08˧4f<  ˧4fRNt t˧4f@@<@T 08˧4f<  ˧4fRNt t˧4f@@<@TU ˧4ft`A˧4f˧4f˧4f$h ˧4f˧4f˧4fA˧4f˧4f˧4ffA.˧4f˧4f˧4fhpxA˧4f˧4f˧4fgA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fmD˧4f˧4f˧4f (08@HPX`hpx$˧4f˧4f˧4f8@HPX`hpxM$)˧4f˧4f˧4fK$(˧4f˧4f˧4fM$C˧4f˧4f˧4f (08@HPX`FA˧4f˧4f˧4fC˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4f!˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f4!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f B!˧4f˧4f˧4f B!˧4f˧4f˧4f!˧4f˧4f˧4f"!˧4f˧4f˧4f"!˧4f˧4f˧4f"a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f?\!˧4f˧4f˧4f>\!˧4f˧4f˧4f=\!˧4f˧4f˧4f<\!˧4f˧4f˧4f;\!˧4f˧4f˧4f:\!˧4f˧4f˧4f9\!˧4f˧4f˧4f8\!˧4f˧4f˧4f?\!˧4f˧4f˧4f>\!˧4f˧4f˧4f=\!˧4f˧4f˧4f<\!˧4f˧4f˧4f;\!˧4f˧4f˧4f:\!˧4f˧4f˧4f9\!˧4f˧4f˧4f8\!˧4f˧4f˧4f:\!˧4f˧4f˧4f7\!˧4f˧4f˧4f6\!˧4f˧4f˧4f5\!˧4f˧4f˧4f4\!˧4f˧4f˧4f3\!˧4f˧4f˧4f2\!˧4f˧4f˧4f1\!˧4f˧4f˧4f0\!˧4f˧4f˧4f7\!˧4f˧4f˧4f6\!˧4f˧4f˧4f5\!˧4f˧4f˧4f4\!˧4f˧4f˧4f3\!˧4f˧4f˧4f2\!˧4f˧4f˧4f1\!˧4f˧4f˧4f0\!˧4f˧4f˧4f2\!˧4f˧4f˧4f/\!˧4f˧4f˧4f.\!˧4f˧4f˧4f-\!˧4f˧4f˧4f,\!˧4f˧4f˧4f+\!˧4f˧4f˧4f*\!˧4f˧4f˧4f)\!˧4f˧4f˧4f(\!˧4f˧4f˧4f/\!˧4f˧4f˧4f.\!˧4f˧4f˧4f-\!˧4f˧4f˧4f,\!˧4f˧4f˧4f+\!˧4f˧4f˧4f*\!˧4f˧4f˧4f)\!˧4f˧4f˧4f(\!˧4f˧4f˧4f*\!˧4f˧4f˧4f'\!˧4f˧4f˧4f&\!˧4f˧4f˧4f%\!˧4f˧4f˧4f$\!˧4f˧4f˧4f#\!˧4f˧4f˧4f"\!˧4f˧4f˧4f!\!˧4f˧4f˧4f \!˧4f˧4f˧4f'\!˧4f˧4f˧4f&\!˧4f˧4f˧4f%\!˧4f˧4f˧4f$\!˧4f˧4f˧4f#\!˧4f˧4f˧4f"\!˧4f˧4f˧4f!\!˧4f˧4f˧4f \!˧4f˧4f˧4f"\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f \!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f\!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f$!˧4f˧4f˧4f4!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f !˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f?\a˧4f˧4f˧4f>\a˧4f˧4f˧4f=\a˧4f˧4f˧4f<\a˧4f˧4f˧4f;\a˧4f˧4f˧4f:\a˧4f˧4f˧4f9\a˧4f˧4f˧4f8\a˧4f˧4f˧4f?\a˧4f˧4f˧4f>\a˧4f˧4f˧4f=\a˧4f˧4f˧4f<\a˧4f˧4f˧4f;\a˧4f˧4f˧4f:\a˧4f˧4f˧4f9\a˧4f˧4f˧4f8\a˧4f˧4f˧4f:\a˧4f˧4f˧4f7\a˧4f˧4f˧4f6\a˧4f˧4f˧4f5\a˧4f˧4f˧4f4\a˧4f˧4f˧4f3\a˧4f˧4f˧4f2\a˧4f˧4f˧4f1\a˧4f˧4f˧4f0\a˧4f˧4f˧4f7\a˧4f˧4f˧4f6\a˧4f˧4f˧4f5\a˧4f˧4f˧4f4\a˧4f˧4f˧4f3\a˧4f˧4f˧4f2\a˧4f˧4f˧4f1\a˧4f˧4f˧4f0\a˧4f˧4f˧4f2\a˧4f˧4f˧4f/\a˧4f˧4f˧4f.\a˧4f˧4f˧4f-\a˧4f˧4f˧4f,\a˧4f˧4f˧4f+\a˧4f˧4f˧4f*\a˧4f˧4f˧4f)\a˧4f˧4f˧4f(\a˧4f˧4f˧4f/\a˧4f˧4f˧4f.\a˧4f˧4f˧4f-\a˧4f˧4f˧4f,\a˧4f˧4f˧4f+\a˧4f˧4f˧4f*\a˧4f˧4f˧4f)\a˧4f˧4f˧4f(\a˧4f˧4f˧4f*\a˧4f˧4f˧4f'\a˧4f˧4f˧4f&\a˧4f˧4f˧4f%\a˧4f˧4f˧4f$\a˧4f˧4f˧4f#\a˧4f˧4f˧4f"\a˧4f˧4f˧4f!\a˧4f˧4f˧4f \a˧4f˧4f˧4f'\a˧4f˧4f˧4f&\a˧4f˧4f˧4f%\a˧4f˧4f˧4f$\a˧4f˧4f˧4f#\a˧4f˧4f˧4f"\a˧4f˧4f˧4f!\a˧4f˧4f˧4f \a˧4f˧4f˧4f"\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f \a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\a˧4f˧4f˧4f\ !˧4f˧4f˧4fi!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4f B!˧4f˧4f˧4f B!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f!˧4f˧4f˧4f!˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4f a˧4f˧4f˧4fa˧4f˧4f˧4fa˧4f˧4f˧4f˧4f˧4f˧4fbpf!˧4f˧4f˧4f $˧4f˧4f˧4f$˧4f˧4f˧4f$>˧4f˧4f˧4f$˧4f˧4f˧4f$s˧4f˧4f˧4f$˧4f˧4f˧4fA˧4f˧4f˧4fm ˧4f˧4f˧4f$˧4f˧4f˧4f $˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fA˧4f˧4f˧4fo).jqK BvZ"/ =Fl&ݡYw`D/9[J6nJ.4",E(TY"h"bCOTaItgf)A|)%P8(\t*[EVhcvűwM4\xk-^ 냣d]: I_d1[QWvofN^=ͣ\8NOD1Z`ܗ}L2G7O> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(44 (vv`>`> `> ؆LL`>`> `> NetBSDlAPaX NetBSDearmv7hf3D0D 0p@-F5DO-9F 5FT,AF8F48LW!=(@18M-OtFVKp@leSMFI;3h+FOI?7(GѸ@`TФ3h>F+`fpyth+iK8F\ "oȿ+a)io F`@XF8hOc F\L)hPF#`0ZЛB) F\%jhJ"!F\\v0 F\1hPF pCO F\1hH>F#`3h+)FF\j, I I#h8FD\(Dћ\!74h!z; Kn:f*oB² *I\񻼚mQeppGh!!AIFFH: j!Jh3`pG!-pCF-FK"F)F0F`pA0 @FIF f#eA0 I H {zpY@!!0p FFmF@)F0F^ H1F ph-ApG#sFF `ֱ0F\L$h60F\J(Y/I$/H O!.B F(H\Ah+ $I$%Hh#@c`$H[(ѷ O"KpA9F~0F\0Axh-+I$Hd H\&0H)Ft($0+ Oѫf !K-OhFH\I [F IH,$ F3Fj[ AF KX`h+KhKhC/ВKh O +@Kh+8ЍLJI Fkh;k`+(F"F, F (0$ Y,8F[O TI rYoFJEsj#FIF  +?F[1o"O \vLF[F?"FQD(O2(F[B/$I$$H:IFPF\( $H.0C)F8FI"H 8F[0,o(F[*h@a"@b`$J Ch*ZF,,I$!f z!!!!!!!!h!!YF(F[rB5I6H5K Jzh#JFSFO2YF8F[ܸ O F@L)F0F0$h@oKihB (F\`бI$H(F[ I$H0+?P H1F($G2jB K(Fhh! [(f z! !!+!0MF Fj@2iF["C!jHF M0# 05 H[ I H IhF[nFHiFKh(Рm^f ,7!FIH[( I H hH[jFIHKh( F@3f ,C!FIH[p( I H h #H[BFIHKh( F@ f ,N!@IFFH X!KXbpG+"KXbpG0+"I 4I JI aI w hh\$oCFO2H#"#rK]+"oCFO2H#"#ZK ]0+"oCFO2H#"#BK ]+"?#F "H,K] ,"?#F "HKK]v0+"+" KFh[ ?#H" K]p+"0+" KFh[ ?#H" K]p+"+"oCFO2 H##"KQ1 ](,"?#"F HKF`  Fj DIOr-C#BL#FAI88#V#h];JB#CS#`#hX_5H#h4I5J@)C(72I d8F<F .I:F Z=!5*F*IF#;Cx'I*F#"IF"hhBIhC#`Ch8FGIK F`! KC#C#`#`LKKIK0+"p+"+"#=0,"3F`Y! 8KLhMchk`#B#A khc`##81bh;a??xE][4,"+"0+"KQKpG+"0+"J IzJ IzkF[ijG bj IkpCj_ iIG#j(""C#b6##j"G??@nh+#jCzm8@F-BBF F@m"F pFj.؃k"!0FhGI 8k0FhGbp1F FF IjF [k2F)FjjGF@ "iFh [@` Fp +"|K-OرVwLFF#m 1FCEr #DI#v V3B\(#RСl'k jG??bk^I BF\HYF(sFFCbkVI @h+bkRI'FP&2A&2 #<$2 B$22B&2DJVEB&2E #BB723B2#Rc V#BsbCai i5,i#iDca.#R=Q@F<8C2I" O[J23B223BEE2#k 03ak#H0#k[bk I`i  +":0+"^zp*R*xBxKp p:<!F<F*2Bx3L L  L L  L  L  L  L L L L L L L L L𵧰oL#C "mI [&#CiI" [![ Oz|dK eq aL UpEwel &q e6d!Esg V#&%#######HJ6P < F Z #RQ#C?J >I?Id!66 < F Z#RQ#C5J 1I2Id!6 #0F)FOzr>Jd!t 5 < F ZT'+">Mb+"1]*dvF F0 [~-G*L!jc RkCk3j%&+D jG?? bj IvxO dOk2F!hj[jG(#j6Ѧi= ;h+;;` I B0[պajHFУhHch#H####oH ###o"hH#H## Ma@ B. 0 O + 0f0M0Lܳгo$0+FЂK0#0#+`O}K4}K0 #0 yKzH*F5[FQFF0F>FFIF@F>)#F>F IF@F>#9FF(F>zF F 2C# @!# 4ZF:3FH"Rj z3(>L,"k 8,"AFHF> fOsEOry: OsEOrrUxH00+@,0+#HB $hЦ"40+"H,NBy 1F>]KF9FF(F>F FF0F>P#3 -JFIFpH$hȑQ h 2h 2 2C# @!#FRHRKj+ xcQ~VDH !2F+FxFHx0 OsFE{01F@F>[FQFFHF>2F 1F@F>#F>&FF1F@F>#9FF(F>F Q [F 'HlAF0F> ; >OsFEOrAF0F> >OsFEOrAF0F>QIo"+F2F@!z Hx*.3M8,"T;j F!F I &`9F>h6DB epF Mk ."f!-"@WZ-"/"h!."p%NL3hh3U3`U(3h`;3`[Kh D p."-"-"-GF'L#hx . .$HoF(#h||xBN3#`0h'6hF0B FjF(0#!i #"#QFF(F.[ B$h6 F(ں."q."."." Kn:f*oB (КmQeppGIZh!!-GFܑ&nLء0+S8FFh[ -^!hE򘀶F`hOz  D0QF30M(s>HhbWIFWH:WH0;0W@ 0;0+LKhKԛchUHK"`6{h;{`+8F ;hZ:`x绉`+!hB@E0FD`h30AF(>h +IF+H*H0;0+7&Kh 0;0+KhԚ -chUch" Kh˱h8້[>h IF HHpo@F.ch "U#`F-"f!-"."0"."-OFRMF\hX0LK#`00 8$EO#F`0ѲET,R+O+L;I;H 0+QЪh*NвE`4P"$`H:hhh2:`;h;;`3-Kh no hk`:h::`* JhԒD FFF(h+вE0CIH,вEѪh`C00$4 F,-"."."!-"."0" ."FxF!+"I0*F>hI*FFHHxo-I1F+x F!+(>h I*FF H H Kh# I:FHxKh!0" ."OF FB ;h)F (>VhqIFHHHo0"f!-OFF F0F zx'xx$ 20Fs'8F#*iB T20F( 4-hDB(FF(o0"."."-"-AFxF FF!+%I0JF>h I2FF HHo/&)F:F!F3x(F!+(>h I2FF H H Kh# IBFH <4 F!,0"-O$TNFxpsh;s`+A0F FEFneBP۴PFOy  D0IF30ZP>VhphIFHH"#`K`oE#`K hUh%FK`h!f!-"."0"."EP/"0"."-OFDFF; +--=`9 (|LO3;`hB9zNx iAF3h33`>hpIFpH|pHJ3h;3`+;mKh 2 3h;3`+dKhԞ#i*FF>b "F+D,MFpP 0CD< +QH =hB10q i30'>"h<uYF+H#i "3D,еhB5@Bp5F5 D i0)F30>hIFHH0;0A0P;0; Kh?;?= i#U>`-"."f!-"@."/"-OFFFF)H%&DB {:05BI%H x ^+\ HYF3X 5\(4O500 x00 x00 xb!,Egj p#J8Ih# `jFY( ۽0+;J`0+;JS`]-"ht@j  KZh B)iBHo -"-GFMFliO !+iB$4 F6FFi+ #"#9FF0FEP F,̿4,i$kiBH{o-"|-CFF0HloL0B̿H F FFB (F4()i;F"F@ (-hLF-"KJh30 H3oa9 Ki" 2 #Da !z-"B Kh30Ka8@iHo!-"z-OsM؁li p;xY2I +"O (7p )(((iiiiiiiiii^.30-.^. \D"0x?.. .@ 300xA2@ (I> "QF|CF;3>h"+ "QFJCF;3>h"+*..0/li*'/YBYA0xB30z*К Xxpb;.0jikh`3k`,i`B,+iBڥO4-"!."#Lc`ci3( ch3c`h00x,* ;* bh*F#*c`h ѣ` Z x;+`aBу -" I"0FF 0-'h54BDl3"-"8F Fp=hIFHH F8##+iaf!B <\+9@  N0 3h8"#3i0`SIH($HF:(F 0F9Fc I F,/*/"bU"Zpj3iI" F -"J1h8#@ C`-"F H  Q";hO1"@+:-"-A'9LO`a1da, *0I @B"``3x S0x *ћ+2x.*rx *0300FF0;0K#h A! biFM`B0;0+#hԛ8FF]F(o-"h!-GFJLSBhn8&E+(EBEA030%0FF@F hcaF10hIFL#10;0+` hLNѽ%2FAF H0;0+5o#i9F B̿z*F(0FhBF+@FF8FF03`^`00hB¿h5=Dea#h  8FF@FF -"-GF2LhgaF0B ܸB ]OO -4 '00F30F0;0#h E* 0;0##hԛ6h=`i=F'09Fbi@FFXF(o-"-C F*LF FF 030?0;0+:#h 2 H#i9B̿h FHF1Fh9F;#i5p]#10;Y0S hѽo -"-OF`LF'#iB̿H F0FFUEV{B ۷=F0Ou5 D30)FE([0hP;0##hfԚiEJAF10FSc(y0>3fa0(Cbi F(<#10;0+^ h8:ѽ(FF(M+i;DB<ݳ y IF2 =hIFHH0;0#h  i0h;0##hԘYF*i8D=+i-hDRo -">f!F.Lq/1QXibBA+D",(Fw09F30~F=xhIFHjH90;0+#h  0jp;0+#hԛ2x\*rx6/*6-"f!-G#Ll#CаH!gF oB=030@BF5 D)F =h IFHH0;0+#h 7 0nP;0##hԙ1%(@!"p x +8B!@B0/F7D309F(0r;0##hԚ*Fo=1Q"ZU0x!XBXAr!+B%+oB$۵F0Oz  D30QFy(?m0n;03#h?x?z0!xSU0Yx\)љ[xU=F|B0B!EE/F0GF7D309F;(?/0np;03#h?:?<0oZ x1ZU1 [x (H1a+DB!ݳv 1F2 (?0n`;03#h??13Dp!/ DB`s0++1H-"f!Z/"HFF:qCB!ݳw 9F2 (?0np;03#h??10F+D++GQ*ѠJ1h8#@ C`-" KF1x!+ I-OO(CLFCMF0&h;#`?K hKE &`Sa:H h0 `P:FFR o>!hF(,Ji +hO 3+`0FF+h;+`+#Kh  ]"hFB+h;+`+Khԛ&h  XFF!F(:F1F0F( ."."."|02"-"."[K-OhZN|3h3sh3UH4oRL#hQK"`P RO 0,F30,1, # # | FOl E Z?Kh !3h7J0sh`s`0;0+\5KhQ g R. ܾ"  FXP ;DpYhh`py`hHh`X`4Xh#h`#hX`Chh\h#`\`h ; =?d i ^."j D2"/"/"-" ."."-A &M1; ZF J#+`Kh`JhZ`; :X*уh,`DhhB F FDFD2" ."j ."-CF LFFh"hB#hO bh8F PS50Fh`0Z"`d1  "`7(Мf IF H> H `h] D2"f!;IFFH  P!-O]NF FF3h빬IrhK* FGH)FH ]pCO;#`o Ob)F)\o@;?# FVx(pCOгhS FVT(pCO3hkh[+x/+0(FVBH)F FVP3hCF@!F(F:(8~H"F)F (#FxJvOa1ovOb!F ) "F(OajJ `1 `V(eH)F/!(F<(Y/! F4(SG9F@F:LFo-ڧ o(EEB.#=* PVF๼BB.#=P PV눹*PBBTBB?3i-si F+pCO@V`(!F F'F P)F; S PRF!F; S i+_й\$OX8F5f"IX"F0;0+@FFp8F (0' Y/IH2WXRH<3k B8F +𽀵m,Bs ,BA8iB8F1BAh10@_( .pEpF_>NEF   L  Ah+li)BiZJ !0 ` i)>+jTJ !0 l XF7P BFPF 7FBFF8jpHIF76BF3DFF iF(ѵ(jF(ѹ 0YF(`QF 0(Dh`:jJ!F0(D` Fa3jQOsEq9 J!07j,+?KBsD,!J0~7j1+? KBsD18B333<7VUUU-OFONFOJF!Fk+" FF 2!F 7h/(FOVk#Ow(FVFx:h(F: `:h+[1IP0;+R#lyl!ll!l!ll%H\D!j`jFXF8#sal[\0.+ѳi+"!F(F3l+sk!jPFJ9F(F$F Fk+)њ!jHF2#scx2"g}E>-GFhFDI Lr 7:(IjF UL 0 J`#3UR#aO &MFRFAF8FCgxKbmhlC"mCuH~pK`mh3"ian#ehCC boo CCR @!hFR F F й^IHFj+[b#*++ SKc`l+QK2F#c/8F`i#d18G(΀$gj)X[̤`eoPtc0x̐FKhh;EKh3pCO F(Fp2"z-CðF6"!%F9""!9&DBҦ!FBFgF@"wD(FCB "? l"!4D90CE"? 9FFJyI !CFqH,;hZ:` {h;{`+ HFC Ѹy?rY?n;hZ:`x (sh+"F)F`H FTx FpCOT:(WH!FmTh(FTF)FRHapCO@F(FT@a FTFH!F@FT3si4O F!@FTy)F4paFa(@FT8Fi8FT2B !F+H FT ((H!F3h Jz+0#HFQF##3`A0  ###F*FA0 IXF {zZY@ 3"%!h!8_i Yl5elE9F@F01H!F&@FT6 0 @ˌ$ˎaF8FT&H!F8FT`9h+ H!F#@c8FTH!F58FTH9h-+5!FH8FT!F(FT^H)F^wh/?q"F)F H`i!F(FFdwlYlsFhFFFTh( I &(K(F`I!FUTFTTp罱T8 F!LT4TT#"F1F0F( I!T F)FLTEj T>cA-AM@M'kh+lF>IhjF#&#f`T$(9V8J DhOBT(9H2Jh QO4 F M*IjFh#f`#T(90'JhOBT9$"JhOBT(nFIhjF#O3T(/!F8F5!I@Fp`jF I#h3T(9sh Jh@Fj mr =hF;`+ T7hZ` "ppG-OFLhATMO3JO`#33+a`;h+'JbK`kahBЩi"h+UO0kOr!0FTn(`9vJ3Fh ^#`rKkahCЩi)"Or@a0FTN(`9nhJ3Fh u#`&#``KkaOr!0FT4(`9R[J3Fh ZYKka# c`WKhVIhT(9:kiSJh BhT8O0#``+0шjpCOji EI_/CIhT(##+a(i>h(C$#C@ŀ.5.b.$6O@6Kh-*FPFYF7C@0K=``O##h"#7\??9h+##.@o;`'.O`KJh`J`mCIJ+q***OC `j 03"6"o j jj j d"P3"m8@^"^"j .%Kh+0GU_B-OS. `(KOB`OSOOEF=`UO S*FCFPFYF7zuhCO ;`.:hKOs.?|;^"j KMi+ Lch+ݠhOBiFS(`` M03"j #LcbKi #"#h7 F 9Jh  O0h(j 03" Ki* I O0h(K JIhhu03"L"^"BFFF$*F1F8FSD-D F,FFFF$*F1F8FS@D-D F,FpFM Flh,Nh1i)FS`J#s`hB`3` FpSN#s`l`D9vjJh }j FIj 03"^"sFJMlh, FFhBFFN#kbs` Fpsk`3i;+5(59>h +;;I $l`(3#h"#6 hcs($l`#s`(9h+ $l`9hE+,,#kb9h+8h+8h+8h+kj#,I ,Ѫj FI8jJh  KhYi F4! I h| Ij 03"!"Dz2K𵅰 * 0MjhB/Jh:*.I ?O0Xh"`i*"*=@!Y`B4݊BOth'"#6),"F3F7hf6)*!@"i`Z` I  hIT((#k`Ot"Z`kh+I03"j o  m(O-G FuFFO# Oxh(|9)!h6 F%"I9$BqF Fh$6) 8 Jh  O0x`a 0+j ?03"F7LF`h(%5Ki+:+-q[1I p-qR#h'"6H  8(Jh O0``Bc+ڣj+ I"F!h6*)*8J1K-`v(F1F7CII#h0TP(8 Jh # c`j 03"o^" m-O]|O|M F:hX *FXvHV20[bSF2#"F#0+:;h+ˀ䁀!0F##fJ.8V|eK:FV<7DaJ;FLOq.$^JL3FOQ.,@YJYI(Fh ]x0ӱRK!0F##HJ.NJOQ .쌨5>쌩F Sp;h+EK!VhCKBF8FV<78JCFLOq.L;J;F7K 9O!0F h z03Kj;###J.#!HF#J.K 7  A7 FJOqPF.JOQ[F.e猨5댩F Sf,jo !03"6XA^L">^"6" ^"j "^":"-CXMYNYLh+#3`3 0C#i+NKOOh8hAMKMI8hh8h3hIIhSFhjpCO$#C`iSt`@Kh+?Kh+(h(!ShS(h(" 0C #i+ ,O2H9h8)K8h"`3FO3`#C#3`)O#3;hj3b 0CML+h# h#+`;h۱KHh7꨹KOR%hPOI6F F(FI * h3j 6"03""$"L"P3"o "" ^"^""x"-AMI S(8XJh `" S(8H|Jh PzN{Msj@+0C@L0#sKtHhoirI8F7(pI8F7(+i3+j9F;iH|hHyhKh;+5fHq^O9h@FjbHgbHdaHa@Ap(]I79h#[HO40t`KXK"` F MUH@THTH0 QH s+ S+ Y+hi(iiJH#y+HH4OH9h@FDH@A"(6I7(Н0#Ed0"?KFhC F0O0  o -OL ?OOv>I:FR;+1(B:H$Oqؠ%Fo(.DB5ܻFOL#[+*?<0+%-I al,*I"FH-&Kq hBF HOq$%F$B0I ?O0($(,0+I .HOq H)FiGL#(W( )FH J`V o m 4"w4"L"o -OO ;+7 FF+3KJ1RA- F"0+?׮BM+h+?Ү;Kh.#+`B`CXKhB/Hg6K"` F` ¹ F(K+Mh2U#AP%2h)F FlG0F)F F0CM+h+Kh#+` KSQ(A4+?lh+?h KhJ F232,Kh@/6)J[FOyh @I"Kh !bE  $hx D!T U4BIZF S .bBCX)[hsYF0Fj,x#CO0X"^"-AFDL- #*s&%' h0B@!DAq#h!Fi*F6lF+Da0B BA*I  (%K"O7`#Kh#hB+Da'8Fua(26DBr2#h2FF6*F3DaKhYi)0F2)(0"hBDa܈^"<"j "8 Li#hB ٥i!*6`Kah8@X8^"j -AFO FL- @$,=iB1F,F&DF"F6-F#DaO0^"j -CFdFO-v B,8hOyBv 0O,FF"FF6F#D,0f %FO0j ^"-GBC̰FFQXVh 1F"hF6p=KhiF@FQ&( 6^S8J8h b-v U0T/I( O * O0VLBv@F*FQ($0-fvD&@FQ(T6J86BBT I(T6 J8h  V|"^"j F8*TTQ(6J+Fh Q<(64Jh J#4`8Be"pF0FiFQ6("KhB CXRhBBB0CXRhBB I2F (F&p%%"v0 FFiFQ( '0Kh۹pCOI F5D FQ(-6P J#Fh WO0 FQ(Kh06<J#F"$"e𵯰FF6F4#g##9'N3h&Kh  FQ퀻3h[## J!Kh[##J!iF FQN`6hN+6J#Fh /6 J#Fh -iF FQ0 o o MbpF FFQ p2F)F FQ(Kh0&6J#Fh O0$" FQhKh0 6#FJ@h $"%-OFx̠ F/+F0O7 FO/O /!+F(HЀiF FQXF@ Ft0/#0iF FQ옻p@@O0'0#2F)F F}! FQ(iF FQh FAq#jF F XF'/'O0`"-GFh#x/+ 2Mhh(1I"#k`O09 "G@AQ%0U H6#h#J3h N3h B'0`!h;FBF1,(60C@$8F<:( K$h004 JQF 4`D"B$"h"-AF FFFFQ((@.Kh (BBBB#I2F O0pCOI F5Nh FQ(6^J#Fh f FQ(/ !F0FQ(6F F(/J3FAF B"S0F(4pCO*BCDXCh*s!PPBp## E `iF(FQ0pCO  I*FO0'0#"#iF(FMSF( P Q# 18pG-AF]VD,Q(69J#Fh 7Kh;@$ F<F2Jh(?+=( F.Kh.KhC""RS 3 F#b4۱5 F)FQ( 6J#Fh  FQJ#4`(t'`g(t(@0CQV QR#0 'B`"d" o o B"-OV[@3(t@)FM@  FDFO 4;+܀KHh4xKhc FQF0,pB On9F F (|чKh0@$ F<), *(@(@F>4 +(tKxHh4! FQ(̀ FQ^(6nJCFh Gq F#R)h 2 F0#dKh+$SU 3QJBJA"@F#cF@2 FPTC,!6#FPJhPF+6x5йzIKhGJ#FIF tFTGW[#9F FQ^GG9F FPV:I"F O0S @!FPtH4I"F FO @$ F<(O (4) o@ao`a @(4*?:3$@@3*F F@Aqg0+K(4F 0C JhC M#7L"X"`" o Yh"d" o pG-OFFFF FѤ ^0+#`00CEFEF[0h[f#FBFx3*#` # 8*F!F8FBH5$J/A$*F8F3)85Jh KthhDFnFI O0IH hqj!F0D$ `*D f4F}""""sF F p$O2O33) 5& J+Fh F-O0I"F0FP(5J+F "0Fh F(PO3+` KhSQT"4  3EE#0 "-G"]WFO "]$FFF _(O RF(RF0FP( E(Iy#3BDBCXKhKEB T I( shJjh_#  ##$$" " (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (0 >ZvL" pFhF# M*8 ]CB FvO@JJ&h pp?K-Ah FS;IBF F FAPV(S 3 #!<!F@*K*I/F(F F#s#844;+c#ؚj FKѲ3 C "I CFI F4*I B F F/# FIx+ I B!F $"fF;S 3#F9S(tH#7F FC1p!x 0?"hF)FhF)F F0@PٽDFB4F (*O +0 ,08B#FA,78a,W808B+0, 8%)O4BBDF;$(D:ѓBQO0 8 (AqOF305W5Q]pPBD FDO0"5! FADq00 QГB FpDB Ґ0x+@iCO2?oEBpBu[k AaF BF* NFFF )*F FB+0:ղ-APqAq F;0ֲ . AqAqBغAֲ. Aq 0Aa;ڲ* Aq 0AAqO0Fp;D,=&BPO0 p; -O,F@pvO404W4\pPPBD FDO0"4X F@Ap04IPГB Kh, I FO2`e F$$"-A FȀ!+LF!hi.Kih!` x-) !y'$I1 !q`!y!hO'`x!`!!q!yyC)F0FAP')F0FAP9FF)F2F4~#UP"IH !KhQЂB`o L!F H!F H!FHH!F p!7-OFdFO YF@FHYF FR@F8F0CF 5J;Fh 0F/#cUNF|N-O FF/! h(I0O9F F(pO JF_FM#`0 KOJ!F0F C"KhKh]Y*"JX+ FI `*56V@ hz(<S  Q_cc-5=[aimqu!%5!9=AK܀T1K(` /I 40@` +*K)Khx-*(JYx#``#$K"#K$J`#K#K#KKh+!Hu(ˀK"`#`hK"`J#`J`J`|X\"P"j $!o !$"^"j $(D3""H3""t"o `"d" o L""K Kh&(= zKK KKJ+i3+aKhka&K|E  XFOF I KNJKNK"E%`X؀IK(q FIDIOrE%=BK"E`7&KE>H IF2 O30&HF\(4I v#Kh5(E.K"E` ,K"Eu`*I [ջ(K"$KEej ^"""$(D3""H3""""o  """"!="_""3"";3" o d"`"o j kKh(EefKhZ(EUbK"EU``K"EE`^K"EE`z\K"C`u[KqZKrSKhYKXXKXJUXKib&# `VKF+@;CH SITHSLTNQO-O3Y#OI0;0+%ڰ1 FIJ*@?# `GKJ#75# `AK+@"1F@8F%\0Z "p h+5K6J`6M7++?k2M+hBf"T#Ft(+h3+`+V'KhB&I >%KT&`h(T#!(߭+h3+`+hBK"`1$(x"t"p"l"o H"H3"" G!h! 0."@n $!P"j Khh`pGP"8KhK ILhMh8 KHh2 @#!F(F(8P"" !L"X1FF"2`,FO ?(1*(6,B/![(+̼ox"!/ F4x]-5ѧ!GBGAB;x "Jh*O0/+7`+,*1%F+kx*++9F7 x+#2F F(?-А-ѐ о]ЬEEؿ"E""FhDx/+5CF(@o I,O0`h1FBCD;aB8 D0(DB (py}9=.KFh M,H,L,N-O(F F0F8F@A(:$I20"H0@CBH03H M.+ѝ@$H F.FHV0F`@BF0F"(`O0L""DNp-O]|K0 EFFF @@BFh"PO9Osi#0 ")FN(@Fh LcB٘E LcE𼀳hDF1h LcBҊF+MDO@F ]&*3\*-Hx1  08 B* (R*B F)D LcD\(&( F+QF3I:F hD LcBS+x La+FBF+##p Lc B+x!I[F:F Osi?QѶiE+ si0xI:FH0x+?l?-@BYF8F!t`# I[F:FH Ld" .!D-CFMx"JI ~,EF+xFI2Fp\+55B F(='"AF*p8F9FOcjF9F 7I3FjFS FO802x(F+F+x38F` F\+55BO / `88FJ F!I*FQKahr`\`@F Mg)P)S)G)8F( F3xI2F+p p) s)ciCciCcaciCZhaNg"-AFFFx;I O0 GF I%`E`0F0 K``hDh(F`Ta  " K M N Oh#"i 9F "h)F0F#di"f!F 1Kh*RVD,L-I h!i%A!a(F@(Ih/ah) 3FBRi4` F#4p0/ ``I Uch /"p#c`O5ch/"p#c`%h(F0`8+\/+#+TO`#aD%*I *"""p  V#F4Kh#i.hy/+di,Kh@ Kh+KhO0 h9F( KDh+(F\(# 4 h"9F """F]KFh[y.+Cy.+уy/+˱WI(FD*FF2x)Z*,.*,.*  .F : . t  []0Pm.+O0I.F`!F ;0cx0;3D+Oka F;0Kx !31;+a"F ;0cxF0;3`"F ;0cxF0;3`#x !(F0cx0;3k`(:@0O0 #x &!0cx0;3d"SClskax0x0:"Dd3!F!FAM/hS@= Z "-CFKFFh@=1lT!  FI h,#BB FDF#v,F"  Lch !@``( IO0" BK-OF^h.XX4+I84+DB0CX@Sh8F1V!F\F LF#BBBB* i, F(.8 `xU'a##ca9F*@  FI lO0!h @@B!04+ ## 4i;a+i h0 F " "K-AF\hS8$*-4+);+&B0CX@0F1| T!@U 5#EBiBB F+ѽ h0 FA"K-A\h&T4OV_]/Fi8hi8Ff-ѴBѽ"8Lh!LGP`8I O4 F8JKh S BB M(hK`CF2+h Jh (hN$" D"G @"$o U  Lh !@ }`( IO0"y  L#h !@=c `( IhO0" P" 07@ @B-O[NF3h+B C PO0B0C XPF0CEBCO#CFGFF(Eh+:0AP"F(@BBX"(SZN q(IhxaB C`E`B0CP>BEB<i  BE""C("FBE/ 2X##h a` I *I  ##"  Li !@={a( IO0"N-CNiñ%O F@Gi\Yd### hj5B"-OF-F&KF.@=HF1X!P}+FYEHEBBЛj+0 FPF. `vbH#@ FI O"-AFKFFFiԱ@=F1FT!@jBEBBB(FO0` hJ FG " pGF!KMFFh{x/+ iF8I*F  MF( FhI*F , F M@(F.@ `(3`## ##07Kiab``""-AMNOilcha3h cjh h:h0C #3### h{ Kh!j h h Fi"d" o o o @)s¿@9@@!F$%FBSBO8F2~D1F F1fFpP%5 D-OFLM@,@ЀFLGRXk1F@FT @FL$O #hB.Фi, [F(q#"#0)_2FAFwBLU&`##0S' aC'@ 8#0#BB 2 Jh O0 2F0B2J2FAF0(B`CXKhQBA # M2 Jh  F2JI h0Po"$o /K-GFhF>-I0FM$ F@"V F; F(=@F.F `(F.```F'@@F1jF(`(F1F1`(0F(F.( I O4F@F FI"F KFFh h@"T @T!h(F1(0ah:F(F 0`h"pF%)O0BB6.1O/..O /CVTCUTBDEt01TPBD4 FD8"0!2hTO0 p #ST\UTlFF0OpB DB0[(DDK@,-A]\FO\ *F:KD.&h#BD",x/+:4JkF@  ( (IO0 ]KZ*, CDlD2L?,#DlF7 CDFJkF@  (z |(JkF@  (l n(ڵ JkF@  (^ _!!pFh FF*F3e-p@(e"MF F hJ#(F#`3`pF  FI ,O`!aKhO`!pGOp"0#L#`C_B  hY`ah3!`!`h(̿  0O0"8F'x+"IJйhc!` F8Ig"FOqF(F$O4#`O4V(o \-CNOxPF%h1F(F0xch*FI 4KJI .O09FHF0n( :*IKF*FK"`"o -AFFOq0F}(O0BB! FU1S #840K;+bK@A@A ` @[K "dFBH"F (l"F<t" !@|u??Dy`" !B`BPBPBK`PBpBK`PK`#h<SC  2)+1)90y($/(5)=#BB4#($84K*K)xh " "$T X`QBC!C#4(4C C(43y /+0qA#4#84(4CCBB($BB!X |hQBC$"""-CVŰF4Z*. -%%%Jh"%TI( TI(TI(TI(,d*|I B%h+5c-wI:F@!O19Fd" 4WO +G" D/"," #@FIF(MTbI(+ 2# A d"0 j#;+1##0BCX #Ih 0 *F BAr 0 R l DB"D< "D0!1:mB#G\G<=K COS#(xF(<#nF( @#d(#%@F #IFZF({@#)F(#JF(k@( O5(FE8TI( !(4 ++"Hmp" pG pGpF.xcI"0FlFI0F0KZhi CCI F"a"FOqF(F,BFI2F O4 FpV'"/-CFFOq0F(O60FBB!(FT1TS#84Yq_@FY@B Hr + K#1# +7L#0-K jSBH<#H<F0 BAr05YR "BD< "D0!1t8T I( +O 7#0#0BCXSBIhH0  BAr05YR8"nVRK19<#F(TKH @#(TEHDKO  C% S #sF(T:H!<!ܰF@IFYF "F  "AFYF 5Oq)F(#=F(T HOq(O5" !(pj@4 +?+1ji3jU(ZBXSBp()p"0]F FBB!hF1 S@B I 3`~ K - B"ZbZb,"hhF2b ]00"8F.NoFI"F )F F8@&-AFx-+Cx+5I0FF1hI2FF dO07o3F:FAF T F((FF(KB(F FM'<h!OL h8+ h+@pG"pL,FO0p KZh*!F(& !(F.U&(p0F"3S[K"`KhKhCL#h+I ##`KI Hh>)F H+I 0@pG<"x"""!L"p8!HLI4M(`PI F.h` 8(hD FL Kh+ JIO0)""v s FSkK"`KhKhCM+h+I #+`KIHhH1F+D, FIF H I pp@pG<"x"""!L"p!1fIFH !̰HF8x/+$II FعiF FL0H&L0&BB*BB$ FL# Jh3`pG"1IFHF x!-AF>OFF|h9F"8""p$ N%F0Fh+46',(FpZhx5F8"-G/N3h33`F#FF*HP+:1')ѫB &H)Wh?xD# 3h3h;3`# Kh K")F Fpp&O 'E FGV?@FYh 3hh Ch;C`+  hY`  phZ`"8"!" " q F /2'!/(HD8"FF.h$ qh8F/F(F(F F5F8 M(F F`D M+hh`+h3+`Ca, $ F8" "-AFF8FM+h3+`F F8F#```@F3h#`+h;`4`+`3KhA4""pFFhTah(F/8&h$ Fp$hF!h-G (M ^+hh,B F=! &FxHFFxIJF$ +h*`IF8F  0hCh;C`+ 2hhY` "phZ`#HF;fO$N """ q q -CKMNhI+hF+P7@" F.jKxr\ Z[x\ёH#F +`\ЈK'FhK`?\> p2F!F00 /`/*k* *zHF% a &( \ wwwwwwwwwwwwwwwwwwwww wwwwA'1w a x=+D 0 F" ?*9*٢:(R #|*/~*V^*z h2 `$;"q  F F     bxF=*7>* )`*bxF<*=*/ bxF|*F Lcxa&+ F Ecxa=+! F > cx++4' 6cx-+4( 0) .& ,# *$ (F %F "!FF !"*""0""u"FKHh""Ks[hM.h+` lK.`0FH"xK*F0"` F.F F0hx0h3IxJR\ HL3(F!Fp""p ""*"8FFF#- _iXfm {6E'.2~ t=HR;HO(ѳ??6H ,.FF8.CC3DAa?  @ !CC@?   XA@XCABq BA !BABqBB  BB @@P@Y@CC" ##-OFFx %*F F-U G9F. &*FH##F ;FG1FFPFUMFF F(F!F'#""K𵍰#FF#q,F F;F2FF F(F!F (Р +Z9FF F/. TF F F FJ!T&" "8 FMh)+8'!F"-OFFFFO O ,q,{,8,;\H,##FLFF$,y",1FHF0#+F F NH7'+عqJH  !D EE'+#.ѹ'OO2"FE&3J&8h" 8hF F##FkK F#%#3F9FFHFeP $$##y3F9FFHFSCCn.', JO4$&F$F!E&"_#6#D#"-OFFFF8##F1+FF F @ F F2  E%"FcF@F FE20F:FCFF F) EFF&FFF--"-CFFNh+F F#F Fh+##FU9F HCFFHFU P%%$(F!F5F"-CFFP0+F F##FU1FHCFF8F(C!CPO%%(F!F"𵇰NF F FaL!%(숱CxI+уxN+ F'70 !%(a4`aT!hF F#H0(F!F"q#(-GP(Mh7(L 'K & hh0*x  0;Jp0+k +0+xF;F=Fro+{#h9FK(FhFF F H F zU  PMo o "#" Jh@F#F/))`!`"F̰ Lx/+HiFKv0& FKp0&BB*BB  pFOu(F)FFJH FKX` Fp@ F/h"+mF/hFHHp"#pF Nrhr Kha H`F (Fp`p Fp@"ho #-OFY}MkhchzL #h3#`kh`#k`#h;#`#sKh lh\h"pH ~ihoH" y lH!F F8FiN,0B9F(`dK@h3`;x/+oh;F7x*Q)Fh FF FF/02F)Fh FFO0R FFO0 FSK/!Fh@pG8 FF/*F!F8@hO0R]pG FFO0 JF0 H ! J *HBѲBPh2"t$KhpG("pFJ`F h( ")FJBF hJ&``h( "!JCF`hJf`(FpO57 MP+hhK"6 N mK\h\-h w Kh#F2F(F`hBB $h0 "p ("X"sF#N Fh+' &<#XC`h(F1F.HJF! Fg j` g++%J#x6+ cx0+I" Fhp F,"D=0+<.+(F"pN@("%%K"`"apG("F #h;+h "iFd[h#a iH "iFZ" FYhdhhhh a0L%jH*F!U00 bB H!U0 J#jhy`q j0 jK#b("lo T9to Fh+уhch@Kh"hh3X"h-GF!9O0FO5F;h3;`6hFsh2M+]@Fhb;h;;`#.Kh h1`h#hhF( -(FJP/HhbFHrh@Fah:".;h;;`#0 -!(F +J(! `h!-(FJPJ$hlb"(""%-CFOF^Ph-@!? @ !h)4ewpEU-@ՀpK]bpKh +̀kKXj(ǀ-Ā `hAF^0bKhh, `h!^0#ZKZjhC`h!^0+QKh*[j+OKh i1F FK$1F F_FKh W1F FuAKh M`h![^0+9Kh*Zj*h,\b5Kh 4AF F0Kh *AF FP+Kh AF F&Kh "i$K`h!JSj[ Sb`h!K\j,?f"ZbKh F"1F F H @ H {%,F* :p (""x" &p -GF!K!(Ft&hl` @EF EK^bױ ^0kchD(F& 0+!F"("p p (-GH(Mh7%L $K & hh0*x  0;Jp0+k +0+xF;F=F+{#hIF K(FjlKXjhK"Zbo o (""-A LF&i3ahh!"^0hh+#i;#a+ #`+ #i;#a+#`ifb;a;+fj*hcj * +Ѩh9Fhfj++("p -OF8ILF^`fj 'oh/``i3a/m)i0+39Kh0 6H h Ch;C`+B ] hY`="pxh Ch;C`+3 J hY` "p &"yhh h ^ fj"h;+#i;#a+`?h"AF8FhhhZ`hZ`+#i;#a+`ifb;a ("0"Ҧp "q -CFFh`h"0Nh,1h #$h dh+i(F0YhL# #h9Fh +#ieh0 sj5,Fh^P-sb mh#F(""p -GFhFx*h I 0chSLKMNhMK0h JH 0GH -FH 0hCh;C`+* n2hhY` "p0h L=N-3h3`! FlJF!FF(O-4OQ#{b'QF0h " zhZ` (7(3h;3`#&Kh h! ,`hGq3h;3`#Kh - И0뱣h۱KhK0hr zH w KGh -'PFgxb0"q "&.&>&"(""B&p NKpȰhh##HK0۱hñFK &FMhFK0h& -CH *hAH $-hhZ`hZ`X""("""p x""l&0"q d0hCh;C`+ }2hhY`phh $ -hhZ`"F)F mh( $xhZ`#p0Keh:F1F(F 5$hKB%CFF;VF˼-ѐ- рx8 |Kp(%F (0+YD#p0p0+?;+gJB?fJB? 2p03+ U(p)9)WJ# + TK"Z`h`@"` C O3NKk rLK!h) F(@TFK)`EKh3B@6 h +X\#p0p08L+ )FOA`` 6Jh#c3`4K"`#3J`3J`b1KhS#SG`b &K` *K*J`*K+J` # g 'K`K"Z`* cԁ3@KB@+ KhQ`hR`"`+@@k"H1)+#$q (" "X" ""$($! q p q q "K&0+*ѽp0;[hh Kh "`"KbIGF((< K` ~K`~Kj*Ob[F F  #(VCuK`uKh+>;.oJh;h`3 F1FlHjKh+wF)xfKh+_J bI+ [KaKXjhZKBh )` TK  jN^ C #F IL#cb +@s `bFK"`EKh+?1-->Kj;H! B;J`;Kh+h !6N F M$5F"+h`#`Os(L;3`3`#h3#`!Kh`  !#h;#`#Kh )!"(BKh+$\  K! `K`K` K`L$ FA+h#` p "(" """}&"`""""sKh )`Cr XnJ`nJ`nLB i3aziH$ eJi;ahcL3` `K F`XK`XK`+h #`QK`TJh;`OKh*""CJKXj KKh+4HJBHJB­CK!h`# 8 AKh6K"Zb++K~"!Z`\"> -AF F*sL$>Kh3"1FhFFah5H 8F A2H 2H )0H1F z.Lk hCh;C`+B h"hhY`*"p hCh;C`+8 Z"hhY` "p4H H1F -M`h+h3+` "FhF+h;+`#Kh H  HH1FhZ`hZ`X"'0'9'z q B'""L'R'V'8FL h0*xxB%+`h8)F,.(4 8FL h@x+xB)F,`h844  K"0%h IQ;:0(,۝rho d"-CFL%dd#h3#` 0ChBh;`8h(5|-#h;#`k KhSCV+0F""d"o -CF KO5Bt&h3xF+B:*4F:)тtzN3h+j5` F5`F4F%*i9FHF2(5F<:+6k$X"o u'-A&MX+h3+` 0+#h`h;` ( F(# -h+-h+-Os+O3`,`1Jh2BDI D '!0F6(Iа **уzF"  0* j` jԀJh*"Т$0FFyL#h3#`+@!0FF *O   pFjJh*ۺ0к * eJ0hO O8"1FEFع* YK!HFh5WI2FF F FOs+aO39:x/*A 8FHx(D pBO{ *O t8F*DBKDh00 c(F#h;#`#Kh W0"p "!@0+@h | -O&|F5F4F@FP9h xc+E"CЂHPp(v(V($&%zH?4 h*@ՀvHvJc+FuH/ F Z! FFH.@1F F'F( Bh *R #xB!FXF+L(-tYH u'-6WH o !"@TH$ e8F 0hsNL hCh;C`+ "hhY` "p0 h,@FAH,F <\FhZ`/! F"<0"!F.? E1I)J1HF A8F =,Jh! FH((H 0!Fչ,hF#H-"H|-!Hx- Ht H OO~OOC" FO DKh3'('+(@(U(c( q s('y(X"(j((((f' "-OFgMF0F(hk`J@ ,<Њ,؀,:,1 ,)/,10;0+bKF + \#KKKKKKKKKKFF80 )>L9H#h3#`x7H F0GHPO "O/*3x/+ 0F JK#p /K :* Ҳ * "h:"`**hQ)`"h:"`* *hQ)`ZFB*`B*`"p ".o -AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`3h;3`+;h+"#caFh[aaNOcihHhBȿ`XhB"3h33`ci3h;3`+;h+""""7Fx F!+$Kh0 0@+*+ Khh(=;S(x* 0; +,"# "` FF,h{x =+ \ Kh-x+ KhBۛhDKh 5,Bh+ 0 Fл 6. ">9)H+. *ZF qBQF H!FO h2#&rDCJ :* Ҳ * : "+ : ` "F"""("".o o EK-OF[i FK G`kh`h`>KF&ZhVh0 0;DE #x+ D`F xɲ)K `(F~&)AO 0iD`lh `h`aTF E#x+$Ё+@F  F!0H! F@F!p H!LEF(TFF &F"l"F9"8q M L Nhhha#hh3#`@#ho`;#`+3h+"""8F)d0)FFL KjD``b8") FOF";F;#9F`F0FFih`h+(4`&F#hC%`2F6hF#FF5`.F+h+,`F! ȿh1-O' FFFF[غ*Zк?Lк"#xЁ+4#xSE 4[) غ\#xЁ+4"xCx' x۲+E #x+ cx;@& 4#x+ #xЁ+4Bx#xRКB4#xЁ+4;Cx+*+Ё+xҲ*?+[+'FF0F?*@bxB44"xBBx!*^*Dуx-)?s])!*^*5у""x*и/Ё*-bO x+xɲ)@*?P[*FX:) WI(F x%(FK -x[!FL3F3F"BZx*њx*ШB*xGIR\ B EOҎF()x)5B)x4J 5E>rFF*\*FF+x-+5kx]+2Ё+.\+,5+#1(##(ؿO +F+]*dZE?F45BO F;x+?֮7NF/;NMLx+EЛ] ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xppK&pMԡhBK yc0eO;0+;hZ:`"yp6bK^Lh!h' `^K^K^K}C;`#yp@/UKhOJ!bh,KLW;+x+1#hGM;#`++hZ*`"p#h;#`++hZ*`"p;h+#h;M;#`+d+hZ*`"p:C+`#p3C+`#p-M=x+0 ;+ #h;#`++hZ*`"p#h;#`+S+hY)`xpC+`#pZB*`xp#h;#`+ S+hY)`xpx+ћZB*`xpC+`#pm".""hl"L""o p KMLZhVhK3KY;+?$ /0x;0+?𒀗ЃK0 ;+ +h;+`+t#hZ"`"p+h;+`+q#hZ"` 0 ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xpYC#`#pRZB"`xp 3۲ + +h;+`+#hZ"`+h;+`+S#hY!`xpx+ц%C#`ZB"`xpO C#`#p C#`RA*N/Kx+?G+h;+`+#hZ"`p<C#`p6_,KhBZhD00B s;?;h<`0;0+ c;`##p;h;;`030?C;`#p"o o "-CFLFxOh!p'ha0ga#`Kh00;0B#hZ"`p0 h"1F"Fc FC#`p"o o "-AF-LFA,H hCh;C`+&e"hhY`&O"pB"HAF hCh;C`+N"hhY`&O"pB hZ`W&6'DhZ`W& hCh;C`+ %"hhY`6hZ` q H)H)KhpGhB`o Kh) Khj3c1 i@ pGh(h pG pG"o Kh2`Zh:Z`pG"-AFMFlF+h3+`0j  0j`bKZhB`h`h$hB`g+h;+`KKh3Aa$"""o K-AhN,j3h'i33`@F'2`D< + +KhiCah#`K$5bhZ`h`h`#hEob#``O02 i+u#h;#`+chZb`x*^h+3h*Th#+BF!@FE@S"!@FE6(8FZ3h"`Za2hahSi D!c`FQa1h Ji@ (&!J,+2Ja!h:`*ch;#`+#+p#.x+pK03`h%Kh.pahi!`!F)oo "p q <)p q  L#h;#`+chZb`x<#h;#`+ڽ@1"8 L J#hh`hRhaabhZ`#h`O3 ``#3ao "FLFI#h3#`"!(FEN3hh(7hi`#O`aa K"``#s`#h;#`3Kh@"mo ""F.N!F3h33`E@*H)FE툻pCO+#" F(P"" FE(F I( FE@H)F#" F#(P FE0H)F F^BE& H9Fn3h;3`# Kh +"+Y)^){))"FLF#h3#` , O(F}`'N K^`#h;#`8``3Kh@P""o "pNM4h+hh3+`(Li#j˹#h F3`3h Jh`i`i[hQ`s`+h;+`KKh3p@po """KhpGo pFNM3hB ЫBѬBH$po ")8ML+hB8o "8FPM+hh(+h`8o KhB`pGo $Jh$LcC#LehB %2FE ݖF2R|B 5 b`) )$O30 bhU%b)Ldp/0"Fbhc` \"5rOo FRMhB QKhQL(g hCyNH!E `0'8F&P7/GHGK"N 8FE `0 hAI `E hz(`EFhB! ! ! 5O! E09hB E0*h"F*H 9h h0;*h"F$H.E hB 0FE0*h"Fh h0*|h"F h! O3#`! ! `~\""o ))p s")*F0+fH2K2Hha2LaC10N% !Ow3h33`B 0B(%K(Hha%LaC103[h? ѻB5!0* h(Ћ#FH OpO5'; 3h;3`Kh@\Qh сBU`p2\"G*5rO"*n*"8FM+hB+`Њ@! Fa+h;+`3Kh8@8""-OFFF 0hI FOͼؐQB0+-і0+k0Fݪ IFPhShBE_  ++ +E 9Ѐ F0#00CE@qKrHhrKr@hZCBG'B "-"gJ!{&~Fh bJ !0XFkXF&nD  Q^YIXFPO &\!FDch;c`+ F#h7/"`!F|պch;c`+ F#hZ"` "pch;c`+ F{#hZ"`|"pch;c`+ Fn#hFZ"` "p^+" ".J!O#(J!XF&J!XF(OsB "YF 0~XF&DH@qYF F :7?# 0GF\"o 5rO**?****0Fp@ӹ ; CCDXh PU4mh-(FB! p$& F+OrB 0-OFFGKHH[h x%+d XFXFCAH+&@JQhB"h"D0۱ Fkx+Ъx:-+++%+3K $i ,,HO)Fg'KZhSD(K!(Hh3000+ kxp?+QF8FL4F69FXF8(h((F&9KC;Ԕ Z) "R,B4HH$o **\"* +-G/N0H03ic.M/O+h!hP0F#+H+H!1h OA%H2O yC10CE!Ch;C`+# hY` "p| F+hh"[h*`+ PF 1]hZ`\" "5rO*++L+* q -A'@L=F>F F0s;D+;Hj(p(g(&'%5Khh[h 3H!Fh0KhD/ILCa.H%(FF&y)H-:0;! KC#HX5F# sC8F6XCh;C`+M0 hB̿ # #P`p0B0hB̿ # #Q` O.F(T+X+ "+\"5rO+ q KFiH!H@dB F\"*JiH#;pG2 pG pG\"-GFOM+i+F>\#+a@F;@HN3h33`(VOhp(`C"! FO>D"F82?d3k`3h;3`#8Kh s5N! F3h33`Os02K0+#0#63h0/H xC3h;3`##Kh H F0 F40O QFF)#F"EPF,`2B03!B *4p@\"""p F?JFFh`=K>J` F F7 :K`/h..8KN0+A0˹DHF)F D쮹1K)Fh0)bh}@BF*H0h!F }!F y!K60s!F q!F m!F i/K"a.!F !F 0+F(D& H)FD( I H." ""\"p o *%+ FF JN js0+ ""BO0Dؾ"Fp -OFF #`jL@FCFw)h+#h+(F00! O2OqBؾ 3BЀ0!F0S?ЪE ?  ъEy?  E"3@D@O4O\` 0`FO"4P"90C09($0300F0!#B{00Kh+K60+""Bѹ*{K!Fhv0;0+N Kh+?IEEEє""p q ""\""-GF F F " F(.KN04,N0hFDB4hDF FF0)h@j"F H]O| &@0BڽO0C0C0 F64Д0ոД0#0*F!F8Fp o *\"$!M(F>` M,+hhё xH$ l(p(Z($$$ K6 "0 D@N+h!7hh8"FF8F+h*`[h+0h!FC+ "zp q -O$NOF0FFPFF FH!Fn-p-H,, &:,pF N Fp0F F%ch0Fdh~pFN5KFa6 N0+$2$a}i+ <."+*UZpp"pp$i"p\"p -AFKFFFh|*/KN@L@0+@!F@FCV/KH S0#ZCO3AC`#r@1F@FDF$"p o -AFFFvCFЀF:F1F(FA(hFHF:F(F1FT F,-OFd@ #0LN KKPO LZhKGKhh 3H30KE"YFhFF`=0+-#x+9#F/*/)4 F,C(" "B#rگ z%L F%L hCh;C`+5&"hhY` "p"##  65S] :+хL#hBK*Fh F(^#cU=FKh+F I F0hZ`""",q o o ","d\"-AFkЀ-L'0 06P-9.9'K!h &$H(F#^0!JB'1/ܔ^0@60.0sH7D((e 0F(Д^P- J/FhKBKA)F`p q q p ,p""px+B!M!+h3+`C!+h;+`#Kh ,+M@,`&#0@$#0 [ 0;#0#0p@&Fp""p 8!LF#h3#`C:( !#h;#`S +8@uH)FKh+"+"8F F]@-`hU 8?H -H -8F%n0)FFV F8L&M#hBڶ+h7FOw83+`bhFpC+`+h;+`#Kh R+hh3+``#h#`+h;+`#Kh @8Fo ""0I " CX4Jhh` D`--o KZh`hhB``Kh`ZhX`apGo "pFMN+h3+`ph#hBchh`h3` K`+h;+`[ KhCp@hs`p"o "" Li#h3#`KZ`#h;#`3Kh@Ͼ"""-G*L+Oj;h3;`3OIEk%3B-3h)0Fc`ch `#h```D00%`hB ;h;;`KhӱGhh"DRi(FJFQFF(#h`+D#`o """ J0 h3` KhD`h`h;`#Kh QpG"o "p M Nh,h( ۴o"Fh`oCBH$, D4C hp$d5UFF-8F ApG, 4S l)F@FDh(F$F8--ON$M #C0FF0Kh3hHp/r/d/+hx,h#<$ F9e!HKXO LF(FSJ h"`%"  B(F@𲀝\)(\+C FB(@𠀝 *Н)и"h:"`*HPFFsJ%h B)6(gH0(@𹀝%ph"h"h:"`*#PFF-Ѹ"h:"`*PFF F + F + F +xDI0h&\F:"`*PF0[=J6O h"`Z|rw#h3#`p3K"0hhd" '+L%h=a"h2"`Fp(L :$MO "hJDE#H"FC!h"0h>LV8F " ((F "!F-L%CV-" "\-;F9"o o d-A&yL FF(@030BFB0;0#mKh .kKhh-|.u^r#5F0"5kDw" ,c5kDx" , O <^r#03F3jDw!"3jDx!3ekDOHF,\r# 06kDw",6kDx",LH,FKNKILL#h3y@F#y\IF74/CL hCh;C`+k"hhY`>N$>O "p)h9y@F*2F:F45,ѽhZ`2H,N1O܀yyB*h\@F45,%L hCh;C`+ ."hhY` "p*y8F\hZ`)I&RhF F4y3,ѻ $&U6A8F&< !F0FC6.K:F H]p //< q ///////// KF $yBѽ@0(KHY\p //8Fych=U h8@ 8-AF T 0F0+р<FFT_e L=` F##qe(FG "-AF1N#sàih*MFa-) Qx)=-)ђx*@% +)2гa8Mc(D (o(;xC,8F)F!)Dih@,a)F!)D)F FKHY])FZ%$ K@@,[h+ѽAr"//p "-A(PMȿ OLFO ȿaOؿa3+q sih#ci#06ѕp/ #`@F#@6p0+6060+ЕN0F +60N0*3h#b+x-+#F0%K"y23)*ѕ0ai!i#Hi2hM*`ha bw#j+`ci+"ibq "h`FFh32%`aAh*!Zh*3"ba p "0X"(-CHG HhHFM+hBH$OFh+`:hF2:`իh$t;T+C/*;h`;;`# Kh +y  0".0""(F#@FF1 L #h3#`@ Kih V#h;#`#Kh """x0; + "!(K"Xq`"-OFF8F x+A1h) hc4h%?' $F4`3NJ !]OrJHWp':FpCHFLT}7`p: 7x-*\xZ,11`Yx-)ћx+xFxB :+T3hRxh*;,;ѐ:1"F,H@pFx:+"F$H@pFO? %WF#F5`I:FH!FH\xY:, 3 FI:FEѣF33`YFH"O F5h %3n I"HF%(Fv0D0K0q _0( F H K( Yyh)!`aYqK;}0""pF Lcj xIi h px-(Xx(aXx-(јx(К3FxBRxF:*[xiah Ha( HVxP:. 2Fb%eb"00p L M#hk+p+h&;+`+k"hk;cp "BhF"h,#FZh:Z`F$hD`8FEhkC`+݈ #CCh"bZځ"h`8F !"Jhij`$p F;  pGxɲ)ف+тF3۲ + pGxFI[\pG\?+ pG*xFI[\pG@ \=( pG*FKHhkp o1pF FFa(Fh(FKhB`KhB`p+x-+kxO3`HKhkkt a""1p -OgMF+h?F:xaH`K`J`Nhh2`+rѹ?:xr*3h;3`+O FRKkhRK(hha\D*2`5 FF (F82h:2`*- FF+h3+`?F2h:+*_2` FF +h3+`?FєFF2h:FF ЈE-BFFYB ()h1)`h`C ( Q (p+h3+`Khh`g"@F *^^o o o "p KF Fhi *ўi0F#|3F (JJ"!hFlhF#phDmJ+F!bhF K Jj,KJ#jp 11111𵇰F F1Kh*F! F=KhBF#2OC-%y>(1##`00F`\b0 a)(F(0 Fbb00Fa0 (FPF|(#&(###`(8%u<(>(#&(###'#` `0 (j\`a0j-("``M##FC#*h{( 2)I \(F*`"+!J{+Oh*h2*`pM#(Fz}(FAJ\L8D$h4@ [1}( F '#,32363o ""*!1H"F0Dpp9F'F}J\2*hܲ:*`*(KuJ\F*hO= :*`*JDF/@%+:+G#+IO2F'F0 )*hܲ:*`* KO/FР0 *F *h :*`07F0FLHOF%'F,F@F(РshZ  G+9KG@HhT?`0FChFډځON+IZ`HOB /}+"HF''(shhKBш#*`0F0jIChFF`"Z$#*`0\*hF:*`""Zp0FR J!ChF`"ف "*B3o 2S3.,u-G0h $i4&F0h *h4D`h3 b0 khhZBZAF F(kh`Fh+0"F!i"QFI0ij``p 0+(OK0h!KKP0 GK h  C BK h #F$(P8K:M$!F`6K`+`c{"F3I*hj; )3,I)Mi!   2#KF$Kh K`K K`K`+Fa0K`K | K` K` Kh+!# PKK "p "p 0o "u3-GM"+ha#i (%*hSi3Saa(v"dd|+h[j;` O F F`` `$( +hi*  +h F Fp` `" Zi2Za f+hi+ # #F` `` ` (+hjiXH @ #`F+hik`a+hi *j*NIi$(+ '#`IK`#`C`+hkai``:*Zi2Za+hky0` (!1`c`+hiZ* nF+ +h"a(( ! & K`0F[& *h #`Fkk` +hk:``/.h3i +Ii#IO0O H+hi*" "ak #FJ;F+hi+.+hi * ! p 3[p k+hF( +hi*! vk 3a+h"`a(Р +! b ( #3`+h &SF` #```! |+ha (1*hSi3Sa#;`+#h+ 0#4F` K0F ( +*h8FSi3SaF F+h[j;`p -AF=MO$+h+h (kU8`F+hi(Oi *\j4`&*. B+J&O +hh:h0FZc>!Hz0Fh/!8FH*h##`;hk#a+h``^c FZi2Za)O0uO #`F+h`k`ap o 33-A%"&L0a(< Si3SaF( \"#F# TF`F` &FMFe``4`(>F##` Si3SaM 6VF0F0H5p 3p 8!M*hQaa` +h$`(*h Si3Sah+hh+hiHH8 Fp 3"F[pGChBhKFhpGCh hhBpGhh"pF FFch```epsFhF@x(Ha4i F!"F F!F*?p!"FF(?! $! $!F$! $!F $1i*F F@tl&KXh8 pGh" FF:)]KO@ع FF]K@񮺈BpF FF?p!F(F@B $bh(F?d0Fy!FFH(F?Z Fp4-AFDhF Ol`{h;{`.h(F?> FDFUh"p! N L5h#h(F3#`+h(F3`>#h;#`3Khp@ph""" KpFhp-)F F$hfh.аh(?6hh"J$h +ܿ3`h@ ,!bF?(?K2Kb , $`dp gfffh"pFNh +JhBh ! F?۬B F?(Fp$h+ h +"! F%F?$h+h""8F F`(KEh``8h" KFS 0hhB` F@@FFh"JFhpGhBhh"-CFOhFF;h -;`ܿ#KUh;+ҀB}71FHF? qK$`$2!FhNIFFmHN"!?!  F?-dK0+𧀬Bq"iOr@!0F?ZKV0+5i!0F?CFOr@!iF?0$h F?$`HK"`$!h1FFEHpCO F?$#`&iOr@aiOr@ !h.;0FN0F@ *F1FF0H@ - .0s# 0;h;;`#(Kh ')F0F ""(h$h*F!FF(F?FW0 F"! F?`B")F F($`h F?b0Fw)FFH*"`"<p ?54"5pF F FHXO0p Q!FFH! F?AF-$$h! F?BF -$h1!FFHH@H@T5t5p-OFFFCFD#O"I2F8h'!J!K"N-FF3h8h[%I"F8hIO hB BFYFhC8hIF EFQF,h+$ 6-$ q j5|5>55>8 !MFh?C Ѫh*b ! F?E8 !R F?xA " ! F?pB" ! F?hCHh"58F KhhBphFhBch)FGh?Z`8h"-OF F C 0 #C`FjKh`` 0eKeJ`0dKbJ`h0B^KhB`+h F;+hB FF8 !FFRH! F?($hFH FIB F? Fso+jph!F(d0300 +6K! FhBF2??F5$h* * *.$h!FF(H ! F? $h+ "! F? "!PF?x$h+(RF!F0F0;0#Kh $030:F(Fmh2h" q $q q "55"""-O&JMFhO F;++-+jH 8F!ZF1cH9F  B8F*`)hp9C)` TI" F#JF!4+hBOL hb#hX}.r!(FzwFXHy' "O2XQG* " #"B$!(F?0$h)FF0HO2"!(F?z0$h)FF'H#F!(FmX{/8FF8FF0;x0+x+8F!(0BKhBH9FE,JFԿ##Hc |, Mk$($!$(55 66 q u6U6"1666"|F F)] h;+Y/O)TZChֲ;C`+#hZ"`p+hlx<+ѫh+h!Fl+h+;+(i!F>+ѫh+Ъh FI+H!FH!F h* ch;c`+ Fv#hZ"`-"pI F F|968F$K,hh hrJhB1+K"`$`8*Qh)Qh x),!" D" K60+,KhK`x"""p FP0J#FH !jHH"7-AFYCh;C`+#hZ"` "pO%L &(F9FF Fm -?-!F@F%5@-ѽch;c`+ F#hZ"`pz>@&M'L+h3+`#h3#hx h('`> K`+h;+`3Kh@b"|"x"" KhXshh x)2BpG pG pGx"FONF3h+L[h+Gx+%%HKh+J/H-F,U9,E,P3)cjF F$z0[+K-_YBYA F#0N&DR-! F<#>,33G$#`"iF >&2%$+%KN0+%,% K6 zJhb0+%K60+%%FKN *, Ф* ٓ603)ЩB! Ib #R<CBLx""p "(-OFF%їIh"uhI(F"(I(F"(Okx<p+ OO,EѸ@𞀊H%(@thI F"F(@HK!h(F,F~N{h3h33`xh!y` F3h;3`#uKh 44@,#0OfI8h"F(@4F,@odN$dO%FZh[hx`H(F4-F8F ,[H$5@-WHVO$lkh{khxc8Fhh FF@F4@,%,?eO$%F@N@O --[h>Hg(F4F8F ,@F$Y5@-,1HQF+Kh 8h(@>h3x-+sx+&,?!7O$IHFF(HF(F(@K:hIh?%xDH0CH FFH% 77h77 q ""x"=7>770q 77. ,,.0300FF O ZhXhD`! F0;0%Kh ?3?]&?%W?HFI(?dHFF?,?lиO kD0+ H I F"JF(?z$?(;"f7"x"-CFK"`L?'N\#h#hx3h33`kYBYAZ3h;3`#0 ?-ѽCx""""pF LF#2 2,D2;+!(F#$#2px"KXmh+(x+ pG pGx"-C' L N131#rQ3@+1;1qUh-hFX2(FAFF(F+hFx"L"K@ 8 !*pGx"8F M\2B ! ! ! \B8x"Ͱ#GK`"b!*8X"*42d"?K?Jd2`K ! :K `i !6J !h3`F80K ` F.)Kd>(Kh&K%N &K5h`-th,#x+ )F Fu`;$;+   >! F#."""b>*##`" >>!F>P "@S  CC x"L" """K ]x"8F I'!F F> `]8 8BOrOA 08 M Lh#h3#` #`k`#h;#`3Kh8@8p ""-AFFFFO- *F1F8F>- FD `#ph+O0hFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+` hc`` `+h;+`+Kh+3 Mh+hq`F3+`hc``0D `"""8E F?C K[iB F8@ch;c`+ F#h*xY!`p8p Kiܿp KYiֿp FHj!F7R]pGKRi]pGp Osp FFR& ;+@p0Bd#<p@pG-G F'!F8sx+[I0F3\ch;c`+ F#h!F0FZ"`""pXch;c`+ F#hZ"`""p3x[HI0Fj7\0FvF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0FF(ch;c`+ Fz#hZ"`'=F80p KYi5p L FF@@p Fxr+ HH58(8h-Ah h"xh3xB.K=! FhKh0=!F0F?B#'F4F.F<+#x;/0;0 =*+O ,p){F/Fupo o "ChL!2hJh FF F "M8FxB ұ` O^] 4F[=B|] *`F*-A'"h!EFU;H:р''FFX[m?0F'`\hh,Fjh++iC(FG `4-hhD; "Fx#@HIF F BNO#x3H!F@'+8Fe,F'! FF H!F"F0F7V8w8n8zr8-AFiFhFFKBh՘GF,մhF HAFH9FOF40=+sh-H F8hCh;C`+:hhY` "p8hCh;C`+ :hhY`,phZ`hZ`~8 q 8-OF+LFFF0; #0%XkCE"K)FJ@=' qhպB KIA%`56hT ;FZFQFJ"!" "C/ B=*Ѱ@ pG=* pG pG-AF FF F;빧'!N!.`KDiThBѠh:FAFX.` F=+@`&F$h ""IKFy F!XDiF0FF(nChZ `0F#a!;Hg`W0F@w5O:h2:`iJsq Ch00DGkh`Ѩh`*ikh2R"*a L#c#ak`Bkh#k`Kih H$B$TDFB0 *;h;;`#Kh qE $ T5Fh``p 8""" FF=!F 2FHn7ܹE8FFFX:*="p"Zp!F%`8F7 FD;<F8Kǰh!N@#K`G]K` "8>`L0`F KH-F0 I"#`0 KBF8@H"88(,{/(O!0> h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp", ] ""X"p "8pF MF+h3+`T+h;+`sKh[p@Y`h1Fc$hp""7M,hLHHh `#;0>0h xhh"``kh#0Cc`h#a`5x"8%O~ch"h2`Ԡhch F4h,5-ѽ@[ՠhjch#@c``&F ""FF BhiC՘G(h3DhFKFh(F"F!FFرCh2CiՐGph4D gh)F8Fn0=!8FD F$hh,"-GO hDF>N+xr+ ''0F`9KhhؐܠKn(p(Ѹ$ /(FZO$*Khh-#"F9F(FG!(F0nk\=+ 6&H Ch#C`:F1F(FCh*FPF$.Ch;CC`0 h- F.(F9(H)FA "88F"FF$ FChY*5M)h1)`r#c`,h<,`,Kh+1 D[xI8F^ch#c`chCb`ћԠh"h F`y$""d-ANO|@ #heh0m:h@Fh"BhX FSh+Ѩh!#i;@hh0DGkhԨh8hk`h`#i+a"p p -AOMGFFF(FF`VK'h=U Fv, e, f,&x,O''OGFC/(hAF0C9 "(ܽ@(HV"  9-CFL FH030z;x-+F|xEM(hp*hDI"0t`3`0`;0#9 hxxpG hFxxPxKxpGsF"# "` FFF"h{"h"+ jfC2s3H!F4Bxr H!F Khx21 R3B(F1Fp99!̰ FiF= L& F=(6BB8BԿ  Br ̰ FiF= L& F=(6BB8B  Br ̰ FiF= L& F=(&BB*BB  F F=0CCh @iBѤ5j=B!F=ؿ%hFF(F=8W 3jB8FFxCx-*xKK"I#`x K " I#+K" I# I!(H  90Fx F!+Cx+x8 '0(F(𔀰0+@P- - - F& x@ @ x8 -iF F=(E =(=-` _#)/5_M_AEI___V[!hF:!!p@O  p@Op@_p@Op@_p@@Op@ O  @ +s =B= +x(+ #x)+jxcxCO0 UO0RpFFFF(𝀰0+@𘀰0;+ "+:IXgs)F F @ @ )F F 8 )F F )F F (Կ  FF(F FBB  FF(FFBB FF(F FBt FF(F FBq FF(F FBq FF(F FBt)F F)F F)F F.hcx#x!+ )F0F(  p(++x)+kx 0xgO08 FF$I h X="IT%  HD%-011 chx@ 8_`h(0\xx!+(  (+x)+Sx+H 9999FH!Khp o(:q KhHI3Fh \X"q J:7 "F xRoECAoBrI"F f0:-OF F Ie-cho&x-*@Zxl*cJ*-*(FzFhtJ(F0h320[bF F@0??6/jI0h 0?6>OV %*pHFF(@1h\H8O?@FGs*њx*JНVI(F F((F,F(3hB(Fx/+GJ#xh320Z FV(Fȿ- F'h(F0(F F :I*F 9H# 7K!h4HQhx+J$y!"` "HF EF)&Ix*ѱOBoBB?IHJFs!h*!F(F0=!(F("!(F"\"4(;8q ;~v0(,{/<(<,8Kh+J#`J`fLKJ`"Zaa`%he KJL`hKJ``8"""h","p q p $q q q 8 K$`#+KO2`K`KS[L(F #h3#`KJ@#! (;#h;#`# Kh 8@ۿLL"o d"p """0pG8F F8+h)F`h3+`$hpF&N F,G#h*h6 D*`+?!!!!!!&!!!&&++;;;;;88;;66h)Fhh)Fp@ȿhkh3Dk`h)Fh)Fh)Fhxkh3Dk`dh i)Fh)Fp!FHh;FOK,J`pFF@h1J h2 *D `+2 22222622$044<ѽB1H9FK"aH|K/F"a\$8F4pa$-W;DA-7;0;$ $ $ $ $ $$/F|<!Q<"6<F+O FF xh\(4Gbxc*%JiCsa0*b xF3<7)ؓB0AFM*ѣx-+x4@G^+ F;?+@C^* ` 2FF!"KIhKhX"<q -AFF( L@- H9F%##a9F H2F&D,Dj#H3u#t"<"F xRB H!F H K"a!h"(т!FFH<<">Jshhܱ3`!~&2F` FF FH!Fw0Fp(F F"=Ohh-$&F F1F3`+x"+'+ lx&,Ыx+ H)FN#;a!<"`(FpFF(F"<-O#N(-F F3aKhS#S`h%!J!F(F60їKhm-# =4#FOS+2`0,FkFhBh+ѯ\. F "MF(hCh;C`+ *hhY`$ p%FhZ`%.kx%+ѬqM(hCh;C`+j*hhY`phZ`jI F#\*+F0.+"ј0*+FZH)F@FXIO6DUI FO40xOعWعBSع%APEH)FX +R#5555E+ػhh) x"+'+@qЋx#H#;a [0ryco"F1F(F(" q $!=&=D=<FxmPF"0xe(cFO\ O^ rOs0cc"F1F(Fa((+PR,(.&*'(\("(ЙI  h FA2JՌFe cFf n r t v A M" ( O?Zp(@@Xp-"pa b 1F(FDF0;ihqL h"h0@΀#lI Sf!F(FDFm9mO X1_I"PF\:hPe(x! jpOs a2FMH#F)F0mPFII"`hGH2F)FBHb"FF)F=Hhhx3`s`?vFuFaFQ(FIFs e#1F"FZ1FVa!FO!# `hhh `h[[RF[F1F(F2fRF[F!F(F(N.B,  Ki p HGR! q h$"z"Z= hh<кh"-C8OFF #6I  FP #1I "F(?+h*`_h'+HAFt"ehu&I8F85D#5<"I+! "8F(FHBFPHBF!xHAFch3DH b^5D {x?+-+H0#Hh=L>BBBBBCFI I CCChsFhhhH$MN)hq FF F)FF Hp@D#K0#M0#P0Cl# CCCdk#cc#bpGj#ACBrcc#bpG"r#clBl`3CCdB3cK@CcCCd#c#bpG$@ hh<#dBj80]F@k##cfF@k##cdFjhK#I< #b#`t"pFFH;$! HJ\ >cSDBFFFF1h9.x-.59hyF(F8h#h##`rhC 6(F @-."h{h" #`78 FhJh@(F b8J8(F$( JD(FT(J<(F<(?|@ A$B8FL#h# ##`e`8"pFL&h6FahHN `p DH. HD H)F@0H)F:#hD#`"> z=) F2Bh:*J!HH JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJH""B-OFFFF@F0Ff)FBFH,Fٹ HDЅHAFD'H9FD 4HhM,s i+𸁺j /@)-o6?H-QjW+`ir){]H5h,s{jYzw+k(񐁻i񞁺𩁹𮁸@/k/ʁ?Huh,с(Ձ؁/i2Hh,cP+T@s\N+QQ%K_G0F,GD/O/Rh[dmv,@HiLO%h-@t(F`7HGGGGGGGGOGGh=HGH+8F,@𮀿H<,@𦀻H2,쮸@𞀷H(,段K0F,ݮK0F,ԮH8D ,ЮK0F,ǮK@0F,K 0F,K0F,H-8,K0F,K0F,K_0F,K0F,}Ko0FzyHHyHPyHXyH`yJ 0F,{+trHx,vpK@0Fl,mkK0F`,dUdHW,_bKo0FK,VB\HB,Q;XH9,LVH@D2,ISH+,EQK0F,SES! H@ Ki! "CFh"+I  FSS"cS H KXi! "^CFh"+I FS"SFh Fx;H)F,K #`.O6/!8x/)O0:nSCF0zm30@2D#`H)FQ""S"-GFjIkHiH*hKiIiI<#rjfIaHnjdI_Hh"kcI\HdkaIZH^bk`IWHZ#akJCB\J\IRHN[JH0aoYIMHDVJJ0+VIHH*2h/(3j+%H"F+FQF,1+?QhH:FQFEF1)4h(hOrHF#1JH%H""VV}WEVVEWV(WWWW"!V8_F FFO 5+-s)J{jqDBI"F R%*h*o`0o0!F(FI(F!F ""W("8F I(O2 F!8@F'E"$Kh+OrO2( "wF H>  ("-O$NI @F( iB9H)FXi0*0 ( 1I@F("/H<.I@F"+H+I@FFO3F  2BF!H)F3eI@FF(?O3F ( se"W;SQQWLW[hXX("?XNX\0"g@"kXxXXfhkh'XI@FZF`O3F |( 3fpI@FHF`O3F i( e]I@F4FhO3F V(y eIxI@F wI@Fp"O3F =(` sf0nI@Fx"OsF )(L p0dI@FFpOsF (7 r0[I@FFpOsF (" t0QI@FFpOsF ( v0HI@FFhO3F ( g?I@FFhO3F ( ga+ؘ0+0HBF)FiB-HBF)F/+H#BF)F)FX  [E,?)F K E?IHF  0H)F4HB  "1F F8HR(Fp6 I(F K"1F(F $S$4B MYqKh@:ܸ#`O0\q 8F&L5+H!F!F &j;I Flj9I Ff*k8I Fbk6I F\jk5I FXk3I FRH 1I FLJ /I FFL -I F@N +I F:*m*I F6jm(I F0!F'Hl!R99F\!O`5V+9F FB!FHz F@9*)hOm0h:hFhShZhehjhshhhhhhhhh ii?igisiat-OOFX Fa+cЉk)`,[PFPFYFFYFx@! ` FcJjhkFjFFFPFFYUJ@!XFSI:F F*{ F!*NKOIOInt+{;ڲ*k+iMhMhhbhMhhWhhhhMkh:FCISFBKhk{11?I FPk)_hh;IF FDhhkBA!F+ |khhKDX D1IB F.X 0hhDkB2!F+ c*H!F)O8ڿ뉪hk{11#Ih Fk{11 IhI FJIk!F* !F k)!F* !F )O8)wiiOiii8_iijiiiiF FF & I H!F0B F@8˿2F;F)F F6 jjpG@pG8Fh`Ȉ؀R[B@[(R[B@[шj\\pbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXemeT 8BE pR uBD 3l#J1C 1 f# 1 `# Q XC Q Rh"C B8Q 2BC Q djq p!j(7 F(# M I(h80 #h jhII`h(#0#vdCn(sF F(NhI0Fй- Ih(C3MI(h80#h jhII0F#I0F# I0F(#pjj#udCblj(0FTMI(h8x0jh F I( H&0,#H#.#90#zd@jjjs*L+I h8L0bh (Ixah9%H$N%Mah2F#H*FahH2F*Fah?H2F*Fah?H2F*Fah/H2F*FpHah H#td@kk8_kakkkkl+kCkpF-P"L F"I h jF80bhI .. ahjFHjpih " J I h 80bh IkhjFahHR#}d(@1lj~d(ClUl(0 FVIh"hF ( I" MjF I(h8n0#h jhI50cl#{dЀC-C%CJ,F(F/F#`0JF1F FC0B$DIF820  /I^e(q('%B&NCB1F}KF(  I2I%H￱ b읹K" FN lIKH* FB (#!F0F5#*##4$(lllmAm8_fl$!l#|d-O(-]LhI F(FћMO2aOR (h9F80jhI?i 0hv! DZ`h+ ]#@F(4> #T## #QFHF{I FxXuLyI h8T0bhvI FuIfF(lM (h8:0oI n hpC_kJkIlH^ 2D0OS4(hYF80VF0SD0 0+Oq }Fб#F2FF7FKihcFQHvHI(h803jh( ( }6F!( F>Ǽǜ@tF2L hhha@FFih2Htؐؠ,?1#ih-H##bg#BA$h{"CS(hrJ2F;F??ihH6GHFoIFFHD v p!-OFF F#  3)+ "   *I0FJF70'I  (},(!IJF0F70 BM,MFtt $ B&}IHFtE)FPFlOC#:F0FAD4ODpppip FF ,KB7+KB@}SB F&IF $KBc#3B F< FJK(FFp@84 Fp@F FH8 FFFH Fp@} FrF Hl F4p)Ftcidyaraqrbmn/q neqJ1HLhDD"AF#u,OmO0,єQ@ueD `Q`A?`.h0`h Ch(<` hh 3h DBO0( Q@ueD `Q`A?`.@2 D8#K !*03(pG0#-AFKFF銁FFAF@3BF2+ЬiO <ԠE*hD") F<DD$XDgEzHE{+и? F8±HHH#~~pFe}s+CJ2;B2BBHO5(F }pT">)FjF0F CF 2 H;CI I\"! F%#6e,|J"h pG#-O}FFO  YH(ܡH }O7  (Aq)@CKI"#(Ah H!D#J1FHE:짳KOYhqFKOsAFH$yK"*hX2Bb e - Exa") O  !)InH rbK23DiH!?@s! D1F\J!_H?@s! D1FSJ 1THK2+ }\OIi" F)FMH*/+-2+AF;JDH  F)Fw0@=J>K>H)ȿF0JAFh|"F+F7HzOD1*+|2+ 0+r/1FJ*H6\ F)F02XCFF;FZF1FHF9F7"F+F/2Cw#2r#9Opr8_r .Wb|\~Os;TBJBKCH)ȿFBJAFAHQF@K2+p#JU"蠑B;2J3K3H)ȿF2JAF2H2+Q-K2+K #F;%ҝ>0)+#JAF&HZ0)+7JAF"H0QE#"*+JAFH)! |#FI KYF"#VKJAFH|PF||8_#ƀ9p~m -AFAMF4bN (B1-h F5NE 5Nm1F*F+3HA61H01*F1F/H(1*F1F+HG71*F1F'H1!1F$H@sD*F1*F1FH1*F1F?H1!1FH@sD*F1*F1FH1H*F?1FA6#Z8_ʁ݁"4-OF-z(X F3a0Bd0F%A) t FI "jP вH #)FHF) RT-Kѧh &y C 5C@+KziX+FB[ܝJ2b EuqۙH&0F  ( I Ft %I+FF,F %O2I+FF,F qO&yE? ѧh C W XrF #B? a F ,J E|q 2?A J 3 {J +C]\JFXRBzP[H"F(  q wEz L Bz'F20W -EIO !!By L ByFFO33+#By rG4H.FF*=FF,O2+@.1O &*H2F bC +H;i!~i # #KF*FHEFa EEyF6c +K K'hE+ f W^ HZE#f8_0#yH2!LbZF [FO BЕ1s8F-E{ Bq F7u^I(FBБ1sQE{ BA &21*јX GEv ڸFFHKPFYFR#\vCH +BOEO ##ZEUEBFUF#KFF2 F#*F1FKF?-O2+7b*IF F5FF*F1FKF˹#R*FKF1F FHI *FKF1F,?EI U PD &0##yeZFlX2[BJEBǀBF(FIFKpGtD#KhpGtD#KhpGtD#LR FJ!F  !-GFFF5ILch!hH>hS!hH2 9F0F-PF{FH$ch{ chSR$h!FFH tD#p R]pG R]pGHR]pG R} r-Gm$FiF@H$@5B=H0F mr@20F9F5%COaF0wH>%,FRFFpHw+i+o.o+i6gIJF_H%p`h! b0F{hOc*CFf\I 5*08F F5^PFVKhCFSDEF x;72pՠ  p/B FPF:F#` 0B ?;`#0{``0p30 0 F0F :i 0FhJFQFF 2  0+?h1F H1F>8F`  @FP I# ݝ!>/-8zVhzd@!z=8FRF0?宂EF?h SHFJ0B) PJH#)i$+OqB SO h@IAHh*iT2Z`jh`#+`hI k``` #03h;3`*Bri:raLFQ (iFzShzP(FzMBriBh?h/Fh+{i+8FzTF`.?#1FzhhGF(? ?eBF/@FF( ?=EF4Z?hO f-!IFH !pF6Mðkhch+Q3H FCp@pGHGOqh#h+0)N)M0F*(Hkh;k`+$(FhF ,kh;k`+#(F^ (y,"$hJK)FHhd J+hZ*`x竉$+hZ*`x +Y,n,N,ѤY\B\A(I#:h!!0k𵣰#OFKNh;`3hFH;h" F+ !F4:hڹF F4yHl#;`-vH!Fr&0F#3h+ 3h+ (FF(F4 3h3+cHcH(F"r9C(F4+':F(F'C;FGCz|7B3hKH,Cl3hFHjC&(F6C3h=H(FCD7I X@(FC&%D! pC (H|" ԣ %I $H$ D&HH#(FjC&zj(F4L?&H!4I#(I#,I#4Jl8Je-G FI#F4Os{H; zFxH2)FHF4BFsHB(Fz !U*Ѫ)lHl"!H*{o{O3dzg`##`'8F(`H9F{)|{`#` [H| k|i~#*}#a|#cbk}}ca}"+~a#~a~e#i#b+#Cc!b 0#"C#c1FbzF8H zF3H#iclCcdfl:% $0+#& C' c( e(0** dR"H|--0HF, 3".0B/0bc1 00#2 #c"bc"hZC3F#k"hSCBB Hi&0Fd@̠,N9FHFR4CѝI"8F0Ip"(Fع1ù11U+ї1+ ї3S3;3U+ї3+<ЊH I F(fЇK&"hHF;`SS 31K13#kZC3F*#k"hSCBB zH8Fz@Fz9FHFR4$C&#k뱗!1#!C!c!c1#!C!c#dckO "hHFZCSFck"hSCQEBXH cAFHF4 BѕA0  O"A0백akO KHuH  0BIFPFi  e8FzI@FzF(FzCm=H9FW%h ik)F@23D f4H)FC1HAF;cjKbcecmBF+H/jAFclF e opCdemB!H:F@sB @sdZK#[OsBOsdH1"#!e#efjottRRaAUΡ&IazۢF F hzF$H#k%"h8FZC+F"h#kSCBBH0Fz R1F8F4:#hCk8F!"l!"kZC+F"h#kSCBB HR1F8F4#hC0Fzf(F礠NsFFlFhF" B$c+`(h n3fp #o3#g (#mB  K J Fl@2F HR I <0O3 +`K - Z-OFXF FF XFy0`8HYF5 h#8F DH"FCFRAEB H0hzm8F*h1hZC4m*hSCB c-O%U FFh4m$ FyF@xH!F z%3"F)F sil xBKxRьx@,NOtB$x(@ƀ%lOr BfopBBd4O3mCE` z@8Fz#`(F opDBx(y y- My-эy--, y,Ly,ьy, ( %OtB}opDByyHyyxx I ((2FQF@txͤ5IťpF$+mBpkhBыYl`Q`-AFF IFFF0*F1F8F  I *F;mB4X*O30`Z-O"mFFB @O%;mB@FHj j 3FO]hBZ`0V 0+ٜB؈b21QhB ёh,F" FX,٣B b 2 F)FF,HSF*F1F8FH5RhB)2F,УBH"F)F BF)FHH#F)FaSF*F1F8FSYFJFF A :mB!chKE =JF1F8FJ "H e`tX,.hܦ-OFm hF FF_C8FyF@fH9F'&0F:F!:#lfVci!ipp+pOsBopCB m!OzopLB9L&FFhKEz(Fy+p!pj`OsBopCB&&l!F@F"r((Fy&2F(FQFPFyOlY `REO.bEn2f2 px3lf"Cl1n2fFkFn2f1Bp3D`n2fN2 3,m@Fh "#h#22BBXF&i  f:F)F@F3Bc-OF FFF%'#mB#kCkJ8'!lKD/^(F$0B' 0# 3+!,0( 9FPF;F2F!FHFCF+ YF0:F1F FE7nBHI (n'c#mBn+ X+JH I ("m#BqXA#d!FHFCJ3kt  .0ehO? OBڼB`\&knx058J#-OF6РF F^C13D,+mBB  1Djh/nHFs/h{#:F[FYEB2FHF3B"E#:FHF[FYEB H HS  +2FHF3BB$Yȧ8I#-OFFFVF+q+++HI xBlJB@FJA1IFbRF+F`(AB-  H H ;B# S8I#-A"NFO/g #c~(F;FB7F)FvF$h,F ?",;F8I#K OpyjBh %pG8I#-OFp 1FF /A+@ mB@ބ$O3%F'F C D03 X0`3v 3F #  BBОHSO3=FsBD00+* @[# : BBxH(1#sp 63rxr*lHFFmHmI (L(1"AF#(11 RF'(  cC(1B1"BDDD(1DD#DspIK@!IJIH +GIw((1C(1D3{+@rxQL 2 =F Or!XF{  +K; # !  ( ! ( ! "KB"H:e ;F/FF[+?>H,-@) ;F/FF1{ BB%/ ' :F/FF'ȧ<Z8J#8I#Or!2{1F^ψB o#O p ( ;3h)!h"'-?Ϯ - =FHF"'AF+FO2 'RF|C%qz ). D3sqzDs 3 \ D O D (9/@߀LZopCB_ѳ}q}CCC_i`g uOrYF#0O3 0\m/@π##r! RF+FAF C?r/ B1BЃHDD^R`C@BFHI (5wDDvDL opCQF@FBuuu_#__- P0B? hC`^|`ñ FHI (߀DD#D 0wwsw`IfF(@π_ 1BHFFHI F( 1_v_ 3wL opCB~1su1uh 1FSC/RBڲ B?- ;F/FF' ;F/1BN皹jI00h+?sFcHb#*P0B Z03 3+ChB?XZ0 tFUHn_FRH=^$PI #F(#spDDD% 3 P_FZ5)FFBHCF@H@I PDDwopCwDuw5wvL BOuuu`DD((I(cP-]/h_+??HF F&HI x_DD7wopCvDL Buwu"D !BHFFHI F 0 1!>(VjөZ>kD/FFsH:Or>P( xE lH*Ch55Sཱ- #CHDDh03h0-P0B d0h]C`Bu`+FFVHCVI -(`+ uww+ -w P#d0B*VFJH&II (_%d`DB Z QF@FO3`_ `#5#' Fq 2BB$DZ0+P0B?rDZ =F HF#!RFO31AF +FC!D00ӹ  BB ^K2F2B$D$@ ߻ǪZ8I#-C F1F?NiOCEF@FxLF08HAF HFx>F(8FxA1HIFH8Fx6@Fx3+HdOr!zclСk)#mB"H5 X( +ShB khC`5 !縹H$I k" P ,F H H 8I#-QuƫJ8!L5% %5" F%ù %UUxx@U8YhZ`F F!h` FYhhX`"F8I#-CFNFF5F$ FU-28FU%JFi`AFC8I#-OFϰ F sIFFu(9qN55h5EkIkH& QFch5 EO d 5jnDB ,$5Y *$%+mBWIXHK hnx (SHM O"xZ*) 45 !1:(hCC@F2#J+\Z#BBAHjn@F 2knB EnOr!3f.;F6J ! #J7 jnhSCLFF F  !P @FC CKvK vlopCB.1#u/1cuL#wL cw21w31wLhC`#T#T#BBHmjn@F 2knB eN8I#Xua<hN#L xc# 58I#KpGhN#KhpGhN#KhpGhN#LR F!F  F!-GFFF5ILch!hHhS!hH| 9F0F-PFx FHnch{ chS$h!FFH\ hN#p R]pG R]pGHR]pG R} -Gm$FiF@H$@2B=H0F mr@20F9F26%CCxr+n#`rJcOaT n!`FUEP.,4F..O Fl`2F(b0pCOQ ykhhJOaHF BHF%F,. F2( ..#SEZEH F2 ([x52, F2O4T``.`2x(%O45FO`_hh!25F&FhhOr@!%2NFF a(Xp%t#3 F(ڣ"&`'J3F! "!2IF2n( h+ F62" F I F2RnI F2L( I F2F%ax$## F ]ȬЬެF F@FpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h``lwhd   lm(d  lcdz`p`lSd mO(e`mKhemGemCeQ BC p`"54S+BE+8#FBT#!A#38 FF2,& 8F F#T#E#34+g fXX\\|q|pccWFgfWF\C\BAXXS BB czgfp j $d$(^(,X,ncWfF`H>HL8LP2PT,TX&X\ \-OFh FF44``h H`Fh`h` `H`iHaiaia jb`jHbjbjb kcTS BB D\5KE'L53#T"#XPZR3B2*5q5pOr  F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" PFlF8FhF0FdF.D#$B\5KE D"0BP%S#`xHS#-G FFF@FE&=L ;KhS:Kx;"9I0FGO#"#F=F-K,KBB7 'I(Kp@OF%HON"HAF3hSKx- .H)3hH&3hkx~`GKlH=(K"`-PS#HS#\S#S#fj̲r زS#pG8F M+hk FC +hk+h!kFiD F8$TS#Kh @pGS#KhpGS#Kh 0pGS#-OFF (q]J2Bra[bBOprpOy0kB Z rIBp JJhB;IH+@*F;F(F9F #\5@IB΀FM`0(^C Nv0XFs,I Bw8 QFvBv N)Jh**F;F(H$J\5Bii(h2SC2HBr2"FKFbvF AB~  Jh*?Q*F;F H|0"F H0KFr> =S#LS#T*JcTS#(-OqF FMK#BAKH2F+Fa442pSx ИBu BBua #0F)F@FFFF 34J D\5Bi, CirO~ sDCZF#`;n  @ @;iA CAqDL"hi#a:kL0)F `0Fo#"F6300F)Fo#( Khi Kh xS#TU#U#S#TS#-O FLF!UABJEPIEAҕHJFjEs #j0FQF K h# PFFFF 3J D\5Bi, CirO~ sDCo#;n  @ @;iA CAq{nEXF  @ C(ajC): s`HJscBF+Fkh[Kh˱ZKi kXO ERHBF+FkhHkcLKkh+Os#Dc sF`6 `  O  vV` FVF^EZE%JX h(e(Jh*<&EXF;X I `  OKhr. [HBA  0h B ZE ZFhB BS#TS#TU#U#U#U#S#U#-CO +KFFKFp:FC&H*F3FX$L{F;B22k VV s8UH0`E@K%c(Fh+OxOAFUF`cF8F`bbbY0`b)FOpvPc(H VTS#˳S#U#Lkv#cS#-GF`FF0+cKKhkTF Aqj (U(UCF80uRF(|@K1F8Fh=Kp(FhS"!`0C"@2CO 2FF3;Fv `2(O " Eغ $&O'N'M;h1hB8d1(hu+hk"H F>77210^"0X5^ 3B*h;h(`d3;`3h*hY1`B#@TS#U#U#U#U#U#U#8F K Fh KhS" H*F#F4#BBh8U#U#6pN3hKMh,hC;+hB 0hu(hu#+`3`pT uU#U#U#K"h pGU#-OFH0, FF+ ChGFXF , K*jF(@S0k 30tk;FOqFB$XI1FC#EAK(Fh+3ЕKh+@CE$iR#B#33JC"`Di  E# 0~K!Fhjh|KBB|Kh[oCE=vKFyJhi(D Q;C O O Oa (FiJdKxhiH ! `I  hIoYE[K!Fh8GEۣiO #a9O Q+OZA+PIIKhi)GS7RhC""*BѕH0+nS jBK $@@A`## $APFE;Hn(FSe0JhF*=xa r.H*.J!`S' :"穱Z(FGFТi"aS'>KF(F:a 47i YO U#U#U#YTS#MS#S#n-Oز$] hF F`+# ` F(0CpL_ 1K Oh@(5BOpqۖHh<*q+@.ހ#C)FOr :kU(Aq%PFFF:I3F0Z @ŀ+ 08%@@%DApl[m @p  "B@ CHp"b+P@/1+.^J#G@A`##YHG XH4(,0F+zMKhkhC<MHMK"`56 -BKhk#b0+z ".k #OsCOyaw *y4Py ;F*FAF FdL+KhZosC 3iDg n+?)F"!.@0k_j(?f KhkhC/ch FG $] FTS#S#S#nS#U#Xm(9єH0+-w!J#G@A`##GPF4H](tT0Fñh@acHK"`pNJO@aJS#S#lFh0#+B2+r3OB2y1`l2 8Flhal0Fx(F( KBs 8 xS#l$he2BB+r3B2  `8FF F0H F-tX-K#BAR!F(F)MF)H)Kh+6+h`hsph#H F!H Kh+FH+hF FH+hӱj!"8@FH/| o+h+`hFH oi8xS#U#ȴS#~8ԴHS#p޴дFFF?/F1FD+J,Kp@OF)Hc'O>h&H&J1;A11H0+ #  !F(FKh˱IOr(Fz#p@gH(;h+ I" K`fjF;HS#hS#U#T#U#S#0F FH# !F(F9x) )H"K+0#p#K-OhPF FC$%&#Bu@#BB7Ȓ F)F0#ZF6FJFO hR BsFV! .8 &^E(^F0FuFH6x+$%F| F)FxF+4EYh !S FBXhu#}K F)Fh C `FwI ,\5Bii(YCL|hȡLs̱PF08F dK h*+`KzhB#B]HAF0+ZH7# 0zh FTK)FB5zm 0 #ACq#0C  ;jL;;b4$;40B2$OR;0 48Kh1Kh#FO  pCO;г O?гO%#3pi[Da#OO8F F)F `KFXF1oQ7ц #3+?[K9FhR#3p Kh8#3pU#S#%TS#U O(V#S#U#TS#xS#U#S# Ox#e8"0  Xm   +HH AFXFO[ @POh!(J13A1I$Kh2rp F)F b(?q Oxd808a8baXm   +HH AFXFO[+KPfhS#U#-O`FKF`h# 60I#F\Bii'MCCsh{MCszN(F0i F 0tKh+ǀ3h+ǀqKbhB#BnH9F!$X"!jKHFAF9.fKhF*@h9*1*X)XF""X TKh*SIOrXFHFAFq{#pX0+ #  oDJ1;A11,QbhHF9KAFB5{m 0 #ACq#@ "  #jL3#b4+L$34hBi$3OR` @#Kih3hiF i&H ` `3h+?9 !Fi1oQtVd[I"mU#T(V#S#U#U rU#T#hS#S#S#U#TS#-OFsKFFqKP`hOpJX- O!!O0` O|Bss $ XGD XCG ,vڍPZF `GKhk 4)FX$XF# ##U#TS#ϵF!P0$ $H$H yծF(O HF jIFH !sFFFF FFBx+I3F*F xp~-OFLMF!hch##hH(F1FBFX#h %Hd(F M##r#hkhH1dH^H[O#is#hHD#}H?HJ#h~HCY#h|H<J#hyH5#hwH.i3#hsH%hqHt k"1 DB 2 ###hOzqDT@2 E @@p !RF+FAl "#d!  #RF+FKF:FLHLch+# 2ChcRC#R@ P0, Ozjz4 Z J Jz0HD80^Cf!8D-JzH a j  #RH#iSHN%i-@ ^#l+<HN%l-@ P0HS#϶ 'Jnҷ .xJHch+r%%d%aedl(FhORfhnon5onFn#p00#0 %ghjBPt#0#z0+(H'K"`l+?h#h$H0"H\(?XHꀹ #B"IH.F(?G#hH.*%=#0F$-h9#0F-h@@ht5dP[#e N@D-OFH0u+zE3*s̀2j8F)FF cJuaJ1\A +q@#[HY[Kh+yZHFO PF3j KE``hE1 эBBh``BBhO W\V#BHS#\qpS#S#hXS#U#S#Kh @pGS#KhpGS#Kh .pGS#-O=FFF8IFMF@F+h pCFCFF*SIp`"z`I"t(V "#C#p = I(0"Z`IX "T(V ѣn+ЁHBFKFH.(@FIF&+h;{IOrxI"xK"`wJvJh3054%Br  k;B2JBr OѶOzgKh+VfH2FSFFP kBBS;B2_KhKpO%]H( IF@FTK-hhFXk-O,NKHh^kQKOzhH* F#'FKhkQOsJqd)F/?Kh32FAHSF@HBFKFh#0Hp(@ZIFp@F$Kh+J(IOrX% 0K_EA O@Kh)s%Kh+orJ3;*shңn+eKjJh[n FXFWHU#xT#T#0U#`U#T#U#S#V#TS#LS#ƺHS#պS#VU#U#U#KhKBFUKFHj\IF@F2FF(0Kh+v aKI(5+uBzpӄJh<.zi3 h+Z#Cd{K -hs(F w O C1pKh(qX@ Fz(? hJdM13A1`X(Հ s|(@ɀ]K`]H\\H(@Ā  ~fn+JEu h+JEAu -sۥ !%( 5At 8kC3QDC##2[0Kh+? YFT#F0HQ+0;# FF'HYFny  Kjo  P4CKh+?e  T+TFHLWR+)  394IF F HLS#U#TS#S#hS#S#h7]Kh``O@V  F##pBFKF#Jh3` Sp+h3KhOsBFB@FIFOrF g`gvK*h *F`hd*BРh8e*>Рm9F F##H0d+hdM+G+hbKh+AmhPP/XHBFKF WH2hVK"`#p o`o`n@FIFNK"hB OpC#eF @ ~+hùCKDMh)hZkcOb* 3 D)vѠnNvmFI(4KF` pO h#H09 kKDnF*K=j hU ,m(85@%@5D%BplIm@p  #C@ C   ;bP^Ek{h8FGՋS#U#U#V#U#S#ϻS#S#TS#U#BEKFBFHMKh3H<@FIF_+hFH0+?"##@F#IF## H>( kfI"HS#IU#K -OO MNO*hjB2Qk'0HHDDLTNEpBufX"!DK% K K 0$jBmTK`09\Bii LCI TiItHhIrsEr0FF*FF BO *IAy9hD9a1 3A B-#F*FE-CBs2hD;c34C Epup!FoC8F{dJ\5B0j#3hcLCs F0i@F 2[Kh[Kh*Z+ZYKh.]x@&t00jFd hC+FRFMIMH#0KKh+dJKx+`00KE=3KE15sbF1BAr2DTIͼ+F3Kh3K`0jB00,QFFd pC3F'I"F&H#0J3FA1:KBs7K#5HP(@!.K`Ԑp/(y+'İ h!cxFK+ !ՕUU+!KF#TKHh+ #Os#`#q(K"`L#*sӀ h.KFV0dvLS#WfS#vxS#S#"U#HS##*s)40+@VKx+@UI h#FPH(F h!FpCO ##0P^AI hO YF#FC(#*s"# P@A#' h@A[FF FF,J Q,HL+Kh+H:#*s##0뱢y0B hO wKKFFw0Hq?(K&0;07p H/(F# #`h hOF H&]\S#HS#S#! -O|]~xK+5HHK"` 7 HH !O@"#FF8P ЩH;K`H(ЦKh3 !;@cȂ"MK(hX"!#`0K0.hBJӕKh*@/hLB`O ,hOB9-hBC != |]H@xHi(Hd(?t! [F{ @@utH0ñ,h4IFF `C jI:FiH#0VKj++cObJ?h9FxCbXH(4JK"`A:h:B=#]@A#SKx+;h]PIQHj#0LH?hjxD9F~0xCb+Fj)@BOr!9Kpjh+ OC@#p0/@9Fj;F *F(O 0&cEt *020304### #/@8/$S#W <hU#U#U#n!U#ƿ\S#ڿ̲S#U#U#HS#$U#:hIHj#]GH !hbP3A!\j# *F(O 08cE *|$#P#&#R#(#T#n 3 r9w"ر`KEfY( *Or! 00gK (h*,` OB@"p /9F&B# #8TB!8 B 9WKP?j+? #BB????#CF3Kh+1K##+s;s#PF\#K`C3Cs;s###JFT{x+UKP?2;C?PCh`D`ڿزU#LS# S#S#pG-O}PCP;@B }0ñT,p<9FFd `C #F`I2Fp_H#0UIQ!: Cx C+TJhSJxSJx+(q2C3C+ѯ'HKPh DKx* hB7FhB#0FAF#(8KC;5H1FM4Hv(?xmX"!F"P +Jh)Jh)3xh&Jh Bih <8FUH0FAF#:(?<K/<0FAFC3C8oxo>!HS#PS#\S#U#S#`aU#S#U#U#U#-OFKPF9FhOsZFI#F\B %ACCs CsXFQ0 F KhKh*v+vНKbhB#BКH)F$3jO +UFSD[+e,5й2АK2jhkB,iL3a23B2 DCh3C`x)n  "XCBXC#!F(FHwLORitKihcmKhiFi% PlL FHF P+ !F"(F9FW(@/+F:FG/CBsZJh;c3L@RJZF*m", TDK(Fbh9FBv{#n @Kh +FFC+A@qYD:b2# xC p6J1;A11H0+0 [k[[B2#F!K2jhkB)Dcj3cb4 34L3A Dh2`BBh XF0 J`r5GO U#TU#S#U TS#S#S#(V#U#XS#pS#KhpGS#-OX"!aK'aL#hjB^N3h#h,AFFd xC;FWI*FVH#3`#hO p%0DF R B7,uA)F F)FF FDKEhFphʱhm##P0xC+Z C KV0opopn` F)FX,Kh#,H"F+F64E F)F68$Kh+$H"F+F1F F+BB  h0qI"ch2#CI"#I"F"F H+FTS#U#!U#LS#%MYaS#S#-O!- NO=4h=h#!p 0Kh+Qݣm+$5+ Ђ0+@𖀣HI(@𘀣m+:$@CE2ݸ/+#H$5 2"n@H-B"kAB@򈀅HIF$Kh#.怙03H$u/Fz3#"nAHgK.@𪁔 *LJڀ)^H(]H0+?b#$5"WK1h`OR>TKhRKh#F# 0BHO40GHIF_0 -$HX0OH)O %"nAH@5DDD8hDlAFq$Fx-H-HF(?;0+м!!K"8`&O`OR1hiKih2KhiFi# 0P0KC21FC:RTS#U#S#U#U U#S#S#S#HS#FS#5OsO sT#rOr!*jK" 'h*H`2X3*рP8$O< k@w>G7@wBp{O j[E|u ")F(\GKh3c  b5HS#4I*}(**FF2͵BB +FB#00OR'K(Lhi&Kih=%KhiFi# 0 =#G#(FF@(ACq0D;c32C@ p_U#LS#$TS#S#S#S#U#N3hG,AFFd p[FI:FH#3`0H # 3\Bi+iACC FhOCs8FN2 i(FK h*+𡀎Kh[KjhB#BЊHYF`0+H# 0KhK 0CJ0hCJhC~ЁKtOh{K0 # 3\eB `p+~CC`hCsd`AF  @"C@;C<8d * C Bs#ZKh0+"##h;.@j;[Eє0+ۀ +?_2h)FiPX0h6O  # 3\Bii+yCCh8OnCs8F\2HYFO0K0hh{iK.Il(`K!hz3hinLKh#i0I\%B JO\%K0hhH(KhCEU#6!T(V#TS#S#U#U ^S#S#S#S#U#U#PV#~S#8 U#U#U#KhKiKh \5 , ̂NBii+sCL h~nnL|   "L @Lk F88D02#$5+ݡk8F#j B#jB#+kB#.pѠ!TKB ,OK!B @V0+L53DK5`' IF 0CE=ػ;KB CxBp;2KB CxBp;&Bz 'K' nQFOh}oB9F0FxK+"3OJ ;BKFX\CZT6G.wH2F;FU#S#TS#TU U#)FFA BLr):b2LԃHBF O  C 23AkBBmщ3+A`nJB S 2C JBDЂPC`nFIF"#JCIF FX@;Z3;R$5+#n &\CTkDJzPuxC@D +݋ DnIB c[X\##A!A@ FX$5+ݝnO D#1FopEK$%BFV# 2F# $2(PBr22Br22 Br22 Br2O L3" 1F8(98JhYF5HXhsh;Fhd/I*,(gЈ"0F,N+KORih)Kih'KhiFbil# 0"Kh+G (FNx0F5# 0  > 3(OL O Z+$BFV#p7F#pKFU LS#$S#TS#S#S#U#(V#~K`)F萹zKB jhBTimI rIV(RЂ(FoNkKjhBThm@B 0F# 0bKx+@\KB@𫀙DjhB5qmIZ(?mVI@c(?fNKjhB5pm@B AIDK`CE CkhCE5sm[]9"6B܀&:HkhBCEvs+n[CE c]9'6O 5r'IkhCE mF[];A  9D H7/ѻ\&HO 5r'IkhCE mF[];A  9D H7/Ѷ @TK`wS#U H(V#\S#`-O 8F8F$Bӽ!F@Fg  HF_E 4D -AVL-#h 5@`%#h#*A6rS6 KhC-0+lGKGHS%#hDN!hORiD>Kih0#h3%3M+h+G2H!hOR+L 5i#s 5'Kih&KhiFkiu# 0 F F F A%HK-F 0+ЅK`H+h+Я K`TS#0s >S#S#S#HS#V&S#tKpGV#KhpGV#KhpGV#LR F !F  !-GFFFH5ILch!hHhS!hH 9F0F&-PFqCFHch{ chS$h!FFH :V#p R]pG R]pGHR]pG R} -Gm$FiF@H$@+8B=H0F mr@20F9F*p%Chn_?I&pABHHS#(RS#U#HS#S#2S#QTS#8 U#U#jU#U#S#T^KpkhUC U! Drn@ WK)F`FHF OS#aRKh+Tj 9#3\PEi!iACC FhDMCs(F)ki+0iF;h in,0#i02Ii\%B\8h)0+Kh{+Iu*M8h)F(J0hC'JhC9hORi)hi]0iFiJ# 0 0K$pH=h0\n &.DB(FU+Y?B9hAPFU#S#PV#8 LS#S#S#S#U# U##KJ-OO O3` KFF*HHEhp)FFHDHF  0!(F*K(`hp)FFH( pC_ВH)FH(O KLx+SЅJO3`#hHH)FJ#`J#OOQOp`J 0a J 0a p/OQaOpp'{IF`OQOppuJOQaFOppsJ`3йРnH!(F*YK(`bK"hhC)FgH1F(F x IF0F)^H1FPJKh *?D0F07TJ 0`PFIMOJ+h\(O Bѓ0+F+h 5(O @6K"hh*TP+IO9Os9K"hhC 0Y 'IxJF(F hc0/H)F0#+H)F*I P(I ('H)FP"H)F`EH)FU#U#S#pU#hS#HS#V#S#S#S#PV#TS#U#+U#TS#@&Q=`S#U#iOk'H)F7тH)F`H)FOb,QF8F "ŒFFːF)F0ŕtJuOV (즺B% 1ZFHOsJq "뷐kH$(?diN%BOgKhJhIhKiHiKiKj%I O O2F(1ܼгJ BF0DR 2YFD F  wBF#QFې(F u2F@AqR@O ۛ # 8B%"Ś@3`5緛B1h8H7H6HN)h4NOR 5i#s 54/Kih-KhiFiO # 0'Kh++h&H$K*hh +O NչEKh+p!hJKH)FF=dU#T S#Mf(8S#S#S#LS#hU#V#hjt"hCNH)hMJc@SgIKg 'jkCCwC`#S`?Ko`O~ @w"`D BwcD0 G+@ؠ0+k0+@+h0+#h+(H)h0F0"!Wp0L%P%Or0#X30@F`QF)hOR8 Kh#F # 0MxS#S#S#S#U#S#S#0+7#h+EHI)h"0P%ORc0#X30KhRKh#F# 00+?X+h !1c#{HH((')hOR 5#c# 5KhKh#F|# 0+h0+(وHH( )h#,OR0zKhxKh#FNW# 0+hkc)'sHqH()h #ЁORcXdKhbKh#F"+# 00[+hL%2@+hL%2@ł+hlkB0VHo*hk[Bd#h+@RH( LOR)hCKhyAKh#FCJ# 0 0+hl[kB0>H9*hSk[Bd#h+@ʂ7HL( OR)h(KhC&Kh#F(J# 0 0'K\BF \K[(Q HF(@*G#h+@H(>XOR)hKhKhS#S#IlPV#2S#S##FGPJ# 0 0,+h, ,%*@0%45BB1зH+h0e4u#h+@[H( ܒOR)h6KhKh#F J# 0 0+h(0+5x)5НHT0++hx"<"(%#h+@%Hb( \OR)hKhYKh#FJ# 0 0)h8%<5lCBB4}H+hblCB1#h+@qH!( ܑOR)hkKhiKh#F_J# 0 0)h@%D5lCBB4]H*hlC@5#hD+@QH( XOR)htKKhIKh#F>G?J# 0 0#00+@90+0+@-+hL53@'#h+5H~4J)hh3`#L5#P5OWsT5OcX50-F^03H$5+@ n AH@5LDl;D3DDi@OR0 Kih\ KhiFiJ# 0PV#yS#S#QU#S#U#U#S# 0sH"(`H(KX)0Bq}H+h" #h[zH( OR)htKhrKh#F^gmJ# 0 00+?=AhH#h+0B۱C1`H+h #h;VH(!pOR)hLPKhNKh#FIJ# 0 0FHh#h+CH`#h+?HX#h+4-[ 0+?cB0[8H9K*F8HFMB F"8`"ER)  B%H&#h+F?!H#h+<)H#h+٭H #h+ H#h+KDlC8%O|lUS#+h,5+?K#h+cиHJ)hh0e3`#,5<#(5lORN4uC85l<C@5DijKihKhiF6i@J# 0 00+?Kh+5јLOR)hiDKihKhiF+hNini2K1FhH(ɿH( K 0+.hOp@!FoL`H!FJ~K$ F`v"F! $'FF,h`FE!tK1C+1CACqOp1Fq!1FogJ`(nfH1F#kLBH$ LFk{CAsan  @"#CCVH@QFh 3O 0 2FQFPFG)hkH$L{CIn @s @"#C@C8HQFh2Kh#2FQFPF"+h7kDz8H7H(/K 2F! j!0Fn .K`.HI3,N-JoOc3`21h3BBOpOA83`#K"0h` 0"K`"K`n!K!`F0hnK`(>1hHU#S#S#S#PV#S#U#5zS#S#U#U#hS#U#xS#U#U#U#U#U#*U#@Op!FoK`H!F+hJ 5@pKhS1;Ip K"`KOh@Fh!F )@x!FOP NiOyFFHKFhF(@bIiK hB'ЎKh+RHH(FO3O29F F @Fpp!# 0h(F"}H0+gzH(i#[ uH0+prH(r#[kānH~0+xeH({#[B+":*/*@`Ha0+[Hx(@# F#qcqiFBƀTOUHF;h+@KH](@iMH*0+#O #rcrr@F 00 @H 0+#"ct"t@F00s# 0y4H0+?O2O3! F #@F00O# 0g!H0+?x7'i#8F;q{q8# 0o7TU#M\S#S#&QS#U#V#U#LBALwHS#MI7H;h+?Mi# F#qcq# 0/K"`.Kh.K) OrOb`+Kh*H-h)L 5s7 #"''pY+ɲ.kp03B&!p"H@SHhH%xO ! (FnK!`F(FnK`(~lH"JO #p` J`J\IS#U#LS#U#U#`S#U#Kh IpCOس_гOг_ Kh Hl @OPCO S#LS#F4Kh4H3I0F F t0Kx/Kh+.H1F>-K p,KxD&Kx+*H1F0 (O(M1F8F('Hkh;k`+(FfIJ ,kh;k`+(F\ (y, Y,+hZ*`x竉ս+hZ*`x +Y,n,N,HS#hS#U#&PS#S#0:h!!pF KFFh HH2F+F!F@Hi hpHS#Dh2KOp-A$-`/K`/Khk9Fn,H,KOaaOp @an($K9F$NaO @ @af ( F( n9FFOpnF(,(Fn 3h4Ean`+`5`]`O 0a,+ѽ4aU#U#TS#X(V#V#xV#-OFAKFFhH ;"DRF;PEKF5H"F'MRF!@F 1H=FUE "FKFQF@FF(8F AFFKs#"KhX KhB)K(Fh pIsB) 3D@OsF t FF H7KhDD#HU#tyU#-OFFF8PZ3ZFDZEK"`H2FCF$HE O(b9FJs# B F HsHf0DDS#U#-CFMi Fu3K i3Oh 2I#B9F0H#i%0F Pea#i*KBF)O,F.F;kL0B F#*FIFHF 8hkH$L4CsAn  @"C CH@IFhJ0#*FIFHF;h4kD;hPBU#S#TS#U#S# 0}pG-AFIO hNn ;h "3C;`# CBBK!Fh H{h2F3i{`+Fh^e`aTS#T]#U#U#-A F!MF!I,hBdhBHd`  G C!BB$hiF F2 F`Z`+he`#`+h,`\`iCaxV#TS#pF FF!X"hF (hFep FhF)$ H0+ J Kh[ H##` HFH(##`HHS#2z>FpF N Mi3h)h tKh32hi(hp@pTS#U#S#K"`pGU#8FL FTBA H Kh Kh # (T0BXhH8xS#bS#TS#8s -OFF VFFBB ѫ3C F=IO(ǼHFAFx;+3I:F FT"YF'p jEEOHp7$&KViF$ F 2!F;FF/"G,BV3CK1F(FVKiF=#0Ub F?#<79FO(μNx9aT]#\%[K-CB}F F@𩀐0+)U h#O`m(`(hOHOb!F8LKhLHjKKh+:JNL533h OxO)hFOHhF Wq:F T3hIFHFiF"2 E[!;3h)hF(h:FiFWp 83h)hF020204#k$ \3#j$ 4$bj04#8$j<@$ DH$OR#0L 5L53 #P50"0#"# }TLS#U#S#\%!KB?ѐ0+; 5004b30304040 5 5L5?P%P% 3WqWp OrOr(pGT-A0Kh+@?J`L h(ڠKhA(񼺞IKx+;НKh+7МM+h+PЛHlKhKhKh+Nі0+JFOPUMOR1FiKihrKhiFiI h# 0]M& hO)FiMmD h)Fim=}h B9iB!}H|H9(+h+Х ()F hi6m(FmEFnJ#[M`mJ`+h+D`O;h0>[N3h+4gH+h+49hQM#OR0ci #X4QKihPKhiF]igBI h# 03hKOHNH((`LKhLHKK5M"`OR7Kih^8Kih6KhiF*i4(I h# 0hkB۔I! Jax!ZaEr F@ @ۀ B@ǀ FAF\#F~HBii)HCCsyIhPFuNCsW;h@F oKh+3h+lK B#BhHIF;h FzO vs[H h CTYJ0B   `O@D]E  "0LHO|2[Br28hL3 kB\0;02;B220n;0AO3AF18MOR9hi5KihM3hiFi&/H ` F `O  I0&D2BD3h+?U:hAFiM$0 $[$04[4b  $ @ "TS#S#U#TU#S#U#U pS#S#S#(V#KpFF @P%8 m8 H;CiB iT%0PFaD%@ apU# KKi i@P"0B@"@FiBaU#KFh 5p KBBB BB    TS#^F(-OFq X GFFFAv(=XF1F(7KhNh[iSE"QFy`h1[A1C3i[iKE K"IFh^0a3i!RA!!A!`S#T]#U#pG-OFFkKMlF$S"0[\OC kBܽ#DJK'FS$ [$0B 'DX$@@HDH$k7R[B4爭Я8Fn*&](  8d#@ݲ]@Bc#@ݲ#@]ڲ@BIHPFn*%\@ Z\"B  [\"\ACIHy\Fn*"TX"@ \# T[""IHNlFn*"TX" \C T[""IH$y-GF$F) nIIF=n*FTB OX $ +dhV̿C lTIF8oT$!F E(F,O!@ FPEIC C C F9I8F: 7I8F45I8F.4I8F(2I2F@F'0&I"F@F'0,IJF "!0F $HF',0 0BxBO# (*#KhkOz"FSFEFx FO6$$ O<4O`aq (FFPYYBOXKB B!H!Khk H# # '$\ " h*۰mK@FBH0ZY0C@ H( K` U#TS#HS#U#S#h]#Kh 'pGS#-OFF FUBгi#a _0kBOrtB 0(F!Fk @ @Fi *FIF#FGB " 7#FF#$BB-#! FF[EF F^E0#0 *F#F0kB [i+ H ^EBi#a Pj^FF F}TS#-OmP` F"C FFF(BF ?QEXEFF 3#BB3)##2FHwKhHf   H|(K` (HS#S#-AOB F !*NFFX3h+ #OsFC(F"#M+hkBSi3@F9F3hCKix)h" i"aOR Li Kih!3hiFi# 0S#TS#U#S#S#-GFiFF{PF F;PKhoF8F FFHJHIK` GKhFKhk2+FiRF0F" i"aBPF F9H(ؠ0kBOrtC0(F!Fk^iD#8F#`" pHFse K (F#!F#"CE i"a*F8F#F 0kB[i+ H6 U#cS#S#TS#U#K-OMFKJF+hFJCFDزr'S6 @QhPxxS+-!8!!$+hQFH#Kh+𺀐H4+hf+hK+hQFH$#+hH# +hFp@O +hFwH##RF "F#]*hkB Yi)>+h#D +hS6 KhC`HQFrYKh+X]H`(hAF+h| "#F#+hkB Zi*APHIF?iNKNHNKFhB yCE Hy0BѸ,ˈBCHQF#) i#a@>H>(CFVi!@BK@e1JH 6cEvF5FdF=F|qE$ 5FF EF BuF5F8F%#kS%kHbk5Bñ K@1 J+ K@1 J H B;ch BhZ`Bh`k8jFKh[Hjk# Fb#`k3K@!JH  k@kl]#+jF3K@1JH @mk F@k7>-OF-FF# -P+ +I+$O<pO<@O<+QJH D1F FY K@?QJ:FCF(F (, F$8[-CFCi& F@jFF3K@OQJH 1F(FQK@QQJ4DI "FKF8F(#AF8F#kF2F(F(F8[K-sCFh F N3hBF HKF0hBFKF!F* pl]#U#rK-sCFh F N3hBF HKF0hBFKF!Ft pl]#U#KMxQH.N$O+hmB(hPHH:( 8(hJ2hR[m8FS4Rh4S#p]#l]#(hL h@j $ hO##`p]#7FHh(j,)F0 Fp]#8F FKhñmJh K@"h`B #BB  8@n U#S#TS#oKsh;+nKԿO@bO`b`kM+h Et`) fHfH(W a)7)5`Hn]H(]Ht)h\LOR 5i#s 5#d3#a3TKihRKhiFi# 0#$F !$p#x3.h e2#F FBH!H@H#9H-)h8LOR 5i#s 5#d32Kih>0KhiFi# 0$*hd3+6Y)6ؒaqK+-HH(?k!HL)h#ORa3d3iKihKhiFmiw# 0$+ FpHFLS#l]#TS#VhqS#S#S#p]#-O-#FF F3 FK  h3SB7F>FѢO:FAF(FCF#ўO;hB+њI"PFF(;# F#O3 #&??F F0 kqEl.t.b. F0чI F3 FQF F FFQF ;hB F  #C+sF@mB FnI:F F0F5O; FYFDaI"F8cI:F F9F F3"YFF(7mBmB WI FNF0F&kf.3x/+0F3F]J]I(#$jGF WI FHF!%  FQI?HF%7k3.JI%0.2sCOsCI FOr1FHF$.B Fs*.t*  F`xK!Fh8 @B h+I$O0 # `10O0 (1R01 1r$(pF ! IFF!2F!F( H#0+Fx0Hr p)-GF FFF ) FIO0OI$ iVFHI:F FOi#"# F#RFCF@ F I:F0Fi 6$Q,p-O!FHFFeXI FiO5.F(F1F ! FTF(#" F \PFFхI$3J8F_Ih$iCEBiYEEx(- 4ZRI2FCF8Fa#bcb(-JKS -II8FFKHKS%0{$|(CJ#aJF[F0FAFcF(\bCb#AEBaiAi aea c #,FMTA EsE!iMa%ai2h&a2B &L&!a 1ciCahaeaCi,aa a(F I8F4[ I8F F Pl-OFFE, u-"F+FXF1FC "FF+F FhCD"F+FHFAFC "FH+FFhCD t/_лi+@:hzh*r[QEvy f 2 [ b YKEz_BzZYS,u"F+FQFCР:ECUD O3O :CeF8F ,u "F+Fz #C"F+FAl3  Dc F ?ikF-OiFFF۹vIXFRdsI=i qIZ CE3i;a3i_a0F>KFRFD E MDBDEDEu BFWIXFEO4%FEe#A#2b2C F)FPFIFC KFE RF E MD#Bu-Eiɱ8hOyhc Ee -IXFw8ag.pa2b22E2BsIEi IAeBq I6a# 0he phAC3i;a3i_a0F-E{DFx7biBpGipGipGF-C\pF~F BEs ځi! F iU PC Ey c8n𵋰F$ !FF8(F IO0 J !v(ȿ  Fܿ# 4 rIFK"F IH$ I H M NU40F, IN!Z k*"* I_O0**     *8F FF +2711111'1) *,"$& 8O0: *"+J@!HLK FI*F      JR#0  t]#-O2OCFF@MI0F%F(FhIJB BGI0F Fhj#P'F"FFECE!4+;I*F#0F#(F$$FOذF0CE Fh9ACB~%324+ݗ0"+8"HZF@! KBFIF0FAF 0FGC!8H#)F0j$XCQ"  cC0B8B2 57JR#07WEVKkt]#v-OHFFF#O BF9F0FvBF|KhB(F !(FF#C&sI(F p, A,f,nI F F s,# (FN0O #jO (Fi#r??4j1ơ J11 4+ݗ1"NIQ2B#LK0KIJF(F!*** *0______________2*;J@!;H9K*A*X6I(F+P3KcRF#(FF  7(F0?l(F0?f!@"t F# FAF(F/CF!I(FfJK 81FH#["CD3B2 26  $+$!s ]#M-AF)OEeFl N\N FF(`PI2F FO5(F FCF I2F FICF2F F=F$,+-GFFBF8/4 d1HOF1j$$j0j#h(F##&##.a#L(a F_CF I:F F(F3FFOhFIKF:F F5F$J,g-GF-FFtJ0FBFqI GɺmKhB F#FF F!=HgI FA(F! F.! F(!  F"! F$" 4 TI4+x(pQIjBBMIF F+g(] 4;! FFP%2F;F! F&0Ѫ6#" FP9IO "# FvF3IAFOrX pJU#2F1;F#"# FF FCF"I Fg I F*"#! *ѐ(#!g Ft0?K4+ 4+"#!s $!6PKOF FF M    :F1F(FCF KhB J#iF FX iF F0I lt$!գt KSB@pG#-OF FF   BF9F0FBCFJvKhBX+s F'`i+Ui+RaBBL # F# #??FF1 F +Fa>F I">HJ!>K>Hm#8$!HH #RH4 |]\ t :zz0: + ~ J W  Kn:f*oB (КmQeppGI"ih!!-CF] eJeHxeJ bHrcH(FaOF$ F ]#8F X# 8FR i.1FHFD#!#"ji( &jGJ!"3F!EJB3FB" AI"""?HB>H9J!BB9H9H  $O O#3!F(%$!#3(H Jm#8$! "H"H #R HJ$ifHbOa@F#1F#i"j ~C *  z0   5  ]  W > -GF FF%BF9F FCZKhB!0FVH50Fl( `( a8 ( #u(JI $F FEE0F00F}EE+s0F!xi+ sBB )0Fi(J (H'J %H%Hz0F[F/#@F  #@F F CiPF ; 8#)F#:ji ,?iHF$! pt ~C *     -APF FnFFC 7F+K    h3ScE2FF!K!N2FAF(F"CF<I"8F2KhBJ;F FT*l*H O09F FG0$ I & Fl0 $!Z t Q+B@+pG#𵉰3OF FF :F1F(FC(+s Fq!`i+Ei+BvBB<ԱKhB# F#"#-)a8 (!$I  Fc0, F, F{H i$!t Z h `Èˀz rCz ? 0+B/pG{ {S{{zzSzzӈhJ ]-CFhF F ڈ z Zz ۉ0sxs+x'F"iF@F#*F F9i>Bsxl+O&F"iF8F鸹#*F Fqi(C7/jF)F F67.H-G FFxcPD QF F]%(F 7&I"F 6 5  3 2 1  . n ( ѝ0 00**+DONF9F<FP#c˄QF F  O5HpFpL&"F@!hF6 hF4G. pHFL%O#1F8F4=H%pFL#FD F5`ir)Fp@pH-AFF4043309FhF$ CC00#@c0 HO CFI(F F&F2FAF F  I(F FO4  IB I3F(FD F q4Nh~P K OF FF M    :F1F(FCFѬKhB#JiF FkFpcFJiF F< I FFiF F0t$!ͷt FFIEK8SB@]#FFI/KSB@^#-OKFN FOF2F)F F0F3 ўKhB НI ?OUo+;hF($$*ڒK!JHRI(ÀHFF8F"F(8FI(IF(@HFI(Ffi;+(F(4jOssI"F(}OF1+zНzF(mkIZFF(dД!(FgI(\Д!(FdI(TД!(FaI(LД!(F^I(DД!(F[I(<Д!(FXI勉!(FVIzp!(FSIt8!(FQIl!(FNIfȱ!(FLI^!(FIIXXѠ>F )F@F&P(F(AIHF8F   4z9IRF8F(6i)5IBFPF(5j1IhF(, F,J!8)I FR(*m*%K!%J%I Fj(#I"F7$($!t  ( %4AO_hn)F(?gjF(f5jO h$3j3B >IRF@FD(Q(?! G(.I$0FL(?+I&0FD(? (I(0F<(?%I0F *$" I0F(?E<IKF F-O ( %4Ajv~CwFh$:"(DzE$JF)D HEFT$4!??LI{$BF)D E$1F(FO\ ARFBJ+F8 hQhO39+bkb 6+c kcˌ"## AF +e#keIFe(F$$3F(a??$I'$$)F $4BIF(F.aaadd$#(a3V?? I$$)F Z$4BpF" FhF!ah"hFohh3SB"FF B J I IjF RCI B $p('i(!!pF-PF!Ұ#.2### C## #@# 0"K,"'K(K)K*K+K,1F(F  Rpi@(i(!i(PFxhFM ]HKpFx +EK%%x+h Bx5@C(0=I @@BR:H Af ix J#@;@BO6F.H1FLh`i# Bx3@C0"I @@B"H A06 iFH(h`i# Bx3@C0I @@BH A iOaJ#p. H  pc#w^#(F((((!)sF J ITI L"(FF$pah(F&ph[x+ F0h`h 0$hL2x8Ch/hB(F -OFFC BFwJwI (F5FrJsIFbh hhIFhhbnI(F(=ОkIF(FF(KhI(FxFFeI(FpFFaI (FF(2Ѣn:"QF (F0$KJRIPI (F(Н0+{ѡn)x"l0F h0knGIF"  ***# FZ kDZ9I #8IJF d(AF3I X诱09F>C"l0Fn &阹"l0F!n 0bnl)lckB(FPDh1+#o˱!F(FG0mI-QF "l0F!n 0k0Fm 0m(L2i,)4);>)z)M)m))-AFJF$ F8FF(FF`1FF8FF` F$(F, FFAF F((I]2-AFFIjFF"F( +&CFO08FF(А"!F"9Fo I0F ^0н #FI@F* F3iF0 F@ FFF0l#`O0\BF`?#8Ff"FF(F^2(! FFFF0F#`O06BF:?#8F@"FF(F82(! FjFI@"#`O0]̹pF/IjFF(-K!-J-Hx-I FX FŔ1))D+N+*,)7 F Fu0J I.0I I(FF0 KOqJ HI Fn@B0>)X+4)N+*pIF@O5#`(F$pE@-I (FeFIF I+F0F0 I IjF0FT FI Fer+x+++i+𵉰IFN8#`O0 F0FdFI FI3F8FL0 I I8F%V0I Fe(F$1++i+FPCHHH],, 𵅰  KIF0I J0d`FI`I(F0I2%OBȿB , FeI R "1F8F5xi ,-,S,zsFF=F` 1F FA0I*F F&l,8FICF(F$0 KOuq J HP) FI e 8iN+ **H |, IFjF0 KOa J H I F0H &,***i, IFjF~0 KOa J H I F0Hl &*6*i,I#jF3I X%]i+ F IF0 K@1J HI F@BD+N+?*,)F08 (٣a*أWA*أ=#`O0P IC C #@0I ]i+pFIFFXFĕ pIjF(FmFĕ !hF(IFF0F$F(F@B,vi p F!IjFF0K@dAJH !F(F0O0 p2* ^BbB;B2@ @e !2F(F I FF(F@BC C,*L*,رL ! !< J H` "FIH,,,/jFIF,@8O4#` F F"CFIH$,VzFF J I m!HONL!(>FHxKI"F(;FH3FKlƹm!HfJKIDD(F"F H(F sh(FG6hd-`u ,-#-!-A`pGA`pGA`pGA`pGJF `l `dpG`u JF `Qm `SepG`u JF `m `epG`u JF `Ql `SdpG`u JF aQn `3SfpG`u 8FFH0~#`O080 +$ A;+n#M(F>(d #,T `u )CK \(^#JFnpG BЀi`u -OTNK @@ D`lOy0FI $Q DJgI B7I DD@uAvB;L5FD0Z7IFF'FF%F&FF 0KXxF Bi*i+8@U,BB" B@FG(!@0 0#KEB SEI BA@FG(By :@FC/ɚ;6ex8R/(^#-O]FF_BF 3FFsCFэJI vO IF AF(FFJI0OaJn#on9FH"9F$nr~I$0F0!{H$<"9F$nbxI$0F0(tH 6 AF(F70 fJnI()mH#R9ԡX@,h"9F$n2dI$0F)@#()_H!(Fq"9FnZI0F#O 0W d#F(>QI :!#nNJOanPn#x۹:##nOa J I;`;h I"F P24c#8i(4 5(5 FFlI#FF :5-CF!I F8F0KOqJHN4h NF(FzF8FFȱFHFmCFJ)FHF$p$(F$dD 5<6-OFF~I 0FC BFxJxI P"!FFC   moI(F|0+ј"! jI 0F0dJgIfH@P eKXh !FdHxB:ZxB33 [H!F!d FWI NI(F:0SIlnFQHPIJ B MH JI?) T RX%6p FFFȹ(`(hP1F"FF(h.` F #`O0h| F p𵥰FF*FF8z#`O0%#+~!(F` #ji!F8FCVh c`-GF FFF H#`%jzBFaC2s3Fx-#Bx#Bs &"#"h"+O00FAFF #j9FPF^0h(FI{`FhPD 4D-MOFFFFFE h8 cF0$hj`O0FFļļĜ40 40 0 0 pj(86hkbbc-OFF@# 7#`O0i)@1j)@ IhxF(@"!-ހ58FF( I2i,KFD/!@F(F#;PC #5# % YF@FF(@ i)@,ɀ " F F"x*O $O "#`@Fc>)-I8F(tOrYB?mQ)?hy\)cA^ [X\0 X 8FcF(?M(FBFQF  9F(F(F(Fc/?5ri;FIF0?,i+р,΀YF@FF(@OJCFOI h@( h8(? -2-? "`VRc@FZ(Os X X0DSպvO #`7""O;IO;$N!? F FYPO;+?2kDO;Ҳ^ xX0V:,;+?2kD Fx#x*?!Fa( W<+ #ɲ CA(7<0< ,ل̹5"7h"7+u#x1ZF(Fc$$JI i"FLF FJI ch07h"+++-AFFFF@F,(#`O0@FF #ji!F8F CVh c`-OPP%FFFFF  H CFBF!FPF5`hQFhF#G F5t\F00c;+- F[\#`O0(;  +-LO` O0 -OF(FFF0#`O0;Dj  &#!ia00sIFPF8 0h($h0-+YFPF(( iIaiybh*=C$70h( 0h(H #RzFF)F0FCck xk`i+aI Fh#F=7-AFFFF>#`O0 /K-J4 B!@F(p&疱hi0ax10H$ FEHH.h 40IKEh-1PXW= X-0Xm@O09h1W9I)C4\!!$8;8W8)F FKh#FB"F)H)F@}x0+JCxh320x+H&OBb\20 V@# H]8F6!h8!p8(p"pP( FC C (8%#`(Fp#0#,۴O,F!(FX"B\"T`bF(2F K#0#F FFCF I 8FFI"(Fl*F1F F@񺼌(P2pF FF!"hF jF)F F$p-OD]FF @J@I  sCF:J02$+*0/H8i(i;;i;;;;i8iiiK$&<p^#;;;;;<),.,C0C**+-H xh300[Kx:+* 'H"d &H!Fx&$'i)@Fl.?<74/?7, iyHZ;HT ,HLF H@OsB H6 /!Z:< <</0<:<0 I$jF%DED D D0I(F F0i8:P M jFIC0I h ]i: IF0 KOq J H I F0I D n?*Q$9iD<F FFHF0FOE%D< "&D3+ 8FBѽ@> - z(-O=P .I C # %t 8WH]6"8@FFHFI0+СxH0+#y'FIOHxxfxK>XXc^FEݸyyy(yDBPF~7FHFv0+СxoH.C0mJB^I_F>F , FD .p7(UH*i.5؛0+?FPH!Fa?PF  9FIHIKF0h>KBsBHCJDK`EF?H6 9=I?J?J?JBѣys=I%H0+?"zy9H+5IH0+?!z 1H/OĠԐf<< >n>>5x9z9l<y<P>>6>\$<===PD>GIHHV0+?ua CHL NFF@HD'?IF8';I  FFF ODo7/f8)PF $  9F,H,KF0h+KBsB'J(K`EF"H6 : I#J#J#Hbx!F2+# H!J+FHHHHHHHHHHHHHHHHs>z=>f<<>5x9z9l<y< =<=<<<<<<<<<<<<=<=0P%C   FI+CFH F 0,Fix>  IF(K!JHD ! F>*l$9  IF(K!JH& ! F>*x$90" F!" H  0@Ը"!(F( ObiF FX( Hv F  0@Ǹ0+ѝ0+ѽ0i+>>0IFjFBF HR F%00I B(F$(FEi>>  IF0 K@A J H I! F+0I ( >*$9?  IF0 KOq J H~ ! F0I ?*$9?K"`pG$~ pG O4S+2h @pG(OD ##D Raa]pGFaFH  F?Jh+`Ld# Raa ]pG Raa]pGK[h˱" ##!##3`F`H FO4Ld#?F! H,! F"C H!F "j 0H!F ???p(hK%[hӱBF! #*F#!+F0!F[H<$  % U U FdFHFOHMH$"F DDGK"GIHH4FHDIEH , AHB@H"!O0d(" " 6N5`6M"O0NC h+0H0HAB+,OrB((F! Fp3h+ +OrB+ + O333H"F 8"F4h," ." (0hpLd#"@X@r@v@[@e@@$~ SA!A mAs%&SKh#p@pG;>+ `Y T! "D!00"H!"FI a MF(` IH!D([ k`0(~ XBTd#~6 M IFF(F)FH4I"F(F !fBBXC hO(0TK ! CC !B K`!03 CBKK `B'B 0VHlCF(aa .@/ h+@\ 4"8F0@[DH ,8I&,?9!,P#2B) .I"PF # Z"(FYF!F8FFFع&Khk$$H F ]TF #K aZFH # I3II;F0J Oa|J~GG8xGnGjGDGGH H`d#GGGGGGH9qB OH8FOjRFx)?-) O =!FP`#4;G+G4G+0\F$^H`&`"$j0 ~  `h!0OHNLONOO2F @A 4#h 4hh+ 4*F8FT?+h+ =H*FF SF3h< , ! ( "FAFr(#0L " hb(.%I 4 4@4$D48O$.ٮ0+?Ԯ 8A(F0H)F(OrBa)FF HS 8@4FNH~ s[C0,o(H#:FYFhi  I iU#AFTxhQFOL$($(T$!Nm c#!FH0h++h` H? KF#F IH /]PPPP8F Fp I"F #x/+ !FH)FH8@8PNP>IFHr 8P!-OF#F` FJ F|;`#`0J)F FC0,o(H#:FYFhiN I FOR@##" #>#? F!( h_$ IF HH#`O0B B@}o 砆zZ>-GF FFFCO0P!m`+MOpDB  BORD #D(h<0(`CDOqPFD4:D0 HF5D, @F01D( A8FII(E(H#`DV (V F IHe#i/.Z]-OF$ p FFFFF(qZ,u TO6<#`0FZFGE yOO AF >a@Eq  FDFMFHXEI[FHEGCFh(FFa WFeFFF FWF砆Z]pG-AN} x FF!F@FOrT(F:)F(OpF"F4$4MND#I:F0F #Ch N}( .0F N}A L!D ĕ0FH e#-O["F FFLH@!8FFFPODIC 0Fh kF Ft1FDFF;H :!8F,F>FG5H F i̠İO3MO O OF0+O OiBFQFCFJF9F2(L0+Fiv;Dkdiij``ka`h4laa$ #ai#saf#]]]e#IFH L_!#-H@#^ I T gz h]__P-OFF$C 䰀FC  ~NFC#`'F|J@`zJD`yJIF@FC tKh( g8(S 5[5[5[5[5[5555[5[5[56[560hO#F0hh#F0hz02hTI :##PI#0hRFg:NI *g"3h"JIF` F@+xBI ?I z '##nF7I"2Fx /I ,I,z ڀ' F02h%I0h#8Y#Ob8,phYFXF40IZFq aa ,b/$($($!`_ ^T__'`V`[``B``8 d(#!FH0I"F b[#H#H#H ]F H ]yF H H 8 h Hh H``aa#a4aRapaDaba7" FFxB(I#F*F 0dNF]( FI@ݿheF]( FI@Ϳh"FBx (I"F vN8F F I"F #x/+ !FH)FH8@8PNPpG@pG8F FhHȀP((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h``lwhd   lm(d  lcd`p`lSd mO(e`mKhemGemCeQ BC p`"54S+BE+8#FBT#!A#38 FF|vp8F F#T#E#34+gZfXX\\:4.|q|pc cWFgfWF\C\BAXXS BB czgfp j $d$(^(,X,cWFH>HL8LP2PT,TX&X\ \-OFh FF44``h H`Fh`h` `H`iHaiaia jb`jHbjbjb kcTS BB D\5KE'L53#T"#XPZR3B2*5q5pOr$ F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" PFlF8FhF0FdF.D#$B\5KE D"0BP% F x(AД[I;F2F b({,T(F(B(tUI3F"FG8 ( \ MAo@o@o@UAo@QAo@o@o@o@o@@;Ag8_ $-E,`  E "C h"(д (XE @!X@ EBB%I;F2F $ 4 4 4- (`$$$dF,FEu JhʱH:F1FEz Kh{H:F1F@F)F I;F2F >I;F2Fc3cVcxf#wccLehFIH,IHchN+LO%%#hC N KIH+Bbh1F8F4xf#c!Jv addKh (xf#pG-AFFKFFhKh+!AKhKh1AKhFfSDKVhE h^"F;F H@" |f#j#j#j#j#m pGFFKFFh[KhKhCKh0@UDKXh^B zh^"F3FH$ j#j#|f#j#j#mJ@Foi\BoIFO70S9F0F;((XR BA Xd6S BB x @fhPFki!FkO"1F8F0'9F0F[p p `E 6VFE@ @8eOr1F8Fj#U n%nTTj#(#TpGP# \C TpGR##FIH&On!-OF hPn   @$C0)CshIBTsmO S :C shPBm@3@`n  L %LO{FFRF[FO~  DO~KC3!DLRF[FOqQC AD@Z;R#k4B5HKh3 F hPn   @$C01Chb!\!T2I2Hf akHDjkO  0D 0k4  $[4sjBr $B DsbLGqsk3sc 0`kBshBv~3n)FFA)CFsD;c3` 2CA0 U j#n!j#pFN F3hùy2!F"(F2 Kh[ h[3h(`[py j#KpFh!F+ OuOe*FBKhy3!F#0F3pk!D 1(Fpyj# -O=ǰFF!OrFJKƬ$uOh%h>x)`#II>x#0h+I(F>t!hXk(bO HF =GD0@p~JtI 2@eDBL @r[ CSfd04 @+F#"]hkAoB@iBoB@fDoB@cHoB@`CB@]3B@Z3B$$#iO@O ;O gKFhC @h*Fk0#F0FD`" FXF@F XF)+ OqF0FOr!h:J\kB@hOzq  hKCOA22$0O30:((?h2@eDBl@r[ CSh0Hph [nt(@+FOxRFCFzh rC2  ծO `: |f#j#` p j#Tj#+YIIOzr>thSC  (F\Icd#ddd#c1!hXkPF?h2@eLDeBr[ CSR 2Ln   L Jk@L+FD0$ $ $ $ $ $ ! Ozr OAh SC D0@0H0L0O30 HP?h2@eDBl@r[ CSR 2Th Xn  @C. A +Fp -OF-!FOL- Oc #s#  Kh+L Kh.H K=h$h]C#0 `j#|f#j#j#j#O;"C@BDA@0F)FXEFA"O10F?FJO1~@,OQOp]MF`(OR!XO1Op]a(НLO2!H#h+@O3,5KhKh4)HF h)H< NJh1hhcZcK BЋH, hYkK BІH" h:hYkBڂH hk_}HOR  hk?xHO2 sh BrH hpK2h hB0ZBZ\jK\c0FXWE eKXh+cH1Fhm**"$%kVQBdYkO|8eN<@eHBO|Fd De.)F Xe.Xm'B&cFf!( *FEH h9hpk#!FB@ 2F#  H  j#j#j#j# j#^F[qq|f#Tqj#j#qj#cj#O`^Kh+I# h4)hOP ObhObxiKhyihh0+xiOr!Wp0+ݛH0+@hNj0:5U\Bi"iBCEhInEr  @#*C@!CF2J\ KIfB(@𷁽R0+P#"h0"+:h+jOC FoL#FhjB@lH 8<O{0GF  "KQEA\%FVI+B%a` D%4<`DEKBD p0C_CKBu@H( h!i & i9K$8I{`ȿ`  h{a`Ŀ@;g)2@"2x0t[KEgx#e  0mH:fxfzn0BHp% kihj Db-O F8 Dj#j#j#rTRHh!ht@j#!0rU  rhREi@JhnZEvq nJFh$5+ ݡi #@n\CTi i3adKh+Od {h[ET{mS 2C {h[EP57XCm@P5?+ @ d FF0 0F FXC@;Z3;R80  D~O`IFF) IFOPOb 2FF(Ob)hOP# ;P#K#_ * , :BQFl9`#{eO3eJI  h)F`2" Af fH zf j#Yh}JB5smxBpijYh:buJB5smxBpij;bhkX0@i3DiOO Qk1Qc1FBi򭀚B"Dh|n&hikQi3DB@򽀎B2hi$5+O2fj $jEOKh#jzkFh!jjPn1Rk!b!/hj!Zk`bD(Fci6 @F "kDBh,H`f\Bii%AC Fk;Dk  id Fv F    +CD1CF E+ Kh+@A2D?p. 3 U Tj#hKI*FF0I2"\Bii%HCBhqFBrxn  @B #:C@H2 DDB$3h+hj8CwKhswH+ vqKhk ; r h#:* 0fKhfI DeLghcgbKh+30304040hJkcSCoTIOb`i0RMgib!`+hh9FkKKgihJK\5 0+WpOr!vCKh$;F2FW+h+hiZkFhPnHtL  Rk'@Ci1C8jcjB+h#hFZkh!jj1Pn!bRk!!!k`iDhiYkI> L-)F F4A1"0F2CF~f+( ~Tzj#r|f#rj# rj#j#8 j#-G}FFFFJFF(bI:F V(`I@FO (O78F }(.WI"F@FCF Hh+QHIF4kk:j`j`#k+ackka#@0+bB0kbclb0f'AIP+F*F>IC C C F9I8Fh 7I8Fb5I8F\4I8FV2I2F@F0&I"F@F0,IJF "!0FRHFZ0 0BfBO# (*#SFG700F9FFF$&F v0(0A  6    I I &+FPFIF$&0F9FLKlV㱴X AF0F`0pC O&+FIFpfPF(FG[b"((dSCEB@o#uwwww -AF:N0 0 $ FB FZ(F("F+F@!+4j*FBFd (F[ Fx2(!#(]T  \@  J I1)(FZ CT06&h+F@qF (FZ06:zB2h;`siD@o#ux-Oɰ F!FOKP| #ceKX0R["I >#%dS#cfHKh-=(F(3I@o#o#4x o#\xo#xxx y DyPu#0o#y(o# QSNyo#8o#yH")Fnl# V0423 *8m5biOH=I!F7I:H6G r&!HF7pIFPFX KF&@!=r%+K@&)F2 "#ciDfObB"IOc@FZP&00DHvfi6@Khy)FCF:F0DHD.I. v{ v|rB|u#@o#o#-G}FFFFJFF(bI:F j(`I@FO (O78F }(.WI"F@F*CF \h+QHIFHkk:j`j`#k+ackka#@0+bB0kbclbDf'AIP+F*F>IC C C F9I8F| 7I8Fv5I8Fp4I8Fj2I2F@F0&I"F@F0,IJF "!0FfHFn0 0BdBO# (*#IC C C FF9I8F 7I8F5I8F4I8F2I2F@F0&I"F@F0,IJF &"!0FHF0 0Bd0BO# (*#;+ٌH"F?@$^+؆HFHB&HJK +F/! {JOa0n(?_!F3sfF(hpCOvF"F8F1F C ѧBvCBu_H? #?{Ga>Bp=g ?.FCs-FHD9Fb0SFOsD~D-:@phC DB@؀0!Fg9F_ D5OpEC .DBJcOsBKB",H O3#p!F9@sXCP!F0Ou, >JJOrB B]KOqBHOKKOrBЫB]O BГB H;̅!QpyцO >*QѺ  !FO@(8 B8F> @Os@@a XT=!!F7F O`OPDFaK?! >DGF=-=H Fг?CӦHӻO BҢH)Fq .РHOrFF"0z " 0ЕJO|F L Bv m'@p@|0!,>)G8!?(F # FBs{Hv U=xbC%IA rC%FF OD6mKOvFB3(0F00 "# CHU#x(H/#IA/"B(FBTH/@v# $@sOrFB(;+#+? @sOrF@HRFT##B1=9H)D%6H7K) FF*FAF2HVZFB++##B #I?>A#GG   COH@! !$팋4F FXF8F ##&Hk҇, H  3I !FD ## O## # @#$#2J) F 23K)FKE⁂Khd  BF~IKF}HyJ#` @[KOsBUBQOEN #xP߬B)F"FAB :FcH"F!(FL к @܀KOrBKE@ r+sks, +tktt t+uku"&+%ka+b Hkb#bIb(1+,1k)#p1#b1X1ih13h@ 8IA##B#rilrDCCp q Jqq SF)JOarB' #+p kp#pB!IT"TJU#1"F)FXFC?BHJFAF+x3+ "x2 !AȈЈu$׈!gfff(JOqBJEЋBDKE dK+`SS 31O3z3KEE)+p#Bٺ * ""T3"E+F(F((#r2[C#2hCRsiP3i3[CB#hC+j  OF+!!6H* !F4H"2HFA /HFB.HF 1"C)HF1D&H&1%"HFHOwHHJNMFB 0F(FHKB 0F(F J+?O m )?EJRRaA?Miqy(<4-SЂhh *d RA0 8  eA K hM N OB`bU1 u$-@=B'$pG@pGIFH |!P-C FFFFB Os F(;AFF퐱}Kh"!@Fh:F!F(FCN F HKh` I"FF |h+ IJF tihhs`h:Fu$$(!:sFMh hJ@FHp Hp"!(h hJ3F@Zu$eu$TCxx"x"y#F^KFH]Id\𵉰FFh3SBF*Fh/4'78F# xMKF*FVBF  OEdrHqHqK"!pOaX`2+F"D3`2!+khCWI`N .ձ@ +ih{:+Ask`h hUBEOqDHq;F*F1 @=I k({V#蠡k2H+0IE3QD@0+HYF ԧz;@ ! {*72{F3FBOE(n`{gD u$t$m`x$v$Mbnj! Hx$$Ό$$ɚ;6eĐx$H I; jhP [B( ;D Hj`B13;KBj` D;%$ɚ;6e-GFFFF 0  q jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B ю 0  F.9FFHHF u$-CF#M -FF(F@ h+HCF:F1F|HxHIFth?  ?H!!h S0+bh< ICk@@u$'! K Lh K*FnI#FFH t%ܕޕ!XMIFF(F I"F(F I"F(F I"F(F| I"F(Fv !(֗,-C FFxF3 * *NlOx *##p\* Cx+AF8F(F;'*"*+;F;B+1F@F*MFƚ! FKhhSIC h\B Kh ( !\(O OCOC`O0%܁%%FFFP; F/O`#S`O? F`+HF+h`(Kh3#h'I; h\B^##ty* .(*.*#%(,h)9h21 QX0F È*# #IH #@#ct=###%#(h!(/#!%%܁%!hhPFMNO FP+hh *3h[S9hO  A L#"`c`y b2 F稁%%܁%@% K : *B ( QppGIh!!-A F9IFF(7I"(F`蠹5I Fh FvF(FrDB /I/Hr :+x/+ 'I'I)F F#F!F xj&Op/),#xcH+/*F[/-e+FF+/**s+cx.+1F F&F%Fr*9F(FX=EE=/+1F(F.F4F!-O]H#1# 3@#SaKbKSbKbK 3Ob`HPHh+TѩJ#3J`L#3[h+3+L2OFtFN*F9F0Fb0FNOa F2h3hzK3 + F8D"F9 + +#SpK!FFp\cx{1 @ObW%#3tzKyMFt!Fx+F3/+! AOb F% @"@!' CiMkIRk(F0`4/fH)F PeJOa10 P A0Ob^H)F@h!ā%DM4ar% ͷ lIF H(: @P?pO(яI BHd A1:^ FIF "( @ÈԁI BK# (|IF F( FuKhtK"`$ pIF (׮lKmJmImKbHmK mK mK mK mK mKmKmKmKmKmKmKmKmKmKx jIF F( @WF(?حKKhch`I; h\Bȭ[Kh#h+? @F(8!F @M1F @XhB ٠h C``F&4(F((Fg `CV/F0I:HtDF @@F(5I BHFF3J C @@A%FFPFF(YPF9.@I FWR$H炛!3Ÿ%%fқ$Ie :^~f܁%%h@Kh[;hI; h\BկKh;h+ IHFd(ЪIHF^(?| I# 0yZDoObJFIHXfFHFj*F9FHF[6FVK"1F F#!FC"#FB233Ih/IGF*C3;D3Q F(8 F0F8##FFCCB0Ѻ?=B?!h1bEw8FQ 8bFB8F (  ( 7#XIZKhr:F]IYH y D Cy 2 OIFCh 2 DKEDI V6  [E32BH  :IF ([x/I3Hh3I  0IF ( ] (IF &IF F(LI#h+ H%`H#h3#` IF t(e %܁%%*!IgfffFLfqCPTfw ^IF :(,f N IF *F( L I#h H HObI%!qC Kxi+ H3#p!H{ %@%؞KFIF"Fp IF IHb IH|#IHvHX% Y%FIFK:F hh\=%C KhK J K I( FF I"F H3FN(F܁% %ʹ!#-CF3KF3IFh h 3$OO \ A )Kh#F(I)HHF+C%Kxi+$Kh+#Kh{#Jd!e/2F+F0F)FFx{F F00C0G F2F+F/F*C〸 ܁%%-!%% BI:K hh\<$C PCyˆ+"B€? F܁% -OB.]]SSBSBO O FBi,FwKh;(FuIFuH(FCmKh  U F F;F*F(Fv(F JF[F8FVFC|Ѵ0X\CY F9F 9F F8CIKh+0Fcy+ FFI:FFFH* HJF8F[FÈFCÀ8Kh+0FjF Fm7I;F*F2H.N(F(FHJF8F[FF@C3h+?e CC3h+?T *F(F-;F"FIZI FN?by*/M F FUiJF[F8FFK܁%%!̟!!cy+)F F FK8Fjb[FbbJFlFKh(?J I;FFH>I:FHd0F I;FF HZ0F:FFHYX%%C!]!8K-Gh7I7H7O$&#Bv2K3N3Oj F1F4FCy+,Ic h\Bj|-е00;(FIFFPF(F(Fi,jD mjcy+Ѵ0I Fm3h; Ff9FF@F F Foi%!Ё%X%%Ҡ܁%K-AhIHM ,j&GF4.,jM#j$y3#3BQIH0 I vNDB؊+hD+(F 猁%H%%!Nb|%K-OFh߰IHOOaL#HN#J#h0R+#OaH#J#hHBEуJI I2K}JI bIzHM1#Oa|H#|J#h^0R+#OatH#tJ#hLpHAnJjIL?3iJeIgHPhIngLhK"āđ#ch P +wpCOr2!UFHFOzr#PFYFU"0E"p;`;a?Sk "lk bl bh `!i"ibi"(5H9J:I:HA?6Hc?"2(H#?;ixa(2HhV!IF!H(HH{_%!ȁ%% t%ãУ|% #1N% u(%! %FfL#CchpCO%-CF*N)Oeh hObIF(` #Kh#I#Hp(F2B#c` "a1BKhIH%YDb`I(#EOr0+JF9FHЁ%%!ΤN-OFMFFFF8FX#*F840F#FQF MOG#*F0F#FG3FFF(yB02F)F(&ht%N8gP F8\"iFF*,F F8$Fh F@U̼K-OhIHKxR+ ьKOaH##KJhL#x#+ чHIHO6I FDxthUIF{Hf~I"FyH`烉'?XFIRHHIQHfFIMHb2'F8Kxi+Fx+L-Ե0Z#뀆;CJ3FI H0FD%!%ȁ% %#!)J\m%!צ|%%%-AFmFFFFF(@H:F#F?Or@a0F9I2F9H*8H*hUE5IF3H m*i0NԀF2hmiF-0F F  o/F0FOg:F0KIHm#hUIFH 0:F Fl0KI Hm#hU IFep!!t%%BL%(  C L#x#+"# Fv F4#+ H"#j@Hi PF FFK#BqH"F+FsO F)FzhR;hES"qbC"` Khvj O#BB9F0FvjЁ%X4%%rBijB ћibpGiBтiapGF+IPpF F K#Bq Nrh3hS"p#BB@j Ё%4%PpF FK#BqH*F#FN(F!Frh3hS"03*F#FHp@`ZjBB `p$FЁ%4%-A!mF 'FkF(FFkFk/..p hAF@i,$ F m5.$j8/!F`F$ F8#p(F/##pF(Cy+H)F٧FL/'6*yB H!Fp F)h F2 !5B|H~O"#!x`T]8`wH#vH"#ÈCÀ5"HFF hUjIFjHjHIF(Fd( hUcIF`HbHIF*!0< FTF]H"F1F(FP(+|hUVIFPHnUHIFq(FrRKxR)r)uPKBB)ЈBCIrJHKH 0"(F(EK"?KBK@Kh ` ##"4D}`(<`1D('B4(3( 3D(B^S(,2DC(,S,C,S,C,S ,C ,S,C,S,C,(3HT"D"2%!4%ȩ!ҩ BH%%j%ȁ%%Ё% F h=FhFG##` =pGA˸KIHm %Ī!Kh)Kh,Kh2IH F[h9@# FpKjFIh((ZhTu IFHL %@%! m@pGpGaJFhS BDKBKm I H ]"S BD @%I%&!F L Fh"i DBHh*F`i9F5D0D`@%L KiDao J3 Im H F]"@%%f!#MF`+iBli FphiT0FTFha.aK(aImH##2FK@%%!K FhCK$h FF`GKh I%"F??KgmthT I2F;F@ Hb(F%@%%%ܫ!8ML4C0+"mIHJK$#e###c`* H!4&8@%%:Ё%J̫%KsFh F;H F!F`nhGKhK*F!F0 KEmhT I"F+F`H $p%@%%%Y!8FL hF F8)FT(4pF KM`khB NTT0IH  l`p% @%!.K-AF-NhC5,KhñȀ)O:! FpFh# F;t`F(9 I FlHIHzhTJIFjIH`fhTJIFV3h33`!F HA,F爁%@%%h!7)%Ԭ%ā%𵅰=L##:IF:H&##Cb F5I3H4M8#3K@3I*+F2H"7-M.I+H.h.A##(IF0F#.h#C,F!I0FN8#KI*3F"7(hI(h)hH,+h[I JJ%! %լ!%~ !-Jʬ-OFhŰF FNF0# FHI LFB#hBӫzKhCyJzKzIuHLEFh0pI E#y+:pJOq8Fyd0S#yPFkJjI#hhB.#..2ly`y2B"hK:#D@FR:F!y\J0/SKhZIPF #hDy`y2B"hK:#D(FR:F!yzOJy`y2B"hK:#D(FR:F!ylFJ#y+ EI8FpBI8F(60+QF>HF.. .ѢyF(F2B2"D5J y@F1A1!D0J0#y+yF(F2B2"D)J...ly!(F2B2"DJ y@F1A1!DnJ0hy!(F2B2"DJ!˭%fp" r)=%Kh(K[h pG @%-O(L$ #F94#hs(ЩH=Kh+'FFKh35E(@Kh+)IHIHx#0M 4KxR+K0+''F:9+LьK(FIJKKKH)FBdd)FXF:(FLOa `@0ԝ 4 + `: zH)F0SE7 J $ )FmH `IF#)A bQF(F `YF3 +)F ,F'RFXI(Fl)FUHUJUI(F`(F `Oa0  JKI `6 4 + aAH@H Dbh(":HF?4J(F6I F0H B/IH.IEE *IFFBB\#IF HH IFH@%N%%%!!"%% *ɮo `2Ԭ%ȯ29ȁ%%u<Hā%=/ :N"@9C3h)3)4I4H+ 2K0+90+ۮ.H#W0)- `=X*sY=BOqA3hKJKI-ȿFH*FN= `8+Hg4+?H!#4,0- `=%!%,!%̫%-OFLO5 B::h#1FBK)8O)%ch(D+?IF#hF;hB ( 0nHYFB;h9!hif-@#Ob5!Z%Ob@F9399393QWKFJFh ~.98h/O# 5DܩF-eKILHKK *,*!*"EIGHGKhCFHE  :BJh"BI2FBHniF5F5I=Hm=I2H`#:I/HX=h!*Fch!(FC(LhTf.IF!H>I#*Fh??-[MFKhI!H#hC J9h`0 +:h)FHIOb(D3@%% !=%T%R;%!kű%%%rKFhM+@iNl"BkKBBИB&0F MeMhCeKhdIeH#` Fx(]Kh+ hl ``hh``hd`h`` i\ a`iX`aiTaiPa I nDf @  k= c`k9`ck5ck1cl-dl)d" xx||!hMK+4 %T@%%!hFhF(?Nk#BbBMhCKhIH4#`wuq i "c"$]$&W& U Q MIEAOb! F#`22`20caa 0#$00&00  2 d22Or0HcKa2#ca0C@S #]Ka=;$ & WJh*Ҁ&hUO.QUIUJVH+ FUI#RRIOHNI oB##:x3\#=#caiNl#B#i2|3 2ch2h2#k2k2#dcccf3H#A1C$9) 8:%I)H#I'H'I!H9-;B#IHI P"h*N*=*;o  # B1k.3I IH@%%!T% ޱD!>VoвF-bi=#9#&#-AUMmTKUL TO+e#+#k`iBQND=3= FLBB!hK+zq-o fl=3=$&0B=N F'8BB=3=;hF6#k`0+a0ka0ala##ckc# #kc# #l+dnkd ##ci`#`L-*IH#= mK##K+eKH#h+?kH IHd%J%T@%ȁ%j!Ё% 4Q%-O=# `J   ` n`h+𝀝KiKBМH_H4+𓀙J434 #C@ +@  F ## O T %0B@;+y h\hSvI"FF+!%s!%%F Y@%+Au\%%8Ǵd&%1FZF F IF F ﷹ2C F F|HKhñHI[F2Fn8F0DJEIFFv#*F!F;FO0QQF F %R!%c!-C/!F@D'O/O ?/+0F'pF`0FB+Fh0F;FC뀄FCy+I#jI F F# CKhF l( $hR?"F I@F H Kh3"F I@H q%R!%!FCy+I| F# CqKhF `( hR"F I@F H Kh3"FI@H %R!%Ϲ!FCy+I< F# C1KhF ( hR"F I@F H l Kh3"FI@H b߹%!%!-CFx2LF.+ FFCx/+!h-H 2F+I  h;FX-A!h%H9!h#H#J"I hDJk I h>J/I h6JI h0JI h(JiI h"!h #h[I JJ%3X`5gnwJI -CM`/FF "F ( I 0 +;#0B#H+UwH!Fs瘺%pmFFlF! F#xE*Oa&H)FPF (`#xF+K"Z`O0A+ F DB< +#< H!F,I h  mp>%FF FF K!FFh F FBI B1F(F@%𵅰QL`QI poixȼ -H-O$cMFF!F(l,` d0F*F9F&0""##!"FD D dBPI0F Q"FLIF!D(GI>DkCEH+hCHtpV\*5O `F#"2K!F?VIFH p!HFCNM F7h{3`70@bq=N@A<,u-AFALm1+?HN =!POC #Os3`Os   F8F0 9F#h+ mX"AFOc3`OsK5R# (o@# `#*s3F 0 hP(FH,+ Hh2C-Hv%ej-GF9OFFF1+f1!S .]:)F F/K"G C>+KF+HZhB1+. )F FG."H00&8B.ѽGH ļ1#HF)1+PF"F)F HG a%!ؔ 9wH'-CFKNFFD3h!F',>DI F.O2oC#HFG00*Ѵ@ > *"` FB /H"F)F3h+ Bx+h+'F1+#j# CoBB?#)F@F,j#CoCB?#)F#@F)FJ #@F#J)F #@F%-OFcNFF3h!FG'O,Q . PF0SH)Fz%@F  FxFF | IH"F)Fc3h+ @F jFXF|@F bjh+.PFGX0Ѵ@ f'F1+Ѵj#OC#)FHF,j#C&#)F#HFPF J !J SFd!& )FFHF,8F . ! J ;Fd! ")F FHF^% K-C8KMt}wBEO!/!!AF(FF0H)F C F)FD2F( #8F$<%FIF8Fؔ %%%8x-OF$HF#L%F!hF F)3h B"8FQP@#9F|"hI nk3`#"YF8FSh CBAEPF(@#9FV"hI54%,*:-AF1MFFq/Xj2C #CP)HA!S .B;!F@F#K"A IB>হKFHZh1+. !F@FA.FH,N%$B H)F~A 0Ft7%J!ؔ 't0% FF#S0 0*I"F KjC+F Fc1 H!F0H&%-OCF+F FY K]h!F*FF HX)HRHL%ؔ  npF F&#f0 p*I"F Mj1 C3F FC1+K!FHZh1+ ORD|#H%ؔ -OFF/oKh#nH# x (#2 ZC @FO`FX SO3 (# #3Q9F$ F(" D0F$0 5 FOOA P(!![ BLI*F Q-,&F,/F O ZCEݸ 3 ZF+F! j2CN#("1F8F (63P(O D    bE(Q g  0@00Qg@00Qg@00Qg@00Qg@01H9F#H########% -CF`"*x FAFn/#JH#X(FOkFX ^#O3#F%9FHFU60 F F#COR2B/I2F 0/#C#C  #"F1F$IhjC!F0F3FBF!u# #5BܻO\1H1FnODB 8F^)F#@F5V% 0FF%#U0 0*I"F KjC+F FI1H!F zH zgzg+z;g+;; ;S0+%-OMfNF CD3FF3h!FOZ,j FF ZJ ZI@ TRF4!\O FHFSIRFOS AC@18F h0?Ѵ@ * M#F`HFzCFE H*J\DI;HOrV(OAFOr4H*JJ#l{O +?Qc"F)F0Fk+A$* 0ILp#C3F@G#C?@3+ IHWw8_%% %"%9T 4ck O 0oF%0kN\F#F30FKF40 @FNV 0h +ѺF#h.@FNF|O# F%;ackCE!0 `0 C $IF0F$RRFu ` 0O CDckSEЧk`#AF wB  zh hBЋh;C 3DjKhBъh*O9XF NF( ! 1*)F0F0 #AI* Fa*)F0F0# OcO BF)F0F0(h +NF(F)F0Fn0 #$I:F FGF uGE?l8FNgGF*')F0FwOHJ0CFN_F0K JIh:GF')F0Fw00?H;F!F F%%ؔ e-O8F=!F&`FB<'?+|7F#;I(F耱xJ&809`*xBHF'F.# Z`"!@$VPoA(,!(F C D, %@. 0 2  @FFKFO O3OFLF9/F8O 7+uH)F==!@FF`|I@F(bL,! F F" +tI@Fr(?ѹpJ)FpKpHFa0+@݂ B"pF$eH)FLdJF FB]H"F)Fx+Ph+o FRI@F,0o PI@F (5,MI F(KI F#' GI F#' DI F(ڀAI F#' >I F(̀;H"F)F:I@Fع,` F^B 1H"F)Fjx+h+,I@F(X,?l` FBF"H"F)FGx*h*Bo@ABOraؔ IzQowy7lU%I@Fd(9,? x*?'a)'&&&&&&&&&&&&)&& & #p"F3FFFfFfFvF&FVvH)F"tHBF)F'''F}*8uD*"`@FVEeH"F)Fx+h+oBCABOApXFf`XFL # 4@//@MJNH)Fl"`@FEGH"F)F\x+h++q %qXFfpXL +# Ff@F0$ 0 0B-H"F)F@F"`@FE$H"F)Fx+h+rGL#FfXL# +#H)F Lz/x H)F3?sFflJt/L H)Fy bw /, 3/,/,/جH)F/ѫH)F3/K@cp#I(F(BxJ#(FP908CFvF @ "(.ABhB#+0(Z:@#`#@ # 02hN)FFHUp#.!)F "((FOr "pOs# zKzvJ8 p0)F2o@# h2CoK)FoH ""#4qiI" F(okz=+ _J8 Bg 1D`H P44OC Ow #(FOs#`QK8 : < > 0)FX"AFZXp4KXS,YoC,`#2F#`c#F80:hNT)FF:Hh2CX2I6H;+/J5J"3I" FX(cѫz=+$J8 B[O D=!@FF@@FqOO dv 4+H#4K ( Or @F0Or # K0Q/< )F ؔ 4%ObjS H)FqOjxB=#<I" FF(+z=+?J8 B 1D+Hm h#4$ CFD@0! F1 HtCPFF豆hN- NmIFH0һh"F|ILp0 G#03+?0 ! FO T'&JF F??h"+ hN!FFWHzBxTH!F0+-++.##;3" #S1F0 Ϲ /# &C '##&0##XFh+@,#,, #'I@F#T##I@FM$ '#FI@FC# &#FX#I@F#5## F,F@BH!FMzFI HBؔ %%j'eFAFF40G D(FqOMP,h+*FHF I#<# I"FHF3F4 #CF p%MIFF(FI"F(FI"F(FI"F(FI"F(FI"F(FI"F(FI"F(F I"F(F !8Kl8FKhIFpF CF H)F` 8"F)F $^*FFH %3mFFOahFVx I"F ~hF mzpmFFFOa&V\8H!FX mp&iF(ZH!FH!FM#C&h nk`+h  &2F 2(z%mFFOahFV8 H!F mKh  hiF  (z%-HOXMFFF0 ,iyI F(YF F(+*hOa FV qH!F(iYF#4  FhYF FdIh8 0Fh`IF(q^Ki ^I(,!(FF#p F,#;p=TI PK +x3PH(FM禱MK@LJ @E @FpGH!FuEK @EJ@7Fv9KiF8IHP?`b#FFHF0M+FFF Hz( Fp@M I FM(1F)F p~-O F-" F ܡH O`hCM I *F ڕIEEДH*FAF,w,|,@OcMK)#C(F (+ +@7FDFO 0?b!0F[CS.0?خ#) X cJPF[CS!0?î FA (F/JjA0 ,HYF `   FnOxA (Fd#A0 )c :F HOL,CFLQ`  $:FYCFAQ`:FCF1FPF JYF HY@IS|IFH 6!-CFFFDl `!(H FT@BD=D-$1F `zȹ4;`px HbOa;`Vn@J It=DLg%z8FL!hQK*FIhXKO2`(F>4xHa( "!h Hh J` J`8hah* HMx 0%|&8&4&0& KhSK"IhCH!P%0%>% K$` Kh F K Jh+#`H!`%4%T%&%-C)1N MFF-L FF;F"FAF0h0h@ObHF ( #K$#I`+F0h F MJ0h320n+) ?+a+OK*FI`0hp+q+ $K"1hH` K$I*F`I+F0h*Fz$0%h&!X%!t%D\ih!KhKhx pGt%X%-A N3h Kh M! L#'h+`!`'`#3`h&P%t%X%-A F걥L&"@< T1'h27&\ bE!T.MAN/FSK&F+=F@8ױI"E/h27p<B7h7 p6B3іB +BEF"p" P*F!C K   xx{L#uNpFKуx+F(F2*K,{$,\,*\xB)3_x0/"ٓfEЧ1V$|Fl,7F$|oEp4lDDH,3x2x,3B#A$<[!м\м$@ax7h7p@0)@lAax)T"FQx$)}ёxL<@gw0)i/jaxb)])\)ѡxF+19Q$|/uQl|QHY:FbED\/$/?x4h 4@d70)lQF{/W,/]/<19Q$L,QlL_QH!FaE  D!!X&i&X&X&{219Q$L,?oQlL_QH!FaE  Dc"FZ,)?[])?SUKHh0%-(cLJMNO#h(hCFHKO2`1F4z:FK J Ihp K"@Hhx ~0%>Y,J|&8&NO$;hBKMh.hCK)`h"I"F 6hB 3 JxS HN(.`<`,YhHC0&&%x p&0KO2`@H|&0KO2`@H|&0KO2`@H|&r(LO3#`KJIh|&0%ȡ&(LO3#`KJIh|&0%&(L}O3#`KJIh|&0%&(pm#$$Kh`CW-KO2` mp+D+(J (+Xh F(hh,Fxa+/KNhK*FLKJhh;#<$"YhBFћh#0F)F(FL] J O(ѧ N#F#|&& &&-GHMH{KO2` HM(wJ (tK tI$`!FrH(hpKhlMoNpO"FF(_ dK"gN$hOB3h+=h-@\Kh+@S$hd(8]K*F `TMhWKQ$hWKhWKFWH)FS$B TK#h[ &)hOKh{MK"`h0+h3+`FK4h1"x 2h#+`*h*h!F(5K!F:Jh;hh91Kh1KF1H)FB!F .K#h[ )h)d(Kh+?_%K h`h+h3+`K`PP"O aC   P$[HYY|d|&)h&V%4%T%&p%&& t%P%&5 -U)3h+0+h(K" Hh0UKhKFH)FUB K#h[ E)Kh+ K"`hL 030K瀪&& t%P%h&&-G(mF#F&&Kh`[MNK$O2` F m+7+HJ (+ F(.(?K?Ih?K: hh";#9!*)FF-6Kh5K6Hh4J O(ѱ3F2F1FF-(%$h+(H9F$3&K ZhJE.њh"CF&HJF9FK K(FXh>??#BA$(FLh"|&&&&&0%Q&K#CO KK)&"K#CO KK&-CMHj]KO2` M(YJ (VK$UI`UK #hdHQKh+QKQHhOI ;!MHhJOBMT#x0#+`9h"3F( 6K`+h+/KO2`(,J|()K )I$`(!F'H"M%N%O"F,FP K`h#x +`+h+h!F(!F0F?)h(K"`);h+K"h`h+h3+` K`|&h&V%%P%&t%@KO2`](+JiF(+HYh( Hh( K" JiF(|&7?G&--GF h FKIp I LD F(xDKh;DKDHhGU=@N#2ݺoh0=MY;к-иp59H Fpx7K*F(FF0H|#)FF;%F#:F3)F+K0F!'h)%KO2` MI(F6б+x|+(FFXKO2`, FGKZFH($I FJN(FF#&0%ZO7|&T-A@MKO2`(X+HJ(C;R#!B#?Ixx|+ (9Hh($6Ih5K6I` !F3Hf/M$1N1O+h+;B3h۹ t'K"`BK&J(ѓh:#3KH,;FR$ `F)hKh{K"`h+h3+`K4|&7h&V%T%"TP%t%pFm@;KO2` mp! FQ$ F4*,! .H@.L/!(F F`AObz'Khk'N F1hf1hh;`+ -#KJ FhH!FK O2`!F hZ ` "p" F@B1F cM H,`#+`|&&0%D%>0# 08u7KO2`0(4JiF;+0HYh(F+,HF)F*HF(F!F(F, ,*#K#Hhh+HF!FHqF F!F F-KO2`h+Hh!FS F!F F|&*20%JT%p(LO3#`нp@ K NMh 3xKn3x+)h Hp@JI(h##`p|&p&t&0%)p(LO3#`нp@ N M3xK53x+)h Hp@JI(h##`p|&t&0%?@KO2`]((JiF(HYh( Kh Kh# K Hh HYh(K"|&T%0%d&@IKO2`]((JiF(HYhw( Kh Kh# K Hh HYhc(K"|&T%0%&-Am FFFObhFXo$B HiF8( V$ObhF(BObAFhF 4K"` mz&~@ KO2`](JiF(!H|&@ KO2`](JiF(!H|&@KO2`](+ JiF(+ HJiF(|&580S KO2`8 L#B%h#`H%`IhH|&%#8C+/ KO2`8 L#B%h#`Hf%`IhH`|&%1;80 KO2`8 L#B%h#`HD%`IhH>|&%HM81KO2`Kh+H#@/|&T%`81 KO2` L#h!F #h!F |&T%!F #0(KO2` Lh!F H F!F F0HF(|&JVp8v=KO2`p(:J(XhF33K4Hh/K1Hhz,K.Hh.H!*(,I BF u[z{'Khd K&Hh Fg)F ,!N"I0F 0F41D0F " FhAOh8GKJ h;#`7)F |&0%`s%AVT%lY&&JKK`&|&JKK`&|& FOF(O3;`(N#3`KHhB3h3h"Ih H33`;`B, K"ph"@H{|&&0%i&X&(7&L %M#%H+`%Kh+h#`0 tO3(,+M !J##`(h` KhFK? + F !,`F#H#pOb)h? +Ob!F H JiF(|&&0%D%4%X&X&(8!L!Jh[ `J`(O3#`8MhI(FK@K"`K`MKI(hJh+F F( FHIh +h I(FK"K` I(FK(J#|&|%%/0%ڭKJh+K#K"`K`%%|&%KJh+K#K"`K`%%(|&%8F F)F F8@ۿJKK`&:|&JKyK`&G|&(-GF FF*|({nhAI0FJ(f?I0FJ(c=I0FJ(iO,\Шh.`,Zh'Y%! A!F <F+K`+K`+Khs(J'K)Hhh)I)Jh+ F'IL%K`%K`Khs"J KHhhIJh+ FI0QF IF  OO%&Od%(O0hDbV%%%0%/Z%%"RK`|&0KO2`H( Kh Kh# K Hh: H( K"`# Jp J`|&%0%&t&p&s F(~KO2`pKNh31hHp@V(Lhh ")xjjhI0h#0hRF H Ip@N|&&0%Q&%@805KO2`8L#H%h#`n%`|&%p-C(SKO2RO;h+QKQHh(;+MKh#JKLHh$8h "8Yh;h[EJ "DLhchME3%>Mch;c`+V(F (Xch;c`+Y(F (O5JiF(ѩZi2`+c` FCF "K(HhBK`#hZ"`x.p .;h"hB3;`Ka"`13;` K=a`#+p5#hZ"`x +Ѧ0KHhi#hZ"`x +|&&0%ut%(&h! (&(&N0RO33`p((J(!XhR??F FIZhKhX-t##|&60%L0O3#`p((JiFS(!Xh~?? Kh^h3 I2FF(F+s##|&0%?0KO2`(ѽ@H@IhH|&EJO2K FS@H2I@h0%R-A@O30(( JiF(XhF(H6F`xK*F(FF0FD4 Fp"F)FF"FI8F"F1F8F8F8F#0J0FJM~|&-G@>*KO2`((%Jy(#HF(9x K*F FOF0r|#N!FLF;#)F3` ;`#HKRh(FOsJ@L|&&%&(FO FO3;`hI0FJXI0FJI0FJ($hhBFJh3*hI$IJ`h ` h I#|&Z0%&&-AFFF1F8K:FIAhy@hJ#c`0F JhF``B=H"hIAhb0%%-AO2M*`((ACbhAF0h4*:F "d#h+#+`LNO "|&ؕ 0%(NO3 F3`н@ Hh OF0jh8h I@@hJO#c`"hI8h #3`|&0%80 KO2`8 Kh3 K Hh8@L#H%h#`%`|&&0%!%N8C+KO2`8Kh3 KHh8@ L#B%h#` H%`IhH|&&0%S%*8 FKO2`8Jh2KHh8@` L(OIh%h"` H%`hH|&&0%%h;`+ڊiB ( hZ `ppG߼-OMXa;KO2` M (Jt(ІK$M/FEуKrhIhB)Fph "54}IOBO#w&hO ;iBҀuKh+FF+21 TnLO F+x˹#pmL#hhh?FccJgHhj\J;iB5$+ \+Okx5;+x+5YJhjxP1@%# #eF0;jx P1@:B3  FBQ#<2R#$Di*5B B FS $S DO;H0K6Hh*KO2`Bz21Jh)K0Hh0JhZ&H   "XF"hh G Jh:0#K hOBH$0#hhS?6B?|&&(&0%lY&!H%`T%%\%L%FhIJ##``hID#c`hI>#`K "`Kh Jd!F KhCH!`%P%0%%  Kh Jd!F KhCdH!P%0%%-AFFF%hI*FFF2;x ;۲+!2FAF8Fй] * :* HFF2 x ;۲+ !`(F%FpFh F:!0F꠹I2F(Fh##P+"(FI(FIp@0F_F$0%!0F#p I2F(F0FIt+"@B 8F@hI^#c`h=(F!F(FhIN#`8FKF FFh(< :F)F0F ` #h+H#h+ ;\ :Ҳ* C  Hx *3P #`T&0x#OFx p%,-Cx[=hZ5`%Ղx 5PW$7$nO۲ W$7$0D p10$0$0 p!-GF FFFnI mI"P P#`#0+; 6fI"8F(# `#aI"8F # `獱(hFh `hhd``h`h`+#`SH:FIF@F F'O0/!PF(OPF@F@!0Fh%`+AK"`[-:!F(["<7:!0FF#;3x&`-1 "(Fx+x;x#BOsB%H;FJF)FV E(F*FQFF\h+3` (F`` h++Kh-ѥh-ChH+0`(Fq K M)18@&Ph%Nd%h;`+ڊiB ( hZ `ppG-OL I"$O3FD D@D(@ۀI (F0 x x{H)F$ :# F L O &x+;! F(ЁIIQI FIL(~I FIE|H{H*F!FO ##p +x+-+x+/!(FBF@*@jI5+(F'eKh.++@,&x6^I F&-(x(WI(F~O`RO0!F gObF8F<  # *Y # "0 H00+F9K 9H*FmO o(F#@! @K ,K` :!(?.#;&(?n#F",F+FfF,Fc&FFOFFFF + o(й-йuJ#I F1m~Np%&x9T%x%HF ,I$-+x+𡀖Ob!FNIOb&)FOb ObGI8FvVODNu eCLOb%h#`3h+[@I8Fb J%`_N%x9:%~ FkVO #!i@Ci퐹0۹h!`h ڑHk`i,c9F@BRF9F(F.i+ІHkIFhJ0i"isi[ (F((FO5B#xH10/K(uKhk/ ="=0 >>mKnLhB!F@F4(;hIOBhHzfKhhfKh/H!#/0< FT!F Ff0H#01< FD!F FV1H#1.(?6MI LL h(< II+(( x h(< rAKhc(,/M(F>I,=NK(Fh(#(^E##HǸDD%&%%~&9%Kh{KhcKhBr .Ft +?W,?S0SNOAFFNFB1HbD@;t bp+r 0# $KhKIy +?,?$:$8( pyHyI wH,?(*nKh++sK)s#kJhBOpAeK hbK# h g)'cKB&8#??!FZ8#`^#')G)#ZT0 MK8hRlQIF FPMK#*sIK .  8 6 4 2('+18K#hB3KP֮O4F&FF'FPO4F'FF&F&%0%@B%%4F%s" F IF(I" F@#FF F7pI FFXI" F(I2#F z%h++HPxC I" FF Fp@ջ)8<1k&𵅰#!2H툱0Kh++!F)3(I 'I 'O 'M'NB Kh+3!F:!R#(+hB #+`!R#_4hdI F8#x|+ FH%#3`+¿33&T%]%&%7𵉰 FFGI "FJ0F+h#3F*8D%h KhSK"IhC H 13 1Ch0!`P%0%>% K"`KhSK"IhCT H! J131#@;`h`%P%0%>%h&KF "`W Id" Kh0YFF F H!:`%0%%K $`.J#`J`Khxr+s+I FRId"Id"hKhFC H! Id"`%h&%&0%%FF0$@X^0Y@<# J h20[aջ O$p)5KBF$$hZ`}1-O+K"`AF IF  @BB  L#hkKE иٸи? G 1kKE йٹй? G0.$x0+\ Kh+?WGS,?_!%&%M%-A!N 4hdH>KO2` FApGO I#;` AFF0h@1hH(0h8KI@F"`@ ;hF;--k G)F v &=|&%&`-OPLdM"FF#FiC C C #K x2 (phGFBF{H9FzKO2`$h 4OrYi FqK`tBFnH9FjKO2`b9F # %S!i@CinP@BQF*FQF0F0Ki3YHYI3Fhh!`h|TH2Fi0i"ici[ (Fn((F#"iO ih#+H,# h:*F!8F'`"0Н90+ #"!#8FP h1F2( Hn hO3 #`|%%Mb&\%?-AFgO gI#;`eKhF,*@bLe"``KaNh1h"`*h`) OrB+3`ZN|s|ˆ6sˆpNKNIh$!$!`LKh(!(!`IKh,!,!`GKh0!0!`DKh4!4!`BKh8!8!`?KhKHh(9/'p7epO@F0'v H0/<.+3<1#;N}%0%%0F7MM+h6H5K14KO2` M0@!"A  #"iF(&H\%I"(h^(h"K "!Fh(HHK1KO2` l մObiFC ( /( Kh  % " M0 &%|&$&0LO3#!FHKhLKh+*ГKh+ $$KhB"ѐH(" KhKHhJ KO2`KJhK)F$! Ft~KHh, 0wKhB LHq( ! FX!^(VuI wtK#R<qH(F9 F3hK#R/eH(F,^M kh3k`s ~ m @ FtMH#k`WIh`UHu( *PHk(OH!F  JI @K2I\`(FKhX3EM+hS  8+d#Bqb Xs.@ ZeHl [$C&F;+ VJE ؉ L ىXKh0=4-s(!PHD 0 # G# $ x F 5DK#*s (.h +L:K 9h# ,8h#Cs##~ 23B2 (F 23B2U hY`x\I#BqK hbK# hH&UF;&&|&z&%&%&%0&%0%% M(h(,` # # KO2`V _x Zw +? G| |%|&ŰJ Ih# FJ g`JK I KJhKh<@ +EцKh+^O2# Jh;#H!(X}L%#h+O|KO2` 3@Ѓ3@уwL h($O3#` +@Ƀ +@̓gK`fK``K $iKh+,Kk x-+ +cKcIh_K `Ih+  E(FXI WI K K TI(R x|+N !(g /!Fh+ h + EH| ##p Bı !` /##p(K   9H9K9K8B < E+K4Mh8 +< O07/KhE!KhK[h+$+Kh+Kh+߀;+w+OK#RI G ȉ!)< H%F4&&|&&UF;%%7!%%&Q4%&%0& JF ؉ L ىKh8=<-(fh +]ѓK  # G# +@?K#+)?}C@=Kh+?u KBp!???c!# ##p0RoK hnlI*FF FjBiH`( gHXaL Sh;S`+ǀ &AF| />VN />[OT[O#C$ "#tB&F Sh;S`+ B? (4F#Bv# "#R( hY`x43 8FT!h#  hz;hAs##2-Br3B2 Sh;S`+" F /+ [-G Z h +SK [W hY`x GJ13A1KxYG%%%%40%/%& hY`x8%I#Bq"K hK# hHhLI hh!hH I /Kh+?,   "* ) +?3 G. x.%0%/Dx &pGKHh0%81KO2` L" hF( HKO2 @` |&$&FIFF FhF"BF18FL hF F8)FE(4ؕ h;`+ڊiB ( hZ `ppG- L#hK H I 0 `#hOaHhK*FNH(%,%L4S H I 04OaHhK*F&H(%60%FJ$!F FhϱF5FEмB12,FF!)O0F( -OFFH8I@F(F0,b O,[1N1K2J 1M)F0IF(hH F ! F O| 8 z+ F F5W?FCF IBF<, BFYFh^ "FX0FhGCh " FQF$$(%`X( b?KpH!x!)$))*!x"F4 ) ))Y!)&F!x"-=& -)&2[!)H!a"x!*Fp!H!!(\-Uxݹ2%[H()(*FV5x2F6-"-2F2[![F"("((% 8LK (8 K8#8`$8jFF $838(%lY&l&𵅰@LAN(8{JnixF#1Ft6I6H#OB(ڂ0$8+ 8hhlCF)H(8# "H.HCz3,8H)h "#8F08" 8$hh`G483+z# hKB I i I e(%~8lY&h!`]pGFI d I"F \@hU| L#h3 `KhB#hXBXA 0%KJ-OFhh-CC˰O!2ah8t#as:4 jvA0 8 򏁵@PF1FTA0 Q0 F F 33C@xKJOq h2J{IEF IFPFJK 0DFJ[FFqDOaaPFOaaFPFF q0DJ[FD0%%KTF5F$%FK 3DT+# ,jK#*sh KhS K" IhC N`%P%0%>0%lF!FF` 0#iF33(O0 ]-OF-3MTͰ !(Fn##! F`Kq2cA!ia h+>j K#BsvNxOF0+Ё3@I  y0+R(𻁖I Kh+}J 1!DJ;+{K8FAFA0 FYF JA0 q D {+{dOd [F|KhwK*"-:Dh * sKtI DqSoJ[ oJ^DnH#:FAFFB| +@#!qeJ[#0 B#Dhc 8t#as:D fCKA0 (q8 逵 ݒTA0 Q0 #z/q+@Ԁ[#0N | ;oSoS3nd";*@>B)O#CS@3A *J@PaF(FKD (|K %D{#*s ۵ٸB|JY@.A&%&Ъ&1&z&D&QKUbw&%OsEs ZJOqF ^WKhFA  ! OH!+x ! o$ 3BR+# F" 3@P.z ;JYF(FD+ q6JD1K "FhCMg#l:A FF2$KA0 ! 0ȋ{jB?7 OaaFJYF(FDOaa0Fx F?~|h m`pILcn` p`nCh;C`+3DBР + (,("(=;Md&`nCh;C`+0.A "( \(`nCh;C`+ C#+p#x+,L+M h(I hZ`xhZ`x> #HO0hZ`xMc& p`nCh;C`+!CР + (,(\( `nCh;C`+B> hZ`xhZ`x)F`hv4&Ĝ &-OFNF3x mI0FL`fHh+ЌH1F@+.!#1<%(+0.K(FF+(0@Ҁ( (-FF (rI8FD(9rKnIh0FD.!0FFQFD`eI0FBF 0+a.!8FF(QFDoF(ѨXI8FBFF(@K0+HA@hh(@FG`AF0(( (f(d8(S Uh>IȱcnB( 6Hr5Hp`nFO0/F(h+@FcnA(!HJ"HeC(0+@FKhc`n hZ`x ( (@ǀ`nCh;C`+FKHh%&|& =4%0%n&#RNYCS 2UPI`nBh:B`* \AII IKJHhhx h 2@ B"p (Z`nCh;C`+6BhZ`x6J`"ch4IB/K3Hh`nAh9A`)"Cp (n B 10hx J; Op3HAFvFF5F`0+Z abi2` (?@)^K Hh9(&!0%(&(&uKhF;sI FDxI" FDhK"`320[K"Z`I FDK"`I FD K"a I FD(K"Za!&pH h;`+ڊiB ( hZ `ppG?K@Nh5hO33`=H(7ѝ;I&Fv&Mh -+h$N3hc!B0h#3`N0h(!0h\O33`#+` S+hN3hc!Cv0ht#3`#+` K `:V$I"F *`T% &%& mK-OFhMkKFkLFhjKh8F@F M@F4 瀹4 d$CF4@SKObhHDH(2=I";H`ذ:L7J:Idb2#7Icq0#4cpZP FC   (#K"F*IhB"L'I F.(O3 ??0;Cђ.` ( 0ch3#c`/0+|L H!hr!h pq%&0%2 [ ,&c (&g    &|&2!FJHTI H X& F F !CIF C I2F(FF` I2F(FF(I2F(FF9F C F`# = W OaL F pt& K"-A`KL Mh'h.hO3#`Ht('H !xCx"+0AF#@<x cE" '`.`"*Ѿ"0+3+#0p&&%|&#(&t& @BFFhFhFIF( E8F)F (H9F( +x/+0F1FFF(Fd(+]/+ m -O$hF%FB.K4$hB"!FFh1F0DoO CCFE? O ;hS%5DB8F&  DE;hX3F2hBE +  FFB3 #&0%jF KIhhCh0 н0+P#J``P#0%ht@&(FIH*I xhKhD` hKhD `h+ JhBĿ` h+JhBݛ%% %%#Jxh320[O04 "bxRx*J3h20 b; * +R#+9)5@p]!!F0L#h#AOq#F.0)I #h+OS#`%M+h۹#AOq0F+F0IO+h+$OS+`#AOqK0F0)hH#AOq K0F0!h HpO& &   -G&d5FO\O ] GBҞB#;p",, <  ЮE5\,М@BDU85-OM,FFF$0:##;U%+ХB4Fp ` c.B,/.-.=%.ڀBc%!Bp@ހ4TM.0+ĀjKkJh+F;/*m..*ХB:U4m.n.0+^Kh;/*ХB:U40d..Yc.WsF;/*ЬB:U4OKh;?0+0/(  x F1(ј0)  109  ! 9$x/)sE3(ЪBc..ѥBRapBL٢~TBJ4TqFO ;sEٸ/);B4`/!Bp+ټ O<9TݕB%9 BT4+"zTB>!4puB 04T K?KVB4pF FFF|&7l&p&T%t& pGFFFF1F8FF툹 J"`o#` J"`O08FxC\ *F"T,##`>BNsh;s`+ 0F (|o#`3hZ2`x +0K#`8 F h!X -CF OFF8F8CsFBFH2 /IBFaB #H9D;U$BKIu J K(hhhhB+`  2`lY&o  h!  H%L%0%-Od FFFF  $ #CQF@CHFPI@BI"F0FKh+6Й FyhBi/F:i(FiCF$V#& bh6@C9ii0jI `@B> a`fH, F d "!(F"DF_I_H3FB" +FF0 + K#`#ob8 F pG!!H&K!Z0K<13H1hGpG& K-A°h#KhCKh,@ BL !F!F Hx! ! zHwJ1 wHwI !<hGrKrLh!h FkMA,ǀlF#hx@+9kN#hx#bK1hGfHgK*F(FX(4 h#hx#hx,+#hx##hZ"`"p11h[hG(3#h3#`QMRI(hlFhPMGN"FOq8FH Fl)hIHIHkkFF`0)Fx08x + FT@HW3008FZ "p(7O9Fxc8x + F2)H53x;x,+x +x#Z"pOJ1h[hG F 3 F*K!FFh3H&l&&e&[ & &q&&F9p>L&-K! `L& IK"`9D&m!KH`hH&& Kn:f*oB (КmQeppGIżh!!-CFM O"(hl1+`&O  "(h 0s FF H>I"(hoL& o&D&&H! 4! 0vCF3ИjBH! ! F !F K/!LA F`A" F I H6 I !FIH,I !K"sLXhID1N[P+x;(F)FFph4I"ph0K "hd0n+Hp(& 0&>8& HP"iFu Khs K\A F(H!FHblF& F K!h4 F\H!FHB8 j@& K|Al#x[ FK!FFh L& K7FLA/! FHAJ# F+F0!F >F pFx# + + `F+FK , ,њB10 kx pSFB-AFNFFt2hrhFh!FH$FD=C<HAaS ,-)2D@Fhs##($ z-GmFbL)FbMF h`K"`I`"`KXh_K_I"hH h " # 0" h 8*h 0*""@ +QJ! VPHOI GLzOF TFF#hù"  0+O3#F @#h +*/d"FB5H 5K<1C B2Ha40J! /K"&IXh1F * mW(ѝ * * *p K<1+HAFdJ[ERFfE H##`L&&H&,(&8&&&&U &0&0Ű*HOr0F &HE0"H*"HOrFM ! FfI Kk)F (݄B!Fd P= HV F'=JU kK-OF0"FFXh{I'zI pVxJ!F8F$vKvI"hu=(7rKhrKl1" mM'FO ch;c`+' F0+cCa(ѵ1{(_ (1 # | <#hZ"`x (i+ѵ,1+  pO  +е1+е<1#7BH9F:l1+#088K"hr *V5K & /K1 4>x F FFIF #I<1$K"IXh"J! h+~h*"" @BяMfHmHHF(&,)&8&&L& &0&&yL&D&p°9HOrF(@6K"6IXh! 2! .1J! F/K0I"hj%,H&F+K<1C (Ha 'K""IXht%J! ! ! Bp FFF4(݅BK!h\ )F )F H2(F(&,&8&&= 0&&L&p°;HOrF(@8K"8IXh! ! 3J! Fj1K2I"h8%.H&Fb-K<1C d*Haw)K"$IXh'J! D! l! hBp FDFF(݅BL)F h! h )F H)F DH(F@(&,&8&&= 0&&L&0LF h I(FJCchCc`! h J! 0#ch#cL&&0 MF(h I FHC3(h! 0#3L&7HOriF(a4LhFNcy#cq0K"0IXh"1 #10D#00#01 1 #11KHi1#!1K`1 #12 #2 23Ht@HH (&9D&/"LI h ~ hI"@+L&{t zt F,!@ 8F F 8)FU( 0MGI M0(AH?JOaF;KLA:K,F b 2J!F Fn C -H 'IObjFBѝ 03 +IH,HvIHtoIK`!Dx *#Cp H{B8O >&!;&IHP";HDOr@!L ( ` IH@@X HOriF H@KhF!hkz&"P&4J 0P"MI HLHQC+H M0@(55Or@!H M0@ JOa5hF J)FhF+ M0&J&R4lx8?P"IHFй HI(8@ I Hϼ M"FlTl1+Kh8@q8&"z L&pP"m I!Hz MHQqBF*H mp@+mIFF8H1F mp@J5l!jJOahFR IjF F mp J硻&&z IH L!-O(F K'ĒO5K"`%缱=I,$'J#O1`8J`8JpO3%O5 O4 1IS"HF+J>``+Kp,I *I (I &I 0$J !$H"H(O!IOK& $!&!_$(ZG3ķ2]&,0&ID&}l&P&!ȵ&^&&-I"-K:``p0+I+H!|,'H(H*k'K-O! #H#JRh "! "! Rf"WI"F>d1TNDV)wQN3hCQI2F>Q0OS3`MNNI2F>F0Oc3`JN3h+e#3`HO:h*iGI"F 4EKP``AO;h+(:hBK`"AK`AK`":K`5Kh*+5KOb`6Khk`+h3+`lhL,! F0K(@a`h` F#x/+! F<`(вs6 )H OR`'H!FV $$HPW+h+}>yI:">8 0`3h+7Kh`KhI"Fض&FK]D P &p&rl&&d&t&&p&wI:">huK8 `0srKh)ր0h(8ht@ kK:"kI`>ciK" hI:">YdK"l!dI:">O_K"`aI:">F[K"`]I:">=VK"!YI:">3QK",!UI:">)LK"GK"BK"!II:"> =K"!EI:">8K"!1I:">3K"!:K"p:I:">*K" "6Kh 5J`5Kh 5J`5Kh4Hw4Kh3Hq3Kh2Hk2Kh1He1L1I"F>0I0##`.L"F>-I0##`+L"F>0 ##` /"+.BD&&t&  ]F%.":SP&X&ԟ d&ߟ h&`&T& \&*P&$L&(H&&&MIFF(FXI"F(FT !DiJhI  *&t HCh;C`+C hZ`xK[h+##@h!&L! D%H` )F&J! վ&J! ;&0)MF (I#`! !H!Fj hLDch;c`+ FB"p  KhXBXA0#hZ"`x (pB3 & zh!9FJpGB pG pGKO\ v^%?'+)"HpL !BaxFYpF)*F@2[Zp F*F[_p+D&(K((O^@0d"? Of"eHpG"de"&D&FHLMNO < <Kh2ùlF0F  <T<*" "F8F 4H &0 MFl$!F{x!F{#SC@rp"CCI 2C32""b"$ !b#sCcl! 0#c& pMkh FB >(h+ HN#x+Dq2;p@HҼp&K7nM0BKhIJ*xb Bl " FBjx ԝ F H FhG 0) 5 < &zpF-L.N1 x[@d(FA%I F#s`p"I F%u`FPI F@I F0I F I"FHH+F!(FN$M+4,B+! F!#!F &3ZG !Ğ Q&K1#Kh X&K"LXh!FVK!F"@hz8&&0&p°#M "(h&Fz0 +M##p1빴B"#1y#0K "Xh$BpB*(h ";RKh( I0FK`n#y#0#10& 8&X&"J 0[ `pG -H!M vXO! rWI hlTI Tf;hQN%#00# 0O2!hF(ݽ0FI"8h( ݛ0S+W+B+F0ñOb O@ Dh+(F +Kh+ O1!FE("F n1+0+ж ڱE ^+ h;`+ hZ `px @+"F!o(iB (ѽ(&$ &&L&X&8F L hF F8)Fl(Рh )Fd(4 CABAH@  F F@y! H@'y;+&!0h&)F0F.P0F?a(F`H#y#P#qcyCcqhB`+x !;#B`+x"{ IF n; f+ oBۋmXep]KpG]KX1ih!pF0L#h;!+.h0FP#hD+y `;+65.555? #h"+"` 0#0 `! )hHTH1FPh#h3#`0F#h)FD#`0h `1FH:#h"+#H#`p@U H1F,h#h3#`(Bp\&z"FpF+ B$B Fpp\* ^*Ex@=\ FEx0ֲ.؅x0=. , Hn"BBx/*x0=,-CF9I.(=7O ! FF6=! FF(9#p FF(Oy5["(FFHFn4F`y! F4#h+L#h+H ##`LAF F(F F)F?! Fnpp FbF@y!th(F#x!+ ` FP!F!F8F^hD\& _ M$L%F h\1Oa!JhF IhFFXNO"F@1hF Fu0#u0 M#y՝`#y4BT<hD<3hiF8F !hFP#phF3 &pF FFy[ FF(F pI0FF FhF!F _ s$M N<H FpI"(h (h1FRI"(hI(h"(*I(h("0!HX HO!( HK!( L&f@xt yt `&0!I$ "K,3CLF0  0KjtK "h FjPP,B +! ]4B,`& L&H6!H,0@'`&"%L&I hh #I" h`! hzx=@ ! hznI" hH}0(3(HH I h8I h" h!zHI" h& h`L&xt yt DJMdf@0F 0=K<1O4&F -0 D OYHx#-DT`jq|!: x)"+x#ZH'XF?PF?"( F1FQHQK"`O4&F2 ";FF mP%j x)О)EH2;% Z x)?H2;% N ;'%  D/?W ?2"P ;%{ 2 ;% G' (/%$8 ) %; , ) %' %/ %J 8#of(?H !fF3+EB>@D4,O:j&?̮2,QF mT QFg B1H-0HHO4&F h,H,H,H,HFvD+ %hO34+ع?H hBH;2 %t+ hBH; 2 +H?d?{ ]f-E~-OF O0 >VFO0>QFjHjJP %hQhC 3F   "Os`I8#_K% o h   l$F@VH,F/FO5FFFm'F%FFFO21FXF?IHO4U'FPF?0F? (FIFG4`G ùO2 QF8H3@FQF mF UIy F !k(.H; !k(1F XF AC BG+O2 lJHJ+O10FC#OcC#_|"1FXF (H4G{,  oR -CFHNFF shEHB#Oo FO3??" F ??5HDF8C1H;F/HJFHI;CFFK G@@p@BgGG/8"KBv*T2Oc!FXCzs!J kD I, ,."H,H)FC@d@pDtv K# 1d~!p b(H pCOK ""[h;K#F;,p$.F"F)F NC$D, H+ HJ! 2F&-OFx]-+Cx{Kh ]Ov! ]|,FOO FX0 *h+ F FPD0>4FH!F2Fh DFH)Fv$pCOхH!FO@a)F F!FzHUl(F@F ]O>*8(FoH!F;,vOb!FpCOF8F&8F `B݀>1F퀹0Fz"(Fn(0!F UH 0CRH!FPH#"(F# 00Or@!8FR(FF tp8Fl!D)FFzR F8Jh3`pG&8Fh#x-+4`o8F " F (+hBO0O0KpFh+NuhŹ ! F Fh` F(!0I"F``shu`+`hh!Fhp-hFJ@!hFhFH &^F@ Kh# F@ſO0&8F F@Kh+)F F8@8&FFF1F(` +`#` 1F8F `(H1F `K8_Fs(x08 Kh+ F@P&-A-N F-OMИ0+I1F@FR(>Р?,:"FAF,`kD")F@,:F]4 " D Fx*+#!1S.oC  |>!j0J)F@F]^0FM FkhB F!!l` 0H KhB!pG&K!i Xiwi&-AF xFx9ӹKF!a F+ M' J)j/`]@J0F)j/`]8+hCE4F&I<-AFgNsjB$b(("#b #\!dwb kc<#cybot=؆(h)K(b!(X2(YН0b03c0sc#s#xC#$0#0 0"0n(5K"8@ؖ(:(/K"-,K"'O;ذ_4ذo-аo$K "_!K "aO'а?'аOK"KK"K"K"K"K"K "K " K " K" K"K"<ĕI&(t'7 (IjFx'LH%'H(1Ц b0P+#b HH"(#jK b`#j+ܿ##bűfH0(nfn+ܿP#f0H( Hyf H(ht@&^^H ^^^^F(L+l+;+!$'* 7(+O1 HHHHHHHHH(#ml0HHx(# "m0l &^^^^^^^^^d&^𵇰HNL@ 0`HI#`BF^(H#`i#` TH_HZHUHP aHLHGH(H#88+88ȿ"88888ĿK`KxKpHM(F+FH<(F+F}H< zH(} wH(x tKh+urKh+@ppH nH< \< \hHax#ScH#i`a+x#eaa^H} x##aYKhNBj3bdsh `ip```i`a_AKhDFxi2F1)D L@pi1Da.+l"N3hC &H b#3`2 K[h+a!Kh+](YK"`@FiF 3I*DS<\wiR)D  BxF&|&T `(&&0 e<&&! ( H1F 3Fu#s3FFpCx0+Kh+?^?#`d' KhsBC kIAA@ApGO0FpG(&L#hO0/C#hAtA kB2 cC $2D $# c(&8L#h+Jha hVO3#`L h=j##`8hC@3S Sh>Eli $ #S``=?0hB#+bBki  (i8h,@O3a=%K!F<`h@ܻ(&&Kh@@ipG(&0F hDHh8#hBC!B 0ZR@hBQT20BS -OF1MȀ$Đw?[+K!F(FZB"Ob+B..+A0; + "##O O  HF!  7B@F!  .K;+#c+$3x0;2 @($$4&4&Z`J`p FF0x3N1h!(F:`uhN1hQH!F < 6(F(@h$nsh` Fp 6FF F\ r`FFFFرK1A?+x *+kxcxSn!(,F ;^+#x*+cxs+ d+ k+# n!(F,Fu+##43`<`##4&-A I=HFH H H H |,MNO#x+LцKH!4!!8!!aBa++++(  pG pG pG pG pG pGFx+FB((*#B #IBɲBax @* \*3hZ`B [x*+pGpGFxF8( ':FHxb?CHx|`CxHx|0Cx?Cx|`Hx@r|C y?Cx|2CxHxB|PCHy?Cx|Cx|2Cy4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`p4&KpFhh)ݔB ,`pB <) x&B F4FB =+ F F 4&FI I F I Fh Kh+ I F8   &x& & FI I F I Fh Kh+ I F8   &p&Ĥ & J пò\pG4&(7FIHwH0(@F0ӲHJ !H#FT!p ! FF H#FX!KOq$8!Fp>a&Ba4&FIW8I FR8  h&̤ @DcB ѡ"c+ !@%` XBXApG pG pG*-A FF FFnF<`@0FvF(Fȹ(F6F0FO1 J)F((F($$$&FHFHI*FqFxI"0FjFPHI*FaF` F I*FYF8F<,*F0FI@Keeeeee8FHFpI F|阱 I Fvp F8@u(F8@ (8fVf-O F F2F(( pCO5I FF FpD+&`&7L8xhF (DKhBF(F8 8D 8 8x[ 0;B8[x+hF+ 8&`&pLXB 8^]k. KO2b 8B x@ p 0F& K8x &8 L#x%X8O2pKb 8 & pFM F(Fv@sBZ p(+BB KO2bf> xU;;;& 7FF% xX!*F F (0K$ `pG&-CF xFF+8KhlhB*! F0Fkh%`c`kh`l`h 1F@FPch@F0; F;LFh1Fx(#h`(&FF"FFpGL$XKjB"!F$8"a& K-OŲhLFO(XX-M#8HAFO)(2O(X088#8+ +0F%+08Y#DB0(X((X%(F#8N1(и$80 +!!B A0F(F(C+sy$>*oWce(#48w#48(F?o#48e#488x8x +#488B< + 8B< +;8#488o#488x+?g#48_#48#48$#%48L#488B< +8B=< +88B.< +(#48n#488x + 8x +8x #8$#48 S4&&& (0`+`8(0(6 /FE ZFPFIF$(`K7HIFw"H8x+? 48(@Հ8 ;#88\8xFEQpKEFػJ^F8x3F )Й40O Q50SFEI@+; +p; +R#tsssssss]tmtt +R#tssswt3tsssst7+E+Z/+ѫiFp#+b)ip@Rhq`p@ #x%F4++ ++L h;%+x #`(F `Ax"+ixp@x"+i@xKh+p@ x!+hj; FhbKh+ohjIHp@Kh+b I Kh.YF(<1FHp@&&&f8_ffpFKFFX`0F)F Fp@&/#NHMis`@4@Fs(Fj(F} Hy, , K!F`@HjH&VÊf&!p+LhH7#c`:h&HFhZ$H@h"H:h^ H4hH.hH(N%h A+F2F! 5-ѣh HK"`pL##L H H&ffffffff&8x!Kh@ܴ KXhi8 pG&COppGKiFH] f!F KhD```&Kph\#xK%;.FM%B p]&>#x5 &!F ^J#`hD` `Fh&DF F-O#_Le%`\Kh3s[0|'chg`0'b C ~PKhO0S #hOFo ( P?Kh0kP 6Khp0 ekp ,*Hc80+e-0Fp/e-och+N/+E+;+L+I .@EBn AF ZHЛ0KO`: qXF&&&&fg&Դ d'&&>7+ i+ch+0F(?)(?$(?#^Fi-Ά6c+نR#CE~u_}i~s#g݀%_Ӏׁ'~3QՂ-WłU__U#Oo}+3_____Ղ______________________________w0 +..!0FTd(:e(F .?0F (?$ch++ѧKh+ЦhF(p#+x+@ vKh- pHxch #c`#j}i3@_. #b"+.@.#!.j+y .'jZ .X=.V0Fϱ(ŭ-.) ##Car) ##@a(?y(?txa;+##a bȱJx(?Zi#a+ 8d(3+?GCWB(?=RHh#bi#@+$УiLJX0Fs(ޭ#j+ڭ0F. b00F@Ha+##a j( j!#FF/ (?.:.s+?R#~O~xxxx]~xx}xxx}i~xxx~OWhx@l`S*.@.%!.nOwKh+ch7+hOw#C`/?Z&P T&g8_0g&Kh+ch7+?BOgch7+?'#J#!dA1+ 8'@ch7+?iOG#;+?[(V "@)F 2(?snhF`0TI#" e%2+rJ`#*skKh ""! ie%H2+ruJ`#*sH"! i5#*s#"#6eKh+ #*s "#*s"##"VK"FhSK"Fh#*s#"#IKh+*#*s$ #*s"##"!#*s24Kh+"!i0Kh  F 2+r0$Kh+ i"FD2+r0"FQ (#M*s/h#"##+`xF/`簽&FgSl&P& &h&ci+#c 2e+rd;Ck+#d"##cHk iA(q i6(q(ci+ KhT?H2 yKh+ 7"l K`blK`lK`(?xKhC`#*sح"##KhCB`h`#*s"##!i %VhCsh%LCC`#*s"##!i `4h%s#CsFPBPA % }QKTHh`PK"dh`OKbdh`d NKh+@LJ LIhIKh+@=M(hDDIlFCH>(hnAH9Fk@J#@I h: F( . .?0F[#_IF omF(z . .?u0FnMKhSIF% TRF(_ . ..&0FpF(S@J% @I(`hg.&BH!#AIFz#*s>K`>JhBOuu5!i[`7K"`&h+߿5Khs[2#*s+K`*J#ih Dh+߿(Khs[2"K"`K`chi+?d(FI#"0FKh+?#c߻h hh&h&!& f)h4hAhMhdgUhL& &&`&i&Kh0pG4&8FF $r!F(F8-OFFFFhD,FW E[լB< +4##pd@F`>2F!F չB(KhSBi<,**+B8FHF FBFIF(FMQHF9vHF:^FIF[K# 4&hZ`F`XxpG-GFIE6?h +43pF#xp+3pc!B" *+*F`xTDFhEEF=?0F+;M&F`h-MFOO O $ò0 *;p&  T`Sh 4O0pF FFZ ! 9@3h,D`$E``0` FpO47F e 0;+ (ݝ0;+ A-@, A,Kh+B C 0 Kh+C B 0m+KhB# OK"`$&&&-AFFFO,U2F5B$hxxBJ)^Xx](g(@B 5=`@(/ @,A,,e !Kh+B C Kh+C B K!h;B# K"`D( ]d(f(d 縱Zxg*+*xF3*?+r F32i $&&&L h`hhh@d& FFH(ڽ@!Hd&bh FFH(ڽ@!Hh&h-GF]Kh$$ F!F(FqF0FO4!9kF("#0FR??(F9JF)F0FF0FEE(F9 S  +xCkxM+ѫx++xG+ <<+IF(Fud&7F MFh4(0 Fx+h!F"( d& x@ pG pGiFH]e-AFFFFI0FpO52 8FHFȱHFFhIF5"F0F@F9\8F`"F"F()F FGF F9(FhehOqHHH!XJ#!HJI#H(J#I HJ#I H8@#JIH h]ii/i( 9e$64 F( Fd$(\$$$& &(&-GFF F.xF+:CE8F!:+ F;+)\+' +NmF ŖnFPFHEFFQF8FXshxG#x+4!6 pC HfiFHT9Kh+ O#HiF>,OsB , F`iF H??iFHyie&iii-O FFFrF F:FfKDP%/F BؽnB 2FIF F2 KTD'4"x-P%xB *%p/F'/F% 8F FahkhB F+*ЃB 8F! hIAhF)*ЃB pGB98,*ЃBpGpFFh(F(!F0Fp@sp0!LhF#?? hiFBRF hgFh h h+F(F h!L##`K  0&&KhSL h8? h@&&L h! h&O1 pGCѽ@˻0F), F(#Kh"H!Ma( D(O( A(!(Fud( o(Oq FK`Kh+0 ! FM#"(`#d??(hO3+`H&i/j0 sj-OF 0B ^t0F0F " HF(HFK'HFc x8FRF8FsF`8FO3wF(@&F%I FbHI F^  FFF&FI FN(%%Kh+g(d(`ЃH D(&F K%iyI0F, O3%sI0F" O3%0FFqH9H;FAF F10F( F_Kh8FRp^Hv Y(Fu%LKHF8FAFp'FHIFGK)F"`MEK`EKhBSCM"CKh+h 4I0Fh 0F2@2K 7Kh(:O@"B+h#.KI F"`xI Fr` Ft'K"FFh(F8#Kh _ F8 KhHFQF ??FF`0k7&]jVp&j&ejȽ&&&&&ܽ&& &ش &d'&̷ FJFбF|XDZEF, *F I"L0:!NJE!Fj̷ @0KhL&Ki0H! @H࿸&jV-AFO FF.@F=F\ @F(ѽ;hѠFd'KF"h&@K" `@&KFO2h&K" `&8F$ FF@BB F8@ 8pF; FpF FxF Fh.ep@ "!0F(pO2!(F|(FFF FA F1Ft F8_(F_0F8YB 8F -GF!F$'FFhF!FhFGF8G0F %FF)F1F@F8"F('FPF8 M8F)hF+hB0F Fk8F&KhF B F@W&F xpG%*Yx%)33s)0@0pGL#h#H ` hK#`&3kAk-G!Fd Od O FFsh;s`+ 0F^ (F'#8F#p3hZ2`x - 2BOI !HFX9FFt8FGF8@F[CHjK(F]kp-AF!D/K"xxBFI4F#x##8F3p xBcxB4;;>FFF#x+5*FAF F\,D;; -OF8$F%FF`,K,JF,J8FR!(FF&??@.AH0Kh;BBB } F)FOCoBBi F)F1`Ʊ&O oKhC@F(F5iKh+(fKh.eHH)ݹ LFMF F)FƹZKh\KhC\KYе??SYJh*OXJhXJh CI"`  . F)F??F FѸ!F%(!F( 9(@F??;Kh+ !( " !O}-K"`0KhC #K"O0`O\b???&!Kh+FK FIh hC@sC)!O1)F8 F)FYF F??O.&&H& P l&&t&&&&,&&& KiS Kh( Kh+Kh8pG pGBppG&&&&-GFF FB(4KhB#3Kh.Կ&&??.Kh+-KhCBOqu1 FO3"F+F&"KhCѹF  F)F??F FѸѹE?O0Ge F)F.F&&&&H&-OFFF%p  X FO=oM??F F>!KhùOK h9(#"F@F+FFLO F F (o??0$%FF F,&&d'-AF FF??F F &AO0P*F#F8Fh8 MFF+hB(hBԿ  8 ??4&K(FFhB pG K(FFPhB pG F @F޿8F(Mo+hB F(`#IS``#hB Jhh;`7h7 F8@7ټZi:Zah8& &KhpG&-GF F+O * ,< -OF F  ?? O4%F F)F Kh+qѮK FIh hCEs)!O1)FD F)FeF F F)Fb(ѠFFKh6G (K@FIFOW@FIFFDFEz=DF (a 8 J O4%FKh /y@xFF F +E}Kh/G'EMyKhCџ8i qKhoZFSF  J :hz + +  J ( (& jz>O (  >F euF RKhC?BO a^ 8F"+1F!@FIF( CKhk\E FF@FIF=Kh+??3L# ( (0Y O /O B8Fa dñ Khͮ (0K&"`F F7FJh> au / /*F F ( ( ( (F F&&&,&d'`& &H&P&&&?? au+ Kh[ / / +}F FF##hY_`&7F F pKh*Կ""#(F!F#30" &-OFF.yO;$ XF$^FKh+ѣKh@BOqy FO32FKFp]KhCpi(єKh%#F`^ , , X (g (e0KhJ (_GA8FAF_(#F8FAFd$ XFP \F#O: F3qKh |cE (F0 @ZfJhP@ 3cJh*: bsT0inWKhJ0FFBaJ $ KJ h*JK"`  #  T * *$| ( (4E ( p (4E4E (дBu WڢF|F dt??(Khs + +4 +FFBs K  "8FAF(ϮKh+?Ů=E F F8F AF# E &&H&&d' &`&&??pF F"KB ( ( KDE0(&O;h;BT.Zx=*ј+&Zx=*ј-& "FBJIJHZx=*јHJ3F!<. +.-.!.ki"=.kiXКB""vkiBԿ""kiB̿""kiBg(?dpFFo B@F; +8#+<\+# p3x+?H"hi+m=!0F(;ІB9+)4G39x(I!hGJBJA Ki& VbFmLmUm8_|mm` !J!F<x +=+ !h*Cx=+;IHF6Uh6R Vp( &FO FF0BhU;iC$`(&8FJi]a FFF F8@P& JFhp`e  Z  O0pG &8Kh+Lm!JP M 80 L (8"!"!t&&H_pHLK0HK0!O`{!`O`uOc0 aH:H7 H4 H1 H.#0p&V@pq&&&&&(  pGK8pG&8%L#Pcaa#B&H%`U8 :UU@UPQHHP8hTi#iC"Pi3a&&&&-CF$ F0+3qFFF(F!F@ر#KOb!0+L(M  +hB! K#??ЕBtK#BA KOr$! 5 @Q5&&&&@ 8 &H&KhKhKh+Kh3pGH&&&&p LeiiBcia0#`p#iS%0+h0FY]05&(F FF0@E7Kh#F(bO4 F1Kh (A(: F,Ni( $$+2io@G;D)FR#8iD3iS'D(F9(гi (F2'хBJhABJhBJhD$(!F0F2iC;)FR#z(СKho4&&&&&&-OLgF FF0??@1+@O`D#C?? з??вBADg#1-𰀣ih+@O1SFiPF+ÿC!i3#ȿQ#0)F"FsKh+@@ O  1B8#??08g+&0"!]6-0B\HHFFFEm 1Bn )r0F9FOG2(qJKh#(i1+?{#1F!O HD #C ZE  ?b ! "g#  "]O k#h(F  L'KhDEapFe ")F-H_2BZF#aiBܠiN aHDP1Bp1h" =Ph\T!iQ"2A#3&t&&&`&,&-AFKF FFh+ 8ȱ")Fg( Kh0D(FKhDB t&&`&8FF*F#FOHq8 8-AF MF$x$1B  2F;F $4$& O?h/ # F!O8 t&Ki(!h,!pG&K(!a,!`pG&(FKZ8  &(F HK!FD8  & ( ! #3` Ch Fs)-Ѓh\)) \B\A` h+J\B[$)3`\+#C`O3` F( F( [pF FF!*F FM#hBF0F(p-OF̢LFFF0`+ 01;0#10O (9F(FH((@JF!8FwF %(F01[h HJF!8F^F(053HN0Q0 `* QF0 1B rH 1BFۣinMh0lM3DO12FB +щ_H)`%050Q/k]Kh*\Kh):BF+FIF Oi+`iBhD @&i@8V 0BF+F R%aB)4F *-;hO1DWFhBO1aKi!iQ%S<FF0F#h(#`#0)%%>F.u(Khh+O3#0i)TiB"iR#`Q_/=ѳFL#h+/@0+8F^(8FBF+F !\0 CF&&&& &&&&4&t&F /i $P&d'-CFTF FFF??.0BEF#p JCc`Kx8HHuV0&,&u08(H!vK"`pGv&(Kh ۼpG$&0L#h+ ` &0 L#h+HiF#F##`&v0 L#h+HiF#0##`&Fv0 Khs Kh[??ѽ@&&(0 x J^+pKxp]KxyiFH uvp()0$NM4`,` x,+ I#H!F0`x,* I3H!(` pK! J FhKhH&&vvvv(r09$?+SK`R+>D+1+4+0أ1*Q ;Ce * \"111111111EZ+-+ r+d+W+^+нw+@@@p@`@@p@P#HiF0(KhQE#0 QDF!TDK!DN!DR!DW!!BH H )!BH-#0 piF&vvKhSKh+Kh(Կ  pG pGd&&&Kh(KJhhDpGl&&&FxFFEHiF,F F!D8`FO!xi;hK\)cxS4;;$)#+p.0F(w4&xBh+h FHJ*!H]*!JHx&-w2wLIF F F&.w(hS  pG(h ЀipGHpGo( OHqKl8 pGx&KliFH ]x&wFh FFx-+0''x0; +,##`O0- HiF "1F(,-H ##`/@B=wYw-OFpNlȱh+ +Ci G#d Bl"iF `,FOx*\x-(aP$(.(٠ ڲ#@{JBF O _ Fa -O O F F.F,{+siHk+(#3e#F F(x++*8h30Y8`39(/(z$n(0+ n$z$Xx-(3+(@3%O@YFa O O  xF=*hh**5H B31H#hZ* =)2M`ci G(5[ ! `в O *Fxd0x +iRF (x+"QF%x&&wrww&𵇰#@FFF(FcH-hY ]H=ZH**-x* hZ*1Ae_-ci+-   G@-Уh|/jѣh+`+`#ih+;H!=#i!h3T#5O-B--"ih[ `2-2- -"ih&N&`)F!&V&`*F+H!h---!+#i`#`H!PF+ -?LhH K"`C#iih/:xx/xxJxvx&FhFFCxF0; +#O F xF10:ײ / "+.` ##`$##`O0.HiF+ܿ3 PC3=wKhKh(   pG&& H K"` L#x#i h`h!ciFG$4x&P FHx FpGBЁh ;B$0P -O$.MF#FFFF*xR+?/MВF#;`PFnh$5"1hHF##, A8(ټ- YEYE 0hFpF#F@DBDAh*vh"# `+иFP H(`(ĿK`  pGXKhWHTK" "`"jQKhBOKhoo F SGJ#CIhB `F #13AKhAKh+@Kh9K1+1!d.09J&0h!o-K"`O21KxB .Jh**$JohC`,J#` KhFk,KhB,K"!J 1 13 1+ 4h+?[.h#+?UO4roo&&t'd'&<& ,& &H!&hF]Fh3F(FPF0FL!D4 FJ+F!FF8FCF3(I"FHpH&-CFGF"F;FVCDa;F"F)DeEu ICBw4##A#d"#]7L2EE0@B! K22JKXChFH]Mb@BK IhT "FXh`BK"` &&FK\` K$""$pG&8FM K*hB+h FZ*`p"K$8 &&KshK"`pND FF-44(Fd'&&D)-C FFF@BaAH Oy#02FKFF F FS `F--8F-#<!Fn˿-AFDppFF# 09F#F -(-0F-",!Fn-OFF FO O O :F;0 )٣a)أWBc#C#FCK A)أ7 O0O1-OFFFO O %BF;0 )٣a)أWBs5CFC5CA)أ7 O0-O%FFFFO BF;0 )٣a)أWBs#C#FC5CA)أ7 O0-AF F$x F%(_^4;FXxn(*c(.d(%(Ns(x(" Uk (; "U iFhF{hFD #jFy F (FFFFUO`~9F0F(FK FHE@K"$& ( Ђ*I@Խ@[!JpF 4F3 4@1F(F_p@ ɽKh fO`2K1F(FhG%HKh2 K4,DhBp@޿"K`m&8&& &`&&KJq]8_*7F F0)F F0@KxJ)FJF FP0 IC8F F/)F FF#> Kh+޿K"`Q,  F8 5`&&F'KQFFh+$)! F 0##F!FFB $(h (h2Y.` F(F2R)! JK!Fhh*"+BF3F(0F26H!O4&'&aFh h2##`@ pG-OFFF(V_OFD>JKPDE 0`(`3F*F !FRFxѣA 3۲EѐBЉE(21B#*F3F BKCO`#`KV#U# B 3+4+!F: "B"6   "FdpF:/ک *FE3B#s'  /F!@E! \,E!@F! 1&HpGqB Kh8p@Kh8KhpGKh8&& KpFh F K.2hOؿ"FCTp&& K Jеhh\,нSg#bKh|b FK?? Fp4;h;B=AO$&'&&3K-Og??X.J h-KhQh #O4'Kh /%,F0;B P2O F??FF@F[Es ۱??ІBw XFQF F8%hDF@ 8 &&&pFh\ KDD  p`1 F14F'H('8F L 58@ "i!8@Hj[ b'wHP'8F F H*F#F`(#Bt 8 P'-OFF #hKh fKhfKhTYF@FbKhF`KhBOsA  [FXF9FFF??92 2?? 3DF]F # JKh@! 2??2 EF{ 2 CE s 4+6 )ȿ4@FYFĿ3426F;CFF3G??K26Վ??FF ^??FF2HFQF#C2LF];CFF;gFFO F6+E`&&h&&&d'Khk,dBoJFSF9F@FYF(}їKh3Khz Kh25Kh+БJhCEJh*ЌJh* EKh+E)F*FF OF0F)F F0yKm-A2?? ЈE{ #E{,&hb"!"F?E{ dH F0D0ALFUFFF-i-(2"SH!#2"F(2 "F VKq ; +EKh+ "FVKq 2F(t+K!*HТ 4J%@FYF`R#`Kv##FBv @FYFS*PO Ku##FBu ڱEK `"K` 5  E F005+Q# K&&&'&&&t&P'& &&7+!+! JFWCH7GFR#`[F KvF8F8EvکEO7;F7s5F FO358F F& H*F#F(#Bt(F!F8TiP'8F F  H*F#F(2Bt(F!F8S]hB4FFP'FF#;`KhùK#??MEA ۴??#ЖBtF FHr??#BA ڀjPW#;` Kh#Kj OpH&@ 8 ('&'pFF +xM,m$,eK"`p&i F F04F! W#2F)F3F`a#( Fp@0Kme"a'&]Km8  '-OFFFF00j40(YxOHF+FF]'BM2??е??МBuۄI @Eq C%I??f}KFFF@FIFhCEu??Y2??УBFAFBqG۽( #F7O33??𲀠BqZO?hG<EuEyTKh@EOqy۸iFF&F0F1FFFF@FIF pO'G'A'oG'Gy "F+F( #?? BA!Xcر#F??F F.4FUFFF#yy#??ЖBz.z0FQFtX#0FFQF??j0040KFhFEF05BO3F(FfF F#=(F\F F??ЪO:O2#jO3pFx0+Kh+?.  { ?? RF'0+ Kh+FBB 'w&H&&&h& IfJhC`Kh@!!d'& INJhC`Kh@ !d'& T I0 J!FhC`qKh@3"d'&FбI KI h+!I ! I@ ʽF !F ! !F !F3"&!!-".K-Ah,TСO`C! DC(F)F )F h!xI  ^K"`NM/h3hCE+hB +hJ3s[`9 K"`b Kh#A d'!&`&&&@&-CFKFFhHF)FFFHFvp3+] +@F9F h'-A!F FFF0Fr!D1F`kX#wa F(F^!D)FakD8 M,hB K""`8#hS``0 i0 F0 h'-OF[NMhYIF0/TMHFO F  :FOaXF(Fx8Fh+3h F+`#k` M0!+BFYFHF(0 + +  Fx+F )тx+!MFyF FCsh`C``hp`3`ZZxx^*3FaEм ,$*O3!!F\2Iicj%chce#jAF8FFj3b+:x#*zxn*a.j @3`cjjhcb%bjcm:x#*Zxn*"a:F@F%(8F ce#pj3b=F#3` 0 ( %@Faeej##b(hhB`b?kpj3b.#1#pSpae%f'z'Lmchh Ch;C`+گCСm hZ`x@ '-OFL Fm#hhkchI {KJeX3eK"c#f#cfPMmCh;C`+گBСmImlCF@"k I{hZ`xmHE p` (;Яp0۱H~I kꀱ{I kXzHp4sH #p0p4m@@EЯnHj!k(F#ehHp##fcn#h[h#`#h+hch c+(!k [K F [I[K{8#cfchxObPHahNHObHo"k OI{ !kOb(!kOb `(|FF `|CJSFOa(Fo(Fm@EЯ89I(F$e(?BB |m Cvh%fb)I ke( !kH#aK\#f瘱nD< + E#`;F0Fn*Fj 3b #`#' h!\4''z'1:cYC{!F- I"F {| F @F.r I"F {h8F F-(I+F"F {X8F N F0h.p)F# Fl@F;F)FF0` Fl60h"'])M)O&khB&Kh@>$Kh$h+5 h.:I"FF { #*hsCX+6h!;h@h:I@h(F(OR#F!hFF F(;h!hF  3 ]"'''>sFMF(h#I {`+i" h libF2>H( h^IF { p "'-CFAL FAO0DF[ij2B AjbiDba"p&-,\-Qx8h 0@09՘ \*&*Fij2B AjbiDba[i2aBF!"iOR Jh??R??i-j2*DB aj)DbiDba"iFR *F1Di*DF+D"'!FBhFAiF*DFSBAAai a `/*F1F#c`D2D"e`ZU-OJ#L`H!3#cKh-C#d .kh*<3h+яKhshB `k~q(q-h+ bk"!kph8 +рKphh @ `hh*ZhyKhB#` d h+ak!k@h(Ыhh*ZhiKhBgKh`+dKBhhBW*[h+h+bk2F!k@h+VK@hhxBxA:(+~=;>+R#PFFFFFFUIFFIIFFFFF'LFoLFFFFFFFFFFFFFFFFHOImIFFIIIFFIFKFGLLLMOFFO PaPFOlbhB! hYCZdE `fh #"h!sC(i6Px``f`'"'$#'x '#! 1h˹K(ihKhkC ёM!bk k+hk)h :Ol+i(k+ek5&kj !0F#cA0Fbc2#zHG#yIwH"@## uH#rIsH"3#lK(ih#khȎck:hjKB<#03 fHVPxC0s# `I  (ѽ*0+0"!&C06B9hSHj9h$ 9h ;h[9LKhh+h. GI"FF z -FP "!x FO$ 8K6hB9h2H&9h$ p9h &lCDXF-PFXF-9'Kh2FB9h& HKBF!VDh?XF-BF9HKhFB9hVFHH6K I8h n''$#'>D#'!Fht@,E'>\ H̓JO hB9h&~H  {K+{Ih6SE^Dz DvKhkC rN!bk k3h\k1h mH!, F#cShIfH#"dH!(Ek+@[N!bk k3h.k+?51h /k+, x !28FF8kcc#c !bk8F0k# |.?ccc>KhkC 9M!bk k+hk)h bwlbhB! hYCZd) `fh "#h!rCki'khjiRhB i %K`%K%Ihztck9FHF#F(#aFkibk5к#i !@ʀ#i!kHhz#Aki8Fj#ihZ9D#W\ ,E'Г'$#'>''֓ #'$O #iBB "i#9FXFhki8Fjx#i#BB]DO h"9FHF#(F(R9FHN H <Φ(Ϯ H<(>Ɯjaki[hcN!bk k3hk1h pnih(B"hC`Bp9D#"XF#iO J1CDhBB2A!#Dh #"9FHF("k+3i3Or@ aH0a0kihdI zbki ickBki"]Ii(h+?#`migk+ki3 (iOr@ aha0*i hickBHI"hi(?d"m"CI#CH=N 0 <Ϯ 0<6Ɯ7k+34?-+Joi&kh* 2DB!3x\;f3x\(0K!B #"1F #"HF#@H"! R BE 0F3 K IhKh #'$#''z>D#'(!'\#'F$ (HFl1S 0DN H <(Ϯ H<(6Ɯof$#'Kh#"I#H1h`~{) Rihx 'D#'pF FO6Bp#~w+{+s+ciiB.(cih I zcia$h`iC"ifa!h`iz-CFF FTF ,FBI z#`@Kh`?I(F\`Oe` zFX/T0FC-Zh`B FF+!*!Т<Ȳ( )h(I2F zB`hQBhBhB:*h+ +x+Х`#0hBC`/ch+g`:!HFF(#;0B+  HF a~6t#'KpFhK``h)FJh+  #iSBSAh(Fp#iB̿###iB###iB#iB$ht#'("0FMF I*F z&iF 0 I zObiF F F M0z- K : * B² *I` QppGh!! I0;0+ B0Z "ppG1 K!hjFyo 0_]>K!hjFyf 0M]>h!@JFc ;>K!hjFyh 0>]>$ F ` F $ ` F $ ` F$ F `8 F F `  F] `  F `  F `  Fc `  F[ `  F  ` !Kh,!F < '!Kh,!@PC - 'OK!h,!  'O@K!h,!  '! U ! N ! G ! @ ĺHg DHg RHg `A  K"` '   Q $ {  8" hOpD!F4; HgHg 8!F"H|B"!FH|>&p"LOpI4; Hg Hg A"H| A"H|d'~'&p"LOpI4; Hg Hg A"H|A"H|~|-OFiFC7z`h@ h( FFF !8 Fi]AFZFA=+x+kFO2# iB Bȿ80ъB2R₴Z0 DB@ڴPBAOFBA# GEPڣj:F FSFGF0BѴ0+!K2Fi9FA\"iF72FiDJiOFBFゴm%u傴GEڢi )[hSX:F)F FSF5_FFpFFFHF0FD*FIF Fp@𶹚F)G 6:F=!J@ 5;##Di@JOqJ@3JOqIHXJ3KOpF@J2JOqh IK@F j?##biDHi?#aJ'F`#B7<2*/i3aд)FB<#>~5p Oq lOq@ e@Q! _@Q!@ X@R! R@R!@ KIH !p"L%h-:6(8R0FB&FO +FF+ E68h@6"FSK8h@+F"!8h@"!8hI8hF< 8h;GK0h3x(@|@F>@FDH@F?8h6z' *  +x+q9K[h;D=ZD0+?6  [R#s"ri0EjB `p3D7D"rB:FBؿ3ؿ[x(c?z(`(x(8a80Bi[? (8?orD(ie[R(!(¬!$'!+?ܮR#Czowkzowwow]zowWzowowowowow1zowowowowIzڰ?(??<( >( (O{piиB@0`(F;v( @0V@0SzP#P i6 jiCBiDR0B+# i6 jiC0iD@`h*#c`%0BQck FGi%? ja?%b is?=@h;posZ FGA?(еsi64 j0iC j?x%biDi?r#a,KiS'@t 8FNiPh *i3D]`3x(d(? <(>(?YF dq(?qu(PE?}ڰ?vos+. K[h;q(?VE"`j]F?\@SB$'KiS 0YpG$'(KhBiS pG pG$'-OFFFF*$ PB*F $ FD!\m P00S$((K#pPEݠh !;.%hRF1F@K1'FFh/=320[=320[?*r-<b FC0F%>Z F>V%ݺ К0SPFDB,%%}%{0CT FBF !KFhB7`F F7?NF F?V"F F5 FEn{1BpF F78F8F7 Fp?&F8F?.Qo($'L   𵅰F F FS{ 9F*"F!c+F L-C 0FFFX F 8F IF*}"F!c+FLSK!F*]F @pGI8Mh@Fh@ D8$' 7hFLtH R<%h}hFIF(FL h h##`L%h}hFIF(F: h hp##` KhI H0q'h'%'!-Oð9IF>Fp7O*F!ȹ(F@C 0!,IFF,H F) 9F  \#H^(`.0F61FF FF0! 9F"DF\=*L9F FQFD FZF!F&T@F  f!0Q#u -O#M`F FdF(?0FF 5 "AF(F(h #`9FhFeIFhFeR)FhFeNhFB( F<(1BKPF`)J00Fl Mh ``h)<(``hF  K*(F`vK*NFKhKKh@f >l''H*(H  Op(@@ N-G -PM$O3+`s F(> !FS+h+5B'iF +Y!#]" SF(@ހ F(@׀ @ I !F^ !F S(,`5qME2!F(h0}( $ F! 5!F 0(h!0g(!F %`Kh+ B+h$A(5E*hX VI2 -(v+h)(k(f 3(?q_!8)F(VB"p"7B.'E<F/FEHOOp EGӹE1Y ((R (!AEE(U!@B1Yk1"BEE(p3U"B2U' H&(F).77W h0G( D#kգnczRnhR1 [h c''\}'z0, FObF IOb Ob `IOb ` Fȱ ` FI#F"F D%DDD!F#(F , 0 a X#`# FObhFIObhFJObiF Ob I < ` @ `iF  ]X#`#0P$ C FK ` F /F Fɲ(;L#h$*!P*hѓ)ѹ@a0*]h0CG0#h$h0G#h$ W(>(9"H)(4!H$Fx EXKMhE"F!F(hG^(h5N(hEiF z#_"Z! Dp! H HG HDl#0''f#q#((P$C "K `   FN FT Fɲ(#Kh*!$HFiF S#`"!F F{[#0''-OFOE D3x3FF+ **O 0F ( \[E 3DD6p i F|Kh+ *FIF0Fp@NKh'>q'7hF#L%hhF> IF(F h h##` 0IHF `XhF$IF(Fp hKh[lh)JIF[ `h){ IF HR q'"##d~'#>#!sF5M F(h5!(hA(h?f Q>~? J!F >?V1F!H4? H>ha 4D(h@6!"bC(hAF0IHV !46Fh(h6F F6(h>F F> " FFG FD" Fp(z!$-OF- F F1 "1.BFѰK` F}1 ܲO ̬LZFIV#h뱡I"FPF"h*ѝIHFI"FB#h+I"F6CFt(@Z X"F!H(! F&;H ƼƜ)Cs)&!Fx*1HtIBFV@PnIBFH#0jI(h@hIhhh 5 =dH 8y xñ 蘱 *hF\H wXK"`DWK/)F(h})hTHSKP!P`#0 OR75C   C C T UFŗ#QFOpF R(t3h;@FN0`'z #Z" @B <"8F)FN'Hj7T-#K h3SBF"FhK `hT vF<$ ptbtM$f@%^$fn$s'q$l'P$$';$q'h' h+.%#" FB*OrB  CKhtAK$`;f @`A:HPMh)5IF(F%#T)Fh)Z+x+?VR1(F$43h#@Fx0`(F I " #0h)F>&0hD1+x{[- ͬ p0<*?OrB?ۭ `q''$$0#"2%K!" S#1 #IO3M I H Kh H x)F! F 0@ђ !$q' -OrFF(S+! (HO0#0iOpG3I(x6F0Kh(/J(/I*I(pnF(O OW 8F(F%0Fg?F#cU {B(ػ F(#0O50Fѩ=Kh J(I(F F9F(F(5pq'$%.-OF'RK !FF.@I"F u'-6)F !0FF0F5 FOAF(uFI2FID3F@FFI0FpB x%+@+*!:0+x'+5<*+0/!PFF#pPFF/#;@FC XF8(@hEPF(=XF@nI(F27.5x-D'P;iI (F(0#(0*0P#*0 o]M.hm"0FF(hD2  !FKFFRHgC=@ (Q?HOF?;hBF !F =:h-ˀB =&??DT@@ƀ;hB?!8F =D6%HCh;C`+򩀩H;BN3hB=`  0h4 0h;!0h@.D&F(zV (@ F(r(F-t2F %1%p"F%~ht@(h!>B{.*? AFFb( FhE7(F(? D(ISF =6>N5.?MH=.Hh3`TD (N(j-? OpGJ%(>0ð@Fx0c.!F0H" C0"[HH"!F%'&'-GFhVO`FB# F#p_-и/-у k20#)F@F[#1) F+FJF4bQ%!F!FFF"CFА"!(F I"(F/a*F1F FF F4,F F''pM(FFz@)FF 0˱) )D<.+( `I@HI@p Hp%'('&'𵱰/I "@0j`"F*HL*I "@0jR"F%H<!"F2CF*PI"FC   $I F|F FꅹMN0"OFH0HF1)F"0F=F"!F0F!i)'%i8)'''8i(X%V)'5-O6]yJF 9( vKhuHuIuH @y'sܡ`$F3x+@FDFE 6ROs02#"S,:QF0Fh1FF(Fx#QFp0F\ZKh0D[Y sOp")F04F r FF(FN ( 23 P,(F(!(h(4r! FO4!7OrH9F< FF SF FW QF1 q:C%I;2 @(?HFM8F(vI ,X #X6sKF&>''c%g%&>&!N]%'&')'U*'s*''I9V)'l%**.@́#[v "1FzPIC   YC0 HOA(J# F\6+J# F3IHF(IF0FfI FbI F^I FZI FVJI FQ[7+ÀJ FIGI FCI F? FI 8JI (@𬀀K?JOq?~HOAO \YF(?@!YF(?qK sJsI(@#z\8nJ  C\8%PE "iH 'sfH !#pcJ  ( "`H ']]H !#pYKx+\8C\8VJ  ( "RH '>0sOJ  ( "IH| ',FH !~#p0+\8C\8!(F8+x+\8C\8$9I F<7L?"`3I~ #"F QF FYF Fȱ,I F+I Fx)I FP(I F(&I F(M#:4'i&x+'w,'"2&K&s&w&&&&&&&&''&&'''s*'U('(&'_)&V)':'C'I93~l%/:4+?ٮJ#FI (?ЮK?J (????'jh$WH43( ؗI"HJ#{ Fx?+ؒI"8(ؐI"J:ďHF< WFFQF  q1:C|I;2\0+?wIwHFpvKh, !FB qIupI FtzlJmIF8Fh0+jI8F_0#fJ8FfIWfI S (8F3+<.p_Los^I ;2'4ZI F&c# "O1 CF#(H?PIQOFc!Fch &F` 9F> `x1F|+x3EHFCHnBѕW5C@I ?J?I =I @ X XFqx+4 3F"ѕ4SJ@F,I" K@F(Ir~#X6.?`X''J'f')')8)'))V)'l%*3*q'!D*a*~**'*&U*'***~%'<+s*'W+u+*"+KX6 R pG%'(KiHpG-C)}F F.HIFF(=є3+93pD# "q%K8FBI FS=I FO:I FK0#8J F8IC8J F8I>03s5IF F43I FJ/ F#I (.H-I.H-\63,H'I+H#(F Bp&K(F&I$HI#H%', ,'3*2&'',*,<,V)'N,&@,"g,r,&w&&',)',~8f,s*',,,8)'X,,,pFxF2-,+F;\**(+FD\%+ _."9p0, 02,,02,,02,B;#pp+\*9F+Bp0F9+-G'F FFhCE؇#hAF FlGF"hQ F#G )FOF+h(FG(+h2F(F0G(C(Bs۠Br O0 hS20K`Ch `pG h zrpG tpG-C -FoHO UO F!FFF0F( "c+x++  F]F! FCF*OR##aF0F_d5JBJBѝ0+ٛB I#F*F YI#F*F S ]TT--h-OP'[hFw8F&FOp&F(Fb#hZhBh'`%X6IhhlG(#X6ZF#ZF QF8 #hP":F(F6'-pFi@+hzFS "FIF0Fp@ >hS1PWhF+h(F9FlG(H+h\o9F(FGF!Kh#:Fv:F#nJkh!N SI"J "hDLI">"!F80B; IbfIi19'-~<9zm mñ10j*j+КB ؂kkB؈B, O0pGO0pG pG-AFFF F"I $ F!F&I8F1F-I3F FP F&,-  I"F@FD ;F2F!J(F(.@.8Fi F[Fh F#`#8@8-O'F FFFE!8F&F(6&0F&@F&`h8 U)& 0Bah# "hR3 EBhB3B01F@FlG 76  !8F&F(FO   B;#4K"1F@<#2#:FAF< (FT+ah h1&(chZ `b`@3S`|U! 0B`h# "h R3 E B3B0HF lG h J  3C, 1qa Fh/ *@B(а@ɼ( ))OpOp@()Op"( KS K(FpGHpGHpGHpG .`d8F L )F40+`"[rO{ZF!O HFP4yI2F FC #8 3qOzssa(3~+@쀹0HBBչ60DNRBEFObI#F67`j'+ZskDl'*bF01((FF;] )iFiSI"](QI](OI2FWH(KO4O  x#$3!@Fn6h0F8?Kh0B\310[#F:JOq8F"[,hkh4,`<sk`$FFF|SD (+skDl+s"kDO O ,K4΢#h3!@FnZJ#FOq8F(.@3.?.N.].i.}Dz.Q|.'..(!..OJ !RF0F  !T"I#0 x#Br01#F2HBF$ F0I0#Mjp1-Nȳs1 4 5#@F!!7HF#A!  ;#!O K4O #3!PFnJ#FOq8F#KO 4O#3!@FnJ#FOq8FQ`.4𵅰$FFH"F!D0 &F(FH!D0(F& I(Fb LF0FG (F& !F bF~#I 0 ]# 0I]-O])FFR٣I@it(LѡIh2 F(?(hI*F(>ЛI.@MaOb)h1@I `at)hOb `12fh0FzEv]`.]/na0BXahOb)DahOb)D `H#(%chFx)t|Kph.@ر0$(nh0+iIFGFHd0$a.3h%'U"0Fr bxOcG3h"U0FroOcG+@\IaAF"ai"HVIHFTOT%TF.@h aF( bhJI0Fw(\)Yx3} `! gO SE(F ]8F1Jر18F,1L# HFph0SIFGBFp3h0F0G  wa.$(h0+IFGCF$aNatObah4I `ahahOb?^"AF.F(TحN.'g'.5SzZ9F0F AF0FIF0FбI0F許I0F耱I0FX" I%"1F IF$I,0..5#S#Q-CO $ FFOsJFF F(K;` FR#Y#"#0GF#F;`F@FF8@#;`+h(F0G0@F0G$Q.-O]%Or F )F:`)FMOr~¨)hN)̿!!F0h9AHdD0h=ULAF O8,׀:@`"ZJ`O2`" O g &0 ~g `(O F gFO :G E(s :@YP#KmK`oC"2:@WP#KcK`oC"2#!&16 :3O3GF\ D O7 D IF 0FQFO300X?pR#0vz#"O 2#~<*F3 ;FzCF8FO30U P)8FS"p(0F,HyF@+L"OF"'K`@F ]"F3O pOO `N F%05 3p!8  IQ A"02 8FFKh*"o`'(h!y` 'z"B`ӮEЮª&M`Os# DEھKh+3ªOs$Kh/@K"!Fh#T }1(`0U @(h""0:"!FH4L/h 1^ $,!01CC(,!4R8KCH1#L11#R#$1)h(11)1+@'L !$Y ,0! (q4,8qRzCR#}J$1+πhsWȀR!BA€@𾀢,tKO O  X !8Fm+hkJHF$1hJ[CS!m cKhH*hbI2Q $1hhK+h$1hFXhC SF!y H O :  bY O300+;Op/h(?$h0G$IO7>!F0F>Fq}1#}1$1c10F,1L#$>F3` + K:(hh((?w s+?q+h$!hR+hM!JCH0F5F FF 6I1F4I&(K(F&IPFXO #԰5k `ObAF$K%IBF F3Fkh[ +RBIcC FIHO lKFrO |KFlKFjN FJBsJ8N000000082011 212 0/@/x-OF|M,@f,&̂UFU+AF 64,ѪJIt6v!60F%_F0O4 F MԂLH Hh`HK(lcc H,eTDO  ZIZF0IZF(KIZF;~Ka``~Ia~K ;84vKD8F$(F I"PF訹BFIF Fx 21 \5dQF 0O5O5%O5g!F#F#`iFjP) hK"O0;-CsN]F@4h 4CPFC ,{!F &lOI!$('yh0F010F,1L#- QA"0#YB#4vE h #kr (FF(l8F$ 'OsC?K"=K>IA#2##Fh h$kh+Hkz+7 $ 0F ] A0,!$l X`(?}2h#F", `$)B@#3$!)hQ3B3 h0G4#BR$#jhBуj+kz $GR$jh0G4#B $'=5 FCzP4 @4`j3B hF0G4Bؽ@$P3pB3$&F$F'F%FshB F9F 3hjFS5IhhlG G50 cpG-CFFh F%F'OUxxOcG  #h bU1Fx FoOcG(I c i@ 3hKXBXApGbJF PT!ڂpG4'0 `pG hhs8F M0i(DXB0 10`a184'POFx teh/-"1- ~ a 0-`A  02140.5i41.n 5F%C# `K0`# aKa4'Q0w}F F:OrFD ЉdETAD !LLAPAi#F IF(FAJ0)2BdFFRH1#DFE\1" Xq`{X1IJ8``#`1nFK ; 90FJCKEC{.+ JF@F0`pE0Xy$0F>X#`"cUaY+KJ!X:r\$(\!d{0pCOX1J `W: D*O C*X1P `1OX1@F J  I`4' Y5'mNF M#HH!0F^@ MF(O9FVF F$(FOb)FoIOboOb1Fo!&( F$ #x;Np@_ ,L,HOp)H@a %H h;nFF6"1F hBIF"Os1F$ h0F$F$ 6 ")F hB h0 h@X H"! " Fdpd~'>4ؙv4pC Nh kh1+D(p0+05 F3D A@ C A4'F"!F"!-O } FFFc#sI^rI :FZO@JFE"FCFhI#p0Feh 2F Ue(FX]a;+Sx# }VI$0FJF0F-$1Bږ056 * +{0a CI:F[F"F6?F3CRO(;Jrs2B ObPF_ 0O9PF:-I[F:Fhh+Iht3`h3`+ $I"$HVF(hCKh!*O"IF_VO"FO\: A!T3-x Ia#h:Fh_*40d@edA4'C445'6'8 FF! FW !F(F8@ 8-CF@Lr@Kh9#?H"%2'*!D Qh)D!DB @  #<1L P D T PaFH0FLFHFB8NFD8FHFB8NFT8FHFB8F@F8NF!KJB8FFFX@8FC𡹃I K Kh9#\h9#4'ۙ44 FiF8p@XBXA& OAJxI gK"!H`KJK K J!H KH]ڿ ]'4@''(H98 66&6F2( 8I D"@  06FIH FKJ(FFKt'$F"F(F !(F#pmKhKx:DjQ ItE0I̍'4' *x9 };H&:L"F Fd FNH4Kh:#F3J!x | "|!.Hs,I < qb#H"(K !0Ff&K #2 #"1#1F O1FR(FO32 q:! -x:!JJH"F  J }v64'̍'>66- 6u5FH0iMxzX8F1FLȱ0FF@8F#|J!1| Vxj\H|!"sOs K( "i, F6r F? 4'J%6 !F@< iF O3]iF O3]hFh+#hXh&"## 8FLch/+ !h)(F z84 JK(FFu''-O/IFЀ_,O-NȠO =Fİ(FV"FQF -HF(82h[F I %O (KO }F FKI"FS%@XF(ѝ0Py+[D0a#0030 6q'6@'s'6&:>p'6-OF-F$K$!F0FF)#LF(z$!0F>=FF,;3x+g1F(F^f0FvDEE^4K@ 3J4H~   "_ V+B Z R ;D $!bF  "HF_b F V*EҤ1F(F%D"FZ+@(F!F^ FD$!HF2F,p8F 7447-AFFF!FF#.FAF8F)F"F?FG(F# FA#𦺽-pC F-$!&oHO D " F_ V+хB p$! FFHS+]pGFHS+]pG@m#@o F& FO.peFIFFB@n Op|K}I}HBF|N|K|I0F,F^H& +;+3(x8 Q+) O3+DkO;x+jL#x+3x+hI `^ `axdI b3F(F` c`I"F;F_Kh!\NOpZSB'tSA:F7O3cUH:( x+ CJ!F8F7۹JHQr訹GJHK)FGIF FF(F^@ =J8Kh:F!@k O3 3H' 5+3L#x+?b2O;x+?]3x+?Y"I `^ `a(K bI(F%I c"F;F (;F*FI I b ~ ``F(F^b%77g77Ѝ'77'D'7408t+' +7b'q' 8^>&8M iFH!hF IjF 2 M]J8M iFH!hF IjF  M]W8sxM&0% + "C(F $8` |(F?<IT  p o8K|+H"|+K`HK`HK`HK`HK`H K`4'8'8ԑ'8'8Б'ȍ'ؑ' F!F }K@hed~'p#-P!}  V"3 ! \H~FعpCOWH"2xSI"TH\TITH"V F }pOr! NML!"F@A"]@AaC"(ۄB@K@'!@J@H*?I")i Q:K"p O3{,6,d ) )I.H^}(5$*H@*N"$2`B\`t#!Cl 1@33O3^CF$|m  F8 F t!QKh+!n \9h#a DYF"hLJ #`J#** FD 1C 1ci3ca7/*"ai>FFFO i61+>rFCD1 (O 0+2/+(aa:PFF UFD 1Ԉ #i%Ichcih"h!F,F -?,[C IT fHF! 6h'Q9' 4'y999:1:NJ:O:n:x::('l9o8(e9% NOth4 )F U0h!F("F9F %%6 F z-O]FfH$DdIFB(J"]I:FOpO4!FV F ]UHSIF^(QHNIFT(<(rJIF(.zDItF(D(F@FX"qQFh 8F9FFFXF|0=+#IF0F*FOQF((F^0F\lh쀹dF$h@/@F(O4 FF!@1$l""" \FOp(FF5z::8 FF4"!F:*FF FF@[8@y -CFFF04"! thD6h6p# F#FZkp3BE0Bȱp!h`")F`%Op ckCE pp"!F5p4B pGh0Fi 00  %hB#h)F FlGP A####5G(+s#h" F#GP8 F@ F FC!F(F*F 8@Fh"Cj"@h@";-A%Fp'F#hB #p'F"hB"ؠh")`hA"$ch35k՞n.0Fo h+FBbh"3nBhbh]"Vk+F3h0 0FG h+FBbh"3QkB4"-AFF2HCF YFYF+HU+IFF FY8FV@FU&IFF0FY8FV2F"I FY0FVJ)F FSDF FV(F.IYWPLV,I" F8 IY(IY(UF3.?.N.].i.}Dz. ;.: M$OcFF!F,CF:F1F0 2h(F4,` F(F, MPNF F'A "F1F(FXB yC ha`"  ` h"& |d FIzd@ M$OcF!FF,CFF;F"F0F F(FB` F M FIedA0hD#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕPlp" pO3 0pGo 0pGpLk, ыk+#p+##,ыk+$#+Ѵ23"+БB++U#`.МBт"M#Xp+ F!#cccj+Ch#h hhkGb0#h hh[kGbjlhbbkZeke%$)аP"N#Bñ+V#Bcc##cc#c+ сBOs23"+ pF XKk+ ыk+#pG+ ##+ + г ++#3###jF F h *!ac#hchhkGb0#h hh[kGbjlhbbkZeke  :*K"acX# 00pGhp!-OFh!FF&Op hhBؠh"#h`hc`"KhOh1FlGhch$#BСh ZEPEъl2  kѾ JmEp"8FDc6p7 jB3 '-OFNk FO YE ܵ0+ۙBݪiRQԽiO  h)Q.AQ*IB *IB)IBв *4  %JBj{ip!D2h3kY{#{h+JB0F~lm#ehKESEJB3 JBЫi;DhCE#hhaihhnG(Ѷ    /   + h-OjFOFF;h 8`p#hsCD ;k.ջk3+ѕKh#n\hniB8$F@FIJFCF@8F, 1i*hKDBs C#s1.chBҹkH hhlG(*hyKPBѩi 0 h Dk@CskK{h#8FYF F#  HFQF< FCF  K #.9a u2 +hF DP+xuh+q003@x00 qp0OpBFx;Fh Dk@BFx;F h#0hmFSho 3kDdFDBFkG8F*K B,ٝpI x)  #$Ii,P<#b,F3 4 } pixL-#F  ' I #,K@G''<DG'@<X<-CFLFF0+@OpObO 0B@R|0BOpDn0B@6`0B@(R0BG F0BH 80BI ,0BJ 0BOp0B@0BOp0B+hhhZjBE&030iS,/kk+qh]IB#\IB \IB[IB[K ZIiC j X0B/[/Y5D () @p0 DI)OpOp>Kh>Kh#L0 8Ii,3Kh2Kh#60+Kh1(KGh#"0h$IBѫjpi @  I#F:F0F,IB ѫlpim@IB&ѫlpim@@G'  + / z<<`}''<   _IB ѫlm0 [Ii[IBѫln0WIB-ѫl[nsOpi`@QI2F#F(FOJ!@!GIF0 i,"(F!B *K0 >Ii,ll;Ii, ll8Ii,ll_5Ii,ll2Ii,ll/Ii,ll,Ii,llZ)Ii,ll%IiC#JBѫl30h+FP!S+hhdBFiiG+h "hhjSFy < = <<<<<<<<<<< -C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hY#hai*Fhho3FGh"İh F0GO1#@"3#s hh0G D𵋰Fl$"(F1# S"#FO1SKh#F)F+Zpl4'x'I F"꠹#+v+m#+e 20 R, F FF///#" "+v!F!FlmCe!70 F%Kl J !"O1 #@3+F_l`dXf(F 0<-O% F!!pF(t@'% `Op aOp, b7O"/$-Op$- 0`'%K@!%J%H/['0+/D 0 і   5!OpD F#"2 !JM 3"2#%"1#!FeQFF(F F! <<M  XKk-C+F ыk+1Fc +++г +! !F()O`%FW !5(aE ˅@C `Op> aOp9 b@4K"!F0#M 2J3"2# "#1F(F; F! m  -O F h%`h+Fp&(B-ဈh!O O  #3!0Fh#h!h#3!8Fhz-OpP"F,#hhh0P"F,#h8h#hhFXhF@OpBFg,!+FA B EL ! @ P CM"hCJF fC "h !=JF@F\- x"h !8JFHFPD mFOphF0F(8 F8F,O-̿FO ZFF,3ؿ#3D r  -! "F ,RF~P!" FJ. *)J !(HeAh"3k@PFHd`}'@G'4)=d=-OF- FKh$8FC 8FUeh !@F @F(ІFO E-F@ sQ%=O3BF L D P POsa#SzKa 1"`"¹"3Or`rJ 3C,OrC,"#,nJC,[#kK@lqkJkHzF3B Ora"ZeJ 3C,$E#COpaKBF_KJ#0O3]H#FBbڨj Fb <1X@1p'#j)F000@,nBO O3FEѺ7.I F F(T#h0+a Mh 081P AF #z #H+  HHD0  +#hh#hFXhJF!F@ #hh#hFXhJF!F FW((FШj u#jb O3b l! FG $H'=  ! =<I !  DG'NF`I@/! FCx pN-O?FV`L F !)`!1`_SGW=;Ppkn#+`pZ RI"RH*8 #+`.#3`"\%KKBk\JIBgOQ!1BbGIBє *S۩YY TBL #+`#3`,Z2??PF8LG2!FORZ_XY ՔB )*,IR"(Q # )#R0-S03`!Lo!KB !KBEE$EE #+`#3`LHIFF F(Ic]b/+FA L?={H'T8 TLI'xH'FH' 8Tp'N(-OF- FFxHKO8GF@F9F "\FF#0 &"x*G+.RF[FO@!4&M+.RF[FOC+.хS+.х+*ѹ#0cx+Ъ-OMhF#im5 Ci 2(F OC6 (9#h FlG&h Kh#BsF F F# *F0Gh+޲`Ҳ F@FJ!~-@ a6J_+D!۲ [Fn@L OE@"KR ht!hF>S j!F=T a!FU Y!F.X-M>SqI3F:F8F x 30F0(F-@F*cK%h5+sSF+F\Kh#^J!PF-0+x+,WI*F#O1( "F#B)FPF(Nkx+@)x`)@ B#h2a9 FlG((241 B"###h F0Ggs;CFqCOx < CF*FID AqAD E q  cBA 2CKEFA8  JI[ a6J!_[FZ0 I[#F '==`}'>RH>==eI  x bKh#FF FPFIF16YKG2h#2F F(IFRKVh#$F F8FIF(7JK!hhObF>Ob9F>F8Fo3F:I:FM>5I+F:FF3I:FYE B  RIh(0"# ##h Fh%0G2F+F(a)FV FKE A  a   HF MO9IF>'`}'> >>p F h#h2S V[BBqb2 p -OVFDFFFEI G hoGhKh$H/A9##GF"~0`ѸOOGF&FF#s0XF0G#QCFu IK h bQEA  BEu H aEAڛAEuF F SE Al9 2'RH=`}'>>==0XF`%0G2F+F"d.KFh#FBBz@FBw Op Oz2 D@Lp#$F F !DB p0F鸹-J#!O31!(CXBXA F2KO1-CLMh9`(U-M+hBhh*1+K$A,GА)1;0h` LM"h9T# FG(F&O hB#h1F FlG  e#h" 1F FxOcG(9hlh`6 F焌'xh'JK(FFp'Fx x/(ѢF]/* F/*RJHOaK/*J>h'4F!F@ϿF!F@IF %7>Fb(8ھhN0h0I*F0h&O;h; I*FE8h F jF!EIFFH0h I"F F $`q'H>h'R>f!FF"FI@F Y>F(!F F@} Fp"FhF Fh"F@I@jF }g>0} FFQ"FhF(FI"F@!hF0DI@jF s }0 p> F,!F@y-AFFFFZF0F)Fr0 ICF:F FF0 F(FK$D"` %|>xh'8 M4htIF F"F(D8xh'>-CFNOD%(F 9FHFFF$h IKFF(FF(#h F$B04xh'>FMF4@4!  4"9FF@;"1F Dxh'L4[O#4T- TT.FV;413F9FF (F^)F(Q; 4=(FRxh'>pFF FF)FJF Fp@z8FF7!FFI*FF @ 8>FO@FO@FO @ۿ@ @ @ K8 pGxh'0%*F!UH!UMFF H I F8#+` F0@ӿI F#(`Pl'>> : @i-A*L#h(a.K' h$*CF"AFgF  hx0Q##"#G(#h)$rRPBrR#h$h i8(( #h$h0G#h$a 'h#p$B @ ! Bh"Rm*3  pGsj$ Fp6hB#hFXh=+F2F!@#h F0GF(Op!F pG $F(K'N!F'K'J7h&H4` %H "I"F"H!Kh,$7`TK!FJ(F7` F,!KJ(FKJd!7`F(I FOpJ)F zF' ?N?#?l'9??E?p'R?`? pGH'@H"?, pG pG pG8F#Q۹ҹ@ F8@Ysuy (3B## 8KP0hFhM    Op-jFOOO ## FD 0Opl' pG pG-AF\F F&Bcm+#~AF찹 Kh$1hmOp#Bc` ##e `Op6p4l'?pPF F Z# N K(`" 0`p+C# @DT $ ! `}''F IFFX1F("H:F(F!F@ſl' p$"!F#jF!FOpo0@c Mg K!F+`F X*hkF^ I IjF @pI<'???0-GFQ#0} Fh(F0T#0(P>O@9a=Hi=IjF(H B2F!F(AFBRB (F)FFFPFfF( 0=+BzB)J!DLW$ 0F$NDd#H:F)F0h I;F*F0htOrOaHFh I"FF[ S1F0F }0h0I0hN IHR?5?q'x?*C>@zF0 FQ#0h0T#0N@9aO8h0 I2F8h2F I H!F(F0 OrNa@q'A@T@l@)@KpF F2#K#pFhFF,ж0OrU#0(Ѷ0@;U#0 a @Q3(Ѷ0 @;U#0ap@ K"`g t+'-A°'F F"9F8FP#OO8iF h+ ѵ0@;T#0 aB5+I ^J9FH?JI T(JIHoI I3x#I2F B!Op0OrT#0IRFF@F(PFFPF@7OsdF0J CF kh(?pOs+ah@9(y#K$Lh:"F h<6 h*& h:#Or2JF&!JF"!o2FY9FF; FgT l'̍';v' > vA-AF1HFU0IV.NF(94h<@FG+IF F%H?F&H(4 K#J H.0h8*FI0hv"I(F8F(F@ /F HHLI*F F FJF HBq'XB CC*CvBBBC!!npG pG-O% ,FFB ``.=-;1 DBt C Ez Ew" C Ezt7BBht .6`g Gg@@51Kh"0pGܓ'-OFF Ez #UF F\FF*#gs#"#.w2F;F F)FJCp;FG1E2F>U DBuF=F4F2 JO \Eu EPF 0FObsE7Br   E  I,I<3BE.wp;FG1E2FU DBuF=F4F_М *[ *W S@ #BBIBADیBu5Bu:EA\B.wp;FG1E2FU DBuF=F4F\Eud#3 eEBr  \0%##"#U#( (F)F 0rpGFBh I F@>.Cp FF/!(F~FH(F2FJFй5Djx`*ٴa:BaBp034O0"H0Y> * F("HFH 0FM+h'&(`r#BA 0h)hB##" F  ^(д +hB 4#B+a\ 3 '#`FFFB,= K#`ppB.+O$@} ` !tb@BBt %$`E%1DC@h;` 532 F>C8OrPF!0 #P`08$ N M F!,]#",+`W$0 5+l'Kh Hl'8m'-CFF FE0PF-$3FFEܸ@a4ؾshJ(F  *E  gE43 % Fqh:%Jsh JJCC4CF0K@QJH@h F@ƾCC8FKh ]J#Bز83 2"+ K"h KhB (4Bx2Fl'ܓ''-CFFF0'0'!X8FM+h&H(`# IBsOb#r#8IBsڣh@""'@8-OOfq-F FF$MPTPF%Oc)Ft @F'rCF F `I0n( F0F$ F $MO1YEu ZF@FSF F\+F#z!`  %F'FcbO #X4"be``` Fn0KE&0Ff=IBFP (д *)#XPBB+37B܎0 *@h2`+;++-1+01#1## 0F#Fx"PFz 0PFBFsC) 2Brڄ  5  [b2edA|E-OFVF Ofq _F({OX"t 3+ #O0!FF ;#O0!FPFcf#fSCfK#`VcaV`` F IH"bX#0 F9sh3`#0HDFmFFF+Kg!JHmKh!JnKi!JCnKj!JnKk! J}CLh`h#uCaȿO~ 8D0CPDjDDDh-Oy F Fh"F Ki  j y {  xO9HFOp"jAEq &+$+" r#PC<A 2CC3D c b1 B FFArF jE| ((:FA J Bq ڞ a CO;h# & 8`0O  OFB ;I hB\ӸOp9\  h/D7/<)( O1b jhjD"(Л0+@YFp 7D'0h3`2Br ۛb 20/)/нYFB#1 '-OF&KFF<h O+hiB'I"%H8!I"P2#H1!Htj S7#h FlG:+FFt% !H (MЇO KEi !FMh+À3 O0w!O3:8F'F(YI #B+6@Or!Q#2OpQJ2A"#!:F#)Fe,7G7(F:+HF3P#hQF FlG8-G  :SE،O5O S9Ih0PFlG#h F0FG(E F!h"#bh2"0Gx# F #"#h0G 0C)CF#h FlG" 2F!#AsH5ACFR3D  1#;[ -C 'PŰk FhhoCj;D[h3;+ En*FkGOd*FkG#h"O1hj#hY hk*Fho3FGpFkKĕ#0h####K p0hhlG(pFkK-lFĕ#0h0hho#GEbBBOq1 p0hjFhlG(𵑰%F F.F hB-H-9+6G#h0#iF FG`#hh<#hFXh7*F!F@:#h1F FlG h* 5* ڛA####6#h039F FGF(F%/#hh#hFXh*F!FOps F𵋰%F F0FF8F K"O1g#S 3BFHc(F >PF-CD" FF! ! #@F(}SLFŔ 4@Ŕ@F0lGGKPhTxO3FFC     h[kF FG6Kh Th#Bs *F#F#"0 G(I # 1F###@"!K!K6#2O3"#AF0F " FJ0F0[ h0G0 8Fh33O0## ''Y OX  Fk#K hh0G@@0  Fǰ(0 h8hkGF@iYh" &'#h"O1h3#h0s#hhlG0Fa G-GF FD"! 'h#!;h h[j HFF(<8IP"\;hP6HYj"F#B14MĕhE;hQF8FlG @"(K1F&K6#2#JF#AF0F= /`32 Fe0F.p0s hB h@ G 8qh@F O0h+##0 b  Y OX -OF-FhF0G#h FlGWKhTx/xO7FFF@#hhVF@ Fx " F0G(xPC C ## ## ##hi !"[k G#h"0 FGCFS#h FlGF(K#hi*H" F#G? ##(#hkG#h" F0G0)  #hE0 0# 8   # Fx#" VG(%(FO 'K-OFh#(1+@ +h3K@AJHti.Jh\(F'O$@O~OFCqKKF#>O38#FCF@Lh 8+hl @ O FXh 0h ph&J#! @FcO@B#!HFczС 1F@  2 ;Fh(F8Ob1F FoӺ.?#&F0FFpC O(?Ѻ>#`*@20F(*0/+ *OaBFF F *Ob FdO0F(*Ob1FToOa FmX(#x/+0 fx&v  F*F*&3;DDoFIOb Fo*Ob Fo}(F( ںh(F`/(F F M4N>@)!R F(  @ F!R "iF@ ( Fp l *@ B+ .-OFFFv*F(?иO&(FxR0(Fvd8FC+ I" FlF(I#FRF0H763FYFHFjO7G4F-GJmH"F@怜H(fH(a(@߀HObF(L(pF($I( m(@T(DF(чI(ObF `&I( bIF I(ObF `{I( bvIF qI(tIF F(@qI(nIF(FF(@kHObF `bI(h_I bF(FF(@THObF `SI(O!F `VIF(DPIF(FF(oPHaObTTF `GI((FX; `JFOa c0 `0 b;FQF s5 -$!Op0F Jm(($0I(ObF `b `FX(I(I b$F(F?#HObF(FI( 1`BHI(F F%$J cI(?FFFG:GBGFNG]GpG;}GGG GGG"GF.GH 4 `pG# `pG# `pG# `pG# `pG0ii,!F@BdDKh#J!(FrK,h7 6 !P"FFH Fo 0'RH`}'po'-O@F# h #C 2XchC#k;գk3$%ke 2S +OkK KFF J!d %[0hkh0G8) 'Op O3cshBٷh wk3 ! 0BO1c50@F lG (#EE1cmw{B{A +W_Kh#]K^JFXJ!# O3F +B# QK X  h "O10 ##d + "HFWCKF x >@%+e(q# O,F2KH#3Kh2)ۣ%CBCA #C00hhlG FFC C 3BFUI1/DGKFD r3D #kD##cC0+P܀ 2XchBAԀ Bq FyeXH'5>!`}'hK CHFh eKh,!<1 F HFQF(P#*s##X @+>UI(F(89FSEQIOp8B"p  k3Y 0 hBB I 0bJ`2 N2p#00D#C0 +9 / 0V  8h 3  k"cE#kC#c ;C$GFPO#k 2Xch c!C# # BcC 20FP c`=O Op X ?j@FYFkX ?c#@FYF ''L9N-GFFShCE@p'h#0!k(qYdhnJAh lJ!hY\h[m),mBdJdD &!Th`}'4Ho'Bh!-A2Fjj!9NO FB=7IO@P#C5#a1KaOsb0Kb1#c/Kc#hg2g hhCE$#OpE/ Fgj(ۡji j( /k3p51L#ClhjFAFlG@GkX Ihg3w ! q -OF4FFFO p' E6ѹlp'q(a0IF:F30 F@i1 x#"4kih hb####ice+je8@ii D hjB6* Ѩi@x1Hk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  hK-Oh F F8F$ eh! PFF(\I #SE-F@OsQO9tpżżOs"1FOpHKA#2RF##k0F4CEkahj1  F(bahOp b  h0(Rch` D1Fbh)F  PRFAF(FF F # +c8Ff8Fl^#hkc F[ 0ch3c`,O03PT8F8F<'=| -CF FOp 0"O1+OkDOp/ #30 /+ "6/#0eh'B?ij aF(ahp'hqW(bhP`!bsa:FE O5F"hFBcc"b "" Uch F3c`(Fh 0耹@{D!FM(F.{7'P-OFF#FFC '`   2Br ڵ iiI BB{ [b B2 p!``U`0KhOIO(rq#Op B bj(Pm3 'oO1K&!huO3E򄁻j+@O VFh;hRE l8FGp&EF١h1Dk3\-|@0H#3+@ Z-z/XBz'E@;>C<@a LHp#HPSCFPC aDHi`WgE%XP0+FE@p HC X-C OgE@/<E9!(q1Op P  [ C1@aCC1CFDEq HFcFF]@K 0iX`chB:>C<APQLFPC0DA B|۫BqFF^0N0L-g  {Q@Y0DA E{ 0=LE{5`hBnB@p" a + I0qFa` )s!#Ic`00I#00#kC#c##''p#hO3BDjWccPQmA;hmkGhhCDb!hhjCDBZm**kB cj+HhXhAPQCQ`h , *chB82F6/* I Fȱ IFH S)r T R"T "X *6jhBh 1FlG(h+++# 1Fj#Fq&l QF8FGh+ 2Br  [ BB{ #FQF8FI  l\9)?hEE孨k3୫YAh3A^ ОE| ЭQA`Op  k3­U 0Ah3E 0AA`13A1HPEOp  BB803 P 00-g 1pPD4 a Dp$IcCFKDFPCRDIPY`INL9-O%-FLhF(Fp& 2B#-u(Dp!F(npFO p70E"ӤDPԬK$\CBTЪK@]QJH03nJk՛k35Sh0pBp" FXnc#k)գk3&ѧpO p4 p" F@n.lhS8IhhlG0##W<[hEp4  p79`0! @|Kh;OC&hlG BBO3 H$F0B~BEp&VCaAh( xZplh ;B1H # CC3 DC2+rD sEr [J0bj` %Op 0B (`+ sO3 3.@ o [B O 3 D0E5 'Opp#sCk?0F5 XkJX:FL(XFhlG0DkY-j -z X C1@JT CC3 DC6072Jpl`{m۶HH ' pGD;kZkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504@3h0FlG FFA#0B?p"0 k3{;kxzhS 0+rp 1h Xb0F2"0G(X##yhS #Bq F F#3hjkGa"{m!Fam#bmcb;nb{nb3h0`a0FG?F'3hF"F0FlG;kC 8;cCFrAoH<*FA p3 D 043l2[ BB Ap#p k3@#k@𤀞@񥀣n+lZhEhS8Ihhl"G(S8 hh"G(z h   bhX b2"0G(>,FĖ##)F"h0GFHC*FhlG! C ;B4A # CC3 D  h   bhXD2"0G(  05bhX+r h     b2"0G(9##ahX#BqF F#0jhkGacmam*bmjb"nbbnbha+?cj+?_#mC"e"~*?WC#eR h   bhXF2"0G(Цk3q#kmщXbh)rg  +chhB&kjGacmam+bmkb#nbcnbhah0`)FFGl1F.G.BB 0BBq6")FGBF*F1FhlG0cccm[j+#mC"e"~C#e705B#p O4BK$Op 0BK p$p2 [b2VF#CEgp!0FFp#F O2F!EfO Op EeOhEz$Op0BPe; "3c0.!FXFlG(2!`.| Bk5Q)Qhq EwEicd4300XJhCЊk263cp3C( kCKkB k  +hB Pp"  {k3h.AFlG0 82d0##3hb.##5ce6ep4]BhXKhCЋk3Pp"74PpF#M(h%&(h4j+`h!0bO6 Fb%KOqUKF#1 #jc#FHP0KBbڠjs(Fb p#!F00!jjc0 V(=| a~ po'-OFX-)1$A#,@b% ,@](!#F!FF0%(F5#0Q##"#GF(0$Q0" FT#G(F%FhB$@1<1@1V#CR#V#Kh-@$,O V! &Ok#3! `J #!s0F#`K! "8F#J`x#h hO& O% 2 !h Hh! gXF 2.#h h "h PhZF! g' 'jH#hh#hXhP")FO # # #0ZKO #$"`WJ!WHY`"aVJhYa"b(SJYb ٠j0"cOJYc #Ov3 6Op33o O3GF AKb0F0FV.?ꮳ+R0TjV##0h0G.@eV!h@#BE@0 FG2F+F !F2F+F F%i%h#h )F FlGP$%#h+  5 e&.!#h FO50G'p4085w Cw 'Kw Sw ;w r'.!F #h FPlG"  FG( ####&#!&#FB9tI%Op BVO1F612F+F FGlh+?iiK@aiJiH.# g!F#2F;F F 2F;FU !FGFp3l!u#*F.FBC#BI "F(|э 6j +AIF5p4 lkC dhlG( C " hk@;FG"SDld"jp6,3j,,Tm,(FیE~  FBv3p2p$ \Ch%DlkGh C"hkP#G"#DmBey!HF0"0#0$ 04(?h #"3ACN IH _W 7FF&+l$jFinhlGH2F[B285B&` h #*s|+ pG pG-GFhF-FFh< hP[hbc"+hch`hBCZa+h X(`C P#J`P'O<h hBܽ-(2h{C2^0\0+hhc D `hc(hc0`#i(`+*F1FHF`7 K hBڂpG+#pGp' K`pGp'8F$1Cx1$h0G F8@x1S%5$1hB%MP 1OO2 `#DFF$O< ROA L` Q1@ 5 a382+-O OsOCO pO D2+F*F#3O3$AFO0 M 8Fw hB Q<"1 Fi8#f4dy-Agm iam%IF#n+#J!6i@? OpiLcnFn+J!"i@A n+J!i@B #o+ J! i@C Opi coF 2II*F1h!D l+$(hOoIlF#G1h!D l$h"  o#IlG3h'I #DhED3h#Dl!2!MF((h(?mIhF0(h(?cI"F]кQFHF(h# 0O'q'ML7L'|'nLLLLMp'$1pF FF phBx1x1S%50FxA^D%8 !x(PJ C $1I 0# K #3K K u] w ' տ h J+ IO2 K JKT] 'w  տ 00X>J`k;+إhݱ1{"2J@6 |(^#10K`0Kh0I*zk#:*  ,0=!F J !F %J %I2h2#K#J#K"J "I2h2 K!J!K0 F{J I2h2KJKK JIcih#KKop''q'*M<'u i ! 'e 9 ɱ i ' խ \'}  a -A%FL")F`UK%`hSTI ""FQKyh0:qXhhBkD";P! 3jHJ" FH3B(F,AKh+;@I "F(3=OFy9h0;Jh"hB!41O D"$#hMԑ'K'.'JX'KM-CF$AF,)'F7#h AF FlGB  BBѷ?GFhCEط?>FOO7紡p'M6M-G}FFFFJFbF(bI:F b"(`I@FO E(O78F }(.WI"F@FCF Ѵh+QHIFkk:j`j`#k+ackka#@0+bB0kbclbIf'AILP+F*F>IC C C FE9I8FE4 7I8FE.5I8FE(4I8FE"2I2F@F0&I"F@F0,IJF b"!0FHF&0 0BBO# (*#( 1F8(@5CFVK@JHiF? H! F(K`8FzP0+V8##c3#dff# c`VD0`` F"Q0N`8Fk FF#8B3 $jbCX@B D0`"R #h\jB K[hHpGp' 8FMkh khB+h< 08p'Lch `hp'-OF1LFFcB[[#lrhC#d6NNNNNNN/0 #J(IOLI"fhLM!F O@P= 07 )FxF+# DN>P#N;(" FZ FOp Jx!F F!F! F@K@1JH:I,42c0N7N+]  FNEF# 9B%31*F3@B hh*F*-#p  l  *FFhXjB jBCXF"hF1FhFiF@BD1*F F.FhO FbF" EkkEkBLkA&Op0` \k ukBuF  0;0 h EkkEkB\kA0*` FFFFĕeF#0# 0F#"# ###HO0KOpo(`hkB-Op # BsO#F - K+` F;00*F!FC0 L(;ih3`2[b 20C03k+УB " 0 P-AFkFF#FB#+i-A; BBL! LFй)Kh;` @3B0#0!"!F04:F#AF0#(0 C01a!a F1)FA4BBL0 'pFh p#kFB ОB %*K`(F3P-0й#c04#)F{(h;`2[B 20(FFSPFh  " FF(-Od]FC ЏK@JHrKh#KOqJ P ISF d]Kh J (H! oF(IO0, xI O L (UFVF'`p oIXF|F3C+CjI(Ms C <0k@08P0+Я4 ;FAF F "!@FOnQF,$//Н`0#NI"~"AFx "!OPF7 "!OH (BI<@ c} ~ P5$ 0 !X0  0 0$050#D0Ocf0pF׹=I(Fwdh#\C FF(80F(FHF;hZk(F #cxFG`2pb2;hk00+@I(F(4FFCE0Ak(2kBBk*2kBB !F0Bc"4|dKh Kh8 ȍ'ؑ'{ {S{{zzSzzӈhJ ]-CFhF F ڈ z Zz ۉ0sxs+x'F"iF@F #*F F9i.Bsxl+O&F"iF8F鸹#*F FqiC7/jF)F F67.̥-G 2 FFxPE #`,0.0〝00#r10cr20 00 7"I*F 6 5  3 1  . cN ( ѝ0 00**+8ONF9F0#c˅  O0̥pFpL&"F@!hF6hF4G. p̥-OF8zF B{'O P-o)ХUBUADaD B^гBV1DBU M MBSKSK%R-E{OO 1.)'D aDBiB(1FB fDB qB s1FB( FR 0@B( F-7/,O0y y pG;hhB, O0pGO0pG2-A4;OB22:F`|$%`fB T"*ѽ.h`.DBO1QA^B~ 4,n6KF B0D3O0pG'(؃(8 ( ( pG8(4  pG(  pG pG pG pG-G$xFF#F ʱB 4uD$G4-*8""3+ y%.= оСB v#D+F45-"(r` pGFJ y)+0@ pG pGJ#M 2J]Q vTvy.<$сx?@w9gD`Gx`)`hhh"D*hDBOAO0 yy?@v9>D`Fy`)`hhD9!`!a`O0-pCPFFC C JF0 K#`0F p#(k+BO18hG,#I wQ-O{O AFXFf(ڸO0F [br 2 IF XF G( m cs JO|SD  aDgP O~ ̢.{CDO~3^RsDlRsЭHCFnkb FQFz6KO2hR#RE Fs FFFF*FPFIFd#F:F`F\CD2DLESE6 O IFXF(@3B32D@p BBE  @3 BԿ````4  ;('pG-C4 &FFLFO Fx"/)pDEB 2*BO ,!Fi,СABAA1HF!( !-OFF#p 3 E A%JF*uO.FO32EvU BR 42 KFK(E ,CD z `SFJ1A"F` 3B Ds  FCE   #Bq (5K c`oFBv(F #BBr"  Y8 Fh;/ * pG BJY # kFJ]%  kFJ] !pG# kFJ]y 0F#hMFF3"!")F I hL M0#6!Oc: `0{dЀ4T-G@4FFF)53B6KhT)|D+{Z*,1991+1;+++11+1++1++1+1+++111B+Ђ+#!+د+"Ю+ٸ++++ ,Ҳ* +"a+#a####8(  @ K@QJHMQ8 Mhh#@` 0+hx;##p8p'pdh%h) p0yPh(FbhMchD#<3y(FJahp3R#!bh(F)p<K7F[h F  "(F(`xK,Oph `$ F0LD!Dch+.Fp''+#J<]  0F %h hjjCXѸh!BAA)0 h 0hjBCX Ky+8 pG pGpFpuvU B Fp@pCc) F)rKO^qJHBB LBrOb"2LBr@""QʨQ@8F F@7B(KF=F'h@XbRJBsڢh`h# h3#h9F FlG1 ¹Ob"@BqXA2@ @C"Bq2hO'@88uF8a@"(F2 F 82F82>CFv,KOdq+J,HrO2q F(E'K`(FFO2B1FOsO?F ``8FFBA3#OsCb`#c#O3iF20(FP222`! F F PQ8F Mkh khB K!"D B021l* 8p''H8 ^ pG'8h  hjCCX%hz0+  bhF(F 8 -CMF cuFF!"+FJ!d,d$.F(Fxh###(8khCEhAFlG(BBBBѝ AF8kh&*Fo3FGF FF غйJ1F(FLFѹ J2FF(FJ1F(F/ RQ0IR-AFFrcFC+hiG Kh#` q+i ``B xc p '-OF,MF$FF!Or8F@F Oc!FO8 FD#/ b)F#XF2FLѵ!JU#BMPF0XF p@"!fU#1oU1@F ,M0FF(F2FXF#L"BBF q Or@(FID HF1"BBбy1*+Е1+*+ѕ1+ѕ1+WF2FxB$ s0PI   E,S"#DBM $Oq F(DFOB )3+1Щ+ 232D2# ++#ER@+#XF D#$ H<FF"OFCFv8K@17J8HO2q F(<`(FZO2B1FOs FO``8FF?"#Cb#!`O320 Fh4#F(F0 F$ F eh+"Bs#hjF!lG(((#h F0GPQ&`2S11111T\BodaqAFF-A y.h,,Ѕ,8B,8Ьi @ `'BD$h@3OAXhAA k+hCD\`7+h8H+h8(h 'B` FwF \ ',%1)OGF82$B тAAAAAAAAA+h9F8Z3Dq4BF2 F4i+?wJ`t2F2 +h43B(2+ѐa.bR-OFFFFFΗ 4 Ėxi +s(C" FF4]T.,FEF03+)БBиO@FFOpB `"FA#B1q F! #FA\aEc()8bN2*ѸКK0p'9A\I/,)КE37/bNEn1*+ $  823NF  $!0F O2D2$iB8 F B^ڸ?mrKF{"O )2") МDDD Et FE~ 2*2#\) *3+PK@TaPJz 1B sڸ?@ q 1D 4 B t" 4CFAF(?.2k @BF"07F'0E1B&K p"!(F2BO3 0! g \  , 1)K@laJH*D@A DBOp1?OseRRM_ QF-O4 F FFǼǜ #+``i0K@JHV@%O0K+`#zFO8 F3++ +(-Os )2D4q!D! +p#hchBse CBAVh h  C B A-Os8BYFl F2 ơ!D# CB Bp SE s#Oq F(V-?]MKh_! CBpƁ!FBy+F"IF[@B;f9F8F:Df0F s v yrE?0)*"*@b3B JU"!"!+=#JFFPF KE s  9cC# y IF2+FM[@BBR'Q S ' 0JFA JE  q2JF"[D[A 1@`Ep`1y+FIF[@B\E22B sOq @FrJU#r1#1F22 -?I+@OsF1XF"BqFh"2i(#!Bq@`i +(B#` "FAB1q F!2ODYBBOAbBr +F4"qQk<@B<"p!1%K#O IB yD3+O t!%yU)/ -СE?014)"1?D@ B p-?~Os_ -AFFxFkx4 )F8F(QѸ h0G#k+ kP"BC v2 0F*F&   " F6  |(# F # ##2F!K )F8Fy(#k˹Kh`h #G c#*s k(hP2Gb!I#`h #G ct'H-O$m FF !!#OcfO4 F $mnIb0H6SCs@"!2Or!Fc"J!2]K@!\J]H vO  Y 4prppqrqq  6O[^OJU"CF"0F*FYF n S*F8FkK@EvB,8F8L&*H&*HFFF@3E(FO(?1pp? A8pFF@3E(FO(?1pq?Aq(FF0F*F8FKFEBh Or0D*F1F8FKF0FOsE]EO4d@M4QFR5K@ AJH)FiFFjCK@AJ Bq#`4+F@ @0QS>QeSsF0K@k!JH4O3Ov]#ah6R-CZ kh0G8utvU cB`h^ Fp@XlSPQFk Mh0G#`hOc!CFЧh!8FF8F:F(F0F-(F F M-OFhFF0+l@6M0*FP!P# Fx\CF>++O0:FP!P# FxFCF+!KO2h#RZEs FF"FQFXF*FkCEE@:0EF0FQF @13h`!"d!*Fp#FGP@'-GFKFFFO<hRL5E8AOr`FFo-?, #Cb@3?$%BF;`3hP@@j #BsڔNx&FL#h[3 ѧI  #hCM+ _(НI KKh+J 1!8DJ;+{K8FAF^n톋A0 FYF ^bJA0 q D {+{dOd [F Kh~K*"-:Dh J* zK{I DqSvJ[ vJDuH#:FAFFB|+@#!q kJ0 #Dhc 8t#as:J ^IKA0 (q8 򸀵 ^A0 Q0 ^#z/q+@ N |0 ;oSoS3nd";*@>B)O#CS@3A /J@PaF(FJ!KD (|oK %D{#*s۵ٸB|QJT X! g$Y@.A''''# @_'e'V'Q8_HTVVVV' 3BR +# FS 3@PN.z6JYF(FD+ q0JD/K "FhCBeg#l^A FF^"KA0 ! 0ȋ{jB?l OaaFJYF(FDOaa0Fxp Fp+DP#L1;L1+DP#T1;T1+DP#d1;d1(F,52;2b.b(F,5p2;p2pb.llbsF# FFFF(9H1F! FD1jN3@ B@ B B2  FB BB )FB B 0#N#p@p) FFIHq"(0Ю #`H!@) K"0IH@Wn0 #o) FF$I$Hq"(0Ю#`H!@s1+ڮ7#||(#1" Kw0IH@aWnY2 #oFCF!@1t13t1c+HL!Kd"!}oE1 hF81 IL03 F4 F030 գlKI FJ@+Fjooop!FbI\#jFFH"=p1+o03F0 F@ ()7F F2I2H`#|DC*H%!)F0@(1D1B0|18\ "T_H2Q=Q-I n; f+X1 K"0I H0@imZe "pWn!h!0 #o8!F H\CFѽ8@ I H,)F0H)F# F8@foh#j FIdh-GFPrj4770D#S00X#C#0zh0q CC0h Xsd{h0Զ@0CCի`>(0D&0 PFb(F5FQF(FIFd{hC3{`(0Cs0ijp+% p030eTsSC#C L O(8 F F pNTrCCx1hnrSCD#C% psRC0F %u$TsBCvh   F ! ! 81CC818!sQF.9K@[x1h F%("(3Km2H)Fp@Ͻ(F`%(( )K"m(Hp@mh<1V "H!p@׺J#F!81EU!C+C F,>", 0 H,O3,1pWooo6 HXpFH81x1Nh5!p@+j+1F(FmhCs F81p@RoYooF FsOrM@!0Hm#0  h+F9FF@H*F9FO0 @")FtH*F9F! h`e h2F9FH1D1 F tPYXop-OFF vF`X! F 2"bFF SF hIFO0 F309C2C0U0#EB HIF I F 1#j+0309C2C0pGp7FhFEQ0-AF`70 8+H A0#a  CБԠF6X !F #!0FAFFHm#hx1h0'#j+$ F 0 FA 𔼬B+jk300"1FmhH AFuNpfprp-AF FFlF Fd$F Fa(Z#j+/0 3` F)FBH F h1F>I FA;H)F:I F~9I F ^030+[cj"! F F10ѭ,h++H-C"A! FAμ.9#j+ "HL0۱&oMhF)F2F F"oBiF(F@@#j3 F{I F #j"# FI F FA HpppoGpnXpopFQ ;FxXllBbj- F@lp+hF<03P=Cj3"!P81033[hݱcj030; F0 HP"A! F,0HF Fp@x%FXF F@-OF-hFFO V(HF0#j+.O0YF F30o2F F)FBFKF F FwEBШEdh8 F @E F 2F)F Fq-A FN6ZG!(FW(,"v0?I?H(8 ((:(@:H)F(O(6J6I7Hix\4JO3I1H]2M+x+#+p81:F3F FAF\#+p%JF'I"H@%JF%I'H8#J$IH2 FD!\1)FxH1JIH@0yHHO6g!FVFO6#`(V@FiF8F xIF;Fj# *Hcjkb> > >0+**h. jFAF8F@+j(F&2۱`h`#c`x1Zh``"Z`#j[HIF F"#3 F%F 2+`h` r.rX7rMr-C "FAOq>0NIOH#%LH0Ob5OzqF(FF)F@F7ѭh7+Эh +:H)FW# FF01H  x1hݹ5h%0Fxx Fx  Foh 50F)Fa(*FO1 F=F2`h x`LFPKF"!r`x1h`Zh``*Z`+j+"#(FgCF:FXarprr}; : ) FFIH0 F(0ѭJh7+ F@*@h +Э<hV+н@HXn-AFFFFFFp- ٭7#&I `%HA%"B#j+ H ;F'>Em**F1F<0#jñ<#AF* 9FFH)F<#0F9FF H>PF**F1FAνXCrrs-OFhFIFF0F8I"PFOɼI0FH00A F!FBI0FF(𷀚I0F|F(k0C0 FW$40DDEXF F(݀F&FEQ&!FHF l FK4FJ`@F9FKJ|KBF|JGOÀ81DFCC81#x1^ "(@x1u81#C81$O $W&6FvZFHFDCO D ;k) N) 4)6)&U)KKp) x) n)!K K[AQ$&FF 0 ELE 2FAF C)DW+F(  0 ELE2FAFPFu081#C81O4 W+Fz( `#`  SZJE(FZFX1F%B1s;sBsRsbsks,Zs$!CE+W#xj03 ahK1C a`!3"RܱExCEW#xj 3(Fx;FBFv8F> F*F[# [c KDc`F> *F>D8p1pFFcHJF(p1tAt&p?J!?H 4Fh+7I9H (5Hvp>02H ]3hx1hll1+,HQ"1FF>0 dh%H @&Fl11F+ ""p#FF)(C  "!,jDF IOr(F0I Hl1+?|{1{e`YK{n{{{Kh*hQ`X`pG'hpG-A FFFF0&K@G%J&H#KOq JK@#Bѭ#`O0(h0hH XhBh2˱Z`Bh`#h`X`h `3D``#`#xa"FU "a``{iY{| F0K@JH*KѬ#` Fh3O4#`hBhO2`h$U@D`{yY{FF)8a5-;eBq8A1h0a P nS8a c`#𵇰F 1F)F0FjOFI+hB~ hh`B ` D:``ʚ;-GFFFF0.K@!-J.H,K@!(J*KB*K@!$JjL,kD FO04#i"hKEciSEch S`bch`(Fjvhj `c``bF#*kchB hBChCh`D` h{Y{0|ʚ;A|7F5-ڬ#`O00hJBBFvʚ;4#kFFFOzqFFJ(FBsK KC1FRMb@BF0KOqJHj Fܱ&hiBgiB'iB gh^w`gh0>`okg`<`lc4Fb{Y{0KO$qJH#eT0{Y{0K@!JH#T0{Y{ pG pG0K@1JHdCd {Y{-APFFC (K@# 0'K@Y1&J'H^'O$DDkB 2FiF 0O0 kS$0;>+٬4X P(,C@(<$DDkB k"S$|04G {Y{8X! -FX %0 F,F F8#FTC _#a#FC(_b#FC0_cc##es,7%h*h.hSHhЈBA5FBkhjS`kh`C^h;`(F sc`l m#UU0hXj k#V0p@pG2+Z`Bh` R"a2+Z`Bh` Gb2+Z`Bh` PMV#O5`(F-٬7#">FF"CF"=2ѝ0>0F#C0<# F HK> 1F FF(є> *1FZ|h F [dhhpGh F dh"DFB ;3+*$F, p FFx#/x+F" F( "1F(F(:!(FF(]oB0# !# "c;H`O0p3p")F"Kh.F;#Z1 R5#oB# "0F# c3px.+i+oB#0#! "`c(O3 ccO3c:+|!-O۰F F#!OrZ OC FH%P Ft0 љH8F /F8F[+## 0[x+]3F(U=h}+S S%p5B%  ( 0D81JB ] F0HQF: # F#izscd@ F0#L0clccd%b F#c`{h`d`4|`|@}0 FF1$hd2#`(F0$E ( F0i+dh-AhF FOh۱ah(FhSx+ai2 ich01i *F0F! $hh(#` iB@hx1hpGCj@h0F F"!hF< "hF2U I# hjFKC%0 h#IjFzi~iFOi /+ i#'DTx!h,#` F Rzh* - -*FhF( "05%"DB,D#iBdhǹF0O0 I" 0I" 0O0 30F82@Uh1Dɲ8D!08@U`Ph!aP`Qh _ `!1Q`Qh_!! @Q`0)##S`0-AFF FHF0H(FTAF04F H F 1h"(F1\HH F 8F 3hFZ2`@#p Z-OFFFFF3x"+"<"+@ڀ86@׀5x%#;%O FE*Ӻ5E##p 1F xF(Gѫ7#`(F,HE٫xO57#`1F F\kE,1F+\*@rxx*m*0*]b*!*!n )P!] ] ] ] ] ] ^ ] ] ] ^ "+F>F, ", ", "+J hxP1 Ս xP1J 7 ,"! 69F`FF0*رBF ѝ "!F,(" +F+F?+%-!XFxF2 + +pG+FpGXxCx + +pG?FpGF FF x; 8` (` /!FF! " F# # " 3H!F`O0%)F (9F0FrHH1F/#<-8h (`}+}-OFFF(BHO=!FP=I:F=H#(FO `$p(FFC(F T8FF(С"HF\(R@$P#c``XF 9@XF6lF0Fh'FXF  #U4BF1F D0D{p4Y$ =!XF^ EBF)FXF(+8F&F(HZB}Fh% i,'#j`Bi,' fj%Uj`B `j # 355-OF1;FFF~+/c--n-{----------0=Hx%0;_ju  - -M-------) 7p   3 - p z  --- # B    0 F $ : P  <-  -#4'-I(FAF{F *F!S(@L"P1\(L6PZL& @# 0F*Fh$+9h 4-#v4%0C0ѻ-40HO5KhB !#*FFF %G #H1O5i (#*F!F0 x+Ij(@% #14%0C 0t-0)Fp"%f4E0%C#0Z*Fp#!FFёIHJ!@.*яHO5>02##%04C#%0-}0*F0#!ZFh~H4R%-040<@1+@7V(FH%@*4%0C0- dI(F40O3%0޺?" F(F  HP +)FSHO5-܇ oB##" F(F& `+ځ)FDHzO5-<1ʁ3v`d1F#8FSBFKFOйPO:BFKF1F8FZA`p4ZKFBF1F8F6()F%H:O5a-|<13v`d1F#8FSBFpKF(O:BFKF1F8FZ(04ZX} Zf}}}g|}}}4%0CS04*F!OO50%Cs04}+xk/!(F\F80/!VF#p*F%FN/#3p(rF)0%#CS0Ĺ#334%0C0-І?" F(F 4 H" +̀)FHlO56*F#7`q09GFHE|(𪀖73ŲD348QD7S%j-,!(FFCx;)FH0O5WB0j90#!EѪHO5 D4%08C077"0B8$#0p "###"#"(FF,#3p,FЎHO5 6 80Fq(!Ѹܪ7#`84 #D3; 84D349P%:D8޸82FKFAF D0;0 F(%̸40Cs0-+x+4+kx4+0CS0+x6+kx6+0CC0hF-?" F(F 4 H +)FKHMO5-40P*Fp%iPm4%0#c#0`4%0#C0U-p &,!(FF(F @F QF@(HO5:>p+F$JAF%60p:F1F0F ?%40C#Cc0)I%lQ%I(F(#%l1I(Fȹ%lQ~-~7~~Q~~Z~p~I(F(#%l1ݿ)F8FF(?p (H%ʿ)Fp%t4%0C0=41#%2𬿺I(F84#%2🿵I(Fz84 #%2𒿯I(Fl(ЭI(Ff04%)FHQO5x4%0#0m4%0CS0b6#30*Fp#0!BFёHK0S%#cC#0>4%0CS034%0#0(4%0#c04%0C30--<1?;3vO:`d1F8FBFKFZ(0BF1FKF8FZ({#P4Sk-<1?3顖O `vd1F0HF:FCFZ(V:F1FCFHFZ~(HPO::FCF1FHFZn(8p4CF:F1FHFZ)-=!(F02HO5`0/I "F(FFH4 0%̀#0n0 BFO5_0%#sC0TI "(FF@4%ЀCBF(?l~Zj~~~~~~I"(FTFh4%ԀBFI"(F>I"(F8`I"(F20I"(F,(]Ѹ4!)Fp"|%@F F0HO5׽O  BFF 0 #;p RFIF 0 #0F;pF( 4Z U 8P2F9F(pJF)F1%𘽆I"(F(FѸ4!})Fp"%~ BF!0?0FF(? O(  4 82F9F^(?)FpBF%J`I"(Fz(^I"(Ft ?k Ob###Or#"@FF4G +?RNHAFO5KI "(F4FF(? P%J /!@FnFRFAF (F@ "##" F0FGb +o-H9FO5Լ#0ϼ)Fp%R \ļ *F(Y/!(F&O3 4"DH1[Z(?fD6% H@#  D&C`D=30Lfoy~ *F(/!(FO3 4"<@1[(? <6% @@#  <&C`P-k40?wX*Fp%6X:4%0CS0/4%0# C0"HO54%0C04%0#04%0C 04%0# 02_@@!00%##C0#2PORC `C :GsP0#S0#T0O3V0OS^04%P-Ӏ<1?1#4Sd6`&k(?Ϫh+/)FHiO5-4T (FT(HO5Py-81 33[hzHO5=f?" F(F  G [`4%0C30I#*F!y( (ܿ#r(ܿ#r(#cr)F^HO5,4%0CC0"4%0#C04%0#04%0C04%0#04%0C04%0#B"Cc0#-6HQFO54%0#C04` d4 ``-кY4h l44p t44 4HO5~$ (4(FF0)FHqO5?"p F (F G F˱)F HWO5~Z<DLpFP(FF#;F:!(FF" +O oH FGF 0HO5;HO5 5=!(FFI(F "FH8F_FNHHO5FFF&I(F F88FFVBF1عHO5I(F Fh8F/F(FO6&FI(F F8FFF(xHO5FuI(F F8FFvF(nHO5FkI(F FC@dH)FZFaI(F FF^I(F Fv[I(F FVXI(F zFUI(F rFfRI(F j(PI(F dFMI(F \FJI(F TFGI(F LF DI(F DF@AI(F <F6>I(F 4F&;I(F ,F8I(F $ FFfw4I(F F1I(F (gFF O,KB+H&v0ո'H/}ѱ)F$HO5€ۀ+-W8wAJ &DjcT\o@tI(F F&I(F F&I(F FfI(F FVI(F F)FHYO58FF#pI(F lб(FF(?+!h1,"[蹝HO5#8F qWFVF+hB?kh+<  ,5EFO %hk#`,##3 36@F|AFFF0F"0!ܪ `%(F9Fк%(F `%-?(FF#;?" F(F  G^,FQ0FFFCFAF@FBF>?OHO5 F(>w*FCF1FMF4"|1ZXP@Hk(F O5F6|Z&xv@3`U`%-?3HO5Y4%6#6x4%0CC0l4%0#30b4%0C#C 0V4%0##0L-?h(FCXh2+ި)FHO59h%h24lFWZˁ4%0C04%0##0 -?%(F0F(#;7FWI(F8DF4HTI(F RI(FPEeghPg`.>KI0F0JI0F(~GG0W%P%e4%0Cs04%0#c04%0#BCs0#4%0CS0-?0#*Fp!CF%HR4%94%0C0y4%0#0o%m6-O<>HAF7PO5J Z-?vh, HO5#L'.3=r-O LFFF F&OY 0@6g.<1H [j+Ѻ HO߹LD9FBF(FjOQ Z}c-OF FFF+D$K"`930#xK<10FTJJKFGBFO ""J)F8Fh"F(Fm00!q"BAB 0 FRPFO $!ss$(,Z-AF F)41+a1+kx1+g"9F0F4P @ T `fd6+c` |hfl6+ch rpft6+cp h|f6+c| ^f6+c TX P(FA K I1Y7(F @' ;1Y7(F 2'"F8FhF(Km T"0F,6,d6;d60F,6"l6;l60F,6t6;t6ph6 6;60F,66;6-O=FF I2 KF@HHF =4'I 0B Cc0#-sO3`6C6hN#[B0C0B0CS0P0Cc0M#C!D#F#"A f#BbC3BC# 0C 0 C #+00Or#1( m<1i,! `kHjIO2? dIfH^#d6cOO   t (P`6FhvO, `2d6d2l6 pBhh% pvO, t6 pB]p &#h6l6l"&p6t6p"66O300FXC =0!3I6H 9F}tF  c JF!0F+FfF8D Bx + +<\+55D<[OsB0 D",0JF0F% U[  /F3`pa'`b;SCkI }F  +0/FeIXF(m (YкIQF%'  (++@IF0F #`QF ^ 8D Bx + +<\+O9-#=F#C"rC#d"h1ZF 6H%wh dqE'(7dq-IXF8+ (F'IXFp+ (F%F(I|C3IXF(?s/p JFQF0F[FTb[ 0"r #C00HF#0";Sp`}0B`pG pGB pG pGO0pG-GFKxF FCpFL6E  *FB8B8 (DE٨!GVEEҨ9F(FG @-A FOmF/K!JHnVmK!JllB38F^F0FZEиO0ooR+xlsl 0B`+ >`R8F"(FFhF8(F!Fh F P FkFFC 2FFC hFC C F!F:FAhFBHkoZco[9F0F7FF˿8FMph$p8@ `FtoF F12KOq1J2H<" F8?<"F0F0FLamFQ 1co[>#H*F!I!H*F% FH&H*FH*FbofHK*FH*FHs K*F H*F{`Rڅ8_ #F0K@[JH<p p@`R80KOqJH$u"F(FhFHF(Fh"! F F(Hh F8`R0KOqJH!K@JAe{aRF8F0K@JHhF!F(F8FaRF0 K@ J HCm@ lh@p{aRF Fq0K@3JHpBK@5J"(FFh&F"!F(Fh F6cxBД90B(F!FhZ Fh@ڿW-aRFF F1[K@ZJ[H&Kmj*Y030UTH)FTK,FJ,f)F8FgF(CoMkoJբooBw&)F s0~Ѩh+BHP!F e0nѨxh+i0F!FhFh6!FgBШ#`PF FXX(!Fg,(bmCmB88w(г(Ѯ(Fl0ѨhV+AHyv"!0FgF 7O%"FgF(?%!Fg!F0FgBШ`8FQ F#N#!"!F0FgxcxBF+:є90BЫ!F0Fg!FgHcm0+30#RSOQBB!FHF!F /0 ѨBh+Ш<h+PF FDFLa`\aچ ea(K;!J HCx+Ш/#`  a(KQ!J HnCx+Ш/#`  a( K}! J HTCxc+@h@ /#`  aF( K! J H4@x((XhCXBXA/#` aF( K! J H@x0(XhKXBXA/#` a-AFF F1K@mJH"KOqJCx#F p F+сyIC1F FJv0$@yF"F8DA83F"F)hxAIaU]8 FF0K@JH!KOqJCxKx`xkxB*x#xB(F(: *(") D8@# F,((F'( 8 eaqpF(&K!&J'HhCx+Ch+O1 ,"@:@B Ш#O4` Fp/#FN3x+P!FC C #0#3p(Fs K@'J0pa'}FCx F+0#p|,%F!%u*F78F! OH2!"r=x0F#;pvBKOqJHn/#`O0bBXSB"{U=p 'a0 KOq J H!K@JOs hC`a8LMT8(Fb-FF F'PC;0! P wwPD3KO 3LO hB'0K'0LO O hB4 P")h `VF P̳`O0T;;>+٨7Y  Q@,CA@+٨7Y  Q@,CA@<\Y8YTYXY3FRCF)F |80O4 F0@pGF FFjOV?  *F9F FCćFF F&B<K!J +*ќBx*K!JH6 1B q"Y({z<FC{B"`)C+ 0bʇއ-O {FAFF,@qpGxF( 3h81Y@;I:F F^008FIĐ(I8FF I8FFI8FFI8FFI8FF`I8FF0I8F%+@ƀ3h81Z׀ FI:0[TJJ 0𨀳l+JI+ FI F0rl FI0𐀖L F~I0rj F{I0!0FwIF F0tЖL03oOr!M0mI F0^Жt0+@3h8!PAǁcIg3hx1@^I F40I  FT0;Kl*?+9I FG0$-?&@61+@Y F@ FYCF@R%H'J"'It F0_ 0+CiSNooop].rYo~q/pmʈLa߈!?GXbebrWԈXFF(?iB`"FgZE T FxI 2H0?P"YFtJ FrI<0DqI8F$(|oI8F(vmI8F(pkI8F(jiI8F (?fI8F(`-?`K`J)FFF^I Fn0? \I:F Ff0?0F%(F>0hA%(F?0QI FO0?- ? 0+?0+? FEI2F0?Ϯ F@I3!B06O:F5O3J8I F0Ѵ3hx1hG%*2I F 0Ѧ8F%(Fh F*I2F0?! F%I 0ъ-9F F50?1ZY*Ѧ O%CF@F(?k F'eiNoo]op/q"~48F h(FCF F8@H8FFF **ѳlZ#JI+ F1F(FO40$/0cZiRlB}1F(F0O4 FJ$$4]oopF pE< NB"1F F4 Fo F40D#`O08-AFhF1AT1F:F(FAFHch0B*2F)F(dh5)FlDi F)F{FDi`/#pFhF FԦ#`O0Fx+Ѓ)F1x+x:MA8А"! Fh FcgdhZ \c+cxcwh Kx+ыyoC@ghXB+kgxR`ecm ph8-h0F9Lx+Ц#Ix`e(-AFxFvuE5|2E xAFx29FD:xFF.8x2F!DV|2 +D|2%O0PF F D !F"  C2"9F (I ~@@u ,٦7#`O4 "F(F F/i pG pG pG.J0FQhhz pFO00"$I" F3#OBOq#0IH5#@"#Oq0IH# #""!|0 H"! (`0IH 0"lɋ܋8FQ(hC((F@#x18@7pF>`ư FBЦ O5#`(FFpOr!hFp "hFOCdOS02F)FD`#hjFIOsh> *FD#hIjFOshiiF=`LT  ( 4l1 KOq J HKh++L@B O0TlCjFАlCXBXApGM FhBF##gD#M00PF" FhFM    jF I$B + ")F FsCXBXA 0 8i(0PFT ["!C C"!FI +0 :i-CF<]F1K@!JHxKm#KO-q~J}K@!yJOb!8 F`#pHF1p31caso`#`-F= hB`hC`FHFxsmXihC`hC `hC`h/Cso`oDCc`2#j"cC#b#cchP .]5xB Xh1FB ORXC X`*Fsmi"0-W=E5.Dh /N /F 5ǜhY 1F(F:Fb/K?G7=Dh F 5Ϭh 1F(FXo2FD膳>F65D*"!F0O0 <]Cv%IFp(F:F/?G7=D''&{_lW-C$"#BFF!"F#!4D0O4 F/(QF(FD!CF(F,FDExE Ҧ#`(FO4##DEӣh@/ "F0F,F Hl "IF8FeEHF3#DFhlp FIiPF"hFQ kM     h-Os000h "i 0 IIK-F@#jF0Fpi@ih5|2FcPC #0%C |2""!x2Z-GmOb6FBF$ (н B Ц #`O4 F m0+ѝ0+π+++w*<,60FW0@πhV<O4+*(+ʀ9C ѽxF(н 9> :0Н0+jjԩlB(FKx+++Kh #Zx* [h#  #Zx* [h#P 5" C )FF     OsX0;hCI00yѦbh+Ц\h1+;I;H&0+H;"0F+Fy8(00;+" O1 !0FYF"(x6F(?:q8F F(?8@/:1:B00+ xM N0 D(F)#J0+i@rl  KF#!3 F|l+  pG+#`$`V#` F+ F#` F$`V#`FF+I"O0pGl-G%FF )FF"PP! F(c`3I3HT``0ؐ+FJF !xQF5B``0ѥ`h+`hB$IjF 0 нP-ѽ0cH)`hCL F$c' " I`h 0I`h0AF FG(I`h0 a3`( F.@AqB@UlBpBfB@J-OhFFFO#`eiU`hCF+FhsD Fh2RJEFeFhai rDB- B hFYF(F!hB`YFJF0F5iUD%DciaB!hC`?HF"O9!jFI`]gBh-AFذF+("L5FŔ x"hш4(O3jF!8F,I#6*\#`O0X4("O31F,#8F"lB0h%-O5P*PI !P @"@h 0!F@hh3 F@.!Fw0O0! Fn0I`h0O0 ~B FVű.إ#`  `(Fmx` hB٥"#(F#;`BhhB9`3,1@pGpGpڱh!MDBo) xD`@@CpF0k3D@mShYhmq#e@!nK h nO3#f03FT F@n8F0P30,Ր>0+(D&0ke#hx1h8B0YmkmB Rh>0+  H8@ 2030ԍhepF F OqF0`X+ha K0#h+0#pOpp@B0 0cSc-OFðĐF!PFF#F3fѦH ; {hVOqpF(d0 `ñ*.h( B "JBљh ћh`#+p(0> kpS+ *p00hs.0..Ѐ#k q"?q瀀(OqPF0oH LOs..Tzhsh`ȂbH$@/D,DB ..dЙhBк*@@2C0$00#)@F@5$p$DB.Ѓ<0k<,@v6#p#q<0 0.q;+8##p#cp4KS BB 4(1x:3BM=#;( F x2(1x0D+.&јW0923:B*<#;"1 F120D...D.A#;`#COp#Fn礌cSc+.ћ843:B+#;8$1 F81280D..L.|0 ;+@ˁ2##p#cp04D<0;+@3##p#cp  +@dF7#;#0",2B;O`6,3d&rEc 3FR(? R, #ɲў0BОP .Ѡ:)ټBc ,232x,B&ДBFS( S,#Ҳ|BАPB .ѡ:*ټB0,3 ;03ИW0;+@9##p#cp4$ 73+?Y ?3:BM#;7#1 F7270D081Ԙ0՘Z0 :*@ր"FP!cpFBF!92FsH!0:BQ#`p#pЙ2 Cpa#p#q+XF .%.4.2Ј #0Y(Т;FB#F !YF`pF* F0Z ՘^0;+mt#fp#p4l953:B`ء#;9%1 F9290D6+?:_`4;+A|##p#cpx |66B\FX, B%cx3D+ H (FO0 +XFX!6cxX,3DDcp0;H OpیsF`m pI"Fe蹥h+KHh^03 " O0I H=.h" KAh@0HI- F9 TmC #o-OFF *إB#EKBХ8V#$` F%,F+F/F*F,lB  `+_!FF BF˼PмQF BБ Eؼ4ѻxGaE]DԱB)F2DF!FFDZF+2F,ѥ#`~F|cSc FFF0Z0#x #pO0#`] `FFi0.H.KBBAPBFѥ|h+%Hi B&9i  H"F(hBC!F(FJ H5(h81E[ 5# #F0P FW8` H "F>0F ] h!C1amG FFF08+h #`O0 FFF0H+h? ` O0 FFF2AK@rQ@JAHZ0 bihh1#` L *: b`)\С`3# *F3F8FO3`:#*F3F8F##a;#*F3F8F#ca6#*F3F8F{#a!F) K@QJhc`i`#!*F3F8F`0 h``#*F3F8FQ02c_lmm8#FxTpoF(2F)FZ#U FpF4F-OFɰFTI@FRFF$(d(hZFQFF(mС1F@F@EH0FIO=Or3Fc0F46#RF[F(h4# RF[F 5FU N0#0,0+A.@ѝ0-N=@#+JOq8F ,0G\$ICF*FHFhGLF(HI$G>ICF*FFHF F~;hNdG*ICF*F`HFNG`積vm@э-OF%M F%NFURFO, ,52, B%p%B&F,ѽ0F U,XB 3BU,XFU ,FHF6,5#T ,@FT,5F0Fmލ*-OFFؤ.#`) FB1F y0 B O #DBҤ "#1F y0O0*O!FZF\DGlCFIFF0F0T G`QFF0F09q*FF Mؤ#` . F]Ḵ,Ѫ(OchG69FF0F0&-=1F(FyZ +F@Ae0 I0F0 M#`1F y<0O0eF02S0[ h# +@F0-OFF+]hPp_0M՗o0 0hZF#IFF(@AT0@ƀ%P0a0hZF#IFF(VR "EL0FF(ˀT;  89FPF"(50hZFy#IFF(|K+%%B700h0  pHX0Cc0(F ; +٤#` O DBҤ"#0F3F(?p# 0!F  O3D T; @F 3#t0/ * 8%AFPF(%# 0hZF!#IFF(?.)CE$  X, *0FFO5w BB BO2! !"bgk(@AO&`A@O& B!CY 0 F  8!FPF+(5o@Op@ F*K8_-O}F0`FFF '4# h*F[FO' 0'd _ѕl0+@𸀕,0+@̀#hOO, #h 2CE׀0OO, 3`0 3d6CEǀ#hOO, l#h p"BE2, #3, h`2B 0 Od6CE @FGI:FF0F0O0 }# h [F*F%0# I:FF0F0# h [F*F0 (i@G{I:FF0F0b@F GtI:FF0F0Ѽ h GmI:FF0Fp0ѭ'0?C#Or@! lCbI :F0FW0/'0?.[J@#@! ,*WI :F0F>0zRM(H5Y,< "P @BO, dBA 0 ZF)FZF   h8J1F:FY,,}* *!F 1F: 'J:F h , 3 ZsE20 PB hZF)Fh0:F1FK h  , 'K9`x@q 8FP5 F#d8p"$IF CF&#2FOq80 FO4 Fp"! F(0OBOq F0PC #0OC0 +h" F 00-G&@Fh$ hdciciai#bhca#ifa8#IF(F0 $`jGFRF1FFHRFIF(F.(#`fh0(F8120C@iKaii iB.(F`n0VCF fk&H;(FG̾"K#h+ !K!K!bk KK!kK!"k #H1FkN܎&e<mÏʏяu ׏(F7(u<1 H!{" K0IHG¼o} m#o-AF@F "hJ(h+F"!A[030%v! *e!F #(hAi;k(Fcik`jF2 F)HT(FD2F!(FK(h+F"!&$h&`ifcidaif#b03 R(Fi#3(Fcb0A30!a"0?9F(Fcfh0.-OF`@FF*V4(E3 3[hHդJsmH#:F)F2BF"Жh@vO:O (F0 AFF(@𺀑H 2(hKF!oxB3Zh*ѷKls#dOzxlO``zx(F(3 3[hoJzrHrzgjz smR[@+@#xB3Zh*cKsn+$"F(F@(?}$?w<>к??rVJ@+h *OB OB  "  '" ""F 0T>H 36O:3F:F0`"br5JAFba" ` FE""p`Op@""r!"t` FuOrbmCF"FOaF FD6 H h4+1+?+h81I(F#(h+F"!O 7+?`HNmkzDCDCĐѐJ! Fp&P>`5j h#F"1FPh0 T6K h1FK 0# q F(1FF HL F@sH C1F JJg ֐H8 PFHFh# F3d8@J!i 8FP+h;+h#F J!hjF FH# F+`# Fd8@8u <J! p PF1FH1Fk*kH hJ#!+`#F#c Fd0p@30!a"0Uyi J!= FP`6h# 3F F(C0H #h81T,I Fd@6 F2F9FfH#h812  H@9F FS!2F9F 2F9F(a FC0K@6!JH  #hf+` x(ah F3 F#$ F@đ͑mmJ!"Q -CF` F hhiBrjBY0F(h3Y {FIFF'H9 hiі@ ! F)F" FF!%F#F"!I FdgN#"B#"R RC#h!(F h"!Kt%Gp 0Fh812=#F!Phih" F~iZ'#+`# F Fe 0i FQFF FHh F 0@8F0P3 F<Fȹ HJI Fd8@ҽ n(aH F8@ 28đ-GF`6{h@hN233C23 GBFѼH(G("K.0ѴIH<1 23ѱI" 0PmOq (ǀO3`fP#"!i +`KPFd#+e#FH90 hQF(*#(10nԙ#*F PF((1RF0b#Cj((f# F}H]P OqhL {h] F(G#ht ((>  (1"Zp(1  #h(\0>_(ీ*"(1Zp(> 0>)*#+ FHHHH6HH (G.xX F(GN3X  Fh(a+iBF FFhaEzhrX+@!H{h#+k3 hiF(@?? *k arEw H h#3kb+ckkDkckDcn #o0o"8 nLZcScЁ0CE@π0ȀP-ɀ+h+ŀ`#+`6d0C F8[H (GEp?ܮw;C hjF FPH100+h+0CE@hjF FEH F h#F:F!c0:CЕ@ r h9K ! F(G h2K#iaE{h_#3h*:$+i FAF:#@0kiAF( FFбHF6ha(?hJF+i!dah0Ch0 hthK B?ޮ!#3h+* F(G(Npw cSc8 PF H Fh0 FCh0#d8@8 0FP33[hHxh0Ch0# Fd8@̺H FI hiIGp@Ա#hñ10sdnDhB#I]K]KpGGp-OF#F xFPF+ HhkmBCF:F1F FV%> **(#j+ :D6۹#+`0ӀvI3F"F x#+e+iBhJ8F=`h:F1F/a&"@ h#F! F6# h<;F2F(Ѭ3FZI"F x+iBh8F F`(RHh:F1F/a hO 81 ikiGI Faid+bhka+ia#hYF~m+?lhB`f#F9J!< 0#0" h!`02/K  FFO 0+?a+'I3F"FxO +#I3F"Fx+h+=0 # h:FP#1F%(,I3F"FxF#0/E FH+r s8nN 9 @Rc*-AFFFF hE "FFHABCB0hE "FF H+OOBF|3F9F(FA̔-OFHhF9FY ; \ FFx1hB0۱hʱ[mBє> **XFX IFPFVCF:F)F FUdh-CF FFFB HI HH+F C-! F*Fn-j'x@+ebz*b`B]+XBT T'  (DDBAӽO<!i F F  h")T'ýPp!F`p8FFHFB E F H `o"x!D@F:&nA`p)`]F FmIHh#`hBBiF FAF3hCH  I(F ]phiF(F)`.m,2nnCp" hh* p@ H0++p@m++p@p?n0!]PF FO PX`` C   a` X`` Ba`O0YaIHj0n "F@C HM !] 0 FLnn FFh F!8F@5|i{`ixhu(q Fn,hx1h K z@O32Bн6O32J#38 h*[h7FP50d00>0)3 (B" "* * BRB" 0!DB 0#c C F0@S)B"BbO`>z  F Hgjz S0+A h*FK!0zD}M 8FP#Fh!J Eh0+ h!8@8M -OFLiPͱ)h(knB  [H FJ# FXIkf F0F(ѳiZA)hñihBE FKH030w F@3 *0r!+h ++ F* F\030s;C F(&Ci/ki akia+cj$'O FO /  Bji1i2Fx(њ2@*٢7/K! hd=l FbXx0DpqGp•pG"Fв2[B F*pF٢#`O0p&F`!=dB*F"tDU0FF(@CO `@@O#oCF#OsXhHh hBhhB0hJI Fh@Bhx1h F" F(dhx1h F h[h hhb@h"Bhx1h F h[h hib@h"BhHh0+@n8 pG pG@ 2O0 ciPiӱ(Дhh *ñ( J0B O0( *XBXAFcScx1-OhF(O5#jpcj YFaJFIF0FaF(@րdh;h+їh0+{n3KOqJHYFa{nh+ FF(O@FznoCg2@!{nh#)F90"F00a\("F00aPF(Scj%00 FF(#yn81ynX1)FH FF"FaF(?b)FaZoynxXCXgX)F0FaB+(F8( h/F(?f")F!F@FQ #AF|0")F!Ft0Jfkx+(Fh88FF0FF0FaF")F UE9FPFd(<  $B +  ЙB"QF爹h BZ`8F<" F+H@ FF(?Co<CCg iFO3iF8 Fdg11X"!0FaRFHAF0FaAFmEE9F0Fg"!a>F(9Fa~YBYnNLaĠ?j0aj3 ZhՈh BZ`8F<"y FH`4 F((HOŹ Ga`2h`"a` B``3h`D^F0h% FJ! 3hhBѹ0#aai#a0;3!FRF(F-F- FOлn0-GFh O Աi'h.hxd! RF4CF0F?'-AFMh3б+i( P/iF8@oi?B8GD8FFB`Ѯa>Da F0 )j"F D$!F(Шa Da'8? M$?ii#DBӨiDa8 F( '𵇰FM$0+DLEKEH&hFFG&hAKCJCIDHG&CJCK%)FAIBJ/z( F@HAI&h/F?HG*>J?K))F=I=J(p( F;H" (7HV[-OKMD+lD(#XC00F(zEI0_.h$4FO bkB"O(xO 2( DB(O(xO 2( D*lDB.8F@FYFH_t 1F04(F4YF_^k01F+k4F30|F4YF_H201FDjkF#D40aF KhKIFG+z klh'P z`p$NjulB(hpU$0LE$4'K[lhpG'-O$MLH@"!pO Mh8F##,#z0#b^(3#b `O3d𓀹HOb9F*C#;T>Fs?+@  ѠH`$0nH}0'-GF9OFF=il @#i@"#aO3D  0 0&0"rnB 030Da`{nBO jHiDaVaciiB !F@F_zi!F@Fca_6iB#ia{h!F0_h&0K,yi,@yi FG'0$BKlD0v44'KpiB lC@.j& DBЛ@ DhXipi@l_.i'Jpil  @@@"iuBeO4 D0Da bTi Dap2'-AF`O;iB lCh@% P%DB}]@ DhBFZ! F2{j3Ѹ&GKD0@@*iC P+a"iCakii3kaB-:hB##;`i)F0FAO2K#/@4 -JO@`C@ AF+8)F_l+9hB=`BKi+8_8)FAMP@*FZ!n*F!Fl^TFFl_8%0#"iZ!hV0@#`'P-CF>MkiBki3DB*n1F F(Hh3/$ F"F _F/"9FHFh_9FFHF_0p;`oB0B F"1FFGF f+i@FB<ciKE*Fdh$h ?щE l@D9F FN FE8FBҢiBFa DjT,!F^ nl@pi!F(#XO0ab'-CFVMkmBmB)F($ F*O3D044D90!FHF0;0FmOG 2B(FF@0B?:F IFH^,%0[B Ҫ`Z!," *0+нB!`)@t Kh K IFG (FF #`~6 ''F K'0CH "#3, F@*'~6йpGpGpGHpG HpG K0h3pG!K0h3pG!K0h3ppG!K0h3pG!K0h3pG!K0h3pG!K0h3pG!K0h3`pG!K0h3 pG!K0h3@pG!K0h3pG!K0h3ppG!9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpG(!6ghF;+`ڌiB (]K" h\ `p]KpGipFN$V4(F Fp4 , K +KKhG pGF0 S pG0pGhxK0h@ pGR0O0pG!XK0h30o O0pG!@FFR;BpGFpGFZ FK0h3pG!K0h3pG!7Fx M K*F2hLI+F"FH|"0L%F<7!(9 xH+ pG pGHpG, JK3(FFpGUF ;A,A 0, 3۲B(O0 KhBKhS HpG ![KhBKhS HpGT!ppGpG pG F H0 I FqHh IFH|I sV@H!R]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBО&#` I)mF`JF 'h"EhFhB x46@d(ݚh J" L` x209*( "`!D'FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00Z]h;iP!0xCC@!0pGh`K3pGD'Fh FF2BY!QB i"1FO F !@i=C"iYaB#PK}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhF#i(i(LP&`S+B2C,ZjB2ZbBѪicC"DD+iQ-AFZSBF FSA'0ip0iF FG2BҔtu(J)8YB;x\*GZx|*D0iF FGhKiBѣh #`t0+]Дu!bh#hpB5 bE1ٓ\,ѓ|'31#`x|*xBoiF FG3)YBxB[xBBٓ|3i)ѝᱚB! Ft0+  FiRiOA Fc Fi DOA!3OAi Fi FSRi"OA F3=D'F%N FF3h+ Os#B-#@\ CTkK52hh* Op 30B#@\ CTKh30B#@b\CcTj"j1Oz 8F !@[jbZb P(!!!-AF5hBhB,xB lx], On{9Fa2+FROA F;F" FiOA FR)F FRA"OA FOi" F95"OA F@AV+FrOA F?iOA FR2i)F FR"OA F&i" F9 "OA Fi2F FQ&Fz2OAR+F F^iOAR)F F=>?Fe)F F5>F^ F!@pFN$V4)F$4 p , )KQ<GFpGF)K Fh+ Os#B%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6(!!!-OFhBhOkB"I(F|FPOA F_#h3#`"I(F|FO A#j@"hh1OV( ! FO7#j!h`j`@"(F#jiD#c2Bx^)3#`#c#hB x]*3)F F#`l-*fN1Bx]* XB-*[x]+, `)F FR2Bph+WK3m-*[*сBZx:*=* F1BF؀:F)F F+ ! F3#`Bأh #`f#hx-+]+ѣh #`f;Kh"hBx300 W/ ! F#Bӣh #`f2BFYBCx:*@Zx]*=3#`z2"`:F '|F(0+ Os#Eij"(j1Ovh !QFXF ZF)F F7kj(bZjb h #`f8D'!(!3#`Bأh #`f#hx-+]+ѣh #`f=! F)FF Fu#Bӣh #`f2B YBx=*Zx]*?yh+#x-*$ZB Yx])?"`-& FFWE?0+5WEݣh #`f0+ Os#B ںE:F7)F F!?3#`Eik"(k1O !kk(c #p3kcQF8F(ݣh #`fO YF8Fw( QFXFq()F F  vZ"`x]+􊮣h+#k>#jiBkxCkp/K h+F O|O gE6+j+?kk+(j>D@"!(FBܭ"jh;`#`:0\ AB3F#jO@Q FhO(!j FpFi(KI h1!I h10Be F#`]#0#0 c` ue pIOQ F p@۹!!!h-AS`Fxi\-@BhBӃh #`K3#hZ"`x@)GuB`[-*-.-𗀣h+@ۀ#hՠo( F"jOA Fl_d /:Fb2B YBx\*[x)+)"\! F /OA Fid:Fd2BYB@x\*@Zx)*@3#`Z.ܵ#ڵݧ0Wt<+BFO`Q F6WWt, F1jBFOA F(#j"Zd.w"OAU@{Bn ! F #jiD F#` c`^#0 #0]#0#00BF*)I"`3FiOA F25iOA FiOA F23F%iOA F O Q F"O Ah #`/K3!! F i+?h #`&K3!Bb\)`Zx{*]3 F#`1BF0x,*-Z"`B+J[xh320Z# FBFݢh "`J"*F1F F2BYBx\)Yx}) 3#`+FOsD'!!`#hB YBx\([x}+ ! F)РoFp FA"OA F:"O A! FG{+| F2BFx,*~Z"`J[xh320Zv FBFݢh "`J"*F1F F2Bex})b3#`ID'!i3FOA F2iOA FiOA3F2 FiOA F$iOA3F F2iOAi3FOA F2iOA Fii1F FO"OA F]i" F9C"OA+FOs3#`#hBx}) ! F9h #`K3D'+-O" FFFG ЅhB@mL F KB FF%!U&0 F P"1F=DV t0xЙKu`!6"O5OahF"" " R""+Dag#B #K32BQ"OahF"KaaaN``( !hFc`@chIFMFOF NF0XFP xC@_:Kس_€-سo𽀳_׀kB)>Fc#k!cO1#u0]K]K ]K!ZhFxP*F)FhFF_ _kB@)c#k>FD!c)F)1OسOسO xJok-@O3#c%O^гOOXJسOFXF*xJ xCOEгOBгO#jC#bk-@@ !@`cprC_Bjk@!0;!(FF(^Ѧc`k(N#cc0O pB OгOGkB)c!#kD!c)F>FTUUQ= D': . - 8Oг@O-_F5m))D%h!c))DRhbcdV+xG_+B%u#CU~AF!(Fbc0Fj#:@#3B+F*FWWB9`:`B2V# B+ "F'0Bj\E;:FP#B@#@# V#09h3EGGB7ӝB0F`h"F0PxAO5бO4бo#jC#bME##`#ld @0Oe#0#j[!hF@FN #BV" k+?+"3B8F; F)K Fh+ Os#B%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6(!!!8FK Fh+) k\A`@8kӱ K4(F$h3(K(Fh3w8 8@o(!!!-OF-F̴ FzBؠE🀜)hO NhV#xBOF ز _ ز_𸀲_ʀ_}"@_B" *@KF0O-ز O(OOjiB[!xJ0  _)P*iBjhhBFJ0 >_);8O@O*iB!xJ0  _)6liirB0 @*@_.Ѧ_ B !xN0(@𤀡_qBqAB E$ F+BE4"wEh("h*iBjh?ajiBjh*iBjh?QhBjiB, * iԸjiBд"xjiB*&xr<_.@\*iBjh?&hB < Ѿ_ . i jh*iB} H2 _)?n(l_.h*?O"R!]jiB]"x * i Q0)M_*D3 "xBDV# xAOK&xFhO ???,Q Ѻd ?!FBDB?hJFD FD(FFR# 3BLDFBF!F(FzKFK&xFDi7C'@iS' B?x!FC'@&xC(FBFz+(F;&xFDKFBF!F(Fz(+hYhQ& xBO? Dr ^h&xFDQ&0xCO>h&xFh!FO(F2BFzKFF(hD*hRhR#`xBO?{ زOвOв`_?9LsOвOвOѫh&xFh(FOC BFq`!FzKFF(NhDH .Į]!-O%0F @ (FFFVE FP& xCO4<س`_0!س_}س_gг_t6m _|г@_Ѹ AF(WO سOгOcгOHOгO OJسO سOeгO #lOгO8O0س(Oг0O+@O EDC+x,xL% DC B$ Dh!B?e>% @^,xLDC CR!xA DP!xNO3 ,xLDC P#0xCO?4 L,-OFF\0F YFjk # 0o(hF)FhPE(iPEhh@L ( F "hiPE""O6`*BRF ,}(hi } .FOFr@hh~(hoojaD|hhyO qhh\I  9YF(hyFѸla](9YF(heFlJahrg?0p/@_ D w0(vѦ_xBxAB{o9YF(h6FoO4bghh(ho$ .(hibO OGFO OFDJ h0_,r _);8O@O*iB!xJ0  _)6liirB0 @*@_.Ѧ_ B !xN0(@𤀡_qBqAB E$ F+BE4"wEh ("h*iBjh?ajiBjh*iBjh?QhBjiB, * iԸjiBд"xjiB*&xr<_.@\*iBjh?&hB < Ѿ_ . i jh*iB} H2 _)?n(l_.h*?O"R!]jiB]"x * i Q0)M_*D3 "xBDV# xAOK&xFhO ???,Q Ѻd ?!FBDB?hJFD FT(FFR# 3BLDFBF!F(FzKFK&xFDi7C'@iS' B?x!FC'@&xC(FBFz+(F;&xFDKFBF!F(Fz(+hYhQ& xBO? Dr ^h&xFDQ&0xCO>h&xFh!FO(F2BFzKFF(hD*hRhR#`xBO?{ زOвOв`_?9LsOвOвOѫh&xFh(FOC BFq`!FzKFF(NhDH .Į]!-OF0F F )F F_E F\'0xAOACر`_3$ر_ ر_sб_75 _𙀱@_ѹ IF(ZO رOбOбOa]LOбO`]id OZرO رOOa]) O!бO-8OBر(Oб0O )@O a]E]CU?&\1C!Tx )?qlif\0C`Td+?a[]#xN`]CUa]]CU(M)?J?=FD]`]CU#xND`]C6hf]!\1C!T&xF0D>\&`xNOn0Dhf]#xN!\1C!TQ xAO-OFF\0F ! 2Bkk hFRix"YF F"o hF:"hFRihRE"iREbh@\"biRE""O6`b"hF Ri (SF -y"hi y .FOFq}bhz"hoojhDxbhuO pbh\I  9YF hLFѺfhY*9YF h8FsJhhqƀi 2){ѥ_}B}Aq2 *rѦ_BBBABxo9YF h FlO5fjbh"ho$ ."hijO OGFO OFLIj h1 _-q FIr h1 _.oj?Jhj1 _-r?zr1 *r_.oloof%"12)3_.\"*:"hF Wi:F h E* :F F"h RiF5F YF hoDFq12 *_-3a+x  !-OFFF FO B F3hO XhP%0xBOвO"вO!#xG/DO N5ز@_Hز_Dв _A]F!xADP'xLO/F/FOBF+F!F0F BF[FFF0FEE 2O𙀲OPвOѱh#xChJQX`4BF+F!F0FBF[FFF0FE 25JF!F0F+Fz0+FJF!F0F_LFk%FJF!F0FzB%F"F)FFBF+F!F0FBF[FFF0FEz2hk=RhR "xBD:F!F0FZB2hiRhR!P%xE DR% xBO=!F:F0F_);8O@O*iB!xJ0  _)6liirB0 @*@_.Ѧ_ B !xN0(@𤀡_qBqAB E$ F+BE4"wEhH("h*iBjh?ajiBjh*iBjh?QhBjiB, * iԸjiBд"xjiB*&xr<_.@\*iBjh?&hB < Ѿ_ . i jh*iB} H2 _)?n(l_.h*?O"R!]jiB]"x * i Q0)M_*D3 "xBDV# xAOK&xFhO ???,Q Ѻd ?!FBDB?hJFD F(FFR# 3BLDFBF!F(FzKFK&xFDi7C'@iS' B?x!FC'@&xC(FBFz+(F;&xFDKFBF!F(Fz(+hYhQ& xBO? Dr ^h&xFDQ&0xCO>h&xFh!FO(F2BFzKFF(hD*hRhR#`xBO?{ زOвOв`_?9LsOвOвOѫh&xFh(FOC BFq`!FzKFF(NhDH .Į]!-OF-Oe"Fh&B@hME"!hB@&j@Ii h i)"i@\*'++hh  Ej)bk*8k8DEv٘0R#0+n= B@ɃB!bi  ;@(!#DDDd!d#kBۨE8FO RFYFKF({cl+O RFKFFh3F qDqE&~3 xB kB@F(КEF[FF~/cl+C 3 l0 &` 3l"Bb blcCe ZFKFFYE 2 KF>F(F KF(O/Or2Os$ " lB)  8 eF(B =92(!lX#3 ZFKFa+0(pai*' )F+v+hh  Ej)bk*8k8DE`٘0R#0+X= B@xB #+ @33#k+ۨE8FO RFYFKF_(cl+LO RFKFLFh3F DqE3 xB kB@F(КEFћ[FF/cl+Q 3 l0S s & UQ0F 3l"BZ blcCZ ZFKF]FYÉ 2 KFF(F KFG(//Or2Os$ " lB)  8 eF(Bю2lX#3 ZFKF+0(nFFm++hh  EBj)bk*8k; Et٘0R#0+l=   B@@B! @;u(!DD#DF#k+ۨE8FO RFYFKF(րcl+? O RFKFFh3pF sDqEZ3 xB kB@F < (КEF@[FF/cl+D 3 l0 +?Y 3l"B[ blcC[ ZFKF蹀FYE 2 KF1F(F KF(/?/Or2Oss$ " lB)  8 eF(BW2lX#3 ZFKFx+0t(FF6&$ &"&  i[\#0R B,DD [\#0R B,DDf [\#0R B,DDpGpG pG wF pGpG pGpG8#MF`+x %`8Oq(FX( P'7FM+xD 0(%`P'Fhx[<@(/! FR8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!HHHqP'i ( pG pGO-$MPpL0WH0` ` ) I)Ad@P0`0@P@PT0030#W00S 0XZ0*9# 0   0 XWp  p@ $Ѝ 0rXd 0jX 0eX@pPp `L  0 P@0g@ $Ѝ\(O@`d@PX87@-PQM@(p,` U00 V Sp0`sЍpw`Sp 0E`e-00Ѝ r000 rp`00VO-M0hw@0h[ PA  !YAZKW  ! !X%     V<      h  X  WЍVY PZ, P    Z     WЍ P  [   W PX PV P PЍOW6P6X6 6065655X5P5(5(544O-@QMĄ00R㸤 p000 `P 0400ʷP R nR a BRrMT1   oRl bPM Ѝ  bPY U000T000 bP[Y U070T070P bPY U000T000 wbPYU000T000 fbPYT000U000{ UbPYN U080T080j r@ @bPY9  7bP  1bP  +bP_YK U080T080@ bPp  bP  bPJY8 U000T000$T080U080T000U000T070U070 T000U000 ЍT080U080T000U000l aP T aP 44`4T3322$2111p11001//C-PdM0@Hp>S@` G@@@@ `$`(`,` 7"`0P! @3@0 p@$ 0 vfp@ cfp@  p@`}f  ``fwf`uf PofPdЍjf00lŸO-1MM @!`D0< "( p C.F DP1pW;@D8 (@0Sn ȡp ıp Q00$ P %0!pt0p@ !0  0SP 0S Rf@001ݍЍf0S PEPU R Pdp 0s8D<4! @P 0 00 R 0(0h,RhL gH@1ݍЍ..@.---0@-M 0P Qp@ p@ P 0 0/Ѝ0* Ѝ0A-@@`v. PP0P 0pp pG`p 0p0e`Vp we``p`p0p0ke 00}tp@-@PCM4 /;P6 @@p@% ` POe000u5 9 C>P@0FF0 0 4EP@X0S@ VS 00 SCލp|@@0Se@0P`0` @0 < P@1:e@?00@e0@0r))p@-MQM@P4SZ TE /:PB QP0s* _PQa P0`VpQ @ 0@\qpH L pA ۍЍp)0si/%@@110p" +od@P0 @0 3< P@1:d@?00p04@d0#S/p@ d00d@PdP\r{rzq$,zm>BRf `VPm PY C@FP Q X ^P  Q00 R pp!@]P QD]P h ,B,@cN]P QB@M  Q ]P  I0.S000S00;0S U@ 0sS9 TAT@sN]P Q0S0p0 A @N]P Q .S0 0SQ0 z]P QA n]P\ Qs0 0  |"Hl!x! !ȱ L dA-@PU 7UP7UP!A`FMFqP ``DP 0!Eq1pP 02PO-PM D  I + +pu T `H0ݽ @ݽOX /L0  t/`0   SB  a WgX !0C3Sf  ]ZYf  oPyr~8WC4@21 tQ <>00,1SC(. 0=S 0qS1X"R 8 Z8T =@01S0OX< A  $P XPL QE0qBLp` ?XP`u0 L00 tX0" T `00q!S?QL0͟qaH0X PA&* 3!,!R\ UQ X" RP ^XL0R p |<L 0XPL h` X 1 3@TЍ 6Q<00X2S$R: p~ L Z0 h1L`X Xq SJ@ Ql1,Q qQVh+ 0nP0W: pR LpXP8; 0L ` 1X 0@PkH@(00(0000,00,0HXP0,^0# <P0  0=R%0@Dh02$0SXP"Ex(XP A PPH@pXP hH@fS@ XP E RQ#XP!E RQE# &XP$0(Y 000<P  =RHLL0^X \ 0@hD0XP0S <P  LXR\@0Dh$0XP0$0 0XP0 0$0SXP"x(0XP0(0,00,0(00(0XP 000(0XPP0L dS`0d l0 `0d E00EEE 0wXP0 SQAP  =@0D hfX0\8 #3P] p0v> 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00XP0 0 00?0000?0 02 t*4 0?ἀ8 000000000000000 000P 90\0PB 0TP 4 dP 2PPT0SQʴ RNʠ RKʨQH00 0S 00# "0S ES}> 00 0\0pP GvnL؀ `F H⸐00` 00 00P\0Qt0 ApP p0hl dp^\lp`@ RYS S|\0pVlXh0SdW`0S\0 Rz{  RR}ڨ70>C 0C0)<2L0P8 5@0(<2@0p0tP@Rfx0S i\g000(, \( /PJ p0l'l?0   P 0 0 0 R1 R?V0 0 !0`Ul7v@ Hp0/ QP 0U0Rl 0h Rh0"\ 0 h0qpp`  0qp\0S [PR@ʨQ @T [ 00 ߍ 0[\ %00 qp.  ) Q S;P7 RTP\0 P0,P0  PZP S 00@ [\ 0 P[0S0000 X ZR0. \ P_P \ \ \  \00h l[0SP V@(hQ:  @`Q3:01PL~0.`P@& @ KdS`l0 \ZP 2y0v5[\i@(I(,.Pg /v 0" K0S" P=0Yt 0V0T@T !]0T @P0E$0S ,( 6L^7 0 "qp1 psZ#00Z0S Y\|)/9 RM<0,"2#[ï sR ZT00Z0Sr 0Z0 Q  @0E$Z0 00ZT00ZT00||[+@-@ aBtpTL00P 0 0R/P/ / Q  DP 0 H Sp@-`P P 0@ #  TQp Pp /PtH  P/j.0 0# /P/,Px000@-PP Lo>O@ 0" P0 0OA-@P @`pP@0% yP PPA-`X@@P jNpP@0& _P PPNA-`X@@DP H@pP@0& DP PPNO- MP \I0P09 P@ p P P oN` @% P P0Sp  Ѝv 0p@ T L  `/ p 0pSMA-PpQ `@Q P@D 0DB(000S  GL@- M`ppPP( DY  00S@ 9Y0"S" 0p000S0 7/ Ѝ%Y0"S1Ds\0pT000S @ Ѝ1Ds$  $GF@-@ @>O- MpPW  pp2S`PL HP@T Pp G <P P6 0nS# p= .@P00Q Q ?P  H^ B" \0A 0 0@00oSpl000S /-` Ѝ<  " ``D\O-BMM@pXd 0 0PP:/.PP 0 PPr00Kp0P0 C `JP@@"0 PPp Z0P0  0PPp |N@P$ hzаD 0 dQ`k`V`  pP  r} 0SP )@PP0 PpT Q PW 00BލЍP/U ` P XpAW0ST  PBލЍ 0H 00PPIp@  PMW P00 0qp!0 :/0 0WL 00 0^(P`W0  ! /#[00 W 00 07PPz|W 00 0+PoPmoW` 00 0PPa 0X<l| LD-M 0  PЍ-M 0 > PЍ-M 0 ? PЍ-M00 0 QHPЍ--( 0P    0/ 00 KJp@-PU@pV,,0 ? P  5/pJhp@-P]U@pV,,0 ? P  5/pHJ<@-fF@P 0003/I$@-@P 0003/Ip@-PU?o@20S 0 003/p`Ip@-P`OUV00P00@Sp$ 0P5/pHPp@-PkU?o@20S 0 003/pHp@-P`F@PpPV((0  @p@/LHp@-PR@P p 0 003/pG-@-M  sp@(0$003/Ѝ@ Ѝ/G|@-nsp@0003/PG0O-$M`Pؤ@ 0 0I0Sp$ЍU0 (P@@4/$ЍFO-$M`Pؤ@ 0 00Sp$ЍU0 (P@@4/$ЍFD!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////  0 \L8T      t \ L 8 $         | l  ($0(- C^ 0C$Q :$0S 537 $05, 00 $0(00#  $0 0@-@$ MP05A05#05!0%0%S,P$00$0Ѝ0$0Q  S,0 5,37$050$0/S 5<37 $050 0$0/0S/, p@-R@pP$(ASp0$ R05>37$ 5 $ !PpO-0@DMPTfp 000 \0   Ca W \2 \%3j?F$00 pT,0 @S 5#37,050,0 Qo ,0S 57,05 50,0RS0# B R ,0S0 BT,@DЍ%3j8G$0P$ 0 ZT@j 0S1 `@@0 SS( S R 0C3@ W0 00 P, Q0Ç0,  0, 0 PV@0S8@T ,0@ S 5>37 ,05Q0,0  0, R0537, 5 05 , SR #0C 0S, R 0C 0S , S 5300C5Q p`FQ")QM*0ASIGFEDCBA@?>=<;:97643210/.-5bQ1?Q'0S$ 0 a31 A<01`00@m 000P, \0Ç0,0,0P`@SfQ?X0@SfQ p h @S7xp H2p2 C#s, 0c0#00FQ 0,  R05705 5, 5 , 00P R` 05=370, 5 ,  Fs@ %:u0@$0@@@0TSQO=0AfV?o20S00:AFVoP\ P\=Q, R05705, 5 ,   R,0 Q  ,00,0 R +@Vc 0S` Z@@` 0PT @` RJ p h @S7xp H2p2[00d`@-M0 0 Ѝp@-MP`@0 0 * 4/ЍpG-PRM^  `UpP*a@/:(P T1< 0p00p Ѝ80S 1< 0 p00pZR0S ЍĠ PR0S 0 @< 0< 000@ pp5R0S0R 0 *R 0 A8(@- @MЍ\O-EM M aX@PE`p+  V0P @)T 0 V@0PT 0 A Pj) g  c UEލ ЍQ 0 Eލ ЍQ 0 hP@-`@M pPP+ /V0SP 0rS'0rS00P 00 0@P@#)Ѝ0rS\ 0 @)Ѝ0 Ѝ@uQ 0 XA-`@#ڼp@ 0P/S /UP @0p S  0 S@' [P@p@-IMM@`PP p 0: S p0 0tp IލЍp3Q@O00IލЍp@IލЍp&Q@00p@-IMM@`PP Խp 0: S p0 0Cp IލЍpQ@O00IލЍp@IލЍpP@00-M 0  ]PЍ80Q 0 080/p@-@P`P F 9PP u }:P  p@ *oPPp-404-0 M  0 ЍЍ/ᤎ$--M  Ѝ Ѝ/ -- MGMP8 00  0 ЍЍ/($0-@- M@SMP  Ѝ@Ѝ/O-`,M P@RP00:A!0@00Ppp @P?PX P@ @ 0 P+X  M!,Ѝt0p@-(MP` @% (Ѝp0 0 H$p@-@`PLpp p@<0< 0p@-(M0P @`% (Ѝp$p@-MTP  D @ 00`Lp  Ѝp@nЍp蔋$0@-,MP@Lp  @%8 [,Ѝ0dp@-P\00M   0 @`Lp @% @0Ѝp$C-`P,MPE pU@P@0Rt0 0:200U P@0@ sT TL ,ЍX0p@-(MP` @:% (Ѝp0 0 p$p@-@`P0Lpp p@<0< 0p@-(M0P @`% (Ѝp $p@-MTP  D @ 00`Lp  Ѝp@{Ѝp輈$0@-,MP@Kp  @$8 h,Ѝ0dp@-P\00M   0 @`Kp @$ M0Ѝp$ Q80 p8@-80@08 880/880 00<(P 80880謇l/p@-@0@00S 000 X t PP `00WA.L00p@HP,7 $tO-M@P D `D30 0p@ P P00U tpp0 0CY 1ATT00  RG LD@D T]:[ 2 00p0`K .K V00 W8 1ATT 0`Fs 0RB K 0 0 B0SH K@0Ѝ V0& 0  J 0 0pHXB0SG 0 Jv B 0 0 B@ 0 B`Fy  BJtZ 0 Bj  BJ 0 `v 0 Zm 0 S0S J00| 0 0 0ꬂ$p@-@PJpp p@0RS00 /H0H0p@-@  @PcJpp p@<$40 Q00 0R00 /܁$p@-`@PDJpT T   p@php@-P X @ 00`(JpTT  p@p@$1!0O-M0P, 0D`S1H0?0 000 P LP !p s+1r'0 W>@t  , @@KDA|`0@p3  W0 S8 0? P PP Wt  ,0000IC1   00 0Q, 0î0Ѝ؀0 00~$404 0@-00 @?P80@080~@-@?P80@080-M0 Ѝ-M0 ЍO-@iM?QP0ȁqaԱ(0 P`?`( K͌U P?( K͌T P>( F͌(X P>( F͌(W |PH>( C͌ V jP>J( B͌8[ XP=( ̌1S EP l=^( B͌ 0`3@@@ 0S7800PH0`@P@P@P@P$@P@P0@P@PH(@P@PL(P@P@PPPx@P'( @Q780 T0x100C<0S000C40h0P00800P080a* ,0p `0@W 0g1p W.00 `00V0 `V, W 0 @ `d少Xh` 0V `Piߍ `0 1Sp ,000q1S D 0|0 0>p00'4,0P0 A,00Q 00D 02!!@ H4 , @ B  0S% 00p 00C10@S3 00   0 X  9X,000 0S,000p,0W1 0X P@0Sp80< 080R51800PX0,00@0P0 001D04 0P00X0B 00P0000P0X40 0CR0P@,00`0T d!@PX0 p0$0W 0 pW0T,00` pp封W 0[ $P00@0SD@,0pD0 , TH0  0q{0D |I000=p^O P  0\@ `    0 \` P  0 U a P@  0T c @  0X e @p  0W gJ @`  0V i @  0[ kD @R\,00@d R+X000 400C $0R@pP$,000,0 WH 00` Q ʔD |p 000<p1$0<0 10400C\0 0 00XD40 0CRJ0P @,00` 000T d!@PX20 p000W 0 pW0T ,00` pp封W 0[ P\0 R0-X 00 0 400C 0R P< ` p,010 0 W,00H 0@ a ʕD |p 000M<p( D00 0 R ,0S> p,00 ~0X 0h1,0S+  80 P 0H0 @0T000 @T,00 P @a,0V1B@ T  0 @w0Pb$040 SG40 P 00C, 0 [# 00` 0 0C10 S2  0 D 0 0L @ T  @T,000 @,0,0Z0`01~@ Z  0 @*0P 0S< p< ,01X 0h1 0S,  @0 P 0P0 @0T000 @T,0 0 P @Ta 0V1V@ T  0 @0P0`40SW40@ 00C00,p V$ 00 00C10@SA  0 X 0 0T P U  P?U0,p00 0 P0|,0Y00 01P U  0 P0P( T40 0 R080000StO-`YMq0tcSA P T3? 00K͌ u0S3?HPK͌Hv0S2?p`F͌(pt0S{t2?@F͌(蘀w0So(2?pC͌ y0Sc1耍?B͌8 萍{0SW1? ̌ 1s0SK1?81NB͌ 80 @DYߍ 00u0Sl HPv0Sw p`t0S @w0S p|y0S 耍 u{0S  n1s0S N fi0@-M@ @ 04@P$( ,Ѝf$@-M@ @ 04@P$( ,Ѝe$X0T 0 DDQ @Q$00?H/he$x$L0 D D 0 R #@ R 00?H/dx$0 A-0D   R #@ R# P?HU`p@V,010 0D C  \(  @T 00dx$0 00c$d d0 H?30\ -<@ D \<0@0D/cx$0O-SH4M 4ЍpP$|   L0!100I9|@Pc 0`D0 R P`@0PR0 T P V@ `@`|`9P! ?3 R #@ R< Dp H0L |" 00( 29 8`P0S R,@PR @P0  9 R0`Sf4ЍT `@000  0F`Pr @|`cx$0 00^`$X0X 0p@-Q0P @dPK1pp`$0S p@-P@NP5pp/H 0?0- \ @ 00\R  |0D S   R 0S 00_x$0 00_$ 0 0 /TO-MpR@l2P0`0Vu T2*PP0LrL 0@2@Ÿ8,匒002吒嘂  $ T X  \ ! ` 0h01 0i010p0jpp 0@z0刲 0匲0吲0嘲0$TX\`hij  1Q00'0 0 0 0 jЍ|00 0t000x000`0\0X0X0T0P0P0D0D0 @000^ hT$C-pP⌂M@ `P d2 @J0P"" RRRdRhR#P0`P2 0S PPPPSS3PU S pP 3pK |0p R\ PR0 PPP(P9 0 PPP(P. "p* S#p& p0 P(P  &c4000S :3S Ѝ|P YRr2SP U`Ѝh0Sv=pPa[8tA-Z`p|pP YBI2S@ T000 R A~ A yLY@- M\Q`X+ P@E_ 0 S*01|0# p!!!- Q!!!!> !< !^ v : !' !_ !| !o !* !! !f ! R |1 R 0S8 ЍQ  800 Ch0 T  ЍX4@0h 0 S/G-M0A@J@ < ^v#x:'# #H#p--`_|opry|zy{v@|sh}pwlVD,@DA-o\PP p  @ 0^(PU 0(`O-Mdp`7 X7 0 J]P4'E0ᄢ  '  S0SZ  p p P`  pS`HS  `r  aR$RS&0 0 N 0  ;0 $Q`B`q 0  ;0p 0S-4   0 s0 0bR44 $S %5` 0Ѝ p P`2 4` 4$0$ s 00bR\% 40 0 !P0S 4 0s0 0lR4S4 40400Ab0S0S 0 S 4 00`V pf o0@`;{ p] 0 $ u`H4 $0$ r0  aRCo $ 4Q`Q040Qt  000r0  cR$0S 0 SS p* 30@`R `00l0  ;0,p4So 0@`  $@ `004S] 0040 s0 0bR $4S4<0"`0 0ЍSk 0@`  $ `004Su h2 0 H2 00` p 0 $ ` 0 s0 0bR 40 ;0p- P) p? 40 s0 0bR44 $R100t1 00#?cn0s440040 s0 0bR44$0 r 0 aR$n0 00#?c0`0040040 s0 0bR44000R00\00S& l0! h00 QxL<dH`|ܶ,-  0B04 44/O-` TDM4@P8 $Q0h v :Q{#R3Z 300S v 8 0S0:3S)0`0000P @P`@-@8P% H8P 1PFP0S)[P& mR R@0R0 1BqQ;RS S0 CmSr ;S R0 R S0S PS0C;S q Q0RRR԰O-@0 M uSp`e`Z|P S0ɍ<` 0rr H|"R 3S(0$00 07PK?T0 ĭTxy7P ửX 0SL$$ @$ 0|"44`0T $4X 0 4S0300S7 p0S4 4S. 4S 0D/q @T㌑T2l" 8PW 00@l2Z& L[# `P P ᭉ0` V 0H5S4S 4S0?o28Yp2=3@t2 P[ 00@t2W>3@x2 P1 00@x2h Ѝ0 D $l h $ <% p 0$0(0`W 7P>0@l2Yo 7Pl2<l2Zn 7Pl2?;~0l2Y 7P<3@x2Z 7Px2?;~0x2T 7Px278x2W  7P<3@t2Z  7Pt2?;~0t2T  w7Pt278t2|200S0X00 0rr G|"R1S0& 4S"VL%RLZ8p2=3@t2^8p2=3@t2Q@Bl0 00<00- $ Tx Xl h  \lT 0p 0tx"| R<804  P X0 0//<O- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-刑\ Q |pPl0@`P QV00` 㿽PE ,0 R 0"00p0P00 ᔾP 㙽0P  H  ర帰 就帱00S0Lٿ <0 800ʿ ;H8A-P@p.P P@ `D@D`0 ~2V P@0 p 2P p@-\`P@U 0S1 RU0S@@⮾0Sʩp@YG-l@`pS0 SV0S"Q0S 0SV0A-0M`@@P. , 0 @S@j @1 J~p † 0|" QU - P*#x [TۍK8HpX - LM  R  ʂ0   Ѝ6`0 Q0@-@L00S :T #l/<60 0A-p0S :P#CRQ# # `b0:@P #Cc## B60:#!BQ##5T0 P-0M 00S ʃ0  8 Ѝ4804  P T0 0//4p@-P|``p@0@ :0SP0P0:3S 8 L40 0<0 :#p<4O- Mxt3E hs`0`p0 *PL3B0 (VU p p PQ p   r  `R  01Q @R R6 RV0B S l20 `hpy  @V `  Ѝ R l \  Ѝgp P ` Ѝ@1q lRQ  S7H @x0 ` 0  S, (q 1lRQ     Ѝ6p  q`RBoo000#?c p Ѝ 0X0 T00㩮8  3HG-@P c 3`pe 80$ RR a ʌ3S23SyX " R &8' $ЍP Q ` *P  0:# 0`x `  000 0010 0<z100\D$D@-,@@0Sb100@-$@@0SS100ܿ@-MT@@ 0S Ѝ<  000 0010 0Ѝ褿$@-MX@@ 0SЍ {10 R0 0 q10 08@-$M8B82@PQ :3ST03b`pp$0Sea` 0SO1p0S@ M0 0 B0)1`00|PQ 1@ 200 R 8 G 20 0X200 G 03,0 pp#P`$Ѝ0`00|P @ 00 R0 0 00 0000@ @8 I200ll@-$MP@ ` :@8@@0@0V 8Xp0@p@@$B4000:3S [ $Ѝ@ 0 000:3S/IT0T 00:3S 03@-pp#P`/@0< 0@-0 03, ppP`D<0< 0@-0030pp#P` p@-@QP0P000 |P t0 1h000*pxP 00 1(000*Cp l00 p@-P *C T |Ppd  10*p@xPp,  r10*Cp@ l P0 p@-@0:R P% P PpP 0 J10p`tP D0 :10p P8 l0 000:D 0S,01/Q%0ϠQ\0CS Q0@-,P Q (0@0C 0 ^ S0U0//Q%0ϠQ\0CS Q0@-,P Q (0@0C 0 ^ S0U0//\ , 0 B0/\//0@-PU,Q (0@0C 0\S0U000@-PU,Q (0@0C 0\S0U00Q>@-\^5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@P@@ N@ T ^Q/0 p@-PU,@Q Q(00C0 `^ S0Up(, 0R S0/0@-PU,Q (0@0C 0\S0UP080@-@@4!80-^\ , 0 B\ 0 ^O-J00dM#dRa&XSUa 3,p0CQB8 ?3 Q:SC0P8p 0  0b,0p3S/a0 P p#@  p) , p3,  X 0`H!0 EdЍ|B 0c9dЍO*/00*O-,M  P0U" `!@Te `$p@ $%T*:0`pSO  0 ῱PPK,Ѝ@`00S S> S0PV$0S-00 04S,ЍO>0@0S A 0Q B20RP 0 P0C0S,V !P 00C0,0S  P@,@0 C`QO-M000P0S@4P 3S-0S*U> 000  0@ 000@ Q k p`@ P @0S 0.PJЍDbP 00 C40  (ЍP0P|,QP0  0 /ሣ D0M@ 000S :P ЍЍ/(H0MD0 0S :P ЍЍ/400 000S :P /|H0MD0 0S :P ЍЍ/8400 000S :P /\- T M P  P 0 Ѝ Ѝ0 0@-0@T J 3$S |B0pQ 7@-P @4804 000S :P _/X PT 00 R0S *P@04//X000 000S :P /L0L 000S :P @-p @/0 0A-0`V* Z 3$SP! #Rp@4S@pp3Tw A|B0tQ I7A-X,0@- @  @Yx000 000S :P h/@00G-` M pW#   0 `p @ṭPP  0  峯p@ 0 @,Ѝ@P  P D/p@-JP ~3S P`4`0P 3V  0s3# S00!01P |2 $R 0X0S L03 |20X #$03pppp p@-jP 93S @P4P0@Ǯ3Sp@tA-`P[ J3S$sW! P#@P03R4 R)W lAQ , W00p, # \ BL| @ WP3PSSpP4PSfpp3Upp@-@P X0P:|"C0T0XppG- ̀\,P@p  `P LTL!VW R T VW  @000S8 0߮0 0xO-(,\ :`pᬮPP1PPP0 C CC2嬮P" U  @᢮!P P0 @ C|0wxp0@0SY03@8ppF)P0!@ @ C @x0@-?S0P  p0P0\p( @``& p@`^  00PP0A-@PQP% pW0!  0S0六,僭000 R   R   R  P nl4h`T `TX *P Q Sp QW02Mp@-PP X0@:|b0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S 903@0SpX@ '|(@ 8Q 0@0ppp@-@PXa`R X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  @PpL00008P@078@0p0pP0P 0 0S P@ ?# Q @080///($$0Q 00/$$0Q 00u/$\0A-0TPR p`@?dG@ H`$X0X 00 R X@07|8@08Q@0@0/$0 00$0 00,d$p@-P`0`0@T X0:|20T1S@0?;@0S<000080S@078@0{p<$P Q@0?30R @080///Rb/R/p@-PS @ `@?LppP X @0*7|"8@0 8 R #@0@0/P@/0p@-@Px`P` X0:|20T1S@0?;@028000080S@078@0p0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/4p@-P| @@0 0p@ $p@-P@k p@p0 Ql0p@-@ 0P00R ^ p@M p@$L0L0p@- @ P#pp6 p@D$p@-P@#pp' p@p@-P | @ 00`#ppT0 T ^ @ p@@$p@-`@P#ppT T  R @ p@@Rp@-P@00S ^ p@u p@nO-`6:94꼪P1S00XP pP  Y 0 0( 0000 0P0Q00 <ЍXUZ<Ѝ胪P 00  T 0S00b , 1 0 0(*1Sd0P 0  0CS00(00P 0P 0 00@@0S0 0H00010S @ @Pj  [   @0CY(P 00 0(0 0帑KY?3$0 2[002K0ST Q 0C (  P 0 0C000T ,S  (0!   00C0<Ѝ@0 0X0X`T0Y`F V8pPV3 Pp<ЍT0Y80  0 000<Ѝ:0@QHd 0aH[H0L 00!0/ R ,0|10 D0K00 0pT0Q 0(00^00Sj H00 L0 弐J 0J 0RZD0 |0pQn   S,01P0Y%`D0|`00pz H P L Q E1SI00 (00Q0 0 >80 [  H100S0P080 N I00(00Q0œ   C( P  00C00 T0R0, 01 080 0000 S0C`C00080  OTO-M@ 0@,0P 1 0$#T,0`0pW% P @D  0   pT 0  6P0p  p"000Ѝ4 00 @-M@0@Ѝ$- M0 ЍC- Mp@00`(S,P 0HSOVtN0 r@03@, @P P9 @(0 `Hoo 0b000S 0 P 0D3@ 0 P`VS 0#"H078P0P0C R  000* ЍPP00S0UZ ЍX0PXp- T0RpG0 W耟P`W 0 `P p0   T 0S00 , X10|80  080 000 S0CpC}p@-@`PA pp 0p@- M Ѝ\p@-PT0 M@ 0 `" p 0 Ѝp4$\0\0X  0 08Q Q @0<@0/6S/$< <0 0001S 00 @0<@0/`$d0M` 00008Q Q @0<@0Ѝ/6SЍ/,0, 00001S@0<@0/\0\ 00 X0:|20(Q Q @0<@0/6S/`$0 000@/$X0:|20(!R !R @0<@0/6S/0 @ /A-@p|P P`lgp e<000T 000S0XT80  /804 0080  Q/$T MP0P    RBPP0T Ѝ/X$8 0  Q/0Q0 PBPPT //,0, 0000P/P/,0, 0000P/P/X#3 O-@0 MPU d300SH0PS@PPQP0nPIIIZ pp`IV ,0S 0   1   `FJV@00S/0pS0a!0封[, D | 0 P000Gp ЍTYppGWp  B RY 0  0CI0YP r ЍPaTZP`JVJYpa,0S1   0  h ` X Z 0pS a0[, D | 0P0q00p ZPZ0 P0CkZ0JSx0P0/ 0$0Q /@-@P`Pp^0A (,, 00^00@UP 0S 0@//P 0S 0@///// ///O-P1!0D0, 0S 1H``?c`%@ p0 @s'W0 8| 0 0Hp@W00C @ P @0@D0 00$X ?o 2 R0S P/01 //zz-(^,0R0SQ!R@O-M1 A0@000S1蠟, @ p P `0S! S#A 00 `0C``P  (0R0 (000C0T0 02/p 0P@S(0 0 Ѝ4$zy8y(0A-S$p4@`P(0P@SQ Qa ppQ p 0p(0p(0S/p@-0P`@s (0@SpP0@-0^ 0 @ 0 Q@RxO- M@PZTppHZ1  0 @ B( T0@0 S `+,0 1R@0p @ⴀD R`Dpz `|p Ѝ0 @0@ ~00 S RP Ѝ,bP ,0[P `0V 0 p pG0,0C(p1C,0A0 T`0 0`000Dp41P ,J00 @4 p` 0Tp `0Dr@U   PB  0SQQ 0 0$ PC 00\R R 7@U 0 B 0C G-@P4 pP5 0PUPAP0S%X0#P U 0 `P0V`C ` 00 RF `C`V` p[ t1 $p00S9 0PAP807`P,! R ! P3 ! R. ! R)  R00 0U+Q*P0U `P00V ` `SW Ѷ`x0 @p 0 $pL0XPU0P`W`PEPl$0PD Q P/$ $\/ P/A-`PAPQ@P1p0$ VY 10 0 QV$ F 0R U E\pL @10 0 QV$ F 0R U EJp:   0F  Q SC$ 0R U E4p$ 0*$` P0`00BTP @T 80@Tp` 0U$A-PP0@P@pQ`@@T0* $ P pX00@T  0W@dP. 0S+ 0@- \#@T\8x ƌ8 t ,@0@PU 0P0U00 S00/Q?X?A-P$@`V0S2 0\-@ 0T `ApB 0S#0^ 0S0pW FG@ 0 0 04@U/80Q@0@080/0A-S 0@ B( P`p0,0,0CA@1` 0S( X @- 0|B 08SE?080$ 8R  R 00S0!R$R R d1S80080080 O-`QM 00pR<[@p㳞@Pl ူ儰到嬞P,g bPP0d Y4' Z0 `8X00 `0@`F 800  p$p<@ H | L0P T`8 0\ 0@` 80d h l p Ѝ0P49 m 0P=  ʂP PHZpp V00PPʪPЍ@Ѝ@Ÿ῟Ὗ@ḟᶟᴟ0@実ᬟ᪟᨟@A-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,.PP D0 D0RH0!b pH000$`P@0RЍPЍ(@-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ@@HP 0`JUp`_WNVPED 0    PI uL1D00S*Y p$`(D0@p`0S00,0UD000@UpC0@aC`Y Ѝ00H00H0t  P PEP` V IPIP ЍP @Tx$t0p 0l0@-M @  B0/o"  mPP 6Ѝ0p$H@- @  0M0 PЍP-00 Q08SM$ 08Ѝx8 /-M 0  0N NLN ЍO-$ 0(0QD, 0!0s0 S^: 0 "@  t@T,0Q0@t@T<0(00S20 R (Q(,͟  H͟LL P, ,R(  4 ,!0 !8 <  , !  @=$ 0pH D0|0H0000Rp 0H SL0HP10< 8 ,    V, 8 Y Y R `R F Q<08 0,000㓉(0 #I0CYڸ T0D0o0 L R Q0YT@o00PP ` P 00`,0 0S0R0S0 \ ɟ`V 0HX 0X op 0 00 @P RoP0 P ` P0 V  R~  ``$QUD PO A0 S04 ( R(  4  R( Q4  *#r PPQ 0  P0  \(,  r ,P  ,.P !0!!Q@Yڶ000S, 80s js$ `V \V HX~ @0@0 L  LL lL\oɟ`VJF80 aU 0T TDD00 R 0 R PP!YR   Y $R 0E0x 0p   0E j D000$R $ 07  jD000!R@ Gt <000V 0 A B $ P=0 5# X0:d2>p6$ @ Q< `0P8P, ` p u'UP0 @000pH 1`11qWy 00S4  <0pD P 0 5# X0:d2<0V @ 03@0S  V0A 00C0 R d1SCdЍꔄ T VUQx  0  0 p,$$ R 00S0 ?3P D`Fp@pP@`@ 0?3T 1pGW1QEP `p?0D000L00@ 0@0 @  X X }P 0P X R ?(080 w <00 $2 0 p`dЍ80 0 @00Cs00S$2$ 0D000h0S(00S2<0 (0 U+0{< 0080@080^7Q00C\0 Qʘ@t* "(1$ 0, QKp! <,\`@VP @ VP  P0@,p, `Q`!J @ <P,Up@WP ġLLxDpCBL;$:9P9<9(9lP W@ P0 @`, A,\,@T q, P@DNP@X "   , ` ^,00,0Q0 0, B4 CRR<0804 00C, 00S<,04 0 @ 40 0 0@00,000 S @`f` P 0, !Yp, 1@S @ YpL `P00 0  0 00S 00 0 0S40C04 R00CQ8( 0 0, `Fv5 @A`i0, \8 p(@0<0 0 ~ 0P`U@0V0S 8Q004CQ0xV0F0<00DPA ` \p <0`pHU0L H2 D| p3$  D0 00@Q4 R1 dP.  +P d1S $ |4  tPp:U U0p` 5`FV 0EPE00EUP'00:  ,0R<0Y0,P 0A040 0 0C 0p% p ,0%80 L0H050@0 0 G40y p0RWx R  Y Rp RtR)0 SG 0PU`@000P lF@@D ,P lFTP@ P0E0PE0PE 800 00C,0W<0p,p0,00 00R:<0 0,P0 h 0E00p  0E  JD000P4B T@,,`H0,0 000 0 0WڅL 0S 0 @CD0T0 <000pP4Z pQW S4S Y4SQ H5S4  8$`P 0 `[D 00p~0 `N00P  n0D` 0 B00{ b0@ @10 0pU0 @%'oSPb4SG 0 D000M$ :P 10  `C0` D000ȔY  4 0 \toPY D00  TP    `(;$ DP0` 0T0 D000H%RQ#    `;$ DP0` 0HTPO p0SL 4S 4S Y00Q0S8 L5S;  `<$ `P 0 `mD0 00p0 ``D000P  0D` 0 B00 s 00QP00`0` 7D000P  U P h$ =P L0   D000P S=$  80  R! T 4>$ PD0 00$1So T >$ D`P0 0@L5S] 0 0RXT >$ PD0 00LTD`t 0 0L@k0P0PU 0``U @P @0D`0` 0HTZ @0HP@, 8:0@0e 0  r= <  p@-@PM0P`0 R    80x  t000 000 P80  D000! B/ 0C?00  Ѝp<0 00t$C-M@`4P0pሐh l8p\` d0P Ѝ80 800 0 pCB`Po`_PЍ4@-@P @TO-P1!0D00S0H``?c`S,, p !@G'T :!| ]p@W 0 R( ?3 S 0S1S0 S x p0 00L~$ 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP @0 @T $0`U V P`Vp`W0P 0@PUpT` @ˏT @pp  ! !@-@P@崏T R/0A-p,SP` @T @垏T0`PS RQ A0@ ", "Q//A-pQ*`@P 0D "! "U0 "! "T^ 0N "! "\^`@WP@-@@@0S $0PC$p2O-M:z*0p$P؂  pPt `00^b S`s`aRX@lH\0 04@Y @A@0 @TE Qጰ@@[@T=P i``FF\S0^0  | aR\ d`Q'TQ"  @CP(4 ,4QT S I@0S  [$ 0P00B$0uX@0C,4Q{ @CP ^^ S\ʈ80,40SlthtH`@0,0^ $P, 40@P0(@0S  00 CR( ( pp' : 7@00p(`Y Y| `nR`F`V00P0SZ  $ 0P00B$04' 00Q4 70, '0 4(0P0J0 覟F @& $P)0Sl600S00l0S# 0 S & ,40Q#0 l,P0S  0P$0@P$60 RЍ6 0( $0(0\GEe@` % (00 S:$%0CP (00xP0S a$0PC$@%@ 00 0,@(@Q 4000X\ 0Q[Q $ Z $0 0C(@,00  00C S[ pH40,@4 0,0104#0zd4`000P ^% $@$#P@ (@i0 Rv ,U, q  P+ x#  l# (@$@?QWD( , #\ $6 (@  P 0(@$ R  $@ P  @ lP " 20,,40 SN  L2 0$ ܀0B@0S  ~$ 0P00B$0܀$ 00P0 ! ı 00(`S7A@ 10(`0 V0`F!(`0 xP0S G$ 0P00B$0|,@' A@0S  4$ 0P00B$0 h,@2z11Th0p0 0//DP/@//L.<...|-<--,,,(,, +@++**L*)`))((l(X('O-LsL3pHC@0 P =400040c`(,P Zh34@2`0T6"0CS 402P00S00h0S000S200ʔ 0@DS(00S0 0l0S R H" 4204@,P0T0hPr RP0 @P 0( 0CS P1 P1040 ,(  @ P,P@1(`0 R&T !P @T 0 R 0 P'  x 00 lP }@T00,P0 0( 0  4@0S\C,PE@D4@SPL04Pk ^00SL004Po&`& &h%%l\%,%$###\#(@- 4 00(, #(@- 4 00(,"d1d!0O- @ *⤒Y8!O (!0P[& Z( 0S!,p`pGP@0   R    P0 P00P0`SY@TP0,AU0 0 0p W  QTk0 00 08QD0S0l%R h%R /!R!RtP/P//i 0 000 0P/hO-`upP2 T5` 80s5 < SD Pr @R !S5 0 40P\`  4 ]0P 4 T400:@ l0 @ l%R h%R 0ʀh20 d"T0s% |20T0,d"d",d"d"+d"d"+d"d"*d" d"*d"@d")d"d")d" d28d20SL\ RnVõpSS Rz_P|SI RPPS? R’VêõS7 RPPS- R_PS# RPP@S R*@S  #Y[=.0 0 C C S: Ql" p" l200 C S! 081: p" l"RU4 1OaLO`PU* 0S X100S H0Y 0H0,  Z000 0 0 00QY'PU0 0 !R 0ʀh2d0 0 !R 0ʀh2%R t5S 0ʀh2h l`p1P0Wd PRP/L QK\I4@- 00ʃhœ\ 1:p“ @T" pƒn pƒn A\ "B\ n@T pƒ     /,c01P0G$ 00` PAʀ: h2πS00n200 /@P)#0000CS 00/00/00/00/000000000/ap@-P@M@&\\ nf Ppf rf0 P |P 00 a(0 GЍp\`lPd-X\\ npr /_00 @- t0 0S X00081:lƒp<00 R_P441 @-00*h"R @!@ R  (1:/n"pB00 R @R  AR t^0 000:d/ ]p@-Pl@l0@00:h2S SpH0000Pp00 ~$ @0 0@0p\lL1A-0aP0`S: !03@p @  "0S1H0 h"R+ R  #@ @0780@01M: @/QBo23?|20R1 80AQ:|20t0p1M: @/Qo23|20l20 0AQ:|20h$d0 p0!Q g0!Q (X\l/|0| 0p@-00@00C0S S p0 S P00Bp|Pp0dZ0p@-0CS@0 S p0 S P00$p{Pp0000 0p@-00Pq@phYp@-Pg@p 0|  JQ S@-\,AQ0/Y$0J0P\@-\,AP /0S/p@-    @ BJR@P`,PTa@@@RA  Qp03O-0PQ`$MC@ pP 0 0C Syrp @,010$1S!00A 0BS000(00\0ř ř!AI"R} T 0JI T0 $0$00Y q?3P00 0 P⁄Pz 0Y0 00 W0(@p  H0 DW T@( "D0( 00C P6$Ѝ$ЍiT0 S80 D 10@  B@D T hp`$ЍHȏ$Ѝ& 00C! Y| @ D0 |0p H0I002 Y @T @卅T @ @^4 8W0 00 S$p@-@Pppp@D0D0p@-@  @Pppp@\S$O-dM`p 60$0PPqy @Ń0P0s  W0pp40Pp0W000@0@STI6+POP0pPX0@00@D@TG00000PS040/ 0 00pP@0@DS1B-,40T R8 % 040 㮅$0$0 P I P0000S00U0pEPPE꓅HPP0p0C0刅 0P0 00P0 0@S4,00! p@呃(, @Q0ر@( @ R 400Q@!0CJ2S X 0IJ X0 $0$04 @0T00 P04,8p, 0@ 8 @ 0 0 P  H 00|00  HPr 00 R0S0?@P5/@TY$Ѝ H\r 00 R0S@0刀0@P5/@TIt | Q" @-@M R ! R "R pP^  0 0@_Ѝ /@-0QM   S S PpP$@4R @ 5Ѝ8G00- M #Ѝd@0<< -M ЍXF p@-0B\S@[ ^S:  @%  ,S'Sy cS{e%!E"0 @ L P >b>0 r a00 } 0 p000 % 0   @, ,L !2b{0 r *PUB 00ES941PuP@P`00B 01 00C  ^00 , ,L !2b0 r S\S:S '  00 pL 0 @a % {r E|O-M  \PP 0H'p p 00R0pp  @` 0,R3Ti 0@\  @0 0 0 Rg  QS%R +0@GSSQPNMLpoIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! > 0 SPĀ2 00Ѝ0% iP@ 0  `fv`00 0 R!.Q R*Q0 00 RZ@0 S\0% p@ 00  00dP% @ @0  d 0 0 S 0@ 0 00000 30 S\@  00     0 0 Sm\  %p00 00%@@0c  a 0 SH\ %p00  0 0% @ @0c@+0 0   / 0  @   0000      <    0@0@D0 00T0 S\R$ W 0`C0@ T0  $ 0  <  5m /000> 0 0 0S0\S 0 S0 C| @ p@-@PM0P`0S PS   0 00Ph 0 Q00QH  < x0 Ѝp0|;4 `A-M0@HSD!00@0p0S= `0 v 1N;AƒKa1#cL 0L0 8 g=M%02#cQmP 0 pW$P@PW 0fSZPЍЍ 00 Ѝ: A-M0@LSH!00@0p0S= ` n0  k<7@ƒCa0#c!01 3>C120BQP 0 pW$P@PT 0nSPЍЍ0"0Ѝ9< O-M0@S!0 0  0000S- Plar*sE  0 `Ï⊡ -8 ?C01N;A08 g=M0: @P 0S  R p$0W% M #W =W =`P` n0000`@c01 0ƒ120B pP0B `@00=$`Hs (0 J" BĠ,bC 1c 00 0#3#cq=P $0tS0cS0S|``@m00` 000< `0S|ħ    O-p`@P0\ %\0pS sS lS@ 0\TT1DW 01 CR0@CUPO-PQྟqM P`> 00S040G P l@   AH Y 0  R VG po@T %%T ,  RA*Pg  4 @P@Tp, 40,qߍ@p%T =:T,,P `0 TI 0DSECB@?>=<;:98543210/.-,+Pf{P" 400P,1S+ 0C-11@ V4 00 `3`,Q*P 0 p 40P4qߍ00f0\`!0D]SC2Tf !x~}~z00D 0 7Pb@0A@?S:T;X0Ds R S񏐀E~}|{zyxwvuE9rqponmlkji.gfe5cba`%I@ZyPQ 00040yP,I 000VK -00\.00 `\0l ` @:  P`160@00`-00.`OU0-1ऐ1`01@P!R) 0BS11`& PB=&@DQ1VTlZD2QU PE=!TQ10 ~T0OUo !ऐ!PQ0P@.@10Ds Ru-1!ORTPX=P1=1 !T@1Sx -!0C1X0SX 00V!@40` RX*, Ra  %pC 4 P040@ R   ?R ;R  pR %R0 0@a0Ds R A0DS"13 DOS  !ऐ!01Pp!POR͍0S'S ! 0S'S'S@P@0P@Sl00l0 0St00t0ATz @D=PA1P eOT=Q1@A夐P@1Sh 0C-11@ST@#,Q*P  P4 @@p1S[ 0C-110S Rf   ?R ;R eRQy  pRW %R0 00     00C2"0OQt͍0S}S  0S}S}Sw@P)AT @D=AA0@a DrQD! 1N`V`SVP .`L`&I0``DVP``>P``9`@oob4P``/V, `(`@%"QA@PQAA DR 3@DP1@-1 1OSl 0 'PexP! 400P,C0?oQ2yV0 020TxP 04 ,00T` `2,Gx P 400`, >P00@8!T00 ~T00R@.00x/|8`&00#&@D0Q0VT񏐻^mgaXE3~}|{zyxwvutrqponmlkjihgfe P00@00 0 00- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/\A-PQM`p@ 0S WB ?wP 1X' x00 X T~ ЍnPPT00g 00ЍT ¬T༬p 0 0 R Tp ஬Pp0S T0  hDap 0S R s0r (0 000ST00P Xd  p0(0 P Ld  p00PbT<\0XT t 8 d 8 |̥ | 0R@-M  E0S@  Ѝ0A-pPP% U) 0S`$V  PR |c@P0DV =o 6PA-PR pQ  0 @`R P0 C C0CP #P (&0 ES  ]vP  Z0 000Q 0  R0 R  P U Eq0V Q ^`̇QP 0S  0 S oP W0C s0 QS0S  0 S P RQ!V0C s0SPUE P 0$XGPG " X! $@0"P20nPH sP9 fPRP?oP @20S@qQ:%uP L!uPH{uPJ$ PP :v$P6v juP$0PSU 0V PWPP @?V00SC-P|AMx!`@p 0 P o00l0S< `Ѝ\@P ` 0 p R 0S 0P` Ѝ` 0 P oP`L004@@+@ݪ P *@P pO-M Mp00:S*0:SS@ 0PS:S``"E#P  [ R ;0  0dAiP 0P:S ۍ Ѝ@ۍ Ѝ$ŸC-P M@M`ptP? 0/SO iP  0IuX PE P 0 ۍЍC`0P P! p P40  PۍЍ0P 0S/S #pP uX0 ۍЍC p 0tYW P0L 0 $ۍЍ404 0 $  l h <  G-p`@P  ]0@tT  SP h@Pd@ @ @P PU  $ 0 %%G -@- M@00 Ѝ@ Ѝ/1C Ѝ@ Ѝ/ 0p@-S @0000p0000  P 000p@-@`t^t\t@ZtXt Vt0Tt@^p@-@(PS:pS sP!pr @-Q @fRQ ^nR sRQ 0  \ A- `@V pfS@`V Pl0P0@nS sS0`V@@h 0 0S00@PA-P# P V00`p` ,RR    0S,S@BLrP  ? ;`p`@ d]G-P@`P P9MpWT*nUK sUB fUH0D Y#R= @  sP H0D@p H0@0H0H @0nUp H P5 sUD fU< L00L0@P@ ZP00pY 00 ,00 q 0S0000  @ QH0 $H00H0H0@ HH0@, ( H0@0H0H0, 0H0$PH00H0k , O-p M@ Y ` `XP P0( 8000H0 00|qP2 0Ɒ 0 hY`   ]PX  SPPPV S0P@M0@ Ѝ1!0p@- 0 @S/ 0SpQ @\T 0SpQ 00pPUp:`AoobEU@@ \S@@ T0SpPx0Upp|A-`0p @PPUR qP!0 V0 00pp00000 00 0PpO-@P0 $M 0\P `Er`Z3 | h PP 00 Fpq P ` $r 2Pq0P r $Ѝ 0 r r,P0 pU 0(0$0,0 0Y``  R \00mPJ PU0qLp0@W@0H0D0L06 fS, 0I0 00  ` P pW P`0nS sS Y ``  q $Ѝ$]]PX 8 A-P0p @``VR pPA0 0 00P 000 P0P 0Po0A-P p@`WR pP0 ` 00P 00 0PoO-\ML0L $00,0k;080`P ||@P00RPP00PwT PU ?PtPHpPN  P U 0T 0$,0P 5 :0H0:0<0:0D00(0 0 R& 0.Bo0#1OR= = @P 0 0pPu< < 00R40 R00 Q$,P p \Ѝ# PP3 @ p@t ,0 S Q0S Q0TS0 000`40.(0pW#S oPQ (p @0@ST "p@tP  0Rl  Sg 0Q 0So 0@S S 0p,Pl  '\S  R^W$% [ ^S Rn `[,P0 0/0IS .u 0Pm 2p \Ѝ0PCu RE C/R{yxwvutsrqponmlkjihgfedcba`_\[xXWVUThRfPONn|x0`pS@ S8 500 @ 0 @`%8`  4 0;00 T\T00S P PU0 Q 0S; t 0R0 00 0000n0y0 0`pn 04 D 0 00` 0p0 00 00 0 0 04 ‰ 0v/t 0 S00P&0@0`s 00L4 ^<8 T@0Q0PE`TUpPP 0F 0 00 00s0 lPbP p@t p@t; ,0 Sa Q0S Z QF| 0 o?t 0P5P0 000 000 000f0 P p@t0 < 00RN0 R0J Q 0 H.?[R 0@ 0 $0 0 0S00'Ps  Z0 0 L  00 0 PF, ", p ?Px H  | P  P/$P  //` 0@-M@0 PP  1N;AKLBH gMMl1#c 000%#@B4dT!PЍ0, P0`0K?//ሢ 0@-M@0 CPg  k<7@hLBCNCl0#c "0K20#AB@C1d^PЍ0( 1P00?//ᨡ @-M@0 0 -8 ?=<;:9876543210/.-,+*)('&%$#"!  " U a  u!00 (ЍpP00 P 30 0U : U05]!00 P00 ~Pu <30 0U 0"lP 0SH B!00 cP00200U 0 SP 0Sm )!00 cP00|20U 0 a  7PQ  cP00i,20U 0Z 0"%P 0S  !00 cP00SU 0 "  P   rcP00Zڈ10U 0 !="?7D"0JP   ZcP00,U 0 " LcP0000U 0"?7L"P :0S !00 2cP00ڔ00U 0"?7L"P  0S !00 GD0  H \ ( ܬ Ь cP00$00U 0"?7L"P 0S `!00 cP00ڈ00U 0U 0"qP 0S G!00 cP00600 0a U  UP`  cP00$ڔ300U 0 CP 0S !00 cP004300U 0 *P 0S !00 cP0020U 0"?7L"P w0SM !00 ocP00p20U 0"?7D"P  \cP00e(20U 0U"?7L"P J0S{ !00 BcP0010U 0"?7D"P  /cP00|100U 0 ] P 0S !00 cP00# 100U 0 o P 0S v!00 cP0000U 0"?7L"P 0SG \!00 cP00`00uU 0 nP.  l @ ̪ t ԩ h ĩ ̨  8 ̦ \ cP00400U 0"?7D"FP 0S !00 cP00ژ00U 0y"?7L",P 0Sr !00 cP00?00U 0/"?7D"P@  xcP00D10U 0"?7D"P#  ecP00Lڌ10U 00" P T0S "00 LcP0010U 00"e P ;0S "00 3cP00^L20*0 0Ra U  P  cP00p30U 0"?7L"P  0S! {!00 cP00 30U 0"?7L"P 0S a!00 cP00#ڨ20U 0"?7L"qP 0S G!00 cP00D20U 0"?7D"WP  cP0010U 00" EP 0S "00 cP00ڜ10U 00" ,P 0S "00 cP00<100U 0!   P z0S !00 rcP0000U 0"?7D"P `0S !00 XcP00 p000U 0f P F0S !00 >| آ  | 4 < cP00000U 0"?7L"P 0S' !00 cP00ڔU 0 "V P  cP0000U 00": P 0S _"00 cP00810U 0y"?7L"oP 0S E!00 cP00ڜ10U 00" VP 0Sy ,"00 IP 0S !00 20 a U "00 x30p30h30U 0?G"&"00 430,30TU 0?O""00 s20U 0?G"4"00 e20%0Uj!00 X20[20rU 0?G""00 GX20P20U 0?O")!00 620U 0?G"i"00 (10Z10jU 0?O"!00 10t10U 0?O"}!00 p10h10`10`U 0?O"i!00 ,10$10U 0?G"3X!00 00$U 0?G"lJ"00 00]00U 0?O"9!00 00x00 П ( h 0  ` L \ P x ؜ ` D 0 ؜   ؛ Ě @ d p \ $ @ ̚ U 0?O"f"00 x00WU 0?G"!00 t0000r00Z00U 0?O"!00 Z10t0U!00 J810U 0?O""00 "00 9"00 4"00 /I mI "?7L"\1 00+81 00"1 @@20 ]0 h00 0 @@80  -DT! @ ̘  d T h t H ܕ @ T  Г  ̓ ԑ  0 00Оz40 00Ǟ[X0 00⾞!|0 00ⵞ/!00 0 00⧞0 400➞s0 T00╞ 1 t00⌞D1 00⃞h1 @@0 v1 @@0 i"1 00`1 400W+2 T00N<2 @@^0 Axp2 008%2 00/2 00&B2 00;3 $000$3 @@$T0 hX3 t00E|3 003 003 003 00ڝ 4 00ѝ6!00 +S0@-SOLAQ Q@\Q\P 00 Q P0 +C 0` 00+C03Q Q 00ALL1\1 ^SȠLȠ n! 0+C{0`{7+S0+C0訒  / /P 0S $0S 0S P? @4@P//A-0Pp`8P& , R( 0"0, 4000R40G@BV@1 V @D8 ,0400G,0400(@  (8/P840, 0S004R000@-P04 R 0    $ < @ S. p T P  +ˁ0P R $ R  R S /0??00S" 0??000CSW0S; 0@8N?0 QO?0(0 S@0(0H8 080t090@5?0U2 0PE@Tx0S :00Q?0HLQD0ʆ;J?0\T 10T :0PE@00SU0 pC0 0,0 SP<@@B0S 0P/S30 PC0W0"1000000 00 0<0? S@0@0R0 GBRR<,0P0US 0S0 0T)<9 0 <0 30 DЍ M R S R  ,P0 PpB0Se 0 00 C0 S 0380U 0PE@T0  CQ1R00S000 00 00S 0S($<,(<0$(00 R 700Q?000g 80B4 R@0,5 00D 0R1P! BD  A B\000D0S0H?0 1UR0070  0P<@@0?/S ʆP<0  @@ ;TU 0PE@0 S  S S @DA?00@T80PE@TULQ{L?0QI H0 @S0 0CR*ʆ+R 500Q?00 pC0 0@P?00 pC0 0ld h ^X0Pr00001p0T :0PE@01p0WU Q 0SU 0PE@T 0S 400Q?0U 0PE@T:D ʆ0@D180+D0]Uy 0PE@T:0ʆ!H0@D80H0;uDpC?0W U0p1Wp!W[ 0  PE0C0000D00CD00(Dpl `R* 0ATU= 0PE@0 Rl @D0ਁ:R $0(00C 8 P 0l0S>0X p0P0tXp0  P 200Q?0/ R=0 U 0PE@T;0H?o20$0S0  $,0r ($B0#22cR0S 100Q?0 0G$Q   9R D Up1p!WR0 D :/ $ R D ;/ ^$ R$0\4 @Dʆ8+aD?㨁@D0kD 0B (8xp<#0#W" 0400Q?0xQ  8@D;D _ 0;??0K?HL0I ] 400Q?0[0@DpSB?0D 0 S40P0;T0G?0U @DZw0PE@ZqUH5威@D00Q?0-8tgx| p⨃@p ^*:l0wp 00r0⌠pZl :@{ 500Q?00@08 (4890(8(:0;D600Q?0E?l 0Zl0PE@ZfUR? 0 0C00S` 0 0000*p8tgx|p⨁@pp41q岠pT*U 0`4`UK PE@1q岠pW0`8Q@D{@D8D I?L0C0 PpCc 88(9b0+@\8@D 0@Dw(J0F?l0w0P 0000< 0@@r0 0`pC3( (0@DR0 S(0!800Q?0FpS>t0φp0P0 X0X 0404P( @900p.SR:@ 3 @00w??@0IQ8 8(90 pCp \ 00T d \ h P :00p0:00Q?00威 @DpC0 0d:00Q?00SG?0z0 pCp@-@PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-P@Pp` 0R>/ S  P00S   0S R?0P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000@Pp`W6@ RS?Q 0<0 1 B p 0Q#4<00M@0P00cS  B R#2^ S 3#P0S S?R[ @ 0<0 @ R1<00l0pW\V H R 00cS  Q # 2R S 3#R0S  l0Sp0pCp)x 000 0P,04hp??0x p0 0 0 30 Ѝl0Sl0@@@ O뼩LP 0S $0S 0S P?,A4 BR/A/Q /@o/A-pPWPu@ 0(+`3/PPn 8XF ( 0(3/P00@b  0 Q    +jP04 Sp:oSS0C0P0T00C0T0p0X Cp (0 8#L8Pp0 Cp0@0 0 Q    ++P04 Sp*p0 C p ($03/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?00@C/O-R|MP  080   0 C 0x ^0SCV0pSQpW -0 p p0|Ѝ:0`\`VX@~;JT\ 0W0P0S1Z0@05P0^s00R  0xS0SPRCRT@!V0!01P 0020 P0S|Ѝ|Ѝ0@ ?o2,0%R00S020$0@0(00$(0,0@?o200 0  0 B  400p@ 0SP3:^N $ %30!`P3P'( %!<: 80C1 ( RP@00F#3 0S C 0x $Q Br $ARVG  ` V  ^ F Z(  V F(*xQ B\   L\ R: 0 Q  Rf, %Q  R`4!LAS @@  401 00 ,0!00 , 0$ (0W0q |n 0O-DM0C000 C 02#03/0@S0S20 X>0S S000 00#400 03 0  0#400  0 {0S0c0?o20 Ѝ0So= 000 Ss *S00Sq00 0 0S&+B%l0S0 B8@ B0 #22c0# 0l0S q00040S9Q L0 0t0 0  R 0,0S0Q0Q0$ s0Q0s0R 0s000 00 0#400 00 00 S0 S 00R01 00 00S 0 0 0#40,0S0 0E00Q  P pK 0S PE 0SP  p W *G 0 ,0 SR B00|0S00(0 Ѝ0 0 0 0 0 0 S0 S 00R01 q00 ?0SEQ=X  2Rby0SS@ S  00 # #8 00#"0 Ztp 6l8&`6 &!6ƅ909&tpl0QpGtp0l0 WLt0SX# :Xv 6S \0l S B80 l0\00P0S P X X0S? Ѝ0 0 0,  QR0 0I000S'   0P P0S0   0S,0SQ9: R,0S  R0 0[00$0S,00  $ 0P P0S0   0S,0SQ@:V R0 B0i00,0S!  Rg  S 0 Q30S0  00#40B0q000SC 0 B040#  #800#"0 }IQ V\ R8 C0 l0\000S*pt0Z(l 8`pR B  ^L 6&p!6ƅp6ƅ909&6Rt0l 0Ct0 l St0 SX S Sl 8`p0  X 0S!0 B000 B00,00I ^ ^  Y Y Y Y Y Y Y I^oᩒ#Y@K`P`0P&0@ƅs0 ƅp0 0 1001  &6`Rt0l 0C`p t0l s\0S B80 l0\000S6^00 040[y^*X6I &RB \ R80l0 C*0,000}G 3t0 000s B00 0$+0;/D3 O-@Q$M R0  P "r !#4"  TßP ` p @ * @+0@$z '0t %{0q 1qp Q`!;`~P0#:~)4~(>6"~r !p'P% ` R `@ A$< 0# s R#4!  " "0r0S"$!00# "0r0S"$! 00#0# s R#4! P% 0#s R#4!@PURh RPERU(pR`R x R R#4( p R#( 0Rp'wpq(t'`&v`a'd&.~&.,| ., 0#s01,# p1,4# A  @Q   "Tr !#4"$Ѝ, ,L""a R 0Ppr 3 H7 1 1 \1 01 1 0 / C-PRp cmN P  0!\00#@B .P @N1R C 0 @$'4/ C-PRp cmN P  0!\00#@B .P @N1R C 0 @$'T. @-@P |p S]Np`@` 0!đQ00#B  |- @-@P |p S]Np`@` 0!đQ00#B  , 0@-1 S@]N\ C0 @$!0R Ƞp0e Q RMO-鯅RlqPWPHuo@V-B0 BPPP0 0 P 0 P 0 P 0 P 0 P 0 P 0 P 0 P 0 P 0 P 0 P 0P 0 P^0 R0clR" R  Q0/Sq  Hc0   A R,A B@P C?@P @@/R#-qHƒ7#cp c!qQ#/>c0   A R,A B@P C?@P @@// < U/ 0`0/;//? 0O- MʀPTR& Xp  1R'ʵ?0U\˞ A@`kẠZ @11: W: @ T Ѝ  Zࠁ?0 Ѝ0 O-Z `p 0`B 0B. 0F00 <@ pR  0 q0CR Y> 0 BV0 00000C01 `FR 0΄N @0 0 T00 0s ^ R 800S@BC0 R 00^<ЍP 0=0yQ / !02N[1`Vp@`67#6QZ J0 0pA-@PA^0RP@D+}n@p `0R- R1|Z000^ ^P0T0 S^ S|^P00 P0P0 S+̀Ұ0000Ұ00O-MpW``PPRO10+=Z̀0 0+=80J0+=000 Rp; W2 R6 p>0 pPn0`N Q1ss0Ѽ00#406c`UQPf RpWr 0`P ZЍY㼆`i Yv` !~:|0 cR(r `C 0`PP`0P#4``06`cQfἆv`:0PcQh06vv`0C```!0nU6~ BSr [3s0P0P00PP#406c0CR! 6W W0`P 0`P R;0+=P0aSr8`As0000`#4060cUS QuP`N0 ~PqP 0PP#406 c 0C^606 0P0chQ0v6v``0C``!0aU6q S( N ~P3s00P0 0PP#406 c 0C^6y ἆ<X QuP Br QPh Br 06aʀO-V6MpS㼖w 4P@0040030 0300300"0`0 cy Rwwp 0Cpp p"$ nV~p~p἖6S&0wp0@ 4  ` ฀ pb W zp&z BⰠ pp't pv pgXw&wpaY taN~bpiW vp&v`` I`pp`&d`v pg^w&wp0CS㎀aޕbޅa඀Აir^wwp` Ipp p"$ nX~p~p἖ `#R~ `d0Cs0yb ^wwp@` Bpp`p.nS>sps6pS἖_ 0c Q~P~"F`0CPP``!0aR!6 Ѝp἖8p἖p἖0& 06Ѝ. . . . . @-6Sڸ6 @@0 #40&006Sڸ&0 0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4&&&&0(A-@ s0`P Q!rr  pp pp"$ &b BS10& u0U0U$0Q  00  0 5   *0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 Sq@q;0PP@0@PP#406c 0C^6 S0Ҽ6ڸ0@PP@0@#4PP 06 0C6S S0ظ0@@6 0C60066@PP@@!PPƂ0O-@ MPp,0S ─&]P+(+%0 N. 0R010S@P j600&6 0 1!S*Q  S030#Z0S&0 R5|2 s000 0"$ &0b B\3&s0 R(˔Aq2&s00 00 #40&0b BQ&q0 R2&s00 00 #40&0b BQ3&s0 R@q2&s00 00 #40&b BQ&qXßk>0➢ MΌ & R~ ~ Ѽ    "$  n NP" Q   1 #O0  P0Q;S ;S <SE S 0R  , &] Pj0S  Z R, 0G.0 0R0 0xS0  0LSW4&&&& Ѝ ЍO0 &0p R2 ʱ006N.V k s000 0#406 c 0CP6@~2 &s= s0&Aq2 &s0q2 &s0 % 4# :Q0@-!DƓPV ƓPV @Ɠ@F 6@o0ƓAQDƃ<  !!ѕ"х  H p@-@P`y1r1FP t3i4FP @T @000@pVp'@ p@-M @PoЍ贺@oЍ@-M @PЍ襺@壺@Ѝ@-M @PoЍ蔺@oЍ@-M @PЍ腺@僺@Ѝ@-Mp`P @P t@Ѝ Q'p =Ѝd@=T 0p@-S P@ `0 C'0@'T @pF 0 p0A-S p@P`0PC'0@&T @*00'0p@-S P@ `0 C0@&T @p 0 p0A-S p@P`0PCd0@&T @00@- MP &p 0S p@0@CD'`&V ` Ѝҹ00 Ѝ̹ Ѝ@- MP &p 0S p@0@C `w&V ` Ѝ讹00 Ѝ訹 ЍA-Mp@P `P {&p #= 0S P 0 C @G&T@ Ѝ~`Ѝy``Ѝs@=T` Ѝp@-@3PVt3i4FPPpp@-@'PJl?o2FP p!00pp@-P`!@P  m @Cp@-@@@-@@@-@@@-@@@-@@%@-@@5@-@@S@-@@m@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@%@-@@;@-@@S@-@@k@-@@p@-P`z@P   @pp@-P`h@P   @pp@-P`V@P   @pp@-P`D@P   @pp@-` P1@P   @ppp@-P`@P   @^pp@-P` @P  v @Lpp@-P`@P  d @:pp@-P`@P  R @(pp@-` P@P  ? @pp@-P`@P  - @pp@-P`@P   @ pp@-P`@P    @ pp@-P`@P   @ pp@-` P@P   @ pp@-P`@P   @ pp@-P`m@P   @ pp@-P`[@P   @ pp@-P`I@P   @r pp@-` P6@P   @_ pp@-P!@Dg>t3GP p0P 0pp@-P`@P  f @< pp@-P`@P  U @+ pp@-`P@aaFP pP U  00ppp@-P`@P  ( @ pp@-P`@P   @ pA-P@ g>t3GP @p8`P  @P`Z:p@-P@ g>t3GP p0P 0pp@-P`%@P   @ pp@-P`@P   @ p@-@R  @ p@-@"Pu l?o2FP p00pp@-P`@P  " @n pp@-P@P #@_ p@-@"@@-@"@@-@"@@-@"@#@-@"@A@-@}"@Q@-@w"@o@-@q"@@-@k"@@-@e"@@-@_"@@-@Y"@@-@S"@@-@M"@@-@G"@-@-@A"@A@-@;"@W@-@5"@o@-@/"@@-@)"@p@-P`@P  C" @ p0p@-P@P {"@ pp@-P`s@P   " @ p0p@-Pa@P X"@ pp@-P`P@P  ! @ p0p@-P>@P 5"@~ pp@-P`-@P  ! @l p0p@-P@P "@[ pp@-` P @P  ! @H pp@- P @P !@7 pp@-P` @P  ! @% p0p@-P @P !@ pp@-P` @P  p! @ p0p@-P @P !@ pp@-P` @P  M! @ p0p@-P @P !@ pp@-P`} @P  *! @ p0p@-Pk @P b!@ pp@-` PY @P  ! @ pp@- PG @P >!@ pp@-P`L @P   @u p p@-P: @P !@d pp@-P`) @P   @R p p@-P @P  @A pp@-P` @P   @/ p p@-P @P  @ pp@-P` @P  z @ p p@-P @P  @ pp@-` P @P  V @ pp@- P @P  @ pp@-P` @P  3 @ p p@-P @P k @ pp@-P`y @P   @ p p@-Pg @P H @ pp@-P`V @P   @ p p@-PD @P % @n pp@-P`3 @P   @\ p p@-P! @P  @K pp@-` P @P   @8 pp@- P @P @' pp@-Pc@ g>t3GP p0P 0pp@-P`~@P  r @ pp@-Pn@P @pp@-P`c@P  R @pp@-PS@P @pp@-`P@ aaFP pP U 00ppp@-P`W@P   @pp@-P`f@P   @pp@-P 3@P <@pp@-P C@P +@tpA-P@Y g>t3GP @'ph4`P  >@P`5p@-P@; g>t3GP p0P 0pp@-P`@P   @3pp@-P@P @$pp@-P`@P   @pp@-P@P @p@-@Q @@-@R ^ @p@-@0 P o5m5p@PP 0S  pr 08@- @@ ilP 0R @-P Q o//$c c 0S p@-@L`P`PpfP p@| h| P o0o 0 @-* d  @-P Q @Z@ a<0< 0 ( b$0$ 0   P   , m0 0< @- t  A-P`p,! B3@P P` 4lpp5 %P` ,  @4# 4,<d@- 3@P $0 0 0 tA-pP 2@P t0 0 0 `2PP  ߯P `0 ,0, 0X @(   @-@P @ {m-A-M pW $P 0P'@P2`P  0P ]ЍAЍ/ЍAЍ/ E0 0t E  T @-@P @ :,p@-@P x0 00R0 Px20P Q  " p@SppH^ p@-@P `0 00R PV20P Q ! p@p] P/0 00R /<P/<0 00R0/P/// ] @-P d0o00QP  00SQ !\ P/0 00R/<@-@P \0 00R  10P Q }!00[ P/00 00RP///[ A-PPM 0/o0"0P R Ѝ R0 p 0 p1`P 0 S  R D  `P 3  00@! Z Z A-@PM 0 00R ЍQP 0 ᕢ ppn1`P 0S d P ކ`P 2000( +$0$ 0 H! Y P H0-0/o0"^ R  R/TP/D0 00R /@-P oX P/D0 00R /@-P oX P t0/o0"0\ R RP Q ֩$QΩf O/<X X P 80 00RP ๩f O/W $0A-SM`"P@U Ѝ0 PwP 0pP 0 0 0iP S )2 0@P d0 0 0 @Ѝ4 PSP  8`p 0 //p@-PQ& @R 0Q: Pp^1 P `0\ \0 L0H H0 804 40 p p @ P p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ Ppp@Jp@-@<PEPp/>P Q 7P Q>/P  p@) 0p@-SP` @ 0S @Pp<P QQ P/P >P  p@p@-<X@P@(@Q Pp$pP  p@T 8 $@-@P@ @-K/@P  G/P0 0, 0 @0pA-PQ@` S @ 0Ls0S(<\)0S% !S%0-S 0F?o2-\0S0S -S 0-S>^ 0Ls0S23 /S `(`  0Bs\00@03<0/R>R  pp@`R  0Bs0S73 00/R>R FU  R`@P0/SZ 0$00>S^ Se 0S 0Cs0S`  ` @23 0As0SQ ` @r R00@ 3" =P  R @P  0@s0S<300=P00S`A`0"S0S   0"Q-"Q* Qw`FVt0Sq 0(0u(0Sj0$00>S`d0`000 0`L H0H 0  `z C  >RJ00  h P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /@- j?oO-KM `pPL10 000 00A P @ Q, U G?PP0 3/P 00@04/P 00 0 P] 0SPKߍP@0@;/ 0 @E 0SKߍ G-,n-@PE aPqP@`p 0Bs0S/<R1  i$P   c$P  ]$P#0 S -S0-S>Q0 >SSS 53 @.| VA-PRMePp`0 @T- 40@0W  W[ 0A/R 0CW /RW  CW0 B /Q @C#@ T@! ;@04D .00 0 R *$ 0 0Fp@  U 0@:q봪0@ۍ讪? 0 ۍ觪 0 ۍ S0p PZp /p@h @-`-MYP,@P4 ,p`F RpI pEe0RAp#0 `#U00p)  G  000Up0PP( Ѝ0 ` U00p  $Ѝ@-Ѝ-@Ѝ-@@- @@O@-fP 0 0 ൧ D L O-IM  @T V 6/ p0 PR @Tu 0 R 2/0P`f` P0 p 03/V@ 6/T fT T @T@- 0S1 0 3/P V 6/f@T 0 R 2/0P`f P V 6/X3 003/Iߍ 0 0C/< 0 0C/3 0 0C/* E0 0 !p ;l0l 0 X BT0T 0C/ l h X D ( t  P , p@-P@PP  P $0SP  R P,pd<P P WPP , 0PP 6 P P0/O-MM(p@ T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT0 00SP $ 0R000 Mߍ R00 0 0K/UD 0/0/@-@@P 00#0 0 P 0S S R/P/ R0/  @-Z@vpx 0p@-(M@P |  h``bP (ЍpD  P v(ЍpH  @- @Υ+谩@- @@!Ť耩 p@-M@P` `0Ps0* 000 Ѝp0"Sp@-M@`P P(qp  000 Ѝpܧ0"S 00 S 0 P:\03#/S 0 P\0///A-P``T@P ()pP ;@P {+ᅤW@(0$ $0 '봧  00 S 0 P:\03#/S 0 P\0///-M 0  Ѝ-M 0  |Ѝ0@-M@P0  @0oЍ00@-M@P0  @0bЍ0@-@P ,0 00R /P/0 00R / 0  Q 0R* R0:/- ^ : P *0 S0*/@@/ / P $0 00R //P $0 00R //hP $0 00R //0P $0 00R //MP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/P/l0 00R / 00 0  S *0/ ɒ\* /P/|0 00R / 00 0 S *0/ - ^: P/|0 00R / 00 0 S *0/ - ^: P/D0 00R / 0 S0/pP/|0 00R / 00 0 S *0/ - ^: P/l0 00R / 00 0 S *0/  \* /P/l0 00R / 00 0  S *0/ ɒ\* /P/|0 00R / 00 0 S *0/ - ^: P/D0 00R / 0 S0/P/d0 00R / 00 0  S *0/  R* /P/d0 00R / 00 0 S *0/ R* /(P/\0 00R / 00 \: /!S /P/\0 00R / 00 \: /!S /@P/T0 00R / 00 R /! /P/\0 00R / 00 \: /!S /hP/d0 00R / 00 0  S *0/  R* /P/d0 00R / 00 0 S *0/ R* /P/\0 00R / 00 \: /!S /P/T0 00R / 00 R /! /- P M D0/o00"^ R Ѝ R Ѝu P/L\ /  JQ\/P/L\ /  JQ\/lP/P\ / Q/S/Q\/ P/P\ / Q/S/Q\/0Pp@-MS ` F Ѝp$0@S P0-S 0S0xS {P T ]P ЍpPeP Ao/A-PP@z%@Pp t0,p0P4080<0"&P`p @_%@P&@t\T  @-5@Q |(@-$@@8 ۟@-@@O-4@T ,p@Dp@Ѥ@T `P煑Q PZ P PZ  0z 0 ਠ4 H  @-R 0P< P 4Q ,  D c@0@ 0 , (0( 0 yh\ 8  p@-M@4 00R<SP,0 S R( 1`V9 P` 0 05P 40, 0C40P0 `ЍpS a0 0D =Ѝp& &ЍpR p l0l 0D %X qT0T 0D @ a<0< 0D H d < P  @ A-@`,p%PP W 0 !D,P0`%,P0`G-@pMP P  `%'00Ѝ!0 E`P (0S0 0 :P (0S$`V0 0  0P 0S  `P  P X ` 0 |P q%( K$0$ 0\  < @ 0 0 @-~P 0 0 @-q p 0p@-S \  Q @P=P8p {0 0 Q됹 $ p@-0S h`@P`Pp_P p@ 0 0 -<  \ 40@-S , 0C40P @j@ <0< 0B/( $0$ 0B/  p@-@PP0S ,  Q<0  0p@fطO-p`@40Sb LCP@ P 2P0U#P 1001000`S[00<0 0 00 0SS 堑 # 00R&P P [I P P  P 0  03/P PP 0 S @6\O&, 00C 0S 0PS APx@` \0\ 0J/YH D0D 0R/PX <d h @-@@)0,S<SS $HPG-K `0pXJXP@+ 404 S S> H000,  0 0,0$ 000,0, P  ?o 0 2\0S `P*    0SP```D }@0@ 0.ѝ, (0( 0.ȝ t  G-`P& 0 0R! 4P 4 R @,0Q p,04 P@Tp:80# r Բ0P 0  Q@-P80080/ p@-P@V80080p@Op@-@P 80 0R@ pPA4@>p許p@-@P \0 0R@ p`P,00S@#:&p=@XA-`@T 0p0WD"PP \000P000e0@S <0 @ 0@԰A-`P 0 0R4 p40S @40S,0@ PPBpp4A-@P 0`0VpP0S P @T @ <0< 0R/ʜ@@舯| о A-`P /o0P0"Q@@T 00R p @P @T z@ 0 0R/̮ ܿ O-@PM 3` 0R PЍ4 00R80p O PP @`P @Ѝ S  P NP2  004Q[ 4[^ , P1 Q  x PYUPE Pl P P!PZt 0 ,0傁14 `<0 4 0<0z ᒑP,UF<UHUJg [E  С0 PP ^ P! 8 V 0,S<SSK !PP6, P<00`<04Px00  '[. / ,$ < Pa! Ps,04  `<04 0<0R |0| 0^/ఛh d0d 0^/৛*L UH0H 0c/ăj$x  h 0 D ȼ p  G-@S ` VP p P U! 000 GC! 0 0i/`Ի ( 0P L- ?o2 ^0S 00 S/T@-PP M @1 0R Ѝ`@ 80  Ѝ U0P 4 Rp@ Q(*,S0 B!Bs400C40<00<0ZXh Hd0d 0s/P JL0L 0s/8 I404 0s/X t 4   ܹ d P/4?o 2 R0S/00 S/p0P D- ?o2 ^0S 0 Sm/,P/0 000R/ԦP/0 000R/ᨦ P H0-0/o00"^ R  R@/|p@-P@PP fP 0 03/P wP PpPM p0S /A-`@P9pP $P p0P  pAcO p@-P@PP  vPP  p肜` ~`p@-@P -0@Y耲 @-@0P P 0R R@-P0S //o/804 40 $0 0 X ( ĸ  O- 0S: @`@P1 X3qPp 0S"  0S P X0UUUH#B!0@< .B,? @P0SOOX% X@0Pp#r 1 Z W:<C0PQ. Q QH Q Q <Qh =Q$ p0P Z @Q Q Q Q Q <Q =Q pP @83`]@QRЍZx`Q 0As0S;<Q =Q p0P @`Q 0As0S"<Q =Q p0P @4`Q 0As0S <Q =Q pmp0P @}8383083 P`Q 0As0ST<0ASJp0P @`Q 0As0SJ<Q =Q 6p0P`Q 0As0S;<Q~ =Qz %p0Pu`Qq 0As0S"<Qk =Qm p0Pb`Q^ 0As0S/<0ASWp0PQ @83F83 83 830 `Q: 0As0S0<0AS3@oP- @83 `Q" 0As0S<0ASoP[0<SS80S0P 80`Ѝ83 83 `@0S <S`6 S @ 13 0<S S ` 0CS@0S <S@ @ CR=S0 P 0"0<SS0S [ [<S``h Ud0d 0X [똶 l <  L ( ر H p   A-`P@P d U0 0 0 pP  wp P@q4QPp@-P``Pm@P 0`0 Pp蘘PQp@-`` @PW`P  JPN@P $0`0 Pp@QPp@-P``P7@P 0`0 Pp@-@P T0 0R 00S P000舗P/0 0R / P/0 0R/0P `o@-^P  ^^Q ۗ/ȖPp@- 0 0R@U T `P  —@pT X T0T 0x h@p4 000 0x \@T X P ĩ P/0 0R/|0P D- ?o2 ^0S 0 S/TP/@-D@T ?o 2^0S ,oA-M$PU@`P !0 P 0S6Ѝ 0P ppMPP 0 0 0}P7 0R3  P, pW- 1@P6 0P0 @  Pp 0  0R0"S | x0x 0 ඕЍ@P P0"S{`V `  , /P/< ?o 2\0S /0SP/ᰒp@-4@4P@PN 00Iphd0Sx d @-@<<T(@@ @@@tLNgg@-@P (0 0R萑P/0 0R/TP/0 0R/,0P D- ?o2 ^0S 0 S/0S /$0p@-S@ P0 |P 0 uP ttp@4@ @0@pLLL@'@804 40 ؝ ĝ LXftL$f8 ȥ A-PP@%@Pp |```0,p0P4080<0P`p @@P@갏@-@@ @-R 0P< P 4Q ,  <0B8 80 (0G$ $0 {l  Ĥ PG-3 pP0`W2W@ 404 SS& 0000P,0 10,0$ 10P+)P* !   PP@ <0< 0( /( $0$ 0( &Ȥ x ` < p@-M@#S4RP,  R S 1CaV1 P` 0 0P400C40`ЍpR e0 0< ЍpS L dH0H 0< ܓ4 u000 0< ӓУ h |  X , A-@`,pPP W 0 !,P0`,P0`00p@-P4Q8 @Q 4 ,040<0Q0<0pPp &0 0P , 0 Ġ @- M`V& @Pp P00 Ѝx 0 P (0S T @0 @=P  Ѝ$ B 0  0` Pܖ L Z0 0 @-A h 40S 0C40/ 0 0 @-.Ƞ t ` 0p@-S \  Q @PvPp Z0 0 D ܞ p@-@P t0`0VP0S R<0  0p@$ ] 0  0 댈 @ A-`@MP40SO 6P@Ѝ P d10XpP @10041000@SB00 0< 0 0S /0 03/@P PM 00C 0S @ 0@S `PblЍA+1L@8 404 0,n!뀔 88  ĝ < \ SG- p&W@ PU 0` 0R 00 $P U  G 0 0F/0܅̜ d SRA-PP 0 0R4EpP 40S @,0aN, 40a@T:8 408 p@-P80080p@-@P 80 0R@ pP0@pTp@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P00S@#:p@괃A-`@T 0p0WPP \000P0000@S <0 @ 0@k@0Lp@-P@`80080p@Yp@-P@T8@Q@@pp@-@P 0 0R`PA40S ,0AT 8p@p@ R0 0O/L0<  ԗ A-@P 0P 0R Pp`8040S !,0X g,0QP<00<0pPjPD @0@ 0S/, (0( 0S/눁H 0 $ p@-@P H0 0R@ p`P=@phA-PP0 0Rp@4\ 80,0!aV! \ ,0\ <0L40<0AAD @0@ 0W/ஐ, (0( 0W/ॐĖ \ t 8 0P D- ?o2 ^0S 0 S8/~p@-P@PP ^P 0 03/P oP PpPEp0S /p@-`P@P $0S p p@Od p@-P@PP  vPP p肒`~`p@-@P -0@Y܉ 011/A-\@`pP \"1S 0 €  P 1[0P !`p P 1@0B< <0 ,0A( (0 萕 \ $ < @-@^ P ^(QRS  T00QNRS"  T  00 Z0 0 এ봔 ( 0@-@R,MP00Q! P! 0       D90T?o20S00,Ѝ00 8 , - 0    S00000000 0  P /- 0>   \-0 <Ͽ \p@-@P(MP`/ 0S, R00$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  :V P0V00(Ѝp@ R 0S V00H PQ0 @0/@-@p00T000@-@T @-@T000 000S/@-ɐЏp000 000S/@-㹐萏p000 000S/@-㩐Pp000 000S/@-㙐p000 000S/@-㉐Ўp000 000S/@-y萎p000 000S/@-iPp000 000S/@-Yp000 000S/@-IЍp000 000S/@-9萍p @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^  \#JJ@J0 02#/I0 00#/I0 02#/I0S@-@1/00/T0T0p@-@ P`0S CPppÏp/@-㺏-@-r000 000S/@-㩏PpAo//p0@-@ MP  vHP Ѝ00; 0 T X p@-@M  wDP pЍ$0; 0 y D  p0@-P M@ T T T  0 Ѝ0 H@X Ѝ00: 0 P< Ћ p@-@ ^B @@08 0 : p@-@PP (P$Pp07 0 &D ` p@-@PP (Pp07 0  t H p@-@PP $Pp07 0 ꬖ ` 4 @-@P  <Y.+ < 00; 0 4 @-@P ( 07 0 ь(  @-@P $ 07 0 ࿌$訕 Ԋ R/-~x` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@P48U%U%E 3 @3C0"!@11@  /  0Dp@-PQ@ : S d S V Sb00Z !-r0-000w- R[ >R-   @Rx  : r -  w -   RG !R-   Rx  "0r-@w- T8 T2 T8 T0x     p Rs   ! Rs   0 Sp00  Sc00 ?00 S1  Sw00 Sl00 S  S  t 0 T 0 - 0 `09\ \0 @: SqA00ua0-00pd00ms00j 8  G-P8a`9  pPA 7P<  ipP$ 0A0`@@T& =P0=S AP` AT BU! ċL0>H H0 A 0  ̃ C-PM``"\2X 0D$PTm X`pP ጐP吐唐嘐圐巌p@Z pp ᯌp@e $P7  0 p@] X0@4S8040p0<S@40040,4,,0,덈<1< 000D000}ᛈt,X %ꈌ0S op@ b ^ @ЍIOoBЍ@b00 B = 9ꘃ pl O-PMp 0GW"S00` 0v@~P-TPg +T@`0U ǯ  0{ 0 { P ! @00Ds \a0DSW0DA0DS70DWUY :Q P S \ P"00 0U00S0S U Ѝ0pS 0F00T' W 㙙 㙉 p噙I㙉A p@0` 0‹ 0R0 00Ѝ0? 0 h00XS00 C R @`0 p0} A BRWgp pp~  ~ 0 0 0:z7O-PMp 0GW"S00` 0v@ᶄP-TPg +T@`0U ǯ  0z 0 z P ! @00Ds \a0DSW0DA0DS70DWUY :Q P S \ *P"00 0U00S0S U Ѝ0pS 0F00T' W 㙙 㙉 p噙I㙉A p@0` 0 0R0 00Ѝ0? 0 ˈh00XS00 C R @`0 p0} A BRWgp pp{ | { 0 0 0:v7O-MP@8p@X"0  \.a,Ѝ`0 00\0 0000m0Si6#0P P` U0`0[000ʥ0! ` \P ``t!0\  P``,Ѝ?/%1R5%%;R:*%6R~0 0 S` P$ 0u0 0 $T"0 0 Z0 0 P`d` 0` \ P ``Ypt|lx x xw v u v u u v u u \v u u @-M@" | d@ 0S D <0 0 |0 30Ѝ ]Apo -M( , Ѝ mD90 0#0/00/G-@SP( pE`J5xQ* 0xQ J1xXP 0 U 0C0P  X$0 0 ss ht t O-pQ,M 0 [ 0S W [  L900@9 P0S 00$9`0S ) )  bP@0+0C< H @p  q 0z 00C 0B0000 S00@T- 00XF0-S@T,.P0-S0  1 0,Ѝ ,Ѝ70p p -T0 :T` `= 0+ B R ]0P1 WT ~ :R 0S000878G04@q0p 7 0  ,ЍF@q 0 0 B0C00 S000600S 0:S |0Tl6? 0@X&_T6T  0~[8&464 0 s 0S&a6  0gW%5 0\[%5 0Q;R~0S00BX0>ʐ5 008500S 0:S d50H 5W 0 0+ C :R :S?2:0 0S0`  :R 00X! $0 0404 0$ $ 0 SF = \0P0y C00 0Z p@`Pp PpP`U  0Sz 2PQ z  Q Q ` 0PRpU0SpP@z `S 0BZ0S" 2 00S 0:S  a0 S2 00+ Cea0JS0S9  00 SP0 S`,ЍpP y1 00S 0:S @ l+ 1?0 i1 00S 0:S  Z 0 1S0$000<1 00S 0:S  00C 00 S 00 00+ C010!0 0 00S 0:S H t00@0+ C10m (<,( ds r D4 |p 4p $p 0p pp 4p p @p p o p o o o o |o po l 0 P @  m ,l k pk | j O-pQ$` V 30 R" P@T60䢟 0R1-[@P-T@PB T"RPP v[P -@o[0P  :R8 T2 0 0S<" 000P@P:T0S" 000100S 0:S j0 ?@0S1 @ 00P x10Pp1 l0h 0:S2  X) 010:R0@ 0S -0?@ A0D 0 "VV0E 0 M00000@ 0 }@{c$H # ,#h,hi x 4"|l0 0 h f h h h `h g 4!$!h$ @-@P  @O0/ 0 Ղ`g g dg @-@P @m(0/$ $0 ‚@aHg tg Pg @-c@-Q Q Q  0Q 1 0 0 0 mS)r0! SϠ @D^ N 0r0!# \ 0 菄T 0 $0 0 9 g (g f f Xf f A-P @` 0#03v00aVp BT@! h 0 0R010YpP   F 0  p`QPA-`M`! PpP@ BP& 0p`0 `` 00 `0@P Ѝ@00Ѝ0P@P @PPhX0 0 X4l[(0@- @ @X 0U0! V WppP`P`ఁP) 0 㼀0@ 00D $P,`(p0W PpPpV W dp``p`TPPH``ɂ00Vp||Xp@-@PMP& U 0`1S ,0S  㫁$0S  㤁 pЍp@0<< <0 u(0;$ $0 l_ _ p_ |^ _ L_ @-@P 0S$ t0 P @0P 0 0001 1 00st40<0 00 ;R 0 ] ^ ^ p@-@PP% U 0`1S ,0S  =$0S  6Gpp@09< <0 (08$ $0 ] H^ ^ \ $^ ] p@-@P t00C0S0 Ptpc P07 0 ,\ ] ] --M  FЍ Ѝ/ -- M0 0XF ЍЍ/0P0@-$M R2 P@0S$  S"t  B0!0 00 0$Ѝ00tL0 @0 P 0S$  ] x\ dP 4000S$/00//0@\  \ C-SPL R44p pP2 PD0 p B p PP!@T Cn`4 P8T݆P.{P& @T@0S  : p0 0 <8 30!ݍ\00T P0P 0 }0M\(a Z L ] (Z 0Z O-@$FM`4 M Q0琤t0d40㘔 T V Z YX (d 0K00;FPP0S 0K PW  0 P(001P C$  P P$7W ,P(.,,1P $$W ,  b `#X3 0 d4 30Fލ Ѝ4 0P30 rzPmzPh / كP@ @W  QC0Xj Xt "0  W7| x B0\\ 8@"y<2< 0$}TO "z2 0}VF"{1 0}Z=!_1 0}3gPl 0$0S㈑ / jx! 0 P  6P1L!0  @ 6(1$!0  @ 6  @ M8 E0 <KDJTX X X X pX Z TX hZ W 100S1|!0 &l!h1h t 0vTL!H1H t 0vXv,!(1( t 0vlᓁ P \0S  S 0 0 &0 0 &H0 0 0 &0 @D2DB N A 0,N > LA |@ = A @@ = p@ <@ @@ A-@P0M`p, V5 W> P  0 B  SP: @T@T 0 pPP 叉0Ѝ @P㈉0Ѝ 0 0SvVd ]`0` 0HvWD ^@0@ 0=vP0B > > ; > = l; > = @; -P$M h00 @ P !Π0 (0 0 0 30$Ѝ;,,-P$M d00 A L !Π=0 (0 0 0 30$Ѝ\,(,O-p `PMP <2 B00(2@0020 0v0   00Bq PaBQWBABQ7B R0 S AAQ 0 &0SGBB(00 D0S0R0S? R0*@D TT.@Ѝ0 T:0} 0 u0p D0TD0[0S [?0:0` mu0 00\0X X0 [uD0C@ @0 Ru n= > = < < << < << ; x; < ; O-0l@P@?0P R;T !3*4.0q0 ,p( ??p?0 S`#20Q * 00\* 0U0 R* Q * 0U000?0R*00x?R`@0p1?p# 0S ?0Q*:00T: l; \; A-P@@`<0@p,00 Z@'X@-@PM  0 0 T0 H  @PNЍ$03 0 t9 8c 4: |9 @-@P(M $0 0 000 ;P `00 $  (Ѝ( B$0$ 0 qtl9 Pl9 ` 8 p@-`P8M@P ! T* U3 40( 000 $0 ,00$0Ph;P+" 0# 08Ѝp 0 0 8tTt p0p 0 -tUT P0P 0 "t9v 0 9 8 $8 7 \8 Xa 7 08 7 p7 <"<2 O-P0TM`0L00w Vk 80  00 !0 0MPPf @p 0 p@P< 0+S+0S((e P, ( 0$   x P0 $W,$j,0Se 0 0 L0 30-TЍ0  <P  \ Pu 0 p Yl0l 0@ sT XP0P 0@ s}$47 A 7 7 (#5 ^ 5 5 `5 4 !1 O-IM0p010hWX PP[ @` 0 `6@P; 0+S+0S( P  0   P   0S` 0 0 1 30"Iߍ P #pPE)u 0 D @0@ 0P s*"T? 4 4 3 \ 2 0/$ 0 p@-@P0MP000# U+ @`ፐ0  "" 0S0 0t h0 0 0 30ЍpL04H H0 rU!PP 3 x2 ,3 2 !1 @-@P0FM Mp0d40. `ߏ!PPd@!+  P t@t R@d \0 0 d4 30Fލ Ѝ0 N,0, 0 dr41 1 1 @-` @P0dM p00\00 Pᒏ ᬏSX P0 0 \0 30 dЍ0 h,0, 0( 1r[\1 1 0 77@-M8@ 4@,0 Ѝ0 0P1Spp// 0 0@-PP0M@000! T) #MP0 \#2  0@00(0t h0 0 0 30Ѝ0L0FH H0 qT)P@ l0 P/ 0 / G-p!P1M ࠐ0 E040$em5P90D W06p;t0& T APP   uT0@To0s@(s@  } 0 0 4 30 ܍+s@sU@ 0 PPDkQ^px@|`Dd- M 0 Ѝ@-` @P0dM p00\00 P 0X P0 0 \0 30 dЍ0 ,0, 0 &qP|0X- , $- 8 80 O-@Q0M000( (0S \@@P  @0\(9:E\l`@; 6obAP p..pH  - p'TPP`ep( Ppd $0<ϿL獈 gq!h *h .' 2/@)@ tDPpP:a5_ @& @@( +@,`@$ppx@n4O `% "`P`!P `|}`&i8` P.*P P%Pmgq1戠 $@)$@] @$fa0@':+,M eQ !. &p ,07 ) 8dA`(9% `& " *o  "͌/``(,``*   8_n !<``P(**_+$ꏠ0뿠p'* * p' !ꯠl p' .  pp@ "p @7$@$4(O *$(ꏠ8`뿠,`** &)<`뿠ꯠ) ) &`0韠꟠,- `  *a ⭊(` ((`   . p' p'b! p'`& `&p! pjp'p}`&`4` P%P% " ` nP%* _PP0 ! 00 $P0,@$gq @$@$$ 0#䏠 0#F %O0.0 `0# 0 P-`!00,@ !@'⭊@$b!០@  p .pjQM0#p"0# `0#! * ,0**dA0%4`00#  n $0*-*0$ 0#a 0P ++ `P.@P%0`P@=*@b!]*@!*@$c1+o`뿠 ` `@"*.*M*eQꯠ D .,* * ` # `. dA*` ..- `0 %$`.0a*.= . $.b! `P`P*0] . .$ `@4`!.c1@* .M ."*eQ$ ```& `&`&䭊 #!dA@@,`  @$ @$4 @$/ @,  %0 " @( $0@$j@$-?@80 ` 0.P0#`P0$ @0#a 0#@ ]o<``*`&b!`0@0.m),!0# !eQ០  p' 08捃0 p' p' 0" 40p $$p *< p0#fa *% ,h aA-| HP P00+++0b!0`0` a)0,0 ** 뿠꟠@%8P*P@P*&<`? P0P 0*` *P0P]o `aa4  (. 0.$/0 0 $0@ 00eQ= . .aA Ϡ @ * .a.  c1 `  ,-` (. .!؁ "0%0 0%0?S@@h $m0hV@Hp` 0V@@p`F A mH D0D 0 k, (0( 0 k     X !1 p@-PP0M@000C TL 0 0R0 0R1130 0~? S ``4` 0~? S {U PE "0 0R1<30 |0 0 0 30Ѝpd `0` 0( {kTD @0@ 0( pk  L 8     0 0@-PP0M@000! T) MP0 \#2  0@00(0t h0 0 0 30Ѝ0L0FH H0 -kT)NP@ P H p @ G-p!MP1M ࠐ0 (E050,eP:0E W07A;t0' T CwPP!  ^T0@To0m@l@  | 0 0 5 30"܍Ѝ+l@jlU@ 0 PPdQZ@pp@|`- M 0 Ѝ@-` @P0lM p00d00 P" -X P0 0 d0 30 lЍ0 ,0, 0 }j 4  3 E7FN v$I2 A0 13L /O-|M8@@P  @0\+L E< @08p,Pd0p'0 (`@p @ 0,phzP P,T `0#dk0@ˎ@@Pc9@' !.@8@g{DhH# +  \.c; PPHklˠ$P )`L ``d`&靇` p`@P+ P%ip@P@Pk@$Pg|@ 0)0#T0a@舌 Q}- 00 R- xB@-d k@4  R  *4 8/ t0 S@- dO@ 4 *8 R РS /`0xBM Ѝ/+S# /S0/--M  {Ѝ Ѝ/0  0c <cG-@PMe `Pp 0pp $p] ,0p p pP ,0 pp  pC , 0pp p' P " p A@Q \010!0R+0̠@P Ap`ЍUe0 S s$0< 0 /c  @-PR0 00//@-MP `@ pcpPU0D>S 0!31000 cЍ>SL 0!31000c00c00H/-p@-Mc@P@U0 ` ` ;Px0x 08 R;0Ѝp@Ѝ/0 a0:( $ :hp P A-@P`PpZ =VC #X0FS#S !  +0F0 v`0U`PPPU` 00 +W% -W' =W000U=- @0 D0+`%2! 0P0P P P<0]8 80 `000000h l p@-@PP_  I0@0RuSpWSOX0CSE4 *pP0R \PSPQP\     0 T 0+S -Sp0 b0 0 s` O-\Mx[p H@8P 080<0@0D0n`l 0kb @0)Rdb@ T8<8000p0000O 08  0 080$0`8$a0GS!si `1b00.b@ )b@ \ЍX700P700+W@ 0-S 0=W0 0l0P@ X B R j b\S  "=W  R"  0 P:0@4a 4Qa R4 "00剑 @0   P0X# 0@ T:4a@ p4tQa0S|40"0@剑 @D@0@T 0VX 0000pW ,WspPBS0P! Y0P4a 4EQa RM4 "00P剑 PEP0P   P0=W +0GX?o20S# Y4^a P4QVa0S#40""0P ႑ PEP0PU 0VP0X00E0PY4:a P4P2a0S40""0P ႑ PEP0P0T 0000 V   ;I?I00V  l0S0@ T:4` @4P`0S4@00 0C@0@Tx - ? 0+ 0 P0\Ѝ'mp`` =W  0 0!]0 ^!]$^lm1Es`00 \Ѝ00[pI  p X`+P-@ +0B XR Rl  p+0B0+R XR  -Rp  X@PPQ`d0]` `0 C^}L oH0H 0 9^|  x D 0@-@PMP 0P@ @ P@p`Ѝ00: 0 ^ l D 0P P C C C//o`/00/00/00/ 00// /0/0/ 0 /0 // /A-@pe`5+P5U PU  0 P@P PPrdP X000p@000_P#!_P 4 T 0p@-0P`@T @T0rS  Ppp@P0+Spp@l@- M@`PrP l00p@0p0 ` @ Ѝ[00px@- M0P010 0^ 0SR ]0P0 1 00S[p@( P 4[0 <1 00SE000 Ѝ(w0 0 @4_@ [0 00S 00sq^@ Ѝp0l l0 \X0T T0 \@pPl8 , $ k h D Pk@- MP !R 0SE 0P0 \1 00S5p P 041 00S=000 Ѝ ^0 00S@ 00y^@ Ѝth d0d  0O\L H0H  0E\0npji \ hi@-PPdA M@I X1p0S)H1@T2 `0`S@% 0SNV00+ 0S$`)^0S1 vApP P Ѝ*0@T0S ^P00h\0 0 L H0H 0 [pXhh0hh G-`PHMP6 p  0 p@ p@ HЍ P 0 hp p@ GHЍ]0S @XH0>D D0 [ 0P R@ O-P G1@0 p 2 0 (P`000h0Xl4p0$0`oP0,00 S 0OT| 0 VT00X0SP` 00 !U3U0h002d ㈀`0 C0$0@00V (@?Ď1# 004 X<ЍD3000,300}30$0040,0pIW'W G2@ d@p0 B0@p@pr2@TpU0 0 [VP0X40P`S 40S~ 0Sd 0DVP``0 ( 00 0$00?c&!` `#4S8 5HU1>O0,0p 0 0U '.7PS0`P`P` 00000(01X10`0d0p 00000(0%,!9(1( @ 0NZPup`d0O,000 S*P< Yp@KP  $ t p@-`P@P T U pPpPUpH qD0D 0 Y, G(0( 0 Y P h H @-@!M1`P Mp0040) T P+P* 0@ $03/ 0 0 4 30ۍ Ѝ` E\0\ 0 XD C@0@ 0 XXp  H G-P@H TQ P` ``a V00"5PP- pPZ 0SY 0p R 0CP000PB  W P8 0 0 0 !0`V#*o`pP, U !?Y 0 0 cXT |0| 0 XXoZ 0 0 0 0 P ̾  8 O-MMM&P0p6 TD0e040600b W4 0S= UF VO 㰠3ZU0*U@@ R R0 0C?o2000 0RU0  S@0E00S0000SnV0 0+$0$0 @y  $02/$0Zx 0@ ,50000,00H(00 3/ P!   0S00&*  0.S 0S R X: R  R , $0P8 $0* R $0$0P ( C Q1/ 3 C10 00@P000 0000S 0 pP80: S; 0# $2 MލЍ$0iK$0Z R + 0!P @kY0 4/P 0 000r 0  0`0P0BV{ 0SG 0+ $0$0PF  k 0.Sh0SS 0.SbO Rh  0@0j  2/0S]  00.S8 G $0Ps $0 @C0P% 0!1 0, V0S!|1| , 0VU`!\1\ , 0VV*@!<1< , 0V$! 1  , 0V!/1 4 0Vy0X0 R4 SH00PX0 PSPPPX0/ 000  x      p h @ <  d < O-P\#`X3KM MpP@0؄ܔ040_ Th Vq Xz \1 //\ 0 \/\   U"2 0 4 30KލЍRb/\]^*@U `/\ \`  `P 0   R  t 0T/S 0: SW S> 0 00G!1 @ 0UT!m1 @ 0UVl!nh1h @ 0UXL!oH1H @ 0Uz `@ 0`W `+P 0 @ (03/0S0: SU/00ā00āf0| Sx0x H 0UW/00ᲰSX \ 0  0 H O-M4MPQx; ,0l%` ; @0~SZ 0p$ S  + ?[ -/O]*O O! O/OO  *S1 @s000S ?S! [S!^ Q00@ S000WS 0G Y, R  r@X 0Ა@< 0 0R  R* Q Რ@   0p G0 0R/RC00 4ZS *0G, 0;zP4S 00C PIR*0S0;R @G G0Wnv P +a@PS ;",0  2 ۍ4Ѝ@P0D hSR 0]S0!^0q 0]S  s000-S]QC q沰0 ]S0@0 0< 0<  0BXo 0RSlBXi RQf@+0 QB  0A0 @10&Q Z;P]@!^[00  @ 0p$ {P0P[T*0G, 0;PL 000lh@hp@p0P .TX 0)TS6@@OM@D/ D A-`QMP3 0  0S0 05{Q p@Q {Q @0  +P  jЍ Ѝ0}S0S ЍAY8 404 0d SU 0 ꄼ 0 Ի O-MM@PP`8p@ RI T9  D T0S @\ [\ {\ }\^6 N\]\@ \ ލЍ @ ]RRR @ !1 p 0ySVp!l1l p 0nSQP+[S0 ]SS*SP[0 P{S &,S^U ' B0S00 )0[ 00ލЍ0]SS 0]SS }S^NU  E  B   @S QࠣW /W% .W&0S# 0Y 0S 0Y/S 4Ѝ/W0 0S7 0Y 0S1 0Y/S.0S@0SUu oVU@  ᲠQ@ (` [W@ X41{0!00 _H0S1|!0 THQ@ "0(C0@p0U0 $ pW 0 P/W[ ~0 / Ptz| X @0gP@-@ P "J 0 Q 4Q9oa@ , p@-@`PDP LDPT00pT00pI 0 p O-M"0  "  p a @T `c a!1 0 2 30\ ߍPW 0  p L  `P: 0S;p00P`P* @@0  p@ 0 ϵP 0PpW*P< \">0  "C0 ɵp@0 0vI`-0P0 00 0`|0 ` 0|s$sO-M"0  "  ᒵp a @T ` !1 0 2 30\ ߍEPW 0  rp L  9`P: 0S;p00P`P* @@0  ]p@ 0 BP 0PpW*P< ">0  "C0 <p@0 0H`-0P0 00 0`0 ` 0TqpO-M"0  "  p a @T `O M!1 0 2 30\ ߍPW 0  p L  `P: 0S;p00P`P* @@0  дp@ 0 ᵴP 0PpW*P< H">0  "C0 ᯴p@0 0bH`-0P0 00 0`h0 ` 0,onp@-`H@P@ VPpPpP)P p@-`H@P@ PpPpPP 갈 p@-`H@P@ <PpPpPP T 0 00 倳l-H- M0 S0 00 0 00 00\100 M\  0S08 00 0 0 30KH Ѝ/kHk-H- M0 S0 00 0 00 00\100 M\  0S0 ~8 00 0 0 30KH Ѝ/j`j -- M0 0*--M  --M  A-PPp`p Q @Q ̼PD@L 0000Ak$0 0 8Ei|w P @ 0P R   0//\ 8'87 O-@P0< > OX>Ԃ >>Բ | ===4 h= <= = <~ <h <@ $  ؀ Ā LT : :Db9,~  t } p@-@PA 0S, [8@T :T8 0R/Q T&*0CT$ /R0C/QT 0C: B0PU0P!Tl00p\@@PT; 04@/S@,@@$@@@l9T9( ,9 A-MP` 8T0PC H!0Cp0 0 0   ! 0b0C S0:.-,+1)('3%-pD0 0K0S@` 0S 0SD0"S D&PЍ T1r0:D 0 Ѝ`_| p@-PP7 0S0 7@U3 0U/  0C/Q U!@# *@0Q/S B3@T@!P; P-00pU B3@T@!<@0@0/S@ @:L < D -DM0  000?p 800S DЍp@-`PUp@ P p V U ph up` QNKV@zE@=<#:87-,+*)(Q4ih".z%1c00000; 0`0Q `DЍ0PP0P000@0(p,@h08 $ @CPp3 8P& P U$0SA $ 0(p,@0$@CPp3 8P PU$0S* $ 0 0`0000V$z[0P$ 000 GR. +R -R -0 `40ppS<:^ >@S4R 0c$00 0(00`450 `0rU0[0040000000 @Wa0`^ n144 W400C0`0Q0004c0 `0Wp AW?0 007 0`0P0P0W%S,=W) =0 s`0o WT 0 ;0 P 0p\0 S 00W00`0 00O 0 0I`00 0000 0 07`0000/c0 4*0S`0] 0d 40/"b2#40 0000004c0 4 0dS40v>C 0C40`0  ` b040 0 0PP0P000000C SX`0`0W0S 00$02$0P 7P 2P  7P` 00`  00 Sl4 W2# 0 dWb P 0 0 S 0p`0SQWR 0 0`0G00<450 `0  044 400C0`0/000}7 4l4v40 v>C 0C0`0000i40 d40/A!b!b0C 0`0# W0 00  RV 0s 0 p0 00 00@@0v0 PP   B0`b 0$I"I/A!b!b C0  B UR ZR^ R   @T P10(00 0$0 0 `(p,@PW0` 0 `(p,@PW0` `4, E `!bK/) P L@"(@bQ1: 7 0@bS#3  1 0!" A!0  40DSd040ե0 MRn 0P^ @ zR 0 R#^ R z K /o0"Pz[M 0P]S<|q Pp j j 8j e d 0000C80Ϡ< 0 B R&̼ | ̼L|@$@0[o^ oO0@`F_O  0 OG0@D V}080< 0 B R$@ 8t`P 00`00S@ c0 TR R3  `@(0 CR}  ABLBq`| \V4JR{!P 000 0c$00(000P400N!S6uSs1?cd0c;S40k<0#- P0P000@V@ B\ NB QM b $ P00> 0(0$ (p,@$`(p,@$`400 @/ R, @( R 00@! 4`0 pp0P 4 P 0000C! ( .$0t0`tp p0 0P 4 P0000C ! ( .$00 0Y#0`  0P 4 P  $ 00(00c$0B 0 0 0@p@-PX!pT10M `@00,007 U?    P00Q Q Q < 0 0 0 ,0 30&0Ѝp ,H㭩 ,H㧩 ,H㡩T0:P P0 :U80;4 40 :꺵?D?d@ ,^ ^ L ^ ] p@-@PP U 0DPp P @pD07@ @0 m:U(08$ $0 c:] ] ] ] ] d] G-pP`' X/ Y @/VP0PES  R D PE>0V R  SS0@0D@ D0H@ @0 ':X(0I$ $0 :\ \ \ \ \ \ R@- 0BAs@ @ Q0C@R :@O-PP⤡ Mp V WC 6@PI 8PU  77p`P )/@101S Y7 Ѝ070P6P0 0 0P 60 0 :=00 :|0Dx x0 96; 0 D0C@ @0 970<,[ 8[ [ M Z Z 0@-RQ M@@ [+PP TU ;0P Ѝ0㌾ Ѝ0; 0 Ѝ0G-p!1M ऑpM0 P`050G ?PT pG @PE@^X0pA 00tA^0O⚪00 TAXA\A9qύ$@0ˠP (@ @, #@P $P 0 0 5 30ݍЍd0D` `0 9@;@00;@00%998: X X 0-  ~8--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-@P‒ Mp `v X X00?,Y$00P @ P ]00 P ! !  7X\3?OP>  *VP" WP Vp[XPVppP *0`0 2V0J`\!X1 00, Ѝ`᛼pP7 P1!0 e8C0 P P00, Ѝ`f ` 0? 0 H8jpP V cpP T0P P0 28 `x7V V `V = ,V U U U U @-@ M?,(0S2 #0 (0 pp1/qpP`0  0 0 PUoR <0PUo%, ЍPPT` 0S  0CPo,P9`00@-P M+(0S< p#0 #(0 pp1/qp@`03  0 0 @ToR <0@To+1`PV ЍP@T` 0S  0C@o9T 0 +9 0 +p@-PPE 0eBS5 @Tp E2 Rp00P0  P 0S PcP0 00( 00 0 S,P 4P 8P p@試L0MH H0 D70Sp(0K$ $0 87\R tR 0R Q DR R p@-P$@@XWp@Qtp@- @@JW@D<<p@-,PP= X@6pC-@PaM`Z 1 P0p00S   0 XR@0@  SM `@@8) X80C0IS20 S0\^**N^&^$ 0^s0X   "\ ^ #R.S @ 0a A 0C ƒ`0@ЍD0F@ @0 6 "^ #RT0|O P O 4  R  *4 8/ 0X\S 040:8 R РS /hxB@-Pp`V8P@P@0@D尀 hU    㺊-C @-P`@X80 }A-pP܈`@P3 T(  r PPP P v0PFW%ve008(0 58(0 5  t00'     70C s0 00Cs0 20\F+%o"% % F/o"#& F/o"$=`Foob%$0     6000W0Cs0;S & l 0B!0000?V```0`0 Se =S_ Sa 0   G 00Cs05000W0Cs0 0 S SK %  . , 00C70C s00 ",C dP;S cQDeD`pdQ R1 P000 S\4 000 0 CR 100C00 CR+ 100C0-V ^V00 FnR~|{zyxwvutsrqponmlkjihgfedtba`_^]\[ZYXba`_^]\[ONMLKJIHGFEDCWA@?>=<;c9876543210/.-,O*('E?$#"m `WQKD>#S P@000``0" ` N 0 00C 0 00 0 0 0 0 0 0\ 0 0 0 000 0 0 0 0 0 0 0 0 0 0 0 0cQdQ00dQ 000<00 0000P0000 00 -M M M LM M M |0K K K J O-pRMP F 0SO  @ X P 0 E0`S!*QPAD 00PX ;P1 U4 0`D00T- 00 !0` 0/3500Ѝ }0 0/30S` \0\ /03UPE 005`00D 6 LD dD HD D 4D D C 0  0}0{  ̠M A-@ap`PUh /C=1"#BbaV7 0S$ RP QP0S! 1003/P P $@00V H!P0  $@ W00 P100S) 3/000PP0S 000S) 3/000(2000`3/P VPWSP 000S=ӷPP0000@HL x@A-@ap` PUh H0#BbaV7 0S$ RP QP0S! 10 03/P P $@00V H!P0  $@G W00 P100S) 3/000PP0S 000S) 3/000(㩶00 0`3/P VPWSP 000SJPP 0000p$J \TA-PPM @'`P} rpQi  00Rc</.#C="#2caqV/ pW =/PW[ $00Ѝpqp0S`100S006 81003/P00  $000Ѝ``0S 000S. 3/000(P`0003/P 00Ѝ3/0000S =㻶P00008h8A-PP| @'`Px qp Pf  00Rc</ "H#2caqV- pW .PWV $00`qp0SP100S004 X(1003/P00  $000``0S 000S+ 3/000(㌵P`0003/P 003/000$0S -P 0$000`(`SR: G-P0p`00S 3/0Y @IOP ʶ T0 0 0 0 Y @IOP TT0 0 H H0 0p`P   /᜽td(SR; G-P0p`00S 3/00 Y @IP T0 0 0 0  Y @IP o TT0 0 H H0 0p` P $  /ြTDԻA-PP Q@ %PP@pl`ᰵ@P PpW 20"S 22P00P@O-PM M Q`0 0 Q /QE P.00G %PP7pp/Q/ Qq @0/SS.Q8 0E00 0C S$ H/0 D 0_10 0 p 0: S-  S/ A/o" R`/QPP=2V?00/0000 ŵލ Ѝ DR .QRV  u/RWp30娐# {0P4 0>%0  R(0  10/Q0#0PVP/0000ލ Ѝ `P `c1001>001001?001001 p@- `QRMP>  $HA@00ϳ P? 00@T' 1`0@ @:T `\ 0 \S 0@ S @ 0:S@:T T00Ѝp\0P L 0 Ѝp}1 0 ` |p@-@PP`2 U' 0P@p:P0S P S:V S0@Sp0S S@P :VP:PpP0L L0 !/804 40 /p00< < < L) d< ; 00/0p@-@PP" U+ PE0 Q  Q:\|\00\0S!R B|Q :QQ0pT P0P 0 .U4 000 0 .pl; L( : @; " : O-M MPX8 T((p ,00D40L 0SU 0S^ t4!S S h`P 0P 0  PP 00S D ['  *0 00 Ἰ PZ 0P}0 0 ` @pY  R( Wx :R \Rp R Rpp p T:H@DqP Y@P+ ͛P ` RWZp@ #QQ /PD600S0 ,6$P0040000= pPz 0:RPX P0Rt4< 00 0pI`P vV v:00e00Z  0S f00垳Z:RZ @`< 0:R` ` R40 FpG CE 00S:S:0 00H IZ 0 D0 @ 0<PCn00Ep\@DpFx$0H@D pGPEȲP @pP$$P 0S <, TD0A0:(0P#3 0 D4 30ݍ Ѝ0 0 0_' ᜲPP@ ⟱PP @3L3@00S0= 0S8$`# 3  0 \- 0S" 2 0 P-0S" 2  0D- 0 SR9 S/@O/@00 ʚ ƚ '@Ͳ0S> 00S00S\S00 RA P0S7\S5 00S1 :S000 0 Sx4Sq A 00S :S|S0@A@ @0S'!1 0 8 30] ލ Ѝ ,@P 0 0 Cp1 0 Z P @P/ 嬴 @@4QP P @1 0   !1 04 ^+V) 0 04 S+0yP !0 0oPX o @U`L8| l! `8- P- , X- - ,  p@-PP@ T `` P E0 0x0 0p@   T P0P 0@ *T4 000 0@ *X+  t+ + |+ H+ G-PP@` T V = @P dPP 0:SS   d: p \S0@* QP 0:SS ^S0S:S Q0@0P P@ dǯP 0Pd:SSQ @0@A0n0S:S 0 Cr^6B C2RBYU?PK<;:9876?432802.-,+*)('&%$#"950+000Cs^O!000Cs\@!@ @0 0 @0} @pz 0 @0v 0 @0r @o @l0 @0h PEP@Я 0 0L *T8 0 0L *V/| x0x 0L *% @@ @` @㤯\,@ 00W|( \ ' P( ' ' $( $ ' A-PP@`J TS V\ = PPg dpPe 0S:S0@@cR0:SS   \0@AdٮdP p\A@A Tp ǮPp@Q F0 0X ) "0 0X )T #0 0X )V| $x0x 0X |)@咮P@+@ 00& X& % T& 4 % (& % % %  t% p@-`PP@4 U= T& # P? 0Q 0XS<,00AaPAs RU70AA AW0AR^p| sx0x 0d ()` q\0\ 0d )U@ r<0< 0d )p$ $ $$ $ d # X$ # # O-p# 3AM M@P0`0(0 0 0SK :/004 PPQ 4P4T   y*00CS6'43210y.-,+)('&%$"!  84 !84 p 0:S 44Sy*0S*00("2 0 (0 30x K$P( BK4T J0:SS 0&100$ 8$   RBK@; < j$0I<$ 0/C0$)84 $0C 0$CL1BKJP0u 4 R:R9Q: A R0  0R!010@0M@ Pa) ֕UUPQ0:S044  K* 00`0E\ \0 '(- O<00TH # # # _ "  ! 8! ^ 0 00 -H-M0 S0@0 0 0 00 00^100 M^ @ 0S0L00 s@ 00 0 0 30KH Ѝ/P@4@-K$@@00 P O-`"2@ P0,M0$00㳙d20 R\ 0A0p 0b 6LP Z p EP p J  J 6 PP0 S"3#: ( V(100s# T$R , @$&x1t@P@l!00 @P0S?"8!1 0 $0 30= ,Ѝ 100S  V0s pP Ƞ P 5SX0(, UT00#    XPP P0Sws;  l @-M(@;0@@0APЍ<  { { {G { // =A z {{ {G+ B`{{ // =A  { { {G { //=A0 A  { { {G+ B`{{ //=AQ@-@0M P 0 0#$ ( ,0T (P 00# 00Ѝ |(0Ѝ-$M 000 0ٓP$Ѝ-$M 000 0ɓP$Ѝ-M 0 0 0幓Ѝ ޔ 0ݔ/C-p4!01PP sM0010. W6 @^X0pA `00tAJ0O↗P0P0P0TAXA\Af 0 $@3 t0 0 1 30sߍX0GT T0 &W<0H8 80 %!PH \ ( , 4  0-  O-MP/ 0P? 0030 U 00`!R !Y L?L/00(00 0$ 00  !pP0(%Ypp + 0S0 R .> 0 3 30ߍ UP0  P 0 0C0 S!0A`0zQP c_^]~}{z`xwvutCr?>=ig-b^][ ` `YCT000 `0C0 ᮮPD 0S000B;+ 0 $U;+ 0 $@ 00S0  @DT# = ၮP0 # P 00C0S000@ 0D S*l00<00 SD00`I0 @D*4 @  ,  BPR (.g 0ZpC0Ptj M1W`` `Pp!p 0H+@MQ^f\dZYLSRNMLKJIH654321A@?>=<;:987654321(/.-,+*)(!  UMH00C0S+000pWH0 P&S XR    0  0        000H0 0C0000 S@000bT @0 5P0@ S0 B 00  R }P00S000000S0S / #RR @00T00C0 0 / #RR 0 T000C0 S IP Y 0 00+ E  `P B RV *P@NU 0U0`P0C0S]V Q*P@ XRy  B R PIR*P` P@08,0 RPE<0U0 S BG RP  Y*8@ @P`0FES,0SF P 0@PF0C0S 0,00Tw: `04@DV*T T@0 PT0W 0 0` 0H  q 00 400S H0S=0 `000000S  @P B RT *P8+ E `P B RV :*P @ P 0 @P0C0S" IU `P B RV *P@`W$00S @00S0WWp0CSP0 o @8PPMYYiU nU `P B RV *P@0S񏐷Q.0ASK0`P0C0S@ p< P;V9*@P(UY0`P0C0S @p% PV*@P0NS0`P0C0S @p 0@0<000C  SLP PYU@ @@H 0@0<0000$ 0@09000  \ \   4     h 00     0  㰀   +  @, 0^T0,0 0PP@0,00<0"T 0% 00P0 @00D0?0P04p8#C,`0-S ]S S{ @ ?0,`#C 0@ 00 00000@ 00 0@090 00 0@000x 00 0 P 0 0C0 S P ` 0 0@00U00@ 0O @,0Sl8@@ULP  M ЪP? PS,0cS. P 0@PF0C0S0 00 P0C0S0R*P00 ᥪP H0P,`V bP,080 P 0P0C0S Y*P,`V CP 0 0C0SP0R*P``ZSe00<0=>D08V0@P0C0S0T *P0`0; EPT* 0@0P 9PT*`PTPpLP` 0P 00 00S0P0S%T@000z @H / #RR  PR  B   H 00F H0?03SS 0PU0C0000H0003 0S P HY8 Q 0 @0000080 0CH0%H0 ЩPV* @PP , ĩP, R*`P  帩P R*0P00HRP  Y-*P @YX9 @`PHP0 =P `V0C0H0H  0S ႩP 0 @00H0 H0PC qPT*8PSxLPP` 0ppP 00,0 ϥ P @0CI  0 嘥p P p0S 9P0SY,Y 0S0000 |p w?03SS 0S0P0C0,00,00S PUVS*0P0`80 0 = kPC `0CFn (K 0 4 0p- P p R`,004p8 00@ 00904p8 ` ĨPV*@PH 0嶨0P S 0@00% 00 H m 00 ឨP]V[*@P? ᔨPY* P የPJVH*@P`,00C 0,0]Y @0t@D @-P,0<`0,0` V vp @pP pP 00 @ OPT*0`P008 BPV: `04r ἤ0P T P B0 R +PV*pP)U0@P0C0SQT0*Pp _0U0P0S0@pP0C0S / PTr:@0 `4, P=V;*0P0,0  P R*,00 ۧPcYa*0 @P ѧPY8@5:Ѓ` 04ŧPD0T: `0@F48` `0F0`4@ `04 `0@48` `04@D S; C H S5Td @t Y]`Ѓ@0 `@4Ѓ 0S` `v YY1-@$Ѓ8`Ѓ``00 `@C4`?O0 SP@!@30UF P 0P 0 P00 @PUP 0`` 010000 0季0P p?0 BC   0 vpp P%U@DP& 0S0(TU tP0T P@D 00P UdU0SPJ00@@[p U@D`0S0 00P S 3(0$ $0 #00C 8 X A-@P`p90 /P:A-`@P@p'0P0 P&XA-@Q0R`PY v6 200S5 0P1S010p L00v`0P! pW@0PJ PP\ 0 0 0 C `C0000Z Q  Q*RQ2 <008 @    B`00` 0 'P00P0s0 㣠P ;0?A 0B#@ # B0 ` p@-@P~ >Pp0@-P$L M`T 0S pW 0 7/@P  Ѝ8084 40 00pE@ Ѝx l 0 0 0A-P$LM`pT 0S $X  0 8/@P Ѝ< p808 0 0$@ Ѝ 0 0 00@-M$LP` T 0S (pW 0 7/@PЍ< y808 0, 0(p@Ѝ \ 0 0 0,0@-M$LP` T 0S 4pW 0 7/@PЍ< 808 0D 04p@Ѝ  0 0 0TO-M@`Dp@PZ] UV 0ST$Z0 0S- [* 0 ;/0S0 $\U 0S H[ 0 ;/@PЍ 0 0 70H J0 0h +0@@Ѝx [t0t 0 00$\D }@0@ \ 0   `  ( (@- @MvЍ<0@-P$L M`T 0S 8pW 0 7/@P Ѝ< 808 0 08p@ Ѝ  0 0 T@-Pp`t@t0@p@ ”U  @0 SF$ ⯔G d < Q 0O-,MpPP pE@0P0 00Eʿs00H5P`0000  @00! B b<6> @ BUP @ 0Q4BN3L0 vTvtsrqpogfedcba`_^]\[ZYXWVTSR]PONMLKJIHGFQDCBA@?>=<;:9876543210/.-,+*)4'&%$#"! #        0 Dr R R P R \00T3p00 01@000@0@PUI*,Ѝ $R \0M 0{ 0$pP S^@0?000  uP 0J ZS0  0J ZS 0-00l10000 ,Ѝ0\  r  p0\  s  p0\  a  p0\ S00 p0 0p0\  b  p0\  t  p0\  n  p0\  v  p0\  f  p{ @0 P^ Y0\  @pll| QA-@p`P P=0D! D?o2]R0S d0T"@=0 !1 U U 06 P0 Ah t A-p@`PᯞP_T !0D S (0D,TS 0 ALI&23 $0T"@%0 !1 , O-p'7WM PP 0瀁0T107儡0401@0 ?oY20S_Zg Y y @㉝0P(0 b`ၝ0P,0 0S00<0{ 980P P  _T. (`000P@Tp` U T 0 1 #~P0?0S0v P|P PD6@&@0 2(0@FDA T @! L `70P$0  0 0080S  V L0$ 0C BP$0a  5? *00R  p5` '0(0R  00 00 00 "00@\0000 upT, (`,$@T' 0 7/P@00$妝,夝(墝<堝$l4 0 T1 30Wߍ@0SP@PR@8,00,- 0S 0S0  0S ,0@D 000UN 0p`0 0 0 A aȠq04Ɍ`PPPPPPU PP U* 0 319<80 P*`0P000 S*00S0 00 0@80@ SR 00@0P$%,#(!4 2p0 G0R 0D 0 t [P` 00S\* 0 x eP0`002"0 IZ1!0 ?00L$ Rp $`ᄝ0a 0S 00S' 0@@'pqphqp  0P0* 0<0z$1 ! 0 P0~s0200*@w@ 000 0 0z 0 0@<0$0@0 0 h@ ` P \ x 4 T \ P X , @ @- M@ (t@0@ 80 0P@ 0 30 Ѝ辑Ю@- M@,  (00X@ @ 80 0P@ 0 30 Ѝ蓑x$p@-@QM`P0  0 `PЍp0@-@RMP0  0( PoЍ0-M0   _Ѝ-M $PЍ-M ($AЍ@- M@@  0'D 80 0P@ 0 30 Ѝh @- M@( 0xx  @ D <0 0P@ 0 30 Ѝh `0@-@QMP0  0$ PЍ0 0@-@R$MP0  0( P$Ѝ0, p@-@Q0M0P`0  0$  `Ѝp -M4 0 Ѝ -M  }Ѝ0 -M $  lЍ -$M  0 0巂$ЍO-MM9㑞 S< 9 Bq`p @P0 Ptp ibi VPp%p PV!  P 0  SV T ᝚ ܍Ѝ  R T   @P  @-p@-PP@ D!!!!@ޙ0P0 @p0y 0 4 8 A-`P@P/ T8 $0U0@@T(0 W 0UC @@0S! 00( pb0S$  0 0 tT| ?x0x 0 i$0S%*}( p:u0S$ , 0 ` (  @-PPM@`t Th ,0PXPK00Po0: S Ss  SЍP P P ;0p`P$pV20 `\0`.S0@D`H08< 0L R90L R58< \P@D V^0 0U :0Ѝ]0S \040. S 0 0 h :d0d 0 Ѝ0$0  Ѝ A-pP`P& V/ ,0͗@P \0 00X0 0 0P $05%0`ⴗ@P\0X0@L H0H 0$ V, (0( 0$ t X \ $ 0 @-`QM@ `pp-  8<0RP@D0RP mP00V ЍЀpp ?pPY@ـU@Ѝ΁PPЍO-PP4M(< 0 0,0Pq ( R ,0pBo Rr @`00,0 , )0P 00,00, 0A /R ,0   0 00 $00K0L00000`p00S$  0 05000V00p0`@@ P ,0  0.Sf  @P [@0 0, L000 0S% % R R,  B $000S<R\ 00  0 M R0@PS0B0 0H00C`S0`0@u@0,0 0|0 PZ0 S , 0 000 0KR\0 00 050S 0.S0 00,00 00/  00 0X 0Ss,0 0 WS 00C 00 0,0S (0WS 0L0S,00S W7 (0SWt4Ѝ0@0,0 080@ŗ`V `* @,0%<,04Ѝ 0,0 @u 5050 0(0S` `4Ѝ!)1 00  ,  @/Q|  , 0S  \R   B  0SL0S0x \R   B   R00L Rh 4ЍO(0S@0 `50$0ySq0x  -Pi  ,0`<%,0g 0`5b"PW 0$0P 3 O-`P MPp 00U@Pj (pPV,P X PUP1QP UfP[R PPQ L [ PP P["  PQ P5 , \0 0 LP05WUp0 PP[WX M^P , 0P 5N X ᰖ ЍP媖U ᦖ外@㡖 ЍP7UP1X00 0 0< 0c @00 Ѝ K0 0H ]  P Pl>~p,00,0 P P H P ,   p p@-PP8 0S %#L R9@T@6L 0R0@T @*TP $",@ @p( ~0p` ~ pX T0T 0X X@m@}T e@@ A-PP @Th ,0,eQ Q%) R ` ڕL0S 5S0S@`T`ʕL0s ,0 @L0S,0 $0@S005` BQR@ @D Q\ 5`V `垕V`05`V   <,0`厕V`P@,0  @ `P@ 50 5$ @T 0   0S0044#U030 0d jQ,0`>~P~00\p ,0/P Wu ` 00 00@SS /0, \B ^0  q@5$Q,0N! PG ,0<,0 Pz,0 w|p(W 505l,0(}P<(|$@{}P (|4 P 05,0@<,0I0S ,0 |p( 505ᶔ$@@1 0 0d p(|p,0<,0  0%$0 0%$0x   * \ Pp@-@P T UUp 0 pH "D0D 0p , (0( 0p  t H L A-PP`> LGp@,0 G5 SF S@T @GT V,0``<,0L0S00/S , @ W |pp! J00}P|h 1d0d 0| hL ~ 0 @{ \ p@-@PPP 0P0S 0`0r0Sp@{(f(c(a(ܓ$0B 0 )ꌍp  (1(0A-P (M`@P @Ppp 0 00@ P' 00CS(  p0 0 0 S0;1:(Ѝ 00?G0?G "00(Ѝ0Ԍ d 0 0 ꔋ@-@P Q PP 0* 0 0\ t p@-@PP U p@ P0BL L0 U40C0 00 p@ P l D X D  p@-@PP U p@ P0BL L0 y U40C0 00 o p@x 긩 Ծ O-PMp 0GW"S00` 0v@P-TPg +T@`0U ǯ  0 0  P ! @00Ds \a0DSW0DA0DS70DWUY :Q P S \ 'P"00 0U00S0S U Ѝ0pS 0F00T' W 㙙 㙉 p噙I㙉A p@0` 0 0R0 00Ѝ0? 0 h00XS00 C R @`0 p0} A BRWgp ppꨋ  0 0 0:܆7@-LMpP` @000P LЍ`0 LЍC-P!M1M `0p00<0㘐t! @PU h1 0S ㊐P(1 }}  zP( n6s0@R P $PPP 0 0 < 30'ލЍ u>i?F㨀R 0 P PJPH0SP ӑ@Б>P(N}(ɑ0nSE1P@ptp@-``@@yp@  P@P p`y`p@-@P @(0F$ $0 @ @-M@ zp 0: S  fyp  JЍ  0 ЍЍO-P-p$@$M @B300P0`ST1`kU00S0 0{00z e00P@  T *@I PP @ 0d0  zp@D PP 0S< 0S00 !  `X*0   V 1U0@JT@@V8u`PPYi 0PEP0@ @p$ $Ѝ0 ߐ00 0 00S0@`0IP H 0000  10 0 1PU 0 0SZP U   0P SPថYxsxppt0 @00, ,0  (H ̴ p@-P v @T @pT0 0pp@-@PP U  p@ D0:@ @0 U(0;$ $0 , d 0 4 <  O-`P MPp# W+ 0Y 0 eV1 1* @ 7/P 0 T VK:0 0S0 ЍD0n@ @0 i W(0o$ $0 _ d h l @ O-PDM@4z Z [T 40 000 80g0P$0 Z| 40S $ T000800(0t4` 0@D  $P0( 0 0@ :/PppV*000k000 R`d,@ `0P@P `U :/PQ 0Y` BFV0p P@0PV E03/P00 S 4 00ZpE$ pp 0  S ^0* $4@ 0 ,0( $@ 40, S ,@SDЍ$4V  W PHP0P@ ZV 0p'Sv0( 0S 40,000",S00<0 00  0( 0,00S$  C00(0  0$ P 0 00C,  0U 0#03U0Sv `:/0P @@p`pS:/PX @Y0V0 S0 T 00T0003 0RP00 R0#03Q0S P0S 0P 00C0C 00000 0(00 000R 00y 0SPp 0Z:0 J 3/P4 00 @PJ$ p'PP 0SIW0 `0@  S` ^0* Y`PP @ ꉐP 0TT:/P@P [00P5P10p1 * @:/Pp [:P0@V0XSZ 0T00T 00 03P0RX0 C0T 0T0@D @3000@ U  00?P @IT @00:/P 0TPP@pE ᛉ) :/P p PU@0P00 C0T0 T0@D @3P0@R 0 00P R P0 0C0C0  C0P 0PC0000 C0P0 C000<0, 80 ( S1 $0, ,0$ ^P( 00 M w0  0Z{ x0  0q "0 0 40Sy #0  0o$8 ,$0,040$0@ @00@  Ȩ ̨ p p@-@ PU 00S  RQ Qp㘋0P 0  P  pH0H 000S@-@(x0(@xqpp@-PPM`% @T@T T0 Q 0QP ``0`P 0 RЍp0i 0 Ĥ ̦ p@-PM@`0S-$0000 0`  uP" 0 00CR U 0 S R 0S$0ЍpQ$0P0P 000S@-@(w0(@wopA-p`@PP0 00S (wP   (w0S `P   0S(w0SLopp@-@PMP  0 PP! 0`PPp@@ Ѝp}0 Sy@`Ѝp0< 0 Sꠀ ԣ ``!@- 0(M S $ > \ RSB  RS@!0 0 $0 306(ЍP@ @ B   0!0( \ 0$R0$0B0S 0S ( !0$ R0 H 40 0 $0 30(Ѝ@? !m m( Т Xl0PX@- D  R4   k h0P@-X  S H@ D 0( @$ khQTQ| P"1#Q 5Q /  R% @ @1S 1  S( P  P    Ѝ0\ y100 Ѝ0@o000 0/A-`Up QU @ @E7/P@G-PTp AT P PD7/PX PPHPG-PTp AT P PD7/PX PPHPG-P@Up`L1S @P@E 7/P/@P@ @@;X; 1Q`0000$ 001@00a0@00 0 `PT!R% 00! 00V000 @0 @10a@P @@@@0@ @` `010a1S Do @ 000Q0 @-@"P 0 PC^0 0 R ^P @/ p@-P`@T0J \ W Rp   T0"f \ ` `R````0000000000 0#0 0#0000`001T^ pp@T P `T0 ^00pp@AR /oT"!0#00#00!0 0QT 00pQ  T \0 !=G-@ƃpP" P`TPX@T$PJdX XP(@`FZOp(Op(0vTX\萊 K00O.D 8@-0@@0@P0S@ A-P@`@_}`(p0@QQX`ap(ZOOp(0TTQXQ\Q,( (0 00=7Qx70p@-05S PPp0SZ sX@ 0CR\pp@T P [P@pD7X/p@-@P $P噄P $哄P p@?n0M 0   p@-PP@ T  $0 !0p@/L H0H 0 T, (0( 0 , | p@-@PM$ $` P0.RP P pp(XR00S 3/Ѝp003/( Z$0$ 0( zt ,  C-DM$`0SP  (p0@   $ [PP  0(0T,00S 3/DЍ m ,0( 03/ =PP A-PPM@) T2 0S Ѝ$` 0P ʃ00 @pP gЍ00pL H0H 0< T, (0( 0< 0  ܄ O-yMpd"`\2 (0@010㼂 PP~ 㶂@Po 2 n20 RF Ln1$@ 0 01  0400~l0  000 .$(p,`X PQ 80 03/``zP"  !0 0 1 303yߍ         PnP P PnP``Pn|x~/KKO|O8J$ Ȃ x ` P00/ 0@- UMH`00L10xp! 0H1*lp@kPk0P\ p  S 0#8 ,0 0 L1 30Uߍ1x3/IHp@-PP`M@`& T. "bPЍp eP ]aP XaP |0 0PL0GH H0 T00H, ,0 p@bH XD0D 0 , W(0( 0 z y y y dx \y p@-PP@' T Pp QbP 0S Sf`P p@``p\ xX0X 0( @ w<0< 0( 0p@/(y ( x y tw lx p@-@PP U  p@UbL gH0H 0< U, h(0( 0< {x v w Tx x w 0@-PP M@ T# `P Ѝ0aP 0Sp0 0bP L0L 0L KT0 ,0, 0L @)w v w hw (w v p@-PP@" T+ 0R0 p_P aP _P _P p@_L H0H 0\ T, (0( 0\ v t u \v ,v u G-PP@7 T@  R R  `V V  0` 0 00 `V00!`V | 0 0FS62-)%!  I0 0l Tp%㠐堀p 0l  R R 0  ` 00 00 0000 0` ,u u t t tt t @-/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/p@-PQ@`' V/ T ^ 0S^  S 0RR00Ap@@TppD0:@ @0 V(0;$ $0 X s Ts Xs ds ,s C-@!P1P M`0030A TI A< XPJ 5`Y ᶳP p!h1 0 3 30Qߍ(3@/0SB S3 p!0 g 0S 0%  00 0 T0 0 p0 < 00Sp!P 00SsX87r q lr q r Dr q r O-IM,M@PJ `$pPI=$0 0S S  p@I=0$$0  2 Iݍ,Ѝ RJ-  RW#  J=000h0} K#0 ?s0 uJ- 0SjJ= 0 0SN S UVV J=00p+ 3* 0 00嚟0I0,0+TP @'0Sn0S  0S0s S0S J=UV0  % J=00piZ\ O < WPa 0S ᡲo03?"R?J=UV0  p`p^\pZJ=P0h0 K<0K K K K K C$ 0Pk J=00 R00J=  0d00mS Sn#< jJ͍0 spp p 00STL2Sp S SJ=00Z0  YWP pJ͍KPp|r 65p pp o HC m O-`$@4M Q@p0DH 00010P0CS+p5('&%$#"! 9QWX000S R  R RQk#3 0 0 30Ѝ30030H 0 D@pЍOkWX7 0? s0<# {pP#T!0SN0S # ?s0qDfPT QWX00VTDpVT 00 |"0 F X* kP 0Sz "0 .T@@? 00!D PTp!0 iT 1i #<QbP|0xP p0X! 0 P030#?W@D p0W0 0 ?P0#S@DQ  Ġ0⼐P0 0pXp@D 0m   T00? \  =qX1\000j j @j i ti Li ~ i x h Dh } g G-`!p1FM 0010% P@Yp P  RW P Wv`ov` 0@Sp0 0 0 1 303Fߍ0 00Ͽប 0 0 0JP Y: /r RX 0S OP 0 p4,p+A-@ 0P`p0 { 0P p@-MP`cP@@P@T 0S  R0S @#PhPЍpPaPЍpp@-@P bppPPep0@ 0 -1 d d 0. SAA0Cq .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0Rd!0@-$M""0  AS0 0S  R lQ  hQR 0S0\000$Ѝ0\0S S!0S-  R  R R R/S /0S S S S S/@-2/ 0  00S S/ /0S//0@-@P M 0S PP 0PF@ 0S0S 0S  Ѝ0$0n 0 ~ c _ p@-PP`@ V T! 0pPpx t0t 0 VX T0T 0 T8 404 0 b $_ ^ Tb _ ^ (b * ^ O-P@"M S0  0`V " pP Q 0S @ T S   0 SQRp`Vp h0 0 0 30 ЍP` 0V C 0 C0 1Jm(0@-PPM@p`* T Q Q Ѝ0SS P P3p0W R) R'  p0S  Ѝ 0 < 000S SP0 ] P 0    [ W W V + G-`QPp W$  v@P  P   P!L H0H 0H W, (0( 0H Y V lV Y X, @V O-Q-`4*0ZMP@puA[00D (0R {,0.LRC@H0%_/D0v#3 0P (0S8"2 0P 0S/"2 P 0[&"2 P 080D0ln4 00@ZP0 $03/P U00@S 0  +D@0@0?s0SPPZP000001 PZn Z Z4 0 0TZP0 " v P Ps@P $@ T0R 4  4S P 4S @0@@0 ZPx@0@0S 0R $R R $R 0@j!<$W W O ,R O N Q N tN Q lN DN Q ! N O-`$4SM @00D10rPP rpP  P$0XP 0   C800pZ3  P00 000 !P| @@PX 0  P9t7t@P#3 0 D1 30SߍY 00Y00 P 0 q .P0P R R. B/o" Sc d! S:*0Sp 0 00 00DDQ 000 tP^0=S Y0S5 S+ S* 0S 0snZs0S Y00Pss @0  KPnʘY0S00N 0 i000  Q000S000 0 2 30ߍ000 RS0$0S0$00 00pP$8>$p0(@ > P0Py?40>,@000=080pW g572 G:2 0W00S   S  R  RQ P  \P/oSpQ" RP\0S^ 0 FpP}Qz ,0 0Ss Q0S %"0P@0 PDl @ 0 B   |0P<0NpWK @0H@ @@LPpW> 0SX 0S 0Sr S 00S PP) 00 =P! R R RP0S0S;0Ss\ 01@<mp@DDp<0SXpW4|0(S P0S> p3|:px*@0  ( d*Y$$ ,0 L*40 8 T 0 d342 D:2Z 0SW 0R P RSMQ Q D \Q^=S@@R ^0QP0_pPp&00 $ 00`040e?0(0`0@S񏐓(8 r/0V>0S Y@TW| pYL [ 010 @``0@`TV o0P0 x p 0}@@XX@$\嵣PPo|0S 0S op |0 0  XP$W 0 P R @00S SppZ  'P 0 0P<00S Pp,p00~@T0 ,pp 80 0 P@T  R R RpP\ Zpp 00S 0  <p00u4 8op P 0 j0P<0

VP40DT T0WWP00D) S| 0T S R SL 0 S 0CBR 003 S*0 S:0SP V@ (` 1P00|K+0 0[ 00mXP @0T 0@m@0T@m|0) Ppp D0<hB ? > l`< T< < p9 8< 8 (6 4 p xf. >j, WP1x00x0 m/c

1L臇0 0, '?|5Olň0 0 "` (*6 7D,0 0* p,608Jj0 0 !$u 0"F}Op0 0#(p 0* Fc5   +,p!'D+H뼃 p p'0p #)L4gzOL  "+  \H' 0 ,8"0'Flł 0 0#<0 "O< *@p,yJj  !! #ഹD  " D  bOb% 0! 0 0# 0@ @L= " 4, Q^B˃  #0! ધ 㶩Na  ,  " ]/Mb& 0! 00# 0SD@= " D, 㡨M˃  #! ȫӧNa  , , " Bb& 0! 00# 0֧7L= " , դO˃  #(! ZDa  , < " Jb& 0! 00# 0 O= " 8, ٢oF˃  #! *Ha  ,  + BOb& 0*(6q7H0j 0!4 0# "1=F0ʊ 0" 0#  8=O0a 0*0# D:4J0$ 0,0# ? ;D0j 0! 0#0 `;6O0ʊ 0" 0#p< >K0a 0*<0# >8B0$ 0,0# 7:N0j 0! 0# 0M : " ,@ a *,,9 )M ā  #8 " ۦN b.0 !D*<?A0ꪂ0, 0#e64L0a 0"0# 0D)O4    " *Db- ( ৃ㔋Jl˂ 9p !|Opp0i0[eF 0#08p5``  p " l oHb-` `0p,}doOl˂``  p!meH``00(p 0#0OnoF5``  Dp " f,nOb-` ` p,ccJl˂`` S7Oe00  4p " 0b-0052:=K0 000# 0c˂2 :B P0 P0 !0# +N0, 0# `050LЍ@-@P 3 E7FN, 0(Iv420A 0 0 A-PPp`5 W) 0!Ӂ00@@h00"V>0: C0hV@Hp` 90V@@p`F AH D0D 0 a, (0( 0 W    p ! 1 p@-`P0M@0 00' T0 P  !7R8 bx b$   0 0 0 30X Ѝp@` \0\ 0 T@ <0< 0 2],  `  \ 4 O- MLLŸH2H" 0 P00  p4 0R @  0XS @@rQ<0`Ls00ᳰ T $. 0NrQ)T  0 s0aA0C80BS,!1 0 0 30> Ѝ.R ^W* 00RP 0GS0 S S Y >Q 0@^*0^0 48 <^*0 8<\0 |- M_P ЍPP!0@- 0,M S $  @T/o"S R;/o"S R L 0 0 $0 30+,Ѝ0PP P B  0@!0( T $R$B R T0  R ( $Q C-\$P  A-P!1`P rMp00109 UA @^X0pA00tAR0O=R0 2?O 0TAXA\AdP5  0 pP& 0@eP 0 0 1 30 rߍ0<| |0 Ud0=` `0 P Gf00P 00[(H  p  p H 0-  t -- M0 0} ЍЍ/-0 0- M00 nЍ Ѝ/p@- M`@P @x0`0P0000 @X@o0@qT  Ѝpm T P1! @-`0M000Np P@   LOp M@ 0 0 0 30(ЍMP@pW @@T PU 0SP@TTO@00[,p@-@0Pe(0Pe(P,Pe 0p0PP 0P 00 0p`00YP 00 0p,    / 0@-@ 0 0 0  0 0 h 0 0 00@-P M @01e 00P 0 aB?o02c Ѝ04 00 0 0p@-0@P 0U0 0pp@-@Pe0PPe(0Pd(P,PpO-P0P[ `ਚPT @000 S S0 S S lpPC 00 pYpp: (@P q0p00S S S@ 0A S  Ak @P 0S 00 00dP  cP@@   O- M`p@,0(Sz: (T^ TppV 00SR 0 RL@D@T0PG 00SC000@D@D0P0S, T0X  0!0J0@PH 00S#0AS0偰0  Y0S000   H0S& p0@ d0ppd(0pd(p,pn@ ЍicP  (,@e(}0  Ѝ0 00@- M@P  0s P  Ѝ00 0 $$ 0 P Ѝ02p 0$ $/ Ѝ0O-0PLM0E E$P`@0 @ ``北PR$bpPN 0 ``PC$PPU @0`Q QB QR Q1 0U 00S} baP  `0 @0 p R  R/ RY R  0 @U pIc 0J[K 0 0 LЍ   @ Q`A@ 0U Pp(  ἐ  A0  ,  p0p04` W G   ` ``@``r @U0@ @bLЍ0@@bLЍ `^ P@Q  QA@ PS ^ QP @  , p 0    S QARZ  R  P P@ @  AX % X XB p X2 T( QX X X0`` `  ` `  `Q@t0]p p0 @   P@U`KbL 0 @-@P @K( /$0$ 0$ @K X ]KO-`<Pp`$0[p@ pPP $p(0,P[P3P#,PWG0-0(` pQEU%PPV V* PV'`U$Y3W' 0WO #(`(R 8P P4PE2PE1PES0PEgPE:`uP4;P? 0 @aW1!030#-05-0%0Y" #(`(R 8P P4PE2PE1PES0PEiPE8`uP09P P4 :0 P0 800@-MoIp/ @Jp6 P0u0(0 @ 0@lIt 'U q0Px  =P Ѝ000JЍ0MI 0 Ѝ0DI 'QA-p@D P`SqP0 A00 / p@-\ ,P@\ \ Q :\ :Ap 0 p| 0 p$O-\MC @P0( L4 : 0rL;;$`r1-lJ^p1C0 10ᖡa0`   ^0 008` 9P 80 @N4ƌ<ŠaЍ 0- 0 0@-S@ 3/@bJ@-] Qi7nIࠑP*i7nI P@ Np ^ @ `@D@P V% @D BD$ BPE&"PE@D"V%@D BH$ BPE""PE@DQ%@D Be$ B'"^ r N $`P@FPEV%@D BD$B E BD &"A@!@ B BA!" A@%! @'  i Q7nIP#@ Lp \@  `@DNPV%@D BD$ BPE&"PE@D"V%@D BH$ BPE""PE@DQ%@D Be$ B'"\  \ \ , ($`P\ \+ \' \) `P^ ^ NPN `P\ \ \ \ Pvlhd\XT @-@P  @L0/ 0 p 4  1 !0p@-`P0 000: 0 ## 00Cd.R 0@  0P0: S@CfP P pp0 P  00C 0 BPP 00t@Ꜽ|  G-P\4\ 00@  p0@C0@ @@`@ 0@@@`v`V @@p` p 0@C0G'@@`@ 0@@@`v`V  `0@C0N.@@.S 0`00@000@ 0@@@E0C2S20/.-,+*)z'&%$n"! jc ZNJ2S2V0/.-,+*)J'&%$E"! D6 *%$000 @ @  @0<@afp''g`<@ap 'g 0000pf@00` T 0@Dd`00 K @0H0 h&0ಐ00@D `  0;`X|0@- M@n < PU R 080 00fP`1S   ;`1S0 0 0 nPL0 0 bP9P P VP&0 0 JP0 0 >P0 0 2P0 0 &P0 0 P`1Sy40S{ < Pp0pW  0R 0OpW 0pW  0R| ,0OypWg 0pWb  0R4 00OfpWHpWE 0 PS 0 O`1S   0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P 0 W0p01 0L0p01 0A0p01 06wx1p0 ,Z>[L 4OtЍ tЍ 0 Ĕ/0 པ0 ඔ 0 ௔0 ਔ 0ࡔ0 x0 ꤮H\ |4  X` h H  X l L ,  @-`0 AM@M 0p 0 40400}?PP0S q@ 80 0 4 30AލЍ.,OL0,@- M@ p  PpR?`PP 0S <0000 Ѝ00S.S 0S Ѝx 4p@-Pt AM `0 0 $ @P 4 ,0 0 4 30AލptOp@-P@`Q  @Q KPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P 0` W00 ЍX p@-@MP`0S 0 @S 0S@V00ЍpO00@ 0PV00Ѝp 0@- MP0 @0@0@T U 0 Ѝ0l0 0PU:H@@ Ѝ0840 P0@ Ѝ0< $ @ x Qp@-`M x00<@bP 0PU  0VЍp_40P 0`Ѝp @@hH 0@- MP?0 @0@=@T U 0 Ѝ0p0 0PcU:L@@ Ѝ0< 80P0@R Ѝ0ď h 0@-M@  T ' T2T7 0DS3m~0s.-,u*)('&%$d"! ZTO #TC |QTP Ѝ0 T6 XQ TP 3^H1P( 0@T" QTPЍ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP\ $ ( D h 4 L < d \ 0@- MP\ O@P Ѝ0 0( 0P Ѝ0 0@- MPBl0 h@0A>@0@T U Ѝ0O,0@ 0Pe Ѝ0Ћ Mp@-@ML `P 0 Q@0P0<00 0. 0FT @D E000T H0 0 <0 30 @Ѝp@Ѝ/T.0 "2PM딝P (O-MP@ ] Hp D0` R ЍPt SP -Q0 0 +Q0 0 |30  0R00C<,00d0 0.Q 0 @ Tဆ 㘀@(0 0S #3 @  RQ \ 0 0S #3 "#T$&<'(`0&8 &d((0'<0'4` 0(< p 0(4 000S0`p n 0T0 0S#3 @ \RP 0 0S #3 "#T E 0T0 0S#3 @ \RP 0 0S #3 "#T 0 0X 0 0 0J   IA0 0 0 B    ;ꠜ|O-@Q dM0 R 1<Ͽ<  6 0@Q2/!zgO|20\0\]lbPAS0N0P0o<88H<Rο b%sedž |f|}bpA㣢2@0W0jEE0L02H>'3 pA#b<Hp8 d bD #"2g22#c"T X0 u q<m[% H Y J XL ,D P0(H00 0$\@ p LP`84oC[ .VY *VX &VdЍ0 @0N\0@R@(@h x  0 0dЍ@Y 0X t ԯ į @-@P$ 0D .R S0@*S@T .T@@TH D0D 0( 'QA.@T@@p \ l p@- MP`P`@_0 v> 00      Pc Ѝp C-`@ MPp䀟@POP @U \GP@Wy@ Ѝ !@P@p0 0000  P"0S0Y@OoB@#꤁ X |C-`@ MPp䀟@Px@P @U GP@Wy@ Ѝ @P@p0 0000  PL"0S0Y@OoB@#ꔀ, P |p@-@P00C0S S u P 0` PpI`u0 0C0SpSr P 0 /I0@-M@w  000K00 !R !PIЍ0@-  0S&0@0Q R    =0H04S e0@R Q R ,@0Q ꤐLp@-@@P@0P`0pp 0,0p@X0'갏LD D p@-` P@0pp0,p@\LHA- @@P`p0p0 ALC-P0 M`p0sp@ H0  D@ <8 ^@Ѝ 9ꨎLxC-Pp0 M`p0Ip@ (0  @ Ѝ 9L0 00/ဍL0 00/`L0 0<LXA-pP0 M@P`0p 0 pЍL 0 0긌Lx@- pMP` p0p@ (  @Ѝz9꜌LC-Px0 M`p0p@ 40  0 U@Ѝ V9 L8@- @  M0 ZЍ脋LH0H 0p@-@0pP p@c/9p<L$- 4  mL R) p@-P`@V dP 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0 Mp@Sp` y0T 0C0 ЍL0H 0080p 07/0Y 0 ܉h H O- Mq@Pp`P'X0*00T+:Y@M X T  T+  p0@ \  P0 P0p00000 Ѝ0 Pp Ѝ0 wPpDWXW X0T T0  Ѝ0 ^Pp h O-M`8Pmwt ON~}|{zyxwvutsrqponmlkjigfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      0 P^[ 0S .St 0Sq 0Sn00S.Sai0ZD =400S 0p'0C (0 C 0fP5D0 Sy0@  0D;pD+0S0 t`〠0`pS 0S @0D+@T 0Z4  0d 0 Ph=<&<0  2 ݍЍ词8@0(0 0 hPP 0 0P0)=D 400SP5d D;0D;500 EP(0 C 0PH+,B0?Q0S4%%050 0T H ,0@ꯍ8@0(00 P D;0B$ 4Q404d 0r0 PxD; Sr*h4 0 B 0$0S8(0$0D+0(000pCW``WD+ (< VJ 0 PHW 0P= 0 0P5x3W 000#80T3 D0N 0C0 . q . 0 0CSW0A0 PD;`0DkV:H+,B0?R0S"E2 0T H ,0@`0D  PD;<"0F ND;d (b0`000 QPD 0d D0 @PD D 640D+ D+d 0 ,PD+0D;`Vp DqpD;`V0D;p 0d 000 P(04p0P`C 0 P}0 Pu 0 PkL h @ l  {0 t  l | h d | 0 ( 0 | t Կ t <  $ 0 0  , T  ( $ Ķ  =400SD 3D; D+  D `30 D;0D;! 1 0Ed 0 PP:D z3D;\a0D;`d 00 iPD e3D;0D;0d 0 VPD N3d D;0D;200 CP(0 C 0P `D :B Pp Pb  `P/UF0 0P0PE0GWM ȼ0 P=400SED 3D3d `D0Dk@h0 Pn `D :B ; pP$WW  `/Z F0 0PR0J 0GWr ၼ0 PDdp`D D  D P:W0 0P0+ZD  =400SD;d d0`000 PD 0d D0 PD;p0D;SH*e`D;0D;S@*0d 000 oP=D 400S;a2d D;0D;500 VP(04p0P`C 0 PE0d 0600 7P=D400S~ 0`&0C  V5D U5EB!?C0 S]0 P=D 400S0&0C D 0 8PD;k 0H+D;PD W᩻0 PlD; D+ D  `1: :J:D;0D;0㪠Z0 PM(0 C 0uPD0 P D;0B@) H 0 Pbd Wx 0 PS 0 PK QW 0 P0 00 <| d B x @ A-Pp@LU`, T00 @W``W 0x00*PE.p\p  ^0070.2000 S037#P00 \00( g$0$  0K` H /HBo/Y0B///C@-DM` @p0 0 < 2 $0 RP,00P@0P< ,0 0 <0 30DЍ.48، 8O-H MHH0< z - @zJS% BPa3>h`>"2d'2#g# C ኡj C6*Z>WFTNX 0 @ p0 SP*[ R 0@s0  00   00 R0P@0P0S, Ѝ 0W iP 0D _PW  0HUPT @ pM0 IPX 40e0 00 o@ Ѝ7| P ( A-`pP᧭0S. @uT$ 0D0 .R T  S\R C@D .R @0.  0T  S\R  @@F( 0 $0p@- M@P00 80P k$`P/o0 (0 0 8 30ލp)34l40-@-@R M00  ၑPP * Ѝ@Ѝ/ * Ѝ@Ѝ/3PRp@- `@P[P,P0 ?p@&۹00pPRp@- `@P9P P0 ?p@k&깹00pp@-@Q `PPP0 ?p@E&ꙹ00pp@-P@5&P  p@ p@p@-@P 0P   /0 P   pm 0 pQP@- 0R R  Y 0 S 0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!  YP n T@T @pKP ` 0 pp@-PP @9P N T ꧮ"00꠮"00 0S \0F0 Ѝ@`eꋮ 0R0 00ЍH0?D D0 \:@`0 p0p p \ \ 0 0 0 | r  Q0?0S @-i'-- M ЍЍ/G-PP`] Ve G00PE !R !@T3Up U< P, P@@D @ 00, ᮝ 0S0 PU00 5P)@@D0 @00 @0 0`0B\ \0 «VD0C@ @0 ห X Z dZ `Z 00$0r0<0M4 00 pP0 Q  VD0$ 000R$05Q*X``$08P`X`10 CR00pWbX0 `pXp0Zp(@< 0@%.2PL<`0@X CR00TbX0@X@0 03/P XD0(0 0D0`B, P 00  %PX0 L].l ΍ 0 00981s6_XX0P  LC@Pa0 #  VY40SX@0@᭜0SP@8 `X@.< %T&.5D 00$1Q *$0X@@$0XHP6 s"$0(0@C 0D0Z,0P  00$ l Q Q L 1 4L L 0 L / A-@PMPG 0 S`07 S2p0 0>+PPD BP? 80 0PP& 0 0P,8U Ѝ 00S S Ѝ0p 0, < 808 0| զ|, 0  G XG G  3O-PP0BMM@040 0 00S0. S` p @0vG#"0 DP @T*Xd$ 9a P 0 <",2 0 4 30BލЍ 0     ! *@PR `PM 8 0 0@PK` 000 00000 0l0@,TA 0p pIP) c00S 0  0pW1   0 s 0  0 0 %f+ 0  +Y 0  R 00Sz SvG1!p F F E E D DD O-PPMp Z00 Zp\0 0(*`P 3 003 p00 > (> = A-PPM@7 q`p@T) X pp00尙  0=P * 0 Ѝpp R@)T Ѝ<P @, (0( 0 70# " T= < < G-M`0pT@P0P0 V 0   0 p=PSЍ 0 1PP 0 0p< H; A-M`pP@P , 0P (    @#Ѝ, 00ЍC-P$MP@`HpW TU00SD 0S 0S0sB S 04=@P($1@0! @ DP`0pP00$ЍT T' / 0 0$Ѝ0S  0 0$Ѝ0S00 @P8 404 0q00 ; <: t9 O-DM`P X$0h L400<00 (z'@P P @p@(0 p(PP ^P ,` P âPP PP0 @ S S $`0 S S P |^0P < ` PpP`0S S S` 0Th*`a^`P 0S P0 0R 0 0?@D`B Z @  6 `F S 1 $ 0 `F V!:  D`F@[s PGPp  `FܣAPX @? p[pPPX(V(Ĥ 0  0x!d1 0 <0 30PDЍ(' @DPA @p ;P>ڵ0P2      徤 GppP 0 P0 0((0 0 @ ( 0000sP00 @p PpPw  p@-MP@` 80 00ɠ VЍp@-M@ (9$  Ѝ@-MP` @@pP0P0 D0) 8 00 @  )P?Ѝ 0@- M|@@PU l@P@@ D h T 9 |P Ѝ0PUV 00C-@PaMP`D UL !0    ` p 0S"  0 C RX0 0 C.S3W 0@ Ѝ R0 XR  9S, @ 0m 0 U0n 0 vS pG W0  R8U <40 3?0@ |3 \3 \3 43 O-P#@Q3,M `00$00w U V V U/ 0 H#@3 0 $0 30,Ѝ #3 0 $0 30,ЍOJT U Pp:Q Gm 0Q  b P`$0 `0 P @`p xP D [0@20Y[ P$  0Y:`0 " Xr V0F S# 0sXB 0!I1 04  U~!J|1| 04 ෠t xP :Y2[ X:Q0@ R 0 Q:! 0 0@ i 0 0@ |].Y P @~0$` VyPs Vq`x ( 1 0 d0 h0 80 / t/ |/ L/ @-P!@P 1,M `00$00 V(  p0 0 0  yP"* [ 0 0 $0 30,Ѝp0hl l0 VT0iP P0 , 0 9 .  d. H. HX. . O-tM$ 0Q|4 @00l00 X T T / 0 0$(4 0 l0 30tЍ$3 0 l0 30 tЍOy0S X P0`@C0 F  p01T0p \ "NT p  0r 0S P r w \P  0pS r w00 Z0S  Zpp000吒<0j @0 TC P U\*WT:00= K0 yP00Y0SJ@T` 0W00S 0SW@`:00Tw pW0 S,*: 0 S&* 0CR00:ZEPZ Z Z00/S0 K P `80S + 0 # H0 0X I0 0w00t  lx t0t 0 \ X0X 0 ߞ @ + * ) ) ) ) p) ) dH) O-@PM⼥p P+ 500SM ߒ([[ U U U ʠ 0 `ؒЍ0` Ry  ? 0[' + 0`P$P 0;/qp 00P @ P *$00  0 0 0ᡒЍp pc 0P  * R + L UY  0ppN P 00 0SM   0 00;/qp 00`PßQ <`V:X0`w R0ѐ0ᾉ0 w0P ;/qp`0 n 00 0`VßR <`VpX0P[LS 00Sh 0<`ß80*"0C`V0Z 0006YL`0`f? ` ;/qpB 00  P @ P v#00 0Z 00 |'P+0 S(: `F v Z1|!|0 ௝0 0C0ב`ЍP`T 0S  0C`ß 1G!0  00Z0 0 AJ` J`P @0P #0000` 00ᚑᖑ`T0P P0 ^0t 0h $% <% $ $ `$ # # # p@-`P@P T U @DV0TU p`0I\ \0 2U@p80H4 40 %VL$ t# L# @# # O-P$M@ T 0\0`#` 0 000 0(00& 0 B0S0 Q9  R00S  B0 S  p  " 0P 00  UC X 000@P9 0SV PPRY  R pR00 SR T*P` QpP R TPV Q `P H04 0SY0  ^tP+ R 0" H0  P@ 0Hp  R TP P, P3 PA X  R 壑0S $Ѝ  P B R pPn [ G`0 PPvU P PP P T hP0P 0(P! 0M !0T h$ p@-@PP` U 00 FGp 00p06 0 Ul07h h0 0@@@p0TS 0 p     A-`Q@P3 ppgP P 0  03/P W@o0 03/P W 0 `A0/0 <A 0 /$0# 0   d -M0 3/Ѝ/p@-@PM`* V PU U U Ѝp003/P00Ѝp 0 03/ЍpH D0D 0 Y, (0( 0 O  d p < p@-@PM`* V PU U U Ѝp003/P00Ѝp 0 03/ЍpH D0D 0 , (0( 0   d p < p@-@PP" U 0S S S pp0p@0/0p@0/H D0D 0( , (0( 0( ؚ    <` p@-@PP" U 0S S S pp0p@0/0p@0/H D0D 04 ૚, (0( 04 ࡚    ` p@-@PM`* V PU U U Ѝp003/P00Ѝp 0 03/ЍpH D0D 0@ k, (0( 0@ a    ` p@-@PM`* V PU U U Ѝp003/P00Ѝp 0 03/ЍpH &D0D 0P +, %(0( 0P ! (   ` p@-@PM`+ V PU U U Ѝp0 03/P 00Ѝp 0 03/ЍpH FD0D 0` , E(0( 0`    \ p@-@PM`* V PU U U Ѝp003/P00Ѝp 0 03/ЍpH eD0D 0l ઙ, Y(0( 0l ࠙ 8   \ p@-@PM`* V PU U U Ѝp003/P00Ѝp 0 03/ЍpH D0D 0| j, a(0( 0| ` D   \ p@-@PM`* V PU U U Ѝp003/P00Ѝp 0 03/ЍpH iD0D 0 *, (0( 0  T   \ 0@-PP M@ T 00P00 Ѝ0L H0H 0 T, q(0( 0 ,   @ 0@-PP M@ T 00P00 Ѝ0L H0H 0 јT, (0( 0 Ƙx D L  p@-@PMP% U. `V V V Ѝp003/P 00S00Ѝp0 0S0003/ЍpL H0H 0 U, (0( 0 ` , 4  p@-@PM`* V PU U U Ѝp003/P00Ѝp 0 03/ЍpH D0D 0 J, (0( 0 @\  ( 4  p@-@P`P U  p@Rp0* 0 #h  A-`PMP@' U0 T9 pP @R T7 T T @ЍTW @00R'@Ѝ !^1 0U!_0 0ܗT &0 0їR W 0SP@  Pl@hF 0SP@Rp t  , p x  D  p@-PP@ T  ;p@oL H0H 0 T, (0( 0 {L   A-PPp`@. X7 V@ T P  R 0 R 0\A/W 0A/ 0 0? 0 05Xd `0` 0*VD @0@ 00   p | @-@PM0P` 0D U8 0pS SW- E P R`V V4 V Ѝ W`1 00 R 0SPV00Ѝ 0 0 Ɩ /0 0 ༖c00Ѝ  Pp009L  $  p@-@PP U (#p@~L ?H0H 0 U, (0( 0 }T  (  p@-PPM`1 V: @T T T Ѝp0 03/P 003/P 0 Ѝp  003/P 003/ЍpL WH0H 0C/6V, (0( 0C/+     p@-PPM`1 V: @T T T Ѝp0 03/P 003/P 0 Ѝp  003/P 003/ЍpL {H0H 0G/V, (0( 0G/ٕ l   d p@-@PP U p@QX T0T 0K/࿕U8 404 0K/കp@90     p@-@PP U p@{X T0T 0N/U8 404 0N/p@c 8\ d P 0 p@-@PP U p@X T0T 0R/oU8 404 0R/dp@     p@-@PP U p@+X T0T 0V/GU8 404 0V/<p@P  $   @-M@^P0.S00Ѝ@-M@p 0P@0P0S Ѝ(0$ $0 0CЍ    R? ..R0) .Q -S.S AL#\0A QS' .S 0 .Q AAQ0B Q AAQ0B QS  \0A Q-R 0//0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//"0 0 /T L$ M 0  0Ѝ/, ,p/0/ 40/ ̠ ( 4 0/O-Mp\1 ܔP4 0 051E0< @S1 0V9T   0s00̐    P 0S00@N0?W0Sp l0l 0.AT0S@!@A@0V@(00踛 | \O-`V MP3P#VP30 U0p\ @ W @RH R R4 x(00 ЍW@ Ġ[? A @ GRP@R\ 40S @[0VA0[0S 0 0-, Y*@T*0P;0 A\ R!"ɑ 40S 4 00d - M} ЍO-`S,M@ [ ` 0 `S 0S0P~Pu @Pe ~\oSp`0030 `Y?$030 00[0000PU P0S @SX  0rr X*@ϑU pP0U00S 0 Sb*`^Z X F YU R0J T P= (00P0S 0CQ * 0G S0S 0 p  0AS" 0tPP10\ڂ@(00,ЍAU0S " ! 0S^@p4?<00 R~^ 0 SY000R0 ABQ AAX QS R0S0[0Y0SB Y 0 `R# ?0)40@B0?P0S J0 0U/@00,Ѝ[ ` 00 @H0?X0S\ jX0X 0U/y 4 0$ ׏H8`p@-P0 M `00 1000>p !@Zp < 40 0 1 30ލp@ t  A-P `0M @(q0 0 100p 0 p0 (0 0 1 30ލ h Q:/R/0S/S:00/@-\@3$* 0^ @R R R r( 0 0S0QA^ R! Q 0Q @-A  SAQ  0SLB= 0 7( 0 N/G-p@`0TS)  V WTT P@0TS P   0 ( 0 0QSp@-P@` P@!P`V  0R p/pA-APUQU@A`pPWڀ1AP运( 0 蹐 0 豐? 0 Q" A@- SBR 0@S A蔐 0 莐( 0 /-- M# ЍЍ/@-M@ %p TЍR/0-S0 \S  R 00O-P M@P 0DT"S ` ዉP-Ya +YQ0Yb T @Q `paP`pP" [)SQ" K0Iq P0aIQW0IAIQ70IS| V[SQ;+0S \0J0 Ѝ Q0YXP"0@ \@Ə 0R0 0 0 Ѝ80?4 40 c AL\T@txp 0 0 0M| JA-`(!$1PP rMp0010+ V3 @^X0pA00tA0O00 TA XA\AϠPOP k0 @ p00 1 30rߍT0FP P0 CV80G4 40 9cL X0400-    -- M0 0 ЍЍ/-0 0- M00 Ѝ Ѝ/᠈ O-@SMd 0YSi 0p0S000!R !5  ~PP E``#Q<0\*Q30A !!!!  P? 0 0U A pQpP 0@pQ 00S  Ѝ輎0T @00Ѝ@0@< <0 ꪎ0 0A-@P`p㢀0 qPᣀ0 0) T0 0p@-00Sh@@@pXPXXPbP@Pt@P >P D px1p@-P@V p@A-Pp`,t@t@0h@ >U  vv<0 K  A* P, @-@P0S 3/000S@83A-P p@` F  c000 @P p@-@PPpp@K!P1p@- BMa@0PD`040 E }PS p10S ` 0T! Ne Pf@9$0S( @ ( 0/[pS p1S `c!&1 0( 0S/p!al1l 0( Y @dЍ@!b<1@8 0( ҈dЍxP" 0@0C00$ 0 $@ (0eP @@$0S( @ ( 0t@c$ $ (0\{ pp)LX'','&X(P8%%%p@-@P`P` U 0 D0Pp000\ LpL0AH H0 bU00B, ,0 XLv \Pdh(D0@-0@0S $000S 3/I\p@-p?LP@TpP  0 3/P  @Tpl0A-0`pP= @P UP ( p?p `@G-P p@+ ?oT20SZ ` @Dv%:/P p@@TPh0Gd d0 ۇZL0HH H0 ч40F0 00 ȇ`8<A-PP`@! ppT  P ` @L2L€000#S €^"R804 40 0p@-@R`P  p@ 0 0 ppDp@-@RP`  p@ 0 0 Y$O-`A Mℱp@|| uP2 0P2LB?0T- P R; S P@T" V0S !Q L/`3/L2 S1P2S? T030# T 03Sp0p0@T@@P20CP26P2SW p W ЍS @  L3/L2 S @xh8 &0 0p@-P@X{`00C`0Sp S u P X0` X PXzpX^`uo \0 X0`00C`0SppSr P X0X /X?x x0  0|Ѝ+맇0000@Ѝk (@-@P y0SCy0; 0 ipr(p@-@QPJ 00!R ! 00! 0S uP A0Q`0R0S' 0S 00C000P0S 0 U00Sp7wP#0qP `pP  `0W\ \0   A<0<8 80 %` 00lDq`P0.- UM,@00L10 00 00 00TH 0 P  A ܆̆Dh P(@-h@-x@- RC/A 0\R#R! R/p@-`P@ T 0FP R @P  ƅ00pT P80?4 40 P0Ppn,- M ЍP/> 3D-@"M @Ϡ#90c 0Ѝ0@-@PMP 0   P=p`Ѝ00; 0 Nx0 p@-0@Q r P p0 S!P00p{PP    !<B{@0O-M` p} AQ P*5[$ 80Sw SP  @P Rs Q)Q0<0   " $W `W `zЍ @ Q:00XS Q0L)ARo^& 0 0 S 0c1# 00Ѝ QN0O0l 1 c0R:v00Q )Q 0D O-MH<0@ 8P00S  0 0P//O B0@0P 0SQ^p`0G PP`0 `0Q DS ^_ 0[ 0S S SL 0`Pb@0@00 0q0Vp@ !{T Pe q 0@SU0P000`\S S 0p \Pe R`  BaPPd S@0D0CSڣ0SuqP] 0 0Z 0 RWf* 0TDX @N S0T0@ T 0 BB! Br0PDP{p00S 0S`CU 0S S S xqk|P@"00ЍRr  BaPP@+P{ -P  @\ ࠃ5@ L^ p>,L pLW[``@ЍPM 0V@0Q 0pS00t LS S80S p000 b@00 0 |"00@@ {pP D  p212 Qp `o\ `\  ^ B `@W 0 0Si Sj S @00`ЍqG PePqPi v0`0Sa p{@"00Ѝ@p @QC@E (rPK 0`Fp 0W@FpT  p 2@ PE1 4@p>0`80Sg80S 000eUU E P 80S800c8080S pT0+  RP!@L80S J80SF  @`V~ \w j 00pdp@^  BR"@["P1 5"@!@S) Pp%#A A-9C@ R<ϠP`pl3 ^oP W0@00 pU @@PEPU 0 BJpP @` pT  p0 B;pP0U@0@-@-P M  r@r 0 B0C2S* Q*KU AZBKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ ?y0"S1 1  !2R / 3RS/00 |0 c R\0a X0 c R80A 40 c R/ᤤ `A-@T!`Q1! !0U l2,p(  U2,0DRA!1! 0R 00000U U0D1 CSB100@-@MS: Q @  R Q -o@Ѝ@-ppaM@P`= ?PGPP2 YpP,0 S Q< p 0: SxP 0uPP@0 $0,00 ( 0 0ЍyO00Ѝt0Ep p0 w\Py 0 Ѝy 0 3 (,4ԡ@p@-@P k00C0S0 PkpP0= 0 Pw : @-@P 00C0S0 @ I0 0 3wꠠ9tp@-@P`S 0rSL wS aSP 9y 0 pP0S e C+Sr0. SR# 0Sp0S0S0S0PSP0> 0 v$P,p@-@P8 0S> jP00 P! !' 0S 3/PP೼000P @ P S00 `M00aaj0`?O` 0p>/bP008, ,0 vxP 006`8@-@P 00!R !.P 0C 0; 0 dv\6؝@-@P 0 0 S 40;0 00 Ov0 0 S@a6ԝp@-@PQPD 100S3 0  QW >000SC 0"$0 3/0:s00P8p00P @ P 00< R 800pv0P{ J0 0 uaP00s0hp 0@0  0pw0 @0 0pX- dxh48-Ѝ/@-A@QS S S w 0 6@@0@6@@0@A6@@0@*000 0 0000/4G-@TSPM@@0Co$!b$A A Ap(qpT`H \\`{(1 Sʃ R `(q^  0 0P@ Ѝ谠Z (qw \w AT 0w`^㲠S0S  ?^0 C Jp (q$! @ $$( Z ) Q$$(!r6 V(qD@a@0 ` uT$ 0 u(1`( A^ \:0  6 @PV (1 w,Ѝ 0(qS  Q(!$!@(q0 A$1Z` 0 `P(aq o(T<̘P@- 0At @vG-@ !M a50@02/P`p 0 P ` P `pp  P` p0@X, 0P`p00P`P`p p!"00#%`&p'()0*$PP#`"p! '0&+P,`%P$`-p.+p*/00)(012P/.P3`-`567089P:`4p,p321007P6`;p<5p4=>0;:0?@P98PA`Bp?`>pC=E00FH``IppDGPJ= 徐ǐO N QE00@ L ABHG[DYq`?P9q5q TXO-@(`10p1SPp1f( RؑP+ ( `,0VaD aD S 1"1 O)ꂡ P ر F Jo zؑ@-@ 13/, (Q0@-@Q 3.00 2p 0 O-SMfp `+ @Y IY㩐Q*y0[* C0 @>!0 B1r 0!1 0!  >0>(0 0S 1S RW  R[J  F& 2  0 zp 6& 0R1 S0"1!|1bx!x0 fS &0 IY㩐3*yI Z[ PT0{F{/010CS` *v00C S {?尰!p0bl l0 afX0bT T0 Xfoh00} ` _`_^_^^\_^O-(0pM RB @aP0lb0yPP P FP'>J1ZuPp01a@0  Q1R@10CS㣰M* 0s0s0S0  Qr6T10C1(0 0S Ѝ @Q! R0(0 2 0p0 0     PM  0R1 S0C10 p p02b"0 eTPf Y  0Ip1P 10CS`+*v00CY:YQ[10CS`?*v00CY" Up崑 (00(0O 0p1P(00(00!0!0=1b!0 reQ ]$`P  @`AP=(00(0 $ 1b!0 Pe@00P0 Pp崑P b 0$`P] 1`0CS㣠* 0J1WP(00(0  $(00(0 $@0b< <0 e8\\H\[[([ZH[ZY\ZYp@-@PQQp #P 0 0p$Q #P 0 0c$ppO-M2,` 00t200l200Q Ui 0E 1#@P! U0ഠ p0 pp QPEUP*uPU0SY P$P PЍ0b dp剐P pp Jwp<1HX㴐0p1  0 S001QP10CS㣠5*0 0s0S0  Rq 6 S10C1 # 0 R WPP PPP1 ! 1P#P #(0b$ $0 =dX`YXDVVTVO-p@,M`Q #00 V8 V :f`00,Ѝ(0  #PP 10CS`*v0S 1 10CSp`*w0SV  q#V 2`0 2,ЍDD7D 00 $00,700 PPC $ R Av` Y*P0 PMa 2`F `OV㴐: 0b caᴐ`FV` 01.*v`S `F0Coo0b   Y 0Tp? 0BRs0`00QPEUP*uPU(P`0%b0 xc0 `",ЍV*v`VPq `Co娂f "Ve` "3P P"$00 P P0 Ry 40 04004000S0 "q, WS  v``F Ya"q W} 0G 1"PP aᴐW`FV`: 0bc3b#0 b3b#0 b3b#0 b\ a"l3bh#h0 bmP oP M" !PPe 0R >" !PPU괰W1 0{洰C 1X0:1 0P10 C P1" !P4V-`& "d`00i "  P 1P00100 0R Y !q,Z` B WR3!q0Z `0G 1G!PP<b0 Lb0Jvs10p崰C1 勰 `F1Pp! (!PP 10CS㣠: B1V`Fr 0ⴰC 1 !  !PPTUTTS@S0RR0R T 000 I0;001 Z. T, 0J /R 0W0 P0: S c p00 R C Rc?00@1?>?>>>>h> @-@ M`pZ`vP P:000 U Z Ѝy @-] @ 0T@Py p@-@QP L @< 0Tpp@$  0  0p d] y <<`<A-@Pp` AqP0P0 00S   L| P=500 0 00 0S$1   @p P@  50  P 0 0 08O-ؑP`pIYS* @y y!@!8 A@DT@]*t@ @0`Bv`0 @a@a A@DT@W*t@@0 0 000 0Q10CS㣠L*z0S 0C s00Q0@갱K[㫰*{[ K{0P0@0 0 \ {0b 0\[! b0 0\!x bt0t 0\\ bX0X 0 w\z0SX::h::77X:|77,:P7d7:,7<7O-14M0C0SX0($ 尐4*10CS0 0000!*0S03 4,0$0 040000@p`Y PP0ES 0  1PPPY~00CV 0 @P`p4Uv`y*@0t@S 0SR 000pVwp:,@@Tt@:x#t3t  0[$ 1@A( (0  0R( 1 S0"s0&1!V0C$0 (0( 1 0YX0 PX $P0Ӂ0C0 V* p@p Y@ 0Bt@S񏐞xnd00Yᴡ00 !00Sd*00CV` YyPU:0 [~01P P0 PP00]01P0\P00   r0`@@pv`t@p[3 V@Tt@:(!$1$  0N[0Y1@t@@A4Ѝ00 0  r00  r0pG,wp7 b0 0#[l h0h  0[@`@p+@49574p75`54254114`1<4C-Mp`@P& PP! 0!0 0r 0000 00!! 0 04000000p@PЍЍO-M@ 8OPPb 0 q00 S0q0 00 001 1p0CS`8*v0W? q`PH 00Q0q000 00 001 pP1 0 0<0 00!Vpp[#@PЍt bp0p 0kZ0p00100@Pp p1. /O-\M`>0pᄀ@ @ 30, SD0(00. nPUX X+*1 C3x沁0ഁ 20s0x0 0  202 00Sp q,Z (8 0 0 0 0G 1@`DPPf W 0 00Cr #Sp:      q10CSR*0S(00"h pW0 0 $0 000CSKzq1S   "RQ    K[㫰*{ PH⋰ p  TH PpL3/ 00Y  1    3 @ 0p0h1  $0Sc 0S  2$ QpP  q WF@ D \Ѝ3S 01040封HX㨀*xX H0x Q 1#4 C0 y0岑ᴑ ఁHX㨀*xX H0x Q 00$0S z1[ C3 y沑0഑ 0      000y 0 P? 0 0 0Rk3S 01040封HX㨀~*1x#4 C0 y0岑ᴑ ఁHX㨀b*x00 0@0 00S 2 $Ap00S   @ D \ЍpGWp&*w0P* C0 @s01p010$0  pcp      s1b 0TX!b1 0JX!b1 0@Xv@0封40HX㨀G*4 x戀1040ct!bp1p 0(XX!bT1T 0X@0封40HX㨀*4 x戀1040 P q0 $ 0X0b W1b b0 0W b0 0Wp00B -P0H0-&&P)t&&()L&`&(%&(%%4((''%$%'$$O-M@p  PPj @TE 2 hX20P0L2 @0 00! Q0B R   `Pd A`@DT@*t0@0C 0 P%0 0Rᴐ  崐Y 0 0 bqW0崀10CS`.*v0X 0Ѝ0 R0@崐Ѝ `V"@Ѝ@0Ѝ @0崐0b| |0 2W 0R @ P 00 @'#$"%("O-p`4MQ 00 YY 0IS ( SSP0ISX@004Ѝ( ?  ($0 p@ $0S ( 00A @P Y Y Y(0QUY,  'Y  @P 10CSP`*PEuPYX Y,0⸶带1 6 p00 0 bVuPU Q 0PEPU*0!1000 PEPB!   X@P 10CSP:腟uPub5pP0 0QV!Q PEU!P: 0bAV!x,0t@pU 1P{[  t10@10 C1 @P_ 10CS㣰: 0 bV(@(R@P 0 00(0rφ@ 0Q0 (0P=P 2 (00@ ( j 0S 0S ($0 @T(@R(0"1Q0CPS㣠uPC*z0UYa P BU5 @P@Y P((@RQ0((@(0R @% @Up(@*PE(uPR2b"0 U(@@2b"0 U,(@R 1 hP 0TS=A T0D @@2,<0042 (@0R0y UUQ Z0E 1 >@P PUIPY㩐uP: 0b=U1b!0 4U0C@sP 0tll  0PEuPj 1!0  PC  1 @PQ 10CSP: 0 bU10PCP !10 Pr PP0 @ @ (@(R"!((!4\\l  0pp@-@`PP o0 00(0`0Q0(0pO-$M$6p@00,0016 0050 0 PI A@DT@1*t@T6 `@s` @T P @DuPP 0P 0%00!10P @ 0V PFuP0t@ b eTT 0v0P 00$Ѝ 2 VQ`i10CS@ *t0SQ 00`$Ѝ44b0$00 2T P @ P QK Py Q0 S00 3嬣003 0 0  t00CR Q0S~ 0E 1P A0U@DT0@:0b S 2 ` P` 10CS@9*0D@  1PP* Ga0 S00 ;@VT, 5a 0RZ P0F 1P N !` `O1b!0 S 41@D Ut@0@CPE 1+ 0@[0:1 0P10P@C1 Z0P!0U!0 s00B!̠` ` 1@Dut@0@C1 @ PE1 .P ! BR@:L 0 b/S$(000/O P 0@-P`8@(P  0 0 E DH@ DX@ D+0/O-MpP`(@X"$@   \ ?p2D p 0 pP` @   P1 %f#" ," 䶠 % d+ d+ "0 x1 0p`0 094NP@ ` 0 @^ l!!   Š!`,)! !, $ⶠ0b+b+ !P 0 0  @ 0P0@ 0 P0`0 `Ѝ,A-@PP# $(paV P80 G CH0 CX0C0(0 0`0$0d0?  EL03? R0h R 08R(@R )@ bRP0 C C CC)8 bR 0A-~a@Pp @f(XR @S 0刁@pG$0(0 $0p. ?WH@`G(?`@``@0@ 0 T   0$ < 00T$0?pW (qR 0$ p p0$0?W@`G?`@`` 0$ @@< 00T$0R 0$q0 00$0`R @-/ ?P 0@-Pd8@(P  0 0 E DH@ DX@ D+0/R @-f/t p@-@P X00m]`\  0P 'R  p  l6O-\M(Pp0H P,P$@P0P<`L$P @ 8@(P4P pp,P]@<80P0<004@@`0@@(00 ``,00pp$0 0P0 0<0|0$'&Ǡ)Ɍ(0$97 "&97,;4 ";4,000 ' ./(! !, 0( ,$ 4 ) 0 ' +$̠ Ì " !,# ,. 0,,  $0 800P(0403@00<H0: p>I@09<4N @`D0`P(``$P,` ` 0@``  `< H0  H00@D00400 @1@ `pP匡#tp(A禀像8@&3.ࠉ.=<;:9876543210kY7P 7P 7P$0Ġ 0^P93P 3P 0!0H gp% Hߍ@O 0 0Ġ 01P 0H Dp HP1 `0 0! 0! 0! 0! 0!HlP  0!000000z 0! 0!0 !~ 0!y 0!t(0 x-s 0!d 0!_ 0!} 0!x 0!s %0!n0R  0dHPE j 0!Y 0!T 0!, 0!' 0!E G0!@ F0!; E0!6 D0!1 C0!, B0!' 0!\2P0H  ]20pH <0! ,0! +0! *0! )0! (0! &0!0H Ϡ'p h0H  p  ?>i@00x 0! 0! 0!|d 0!vH0_<0[T lL(G- M`p@  0000 0BSVJ QP0S BPPL W`A 0S7 6P= Tp8 X 0S: *P8 @V ,! 0SP010PW 0010 T 0@@0   Ѝ WPTU U @ U U \00YY @i @eb(4 T$3 3 l3 H3 3 p@-ּ0@T 03/@TXMcPP S00@T 03/@T\ຼpDH00@T 03/@T$p42 D2 2 1 1 1 @-M@@P Ѝ 0  p P(0A$ $0 QKЍO-PR MpУ ഁ@  `880 S" 0SJ: /# 0 Z  0080 S 0Q>0 # 0 0 Ѝ 2  0 0 2 0 @8@ @ Ѝ   P00 0  00 0sP00 ЍP   P  000 0@-R M@P Q\   0 013/Ѝ0s/r?  8P10@-@@ T1!\ 0C B  S P @Np@-`PV @1@!T 0N B@n\pSVpG-`P @P0pS:ؑI Y `1`! pc"  PU  M @TipP pPO-M؁p0PH 00p PU   @P 0U `1`!  00 "W0  PUp0  ЍЍA-0P @P 0 a`F P pqV @D: g 0@/p@-@Pp00Sp8PUp40``S#U!*`P840#U:u080pO-@R"|M2P 00t00] 00S80S ``"X2 0 t0 30|Ѝ4P`0  P8 0 1\ 40cJ8 `00 0Ġ p W`9 P&8Y<  J1 '0` !40 +4PU 80  P@R88P`0XA@8 0* *J8* "@R:gK0 S paKP8]KP8pdP 8 ` 0`P p8GK00CKP8?KP8o;K`00jI`gX{ { <0) O-Mp *08 9$00 20<2S 0| `Vv 0@"4SlSj90Vn ,000`00N0P . S\ ] }  S`P I \ 0P0  0CX 0 !>01HJ0 (0yCpJ0S(00S1!R00:X Z \c/ H c/C 0p0S 0 Z0 00p 0SZ0SJ00@2S708 R,00+ 4P`(‐\ 0,,0(PCI40 0 @ p  (`V: :J&` #470(7_V04`8X00 S  0 \ V Y P% ` PPX V 00S 8  Q(( Q >P00S#8Q 4Y2 @`@ [+ X`D 0SX 0 EPZ【PX 0SPc/ 0 00SO ZD 0 SR@T (=000S $0S  !H0 0S 0@T `6  P0 SR @T =000SI?00Z【 \c/ H0 SRr@T <00 R 00I"00$4 0 2 30 ߍ p 8Qd0 SR@T <000SI00Z【 p\c/0z@ )woI0 S $c`\P((\` X`0S4800 QS4800   PQ`0 @ A0 SRH@Td `a<00_X ` E%H"0`P0S(U V`P% V`Pa `8@400 SR1@T 5<000SI00QO0 SRd @ d@` ` 0PP ` G8@P@.@ Xt s@ >@ {0 SR @T ;000S@ cx ' h% % r !  A-M`@P`@p`@ᨷ,0 0000(000YPᚷЍ O-Mddß@q TA7S`PQqz q8 @3 0d0@`0T ` Q` 200  0S S @JH0@"2 0 0 30ЍhTŸ <qAЍO T 04S:`W 0 P~. Pp` A;  `X   GTpK`PYH  FT  QX ( Q  ` T 04S`WA p@~ _X` `H`pF`@ T W`@ T~~ @-@0V@p Y ! 1F@pU VYp:q?oT20S` P@c0G 0 ^m b db m l a ` 0-  “ ƒp@-P@Q ^0P !  2!0 2pp@8p@-@P` VP#p0-P@  P 0S RP0/OP *0?c0 3??oPP0/0/R00p: B-~x` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/0@-0 S-Pj $ 0  < QPR$R PVSA@` 00a000S0 0`  4 S  $3/Ѝ S   0`0 aS0 0 R` 0 0 0   0000Ѝ B 0 B 0 BO 0 0QA 000/0@-S@  R   0 0Sp@-P@T @T 0 Xpp@TP`p R Q@-Q \M@PpVЍA ` S4 *P` F<`O4Ѝ2R 3B0T `@0 0!1 A-@P0xMP0t00X 0SF@0 SDa`\`apx!0  75P8T! `,`p0H  |!510H UUP @@T  @@ 0 0 t0 30"xЍ0嘀 S``  AT00Ah0@0 0 01ȺT 8lS \Hx@-0M@ 0P n00Ѝ@-0M@&0P a00Ѝ-4M0P T04Ѝ|8ŸC-p02 MO0Ϡ8P00051E@`la<`Bdd `d@2aCd0SӤ R@PW6!1 0 0 30\ЍTӣd@D0R /S  R5 U*,!-00Q  P 0S0 QPW 0@d 0 @0pT @d0 @U*0SP  PR 0C0d0  0U*0 SP  PR Q 0Q $O-M,? (/ 0 0000$ S  )㏂LetaEIrI((H,  ᫚ ᪚Bp( Z 0 @00S %SP 0@zSzxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPOWMlKJeHGFEDCBA@?>=<;:9@)Ce/.-H+A)(1 4Q<Q# ~W: Zn D,4< 0 0 30ЍP @DH `8 ϠL<0#lΠb(@l4 ' 4P @4 0 ^A!/3bc0m1#c[n13:0cPmn1013b.c0 mA #c[ 3nA3:0 c2nASm1@  00CL``C@ @r  ^<04H8 VS gS 0800 200 S 0! Z J 0R Q 0      Q0 S0C 0 B900|P/A!b    Z 0 S  R 0Q  @9 B00|P/A!b    Z 0 S  R  0    V0Q  80 0|P  Zw 0Zr  R l 0@    0_ c0Q  70 0|P  ZL 0 SG  R A0 ( Q7 /00|P bbR   | Z, 0Z'  R !0Q  70 0|P c Z 0 S  R 0Q  60 0|P J Z 0 S  R  1|P(0   D& 0 / Z 0 S  R  1|P0   % 0  Z 0 S  R  Z 00ZC000Q  `5 0 0|P Z 0 S  R  10 |P$ 0( / bbR    Z 0 Sz  R t 1|P0   l$ 0  Ze 0 S`  R ZUPUP00S  ZJ 0ZE  R ?UP 0  P   PP0 S0R05% P|P0P00T00X0 0\00`00d0 0p0# H Z 0 S  R  000 S 0 ՜ Z J 0R Q 0d00!2 C0C0bSӢ Rӣ?d B1|PR  b0   Z 0 S  R  0z0|P 00x10 Z 0 S  R  04    `0|P 0S0000 Z 0 S|  R v Zt 00Zm 0    1`dO TO xL ,gfXt0<@<\L\DV8V,V V܁d` 0S7P `qp0' yqp 00P-0$ 0 0S! -R? S10 Z J  S ` QB,1<0(|P\ "`0a!"   / Z V 0S0 0    O g 0    0 l000` 0S[< `Pk P Z 0 S QG<P0l 00 00 S0 1h Z{ J 0Pt Qn00S 1 Ze J 0R^ QX# c# # N<04 H8 ϠB!l :8 ?OQ1AR00Ӈ@@TJ00"R ˜ 0 $  R    0!"R<0  0 S0  Q00v4 0 Ѝ0 S. 0P0' V 0V? P. 0PP ΌQP 02%> 09`0OR!" 3@0V  0 R":[bhv 0dPD F>Y02VP0 GP 0V000 PS?S00SPw ЍxP 0P0P 0S V FRll00\"R*P;4Ѝ"R 0S*0Z{000C R\֬`㸠 ` P z @6S%V\G;hPJ? 0h6 0 00T0ʂ T c,P0 T`u6S V0 @S=0h! /O0 BQ@ @s^ 606S2lEKⰊO` RN[ HXP 0QN0SZ0S !R }SK !0 0&@0R6S5 RGkF\hPn@0&@R"0 0S400S10S@ - $ 1P0@  `/0y=02?00cS00МO-@0MP`<S S 0S 0 C+0C RS@0KSЍ0-S +S hP V00 0hpS01Ӄ!0"p0/WpGh8pr1 p0001`V <V `V 00F+`F SV 0@ 0 0BS0 S,S    ;S  Rh0>Cl00SX ;S,S Sh\--l \ 02Phppgg@0lFH 2`0``PhV0pc\@ 9thh&l bx& l&p& |&00*V<@Kh0  / P  0 @0/0@Ѝ0@S>0S; >S0C0K2hP;.V|9h hp t` b@@h& ``lfpfxf|ff0k 0. `ЍhPh00ch0H@ɱpP  0CZ 1 p000 S0S >S00C 01p0p00cP 0,S000YP 0Sh)` )0L (l b )@l `4( {̠ ,壀@$0ht0nO4@CO@x<P岇0l6p60@|6 ZX H0b^ 1:f΂0@$P 4@8P< PTX\@`F1V1ð1x 1(.^00ꔌp@-@@0S p@  PP H@@P p0 h0@zT@0 0 0  -@$W ܳ ؅V@A-PQ@ 0S$ H@կpPQ 0 `PVU*V& plGVPh+V) P0PT`)0t0 0`l1h6l6p60h&J;0:S P W HPVLg@_`Pp8P`W`t-`꤄ЃA-`PQP pa P@@WU(PqpQU? PPTS xQ9 h1h!0P d  0U00]ha PoOP`F U|0P0\  RP ePE?1  PEl0?P0S0  1 @ $PP0  l 0 W@ࣥX,H,00#TxTHT, @xS< =<;:9q7m3k10/.,+r)('%l#"j QnMLKyi SxuMJ{S VVX0V 0   0Q񏐧 2"00C Q0 B$SiPf u0Sp0V `1!PLp  u0S0V `1!P<p  u0S~0V `1!P,@@p@pz2 p0u0Sq0V `1!P{!  u0S p 0V `1!P{ pY u0SU0V `1!Pf us0S?0V `1!Ppp pz0*S4 0 C @ R00 C R 00B S0** 0B Q0J$R1 uD0SV0`1 !P 5 u50S0V `1!Pu(0S0V `1!P * u0S0V `1!Pu 0S0V `1!Px  s u0SD0V `1!Pg > u0S0V `1!PX p <Ѝ 7 u0S p 0V `1!P:u0SJ0V `1!P- pn  u0SG0V `1!P  u0S p 0V `1!P u0S0V `1!P p] p p0 VO*0P~ <Ѝ@@@@ Yp5b Rpz[ KpT DpM =pF 6p? /p8z R  0" 0p+ @0 V  `1 !0P   p u0Sk0V `1!P\ C u0S p 0V `1!PGu0SB0V `1!P:$Rz0ܦ P   pu0SO0V `1!P)@J u0S p 0V `1!P p p puq0S p 0V `1!P rp{ kpt  uL0S ]pg 0V `1!Pu90S JpT 0V `1!P 00B S- @0## 0B Q00C$R u0S )p3 V @s  R  0 0p"  V@`1x$R @0p@-PP@ 0S0p\ 000p0 0 !_^O-oM M@P@ /H0? L0060 @0S 00L!R !0{0q 0X0 0S   R L? @p0䰍,0`00?@00l0g6f6F,p00 (00㔰D0\PPU @%U PU`D0?W0S VU 0`p @ z0%1$0 p 0FZS񏐆}|sy]^v4kjihgfe?c'v]\[ZXWUTSQON$LKJIHGFECaVC}8:983d/., P    R\0sY @0S Pb?RNo`1R`OP`.LQPQTQ!HQ0@F@ /΍LL,\Dt0@ˠ8DPPP PPP0@0@0000FP`5%00F S$V $PK;^ ` 0 0J0`00S0p``' <(0    Sg A0PS@t-0Pz00Su(  000SP00R@@ T.b?0000_@d`Tz0<84a( <0  Z Q' A( P \z S00000  R Z @ 0 0P {b0 d`00d0CY^ dYN z0Y@T PP< 8 4 ( <0 p Zh Q A( P P aPz ,0S ,奥0@0S0000PP t(\8 0 6 30 oލ ЍV_ aboP0z0@T0<08040%!$R PQ  0 R 儠 ARS 000Sz0000%1S 000SI?000$100 Z  @DTL0 0 `0S00 $0PCU00P0P0 U00S{ w0400S000( SPH01 0 0 H040S00|0Z 7R10P@ 0R BD 0R0S ,0S 0P,0 |0(PS-0z00s80 ` 㐠PhL 0qp. , 0(`0(0`@VP(0H (@10s0H 1b?00&( <0 l Za P !AP    R%a ( 0`{00P040S0S,0D @80DZZژ0 @0S08Z IYP80Y`K0 00H X 0 0S0b?!000* @DT@T ژ0`0@S00B00S$S0TD` @@IY0S @ 0P 0$0CZZ0)$ dP  Ph@` @JZ0S0PJZ0h@dP ` 00S5 000hPR T0%إdPP h`` @DT0S0EP@DT0 h`dP00Sx6@000}+P u0 S 0RX)b] DR`@ 00ZD @@T\ R J?0TP LR,ڜ7dPP0hpt@p@  `@DT\ P-@DT `hp dPt@P8\0 0z0S0 [P P U0H` @PEU0S @ 0PoPEU0 00S\9P00pPZ000S9000000 00 X00000S00@T0D 00,0@e0R0`)56P ) -,00NS `Vz0ʔj`P@  T@<@8@*:  , 0E*3:  , 08{0 U0< `0 R R {ob?000$BN%R00f0R MTlk唐 ``@DT 0R`) P@D)T  R0@)?@ ; PH ( pH 9P) P) <0T S00R0Sy < dpp0 P0{0l80TP4@<0`S00W0S^ WpGI<00C<0800000S00A400CS@@T ژ`@Q8TPAPUU0ڔ@PEU0S  0GP1PEU0 00SP0P00/P 'P TPv{ob?00!0NQ 00 0f0SP000F`BPz0 +Y0 4P d@@P IY0S0P 08 (10R0bB+ S- C S)!ھύp@ L cS#/N!b2n00  @ @L@00^s00BJ0^0L0\0 \Rz0@,`_T@<@8@0 S04? 000/x? 0, |00CD0+Pq PH ( H @PV @ PP OQ7 ((  @PQ5 ((  @PSH(01HS`-0z0͵0( S 0 04Pd@00S= 000C7P! ;00P _,`@T < 4 {0 U( `00 $ U;{b? 004 P08p<4p4 0Zp`I0  I 0S T  S  Ry0 0@P8p<4P00C 0   U S (P m   PH ( @AH _  Q_ ((  A_F  QZ (( A_9  S^ (SH0(@AH0_0k(`P Rp 8 A R R Q 8T 㐠PL  0p@0  @00$4 D 0Q (( A P vP (Q ((  A P gH$>D4D , 0 0BD00?T0cP@ oHP( @HEH@( P pH< 0  0 @00p\ 0  0HP(  @HH@( P pHd@k SH0(( H000 @00p 0SH0 $ H0H0@( P H0p0H(  @H_H( @H_H0@( P H0p00S `(P`p00F SOP5%00A S$Q0%S3 10`p,ẛ"0@00 T <  0  0  SH0(( H000gS(H0p1p( 0( H0w  @00HpS 0SH0  H0 P@Y PPV z0T < 8 4 @Gj =t=0= i p988665|b a 3@322d2$2A-`@P@p 0P0 P ܪ A-@P`p 0 P O-PP Y 0SI } 0Sz pp`@* 0]T B< B S  l R!1 @t0 0C0  ` B R T`p@`p@T T,0 1 !3/P`@D0CPS)  T 10 !P0XQRf,03/PZ0i  `@DBX T0@p`0T  P@P~0S *R *0 00PX @DX<X  S R !,03/ PDRi* @ 0X:ڙ0P3  H  0 Q 0Z0C00000yP 0 00C000@0C 000`Pu 0@00p0Hl l0 }X0GT T0 t 0  0 ****`*p@-PP& 0 `V @`0@D0T0@T ,0 3/P`ʼ0@00pD0Spp@/0V 0 /ꈭ))p@-@P|00 H0 PIp1P 00, @ὅ P᷅p dp@-P`@F  R T0U:T:0T:p@ O- MKU0jp/ 9Pfn^D  ЍOm 1KE a @Y: 0D @0S C B0S  U #R   CU&b # 3S RUY *CUR"W , W@p@G0pS.@GZpU00 E000DT ЍU:?C0C01 0 ЍO 1 0Sp 0e@ SR멟P/ P P0SA0D@  R=U0 0U,  sR  Y 0D@ R(U 0U  sR Y0D@ RU 0U  sR 0 0000D@ 08E `&&O-@-4 kWDM  0Sp00 @P<00PW`QųP0000?G04 @Z  R0Sj R000H 8<] @P % 8+ 0@$0+S@\560+C; +p A A{ Z`HXAA 301 ;Z[0H(000X0a00 Z 0C00h,0`P

0 SA.@0c 0c6b33@:0$0G{+S6L[0(000X Z0 ,0ZJ0PPC0J_oѥRS 0S00[0(0000 0 000pW`P 0SZ00WPPU0 Q1  0H;1!" 0 1 00!;R 0Q ` +( R +J:W {{+S 5AH {P3+C0S20 1 r+S:00s _ K q}K ; R4 `a{+: p 000lJ+t 0U 00 pW0p0p Ն00{00: {{+S 5A 1+C r a NJ

BH-MH  0Ѝ-M ЍrspqpppFF|~pq1hpqpq1`pR0 q  Q/S/p@-@P `[PP  Np0: 0 'ꨔA-`@P7UTp 0S *.P@ (p$S !T@pꮓ@@p@p@-@PQP4 100S- 0 5   0 P @P 0 0$0 s0 00R 0  0  0c0p  pl80<4 40 cp0 P(@-PP4qM`@p+ V3 T; p p |P0 :CRo; 0  S L   0(0P  Ѝ ; 0Ѝt0p p0 r VX0T T0 h T<08 80 ^ <@t(LX#X3 @-@PLSlM0P0d00< 0 C 00  #2 0 d0 30lЍ }0p0S1 `G0P "V P000`S ppPP000H"|D2D 0 ,"(2( 0 `0S$`!@  Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!`00  00 %  z 0SP pq 0R ```  00 `XPꩇ  x 4  Ȑp  ̨H h | p@-@0MP}00Ta~V( ~0T1S O}0T1S~0`~~00U TX!\!R Ѝp@l}\!x~00Ѝp@c}00U\!X \!X0 000S/ p0 0p@-0PUp@0A}00TQC~0`U TQUP 5}pX1P0X12~0T0`X1Є ph0h 000S/@-@0}0 X10CX1S @}OT1n}0 @ }, p0 000S/g괃 p0 0 0S/p@-@0P|U00 \A\Q X! BX!R p@|`}00OT!:}00p@|ꌃ p+S#S0/\S0//@-00(\ \0 -4M0 0,008 00 0 ,0 304Ѝ䡆뀂 T P@-@00@ R?P@Rp@-@`0P0PR*.0PpP R 0 R VpP0 @!]0O-MPS]PE@1a0p0 0 V`&:0  @@F0 0[ W00 *0 @0 S 00CX:XPE* R P  P `000PW 0*!1R 0CX:XPE* R PЍ P /p@-@QP  ,Dp@y09 0 ꜍  0S RP/O0?c0 3??oP/O-MP@8p@00 Y 0[ PT@T 06S 0@ЍG-0䁟@p9$A QPiV= @ PU ` 0P+ p@d10S~PP< 0S (1x1xPU 0C  pPp00Sk`P 0q0i000S x0xd0xiV0S 80px (0R0i s lp<00G-P`塢0`@Tڃ0T*P# Zp !p0 i )  P2.R0@0C`0P003 `PpG P `F-0P1 0^$23\ *G-P@p0@DTH1  0\G*32P =:P  @a P@0 0S 0SQ 0 Ap BQ 3 3 V  0 0S03#V FS B  02NS @0@PpP 0!A-`@ApDPG P 0`0V @*P 0D `V1<P 5561 1 +CP5 6+CV `5C5>#11 +CC0C- MkWPC@P WW0Y`6V0 Y 0 C.I B 50c 0 Ѝ 0P c   2# R YC>C0C01` Ѝ0S0/0 R /$uO-PMp 0GW"S`@tP-TP +T@`0f0TV WbX p pb  0 0   @Pp P Y Q P  S  RP!P 00Bs ^a0BSW0BA0BSK70BUH| X[ : Q P  S  R1!00XS00 C RN A BRJWO ?0X   0A0b 0 0:"00"00 0S \0F0 Ѝ@`e 0R0 00ЍH0?D D0 X:@`0 p0p pm,p 0 0 0 li 0 0000/Li |0<0/0 0000/i |0<0/0 0000 /h |0<0 /0 0000/h |0<0/0 0000/: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A @0@->R0M@ 0 000P0 013"00 :P0ЍL00ꜫ0@ @->S0M@   "00!,3,0 P0Ѝ(00@-@m@m0 00/`L $0$-0 M 0 m Ѝ=<;:9876y43210/.-,+)('&%#" ZU %!}2W `4p4@P0   `   P   $j  RO Y 4 PX  R0 [ ɄS0CQ [0Ԅ0ɄPU*^ 0`CV`FY 0 [0Ʉ`V*S00Gp0 00G S \j  d 000S0p0vS-  0 0@0 !00d00CQ0FPA0"0T 0$ (K 0  000v 0SV00@`P00V`S00Cq `s0 ,  v QV`0@P`Y 0. '   0ppp@plW pp倀0` 4 0. p*W 00G S`p6&00G S+0p00p\ 0l0 pp0pS 00pP@T  v  .0PP 0CPV`0fPF00p 0xp0,500v 0SV| 00+400r\l 00 0 v0S   P00%0!: 0@P00  h dT0*00@CC Y04  $ Y* 0[pɅ P  BR B0 [Ʉ R*  BR B [Ʉ R*@.10d0Q00S0 000D0@@0 c  0000 u 0  0  I 0} 000 0 \ 00 Y00I0t"T2 0 0 30Ѝ  m  000?0, 0P0P`,009 H0P0@p|0 00*A@x!t1t 0jZ\X!T1T 0_R00@ p00P0@p `@0r 0\0 00050c@a  0 40p`V0`=x .| 0060 @>T080> 1S; 6 SY`1  8 >@@ X@00x |! @0L0 >00S/ S2vP⸠`0pS JP$ p O 00HgP0S1Ss4P @`PT00ST^vP`㲐0Sqs`V0@  ^ 0S @ ,D,< hl 4 ` Th0@0v? H0x0T00D0@ 0d SD0X1S0 00S S00\01D 021|0P0ATY0L0S|0$0x0<0@00SAT| X0@P{ H0PPPzy 0;<@ $ sP @0P.P o D0@ @0 @ TH D0 H 0 `  ` SY L0S40SB < 0 x0 S00L0T`PP*p6 P004/P(*: 0 6 30mލЍX0h0U 00d0 o  pW A@@PH0Pz !eH0P0 + <`0$ @ dP &40 PA yD0`S`0c  `@ 0 0pVG00  P`?e B 0 ( \00 00  F &FdPP8 U0I$  QO `1  8 l80 X040e&40 R 040v 0(0 90SN0@/,ᐠS?N9c<"dP 0S @0P $}8p'@& 0p 0 4040P1 Q!  6 $<0P0`1  8 6P0 X00 0 0 1 01 040`1  8 @60 X0sO00 0 0\04Pb80%D pX 'pW@000SA0\0B  0 @000L0040oQ @U`D   1qV$00p 0?u0AWU11v#3 QU1("0#03 P BU Y10 #3P# 00< E@U@  V(@0V2 00U  $0v` ˆ01 00@0P /|8#@,#, 0o ^ (0h00408 H3 X0H08 3@Xuo|8"@" 0ho0 AQR , `1S 0  Z P4 ]`!!! QY   L28 @X0 Q 0L RZ X  AT vP*`x 0|Pp4/P񏐾?#0+S .0CS@0PWPp8 d1L @ X0⣴040c bP0qH D 0L0408 0@ X0ℴ0`!`Vy A  6 5 x1 p<|п,ܽT<|Ķ,\HLxв\dḏS0`01SX 0d0d00S S00 0f0㨠(0 P18 `d0 BcP0 d0bP(101<@PDpz_pP 0 00$00 a0PopP 㸰D TPD Br DR aPN0h0KPI0@1D@ h0 6S(0S 0(0_VPI0cLpv D T0D Br DR  aP0h0@0Pk z8"@" 0n^W $0 0R^ 0`1  8 3 X 0ታV 0  . UP  Er R000 Ƞ T Br DR  R ,#5aP8 3l X0\040Kz8#@8$8 0m8 $4 X@h0A&0R  =U 0PF(@0E(0U@ (0   0 V00LL0S<0h06 yh 0 sD0 P 7 30Z ,(0h0@ 00abPdSP 1011S1B= 0 < 0 8 68@" X@0Ȳ&0R  m8 P6 X0ෲ" 0 0 0py8&0& m8 6@Xl P0@K@0h0@0P@ ty8P'@p'p 0l30+S .0CS@0P Yy8'@' 0l P0@ Cy8(0((( lm5y8L(0T(T l/ /MM  00  C R1#0e(6,Ѝ0/M- 00S  R BC0S N 0Ѝ/M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@`P$Ѝ0 `P0/0$Ѝ000 $Ѝ00@-$MP@`P$Ѝ0 `P0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-!p1AM M00 40 PH dkPPC @ +0fEP7 0S4 `  0S+ 00@ m9P00@S 0S0S 00@ K@ @d @zzD ,0 0 4 30AލЍll d@ 8| O-0#,3CM M4p@0`d04401 020$020,00$0D(00 0D000S000-  0p  P?QP0(d400 PM004  !/ S ,$ 0 _jd4 00P0   0 0 PP P00 e\ S. ]\ <,104430BCލ Ѝ0?s0S0Q Q) Q :\  J  D )\ " 0/?r s0Ͽ|@i\ k `U LTC-PH!pD1AM M`@000 4004 U 6 0iU 0 @ P P'8ĝ0  0 0 4 30AލЍ PP 0@ .R@@H  4  [YkD P/ TQĪO-#3BM Mp`0PP0$40.P[@T: 0.TP@TW@S5.@D2Oo1B1U- d10U 1 #R T4 00m0P0[ 1U0) T 0 '0s"2 0 $4 30Bލ Ѝ0 Q^PN $PH T4 0 0d0 D D@R000& 000SG .SB T400P`ʹ0=S 1SA S5 S6 U00[B 0sK0SP0S [00d1PPU>00& D D@R 0 0! 00000S0000   R00S0000< 0!T4 00P]Z00WP<ZQ]j    p@-@P`]P p@Qp/O-p0\MP2@0`$T V0 DC0UQ#1 /O6@ pϿ 00b 0 P\Ѝ!0h 0  6hV X0 F0 0YP0wps]ZYZ0崠SUPP   B RX00 B 0YP` @Z=Z>Z7Z뺠PH0?X0S0 0 \Ѝ0 `F 0S0  sZwZ Z0sZ0S  <0 H4C-@0 Mp`(P3@D T@?)YXpY0Y  @Y U@D0 T ?R0s0?0  Ѝ  \  D 8 404 0  Ѝ@L$lԢG- pPᴒ@Ḃ`6 F0SP`?0WV!;` YPY, 0W`E0V0S?V0 *vG`EzY@T@V@T d =`0`  0Hg < A808 0 `D `t0O-䱐 MP0S5 @d@V%0V@Q\ 0\\"  p偣 pp p +; O-bM0MP@060 W0`+ D fT =0H `o@01%,=d!0 d! . 0`1111A05<0:pP 0ʏ H Jz@p d1 2d1tD eP3 `@ y^`0H SD@_o S\  S S00 Q@0S S\ 0CQS0 C0SQ00000p9p.eP 0d/m!F n!m%F s/r$G o t)F l)s$G< s%r&G8 ". ` "$+ 0>P 2#S;S 0 S$ s5a2GRx 0 S> 0 S 0 S0 o>R00sS#2 S S08( i>R"2 S S0S00 S S SS@@ `0 ]_AP @$@08 0S? e2R&20 S SH00R00S 0`0 S S00 (@@0S S ,PO0 5 C0 C60h`Y20H )Pf\@ RbP 00_\@ 00R`V`0`N00 $S 0d12d1 AW| Ys1,|YAp 0τ`0S [ `0`H@DSH .S0S[ P`.KV00[0S 0 (P % ,0%004 0 6 30'bލЍ0< S$B T T Yʨ4P0@P0L04,0400Tp PD T T@ TT  ;T RR@T 8$`40 p ;T 0s000@@T k P 0 0( P ( 剁`0L@ ph1WP @@T;T l3P0 0s000@@T;T   hP` l!  Y@P@PTpr c8R"2 S S~0Sg00 S S SS@@\ `` \ _AH P@`0D`S \R?* S S00 Q`0S0000$04OdP.P `\1 x#|#DQ xaD@`RbQ\0 SQP P ` -0@剁!@0h13?S01S?4Pl1l 8h!2/R!R/$l!`  `)PO2  {H5Tkc d TYL V 9]`T ܓ|p`!1 p@-Ph@lHMP ^ T 000HЍpp Qx#r cvWV p  X0xWPT $000HЍpVVhVRA-P 00P00S0p `V pP0\\C\ `@`@ ꃃ `` O-PQM |4|0:b0P0 p-l0P0   @(0 0P0 $@@   D`P h_PY$ RO 0 - 0 !pG0 0#Yh 0PP F_P0S Y@00 R% 0 pG P0 @T, 0$   PAT #U  @W pG *p 0  6m00Qߍ$ 0 0 0CQ* @ 0$ 2"0 nXp0 S @ : @C 0  T:@DpP`P @p0R f ` VPE: 0`$p@ P` R @DpM0U. $ ` l  T @D: : qZ p 0 0  lApY 0  lz 0  s000+p 0 iĦ  ̊@0@ 0@-@P @w; 0 0 a  P (0( 0@-@Pp00 00/ᠡ @-@P @Q;00`l @-@Po00p@-@PP  P 0  p |0 0 hPF8p@-@PMP' 0 ` 000`PP" 2|P  CPo 0  ЍpoЍp@ <0< 0$ Y 0  Ѝp舠 hEP@-`PtA M@J h!h1hQ P0p0 SpG0S< `k[p> ЍA@]P 0]P 0S@ R @]P  A0l Ѝ0   l Ѝh0d d0 PP P t DMM\:O-0T*4M , R{ p44: +^0 ,0 ?0 :p:`I 0@ P^O ^?0P0}0 0 0R0 P `\ :R,000\ 0:S Vf <90 P090y00(9p009000,0 H4 S  !$RHXPSQPOU^ , Q h80( R> X800 R> H( 0S  !R (8p0 p(p$ aGd@(`P 0!P4 R B  B QP70 pHp'  ( \'  X 0 HG @4001 p3 0G 0H0C(01@$`,0 S(0$00,00$SaSZ(@CQr @T  B Q$ , R  @ p,p p$ P  PfP p  B RS RA 4Ѝ50PP ^@ `%0 00  t% 00K@T:P5B 0P<500,50 P ATg4000C?00 P$ ,p R*#Zq d$`P@(Tip  P 1 T @ P$$$ `R " @T8 Zc ` $@0 Z (0pp00G3  0$ Tg |# 0$ a1,TC@ 01$000Pj ,0$ e,0$ PY  B , s, b$`,P (ZP f0SGbP( 01 (0YPP$ 0 $,Pa1 0$1,P$ yf@ P$ja`($ 1ag(@ P$ZP 01S(0>l1l!0< ^ς}0S0 00@P +.000@P! /0:\0   \00 Ppp;h|> h`>>@=H = =<T<@<,<<;X;;:h{|9|P8880877(7 76d6 wp50wwvwwwd4H4pv@-@PB00 R P !$0000 0@  ( $ H32p@-l@@`VpPPpdU01pPEP1Sp  (0$ 0p2QA-pAP@T`QV0bc@P 0 pPP``p`0(`,` @(tA-p`@EcPP T  6 0000P   st@-@I@0/t 00(/0000/0004/000/000/ 00(/0000/t0008/`0008/L0A-x``PU pqW@Pfd<0< 0 ,(040/\ ;NNNN/@- M404 0 $0`e Ѝ/ /\r@-@P 0`00@05 0 ypvHv@-@Q 00 2 ~ 0 G-`P@M@pZ 0up TV 00J 00 -00 00 000 0$00oPP9 0 2  < 2R"  "V &= " 2H p=0 00 00qpn W* W+ -00*0@sV K!P@Ѝ00@T0-00IoPP  02 2 2: 2( LP)0? 2< 2D1 000100(10 0 10 0100100100巜P 0 R00   06T 0 2 1 3/p0SW 2: 2l eP 2 @0 2@001P,00 8<t,4C-p@ MPQ 00EPEUC\A@E=2 2 X b0 R0S 2 +13/PP"?o2R03SF wPA (0$`  ( 2 00P3 Ѝ(0 $``VP ЍAP00 Ѝ(0" $``V000`V "V00"?o`213/pP { Ѝ@-`@ MpPQ l00U,0`V( 2S * 2 P13/PPF `P 0 p 2 00P Ѝ > ЍP00PC-p1P MS-:b V%*AY 0eppY  j 0` P Ѝ 0 U P`V: ЍaP`W 2< 2 ЍO-MY:*p00QaP@d0p@ X V`F`PE iaP0& ̱1PE PU0 2< 2Ѝ0  PE P P  ZЍ 0  P Ѝ"1C-S` M2:rBW R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 Ѝ`P"! ЍG-rMW Rb"*^* 0@0\ U@0 D PpY U 2< 2ЍЍЍG-`p@ᴑ 0H PP IPuP擳 0/ @0 @ 0CSà101aIz0S0Cs  0S001P@10CS㣐+*y0/ 0 @00CSÐy0S Cr   0Sq060T!2 B!0C2Fph0d d0 IP bL0L 0?400 00 6i,ji jH2itiiip@- @WP ` wPP  pPp@-`P@Q ㊚00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-`P4M@Q O00 Vv 2+ R3 13/p* 0 000" "0$ 0 003 p`0 9/P 9/P H0  ^ 4Ѝp$  0dqp 0 cP 2: 24Ѝp`?(0 0,009/P  R A`$P@@@0D @Q$0A3@D@N0qW T00 t2 @@bR!DAAMlpP V0 < 0TQQ$PO-0 @tMP/T@ j0P$0i 0 j P( a $t@0 000 00P0 0R @D@0`Hp 0@P H p@pz0 0D0  0@ᴀ000 `Rڴ R2 HD @e0D Pq 0pwpAL0H0 봀 B @r @ 0 @S:  @A@0P$ 000( 000tЍ$0 @4pP(0@At@Q3(p0PL0<03080$00,000000CS@@0S*40A@ 0A`Ts00@@T 0, @@@0P0 6j0P,0 `PVg 00v`Sg 0 `,000040 `Vv`oQeXP@0S0\0 T000S pPw  000@t@QC0 0`V;0 0S BT 0CP\00X0d0S 0S0\0 T000S 0P0B 0 0I 00000oS,0 `00040 6Q^00S 0 3, 00`00 000 Pd0S0 `p0W0 h0S,0 P00kT P0P X 0G 4S80< ?07NNKpKXJ8J O-\p? P0`@S@L$P X WP' Y  0z S40  0 (!S$10$10 10 0S07iP  0P0 S0'iP  00S 1$10$100O-$MP@Y 0 0p0W00 ``FV*Yv`y T$p  H$p  <$  @0Რ00`00PP Y$```0S S 1 !r `0岀0C00 Hxx00勪벀F00F000 Bೠ0@ഀ@0000 ``FV"*Yv`+ V0  1` !I`Fvv`f00xs00አFZ`ᰀ01:0y V02"v`0 KY0p0``FV*Wv`S ddd2 000W`ᲀ00ഐ00B00000``FVB*Wv`3 V 1 !r 00SAp 0pG0@ pp`0`v`s00ሀIX㳐`01:0 0 00SW`00Fl$Ѝ$Ѝ00PP @0 0 0k 0 0`0 b0 0e 0 0p|0x v`t0 WkG==<9H<<|< <h<9;G-`"2(M @0 0$00w?0Rpz2SD:0JSA DPP 2Sy1! BRS:0CS㣠C*z0Y6:ቐ @1p01 p@” 2 0„ 2`x!p1 0 $0 30S(Ѝ PH ZP崐 Z y C0 @༦0b 0 z0Y*0 pVtP202 Vp  0000`0p 0t p~ I ԏ $\:7A-p@MP`Q 00 2   Q `:1Qa0" B.!2 0 0 VI WFEYBAG?0PU: Q * 2 13/pV \* 2<00@PH\0 : 2 I E0P VP V$P 0  Ѝ  0 Ѝ0PU Q:(0 $P0PUP`RP  ЍRP 21 o}S@--M  @000 0/;hh  0ST000S 3/\ ;<P 8 80 0$Q/$$0S/ = Ԋ @L6<<00 R/( 0S/ < H5-AF hFF #x /! FD M)h1 J#F I H F0khBF1F8FAG5L!-OFhFI TOL:F1F(FBѝKLh$4+d ! #  0UђI B(Рb+@+>======="=&====*.49"F^ a#44#4 4#c`#$4#4#(4#4,4rH!#4>mIFmHt $4C$C($C,$C$C aMbK/F#`(_I@F> ah@F[J\K)FFnF1hNFWH6#`3h+KHp(khJM3hNF#`O "Fkh;k`+(F?F! *S($: 2ѹ^O $*D$ &7IPFBFd S3իZ !h0H#`#`d0[?B(FO $JPF#Id0X 4#$ i0O XF л 2,$*^ V0I Q0ZF!$!4!X!h!\7Tz$($*л M 0- 0  K h1 ^ 0?rK@? +hY)`B竉#`0F0!-OFh FI T,ȲK$JFFF&FD!8F)F(JCK}R((G((Zв!H8 (Q =O&X(<Рd)) \!@O O jI hB:U" -ђEђx ; ``Kh/,?йYI O&`!]OFFY6&FOOOJLO&&FlU#XFhFFIZF p F0AI"F%1F"@F2F(\;I XP : *'B33??"!F0FN-<Тm(FhHFmhB$iG!j$H TDAFOFXF|T8AFFXFrO0FLF(hCIDO@F(\f $! (UnIpz}$(>-OFL FhOI &Tff)FJF8FAѧKh/ݢjch*+I v(e(R(KG(+ܲf+R#H +R#a( fh&a`yvhs$pm(j,g#ChC6]Itk#i+ ##h+#C?`  c `cX'@BHFYFno HIZF h+###HFHHD/  0B,/*0 6I0#H'0hS2HF Z  -HT0@h+&J*U&*D,pCObhjCѹ/#JI# O Yg:F@F\F(>FFOY8F(3 \/)F!$!f (|f P0;+`Tl1FFH)jH&+a0*kDoۣH\9Fl*j,ٹ)5F/!#PI#  /*,/*/"+OpZDo FH9FFFZFFJ B O }KhB/)-УhP8FnF3X>PBB%TBB*j9FkHmhpCOq")FHFjbHY`O$0pCO#RpCO*j9FWHG! pCO(س_ˀ_(F1F(I&1FF!O𮀳 Ol+Ё(FbhjPC ѻ)j9H")FHF\<Ѣk4HSco@"1KOq0J1HLq8F(!j+!)j:F)HHFhF(Ů"h+l"I RpCO#`ZAѣickJ;c+R#/K@?J!pF%(z>Eb|f !"5}J)Ыm8Fh)j#H"Hch+??pF;ch+?5pF1HF@0F/?pCO#/jCch+?#C?߭U&* 0ݭU& I Uz-GF- Fh&I TVJ!F(F0ЬI VKNh@8LK`90̢H0+0_ԠI"`F ( I 2`k#cKdccH"mK@+jUj^00! #m@!OrdO@cF (c"m@ l@aOOrF[h`kG#kC#c(cbksH a00#ica<#Cв:#Cв#mCO !#l`lYCl#ik DG_N#m@^IK62@Bq(FDF(Рj1D< a(ч1FQHPI ,NI OSKHf`#`~0Z +61DJB@#m0 !Bp`i! ###C  Dk-@!l(FiG0@Jh+,I1&mBP 5nnEBrҰ !0 [jGPrOs.ф49F$! +"\+"z40+"+" Yj +Cq ]HF=00"j6#GPPH#m6214B2223B2#m]62# #2a6)2EB4 C2%m4) I2!23B24 C2 "13A:"1FZ0 D01GJBѲJBܮVU?j! i 2!iDf2CaaV?ܮlkhG0I Tz-OFl]hFI S\LXBF1F8F0E !kh#j)C𥀂IXG8-(+.DJM #&047F!%I P0; +rIqqq[qqihj (-jR)FF@F##a@RI"FF \i3kj+?++.R)jhjRzF"8_$!eAqaC7zi+Ѫm(")F8F@2;Ci li+$h+?y)jHFiӱP0i+#+h˹i "j#hC?](j##`Vm(N i!:(Di+h+?<h?+?6h+8Ff ii3)F8F##ah+?h?+?h+љ+? R)FFPFipC`O"(F F8i{)F8F##a#j+?u.r(Fm`O)F(F>(bO(F h(F (F(Njh+dh?+`h+-AFh F%I %NR4'2F!F(FpC KhBO 9% DFT@(Fdp(O r(!h%H/&h/!0F0Cx+3x#C0F V(H1F;Fܕ$!zp! " O#"  F F B7  L ! p (``Oܿ#c`LI` RHK!8  j(ŀKh++'+шK"% ~K"!"K`#~Kh+JzJ6 *uJ! +wKhwKhtK`qKh+ rK"`qKh +.#cKxdlHkI#FkJ(F FF FeL hCh;C`+ "hhY` "_HphZ`+:#MK6 0kGKxS{SH(f#OK"`@K0+cAKh+_ t=Kh9K(a7K0S8Kh;AKh?K`v+ .K60+:H5H8K$L ` #1{ *xSKF0+(H#X#x+<x+#M$&FU 41F,ѓI ",p "L""`"""d-q q -"o > "--GFh$tI RTsNtK$tO`3h BY#9FPF|FPFEkJIF(FzB2hx(.cI @a+R#!$! (  PI$$MI (KHJI (HHGI (EH,У+h3=M#=N3hq+F(@6I+Lع*hh#x320[ F2FF:!F\#3"1F F a$H!F9KI Z(H $!(!>HDHJHzBt @THht@_Ht@jH!uH|HSDgtH$(h -OFhFI R0M$DFF&Fx(`oSBSAJk`K!@F9F JCKѓK иѤ+6UйNЊI R("G((-H8 (Q ;;;;;;;h(d(f(!v(!@O &!O &O O !&FO33,FkhW*+=:!XF*KW*@#x;#+'SI FpLK`1F"@FjF(@LI .!XFT(FIXF0FAI F0XFl F 0:I"F fkh ``P0; +pooooDooDoj#"!F0FX0FF(Dh+f%IpRY9F'F!HFhzHmiB ѨhCjBђh`oЪhiG!jPF pR09FF Hj'".I$(FF+ j'8Fz-GmFF[rL`a[B5`G5 a[5`5`[@C5`aHHF('|NBFQF(FBѢi*@؀wI" 0Fj8h7yh)qI2F doOA6+#9)-15TPj~#/𙀻Bx#55#5#5#5#5NIHF AqJIHF @@GIJF0h0h "!?F h"+2h=I m0h "!j?Fah"+2h2I0h "!V?Fh"+H(2h(I#0h:0<#|#53#`0##z#1(#j3#b$#g#e#cFI hAB%@AB!I"sZM[$([{ZMZZZZZ&[Z[Z@F!h BI i\Ѵ`iEєBسB # `Q@ # `#55/5+''Kh--p5#//h/OJ !!OcZ \ڈJI 5s PpCO#55?/Hs/-10F#5@F-&0F4pHpKpJOaoK(F22?FdH2FfIF(Oq@F \[J8Fq%^I8F8F[L #3# V  D:F RM L | NH2MI(F*FrùII h#+ " (CHr2  >I?JFlCF(FQ. FB("  1I2zF H2BAFOr!H8FCF8Fv 0FF 2=F YHHch;c`+8 FF8F (04' N/^\q $!"el[y[s[aZl("h!gZ[Q[N[[b[!#hZ"`xch;c`+ F#hZ"`x- 0F0OS00OS0>H1Fk-50F11+1[2H1H((?d-J.Hq%(I*H-ŭ'I f(6O#-2I20F(}I #=-?T(FFI*F HOrhHP@ "!FH(0FFP(""!bmd?ZW@"(-CJh(KZ`,p$NO XV[8F)FiF 0`0;`0+ AF 4, X0ZX "p18#Xj+hh!-O$#FFFFF  BF1F FCѤJ ,Sl-H!H" ?FQњJI S(2P(4F)0R!MIIIIIIIIII=IIIU'a)*|J#F-d-r- !!!d-A R-S--Q-pI*F Rp-}r-Bl-",;V+PF:F # V+"`IPF 0^I :V+"ZIPF 0WIV+" TI PF 0RIFP V+"FC    x"IFp,<PF@I"F6&XlE&6BE:I PF 07IF5J5IF(FlV+ 3IHFDJF1I(F0JQF(FzF(F+JIF )IT J%ID#I ,@𙀈F'V+H H!F FQ<$!-q$(Yr~D9qDFq{DTqaq|D(pq}qqqq}Dqqqqre!qX)O 0 %IF~RFFn%9F(FXF  Q`EۧI fF(FKB=s@3B1F(FO 2FVF"0FFF(FI2FH%FO 8xyara0r!-OF-FM#LĢ 222423322O33RF9F0FCїK(J(@I 3(F/(G18(FHJL9(>$===H`==t=========d============hG==lp===x=======A89(#ka### "#2 xha( [I D#d2t#42p#2l#2h#2d#2`NM$NNjh4U0F, a#2J232D#2AK/!@FF# ;0C:@F20;:?&/!HFvF#;0C:HF0": ? /!@F\#p0+?:@F0 :J#h 02:I( 0\I 3oҮOc3r #$!҄pr$(#J 0 KF2I( 0\#BٙI*X2x/!HFpHF HpCO0ayPp/!@F`iCFIH$HI :@F!  yH @F , P: 0XBEWslHliHiIOR@F fIE`H!JU#B^H @F )s#2#3VKh3SKh<0QIOKh3LKh@Fh`JIg[+?ޭF42k2# CC"C"C,2;M#a:H"92#2#6H2#ki33H.?fW(0+`d2k(h @pCO#d21C3C2Cl3&+ !!d2(h+zO@C:F[((a\P9Fh+RH!`#)s[#p~eF]##t$(r Ʌ$#?db.#:'2F:s!f0P!F(F:!f0/`wFH/`(NНpF)hH(i O3+a" (a0)hHHOrH7'\Tk`L7P'?+钇@<"82j!(2锇(e+i`mhv(FP`(oчI*F d2(i: ^0)hHV#1Oq}H)hV+F@C@ !@P\02T7,2P7OsH7(2L7fJiI ,0)hgHPaJfI(i 0)hdHg@F9F.@!@1F F`pZH.(i >.aWJ ! LSJ !WQJ8aOr/3023,2 3(2FM\2#SC#)K1!D RObB\"ZBX27K"Fy()@:h&FhRO#Fa!iOrHF1P(􆭪i/hB'0J:F~0@H#+b#a"2*G+@GKZiiBIF\~o(!#rdĂedAކe0#"# ####Jr T02o,2(2?+"\@3?! 2JB Ca0O@F (ڸѭKd2+0H+02+hF+`:HF(2:4A: #cR 8Ű aPCF i 0FF?FщH  ѧK)F\PFIF CCFE6 L  8F( @3B 2 3B7/kKo(Of(VhJBsOc\2:?31*?+?⮗0*(خ!*Ӯ!*ή1J #L Bs i3a(?1BzFO +c"2C):\ʹFFS"QF F {i3?B1F'H2C9KXiW1,?c!FHp]2C"Cs H(H2H(H*Ir nƈ0#="# ##;SI׈Љ-O]M-#O$0F+FFCOka+FCO@E`JIF0FCXiYD#aiD#0Kh ȢOIJOalJFYX/!(FMF(F(P `KOaJ e`HFFpHFFHME:(F~F(32hlOaY*F(@ـIl ,y(c(P(UT(]xKyIFyH Jd+R#&&&&&&&&&&&&&&&&'&u'&}'&iCaTiCaWH9iC iCiC8hF9 *?3:!PF6HI F"+CHBFQFQF( AF+h 8I;h9 x 5In*5JYxo)39#1LȀ`!F `BFz!C#ԚC#r 5C#QmMlSZzd@edA̹Oc!F b(FZCF/I b -JQF F+L F(F#W+FHFcEF;nzYF F 0I b F `$ c D<`BI b ua;0!+ I b JTm, cI <C#PD#Mk-OFP FL'MNJF!F(FC-$O00EH'DKh-"! (?I 0 x+rho hnF(i"h`I v hx#+ h (?Y h " x+?N"hSI 0 " x+?@#O9!F2젹!F8FTKPFTH@F 66 4:/?N@FU#PF0CtZx*Nxc+p+8b+GDDDT ?,O ESۗ/O@ F&!F0FF !F(F>(̀h+I*FbI DTO/WFF IC$($!Td#zsCCUCCDCC# "`3h C* x+/ QIhh+  0IKh qGK#B 2\2 32pA_FZ  8Ix h310[5I 8F GFF*?O.I:FKF!F(FV+?\(F@#KEB#pO*?8B!F(F(9 @3?)(F0"H)F(F|!F(FR:FKF!F(FL:DTd#!'DzMD-O%NFFF/FO RFIF FC!ѓK , Ѐ,,@ˀXLF(J F A(>a8((8 +.3wKEuKh x+ FEoI plN0hJ6hFEfJh3`E#ObIHFLP`IHFF(_IHFB(Ѱh9F (hQF!(2hYFF.Xph rhPI *bOaqW$F JIq *#3h +F 7(DF] !|FB=4-I8HHH!JH5HHHHQ]HHHvHHHH$HHHHHHHP`HHHpHH#=hsI(F# 4pI(F(kmImH##`#443{#4v=heI(Fx#4hp#"###9h"]H`SK`]#O2###9hOrUHOCB?J:hQI R;h4@#"##"9h#JH41#oB##"9h#CH$ !#O2##OR9h#;H$#oB##"9h#4H(#oB##"9h#-H,#O2##"9h#&H0ch=h+I(FLP J+xh320YI*F(F`Fd$(xf#jdFd$! Wfd]`!ddvv[kvdd"e!0eoBH#)F##"KX`#oB###9h"HvK`s#oB##"9h#Hf4c#c"###9h"zHWvK`T#oB##"9h#sHG8Dch=hkpJ#pI(FVdnI RVJ3lI(F6#@4*hI(F,@"eKfJfI *=heI(F0D4CD4`I(F D4C\I*F8h"! (:hVIO2oC#OC9h"PHPKC=h(FLPLJ+xh320ZII*Fh (Ff =h:!(FPTZ /!(FV>I +x T FBF@6O5FHh hC$X*HXy/yTP$KI/CqqI4KX#*sO @*@QF FCFѓI"F,T0ѐI"F$4+5F箨"FOaVF(I"F FOa `X1FOcJ(8FX^}J}ITX0ThpCOuJwI!$rH!\oJrI !FkJnIiI"mHgO{(F <hL4[h4$1F[H0(YJ_I "[H iIF( IOr4IF8F"( 8F IJ PI C`4;#X443+4FI;x2+0#C8JAI䦯AI;L8FX#T4#;I8F84+T46K)J6I6I8F(4KO6!Lz*?x2{KS#Bq &I+Jh$X1QC(F# D0@X# I#"Fj#ggff>f# wff ggxf#`b g4gKg&Qhb@(gg+@i> a(F0ѲH!F^OYIFOpM5JF IĞ!ItQ2zC"sD$*ݢH:F!FOz/sMXO0$$4T±+e)j(OEJFs (F:FBюI?cs+F+O0$ѱ+Ob0$OS$40o$_5|HORL/uJR OrOr0$0$B0$+rOb_rObOR)04$4 4S$O0( 44#0444| 0+ @4+#QJRIRH#@4,4K$4 *Կ,4 *F1F F #s9ЮB4(F~{h+? !XhF`(d9J#Fd!p7M  a (m2I "X 1HObT4+M0FJl&HM "Jd!FB@ F4 2 .H\46HgX <"TH 0(QJVI"RH hAF( HOr4AF8F2(8F,0BJ GI , C4+ 4 AIB1f#C4J=IdC(!F0ѓH0ѐIOn텋LFO6FQFJ8FAшLh @ y +H +Yp(TzIC84(IL 5:PW,[`~6hCC` h"x ("hUI 0hCc8;C8;|hCKKh9s h8CK x# "hAI \S+ =I h"x ("h7I< EhCshCSh0I C@`#h@;/hXChChC8;C h"~xF ("hIOsB IhCghCchCC_`RMb@A{Gz?u$5Jc$(}$j$! h"xF(Ȯ"hsI6 h"&xC+"hmI(KhkJCcjH`#!hhgJC fH`#!h hbbK x+ ?"h]IO VIA<;+SI8FQ OK FY`h"CA0 8`( {:(; DIhHCAHZ2s<+D?2;KhBoCEOFOs4KZ' b3Hd p@`OhCS`h_OcˇOs2%K2s8&n`.#D4`+`pK FKt I"F .ÿDt`##eA3EԀ$Zx$]$`$ /$!v$8_Xh_@K@ hFFK,@ЀBӀ +πI1" 0 / . - ,+*)('&%$#:!#FFHBh ѓHO|B $8;#"Oq@0фH8;#"Oq.0|H8;#"Oq0qH8;#"Oq0iHhՃ"x+"y+"z+d+{+"+"+;!'xy;#z;(#;+&SHSI0"!(1LIc10?$IH@+GIA23Bؿ#T@LT2C*h;HF4DDFvG+h/JBCT3+'223LB@ph_rAـK)!rH`aQUR !" "d(IPK0k K& "!T(I?h@# "!KD(5I/!$ۏt$$$!pu$4؀$U' H3 "(Id &RkhIFHTK;FAOq(򺀾KAOq&I Kk2Fk"(1 k#kKf4aM'#f"%fd)F MT<;B󎀨I K@0z A0 0;0۔I @TVz A0 0;J`"2BVڵQ݂I` @wKi[hxI` @Հ0HHJ2"oI O \0CkI'`KZiRZa*?1fI)F 46dR0^Hx `` 8ؿ`8@HHJ ( IF{*F~- Mh+HHF@I˺# x#p+t\h+*HF2H~1H &I t;x* Jݙ1BPh  {1FF!Hd2"B+?h-C6?@@8~Azv$ Ԋ v$`x$$4$ݐ$!w #0+@𒁩2B`87€EKd#C  d2h?𴃚Hըhh#OzsFXCH Kp @@  Ճ ݄@F!"D3C h h3SsEbF”FѴPC h2F3陓2[B:H FzCFF8Fa2Z+(+; h[HC;&;hC SH;1FRH&!jHKCDF+h 32FHh@F;Kh?Ԏ&H F:zCFF8F Bh ,K   2'K +. !HU  B  E܆PH FzCFF8FJ !hJDzHD <N8chE& (x$+V$!t$ۑ0F HF  ;+Yd #:FAF(F(?ix):#%')+-/1357H9F(FI&O^HHHpFHHHHHHHHHHHHH#:FAF(F(?H#:FAF(F(?ix) H(FHHHHH#:FAF(F(?􋭨FFHl#:FAF(Fj(?vH^#:FAF(F](?i{H#:FAF(FR(?^ix)uHzuHauH_#:FAF(F?(?K)ypHj#:FAF(F3(??kH#:FAF(F((?4gH#:FAF(F(?)bH#:FAF(F(?^H#:FAF(F(?YH#:FAF(F(?UH#:FAF(F(?)xPHh9F(F4I&b0+++&H FfzCFF8F$8H+љ   ._к H  ) D  ;F5Rsɒ*AQb{̓ړW@lΔ,6FZlǕBH@[FF p oO ;   3     EF w.5+E$IJFXFH.?W HPHJFYFnι &oH[FF  CH.3 H.O0ջIL$•-OFFIxF-+4 F(?ѨK$"`O OFFZF1F(F0C9ѠKhBv'>3FS}\(FK FV)W/DDd(X KIF $I F(хK"@Z`d+)  #&O DtDO;h DdDD4D$D$O XFG(FzYF(Fv%)F FaI |.іF(RIphUKhb "!QHKVI2F KTN[h "!+NHKPI2FLHK-7MI+F2F KKJLILHK#HJ#HIHHK !F^! Z! V! R! N! J! 06I6I2F!O00h+0H/L!hF%J?F(FK(I"FF  Pp &F !O00h+H .H0)F FH0F6*t%$!z&8 EWz|j>ܖ/~(-OFMFHKM(FH(`wh;x-+3`JF88F0JF0! jK+`V+8LFFO D+?#Y;pD>V?D;+Ѥ NF$3`+~r+XR+i+G t+x+ O V)Obm:PFFЃ C#+d0BF;F  LEs ki+ #KL*sj:HIIHHHo jAIDHCH"#~!F J8sc й#"I V'0 xg+@FKOfD'80@lI&$!%8%=ih x-+@1FF3*hLgg[gg|g@//dr#g)g82a0h3q&1.\(FF;HW80 F#)FC(3C<0Ch ^")F FOξB1F,H`FFh3++h+xg++%LlC#I$Jh( F!Hlx+Hd+.#h+XhPFHT JJJJJJJ0 j\%Z:J2-GFh FJp숹OL$:F)F0FCѶKh.v JIF lD(CРb++R#ՃG߃GGGGGG GGGGGG%G-0 6#$6#(6#,6#06#46#6#86#<6#@6#D6#H6|$&B<&4 C"<&,&28&qHVr4&r<&Z0lJmKmH)FFD`U#PgI(FJ(ZeK #D#xh`I(8]MOjO W(@M #+p#kpVHSMP&khCT`FOH*HzH(Dh1!oF(f.@@CF@2>HJE +x++#.FO 0F45H`F(FO 8`E_l*Jhkxh320Y<#XCKZ`PBDj ۲20ZԸ:(3x%z|Hyt Ct Д $(-GFh#FHLMBF9F0F>C,хKL1 1Ch$C!+@@$ C@O,p%%aTIF(qI x(`(A(;M(Ua+R#e)1MYe5qh3`434434yGKHJZ`u+h#`131m@33@3g131a131[131U131OД *F)F#(F hH*IxF "h 'IJ'O#:FF(FF8(Frh8 3x+AF 0FIN.?J.W AF>>"h"$+?K J`.%$($!Jؔ wbe%!<-CFFIFFLJF9F0F B0џKLhv-8.I$iLI F I F pLMJF9F0FC:eiK (. @3B#a( t(#i Kh#a%玱#i{?hW! > BFyIzHyIBFwH~t(o@(A83(S ES_kwϐݐz(eci+aOsci+Z#ca:ci+S#ci+M#ci+G#ci+A#ci+; ##c`#a#a#ci+*@####`#`(h##b>`ci+Osci+##i+(hI a(#cbi%$!$(t!ڭp:-#j+?ڮchh+Ԯ&i--ͮjI0FZXhI0FT0gI0FP( -e.--̮=-?ȮS%cs1111M-W)P h)F6(NI*F 0D@-Ѐ-i#"jihXAMAN(cAF?H{i##"jih>(smhW)W)cj+?( ^W)[Y" 0(HJ??#H>OBFHR F5KHѲ3 C "4#>&`j(? i)F F(1F F(AF H(ڭz0,L-OMSNFSO FO2F)F FCOKhBO9(, D8&U/0F MR(f(O#4O*OaR> :I* Dd a*(@ `(>pCO@гO5 `jF!g(> d ZFOa8F&48F/K h+H9F F"0!F*PF `jF!1( `jF!)F( H a<&v*W%$!z~Zt-OtML%&nI IOghhKH8X<8KDX@8KX`XdXhXpXtXXXXXXXXHhLhPhThXh\hxxxBFD8O3l8ciHC #8FF:FB? Iw`I*FF D1UL [Hp YKK x;KKA)J;K8(BH"M&`h$dhL#ЀF F+I FIKT(I FI K"h($I FI0 K"T(X(H!F~I F(K"h($(% բ0^mwh!!6ڭ8d4D+E!,wH%(fqy#8BFHCFѧL#F"BKlhR!# </[P8FB ( #Cp(F (@hIIF:FH8#X8T8#NKSIhLK "h ( x+?+DKKIh#t8"@Kh#<DI " 8 0F  8K`h+>I#PFF:IX"0F|01H <x+)K2Hhp.K&FH*##L8KhF#`8d8#N0h( 2hI( Kh?)H tMHKHhI2F(%$!$( >7!,5/G$(!]qL#H<<(x (@jGFN<; j(xy htK L(*@)@𗀠HcK O4I "LFI "0FhHx2FFHa8Fp"FF8FOX8Fh"FF8FOO8F^"FF8FOF8FV"FF8F>HNJFH6HFJFH.H>"FFH&H6"FLFH0FH* Y!F !FL  !F!F zI +@+D*FFZK88 F GF(MEOb F&$!!1%&X^!m3 t l"!(pM pIO,ť 1#c1OJF!F0FC:KhBc7Kh(Z 4KhS5I(F(3I(F~(-K"`n(+b(9(%0(%08c +R#V(JIHXI*F #`#`#{`JIHF xjF! h T?+ї6 &$!> = OS!C w  -AFV;ELH`#`%C#`I##a }O`a]  G oAh(oI#;`r8hmJmK(FF- 3hx-*+*[xK0 nV{AF=8F(8FWHaxCTHaRKaRHaOKa!j!!NHF-ci L(Z V = F?Kh;?Kh#iC=He=M  x+h+8K9IhJ(5H!L (h(?? *Kh#c*Kh+!(H    cF(N3h+w(5`Kh+c&]]&x]][pZ]]]&&^t& V-^h&&Q^&\&-OFwL F&hrI Hf`JF)F8FC*mKbih2CU# 7G8h(?W(@`K!hj^H(\I u(`(G(DI(FE(;PUIFFUH a8(S ˧---ѧ---)-C-----IhC`h#s6K.Jh+Fc`#`t##aq/J#cah0+JhF|)IXF#YFFY#K &hRhCsKJh+Fc`##"F@F:(?=H8#a5#"F@F*(?-PFCEig'$!x '!4e!$(> D-OFF IN(ڷI 5F,ĕ0FK@/! FzDJ F#xIh320H#eICFHMSK,@𐀢O&F%FFFDJAFHFC@𦀜Kh X#7F@ (I0iij\ `0, 0*Y 2(F"F1F&QI,", rJ! :#zI:FzH0sxH"!SwH"!NuH"!IӱsHDF(5voI8 DnJnKoI(FnJFmH:F 4"x-*ghx-*abxe*i.Yx,Ui*k*e*NC\JCGC Ds( P( E(?KI(Ā-(ĀQ8"(S I7OY_{7#;)#9h(Hs9h'H;hx^-[x+??+e;hx^.ٮ[x+?ծ?+Y|$'w(!e $($!ht@$'!̕ҕוM7G^*$!(;hx^,[x+??+9h 9hH#O O }#z%x&v$t+`0+ ii*0\0 I0KIgt7G-O$FF&FJF9F(FC/PK -8.J0FF(7,C FdFM  %CInF(5W) B0FiK"`BfKfIX@#0]O8h^F8h^#F_4IISHdV(d#MHLI FJI BII >8hZN'c@DH@ # 7G F@ G -@$ FG BG G F@F G1H"!F #0,K`" +K`d(Kh)À 1.1@*#K" `1x'@'q''8u'd''H9S$+:K;J)F9J+! F2;F7J|[ j43K! 1K"1I9>~9O0I+H]8FL|CF+SF%H9AFXF$(@7??HYF98F7~9( IHwx1Yz o@8x-x:xa8_}xaI< 8YIx_xxz fZ#1ʀC[3 C 0rV#6Z1 ԉ30rV#63 Z!Fr605Z[ԟH9X2FIF F6(ݛH92N#RqC"<1!K80ђIH IH "K8c0Yh+ІIH9IZG[Ԩ lh+حH9Dbh+?έ\h +?ȭZ23";C[2vHOq0 Fh+pJiIpH9oH@0 6h+iJaIgH9 LFXH [IcH9bH9aH9 7Z[\^I " 90[HzGBرXH[ Cc[ W W"QK80Į?INH9 W W"GK805IDH901IAHI>A@<1C<1;H8F8H9A<1 FC@<1LFFI1H? 81Ԙ FV09FV#60I'H Z#V $IV"T"J#J#HT K"K2 9 0AIHxx=- 1Yxx0 xxy!y/y?yTyzy0yy= #oyNyyys8_ssy !7 [Oq>0љH9"K80єIH9c*ZY\CsZ`1 F9xIH~H#D \! xBh+0*`[IT  9* F781#{Hw`!R#9X PF`1S"9 3 j+ @F`1S"j)[hjKx F9 F981Y F7?jh.AZ1ZԞH2 /RP՟pLQPOI   8 7)F ;jINh-?L+j;3F"!8mh 032FIF@F73jC0F60F9<('vhjh/:Fj 2Rh*?!)K82k`h F`9jh,FEjB`H8[@#C.89m\F0kF-[ h+? H8f zA 1Y#ozlzzz: 6 z{xAz)z  Q/0@-0 ph P ^0vR@b0 , 0 010h h,h/p@-MdPP@T Ѝp `H0   @  r 0 @k0Ⱦ0ƒ S&* 0@- "@ R P@ 0\ R^H00"@<0 0 0^$00"@0/ᬁX@,@-M @Ѝtl  \/\-M 0 p 0 S 0 /O0 Ѝ\ P/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/0*/)-*/=**/'*/$*/"!*/*/*/*/*/////^ */ */*/<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/? */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/J*/G*/1/ B*/?*/I<*/9*/6*/3*/0*/-*/**/'*Q/"*/!*/*/6*/*///*//7 */>*/ 4T*/@-@@*/*/*/*/xG xGUxG4xG玗xGxG{xGWxG^%xG3xGZxG܏xGOxGׁxGtxGxGxGxGxG炶xG xGpxG$xG xG^$& xGxG積xG pxG縗xGxG,xGWxGBxG(xGxGZKxGRxGxGxGixGxGUxGʂxG xGxGxGIxG%xGQNxGuxG  xGxG烑xG+xGxG&xGǖxG磅xGXxG,|U$ xGbxGPxG紭xGsxGJhxG xGxGxGxGAxG`xG4xGJxG6xGxGxG%xGxG xG ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in ddedlnlsmvpaxpwd-shsttychownchgrpdisklabeldkctldrvctlfdiskfsck_msdosgptifconfigmknodmountmount_cd9660mount_ext2fsmount_ffsmount_kernfsmount_msdosmount_tmpfsmount_mfsnewfs_msdospingrrestorerouteshutdownslattachsysctlswapctlftpcugzipgzcatgunzipmoretsetchrootdhcpcd]&8]U14MX 1,QQ]6 iUK;%5)V;*i. 18  :>5C%IC2]C<qCIwC[CUCCaC/ QlXxi\oo~s}sxQegEŢŢŢz  !D9A"Y5L%s: not a regular filestdoutmalloc, using %zu bufferrfUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'fts_open%sfts_readreferencepushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s is not a directory%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s -> %s %s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory D    @@Q2  @@     Y @@") Y @@, unblock and -DNO_CONV?\8, 2Txoflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizeoutput block sizeinput block sizeblock countfile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekprogressskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposixblocks%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %stotalUsage: %s [-] [-ESsx] [-p string] [name] %s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp file unexpected end-of-file& no previous commandp invalid pattern delimitercannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input filecannot write filewcannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\invalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailable!unknown commandcrypt unavailable ? p:sxES ? interrupt? warning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopno matchnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw.%lld%d %s: %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS/ ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too longout of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodirxz+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readupdateverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromsummaryexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sMODEGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s%s: Fatal error, cannot open %s (%s)usage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directoryusage: %s [-p] directory ... ~$ $ $$$$$G$$G&$%%E%%Z9%N%h%~%#% %_%^%F%<%>%?%%PATH= a.t*f.d/.s/*c/.m/.l /'/r //*p7/)n?/.v G/Xb    EOF reading here (<<) document;4G4O4S4W4\4a4e4i4m4r4w4Z2u|44444444444444424 4%4v,*404''+,,:N64}-+?=6@666666666@&:H,6>,6B,E,66abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'l"0B9"1J9"1P9"8Z9X"0h9@D"090"09"09գ"099 =  ^e$hHH P8ܕ ,  <:s:` !D":H68&:                  L;M:R;M:1;[;1)`;+#0ّ8+f;;P}m;X;s;x;;z;A";i{;;y;Q;QM;;m;m;iye;E:E+Q|;Mr[;;ŕ;;;;(H;;/ ;; ;;9bCA;lAlias count botchalias %s=aalias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld getcwd() failed: %sPWDOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %s-ewrite errorerror %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4f0.0Pipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode ELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misused/dev/ttysh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld Done(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d Can't open %slpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(((...)<>>&<&>| && || ! | (if ; then ; else ; fiuntil ; do case ;& ;; () { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)secondskbytesstackcoredumplocked memorythreadthreadsprocessnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPSc, offCurrent option settings%s%c%c%-19s %s set -o default %c%cdefaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenonoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallvixtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilesacend of filenewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)+-%s, +%#xinsufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<<asyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXIT---pUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=[]missing ]unsupported expression when built with -DSMALLeqgtnt>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'%s %sbreakcontinueevalexecreturnshifttrap:unsetbgchdirecholetfcinputrcfggetoptsjobsprintfreadfdflagssetvartrueumaskunaliaswaitulimittestwordexpPPIDIFS20220122 BUILD:20240503090059Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedJCRC 0XC\C=]bCgCmCqC vC~C C8 C aCF>CDC:hDI lD sDg xDg D C Dc D D D- D D ޱ (DG D ?- D D{ D *a Du D EEEE #E3E#E3E2E3E3E#nGF FWG F@F@FvGG&FEEFE GEGF E@EEEEEFF DC$DCDC$DCEE;E E)ERFYF0E8EBEaFJE@RE@ZE bE 7FlEFtE@F|E FDDDDDDDD9G @G@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sflushrprntdiscarddsuspeoleol2killlnextminquitreprintstartstatussuspweraseillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeed%d %d TIOCSETDTIOCSTARTTIOCSTOPillegal option -- %sallcbreakcolscolumnscookedeverythingextprocinsanenewnlostartrawrowsspeedttylitout-litout-tabsopostonlcrocrnloxtabscrt-crt-newcrtkerninfo-kerninfoechoecrterasecrtbscrtkillaltweraseiextenechoctlctlechoechoprtprteraseicanontostoppendindecctlq-decctlqbrkintparmrkinlcrigncricrnlixonixofftandemcs5cs6cs7cs8-parityevenp-evenp-oddppass8-pass8creadparenbhupclhupclocalcdtrcts-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.Cannot stat `%s'A^I^Q^@']@W^@_^@f^@n^@w^@|^@^@^@] @^@^@^@^@3^9^^^^^^^]^^^^^^^_ __@_@#_(_2_8_C_J_P_ ^V_\_d_i_p_w___5^_____g]l]_[[[ \\/\?\R\t\\\\\\\W`````````7```2`r;`e`I``Z_`n_<_______`W` `_``"`-`2`7`;`?`I`O`S`[`_`e`i`t````]']l_-]2]9]@]G]N]W]^]g]l]q]x]]]]]]]]]]]]]]]]]]^ ^^^ ^%^-^3^9^W`````````7```2`r;`e`I``Z_`n_<_______`W` `_``"`-`2`7`;`?`I`O`S`[`_`e`i`t````W`````````7```2`r;`e`I``Z_`n_<_______`W` `_``"`-`2`7`;`?`I`O`S`[`_`e`i`t````changing %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# unknownline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/tmp//usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXEDITORmalloc-c/bin/shre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsyesAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tableQrounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] Xo klUsage: %s device %s device command [arg [...]] Available commands: nonerwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grewfalseArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'B^q  c   ɋ 'FY̌+ G!W#W$`&W1W2h3W4W56W899:;ύ<=@A(BdCDE͎FGHJLM&N-O=PMQ_RtSTUVWя\ۏacd;e]fqghipqWsWtWuvWwxא1>Sbtё &>XvӒ6<UUUu?`͓ WWWW/AZMq͔   #BYayÕ RfWWQVi~WۗW2EQt/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]@x//@   (0608>F>LPDZ`dh$rv~Preturning to single-user after filesystem check rq,%s-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sexec %swaitpidInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbinv7fsunusedVersion 6Version 7System VEighth EditionMSDOS4.4LFSISO9660bootHFSFILECORENTFSccdjfsApple UFSUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware VMFSVMware ReservedZFSCan't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s ** %s (NO WRITE) ** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors reservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dDIRFILENAME=%s %s=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%s (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ffs ***** REBOOT NOW ***** beleAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSER** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'%lld BAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCKf** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)CAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK GROUPuser%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODE (CREATED)can't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-FvdQlQ?H F>LPDZ`dh$rv~P_h/     !8Nm6R n!#$~&123456899:;< =$@3AGBCDEFGHJL4MENLO\PlQ~RSTUVW\acdZe|fghipqstuvwx1P]r(E]w;U[ttthЈ"-7Oaz{ +++Dc*FN K 6YlSFH0eC쬗-SFU0eC쬝hHah!IdontNeedEFI(s*K>;|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+*=rGy=iG}.9;Mt?DOmWC 3KOOZSyD<#*=(fp3Dh&z\ M}-@Mjy֬-чH`-чHZIчH@IчH/IчHJ&2IчHAS'@ )Ѹ\QN*1@ )Ѹh1x )Ѹmwbackupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdecCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Partition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juprimarysecondaryUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionBootable partitionPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]swap4.1BSD4.2BSDunknownHPFSADOSLinux Ext2VMware vmkcorePrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TableAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'removedab:i:L:s:t:remove[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qEntry at index %u is unusedpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk a:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) Attributes: NoneCould not find index %dDetails for index %d: %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5d show[-aglu] [-i index]type changedab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-la:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changed-ao:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXendattributesgpt_arrayGPT_TBLCan't open `%s'backup[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endmbr_arraystart_sectorUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps***setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatusprintallmaindo_setifpreferencedo_setifcapsziv 3yi;;;v 4)y 3;;v ,z hz ,)y 2iz *8z 3v $1x 3%v r+y 4y 3v 4v !4,474C4O4 [4g4s4@4444 404@4444<4 44 4@4&init_current_mediasetmediamodesetmediaoptsetmediasetmediainst6G66660466 66`7 7@7 7666media_statusmedia_constructor6655H{ 5655H{ 5656z 6666{ 6655,{ 565x{ paddr_matchKsettunnel8v 8{ print_link_addressessetvlansetvlanif8X| B9.9<| f9B9=setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchan8?;?>?A?sethidessidsetapbridgesetiffragsetifrtsg?| f?Yv n?} m?n?v >h} ;> * v } t?H} z?| y?v ?} ?? * v h?H} 8:} ?} >> >> 99q%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflagrc/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLnot a broadcast interfacedescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedmetricSIOCSIFMETRICSIOCSIFMTUifcapsifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATASIOCGIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s input: packetmulticastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPifaceiface-opt-familyoptional silent familyopt-clonemiscifflagssilent familyiface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandsnonewait DADlist clonersdestroydeletetrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6arpunnumberedlink0link1link2downinitmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediasubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s supported %s media: media media keywordsinstanceanymedia-mediaoptno carrierno networkmasteractiveno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0x%s: getifaddrsaddress:link%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tag?NONEAES-CCMPWEP40TKIPWEP104AES-OCB...SIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ specnfscan't get net id for host "%s": %sRRSڭ/N`;S N S SN NS"N@jxjjjj1kNkukkkkkl:lbllllm5mUmzmm%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics formatmaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %sexpected files per directorybytes per inodefree space %use `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big ...Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device where fsoptions are: Bad inode size %d (only 128 and 256 supported)sector sizesector size `%s' is not a power of 2.block sizenumber of inodesVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: open for read%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s%*llu,%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @BĆFفILN OS6aGbWcbevfhςiۂkmnor$s5uF@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:P@@T@h Xp\p `pdp h` mr@ w $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectorsCan't parse timestamp `%s'sectors/track%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'bytes/sector"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u%s: can't write sector %u%s: unknown standard format1601803203606407201200123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()'# usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /tmp/option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! cd%s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered oldNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptywarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d seekI%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY?Rk+Kk9YUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkchangedstexpirehopcountinet6lockrestmonitormtunostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_print*%+%+%+_%+%+,>%+KQ9,`,n-%+%+m/&& %+ %+!%+1%+C%+Ob0n%+O{%+%+%+%+%+%+1G%+em%+e%+e%+e%+11 %+!%+/6,G%%f%+q%+x%+}%+bitmask_scanW)q\cho%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%#llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s???%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address boolquad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexNODESTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytes1M-blocksGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpfetch_ftpfetch_url!Csendrequestrecvrequest***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciiWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. r+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230516Version: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. output to local-file:Can't execute `%s'Can't fork a subshell; try again laterusernamePASS %sLogin failed. Account: Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sAccount:?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". rcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpasshttps_proxyno_proxyrpromptsslnoverifyaccountappendbellbyecdupchmodcrdisconnectepsvepsv4epsv6featuresfgetformgethelpidleimagelcdlesslpagelpwdmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodtimemputmsendnewernlistnmapntransopenpassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesndbufstructsuniquetenexthrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCopying %s (restarting at %lld)ftp_proxyretrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %s$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandQUITCan't lookup `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR RETRproxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Can't seek to restart `%s'sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ?Ambiguous command. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERpagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. MDTMREST STREAMTVFS Remote system type is %.*s. unixlinux215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): loginUSER %sPassword: Login failedACCT %sAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16K) disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for on[set] ~{[*?$`'"\echo %sfork"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dlink downunsupported speed %ldConnect failedescapeparityphonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraectbdchfesprdletdvcmiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zero%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busyPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5d n r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizehostphonesraiseraisecharrecremotescriptsctabexpandverbSHELLechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz  " $#!%Z^\`[_]alipi: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data8_bfLESSLESSSECUREmoreVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<liLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticlcmsovbbc|^ crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELLlessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/tty\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by textlabel%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE%lu \abfrtv><@=!:illegal -m option format: %swrite to stderr Terminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set tois%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i!   '  s' !'!\|'!'!'8!B!߀'S![!ށ'x!!'V">u'g"p"F>LPDZ`dh$rv~PNAME=//x04mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds   (0608>F>LPDZ`dh$rv~P edit_fs_type_ext + /     = y  1L  dA t5 edit_and_check_label    (0608>F>LPDZ`dh$rv~Pdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskhiyC K K M iJ M H E L F 5H E E V J T mI G B G N P R B B yS F {F F H F disklabel_change_geomH `outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default ''\'<'pm_from_pepm_whole_diskgpt_freegpt_create_new m - A 9 3 q U M  K V q  -  m @zz/ .`J\Qhm *!RQ7PPPP@x/PQF QQQ/Q>B`!Q&Q$04//Q3Q9QBQhJQ*gpt_get_part_devicegpt_get_part_alignmentFdQlQ? Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC쬗-SFU0eC쬝hHah!IdontNeedEFI(s*K>;|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+*=rGy=iG}.9;Mt?DOmWC 3KOOZSyD<#*=(fp3Dh&z\ M}-@Mjy֬-чH`-чHZIчH@IчH/IчHJ&2IчHAS'@ )Ѹ\QN*1@ )Ѹh1x )ѸmwЈ zSSSPSSZASSSSST !T/Tmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newHh\A    A A  } s G  1 / V  E  /   1 = y y q a  mbr_get_part_devicembr_read_from_diskadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_freemsdos/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qhttp_proxy <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noexecnoautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 10.99.10 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"headssectorsmount point (or '-')cylMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalFilesystemMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.10 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.10 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.99.10 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.10 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelGPT TypeBootUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. # sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPE10.99.10machineevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X mediaopt iwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicant/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %sinvalid%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)/dev/r-t xx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o asynclfs-tlfs-tmsdossysvbfs-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/random/dev/r%s%cCD001%s (%s)/sbin/mount -rt cd9660 /dev/%s /mnt2%s/%s/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%s>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-file/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmmdm >= 0 && m <= n%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c---%c-%c%c: %s %s %s %s %s%s %s %s%s %s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOs,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c%s%cr%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%u%s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%llu%s%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %s (vnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing cat <%s START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalse/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.c/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullSec GPT headerv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmkcorevmwresvvmcorebootmebootfailed/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0r%s/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0parts != NULLWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDLinux swapNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************8_WW WWWWusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading input%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETAKiBMiBGiBTiBPiBEiBcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2Qzzdhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2023 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option rbcrdBme|fg}h}i2`jÂk˂lmՂno܂pqrst-~u~vwxxzyA"B/C{D6E@FEGOH~IYJcKjLMsNyOPQSTUVWX˃Zo1ڃ46|~}%5GUS\ZaintzAJlɄڄ؄߄^ =&2default_configread_configrt_compare_proto[ [ rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt= = rt_buildrt_delete sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initp)x}script_buftoenveڄlbmake_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os"(,15<if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfread_leaseget_leaselog_dhcpە dhcp_bind]'؋/܎ 7dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sSTOPPED%s: removing interfaceSTOPpid %d failed to exitNOCARRIERPREINITDUID %sdup2 %d%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.0.6--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.0.6 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.6 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurloption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutwaitipallowinterfacesrebootnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0link#%dsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.clo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s not foundreading standard input%s: reading lease: %s%s: %s: truncated leasebootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedI I U U A A VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B& ' ' 1' I' a' y' ' ' $' *' 0' BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~?!C\dL\l  $@*0(l 8|$H*0tc/etc/group/etc/master.passwd: (malloc) Error in munmap(): AJjhPUPuVvXxZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit%s%s%s 646towlowertowupperASCIIUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist