,80 SoQYHYHYQYHYHYHYRYHYHYHY(RY7W 0W]0S 00P7W:>p WM0S  ⟗Pl7W  ;CW0CW5C 7C0C87W0 H4ЍO]6WE 87W >C0CWP覟 W 6WXoY ϴ0 W0`0dGE&0䀔Wppy`0fusX B06W+ #17W 6W!000 RU 0 F0 0A0CS…Q|5pW $pGWP5W 000S0ST%0 R01 5:S 000(xP YY  \ CP T  P x u00D0Su4 R.PP0400 R0S 0 S P00  0[  Pz 0 c(00pW $pGP8s{y0S R0` S R (`V $`FVP 0 B RP9X0 ֔PP+0(S'0SdzP PPP 庳7P40W S 7000(pY1X*1P|@?P 01 x1| P 0S 0 0(00,0 0000(00,000600008000S080<00S<00@0@00D04p000KWU  P0P40M |Hwt@HpB@~B f@pBPLzB ˀoB@|B@oB@fB@{B@}f|fvtgBBfBwBh@BW_/P/@- କ0`( "4`# Ѝ0M0000# Ѝ//Q02 //000SCQ00A\$ 0\ -^0Q  Q0 8<00 00  /0\ LQ @-0 AS/0S 0 /000S000/AP/C-QP P`@A0pSS񟗗YYYYYYYYZYZYXYWY,XY,XY,XY,XYZY,XY,XY,XY,XY,XY,XY,XY[Y@ZYXY,XY,XY,XY,XY,XYZYxZY,XY,XYXY,XY,XY,XY[YZY,XYt[YXY,XY,XY,XYZY`ZY,XY,XYXY,XY,XY,XY [Y,ZY,XY,XY,XY,XY,XY,XYZYlZY,XY,XYYY,XY,XY,XY<[YPZY,XY[Y\YY,XY,XY,XYZYZY,XY,XYYY,XY,XY,XY0[Y,XY,XY,XY,XY,XY,XY,XYZY,XY,XY,XYYYYY,XY,XYT[Y,XY,XY,XY,XY,XY,XY,XYZY,XY,XY,XY,XY,XY,XY,XY`[Y,XY,XY,XY,XY,XY,XY,XYZY,XY,XY,XY YYYY,XY,XYl[Y,XY,XYWYPm@P ЍS S S PS S 0STS 80SQ4E< 0@9 0@D6 03   0@, 0@) 0@$& 0C# 04C @d 0 S)* 1 3/y0S01-\M000 0h\ЍG-PP`p@ @Tpp @0F S*10S0SҰ  10@@DT\Y\Y]Y]Y\Y$^Y@`T @T  @.0S0S*30S* V@@PT 0T  T @TT T 0`ST@Tᆰ@T T0 0#3S#YA @T 0 S0 0S*@ @T*A @A0 0P@0 C @TU Y S0Y: @ V/@-@P ` pW T0 003/@ R Q    0P  Ѓ0S@ P Ѝ 0R00 0 X \ G-`pP P@m  ㈐ 0SRp 0 0G/ 8m 00$0  @@@G X \ /@-$@ 6 P 00X X_A-xP`0 0hp 0@TALg  0R00 0 ] 8/㙯 X @- @ 0 0@G X p@-:`p@PQR*Q.\  LS0CpQ A`LE]@-@A-000pP `PpЍ@ T#E00 p #X_A-0pS@` 0S0SA0d T[0@D0 pPU#A00 p .X_r^$0 0!0 00 /(,03!"/03" /0M0P@Ѝ/0M0P@Ѝ///////0 00  / /H@o/@- @< 0O-`MpHy @0DSVS00PЍ\ DQ 0A Q@Q ĠĐ0PU0S S  [P劏P `0DSWP0S P  00C ^ R0 7X_p p@-@3X02@R^;?$0PUp(0S 3/XPd@-2p@-@PPp0S00P00C0|2@-@(:U p@-Ph@21 01  hp@;C-M 0`p` @峐P 0Q 00  00P 0@ 0 OobSBP@T P z 060n ЍG-p 0P`M !` @|P0 XJ0 000000@P+S?o2P0SЍdY@-@0(㿭@ @-@6 0@q t0/ B0QQ//0(P/0S -  0/h @-<0DT 0 !s0  !//0@- !b 0 !p@-P@p@p@-A` 50S 6PU 4 R040`0,p@ 2S 0C8C8_o2RU0 nˀPA-P `Gm<0@TA00S p3/qX@dp@-@P`03/,`D 0S 08 000 0S0(Dmp@ ;X_PG-@d@u ,1@P"10 U V`@g 1U@ a@^ 00S00 000 e@ GMSUpp@Q WtD =$pW 80S  3/XppW 80S  3/XpˀdA-@P(p ` *R'7P00 0 0 L Uh匳004 0  004  @0D 0 @0D h右3 000SP0PP0P0A-P`p^@T  R    B dTp03/@-K ջ0 hY_YA-`  @0 @0 f 7P20p0pg 0t 0ppk0T T@c D0 ЍAp @ˀSX_ˀYX_]kY]X_kYeX_0-DM000,00(0P0 0H0000<0$ <0< %UDЍ YlX_˫ʫ@-0  e Ѝ^O-|0 S4|00^@S4p0`|4DM00p,`($  <0TP` 0 ,40S Rp=0S/ 8ㆫ` p)l l0@a 0(03 0p0`00p,`$  <0TP Lx0D#DDcSS<3x00000@000S ~_S#S1!~_O@FpPDЍO 0!<0$   ,p(`{TP 0!2$ 0<0  ,p(`iTP{0 00!42< $ 0,p(`80TTPf0 00!1< 0'>$ 0,p(`80>TPP0 00!10 ,p(`$ 80< +TP@ <0< $  00,p(`TPg1000<0 ,p(`$  T0PU     '. ,p(`$0 @ 0< SPD @P1S ~?S?11~oS1O@oaPԟYdYBY_pX_diYX_DfY@ˀp mY X_F^X_X_X_gYX_O-3DM@ l`o P@@ H lб |D1n00,($  p<0SP@ DЍ 0!<0$   ,(@SP 0!0$ 0<0  ,(rSP 0!P00H00,($ P 80< _SP nY\dYBY_pX_X_gYX_@-@PY@ g @ XfYp@-P@W` Q    .p@X   R@ @@  4A0 <0x 8RR00R0S 0S/ 2AmYDfYA-3P` |p,@ `?0UPP B@dYiYp@-@P`p0p@/A-M`~Px@ppT ЍAz 4P ~x@ ˀ@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@cYdYdYDfYdYdYdYiYiYl 0@o/cYA-P`pD@7PUAD600S7/@P@-@400( R @@0000@p @-@00$S   00C0@p @-`pP@MlPVP@ЍT@UP\0pWU  OY0S   @PpPE`?@p 0L ˀO-0M0X5p  1PP,4 0X`@"040 000  0 Ί$0(0`0`Ѝ蘋Y0@-@m0Pm@!,/0A- 0 `   H0D0R@UDp DPU ?D02SH H0 fmr0AՄPH0S D0SH0D0H0SH H0 TmHp0 Q  ! H0SD  D0H 0D00H0Qp@-@ P 00`VpP000p@7@-0@S NPP0℄00 Ѝ0p@-@`P5 0 50k1Up0p@m0 L ,ˀ0S/ L :ˀA-M@`PCp0QP00H8DPP@TCЍAI .PD@-3M@03XWp D`PP(P$ 0S00P00C0+$`D,0S 3/XPUЍ*D80PdG-VM@V/ ᘉp6S }? 0@c1 p 3"0 2Q  ! R!u0S Q050 h,? g8䁄刀 2S g=   0 2VURU DPEU RU& DU# 0ZHP #0 RS V R H0 3/0,PH0 P.&U$1PU" K !8 -P Q01Vߍ40S 01Q 403/0SXP0S    H03/,ˀ@ˀp X_HdYd0L *ˀA-~`vPpU@' l0S~sPDfP@ 0 R Dc'#P 3 P 0S #P cYp@-@`P@P ApA-~`1PpU@ l0S~.P3 DP@ 0 0R DQ "P cYp@-@`eP@P pG-pW0S !S* 1S l Q`~`PȐUl0 S DP@~P 0SP 0 S:V` d.P` ,  DcY p@-@`P@P "p@-@P[P@p@-@`P@P pA-`~P|w tpR@l0S~p DcP@ 00S Da cYA-P`$V  l0Q R@DEP@@ 0S0S "P Q "P  0S*p0   D"cYA-@p`uP@P P/@-(0pMPL0`  @P $(0, SS  3/Ѝ蘋YQ/p@-P@T0}/ P P* 0SC\T) S*G!A0HS$HA@0@S@  S| x#!R01`05S8P P p@U030._5_^ Y_Y_ˀA-`pP40@TA80S 3/X@dA-pP@HW`40 p0H0(0DdP@A*!P D^ 0 0R DTPL0S 4$D>p @-@@@-@@|0/0/0/0S/  lˀ0 R0/@-Pl 0RcYA-0` `00R@S 0`8`0}? >aMCaazq :*a abbXIT! 0$ $18!0 _  0R200 `p00S0p SV `p02P0Q:0"PSp`W !'`"0 AЍA80ˀ@ˀp 1Y_9Y_@-@k@A-0P @ 0B \U R ~`lZ@dpT ۿ S0@A9l0S AP ~I@ cYp@-@`᛿P#@P 0 iᴿpˀ@-Q@M#`@Pp`P@ Q@ 0T0 R0% 0<"E@ЍA-0P` @ 0B \U R O~p@|T l0S ڃPT0 ] S0@A~@ cYˀO-p0M#08PQt 6^0Q@ dh{P  03/@NT(hlP   03/@tNTrG\P  03/f0S00  P ` 00PPxG>P  0# 3/G0DgS<'SRW (]0 00000 0!Y@ (&T X `V@` Pi&喾~@p0Pp Ჾ!X@@0``C`Ѝ(6  <Sើ PR_0SCD P `9X` Vڐ P@P0`F[D@ P wQh5 @ <:~X` ` pcVڐ PҼ@P`F3@D?@4<  }9@z9@%w91u9N$SP St$#8q (`PI@P0S$@P4 <P <q@IH0$3/@@P 0S-@ <PP@ 3|`|0,<N03/@P |`@ d@=0<#S 80#S %'B BS #S #S#W6 0 0 0` 0@P* (r"S  S "S "S's |"Sx"p"S l$'a S `M BS[ BS30 P@0S-@ P[ p @0  4/@ NT0 0 (@04/@#00#  BpjR#0T00S @qP/  03/@0S   R Nq{ S#B%B}e Sb O!"'S s[ SX *.l[8@X8@&i@H@G@IAzixi ˀxi p dYiiiii{iFi@ui niiiI@Iii7iiiG-Ppټ~`s@|T l0 S 50S0 0DP80 ╽~\@ cYˀ0  僽ˀ0 ˀA-p`@%PP 00S0P i !@P !P  WMY_xY_0 卧hYfY) vhYp@-P@_40x@XPx0D#0Uw0D"0Uv0D 0t0!E'D!E&D E&Dp@-4@Q`M P@1h0Q o0CQ 0Q 3QO PЍ3Q 3Q31 1}0Q0 0000 0㙰PP0@S?P SRp @㲟? p嘹`P @᩟P3Q 0CQ 0Q2 0CQ00N2Q 0Q XAOB0!   Q S5  !!@ ! @ ! !1  ! ! ! ! ! ! ! ! ! ! !! !! !!,!1<13GPk3 1 P1 3 1#>0880R 3/PH0@0~< !N D!0/H0L 0/QP@0D  4P#P @qP 0?S@ Ѝ@SPP iui vi iiiG-| Q`PpM `1Q-@WUHH+0 00 0`0p圯@P ލ@q4T @OP  0R nDPp1@ . 0Q DVf@P V14 (0V-@ 841i i]Y_C-qM@`CP1  03/PLNU+ 0S(   Pp@0S  ሀ  0S  ݀ ـЍ5PpP@Ix0/p@-`Q@P R 0 0 0 ^"7P 000SPPPP000p*R 7PD"0 0 0 U `0SP0PP0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RAA@o//1S /p@-3tP@ !P0#3 R`M3  R  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP$Ppp@-@PPBp0@-@0M0S0׷@P  NЍ0ϖoY_p@-Ph@i1 01  hp@r@-p0$M03PA0AS ` R R Rd ⽵/@ PR R @ 000 S""4400 #RH L RQH0 P0H0 00B S0 B 00 0S  (  ( 0   T  000 @P. Q* @'0,001   00^000 000000 0 00000 005@P #T@$Ѝ3  4$0P0H@~`L001 "448#8S 0 1< 0"448#80CS=0 0 001   300000000000t0000 00~@P @10 @   N2@7@Y_@-3A0@S AS S *<2@S 3/4P@O-Q,M0 `#21 2@P0 40S 00 " !",Ѝ0S2200 pH2X H X0RUH0X 0 0 00  v~ r~P000 P0\=0PPp@-P`@Tp ᣄP P @A-0PXMP- 00 0XЍA/`@p 3~1#`101"4410 0CH00UL 800(080@`, 0 0 0 03/XЍh \00@-:PL@0 R 00 C0.APAAꫪE]  0@-PQ@M 0 奶040060000 $0l00p0 200%00 %U 0 00#0(0PR,R02Cp0HLR0d00 P(05/H 0 ᶳ DЍ0耖 Z_$YHYذY]h CZ_p@-@0|0DDx0003/HsRUHH5HRQp0S  0 20C2~Rh 40SD/Q/D(00S/ """ " ]00@-8PS0/@R  "\Q0S7/.S,S :S 0S7/@-0C ^ AAQ9S0aCQ 0C70C000@A T AN^ >9QC<aA^ A7AA00 \0S?p@-@0TP T% T/@ | |p@T |  @ ^ @          R R  R @T \| P3     @      |P]V]\]ZZ_@-`P@H  `P%0, 0) " *P 00 0 | }|0 024`S 0 0B0@202HT ΙЍp`@-@HPB  _`P "@P 00CS 004`S  0 2H0C2dᣙЍp`H[</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Sp{4Pp3" p@D1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00S603P p>Ppp@8PpL2!4<01p0 " $"S $2p@ p@F8"Rp0S 0 0 8Pvpi1iii2i(#iX8i(ib] 2 @-$2@0$20 P$20$2/(2S /@-$2@ 0$2 P$20$2G-@Ṙp`(ᰀH3(20(2p02`0H02i(Z p@2S,PYpPVU u H(20C(2,2S0S,2?02HCW ;z p 3/PP  0S0S0 0"p@-@Hj,2&jPU R,U 0S,2?02(20C(2H U @2S 3/(2Sa8p 0S0S0 0"PpA-@p0P` #RH L RQH0 P0H0 00BS 0 B 00T 7@@ A@0(00(00S  x0'  $ ! "$& $ "$ (?Q00@ a0606@Ph]@-0S 0 P  P Ѝ0 $"$# &  $ "$  $"$# & x_0C-M 03P 0 SP0\t`0#DD0HcS$H0 <0004T 0@D C5 0 T 0ß ( T0 0 S0:0 3  00,P  h&0P<<00   0:00h()(0, ɏ 0(0,h30#:0# T00S FP `0#DDH$H#  3  0 0P0 0  P~0S{ `0#DDH$H  3:#:S@1T Tj & 1T (0Sh0 U00C S`0 V   0:0p1T?T  P  Gy!q1T1  T 1T1@  ,qp(0T00S 0@0000@000 0 R  K  P4Ѝ  Gd] 5݆̀x111O-0Q@00`pDM(00 0<0a0,$@ @@ @<@?000< 0a0 ,($@ @ @z? 0$0\00T0000'>a0,0( P @< f?DЍH] aZ_Y}^YgZ_A-@`pP0S 0Q  6/P Pp@-@P 0S| |0 @Pp@-@ @6@/p@-@P,03/ 0&@P@ D&!R @A000p6@/0S   6@ H0600C0/p@-@00`P 6/P 0S| |0 P@pA-P4 phM@`w540"  8`P@ 0<S6 0000 04'P/0S, `V) 0S&ʼ2 00#6X@\Dd00  006 40 0GP00 00hЍ$p@-@PT0SPPp`iT0P`P0CT0@-@P Xw 婣 p@-6@ @& @0@03/P,VP UPx00Cx0x0PS L0S 3/H03/p0Cx0bA-`pP 03/@RT30 8/`AV @x00x09A-@p@TAl+0S @ 0QU`0S꬀hP` G-\@P`p@TG00S0 $9/@ p@-PL@P0  R 80<000@0,0$0(080$0H0p 0 YYYlYYp@-@$P`r00@p@ 80/A-@`pb@TP 0S @ 3S (P0U  07@-@00;T P |P@03/0P |@ Ѝ0Yp@-@TP0T00  0T00dH0p@/ 0@-@M 00 XP |P@03/0BQ |P403/Ѝ0Y<0/@0/40/@0D0///O-餳DM0#h0P2l`12ViP@#V2!12`(#(0ϬPDЍc`VU" UP  0 3/`V Q#2!120 R0S `u 03/ P VPX\00 X P%0 S010 P5/0PX  PP5  0u0 0& &&Q9 Q7  X\  &fwuX z  0S`p}0010`V `FV`tV   ),Ph0S 0T 00`,]pZ_ 0@-@@PM@0 0(0 00@@Ѝ0 Z_Q/ 00$&/ @-@0Q   R@  Q#S #h ( X0\ 4PS 0S S//iϖoiXYL00S @-@3@03,0003// h p@-P` @0 $030|0|0l0030U600`0@9080H0 0P(05/3@03ip蘁YY h O-p0x3P@` (P 2 008/2W2 40" <40 A3h(p0 0 000 4 000 4 hr R Ra ,V/, R  20S  10S@ 10S 0,01弑帱a崡Xʀ 0! $ 0   , ! P: h墘0 0 0(0 , 0(0 , h姘 0!!0   , !, R  00S 00S K0,00@00p0he0 0 0 hp7Z_h Y_1(,100S/% @-@P T0 S/,P/0p@-P*P@` . @0S@@0@ @p0@ 00S 0 0C0 0/@-@ \ 0 0 0@- Ѝp@- 0@SP 0SP 3/P 0S pA-P`pǐ@C0 p`000@@AwA-pP`@V@D`A-@`$P lpPP+` ` `PPpM㋐P PP` 00PPP ApP(Ϫ p-UAiZ_Z_RPG-@  Q R|"pS`G #B'BS 0PS ' 0P  0S 4P+  R!  R ` 0PE 0PP `S    US PU P 0S 0S=  0S000000000S 3/p0S* 0S*  PU UP `0S $ ܪ?oW20SP  PpΏ pH0pYU !08i(p@-@P`2 {Pkps@-`@P@ "0S u  "U R `Q  `  000EP @0T00  {Ѝp@-@ 0S 0 00h0 S@- P 2S@#@ T 00^"]G-HbHHBTDrUʀ 0 ! $ 0  .!0Sa $ $  (0,0 (0, 0040 004 80<0 80< $@0D0 @0D (,H0L0 H0L 04P0T0 P0T 8S࠳ࠣo\p^ 0$0\@X`%=pP0@X@\`=0T`!C`<0@o$0@($$V@`x PYMbQ]Z_O-3SM⬠f F@@ pt Q0 H@[Ph x RL R 2/ H 2/ @ @q4y WpV RxY4YYYPYxYYYYx  Bx 8 2/P8&RPX`C &&r &R`ڰf` 5 H pH`, $2/x RhL R 2/ H 2/ 0 000 :/1(u 0 4`6/T 4@Sߍ` PPX\ 0t   &n\ X0  U Re x  Bx 8  2/P  & &#& R & &&R && & B x  B x aP| O-@0P 1DM@a3ph 6S06^6S0606T6ᬐS 5  R !uo MpDЍ08#8S06đP0SP  0S0 S1ڲ0X#pW@p 40@pAp%06S%X#06  >o,03/@,T @00@ 4/,tPJ0P0  @-@P6S@0 H0!608#86 S06%0 @ 0/ 03" /0S S/S /Su//N/0H00偩ˀG-`p @0SRP@ @P UL n0D`!P P$m@00@0pQ<@PPPˀˀO-0p#MP2`12_@0t0P D -x@@0S  9zЍ1 3/@ˀA-P@`pKP0L S0@]n|0D0@ \ QQ 0LP  En@00C@0P@Abˀˀ @-岨 0ˀ[_ˀp@-@x2dPS|"|"|2x" DD8D Dp@ vˀ, 0P/p"Rt"R/xˀp@-`P@P \@pbtR N u $ 0@Sx2| 0|2pˀˀp@-@P0 p@A-@Pp`  Y  QA-@`pP 0 PP@   0@TT 0 p@-@P  pO-@Qp00,MP 0 P 0#212E0P0`@[bm ,Ѝ褠D   PT00@0S  UT 000ᅱ  ;/0P0 R0SPˀNu/0/@-@协000@-@@|@-@ @ˀ@-Lp@-DP@z1 01  p@胑G-M0@P`` pl` lD帶0P :"!0 000000`00/Ѝ(Y   @R0S`R0'S"/@-8@0S At00Q"萼 0!< 04 0 (   !/(,G-M0@P`` pl` 'lDI0h ˑ 0$ \0000 0000`0000+/Ѝ(Y\ P/0 !8 00 (  , !/(,A-<0Pp@`L娐!0 1L嵐Ap@-P@ E0DP@Rp@qA-`0@SP &^ pPPᐐXm@ ` 0\HP@DpߐL@|04@SP P0T T`PˀpY4YPYˀ@-@\fP0PST T T0P LYDVH@X1ˀ0M00Ѝ/O-M8p ` @kh``!0S T!SC L!SB D!S0 0,!P w: 0x00 00 000 0@hPQ.oPQ0 S S S S iP @ppiPA00Ѝ0000@TY$YYY(]p@-\0P@Js˟`-<PP H0 'p萼p@-HP]pe(UP@ pp@-P@U !&P(/P`P %0P &DHP(4` %0S00p@[_@-H@0S <0m @T@ P@ˀpYˀA-P㜴|@㎵T %@p'`PTP` @@@O-,1 ARF@0@Sp `a P0S0 ʴ@pmpE0S ݌%a~'堌PԌp ,% a0P Y[_C-M 0P`` @WjPp0@ 00  00P 0 0@-?o2P0SЍO-@Pp  0 400 ,p$@ ` @0T00L00 ,p($@ ` @400 0<Ѝ%[_YF^pZX_YX_0 @R/p@-P!A` ! 0RpC-aMPp'@AႳ0p  0` i0 0000P@``000*g,PЍ|Z- 0S0!Q\ ^010 BS   " D0 S 0 / \P:/p@-|0P@`T   L@PHp h00 000P`0@DL[_0 0R  0S/0 R/  0Q/-   QO-` @ 0 QP0N \ : 0P PUP @@0S 0#0JPPPU @X0 0 0 S(PA 0 0 SP )P  pW 0R  Z 1P PpYp@- 0 BRPNP0@ ` T0Q@:T:@ #pQ p R\:p0-S>"0000( $ #0 0A-@P`p- 00  Q:00 ^ Q0SA P L `0S: 0  000 @ ``A@G-r@`0T@PRz T @(@ЍU Ef D|f0Y`* sR `FV T`T Bg` 0 ` @  ;nP@0P @  0 0{g Gf  0 e@Q`P o U0* PR l  R`FCo0CP 00 0 TPÐʂDh[_L]p@-@Q`P 0 h0P @puPTp0SpPO-P0M`Q@0  IpP ` @Ѝp0 0@S 0/ Q V Q P  P PXX7@   P QPP0 0000@ 0V `0 0 000 00pS/PUP0S$0S# RP0S000  P0SP0S 0SQPPUV~ 0 S{ p0 S00R0SpPUmf0S0 0 PlV V 00 0PO P ;Pp[_A-P@s`P p @  BlPTN  lP@ 0  R?Q 0S  ? T9 R6 R@ 00PSh T0\`P R00#0 P0 QPP(0P,0P 00 0#00#0@T@Q   BR  \R\QМ 0 ~Sd!0 S<廜 0S0S0 0 S0Q00 R Q࠳ RSR 嗜0Q `U P0P0 RPPQ AQ   0[_$\_D\_[_0A-`pP0S s@PT 0 P 0 @6/P A-`p@0S SP@U 0 @ 0 P6/P <00S/p@-P@ ݂0P@  pDA-@`pp e( `0PX 0 0`0d0(0 0 0P0000 0D ZZZ Z0S p@-@Pp*0P 0p@/pp@-Q0S   Q S Pp P@ڜ$XP0   d 000P:hP`P` @TpP@ 0 00RDM\_dg\_Po\_y\_A-Pp`@!) PP000q10S0@@`p@-P@0`S   00(P0S ^p@|1/1M/ fG-`P 0@T UF 0 WP<0G!0R"1S RP  jP P  jP 0SU P 3/P @F pP 0 P GG@/0 Ad0  000 0P0c0010P  )  >00J@P  _08 ` 00@S0400Ѝ̀`]Z\_]]^PtZh/A-P`p@T0S  0 0S   0R0 0 8Y03/ 0S0C0p\_/A-Pp`@T?@P7 0R@S   0R 0 0  0S0C0p录( {_PN,`p0S 0 @ P 00@ @ 000p']_WU R/80 R\P/40//p@-P@PPp Ppp@-0PS`  Q@@ pP pp@-`Vp@PPp 0P C pA-@pP`P P U00P AP U000 ,Zp@-@P PP pO-p\MP P@T@QPUN$QiPlP RU` @P`L[UV H0S (PH`(04 R0 040L0(0S  3/Y P PU  0P@0P@ 09,PP`3@ T @P `@D 0\Ѝq`P7@x@P `3  'D0S0S) P  @P P@Vn Dj@Pc `D40p@P[ V PZX V YU PQ[ (0S  3/H`DO-M@b0 0(0 p005#212<0P0P`,0.T T T P `,`V0P0v,Pw`P00k3W  @@ P  @P 40LP040,0 #P,00,0(0S  3/#Z(10(1 @8WSc0  ]E0 82<"嬀XW 0 Z P`p0S   0R 0 0  0S0C0ᕓ᫉8WY@P F]0W60040 @   P P  0 00S D7=Y   PWL`<0S0P0$QAP 0!P0P 0 H0弐S U1  P . ID?0S !0"0#!"2 Ѝ(pW  7/0S ,pZ @8WP`   W  @@ P Z4 8V0T2 Tp Tp '`J]_\_̀O-`TMPxpPt %30#P00S @PAɖ[% @ 0 @PU0L0S P | R [ R|0[DTH 0 0 0 @P 0S 0S40@A  }4 6\0P DP $`(Hp03Q4PP@P P4 4 t@@3d "$  "$4 \ 0  $`(8m TЍ`@-@Pp`pP;8PU 0S80<000@00C@0PmU 00, 0p `Ѝ|H(p@-@$'$' %(@%(&)#&#&phPl`0 %PU`P`pO-P000`0 Ep@V V00 IQ   RpBpp pS GX[ 0 X 0@ Y/oU" R 0S! 00S 00S QP -v)v@0`0V7@ ЍS00@00S@0 0S @-^9/ 0S @-Y9/0"SJPp@-@A P=PP P *p0 S . \4, R: pP) 0C~\0C00 (Q $uP$ uP$(  R(  $PXp0S*Vp*/Tp7pA-0@S`@M4 0@Ѝ4  W0000000H00S 00 00$0H030,000 0 P0S PU 0S400@00'$'$(%(%)&&#&#%"p圀0 |$phplH0@2@@0 0@ 0GP0 @000"SQ@- 0@SPM(0S2 0SF 0 R> 0S 324 (`0V0R0S (0yS. x0x$Px 0B~S$(x00Q:xx0xp`V Ѝ@T x]P T@@D@@P*/-/-/ 0!< 04 0 (   !/(,A-p 0P0`@ H00000#   20 000 1P0 0S +P7&  5W@0 0400'$'$(%(%)&&#&#%"pP0 #pPhplP0 0Ѝ0" O-H_M1 0$0(0!#212P7@_ߍ0`S`P 0<<嫎(PwUp@PPpPXP $P W }0@700SU hx 0xWPPp7@PP0 0Sp+@Pp34 1`0L0@V x0 L@LQppRpWT0 @|P 0\L 0PR AoXQ Qa0R0t0P0S 0$ST0S 0$S0 ( 00P0㏄PkX0S P0QX@P ?V KUX00CSHQZ0RZ SZ SZUZUZUZ SZT0S  L@R$ R $ 0S,0,P,0@0&@T @)P0 R0 ( @P ( (1T0LS  R   00&0@00( @P(0$P000T00X0c p$ 0h@P pP0P0@@000$ L$0_@P0S P$@ [PX0S0S;@0SX Sr Sj 0?0::S $0PP $0PH  R R |!$! ;/O Hr450", 00 X F6 $ 0LTPw EKP0P0<@K@$0P000T00X0 p 0$L@P* P0Po $L@P $0\ XX\ (, /  X\ {-@ @UpW01X V 000 ^W"010 (0S`AUpXp p @p@@x]S^H\ P/0 !8 0 0 (  , !/(,O-QM` 0@tЍO\P^Mp00P q00000l00p0 00t00cx00|0lPUUU*p0S  % 0S l ER07[@P@0St x00 R: |  BR 3  ЍDP0S U l YP l\P&Y4004 0Sp4#212T40,0,@T <00~ODT 5p0S "Sn20000Si DSg D& 0 0 0(00l0P'|0堰S= [: x0S7U U UMX PV D (0 l;/ &[ N[0SD_2 030(!0 0 |'P|0 |凍0"4 4Z DJZ"ᡍ0000wD1@0@@T ~OD{  P  (0 l:/ R  QX X$0$0q0U000008800 l0ZP$|0S! 0S x R " ,  4   R㸰 R԰8 |嶋P|08 0|0X$ [$0 1hqP  0 l3/yUH < 000E(P00  U  ERp帰1GS  0! R``B``0Q  F 0Pp W(0S0P0 Ѝ@]]_]A-P@`pM4 Q  Q2 0!0 qЍA-@PP`@pD0W H0L P0 H0L /A0 `0<0SP@0P8P000000 0/p@-@0@P6M00 600P :`d  $1(Ѝp@Vp@-x P 0MS`  0S0 0 0 @T  @  0P 0Ѝp-l 0/O-M`p8PPM 405S0(@ K40 S;000050< 0%LZ0<0 v  L L L000\@0rp0 0 00  00  wp 0 ЍL@-`0'P0! @0 0kP 0$1 03/@T0@ 0 8ЍOKLO_x]__O_O-M( 0xP0`PUH ⶐPH \L3m`0d 0 `0d >mb0@P 3!  Hc $H00  [ m004 0 004 m pW$pWH_d+0$ 0T; P0 4;((PU&[2 Pm 50R4 zl@0D 0 @0D l pa5 0 p U \սpPEU Q Q ,,PU RP\⵽Up' \ pP!0"0 0[ DK[WYlX0\ 0 X0\ l  R[ H 4 45 `NP\Ytlh0l 0 h0l l p,p0 ~P00 0SkYlP0T 0 P0T dl$0S KlH0L 0 H0L VlU| 0 S Sv$0Ss00 o 0l PP Ud  NP^40"p P mP 8 U`  0 0㠵`0  `80;~ 000 0 S4kp0t 0 p0t Ƞ̐ 0    `80~p PZ06 X0`S80ʼ$ R] )4 8#80 0S$ 0R2  0PP0#$1 0P5/P Y U060S S+Uk(0, 0 (0, k0  PP  5 [MP 0 060 fkx | x |qk5L0S  p p0}@  R Ik   Tk4P0S p` @0 000t`0k},k   7k,4H0S  p 0p T}5  F6 & Z& ZIF Y  0 @  #~00P 0 S S R 000h  }0S4pPp =} @$04/p}@W  }0W V h}`   ~p 0ZV  h}  }` }Ѝh̀p@-P`PUp|@@8} @޽ Ds0LP0p ̀a_a_p@-@0@TpP P` p hO-$P2M@0p@ 0sB!>540@P圲H0 0X0|T @Dd0P0< d(`P)P00`Vk 0S 0 X/ Rh  ,N}| @$04/l|Z@?  ,T}00` 0 X S R 000h,  )}0SDT n| @$04/A|@Y  ,)}0Y U h }P ,9} 0ZU  h} ,)}P<|U 0t`h@S Y  $09/ |Ѝ | h̀O-$M pp@P0 ``P 0倐hS [  $0;/@ |$Ѝ | @ ᦨ@̀O- qdVQʀ !  , !p06_@p mA00  0唀0 0$ he| R *$@ !1d000  ! Ѝ(,̀G-P`pU U7 $1p^@ ^0UP d0' U+  |A xA$0h(P 0(0$0 000| 0< T`00`040<0  000  0h̀0SlO-0pS4McPP`P@" P |10SW T 0 0S0U0S `` 0 oP $1h {Oz000`V* 0S# 0 S S R0h  { 0S  0R z 0 $0;/zL0  {00` z k4Ѝ/f]̀A-d0Pq@M0H 0S S6d1pX1p(@< EU`J< Z@00< <0-@PᬁPĀPzᨁh{]p]@Ѝ`0< 0C`00(<0S `U0P@S  0 h@&zi{̀hp@-HQDP@`L@T403L0$mq@P 偻p̀̀̀p@-$@@P60DL0*rp@ò0L03@o/̀0 0 0 /@-@ ]O-p 0M !P``  @@P0 0\ ae0 000000@P?o2P0SЍZO-,`tWʀ 0! $!0     !KdPȐ@T 00C0 00 0S003/ k@d 0!< t00 (   !(,|O-dM0!P`@ u ]p1!p0p@0c00@YP Qw 0  p Oh 0 xdd 0`pl!H1 0 0,p($  `<0P 0 vdЍ 0!<0$   @,(pPP 0!0$ 0<0  @,(pP 0!`0@0X0,(p0$ @ 80< P a_]Z]^(Za_]b_+b_DZX_A-Pp`~c@0S 0 0 0 AcEiP 0@p 00S 0 0R000@-2jop@-`$P @P@p2b_p@-@P@D0Ppp@-P`@PU`U00*U-xZxZxZlZZxZxZZ̯ZxZxZxZZԯZxZxZZxZZxZZxZxZZxZxZ ZxZTPp@DT@DTTp%@DT@D@DT @D@DT @D'Tp@-@`P@T`T0-*T*ꐰZZZZZZZZܰZZZZZZZZPEUZZZZZZZZZZZZZZZ PEUPppp@-P`@LPU`U0 *UꀱZZıZرZZDZZhZZZZ(ZZZZ8ZLZ`Z@D TPpT Tp+T@DTTT*T!@DT%TTT@ T@D&@DT,@DT @D@DT#Tp@-@P@TP T0*Pppp@-@P@TPT0*T`Z`Z`ZpZpZ`Z`Z`Z`Z`ZLZLZ`Z`Z`Z`Z`Z`Z`Z00CSPpp 0O-@plPDM(00 0<00,p$@ @@ @`?00<0 @,(p$@ @@ @0P0 0H0000,0(p$@@ @`< DЍ:b_sb_Ab_E_@-@oP 0 /@- Mj@ |Gj tpBj hd=j \ X8j PL3j @@.j蘮Zw_pȮZ^Z_Z_Z_вZ_Z_@-8@?j=j;j 9j7j5j@2jpP@- P0@ P@ ` \ XX xJ@P HrЍ00J@P r`Z_b_Ab_yb_pb_p@-@0P P 0T@@@ppb_G-P0M`0 0` @p<0 P 00 0 0 p@q?o2P0S 0 S$  Q0Ѝ 0O-DM(0 0P`! 2 ,`0800P$  @680 <00!1 0<0 (`,P$  " 0'!0tqt< (`0 0 ,P$  p  0!80 (`,P$  p0 00!08 00 (`0 0,P$ '(` `08! 0 ,P $  p` 0 ,00 ! 0 0P($ DЍ:b_d_*c_̶Zb_E_@- R0R0 <*R9Z Z Z Z ZZ Z ZZ ZZxZZ Z Z Z Z Z Z ZZ\ \ 00SP \ \P00S0 80Q,00S L\00S R0 Rp@-0@P&* R#lZZԻZԻZZԻZԻZԻZԻZZႄP@D T00SpT -P X0P0 SpSp$00S000SB B  B0 / 0 0CS@00Q400S/00S 00S꠲ R0 R0* RZ,ZZZ,Z,Z,Z,Z,ZZ,ZZ000S/00S//$0000S//@B  B0 /00CS(00S/00S/ 0 /@- tthp@ lhg `\g T Pg HDg 88gZ^Z_lZ_Z_Z_8Z_@-0@gg ggg@gP@- P0@ P@ dd d0 0X 6H@P HpЍ0gH@P pZc_b_6c_oc_@-B B0 \ 0< 00S @ifP XX0lHP0SЍ$00S SfP@2b__b_ 0O-`Pp@DM(028 0p0 0`,P$  80<<042 0p0 ,`(P$  '~ 0쑟d_@- 0/GP Ѝb_c_C-MP00`0p0 0` @)90 P 00 000 0@?o2P0S 0 Q R00 ЍP C-MP00`0p0 0` @80 P 00 000 0@?o2P0S 0 Q R 00 ЍP A- BM0 &00S Q Q QPሀV a`CdV @cTzPAcTЍQcU* 0@-M @aP  0nFP  lP0S 0S cPЍ0c0P0S/2b__b_@- $$Ze @ TeZ^Z_@-@ oe@le 0O-Pp'nDM⌑匁!1<< ( 0,P 0$  p`@ 0 !4!< 0(  ,P$  0 ! < 0(  ,P$ 0!    , 0   0P,($  0!H0 0  04P0,($  DЍZxd_d_d__ 0O-@plPDM(00 0<00,p$@ @@ @`m00<0 @,(p$@ @@ @^P0 0H0000,0(p$@@ @`< LDЍ:b_d_d_E_0P@- S@P0BE@P <]m 44 $00D@PЍe_d_d_d_///0S/!  @-@S00A-@`PpW0PV0SASW0  s " S0  " \ R0@-#10lS0! @. TBo0PP P. /0S/p@-0@S`P `UFUp 6 600#00p@ 6 600#00~PE0@-P@M @Pq6 Zm6Z ZnZ ZT  =P& ZX6Z ZYZ ZSZ Z <P  Z=6Z ZlP@ߍ0& ZbP  Z.Zz Zz\ <P Z6Zk ZGP & ZAP Z] Z ZW ZW <P Z5ZH Z$P Z@ Z@ x<P Z5Z0 ZZ* ZPZ" Z" u<P Z5Z ZP & ZP|  ZPvZ Z R<Pj Z5Z ZP_ & ZPY Z ZPQ Z Z -<PE Zw5Z Z <P5 Zh5Z ZiZ Zd <P  ZS5Z ZP & Z|P  Z ;P Z85Z ZZ Z ;P Z#5Zv ZvZp ZZj Zj @;@P@L]\]l]|]]]]]]]]] ] P0C /-P, 0C C-Q`@PLM 0 6/|0 p10 0耟萟2pC0DPUQ 0#LЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@  6/  00\H0 00A00A 6/hh_E]S^P/Q //  00 0  0 00 0  $0 (00, 00  40 80<0/@-@Q@P @ i4C-@`TPDM Pp 0PES DЍ@pQ@P @U:0O-0P`@<4U 0 k K3{|9p Qp0* ZU0D0` ЍKP 80S   ZU@DDAD@P Ua`@K{U@DDAD@C-\MpT@T @DT00\Ѝ``NPP@|QP000//o/00//p@-@M P@`@,Q@T@T*@Ѝp@WQ@-@M@@`PpfP(00 0 Ѝ@-T 000ЍG-@XMp@@pPC`@@@DT00 P@ QPPU @T*XЍ@-PЍC-\MPP@gက TQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*100X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q*100<0T O-P\M`P`pሐT@T   X01H0P"P PQ Q\ЍYT D PP0CC10S @ 0 P 1P T*10@0Y O-`\Mp`pP>T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1P T*10@0<0U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM``Ph@00P`XЍp 00 00 0iPEU 0 R/R 0]0R/@-0CA @R A@BT R LP^- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@?1 P//8@-@P--8R0* \ A/Q :@/Q* @-000 0@0  2 /UUUU3333 @-_-/ 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00'- B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S @-.o @-@oQPO-(p@@@, P`T @H,`VPW:/@P WRQp@-@@P@T@ P`Q@%,PPPpQPp@-``` P@,@T`PpQPA-`` p@P,W PU`@@@-0 0(0000 0P 0@Ѝ|Z@-0 0(0000 0P 0@ЍZ@-$0000 0vP Ѝ|ZO-`pP+  M@P W  / /W M@Q/R H /0 BR 0#01,# P`3V P0!"BP"aPU0&"R  0 0#01R,#  `F,,A ,|,Ġ .̌. !!!Ƞ ̌ A!|̌ ! . .,,,A ,|,Ġ .̌. !!!Ƞ ̌ A!|̌ ! . .,,,A ,|,Ġ . ̌. !!!|A!Ƞ!@$ ̌ @$@$ @$$$|̌ $D@ .L . ...@.|.LA!!,Q0 0####40<1.0#,I@-7<]0A-@R@P `?Rp. R% *R/ P) O[R ^RP`` P\6 ]\F R -\> Q[R: ]^8 R  ^ 3PP0ЍP 00 Rp 0Q  P P P p`0SWp @/o"R0p@- "!A0 @P#.. "P!Q! Q Q "&" p`04`@D8<#<# "TE!1!1("$"[@-@8  .Ѝ@-@P $ .@ (- 0"@^O-@p0$M(`00 00P0$00P2 0@00 -00pc(#"$c$"0 0 0 05e3#<# 0 00# 0 *   "6f1#f;#0W 0Upi.ɠ,  .@P (, Šb,,. p  &  p'c!c!"000` 0` 0 00 0 0 P0P00$ЍPP`tP`P0 `^A-pP@, $`Qn ?PU(7  08R(#)8 b, `<-`4`0pPDa(!"$a$"  +-0Vh ,Ѝ@R )@ b,8 8 ,0(0G-PR: p@q?p` @g(U': , 0$ 0 @PE 0$ (P`p(4?XG?0%#?R%U  (Q,"P0 P$0, 0$ Q0 0$  0$ @H< 0$ @ ,  0$ @H< 0$ ?XG T@-@P $,@ (D, 0"`^ @@-@P @ (, P0, 0$$^0O-P dM@0000tv$0 08<00 $00(00800<0 00(00,0 000004040H0,00@0 X],y ,0,Ǡ Ɍ +W i+Y P,ɠ,0 nj0 ,P&`00 kd,40. 0p0 0#0  "#.0 "#000#?,1 "0 <3 " 0$#0(#00$(P 000#08 , < .!4 ğ ",pğn  # " Tğ$ 0!0# 08ğc> .!  ğ0 ",lȁ # "< $ 0!0#0c>,. ", lȁ # .,x# 0 ! " `3b.00,!D30 0.0# ,3lȁ00" 0#04  " b- *a) ȁ0 00#05 ( |b- (0\a(  <ȁ (0(5 ( b- ppp' pappp' 0 : "R?0V FA"E@P7@-@P * !? 7R8 bx b8   X  Ѝ0@!!^0`( a!"$,a c"/G-P`8 p#T0.@``T%0  ) Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T-M Ѝp@-@ P` !LN) !@ApA-PP@#*`ypP @  X@P ዒ0@L0X D0XV@yCPxUPT@yaratcidA-0p3@u 0P 0PV@PP @ R0*.` 0] @P` Y@P0HBЍyaratcid@-MP@@@`@pT:Ѝ Pp0P00 I\k_|k_$0 ~yara0 |-0 utcid0 |-Ql/yara00|-Qa/tcid00|- / /p@-@P 0PPptcidp@-@P 0Pypploob@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@z@@-@t@ @-@n@@-@h@+@-@b@&@-@\@!@-@V@@-@P@p@-@JPb (0P pP pgntsp@-@`7PO <0P pP T patadA-p P8 X0P P`@P  PP@gntsp@-@RP )P pp@-@P p@p@-@PD  p@???p@-@P6  p@000p@-@P  p@p@-@P p@p@-@P p@p@-@P p@"P0/!^X^@-ZZ@@P^DࠓࠃTPP= P P; P^P2 P P^*:'P0P0 P0P0P@^00P@ :^0:``0SP $0 S 57$00$0/@-(0$ @ BR00C#$0$0,0(0@-@$ P *  LUP$00$0Ѝ  p@-PQp, @Rp$0( 0CQp$ >!Pp00@-S@ @$0,,0<000G-@P8MeY@ , r`0a0000P SL SL S40 0 YPVpP@`VQ FVe `:V =V *V # i@ Q l ` R$0R0500# 3 C5 R$0R0500 3: R $0R0500 3 C5T$@8Ѝ|3x3 S R 0C3 }0   Q \@0S0@T > @ 0  0 SbV. fV ?R0@SfVQ p b7rp B@S8q8  C# c,1 s0 09FV/P0  0Sg 0?Sp Rm  P  c5S CP2QP 0  PU G  0  Y=  0 P-00=0F?ofU20S1:0F?oFU20S* Q& SR=V 0  Q  U 0S Y  0 P  Pj R$0R*00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` K]Pp-@-@`P ?]P@ Ѝ/p@-@P E2]Pp-@-@`P &]P@ Ѝ/A-@`Pp ]P-@-@`P ]P@ Ѝ/00/-0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-0KM0 00000 00$00(0 0,0$000(040,08000<040@080D0<0H0@0L0D0P0H0T0L0X0P0\0T0`0X0d0\0h0`0l0d0p0h0t0l0x0p0|0t00x00|00000000000000000000000000000000000000;08 <T`* X40" @0)p" DP" H@"$ L"( P",  "0` `&\ 0#` .d (h p'l P%p @$t ,x !| " `& 0# . ( p' P% @$ ,࠰ !र "ਰ `&ର 0#ర0 .ര (ะ p'༰ P% @$İ ,Ȱ !̰ "а `&ᨿ 0ሰ᧿+0#0 0+ 10儐ᥟ 0#$10兠᤯0* 00)ᬟ p'0墟0 /P% /0?ጠᡯ,! 0 @$ (# 00#`/ቐ?0\0  +0`0#!>\0D0` (H00'c"##=0d 0h #00#"%#;00 (00''800 %00$*5D0$0H8%(00$.)" #2d040h  +00#"#>20 0  #00#960L0 %P00$4;1 00#  "#1,"? 10,0`!0,'#)!7&9mbቝ刐``+40 .ছ᎔̐`%&$.Đ`,`!.&t刐P%x@$\ClP`(pP妚P'ZUQP `( P&P'%Q_QP`+P%|` Y+W,` *`!੬ᆣlca`<(`p'anqሎTp,Xp!z,v ʠ! ,@ ,*ʠ ƌ) D H1 00)0 0,04D0H0 10)010, 04 1 $1D00)$0H00,(0 0 $140 0#,00,00\0d "`04 h 00#80\ 00 `0#<0 0)@00\ "0D ` 00#H0d0 "h0L 00#P0d0h0p0!T00'X00  "0\ 00#`00  "0d 00#h00`0 &l 0 0#p00@ 00#t00 0$x0 0` 0)|00& 00`0 0 0&000.00 00 " 0#00  00 " 0#0 0 00 " 0#0 00 `0 0)000&000!!0#010+00 0  0#010"0 1 1p0!0(010'01`1!0!0&000.00!`!0#010&000$ ! 0# "  ) *1Ss000 000 00$00(00,0 000$040(080,0<000@040D080H0<0L0@0P0D0T0H0X0L0\0P0`0T0d0X0h0\0l0`0p0d0t0h0x0l0|0p00t00x00|0000000000000000000000000000000000000KߍP"^#^-@-(00SP ЍЍ/`ف@-@ / ?!BC#! @p@-P(C@P 0P0 0p#^007@-@0Ph\000S@H<呔T 0P oWE Ѝ0A-P`0pS ^:@P ` pt+lT` PbE<-E@ V8-dE[@- @  0#^P 0R @-,0QPso//X^ 0SH^p@-P8@ P {P p@2ph_PA-pL@P `ˉPPj@P `-@- p$0 0N@P Ѝ@Ѝ/`᫉PP  $00N VS^@-@@ Ip@-@P@p X0R0% PP  0Q p@)#^X^p@-@P L0R fPP (0Q p@p#^X^P/ 0R /#^P/ ,0R0/0P//#^X^\ ?o@-L2^0S0  Q 0QU0 /#^X^P/ 0R/#^p@-@PPp 40R PP 0Q.#^X^P/ 0R0P//#^X^A-@PЍPo0 RQ R0 ` 0`ЈpP  D0R S0 ( M `pP ڈ#^X^/^A-@PЍ |0R0 p 0Pᢈ`P 08 S0p( M P`P #^X^/^0P -?o42 ^0S0 S/#^P/ 00R@- 0Po/#^X^P ?oH 2\0S 0S0QP/#^X^fP 0R0P/#^X^f@-$0pSM Y`PV `0P !@P 00 0P S .Ѝ  `P  h_ 0P/-P-P>P/00//p@-P0@Q Pp0< 0 Ppp@-P@AQpPpp@-@P` 0S <P P p@> P`pp@-P<@P /P P >P p@ pp@-@P` 0S<P P /P >P p@  P`pA-@l`lplPAQ<Q >Q &Q |P]h_h_h_@-8@lP $tP @ JL#^h_@-@P@<i_p@-"@P  PP03@p,0 0*A-`Q@Pp pᬂ  0@0S83 /S>PEU0S0(0 H P 0B0S>300>R/R )0EV0 S 3P0/S0$0(0S0$00>SP0 >R    0P(PR R H L R0->"   0L0S>300=\00SB0"S0S   0"P  C  >R0\}Pz\w<Pu0Sq !Sq0-Sl0E?o 2-R0SdXPT]0@- PP0<P8 &P @aT@mT!@pT2@;T/Q ^**lT'tP";P<tP;P>pToPsP ;P'SU00gT qTuPoPtP;P"Q@- So/@-IM@pP`V P0P P Iߍ 0 P  PP 0P5/0 p3/P0 0 p0 P ` 0 0P0 5/P 00#^G-@,㠅PP8 p䀟䐟@@ 0B0S 23 ᫅P&@<R` P   P0>SSS P@@hP @@ i_i_i_{D@-IM  @00S 3/P0`JP V 6/0  0PIߍ0 03/V@ 6/T $T Tp 00P00S 3/`0@P T 4/003/003/P T 4/ pp@-P^@P PP@p$0SP 0` P P PP  `P|Pi__P0/A-PJM {U0`0p 0 `` Q-0 @0  4/@P T p0  |P$ 00 0 0RPU00@0@  ePJߍ0 000 003/ 0/0/@-@@菄 RC/A 0\R#R! R/P 0 0#/-0 S RS R RP/$0S @-[4@/-][j@-@! (M P P  AI@]P(ЍHP  mt^=i_5i_p@- @P}?p@- @   D$^ 00 S 0\: P03#/S 0\ P0///p@-P0S 3廍] @P ` =@P tT复LF PP I4܍0>@p @-][T$^@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@T$^ /P/ 0R% 0  0\:R* R0:/-\: P*0  S0 :/@/ //@ T$^P 0R//T$^P 0R//T$^ P P0P 00  S *0/  \ ://T$^ P P0P 00   S *0/ɓ \ ://T$^0P \ P  !R0 * /-!0 ^0# %/T$^0P \ P  !R0 * /-!0 ^0# %/T$^P/ 00R!  S //T$^} P H0P 00   S *0/ S ://T$^ P H0P 00  S *0/S ://T$^0P 4 P  !\0# %//T$^0P 4 P  !\0# %//T$^ P D0P  0 ! /0S/0/T$^0P -?o42 ^0S0 S/T$^P/@\   JQ\//T$^P/D\  Q/S/Q\//T$^0@-@MP 0S"$ R0-S 00 0S0xSU 0000 ,0P Ѝ0 5i_Ao/0 P R   //p@-`P ᑁPP@pPH:@P <0 P`000U ᔁ$^娋$0S @-1@\-,h[@- @ K  $^G-`p@PUT` 0` 熁PT`PE¥P@-@@p@-P@@ᷲvPpp@-P8@NP P p@`ph_0,S<S<@-@f 0 0C0s@-@P 0U S tl;Ѝp1PP`P 0 0P 0 0C0iPPPA-p `PṀ@P V  !V @p ȀC-@p M`P ᵀ 90P0Ѝ0  PP (0Sᡀ0  P (0S$PU00  0P 0 LPYP  SP 0 PP 3^Ki_du[p@-PP `X0 RV@۱ @P@V&p@$^p@-PP T0R,@P 8000000P00 0p@$^i[ o[O-`@᧱0SOhz\>P@ P pP 00 0EPP p 00C 0 0S.7@Va0 S 00RP zP P ]P P 0  03/P P P3^$^Ki_p@-P@P: 0 0 0p@臱G-@P 0R@ #PP`q@ 冡q1  0q 0` 00V:000$^0P 00R@-0P   0/$^p@-@P000p@8p@-@P ,0R@Pװ@)p$^p@-@P L0R@P`İ0S@#*f@p$^p@-@Pᱰ@pA-@P x0RyPᜰp0S `VP 06`P p$^p@-@P @0R@ P`x @ưp$^ P /o00"\ R00\t/$^O-@P p2 R0 K bPP @MpL`- 0S .啈7PP :͈0Q>`P9/忈 P,U <U U` b Ѝ7P` `~ 8P^,PP 喈V>P午U `[P  PZJ! 0P 0p00000000 @! 0 0Q 0 1 p`$^-,h[$^G- `@VP )~V 00p 8P 0 GL0P -?o<2 ^0S00 S/$^@-@P) 0R%P`d0 xP  0   C!: 00C0000TRᘯ Ѝ$^0P/?o( 2\0S/00 S/$^0P -?o42 ^0S0 S /$^P/ 0R/$^0P -?o42 ^0S0 S/$^PG-@6 @`TPp P*  0 S @42 ڮ S 000 01 0 01 $0 0P@ @p@-P@P P9} @p0 03/P P P@0S /A-pP`_@P $Q@|0P@ A?3^p@-P(26@P 0P0 0p%^P 0RR @-(o//@-@0P |7 0SpG-P`@PR  pHWW(G( 0"! 0 Pa#<`P%c?P6  P0 ` P* P P$ pGP匀W%1 ``P R0P&RP xP Wa<``= nP =iP`^%^O-`p P@Q A R;" <Q` =Qb H P Y }[8}[p}[}[V U*@V0 W @ " PV0 W @ ! PV U*0@PY+0 <S@D%0@<SS CR=S 1"0S 0CS230Y@ R Y ʈ(0PS@ %^A-pPPU@ {`PV@  ` PPQp@-@@ P`{@P`p  `P@ PT{PQPp@-@PP@PP @p@-@P D0R@00S  @P000%^P/ 0R /%^P/ 0R/%^\ ?o@-H 2^0S0 RRQ M 0 /%^p@-PP @0R  P@ ){@P 5 p@%^0P -?o42 ^0S0 S/%^P/@-@@T ?o 2^0SZo%^@-$PMU3`P@& 00!P( 0S%    00 RzPP  00 0 xP z 0mPЍ 0R XP @TzPp@PP pU z@]*^`^/P/?o4 2\0S0SP//p%^p@-P00S $* @U @p-[p@-,@,Pz0 0upp%^ 0Q*i_/i_@-@P 0R@p%^P/ 0R/p%^0P -?o42 ^0S0 S/p%^0S$0S @-0@  #/*i_00C0/0 P R   //A-`P yPP@PPE3@P Dpp|0 P`000U y%^@-@ë@PG-@" @`TPp P* Y V0 SS 000 0! 0 0!@$0  @ @⏫⍫@p@-P@@.P~ps@-P@ T R y`4ЍpADAP`@ 0 0)P 00C0@@@A-p `Pby@P V  !kV @p qy@-@p`P 9P00 Ѝ0H  ?P (0S @0 @P $i_[p@-PP T0Ry@P 8000000P00 0p@%^<[0[A-P`@ᘪ0SAk/PPܪ P pP 00 0 PP c 00C 0 0SL*P0 03/PPO P P$i_0 /p@-P0@Q S0 Q000p<Ppp@-P@P1 0 0 0p@~A-@P x0R@ pPP` h@ 0 0`0V:000%^@-P000p@-@P ,0R@P@@p%^p@-@P ,0R@Pܩ@.p%^p@-@P L0R@P`ɩ0S@#*@p%^p@-@Pᶩ@pp@-@P㩩000p@p@-@Pᜩ@@@pp@-@P @0R@ P`㈩0S 0@A֩p%^A-@P P0 R@p`p0@0S@ḩ 0h 0Q000c@%^p@-@P <0R@ P`F@ᕩp%^A-P@U `pP<:005 A: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/ R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/A-@pP`P >jPp` P102 P @-@\& P QRS  T000jLQ R S "  T Ž 00 A-PQ@p`S V @P@V!R)SP V @0C @h@OoV0@d05D?ooL\0ࠑlRV@@@PS=0B V00 W gpo0g0CpG5S?ooL| !0, Sࠑ+@ c0 5̠@  P\O_ 0SPV@ /o?o BR0  c45#̀Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /~-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/@-F/i_A- % M222_`z[&l_ux=)y@1N=$O@ekppoOߩ>b|`a1L3aQ{p4Sn@˨)oc0d+?밓f{l4>< q3Q% 30S#* :3#Q% 53#Q% 5Q0*c/Dryx$Nψ>h6oXzo-0  )08S(,o V?롹ZU,& 3R @00@0U p2pfP׳'l>@gqᩏAhj 1|0\"  000Y@P8Q4q\} qnl4kR YBr\P[ |,0 000rs0sq!( A0( ?A3c01|pWq@TLq@U | 01 @$10d1k^ P '.a 0aq0AD 0U^P0q00$(xjq!\땲0吀XHqx0@tt<쫁8 N'_MP _Rˁ_-]^O6_F_WN_v0 MbS@ 0A @ 0H @ P `@ p @ p@ @ zssp_initzssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846>@>@>@?@?@4?@L?@d?@ioexp_set_backlight ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_D[[ m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    lA`d@f__@`@b@db@b@~Rc@8S d@~Rlsllsrasrror g0^k0^o0^X^y0^X^0^X^@0^0^P0^0^`0^X^_M0^0^P 0^0^0^^@ 0^0^P 0^0^0^0^ 0^0^0^0^ 0^0^0^0^0^0^0^0^0^0^0^0^0^0^pP0^0^0^1^p1^1^pP 1^0^(^>R^(^>R^p 1^1^p 01^1^p ` 1^1^p p&1^1^P ^1^P ,1^1^P @01^1^P P51^1^- ^0^:1^0^ >1^B1^G1^B1^>1^K1^G1^K1^ x5^x5^ P1^x5^S1^m0^W1^m0^`1^m0^0 d1^h^00j1^h^00p1^h^00w1^h^~1^h^1^h^1^h^1^h^1^h^1^h^ 1^X^ 1^X^ 1^X^ 1^X^ 1^X^ 1^1^1^0^1^m0^ 1^1^ 1^1^/1^0^o1^H1^0/0^0^p 1^Z5^1^1^@1^1^1^1^@1^1^1^U_^1^U_^1^U_^2^U_^ 2^2^2^2^2^2^$2^2^ H^+2^ J3^+2^ @3^+2^ `1^+2^ ^+2^ 02^+2^ 42^+2^ 82^+2^ 3^<2^ 0@2^<2^ P^<2^ pD2^<2^ @3^+2^ H2^L2^ ?^+2^ P2^L2^r^T2^ Y2^]2^c2^i2^o2^i2^u2^i2^{2^i2^2^2^2^2^ 2^2^02^2^@2^2^P2^2^`2^2^p2^2^2^2^2^2^2^2^2^2^2^2^2^2^2^2^2^2^ 2^2^02^2^@2^2^Pd4_2^`2^2^pD^2^2^2^2^2^2^2^2^2^2^2^2^2^2^2^ 2^3^ 3^3^^3^ 3^3^ 3^1^0P_1^@3^1^P3^1^"3^&3^^&3^+3^&3^03^&3^53^d3^:3^d3^ ?3^d3^0D3^d3^I3^d3^N3^d3^ S3^d3^0X3^d3^]3^b3^i3^b3^o3^b3^u3^b3^|3^c3^3^c3^3^c3^eqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0edeafdfafafdeaeddaiadbibpmzsdepX^X^I0^O0^X^X^S0^Y0^X^X^]0^c0^X^X^._]^m@m@xT_bus_dma_busaddr_to_paddr_bus_dmamap_sync:^:^:^:^:^:^;^;^,;^:;^H;^W;^:^f;^~;^;^VA;^t[2PVA;^t[2VA;^t[2AVA<^t[3VA<^t[3 VA<^t[3pA<^t[3qA<^t[3qA<^t[3qA<^t[3qA<^t[3A<^t[4D <^[4D <^[4i <^t[4`Rf<^t[4 i <^4[4qA=^t[4TrA =^t[4TtA=^t[4TtA(=^t[4TA==^t[4T AE=^t[4TAM=^t[4TPTU=^t[4T`A `=^t[5TE`A j=^t[5TE`A j=^t[5TE%V t=^t[5TEWV =^t[5TE i=^[5TE $i=^[5TE0$i=^[5TE ,i=^[5TE0,i=^[5TE .i=^t[5TE0.i=^t[5TEAi=^[5TE!i=^4[5TE !i=^4[5TE)i=^4[5TE )i=^4[5TE-i=^[5TE -i=^4[5TEAi=^t[5TEAi>^t[5TEAi>^t[5TEA >^t[5TE A '>^t[5TE`A 2>^t[5TEJ`A >>^4[5TEJ`AL>^4[6J`AZ>^4[6J`Ah>^4[6ZK Aw>^t[6KPA>^4[7ApA>^4[7AA>^4[7A/A>^4[7A?A>^4[7AA>^4[7A/A>^4[7A?A>^4[7AOA>^4[7AA>^4[7A/A ?^4[7A?A?^4[7AOA(?^4[7AA6?^4[7A@AD?^4[8A0AR?^4[8ApA`?^4[8ApAn?^4[8AA|?^4[8AXV?^t[`A?^t[XV?^t[?A?^t[@XV?^t[ A?^t[@X/V?^t[\F_;^;^;^;^;^;^;^;^;^;^;^;^;^;^;^;^<^<^<^<^<^)<^<^1<^6<^@<^G<^V<^]<^g<^m<^w<^~<^<^<^?^?^?^?^?^?^?^?^?^?^?^?^?^?^@^ @^@^@^#@^,@^5@^?^?^?^?^?^?^?^?^?^@^ @^>@^?^?^@^?^#@^@^?^?^?^?^?^?^?^@^ @^@^@^#@^,@^D@^5@^?^?^?^?^?^?^?^?^@^ @^@^?^?^?^?^?^?^?^?^?^?^?^?^?^@^ @^@^#@^?^?^?^?^?^?^?^?^?^?^?^?^@^ @^@^@^#@^5@^M@^?^?^?^?^?^?^?^?^?^@^ @^V@^g@^?^x@^@^@^@^@^?^?^?^?^?^?^@^ @^@^?^?^?^#@^,@^D@^@^@^@^?^?^?^?^@^ @^>@^@^@^?^?^?^?^?^@^A^ A^?^?^@^ @^>@^A^A^$A^+A^?^?^?^?^?^?^?^?^?^@^ @^2A^6A^:A^>A^BA^FA^JA^NA^RA^VA^ZA^_A^dA^iA^nA^sA^>@^?^?^?^?^?^?^?^?^?^?^?^?^?^@^ @^@aD^t@rD^@D^t@D^d@D^D^d@D^D^d@E^0E^d@AE^bE^d@sE^E^d@E^E^data_abort_handlerbadaddr_read@````` ```pmap_map_chunkERROR TIMEOU DFwd_flushcachewd_trim1O^SO^N^N^N^N^O^lO^N^N^N^N^N^N^O^O^LA$LA QAD`APdA\_A^AS*wd_setcacheO^O^O^ QATMALA$LAJAMAFADATDAWAwd_standbyLA$LA`A_AD`A~RllU8S@P^AS*HjA\uApiA,sAhA`hACC`CTAXhAPhAAatastartata_thread_runatabus_threadAA~R~RA~RllU8S@P~R #(-27<FP d'SpectecSDIO WLAN CardSDW-820e @ d' #(-27<FP]^a]^P ]^&]^ ,-]^@P lAA=^^2_^pxa2x0_i2c_intr_subrB\pBj^k^k^pBDqB~R~RzB~RqB8S$rB~R54\(\5\\=4\(\=\\VL\@\V[[ p^%p^d[X[@p^7r^;^[[P|[p[Dp^e*^[[[[%  8  @!!@! ! #/ ''w0 g'' c0c .q^7r^;^HT5q^Aq^zJq^Wq^zvq^}q^ vq^}q^ .q^q^q^q^q^q^q^q^@q^q^@q^q^q^q^7r^u^ p^%p^lq^7r^r^H"r^7r^;^+r^0r^.q^@r^Ur^@IeII\r^ar^I0I0Eq^ir^tr^zr^@&II  Ir^r^q^r^@"I0r^r^q^-/r^r^r^r^r^r^r^r^r^ s^r^s^r^4s^Ls^Ss^r^bs^r^xs^r^s^s^")s^s^uE o@o @o @.q^s^s^s^s^@p^7r^;^@& 3BI@s^s^ @(#0(t^2t^TB t^-t^^t^2'Et^t^t^t^u^u^!u^.q^t^,u^4u^Au^4u^.q^t^.q^Ju^s^u^u^u^u^u^u^u^VVwhr^u^r^ v^"v^.v^Ls^Cv^Ls^Nv^Wv^u^`v^iv^P8soo P q q sMkltu^u^tt3v^v^ hCv^v^ h&FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~BBB BPBBBBBB BBBB$BBB BDBBB~RllU8S@PBlAB2_^w^sysctl_wiwi_push_packetwi_write_txratewi_startwi_rx_intrwi_rssadapt_inputwi_tx_intrwi_tx_ex_intr|^|^|^|^|^}^C}^l}^}^}^ }^ l}^ }^ }^ }^~^~^~^(~^(~^(~^M~^M~^!k~^"k~^THIS is A memory TEST pattern !)kCfC|SCSCTbCSCRClTC8SU~R ##$CLCCCDCCC@ CC@ܶCClAdC^(](](],&(](](](]n@ j(](](](]JڧoQ(](] (](]a>(](] (](]Q?}-*(](] (](]@ZC˔(](]I;0hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6 X)]+] *]x,] *]H-]  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN   !"#$%&'()*+,-./1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }  !"#$%&'()*+,-./lA8D^expand 32-byte kI^xDD DPDDDD@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[jUS_&)ûIt~._dyz,(4y:b,ia /A&"3DUfw̻wfUD3"-  J1AY'A;B'{BP}sՊtS.&ܤF]\F]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;QF]E]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽHdF]\F]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTHdF]\F]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@dF]E]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rq^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decapa^{D{DxDvD(yDDD0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsize^tDhD܀DD|DDDieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_table_initPieee80211_encapieee80211_compute_durationPPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_update^^^^®^^®^ieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setup'^К#F$.F -FL.FКC\EEE_]pEКGEEla]d|GКFEEd`]F0FxFКcFEE_]КCxZEE_]$ZК)CxZEE_]$ZКsCxZEE_]$ZКCPEEE_]ؙE EEКCcFEE_]hF     }E#(D(@AAA==A*ip_outputPcFHcF8cFgFbFfFeFhFhF(cF$cFbF8hFhhF$bF,bF nF4bFgFtcp_outputsyn_cache_respond @@@@@@@Gl G G8 GD5GPDG;G7GG9G:GDGDG?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!^^^^^^^^^ ^^^^!^G^M^'^-^3^9^^^^^^^^^^^^^^^wsevent_copyout_eventsQJOJbJbJ_J~R(`J~Rp`J8S`J~RABCDEFGHIJKLMNOPQRSTUVWXYZJ@yJyJ~R؀J~RyJ8S$zJ~Rrasops_reconfigrasops_init@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?&0&&P]H]oP]]                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~]]a])]2-]_]`]ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠPXJJTFdJXJPN JRR|JCEJSTJNMJ4JCLJ0PLJ0REdJ@RR|JCEJSTJSLJRR|JCEJSTJERJCEJSTJXX]ؔ]X]lAJ^@w`]]4W8]XXT](5Xp](5X](5X](5X](5X](5X](5X](5X](5X](5X0](5XL](5X](5X](5X](5X](5X](5X](5X,](5XH](5Xd](5X](5X ](5X|](5X](5X]XX](5X](5X]xJ]X]TJ4],JP](5Xl](5X]DXh](5X]xJ]J] X]X(](5XD]J`]X]WDw]]4W8]XXT]̺Xp]XX]XX]XX]X]X] X] X]xX]X0]dXL]LX]hX]XX]XX]XX]XX]XX,]XXH]XXd]XX]XX ]X(]X|]$X]X](pX]X],X]xJ]X]TJ4],JP]Xl]HX]DXh]lX]xJ]J] X]XD]J`]X]WHw`]]4W8]XT]Jp]X]X]hX]hX]xJ]X]TJ4],JP]@Jl]X]X]X]DX]\X]X0]dXL]ԣXh]hX](X]X]xX]X]X]X,]xXH]<Kd]J]?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥpK@KXKXKȉXupdatefatsxGKFKFKFKFKIKFKFKGKGKU]lAQK^. .. y]]4W8]XT]2Kp]vK]X]hX]wK]lmK]X]`xK4]_KP]dKl]dfK]X]X]DX]\X]X]XX0]dXL]ԣXh]K](X]$jK]X]LK]zK]jK,]XH]TnKd]pX]?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:ZKKK|Knfs_sillyworkerKKdKȉX @]]]]֮]Į]]]z]^]B]$]]]ȭ]]]|]p]f]\]P] ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  ]`]]lAd,LL_]]4W8]XXT](5Xp](5X](5X](5X](5X](5X](5X](5X](5X](5X0](5XL](5X](5X](5X](5X](5X](5X](5X,](5XH](5Xd](5X](5X ](5X|](5X](5X]XX](5X]8xL](qL]X]DL4]LP]hLl]dhL]DXh];M]K]K] X]qL(](5XD]pL`]X]XXh]]4W8]XXT]̺Xp]XX]XX]XX]X]X] X] X]xX]X0]dXL]LX]hX]XX]XX]XX]XX]XX,]XXH]XXd]XX]XX ]X(]X|]$X]X](pX]X]wL](qL]X]DL4]LP]gLl]gL]DXh]lX]K]K] X]qLD]pL`]X]W]]4W8]XT]0YLp]L]L]CL]X:M]rL]X]DL4]LP]fLl]K]X]X]DX]\X]X]K0]dXL]ԣXh];M](X]0M]hL]H2M]M]QL,]lMH]iLd]fL]*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?%N}NX~NȉXffs_newvnodeffs_reloadMMM\zMM$NX N ffs_syncĻ]]$]lAM^J^,]]4W8]XXT](5Xp](5X](5X](5X](5X](5X](5X](5X](5X](5X0](5XL](5X](5X](5X](5X](5X](5X](5X,](5XH](5Xd](5X](5X ](5X|](5X](5X]XX](5X]{N] X]bN]dN4]4fNP]L{Nl]{N]DXh]#N]>N]LN] X]X ]9N(]ȣMD]yN`]X|]|N]W],M\]PMx]M]XM]M]M]X$]X@]X]]4W8]XXT]̺Xp]XX]XX]XX]X]X] X] X]xX]X0]dXL]LX]hX]XX]XX]XX]XX]XX,]XXH]XXd]XX]XX ]X(]X|]$X]X](pX]X]zN] X]bN]dN4]4fNP]dzNl]zN]DXh]N]>N]LN] X]XD]yN`]X]W],M\]PMx]M]XM]M]M]X$]X@]X̻]]4W8]XT]DNp]aN]mN]bN]tbN]bN] X]bN]dN4]4fNP]Nl]N]X]X]\X]DX]X]XX0]dXL]ԣXh]#N](X]kN]XlN]]N]oN]@rN,]NH]sNd]4wN]N]LN] X]X ]9N(]wND]yN`]X|]|N]|N]W](pX]X],M\]PMx]M]XM]M]M]X$]X@]X]lAL)N7W_^(]]4W8]XT]XXp]XX]XX]$-N]/N]XX]XX]XX4]XXP]XXl]XX]X]X]\X]XX0]dXL]XXh]lX]XX]XX]XX]XX]XX]XX,]XXH]XXd]XX]XX]|-N]-N] X]X ],N(].ND]L-N`]X|]XX]XX]W]ܣXufs_inactiveufs_dircompactufs_dirgrowSN TNlTNTNUNUN4UNpUN[N[NlAp_NJ^ ...N̦NdNԡNuao_putбN TNDNpNNuvm_km_suballocNXNNuvm_unmap_removevmmapbsy]̿]@]]uvm_page_physloaduvm_physseg_unplugswap_offswstrategysw_reg_strategyuvm_swap_initswap_on~R~RO\O~R~RllU8S@P~RO~RO~R~R~RXOTOXOTOOlAO^lAO^NetBSDlApO^lAP^____A,@A#7$wx@g`8@O@cv@lPvR vRlRdeadcvlAqP_~R~R~R~R|P~RllU8S@P~R~P~R~R~R~R~RllU8S@P~R<<<PȤP Pfilt_timertouch_~R~R(PTPTPPP4PPPLPPPP8P$P4PPPPxP`PPD@PPPPPP PP4PPexec_init _{_|j^ _ _ _assert_sleepablemodule_builtin_addlA _module_start_unload_threadmutex_vector_entermutex@*S*S vRhQself`]p]h]0]]]]]0]systemdrvctlS@S@@ @@ rw_vector_enterrwlock`*S*S vR3Rcrashme_sysctl_forwardercrashme_kpreempt_spinoutcrashme_mutex_recursioncrashme_spl_spinoutselfdebug_crashmecrashme_removeAD 0  pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) BRBRHARsleep@tRvR vRlRkpause@tRvR vRlR\schedR,R|RlRsysctl_lookupRcallout@tRvR vRlRtodr_gettimetodr_settime'_'_ '_'__acl_posix1e_mode_to_permconfig_devdeleteconfig_finalize_mountrootX^_K,_bdevsw_attachcdevsw_attachopendisk2_2_2_ 2_(3_03_83_@$3_P/3_`:3_pE3_P3_[3_f3_q3_|3_@3_3_3_3_3_3_2_2_ 2_@2_l%T,$T$T$T&T~R%T~R%T8S(T~Rpr_phinpage_checkpr_rmpagepool_initpr_item_linkedlist_getpool_do_putpr_item_bitmap_indexpr_item_bitmap_put0123456789abcdef0123456789ABCDEF|/-\ȤTĤTvmem_rehash_startTHT(TTT TT4TlATT ;_TTUTT`TQ;_ UUTxP<UUDUpT TTUUUUmemfd:5<_-U-U(U@,UP+U(UPP*U(U~R~R*U$CU7U:Uh>U>U=UXIUEUtIUEU<_PPPxP86U5Ud:UPPlA _>_>_>_>_>_>_ U8UUdUUUU$U UUUtU8SU~RV@?VV@V@V>V@V>V@V@V$BV>V@V@V?V ?V?V?V@V<HV]HV]=HV]RVXUVDPVKV`MVlVVVVDLVLV|VVA_GVPPxPPFVTJVPPlA0NV A_T]Vp\VT]VH^V]V]V]V\VAsbcreatecontrol1B_B_B_A_'B_/B_A_8B_`V8VLVVVVVVVN_D]+1N_<],$N_4]-N_,]. N_$]/N_]0M_]1M_ ] 2M_]3M_]4M_]5M_]6M_]]]8]T]p]]]]]]]4]P]l]]]]]]]0]L]h]]]]]]],]H]d]]]]]] ](]D]`]|]]]]]]$]@]\]x]]]]]4E_] ]]l_X]W8]XT]^X]^X]hXP]$^Xl]<^X]X]X]hX]D^X]L^X]d^X]d_X]^X]x^Xh]hX]hX]T^X]hX]xX]X ]t_X(]^XD]_X`]X0]hX]8_X] _XbXaXPaXtjX ]]4W8]XT]|_Xp]XX]XX]eX]iX]TX]X]TX4]TXP]TcXl]bX]X]X]LbX]\dX]`X0]dXL]XXh]hX]XX]XX]XX]XX]XX]XX,]XXH]XXd]XX]XX]_X]hX] X]X ]_X(]XXD] jX`]X|]_X]pX]hX]ܣXgenfs_suspendctlؠX0XؠXԟXؠXXXgenfs_can_access_acl_posix1e@ @@ @ @lAXP_layer_bypass t]]4W8]XT]̺Xp]XX]XX]X],X]TX]TX]TX4]TXP]Xl]HX]X] X]DX] X]xX]X0]dXL]LXh]lX]hX]XX]XX]XX]XX]XX,]XXH]XXd]XX]XX]X]X] X]X ]X(]XD]мX`]X|]$X]X]W](pX]XdevclsdeviocdevoutdevindevwaitdeviodevopnlAXw^XXX0XX@XXhXX@SXXX0X;^2IчH_|nQn- q+_ZIчH^|nQn- q+^SFU0eC^IчHh_IчHR_-чH*W_-чHR_SFH0eCU_S'@ )Ѹ.W_*1@ )Ѹ6W_1x )Ѹ;W_3Dh&CW_=rGy=iG}HW_|nQn- q+OW_TY̟QhYtYY$Y@Y~RllU8S@P~RhYtYTY@Y~RY~RD Y~RP!YP!Y` Y~RllU Y@P~R4$YX$Y\&Y(%Y%Y~R$Y8S`$Y~R(Y 'Y,Y~R~R~R~R~RllU8S@P~RW_@.Y 9YGYxP$+YT*YFYl(YP_bpf_mtap_softint_initlA$7YW_X_lA(SYX_ifaddrpref_ioctld n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jnd_set_timer^Y)[_$Y0[_Y9[_YYrt_initrt_timer_initrt_deladdrroute_outputrt_msg1route_enqueuert_addrmsg0]Z|^ZDZLZCZCZLZ^Z^ZCZCZCZxGZPGZCZCZ _ZDZCZxZGZ]BZLarp_llinfo_outputarpannouncearp_dad_startarp_dad_timerarp_rtrequestarpresolvetqZ{ZnZin4_cksumwqinput_createwqinput_sysctl_setuplAصZsb_lAܾZ*c_lAZxe_lAZWe_fe_ n{P&YY$SYpY@UtGDpzJ5+^P]2_^H]^@]^8]C^0]j^(]^ ],^]^]^]^]2^] ^].^]^]a1^]i_]eg_]g_]S^]g_]<^]P/^]_](^]@^^]\a^|]~`^t]`^l]d^d]e^\]g_T].g^L]g_D],)^<]+^4],^,],^$]|-^]-^]*k^ ]-^]Wu^]Xd(ā L ܔ|ȑĥ@ȣܗ0آT(СxL @^^@^^g_g_^S^S^a^g_Wu^Wu^g_g_,^,^h_,^h_-^h_-^%h_,)^P/^P/^\a^\a^\-<--,,,,|,\,<,,++++|+\+<++****|*\*<**))))|)\)<))((((|(\(<(('']],]]]] ]H]]h]]4]]`]]]L] ]t]eg_S^,h_ @^5+^A_ @^a^2h_ @^:h_Wu^n^ @^^%h_h_ _ @^Bh_WB_g_^1^ @^_g_Ih_ @^ =_ @^\a^A_ @^]*^<^)_ @^Th_ @^,^@^^h_P/^ch_ @^]*^<^Zh_ @^ɂ^ @^_h_ @^h_ @^h_ _ @^Eh_WB_; ΔHWIn(l QrYTᯨg?RPQrYTᯨg?RP; ΔHΕ#w.jRmQ3h8UQrYTᯨg?RP; ΔHΌQ3h8U 5,+Kыͳw'F3   0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG~h__h_h_U_h_h_^^h_h_h_^q^h_U_h_HW_CW_R_*W_h_E^h_h_h_h_h_R_h_.W_6W_;W_OW_X^  gntsD[E[E[C[C[ h_ $i_[*i_ [/i_ [`^[3^y[5i_8f[h_L[\^[l^[rbmnl][\[ \[\[\[(Bi_tcid j[i[Xm[$x[h[g[g[ph[`h[ yekdi[Pi[g[ Oi_Xi_<ai_,ii_atadz[z[lz[ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/qi_loobX[8[`[yarat[`[[d[H[ zi_strtoullstrtollstrtoulCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALL_C700NetBSD 10.99.10 (INSTALL_C700) #0: Tue May 21 15:35:18 UTC 2024 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 @(#)NetBSD 10.99.10 (INSTALL_C700) #0: Tue May 21 15:35:18 UTC 2024 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 10.99.10NetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partitionbad sector table I/O errorbad sector table corrupted: I2C controller unable to attach PXA I2C controller pxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoop%s: not configured. can't map bus space couldn't establish power handler %s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferSharp Zaurus LCDw100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctl%s: this kernel is not support SL-C1000 couldn't register event handler zkbd: pseudo power management module zapmunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus, rrx, %s r%d, %s #%dlrthumb insn %s%s , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d#%s.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]und%s %08x oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-dask-auserconf-chalt-bquiet-q-v-xsilent-z%s: curaddr %#lxnot in range%s: mix PRE and POST%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botchL%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)%s: not supported %s: status=%s %s: (error not notifiedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed device faultdevice timeoutchannel resetrequeue, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASwdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferrecalpiomodesetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x atacmd_to48: illegal 32-bit command: %d%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitq%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported atapibus at %s not configured ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't create task thread "%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %dcouldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE setsdmmc_select_card: SMC_CAPS_SPI_MODE setsdmmc_select_card: error %dcouldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d unknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x SD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%dcan't execute SD tuning can't get SD status: %d write-protected Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270Kernel is configured for %s, but CPU is %s : Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostStray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacpxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL unable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendunknown error codepower management disabledinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedno APM presentreal mode interface already connectedno pending eventsunable to enter requested stateAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0DYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaunable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors %s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x detect auto increment bug, try again wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: tx rate %d -> %d (%d) %s write fid %x failed failed to allocate %d bytes on NIC tx buffer allocation failed %s: interface not running timeout in alloc %s: device timeout %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: NIC memory corrupt - invalid packet length %d device enable failed ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s com: unsupported I/O width %dtimeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifotl16c750ns8250 or ns16450, no fifons16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTDesignWare APB UART, no fifois_consoleforce_consolecan't re-init serial console @%lx fifolen: %s, %d-byte FIFO txfifo disabled 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1atapitimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardl%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilinvalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow%s: ctxt %u%s: tag %u%s: verify %u failed %s: ptxt %u%s: forgery %u succeeded %s: buffer overrun %s: tag overrun aes_ccm: self-test passed aes_ccmaescryptoselectedaes: self-test failed: %s AES self-tests failedaes: %s AES is busted%s AES-%u enc: self-test failed wasexpected%s AES-%u dec: self-test failed %s AES overrun preceding: self-test failed %s AES overrun following: self-test failed %s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed %s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed %s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed %s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed chacha: self-test failed: %s chacha: %s Portable C ChaChaxchacha_streamxchacha_stream_xorchacha core 1chacha core 2hchachacprng_fast reseed/usr/src/sys/crypto/blake2/blake2s.c0 < dlenkernel %sassertion "%s" failed: file "%s", line %d dlen <= 32keylen <= 32jA%AESŘOOLJ܈yLblake2s: self-test failedblake2s: self-test passed blake2ssysmonsysmon_envsyssysmon_wdogsysmon_powerWARNING: KERNEL TICKLE OF WATCHDOG %s FAILED! wdogrefWARNING: unable to register watchdog shutdown hook WARNING: unable to register watchdog critpoll hook %s: %d users remain WARNING: UNABLE TO DISARM WATCHDOG %s ON CLOSE! WARNING: FAILED TO SHUTDOWN WATCHDOG %s! software watchdog initialized unable to register software watchdog with sysmon swwdog%s: %d second timer expired watchdog timer expiredreboot if timer expiresswwrebootfailed to create swwdog reboot wq%s: unable to attach cfattach invalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: [%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handledmgttoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %ureceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: free all nodes in %s table %s %s table %s: %s[%u] still active %s: scan set:%s%u start chan %u ibss???? %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup initial BSS node%s %s table, inact %u scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechodynamic_rt_msgICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailablereserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblisttcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachable%s: impossible (1)%s: impossible (2)synplrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttiss_hashabcaggressivemsltremoteremote_thresholdvtwtcp6inet6newrenocubicudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknodeinfomtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtu%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctl%s: %s marked tentative %s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) bcast/mcastmcast/dstunspec/srcsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6keepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxdynroutesparam_rt_msgip6_init%s: packet to an unready address %s->%s %s: off < sizeof(struct ip6_hdr)%s: m == NULLpim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludge%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s RA%s: src %s is not link-local %s: lladdrlen mismatch for %s (if %d, %s packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket addr 0x%x%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' : I2C bus i2c-no-indirect-configi2c-child-devicescookiecookietypecompatibleWARNING: ignoring bad child device entry for address 0x%02x WARNING: ignoring bad device address @ 0x%02x i2cexec,i2c_bitbang,i2c_subri2cexeciic at %si2c_bitbangmii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4xOUI 0x%06x model 0x%04xmiiautmii_phy_setmedia: MASTER on wrong mediano media present HomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDX: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted kbdmux %d: console (%s, %s emulation), using %swsswwsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %dOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux%s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] %/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. msdosfs_rename: updating .. in root directory?msdosfsmsdosfs_sync: rofs modRRaArrAamsdosmsdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inode%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list%s: unknown fs_fragshift %d%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsinoffsdino1ffsdino2appleufs, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s not roundedmissing NUL in namenull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpageuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectudv_detachudv_attachflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainloanzeroloanuopguser_va0_disablevmmpeplvm_map%s: kernel object %p %p uvm_voaddr_release: bad typevmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressthread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using package allocation scheme, %d package(s) per bucket uvm_pagealloc_strat: bad strat %demergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: Tried to unplug unknown range %s: swapdev not in listswap_encrypt%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d uvnfp1uvnfp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)use absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptpid %d (%s): %s write of %zu@%p at %lld failed: %d %.*sToo many CPUs. Increase MAXCPUS?cpu%dfdcloseincrease kern.maxfiles or MAXFILESfiledescfile2dup2entropy: ready entropy: best effort cpu0entropy intrdropentropy intrtruncWARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) WARNING: system needs entropy for security; see entropy(7) entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategathersamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)%s: invalid type (%ld)EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY*fexecve*execargsshould not happensigcode kernel mapping failed %d pspawnlwpwaitnetbsdinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx pserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: built-in module %s can't find builtin dependency `%s'built-in module %s prerequisite %s failed, error %dbuilt-in module %s failed its MODULE_CMD_INIT, error %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEunload requested for '%s' (%s)module `%s' not foundmodule `%s' busy (%d refs)cannot unload built-in secmodel module `%s'could not unload module `%s' error=%dunloaded module `%s'module `%s' declined to be auto-unloaded error=%d%s: builtin module "%s" init failed: %dmod_unld/stand/%s/%s/modulesbuiltin %s failed: %d moduleautounload_unsafeautotimemodunload%s: %dmodule `%s' pushed by boot loader already existsduplicate bootlist entry for module `%s'unable to load `%s' pushed by boot loader, error %dunable to fetch_info for `%s' pushed by boot loader, error %ddependentuse -f to reinstate builtin module `%s'%s module `%s' already loadedout of memory for `%s'cannot fetch info for `%s', error %dmodule `%s' has invalid class %dmodule `%s' built for `%d', system `%d'forced load, system may be unstableincompatible module class %d for `%s' (wanted %d)dependency name mismatch (`%s' != `%s')module with name `%s' already loadedcircular dependency detected for `%s'required module name `%s' longer than %dself-dependency detected for `%s'recursive load failed for `%s' (`%s' required), error %dunable to affix module `%s', error %dmodule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %drecursive load causes duplicate module `%s'module `%s' loaded successfullyAutoload for `%s' requested by pid %d (%s), status %dmod_hookLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for %skern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfMutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: Suspending devices:%s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuefailed to reserve PID 1 for init(8)procplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s curprocpaxflagsrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x Reader / writer lock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old panic%s: disabled kpreemption %s: locked once %s: locked twice %s: initialized %s: raising ipl to %d %s: raised ipl to %d, s=%d crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s %s: unable to remove %s from sysctl null_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabledsigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=%s%lluswap dumps on %sparsediskuse one of: %s[a-%c] none halt reboot md0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLsysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destructionpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system %s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrtts%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachlocationev: %s %s at %s in [%s] cfgmiscautoconfdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported waiting for devices: done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sconfig_detach: forced detach of %s failed (%d)root device %s not configured detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbacknist_hash_drbg_destroynist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_reseedNIST Hash_DRBG failed self-testurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? pkg1st%s has %d %s siblings:%s first in package: %s GAVE UPureadc: non-positive residureadc: non-positive iovcntdevice-enumerate-childrendevsw%s: block majors exhausted %s: character majors exhausted writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and partition table is fullno raw partition and disk reports bad geometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitdisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table typehashstat KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u %s: [%s] ph %p poolid %u != %u%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u %s: size %u, align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p pool item size %zu too large, use a custom allocator(null)[% 4jd.%.*ld] %s: table is full - %s %s: table is full Skipping crash dump on recursive panic panic: autoconfiguration error: mismatching pserialize_read_exit()exclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclowxchighcrosscallunicastxcallxcall/%uaioworkaiodoneaio_process: invalid operation code posix_aioaio_listio_maxaio_maxaio_jobs_poolaio_lio_poolefdreadefdwriteeventfdfqabortfutexinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s memfdcompat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgplmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsockettfdreadtimerfdttyrub: would panic c = %d, val = %d not a controlling terminal empty foreground process group found only zombie processes no foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreftkstatnincanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_seqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)unixpsemposixsemmaxksemsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadinflightdeferredunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestednamecachenamecache_statsncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.fstypesmagiclinkstimestamp_precisionlf_findoverlap: defaultnamei_simple_convert_flags: bogus sflags chrooted pid %d uid %d (%s) detected outside of its chroot /../zauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dot%s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... VT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADfiledelaydirdelaymetadelayinvalid specnode type: %dILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsyncwaitfdesckernfsafsfstchgfstcntfstlwpvcachevnode cache hashvnfull%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvdrainvrele%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-listsystem.user.security.trusted.xattr-namexattr-valvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad op%s: ACL_OTHER missing layerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_fdiscard: not a device dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_ioctlinvalid specfs vnode type: %dspec_read typespec_write typespeciofictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) %s at %s (%s) deleted raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) %s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fszfsmdidle%s: cfattach_attach failed /dev/randombpfmaxbufsizepeers%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#link#%huif_%s: watchdog triggered ifnetifaiflnkstifwdogsdl%s: could not attach sysctl nodes sndqmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged DOWN%s: lost link state change %s %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %sinvalid ifnet multicast command: 0x%lx%s: can't handle af%d The multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooks33etherrps_hash%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_looploifmedia_set: no match for 0x%x/0x%x ifmedia_set failed%s: invalid timer type pfilpktqsyncpktqrenqifqcurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us rn_delete: couldn't find our annotation radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d mZV%[Ag%=C+ˮ{0w-0 jB;rtfree 2route_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %drtableroutend_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintlog_movementslog_permanent_modifylog_wrong_iface%s: source can't be determined: dst=%s %s: %s not ready %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d curtainTraditional NetBSD: Extensionsuser_set_cpu_affinityorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d extensions_modcmd::fini: secmodel_deregister returned %d usermounthardlink_check_uidhardlink_check_gidTraditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsfssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadtprofisvvideohdaudiouhsorumpblknpfdtviscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pwwancacpismbiosefisht3xtempscmdviocongpioirqcttyphysconptcqmsofconstunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseusbuhidulptscsibusraidugenucomopenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomdmoveriosscomksymsepcomtslcdtwewdcpxapcicpxamcisdmmcbuspcmciabuswsemuldisplaydevwskbddevapmdevifi2cbusdrivechannelgpiobuskbdmuxcontrollerindexdackintrbase%s: %zu bytes @ %p unusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs3stringpropstng<>&plist version="1.0"?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0x%s: getifname%s: getifaddrsaddress:link%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tag?NONEAES-CCMPWEP40TKIPWEP104AES-OCB...SIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ specnfscan't get net id for host "%s": %s%s: can't read disk label; disk type must be specified%s partition type is not `%s'$%9%q%%&&1&d&&&&&'%'F'm'''' (A(h(((WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics formatsector size `%s' is not a power of 2.fragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()`[d[i[usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /tmp/option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered oldNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptywarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d seekI%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYhhh"i:iciiiiijAjsjjjj k;kMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbatalkchangeexpirehopcountinet6lockrestmonitormtunetnostaticproto1proto2recvpiperttrttvarsasendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspechw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytes1M-blocksGBytesSizeno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpfetch_ftpP{***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciiWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230516Version: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTmoreMLSD is not supported by the remote server. output to local-file:Can't execute `%s'Can't fork a subshell; try again laterusernamePASS %sLogin failed. Account: Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". rcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpasshttps_proxyno_proxyrpromptsslnoverifyaccountappendbellbyecdupchmodcrdisconnectepsvepsv4epsv6featuresfgetformgethelpidlelcdlpagelpwdmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodtimemputmsendnewernlistnmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesndbufstructsuniquetenexthrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)ftp_proxyretrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. %s:No control connection for command Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STORproxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandsentlocal: %s %s: not a plain file. APPEReading `%s'Writing to networkCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ?Ambiguous command. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEactiveUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERpagerFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unixlinux215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): loginUSER %sPassword: Login failedACCT %sAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16K)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz  " $#!%Z^\`[_]a: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data .Q!LESSLESSSECUREmoreVISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%s$<liLESS_LINEScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndadbNRpc@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticlcmsovbbc|^ crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELL-c%s%s%slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/tty\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE%lu \abfrtv disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for on[set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowednonebad flow settingevenbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dlink downunsupported speed %ldConnect failedescapeparityphonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberhdraecbetbdchfesprdletdvcmcuiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zero%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busyPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5d n r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsforceframesizehostphonesraiseraisecharrcrecremotescripttabexpandverbSHELLechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalecholeparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-iȨCѨ0^$بD$V$N$ Q$R$.6S$S^F$rE$T$T$U$ X$B$ȩ6Q$ϩ֩Q$hQ$W$C$B$26W$(26F$9H$BI$PXJ$s~G$K$K$L$ Y$ Z$Ȫ [$Ӫ O$ \$'\$ &]$collect.2B`NAME=Xnp5(V&^6<fDLlRVr`~fjnZx|>    "#$%   "#$%    "#$%&'()*+.  % $ i  1LbEr9 (V&^6<fDLlRVr`~fjnZx|fgw6?@ B>BA<9A:]<9s9J>Ge=; 61;KBDF6G:}::99(V&^6<fDLlRVr`~fjnZx|)-/4----------------------------------- - --------------------   "#$%@//tmp/usr/varu$u$v$u$-6=FQ[ Details for index GPT part - ({p5nLX~fZ`\/m5y!5'WJ=[EI(n  fv# `!SFH0eCSFU0eCnHah!IdontNeedEFI(s*K>;|nQn- q+|nQn- q+ |nQn- q+-6|nQn- q+GR|nQn- q+`=rGy=iG} d;Mt?p{mWC 3KOOyD<#*=(3Dh&Ǧ\ M}-@Mjy֬-чHf-чHZIчH4IчHnGIчHvR2IчH(mS'@ )Ѹz*1@ )Ѹ1x )Ѹ#)33=A1) ;J}   E 5yy  l Nbz`A msdos/bin/kshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qhttp_proxy <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noexecnoautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeNoneOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 10.99.10 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"headsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalFilesystemMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.10 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.10 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.99.10 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.10 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s sysinst terminated. sysinstmsgs.TERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certsFTPSSLNOVERIFYsysinst: screen too small /usr/share/sysinst/catalogLC_CTYPErelease10.99.10zaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7# Script ended at: %s /tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicant/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %stmpfsinvalid%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)/dev/r-t xx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o asynclfs-tlfs-tmsdossysvbfs-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%sprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udfunknown%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/random/dev/r%s%cCD001%s (%s)/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfocat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%s>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-file/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinstmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700modulesbasebase32etccompgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%zu%llu - %llu %s, %sFATNTFS a-%c %c---%c-%c%c: %s %s %s %s %s%s %s %s%s %s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi C700/dev/r%saNetBSD10/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sYES/etc/rc.confs,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c%s (%u)fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%*s : %s%*s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%llu%s/usr (%llu)%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %s%s_%lli@%llir%sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1153: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tableSec GPT headerv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmkcorevmfsvmwresvbioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequired%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxApple HFSapple-ufsBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsLinux datalinux-raidLinux RAIDlinux-swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapVMware VMkernel core dumpVMware reserved/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading input%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETAKiBMiBGiBTiBPiBEiB' -%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu \%03o --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limit%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap???refusedunknown qtype truncated no address %s(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s failed to get receiving packet informationinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 addresscontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2.A F dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2023 Roy Marplesmain duid_getif_discoversplitvadd_environparse_optiondefault_configread_configTbzc%de fgS hy ijklmn opl qrst uZ vwxzyABC DEF GHIJ(K/LVM8N>OGPTQ\ScThUrV|WXZ*146s|~} !&.39?Ej RT]!6emw(  i i rt_new0 rt_buildrt_deleteU U 4{q k*1make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_opensockets_os %if_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfread_leaselog_dhcp~#####dhcp_bind#"##Z!# #dhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sSTOPPED%s: removing interfaceSTOPpid %d failed to exitNOCARRIERPREINITDUID %sdup2 %d%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.0.6--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.0.6 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.6 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUID%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurloption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutwaitipallowinterfacesrebootnoarpnobackgroundnohooklastleasenogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigure(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %saddingchangingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletinglink#%d - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinfalsePATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuerastatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zulo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s not foundreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished]! ]! m! m! U! U! VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\BZ6U9 `6m9 f69 l69 r69 x69 ~69 6: 6: 65: 6M: 6e: BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~6 6*26.2Z6`6f6l6r6x6~666 6@66,o(m$kZ6,`6,f6 -l6P-r6-x6-~6.6`.6.6.6,/6p/tc/etc/group/etc/master.passwd: (malloc) Error in munmap(): AJjhPUPuVvXxZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit%s%s%s 646towlowertowupperASCIIUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidfull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist