ELF(@40J4 (@@mm__K!"\\@0 6QQ O@@@( @0 fH!@P@Q?H3xР -L(/ˀ܀main() returned,ހ   ! X(@@T @@ 0/<8T (/// P-K@-@PL00S @0080 0 0 0 CЍ__Ԝ[P/00S 000/|A-@MpP @ލ0s |PP 0 00`V 7 h@  0R(0R OoB[edA[\ 4S/0!8 00 (   !/@-돀P|]0 !!X0T0P0H000, !  !&[.[G-bM0SpPpP7P hЍG E@T P   P PP 00 B4R  04!@a0C0 (T @ P@ qP mP P P }P|PlPP TPQ 8$ 0@ Ɓ?[[Ł[I[L[O[R[@-<@pP8$jPd@ ⽹ꓝ[[[@-l00: ST 88S!~0YB@] 00 偊܀@B@-0@0PS@!@-F 4Sʀ0! 0    !B? SOC\0 !! HYDWa<T80ON|-[[[@B[ P00  /$@$0P  000/dPd<0 P0/S/0CQ/܀s@-@0S7`P`P) P' P P0000 8޿PЍp@莂dPX0` P0RЍp@ @P8P0Ѝp$[+[2[p@49[܀` @ @O-M4#pP{布 ?W;K&它!7GR  EP00l'0d'd7!`' \7\'0QL7尤ᴴḔἄ e U `P& 6  ::f&fST6 S0S׆ 6;P Q "01%6PQ P!! *!x& 1t !p&pf0l6#6$1  1 @P *<2$1)0C$10!10C0PU0S 9#9S  @P :$1I)0C*$1,1,!p1c001 1 @P :|5*$10C$1 1 @P :$1Du*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1lt*0C$10! 10C01 @ Ps:$1*0C$1s1! 10C11 @ Pa:$1)0C$1aP#dFq㰃 u]FW#VF#RFx#xNFp#pJF$p`3`` \3!XT3 0C 0p 0KF! 0I 0I =F": 5F": -Ft: &F\: F0p09 F 0p0 : FXp!F!p0 E<I$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/xp* 1%G0 GG010! ,1,! (1(!h$&L! 1"C Ѝ?[@T[@0 DSBO܀|ᆳ$[ހAiP)i ` 9[??`?0[G[߀߀$(݀<݀݀݀@݀݀@_{_(ހ,ހt@@P@@- @0 PЍO-p@㬱LM P 1 0LЍ001!4 S6QU1S1S1S* o@ hTTU   ,0PP<0P 0087@P`\  0<0 0^*0 00 \S 0 $ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/܀` (p@-dPTU@ $ ``06/Tp0`$ p@/(/p@-0 P T@``06/0 ``6/`0p@ /p@-P@-@0 T000S 0d00h00p0x0h0x0p@ S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` ܀(@A-0PST@ Sq  /Bu 00 `0*b6/`P   0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0    07/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@[[܀p@-P0 ` T@003/U U 0  p 003/pӠ[}@-00 } Ѝ 0!< 04 0 (   !/\ P/0 !8 00 (  , !/A-0`@TP Vp V hK00 3/P0T00 T0 `@4/A0T0 `@3[|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~ [ 0o/݀/0@-0M P@ 0P 000 Ѝ0x-@p@-0@Tp@t y$0dP 5/0 dP5/0}0} 0p@}݀J[A-(MP@D1P<4c0100: S$ 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0S (ЍA05p`WV xxp ?SPd K0 0@0 0(Ѝ݀i[܀k[pA0@[-@ 0!< 04 0 (   !/\ P/0 !8 00 (  , !/@-@;A-0@TANA0P`dp 7/U }UA}}U}U U 0dP5/ }0dP 5/0 4P5/ ݀[p@-0@TxP\ApPP0 4P5/ 0 4P5/P| ||݀[C-1M@TiAЍpb0` dP5/ 0dP5/P |||upPP p d09/0 49/ `0 49/ 0 49/PU u|s|q|0 dP5/0?<#݀[A-1@T PBP0` dp7/ 0dp7/ ;|9|A| 0dp 7/0 4P5/ ~0 4P5/ 0 4P5/P|݀ϡ[O-,1P@`(8{,5{02{4/{0p,{({0{4{{{ { ~@P0 { ~({ ~({ ~[P0{ { ({ ,{0{4~{OT{݀0S@- S S@@X[00@o/܀` @-\@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ Gy2RS 3C7CR008#8S800 0 &1414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011/P008#8S308#8S0x`0 p h(`8p<⻛151``5008#8Sy308#8SsSW HdHd [:[ B[@-@`P@d `0`` 0X 0P0` P0004 4PPЍpT[\[XJL:@:@@-zv@-s@j0 0R/  Y܀` T[lp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f@-@/4/@-@/@-@/@-@/@-@/@-@/@-@/A-PpX`10@ 2/ p 0S0@0 @0000@A-P M@`r0 0 0  p7/0P   p*7/0P   Ѝ "( p7/ P\ 000 00@001 R `  @0X@p0$0:0d0 00!S   1 0 0S0h006Qd  0|000040J> 0 0000Ȅ 8/0$@0\0` p(ꔢ[[[ڢ[[݀ %[ 0 /݀/$ R/P//C-p0MS *P`  7 @dP 001Q0000!T0    ґ40 00 d6/00@PPЍ0S   00C0/$ R xR R  /X R P0R/ ! !  _W@@W@AW@EW$o  R0"" //@- oT[@-@(00 S@@#܀[[QA-P@@@DT@ 0S 0S`T p` 00  e{`T@T@A-@;P@`0p0```p0P0 PPTb0x PPhX0X PP@N04 PPAC꘣[[ހD@D@[E@D@@-@A@-@@-@ |0 0@-0 0@r0 0@l0P/fހ@-<0@TP [0 0 @Sހ0P/QJހp@-0@T/ 0S S* S& P 0 0 P PU, Pp 0%D0P0000C00 0P  ppހRW SW 0o/ ހ///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2S w@wP0T00S,0upG-M`:@P2`0p봂XP h0* Rp "Sk pd2d P00 000!h8" p-PLPD00$|P(0SHP㰑0SKP 1@}vP 1@uvP h1@mvP H1@ev@10S h ,00h0 01@0b0!dЍ0!p P_ a` P0p 0vP0qw v0* R t0@(vP S T0@ ހ[܀J@` [J@[F@J@8G@ ,]J[N@N@@-o//G-s@dVʀ 0! $"0""   !P 0x vvP0S \yP0SP0SDP0SK( ]0T Q0S010R0P"00 S]0 ?0y [v lv -y0S cv $yP0p 8vP ,0S -0S (05#0x 2vCvP0p QvP Q 0R(0l0 S$00 S YX0S`P\ d$0PX0 0 0?cཧ 0!D d08 0   !豧 ހ\gfffp@-T0P@0`0\00`X0`0s X 0\00px ހ'@-@0קP @-0 @o/܀//0000/QR R / /@-MP`@pT0 P0 S0 P @0S*0 TQ 0R @ЍEx`@VUUU'800: S/@-@@M܀// 0!< 04 0 (   !/O-`@=FP %uo!ux0pS㘀|P xPW PL t0S 0S ʌu P00 0SӀ0.X01 S5p,`V`P< [ p0S7Zy0S2W 1x0: S}1!0?Ac4⤦Sڀ twpS9PipX c 0&h0W00 S00S Z W  0pm|0S+ p0 |PŏX 'Sd d C 00PEC༬ 0 0C|0`  0 pX0 Am ЍOEEP0 Ѝ8[܀\gfff:H[Q@-Mp&`@ p4P X Q Dp10: SRZ e0s(tss@  1s@  1sP0P0P 00P0@Xl 0@Ql 0@Jl 0@Cl|0x 0t00 0@P <@00༥Ѝ([J[V@V@܀U@HV@X@DB\@-@-@<0 @0\@-7@-0@P1 lp00200 lp0000 0000000000 glp000 Ѝ0\ P/0 !8 00 (  , !/p@-P@`0 à  00CS0 00p0 SpA-`Q`pSP@P1W p0S0<000S0;,1UP 0 00000 0 000 0 000(020<0F0P0Z0d000000X0UP000000000000 [%[4[//s@-P`P@ 10: S)Q00rr@ 0-rP|+ 0@00D00<@H00L00P0凅0P |q0|0Ѝp00!00prmr0 `HP,Ѝp@܀\@Q[Y@l[@T[@<[@{[[@-rP@-ro@- 00* R | SrQ@  H000* R Ssr܀` [@-@rp@-C9!: ^SpP3 @4T004 0040606L00L0pp 0l4/@-@, D$0 0Z?Ѝ<\@[G-P0 VPU0p`B@T qp YX!Q0S@p L@P \ HBH#@; #@@ހ[[8[A-` f`V@lPpQB@T 0Q`H0  @  BހG-`0000@p0PU t0(60\ (0S Z00CP, @\@ "ހP/C0@-M@P 0 P @  0@Ѝ00@-M@P 0 P @  0@Ѝ0@-P0M000@R4`pA0SB0 P@ 00 0`0@0 0b@P@AЍbtހT0@-M@P 0 ]P@  0@Ѝ0@-@0 HP @  @pЍ P@- R aAaAހ0/ހp@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !p9-ހp@-HP0PSp P@ `6/%-0  0p@/ހp@-x`0SplPP@00C00SP 0 `6/T 000pp@sPpހG-pP`P@ P" P PV `FPEe@P P #P`\T00Y0S<4O `@Ja[_[e[g[/@-0,\ @T 4/Ѝހ00S/ R//ހ00S/ R//ހp@-@P. .0p@80/,ހ 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/ĂA-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 Ăg@g@ 0  )?)/ 0  )?)/^/@-@q dQ0P0Cq 8 q (q [ˬ[Ѭ[٬[[@-H M@8 000 0H Ѝ[h@0@- 0@ ,MPr           0 040$0)P 000 ;,Ѝ0g@/0/!//A-pQ`.0  P@ x0EP Hpp`@tT:80*0 7'J x@[@-[@-[///1/8#81/1/  R/ R/ 0s S40@o//0@3S0//[p@-@0PT3/>p`S0p@8/4$$#   p@/[[ [Q0 Q Q // +[[.[1[O-P`$M 0 3/$Ѝ03/@yQ  0R $Π  M3/0 0Sp00 `"R 3/ 0A0CS000 3/00u00d0 0Q 0 3/$C H! 3/(!0AYS-000(c0C S#0x   03/ 03/@ 0t3/W  0\3/0 L3/W0A CRS 000 0R(3/07  1 2/0 30 r#03/ $:$(0". `: S0P3/$&0$ 0$3/0 0 &6z R'zppF0$03/60S 6&0S Z0  |3/03/ Z0Hp083/$O8 OS   F0$03/5t0S W0  3/   0 3/W? 0t3/0t3/0pd凰Jq" W  'pS 03/ GR03/0pW03/0S3/ '$0W$ 0FL0G$80 0C2/$01?3 ?3!?#;00 2/@ 0q0 00s00$* "0 : 0#$90"?  :$#: `0H#0$"<407S0 S0s03/ 03/ 03/ 03/0x0s0n0|i$3 l0$2 \0$0LD, R$03/ᴡ$03/t  03/03/0t3/W6 0t0q$0 3/$($0 :/0 oPq0 3/200$($0 %:/ $8$&$p0 7/0NY[4[X[[[p[8[[[[[[ĸ[[[[[[ [["[/([H[-[U[2[@8[L[H[X[Z[[[[ع[[[[[[[[[[ [[[J[O[a[ ?t[//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$OY- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ/0@o//@- @/0/@-@/@-@/@-@/@- @/$0/A-`@P (pW A/ ,pW0  `//p@-@$0P`P !0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S _p@4 ,00,0/0 R,00,0/p@-(0c.0@ T-PUpp@-2@02 P<0#0P20C22S YyUpp@. p@-\0!C !2 Q02(0$! q (0$!p@R/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/ -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480G-`PM0SV 0 S S SM !Spp W 0 @0 R =R D P 0=S0@V20V 0  SR0T=Sp'p 8P@ -  ᪳P  } f9P Ѝ4[7@- 0@P P0P R S @^ Ѝ0@-@0 }P y 姦oЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X@P0`(0 02PN@ @0 4/@2T2P @> 4/@ 2G8H@1 !0R$04$0//s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ(ހ,ހp@-AQ+ 0S R[ xhߵ0_03/UC 00<000S: #: " 8! 4^#30 00C 300% %6 P"8 U#30   00C3000C0$00pB@i,ހAi!i :[1?/ //0 ?1@o/ጋ//0/////?  22//-P/6ᨌ N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  "(00(0/O- R\bY I* b$\" #in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0H00S/@-@0  "!$0p03/0 !!ހ,ހ03 /0@-$@4 ^< 4 @ 8 L < @ 0 < /p@-P$@4 G40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/1 1400 001!/$0</p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0rJp<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@z0` ⿲1017800>ca0` !.p 0W yc0000 0 00 `L<`划0@0 0S101ߍ@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X:$/101101/ 0\! 6 SSO-0`@p0M 46CSЍO-t ٝ000 0$0L0 0C0C004py`Ѝt!pppV 0  Z 0cQ   J<!PP)1\Z 0  qPP P0q  0  3/ ZPu U  u 0P200" 0 0 0L0 0C0CL0P@-0t 0@@$!0   80$ &08@1011@2/L00C 02/@ $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$! 0 S p@-0ZCU lPC^   LL& &p/ppP 0@- @ |M l Q \\ QQSH0t S՜0  !0 @|_|Ѝ00!R 10/߀p@-@P ,Pp ߀0 S   0@-4 0S$ @ ߀O-2|Mp& &  , !`LP PEPELP`0F?oQ26  V@A! 1B T : V HX! 0"@H      "RD$  0YV#  h t 50  !0 P^{|ЍV@@ 0 ;/P t 0 !0 P$@^|ЍOYV߀ξ[^@<@@l@@@BO- p`0F   0 00p(`$ w 0,!% 0    0p(`$ uw 0!% 0  ,  0p(`$ bw 0, !0`%$  *  0 00p(` Kw 0!% 0 9   0p,(`$ 7w0$,00 '!$ 0 B   0p(`$ w$0p,(`$ H# 0 L  ,    w 0!0 S   0 00p,(`$ v 0 !0_  0 00p,(`$ v 0 !0m  0 00p,(`$ v $ 0 !z 0  0p,(` v $ $ 0 ! 0  0p,(` v4 0 ! 0$  0p,(` v< 0 ! $ 0  0p,(` svD 0 !0  0 00p,(`$ ^vH 0 !0  0 00p,(`$ IvL 0 !0  0 00p,(`$ 4v0 '!0  0 00p,(`$ v 0P!0@0 0 0p,(`$  @v<Ѝ[Ќ@p@P@ހ@`߀G-`pMP `  @2000P00p 0@R 0 p0 00 00000 0q?o2P0S0 SЍS0ހ,ހX@A-xM@P`` pP0H彪0X 00 000000qxЍЌC-0|MT@T 0S P`p` ѭH@啪0X 00 000000hq|Ѝ-`߀G-锐xMZ- @P`` pᩭ Hj0X 00 000000=qxЍƁp@-@0 dd @QSQPQ0PS 8P@803/(0t@p0p@/@а@,ހ(ހ@- @p03/,ހ@-@0 @T  0 !! T@LЌ[A- ! 1M03/j0P `X@P pX0 Ju T@X>@@@ K9@}p`p0 /И|~]0pL p4ǘ0$p00 Ѝx,ހ[`߀݀xЌ/@- 40@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00P 0S#020 0vP 0S"020 0iP 0S"010 0\P 0S|"010 0O Pd 0Sh d0E Pf 0Sj @0; Ph 0Sl 01 Pj 0SnЍ0&Poq!000l0 Pn0Phj`!0@00e0Pfh0!000cX0Pdf!0:0a,0Pbd 000_0P 0800Pp 0800P@ 070|0P 070[| [[[&[2[:[=[@[C[L[[Z[[[#[/[7[I[T[W[a[@-H00S<00S0 00000Ѝ݀݀00/G-Sp@` A S5 S11P0 @D`Fp@03/ L03/X(@`pGP pD03/ P03/Y@Pl`@03/ L0G/R8P@03/L0 PH03/T0ހހ,ހO- 0@4`lTD r0PhqX pYG  X ЍR:B Z: PN Y  L\!TWX D p(p W*Y )  p 0S p    0@pWr P@ \ @-0QBQ*   P0 /j[A-Pp4`@P 0Pp 0<0`@P00 (@0 0,0 4G-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 07P  `FP@VU0,00,0000,000000/O-0p `0 W W W Ѝ@04"0 S )4S 0"4PS| V1d0 ЍO/ @D P T*P0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!*0 0 A3A3C?o20 0` @ `FJ0V @DP T*0Z*IY! 0CY!08 0 07 @ `FJ  .[e[,ހ[G-@Pp @ЍTkЍb2"0S@ᶮ0j0O-@M<`N@N;@5TpP3:T#3p0 ){?oZ20S 0 {PH 801P;0; 0 X0=Ѝ`@ 0 SPTb0 0 0Q0 R0S 000 R!>S>0 jJDV:FQ: 0 x[[p@-PN@N@ 0 p@0z[x@-0 PS@0S 0#G-p`@00hTЍ PZe 0 UP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 ЍO-p M, 0  (0P @0800T0R0S R(0p,000d1000ЍPU @0A#AR F   P P P3 0 0000s HP0` B0 0 0 H`P0``>0 BB6*a"*UbY 0 0  0 P PE 0H0 H B O-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T 尩P%@~ P @[H0@@ p:S P%0:0PD0@S | Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xPA-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R 8 (0+0  VPV0P00 0 yЍ R  *0VPV0P00  0 | ^$ R  (0+0 VPV0P0 0 0[P[[[//C-M`@wPT#L,'@ 0'4UF/$ 2?0Rr 岟LQ PPPL P `1|pQ  000<0  cЍCЍ[[ [l߀d߀߀߀߀߀߀[C-HCM`PT~ЍCrRn  "Ÿp"0*P*P l. (D3SP 0S(X!\1pP H ޼0( 0( } a vWT3=WGT3kT3@eT3  `^1!0S 1*B0S0 1F@T1-0pW0p!(C`1 0(0(5 G R$$-T3 $!1@TT0 0 0 0  xW pYU Ѝ@ 4@[،[[,[0[A[N[[[[[[AXV[[m[z[[[R[`A`Aހހk_[[C-`#P@P03/sTDc03/0L30HP3,G?b07@:20C 00<0  00.0  00&+0  00H0  00e0  000  000  000  000J 000N 00C?0R 00ݶI?0V 00ԶN?0Z 00˶S?^ 00öW?0b 00⺶>0f 00ⱶa?0  00⨶goj0 `⠶04L ЍC @q ЍC ,ހ`[[ P-`@P p!c pЗ!P  R $LL<pL 4D 4/!`@S`!W , ,`! !oDЍtReset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! u!oDЍN  0O   ! "`"Рo; T S3 RLDLOoB@ 0 s P 4(S$ [0093 0S00&R ! R &R h!h R \A@X1T@@@(0 00  P0 @TL@0* R @RЍ(ހ[O-`1`d0P@3/tHHaWDʀ 0! $ 0    !U U( U1 ?oT20S00 0!t!0   , ! Ѝ ?oT20S00 ?oT20S00 ,ހ[00P (031000Co//!:!P/ 0 00S/@0. 04S/Q0 /0 @-`C.@-YO-0@|P0PS0 4pp0V :WYW @ p&: :6S1!0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% P <00  T[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0P 400? 4Sj0(4S   0x W4Ѝ@.O-@p@P` សPP`<`V   *60Q000  ԰ @03/00 3/03/C  0P4 0?PUP'S 0h<0cOkXT00  S  S80d5 ,0L42 S0`5,ހ@`0@-0@D0PSMⶍPЍ00 0婐P 40 U0*0@O-@p1VT:003/OX$ZZVUP!N`$5ᔠ?`U0 0C0P @0  <@0HH{ 00?@03/003/J`,ހ@A-p@`PUV$4$*$00SW(DF0@00V@U($<01S  2# RxW$60pWX 0S(H$HJ$J@L W000 00 p@- 0$@0P000Sp`H4S d0)$4$務H P4fh5hE000D40@@DDp@g[O-`MlP@eU0I 0000 T : 0 S:0SMЍOAW$jjf V `!vP@ p$5?pT*. , 0  ᚯ7뚯R0 <♍0    d0  R!* Jp +4S 0,03/0+4Ѝ@.,ހO-^PPE@p]댐匠ZT:O `fV`!P@ $5?0CT*0 GQ!803/@Z,ހO-@p$M`!T,'<01S 01 0  000Y' ^'v00100PqW X [  G EP H <WP 0 <P9vV$Ѝ @00@0 00 0*0皿  w뚿$,$$0 !R3 0?  PX9P $ <P 0 @00@0 00 00皏   8뚏P R0lœ\l% 0S 00 L0 @  0p  0 )@.@[[0 #!R/080/,ހs@-@PSV %60˜`P 8H0 00<Ѝp@U@.O-q3Sa100@-4S[0,4T倁勰U !0 PU ,$$#2$$0 SQ8 0000xdV B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$  2/03/00  !!000T(4xDT U0-40-4|D Ѝ|03/VBn,ހ(ހ10 P0  044-4/@- 4@S 0 4cP $0T V0(4 0@0/,ހ@-$a  1 @ 0 4$(4@T R0D4 p000 00S 000D40P0D4$TPp,tq0000'0$4$0!*10 ,$020 0 Ѝ@.(ހ@-@R0 4Tp@-@Pp 4S u0 4wP Pp 1T 0(4pw1q*2h$T  0S0Q D$,$ ,$ B  B R @@TQD$h0 0TFX0x$R x$p@ 4DPD$(ހ.@@-@P@YG-`mRxPdGWT@@@ @pW0S   YQ @T0,03/03/YP`3P Vp0t0U4 (0C4 040C4 0 @@.,ހ@-@(P@ [O-0P 0UM0 0@p0 0 0   P@PkLFPUЍ0    0* 0 100R `0A  S + + 1 L4` 0 0 V'! B!! ! R 0Y0 0 皟  *0뚟F 0  0 5  B    S 00 "@.@p@-P,@@@ <e@p@.p@-P҉,@@@ <T@p@.p@-@p@p@p[@.G-0X`TL4 90?003/03/@`pw9P 0` S@03/@@@00?003/@,ހ0' 70/@O-xBMgV<*dZʀ 0! $@"08"0"   !J&j aw0W:Q<03/,03/03/ 0!!0 !!   !Ѝ!':'|00QU9 '0 Q P*0?P0.71p p00 R'  0 (P 0  Y) ' 7+';7pP P P h5 S7`67$ 0@.,ހp@-PPP@}$F@0S0?@003/0p@/(ހ,ހ@-$^$!ʠ A@ ! R  L" !R  ," R !  $P/$0!10/O-4TD,M`w|T0 0=$4c _ [!0S2 $ ,P$ &20PYph  0000# `ˁ \ $4P$ ` V (P b<03/03/03/2 x嘧Ћ唗P  )5? T唇\딇(P@r(5? `X唇 "0S70977'3C?6C0C#:%. "&0#2>0#6!' 7D h@p1q $4!*$010y,$020 0@,Q,1 00C0@@ @@51 0000 @@嶺0 0 000@@ @@@+0P000@@ @@ |q<0,ЍO/@@..7[c[([[,ހ8[߀.(ހ([\@(@@ @.@-ږ0@ Ж @GK0H48@O-$M,($ 1@`oPQPwP(PEܐ(Vᖨ(:$Ѝ0 2d@P0 0000009  DPpp@W T:` 00JpL݀xF[݀][@0!S@0d4 S00h4 S$0;00;010?/@8p@-0`S0@LT!* Sp0PT S`0dUP0SHP,1$EOR0?p@[[@-!01; 00? 000$O-~0PP04 p~R@p R R1!ěd`V Ѝ|!t1d弋Ld!\1h帋PV[#0$ ! \ /FVfF<R0 R   P -$%/("(VR#  U뚿HXhF /JZjF[8@[ !:!/ .A- p@P` X0 X000 0p_Ѝ p@-@P`++`%L 0+L$;;d4;hdkPd ;/0SPddkLd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?p8@ !i@d@G-`@0匀pB00>0>0PT0?0?0000?$:aP($5?[%J꜌Q[O-@ᨐ娀zT:00ЍO/ 06Sx`1`!-P$5?PT:0?L0 HS @03/003/ J,ހ0$4 /0  ")//0 !Р!/0 ! !/p@-PMƘP# @,`p|~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍp-݀P002'0 S#3/݀ 0P/݀h0qp/@- P p< 0BS B 00-PO-@2@BM<03/ sr $R0S0  "S  & PJЍO @DF`Ph 0Se ܚ@8tЍO2iP;0Q@p1į0 00S\>0p00 I06SP1A  0 G0:0 0 0 00\ @X0`@Dp@ u00 [`L0000L0l[[O-pRMP P`010000 P= 0 R. R6& DF Fd˃0 0 1/1/ Y @1FI UR0 `0/003/03/Y 803/ J$JQJdЍ[,ހv[0/\0/p0/pT0@-@0 @RS ,0 Ѝ0000p\l0P/0 S/@- ^@LS:0 0CS(0 Spl0P/0 S/@- ^@LS:0 0CS(0 Sp @- 0 0/0p@-`!P J@P$P` 00:o@p@ /A-餀`@s 0PU |p R0P R 0L  co 0$A /[[p@-PX0@T T 0PE0%VE$ @p0S 0ES:@/0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/0@-3@PdM *QLudЍ0  00R( 0 un  0,[?[Q[p@-P!@0PS ?!600#Q0SP(0?0` ; S00,0|0YZ2Xl0%XS40T10P3/P1'4 X3P S9`a WVpA00p 0 0pP7`X03 P1)x3SVP1 RRg,00 4(mt`P!#,娾PP10V0U0S P! 0S ``0x3P1EV ntЍ1 06  #:: 0tPPhuPLP  0e`p *E[@LA[[[p@-L(0H@P#043{X3 @t3$0S$@p@5  *@-`MtPapᬍ@ᩍT 10'*"*0*00(00,00 $0$00Ѝ[p@-PP@00$000P1 0P$P L`0P1 V`p@`09SYS! 0C023 0tQqPo0Sl 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P13= 3 00*00`aS_S<00SS 3 00000 ,00*0020 00#0- 0 00 0#4>`n,[g[11@@p@-l0( h@"6 0TIzX300$00p@_PP p@ *G-@`2PY P1ЍG< D0T`0"R0L0Sl r0 00000 R!!Y 0S<00L0S,3d00!CgЍGlq 0 P1 EP *0& P1=$qP R  qqq|3  d00|C000 2@0S *"*0S 0S$00P1 (x40Cx4kЍG%`![[[[C[EA[[[[[ "(Y?0,0W?000X3@V?040?0  R   L?0 Q29#9P0|$@蔖p@-eT1@0P3/PPX3VP <嗾T1PP03/pX30;X3X[O-MpP>`@ HQ 0xdT10 VP1 P1& P1  |cc fff坾 PE V p`5%ՓAi P1  u L5L P<3 PG~L0$0,($  `N0P 0 Ѝc moP0Q Q P\ P dW` |@PtQL1S 8t/0T | h| -L1  ݽ0P!00P16n @?0 X3<X3n?0 X3@0X3X3|w $2 $”`!Rp#p3?0) R pt   -/ pjt 0s?`9 Si&i `!<#ĠhlÄ |₝6> #W?0D0Y?ⰰX3@0 D ? r0t# D h | ⽽W tLଽV  04妽0夽⢽t# 1PT 2C7CT4v0,Yq8 R<0Q$ R (0S @t T``@$pV80S@<04#P nP -*ξ3A 2A4Ap@-Pb @`0T@ 0 <0S 3/@P 00C 06pC-M`@{P`[@P40S ܛ pᴀPl$00ppek&xp `d0pq P ⋲0@ @<P0ЍCЍ9[rAx;[A\ArAh[T@- Dhl@P 0P000*p@-@ 0P CS <0S 3/p@C-@P 1MSX03/<4`0S  < R% 0$8 Q p~~@0 00@P P! ЍC  \0bT R00 < 巯, 9ЍCjЍxx[AG-@p`>0$8 R482$ 00S 0SA⥮ 0a 0  0; 0q P\ 0, 0S  < 0 <  0  80S 0: 0<05#0  0*P 0  P)3 0R S  P 0BS@cS06]PAQ[[4@- $Lk@000*O-@P$80S Ѝ<p0S P }`}0 00 00劰 0C⇰P[0S)@-@@0@Q00. >0,! ,1Q 0 @5\Mb@-  2 05S=00 a`09#80 8802 0<<0A-@`P8p<`3  A2ᮭG-`@PP@  ,pe0S S8 @@ D1. 尓 ,/ 408p<003/3 3@ y0#S0RR00R0S @ 00R80KS 40\$ $ S 0&$ $ S ,@ 4"4T0 NEFXPi'TDA-pP`||w@PP 028(00,0?S40003/U3 PPBG-p`PO@PP 0,00202?Sb40003/,3 PPO-M M`0P @0&pP00SK000H/,HPx :00070度dRS00X2PZ< :  R+00d [fd R  PWW "Qd R  QH000 0SA R* p0S'=pW*0@ Q G@000S0S00ą|p 0p0p00S ۍ ЍOʮҮp[*Wۍ Ѝ廮tP t嵮p0pGWpX嬮8PLHD@W[4[ [9["[O[^[4[s[[[[O-t@4MPp80S<0 2S40$8QD`V< #" R<{GD`0$8 R(n80 S,d0S 3/{ $`80SN[lj R00 \ 埬D !g*< #"0^0$ <` `00SQ  00  `0c0 00 00j< `V +<0 0` <0 0Q Q<0` 0 x[[xlpA[p@-P@` PUFp0S \P0 P/ 0 /p@-@P@-pp@-@`P0 @Tp0S \@ Pp@-P1 P#UDP30 P0 0 00(005$ @,08,0P  4<p4[@-@4<@D]@-@ ,AU0SM[p@-@P 00P`yUUlAp@ɪA- a@TpUʀ 0! $ 0    !U 0  @ 0! T0t l   ! 00 0h0 03/@T \pm P !g/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-ZW0P R @pnp b=, b0帢,<zpsL!DH1003/E#-  Ѝ_?0Q R 0hz100100100 0d-/@@@S[[G-@p`NzT$0ᗧP @1G-`PhwLp@(0P 0\@0S7fYjP,(0 /(0 PfR;R x \Yt~oOMP PIUE B@-w$0\@[A-@tp0 03/`$PYV 0A R\0   Q @-0 03/P0S/A-P(Ms@PX @(Ѝ0`P0$0(0 `0 03/$0 (0 q?00008 傶0P/ p 0 `p*08/0S0=0 888/Pr? 8 _P (<03/ 403/Ul[p@-P@$0 (0 E(<03/400 43/7p@M"@-d}P0.X X%,à1 0")!0 <"#1o\Q @m"@J.Mb\CNG[@-PM@P  P^ 010 @0PЍ6$p@-P0@$0 3/D`V 1SSpp@-PM@P`P +^701@0T@9C>H0 @@0P  0( 0 0 PЍp@-PM@P  ^< @0PЍ0@-P(@TM h哧TЍ0P ]$0 010408020@0P$020R[2p@-(0PPM n`PЍp00@S SQ 0R0@`P  ]0T1008020 @0iTP`  DP0@[[@-(@00 3/ 40S 3/00 3/00 2/p@-$0@ `8P8P08<0,4p P d `PU$09$0P@-@t`M 0 03/$0PPy99$0IU W$09$00<0S 3/ P0p03/7/PPl 0 4pW  7/PP <Z(0 Qn03/(0 KPP(0 $0 K8PUQ1.PP(0$0$0 O(0 $0 P $0 P PU8P0S pp 0 0S $0p p00 00 Pd PU$09$0]$0 9$0Ѝ@W Ѝ@Ѝ[[[[;[L[][AA-@`,Lx`<PpDPU  0R0H0 0 XPr03/%X_ 0Sx$0 P  \P@PIRA-@PT   @ `840D 4p P `84O-`0.40$M 0#\3*@@R  L$Ѝ![z [ [ 0  =3"[ [ 0 S,  P P9 0 40 0 0@R TP P)TPA  0RT@?4  k h e2!!1 0\1 Tl04  0QPP 0@EG?0 0B0P[ 9 6P Ǧ@P +P@  %P[@pk[ 0 x 学_ PP   0@40  0400P} 4 0 0P 0  0Pf 0P 0B ! YSV@ 妦Rop[\[[[[[[L[m[[[[4[M[C-0@Pp`r*0) TrO,0J)00S V ᒥ`@VL`;r2"4r /. ЍC*|[[$ X0R/0p@-)00+P@*0,,<JoNOPkVPp(![C-OopPd`【TMBP  Z0 1@iP 0?4/`V<?oU20S 00TЍC'O-`dMp0pV Q ;T.;P"PP@P ~Z5020t!(SL0LpU`10W ,PDHpP0G S<<000 0``P7 R00,`0 "0@0`P0 V 0UpC00 0 ϣdЍ4 80 P`2r[A-XMpP`6@P*U@p 0PN0P TBPZ402t0PSd020H0$P@P(00 <T 80U`C00 05⁣XЍ2@[@-$00$00 00  0@PT P P$00$0Ѝp P$00$0%>0S,0 0TP P0 3/ `PP, PP Ҥ꠆b[[A-@00PP 0004P<0P0<00 03/pP` H娤y`0p`0<0<,0S[[@-000 00>Ѝ@-1 0 1ЍA-@04pP0 3/$`Q\@    0 03/P tZ`P XR00018  1\1\1 Q004`V 6/P` , r@T :k0  [03/tSyPp`P[[P[[Mb'[5[0S/pp@-0@4PQ 0# WPL`0S 04A0P30PU*<p (\>[0S/p@-0@4P( 0# p@-@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`Q P 0  0 Ѝbj@P@@@0 P0`HC-Pp`"Q P 1  0{ Ѝ 0E0 FZ,0 0050t`0 0000!0 P00 00 Z Ѝ0 00 wiG-@(0PMPp`p@ ?0 S㣤030#$ 0 P  U011 @0P-P  T< Y<00010481`1d`@0(0 00p0 0 P 2"0 2"P PЍ8 0b0?o0cS2   ( (0` 1011SP T 01|0 @0aP P  T 01(0 080@`OP 0  2222 6$O-0@Yp`P? P9 00 8R/00 RZ 28h1 0000"PB 000 0Z00 00 t`0  h0000!0P00 00 Z Ѝ0 0021BP31 a1/G-0xM01S`P`1 @o (0O p00 pp0@0*@4/@PG00p8@@0 4/@PIX1@ 0@0㍫@P;p@0 ᜫP (S0o\0@0`0d0040(0D00h0(00X0j@P(0 00 @0y@ g@TP@P (0 c@ <03/ 403/TPxЍT rG-`0( xM@p0c   0P*5/PP@008P< 5/PPB,1P 0<PP4< P (FS0$\0<`0d00040Dh0(0(0X0PP (0 00 <,lg0S (0 ,<03/ 403/xЍ` rG-`0( MPp0   pp0@*4/@PA00p8@< 4/@PC1@ 0<㛪@P5,R0 p00<㣪P (R0d-\0<`0d010401h0(0(D 0X0r@P(0 00 <な0S (0 w,<03/ 403/T"0`R`P (R 0408(D0h`AH0@<0 P 0屝ߍx0xp0 22L2LD[C-TM`PP p fR0 X100  @0@P$ U PE_oYRPU 0XP PP  CR(0 080@P@P  0 De@TЍ   Z6$6$2 2 w[[p@- P40 S" 3/P@000S@  3/@P\0 4`V  @6/P@p 2/03/aO-pMp\1堠@Z 0100P4` V  6/P <03/H1S< p`P   ߍD1S R0Ԑd1(0    p xҜVp@  p 0P0 0 3/W +(0 `-21 1\1Q00S  40S- 3/PVQ < PԐd V T兜W```F0 VPW 0 啛03/[VX [ 0  Pg1PI040S=   3/P>H X1000 R0L!00V,a`2P)d1S Se! 0 Ԑ;e 05h1h1S 0 !t P000 \1Q00S 0 4PU 5/P 03/[[[['D[p[[.[[[[[O-頠\1@Z!0P4` MV 6/Pp DR 03/(0L ` 000 ``00*8/PD00`80 8/PF9p 006P8`0 EP pnP00000\90308(0p 00(P(0 00 0% fdPP (0  <03/ 0403/X cpߍx|74p`< !4 4tp00P  'P " (1pS  PXp(0o1S\1Q0Z0 S 04pW 7/Pp2 7夐8#t200( 0   0p*@7/pP008p@0 7/pP6p 0@0ipP@0 xP O0 0@000(60 01(000[pP(0 00 @0X@ 0c (pP vO012000 07pP00 3/pP0 0p  H呚-`1 k 00PpP VWa 做 06$0(0 Q N  003pP 0 d pP$08$0(0         Ho48#|2婒\1Y0 3/(p\@PUpP (0u æ@ <03/ 403/W p0 `0 n0 c0 0 0 R0Zp ѠБ[0 [00 !0M0s1 z Y xX h0S Tߖ[ Hۖ W8 4W0A(Ж$ΖpP .QÖ(1S 0 Pt000ᴡ S<#0 0 R XX :1S* 1S' 0!`Pt161`!A?;`V)  ڗ    '. !R尰R , ub[0 " !(   尀|屗000[ r[D[)[J[[e[[["[=[C[I[O[U[[[][s[u[*[[[[A-P`@v $0 DS P9 PJ0 0(0 `L rPaH TXX p[1q#3!?A1c L\1`06 SQ 6 `'``La H`ʘP  r{ 6Hv `'q`` HLaiP`d T_XX[ p[V<0q#3( ?A1c\1L!4L1D[gfff[\[p@-$`P`@0  p7 `l2 Xp-Pt)Hu%@v!8w`0xya |  pH!R0BS2lGp ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w0x yza[C-dM@d p(P L02P_P*00$0`80 ` 0 0 `h0&hS `Pb`(0~P 0寗(0 p8P0`UdЍ40S04P0<0P(0P@0 0 P 0 0000S (00  00@00 0`0 @P00 0[C-P@(TM@>R`>:pP  J$0@ #0 01020D@@0@P P J$0` $0!01020d`@0@P P I&0160 @0@TЍ@A-@M@! `Pp$0 1pA?!0@P !0E@P 1 4Vߍ0 >@[!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-na$O-Pga@GP)m_#01naV!no1SK^FU~o p\`B<Vnfvao~_o]oA\Zy$p<P O<pPW 1$00G[ {<P1<1 fP&C-MPp`pQ@101U 0|10p!]?lpѓ 0t$0`Ap19l!~y`M 0vn`a 0~n`v 0n mznِ010ȁ1ԁo @;01$ F40 00\` V10㨁 t1@v  Q Q  0PA-4S@`p0 100PU0S0 8/00PQU0S0 8/P[Pp@-P`Gv0@0 P`00 R @p 4@0@ 1Sp R  R ,      0[L[@-@ R 040 @v@-^ 0@/$0a(!"$a$"  b"!4b4#0/p@-0#? d@ ? 0#?00R0S0@#? u BP.?  0#? 00R0Su0@#?d AP.? 0#?00R0Sb0@#TSxAP.^ .?o2^0SP@^D 41PU @?o2T0SA@^7 0PU @?o2T0S20@#?) @P.? 0#?00R0S 0#?\p!?Qp/o"0#?S Rppp  Zp@-P@Q P p@0S@G-P@`pW XP @p@- 0 PX\[@- @q <Q 0(Aq [[[0@-4M@Pt\000(00 0 0    , 0 0GP 000 K4Ѝ0LB@-C  P ?(0  P C [O-4M`<\@2`2020嵏 00 P0 |5/0Pp  PH 5/0P DX pp P,5/ P 0!0>0 4P5/0 4P 5/YP 0 4 ;/U ^ 0 !0  8/h PE(_CSe[(/C#b?0E4+[Pῢ 1  P C I0P00 P(00 000 000KP 000 P (00= 000p000KPh0R  C0 0\0 0F4Ѝd[0A[@[@c[Mb[[[LB@[@B/O-`0A3vᣁᣒᣣLP \[ \  P @P@ PD  \ # ZK0/@-D 0S 40@/0S hG[@- D0Q d@/Q 0Ol[0/A- @0PS ` p 403/0dU00 A/ R 0Q000%[N  0O   ! "`"Рo(P pp`F``t`@T:40`0 J x@[@-兌[@-偌[p@-@PEPpH0. `@@@DQ$06 p@0'[x00! $0 / 0(0S 0@o/@0 !!/@-0 !@@-0 !@p@-Px@x(Pq $0dP$0 ,0KO R0(A,04S00!p \\B@-@D"0DS 0 ! 0$ 040$\0$/G-`0p$0PUGU !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pk10, TP2/ @- 0 ! 0^ Q    D $ 10@X@@@Q@-0DPTp@-$0D0P !@8pA-@@TTy@pP!@@aQ00, ,$041 0,8\` @-,00@10CS@V0@!,1!,0,@\\\B $0 0!0 00 /,0P 0 Qp00//x@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S x\P0@-  d@/  R 0݊x\@-P`X@`00@00  p 07/PP70q 2/U/,@ 0 4 8 < @ D H L P0 L P< Ѝ@莋,P P@ Ѝ@Ћ\\x,!B\&\0@- !3 0 !0@- !& 0 !O-P`AqO@U@Tp p X0@U@ 0100 000TX Ѝ  0 @[T 3≐<0  Pڶ 2/p[ D\p@-P @@@p0/xA-`0@P0c  p   021   0 0Q000S$ SʉApxg\\A-p0p` R0P0Q0C 0@ E@s @xG-l1TP@P\p @咉X 0HS(,0S 光o 0 p0@,0T`0,0 BX!0q10 @AX X iT0 P  @AC T @Dx\\+\U\B<BG-0@pPs0  R( & 0 b ` a/`%RP  Q" 0`@&F @x@-(0@0@x 0#0x 0#0 xA-P@0B@`Ap0S  Ax 0#0xG-0Pp0XJ@0RPQC E` p0Z 0 @ G  @  厈x\\p@-@@0SpP=0 PpA-`P1V8` `p00p D1@ s80P   8/P QЍ0t ?, x0Q  6CQ@ 6Ao60,  0Ao4\p@B`A@-@ 0@!S &BS &S; `Ѝp !S0SP 0SP0SP`p' 0P0  80P` ` 6/P@0 \` 6/ {,0` 3/0S8P 0P  p@`A4Ĕ/!/!`!//` `! /!=!E!M!X!`1/c 8!0/c#c4 4#1/!^!f!n!w!@-`PWU@׈P0@00 p0 7/0P UP~ d`6/0d` 6/ Ѝ@輈\\\@-IPo 0!< 04 0 (   !/\ P/0 !8 00 (  , !/A-1p@ 0dP5/0 J6 ` P0d8/0 48/V00V*U03S 0`4P 5/ P0d 8/ P?V`!U0#02\A-0p@ 0dP5/`P Pd08/0 48/V00V*U03S w0`4P 5/ P0d 8/MPmV`!U0#02p@-D00@ !0 4P5/0 , !pp@-T0 @504P 5/0 00dp@/@-@ (1(a(q <@Q0 嫇 5 5P0 00P0 00P0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/ Ѝ@\\,B-B7@-PN *x0Àp0F0FS0 iPg0@T :@@Dd0 0S B @DT Ѝ0'YA-0P@`0!0 4p7/9dp 7/0 dp7/0 !!@B@-0 4 0@/@-0d @/40P 0S/0S<0//0O-@<0`ZP R \ R *R!SF  R < &    q D @ D<0  D!'LT \\LXp` ,^^N\^ Q  R QX<0SL Ѝ0::0C: 0S ,0S \ 1 !1R !0YH <<  Z TL TYPLITP,Z`N `Y  \ pXp B`\  ::0:0 & SC-M`pR@p00001 00 P0 5/PP LЍCp82傟@   p@W("(000 00 $(0,0 0S3 :Un"0" n2U]"L" ]2L2PUP*00 PPp008/P  1 000:88/P ~)>0:! P!: P<: R? p@ P 0j=0:* 00 Ѝ2\D\Z\\\\9B0A-SPp @ሀW@0000W0Sbv000S00 0@HA-Pq``@::S QL2ML8P`D01 HO-@  P4 pჟ0  Q ` ! PU Xӄ0pW㋰  } Ѝ '0`S V03/<0SNVU 00020L MLr0 D0Q @ P 0R \Q  R> @  3 r B"4AQ4 A!, 8\, ,0@8 @8  V 02/0 ::0:0P x1 R8 8  01Pn$}\ 0!< 04 0 (   !/\ P/0 !8 00 (  , !/hFihFiA- 0(0C*s`Ѝ1 @P0 d0L`P pWQ JQ ,X`P,XQ JQ0<00D00 87 H0R. R/ WH01H0XH01H0 0ps8 4\0! @ 18 0@@0 0s S#4  4 \2H02,00@008000@@0 0S%40040A-@2PZD`q@pWA80@00S 80S0p 0sBPh 80S80S808   pDy(XDDC< :RD01 "0D20LML q @c0@0 ** * S#4AQ4 0,W 0,@ 0S#,8Q, 0 ,00000! @ 18 08 @@0 5\/@-0*T00@/@-0 T00@///@- $00@/$00/@-@$00 3/$0@0//@-@$0 03/s@->0`@ P  B` 0ŒQΌ Q @垁0T00 P05/P  0 Ѝpp\p@-0P L冁00T0@4`X 6/TX0d` 6/p@F\O-,M0Ox @ d0SS0 p(а d0S ,ЍS CS 0C$0P:(0``03/PN 0PP0  (0`P  3p\FB\p@-@$0 03/$003/ $00) 3/ $003/$0 03/ x$0 03/\XP$003/Pp}PUp3/$0 0 N'p@-0P`@ 60 0T @ ` BT0 0p@/0@-@ 6 T A-0@q:@q`PU P P0 ! R00 C1$003/P00P$003/0P RR 00`C(d0 U T0X 4P5/T0 dPX5/P\\\/O-@,M1 !dQ Bk~d0S1 TX00 P0H 5/pP L1,ЍO@d0T 0C?odP2X5/x d0SS0p谟d0S 9,ЍS CS 0C0(P` 0pPP3/p0p 0 0 $=a h p00 pK h00\xCB#\BBBBp@- R 0@P5/00 p p@-@9dP8 5/0dP 5/p@ q@-@@s@-@00 P0 5/PP \婀00Ѝp000(` 6/ 0000*\G-`0 p9d":/d0":/0"d:/Q`0dh":/0d\"0:/408"3/0d ":/40 "3/0d!:/40!3/d0!:/̡40!3/@B @0d!:/40|!3/0dd!:/40P!3/0d8!:/40$!3/d0 !:/40 3/ d`0 6/40 3/=d` 6/Z Z pWfdp9P 7/0dp< 7/d`0( 6/=d` 6/'G-`0 p9d":/d0":/@0"d:/`0d":/d"0:/40p"3/0dX":/40D"3/0d,":/40"3/d0":/40!3/@P 40!3/S@0d!:/40!3/0d!:/40l!3/0dT!:/ 0dH!:/40(!3/d0!:/40!3/@ 40 3/d`@0 6/=d` 6/ Z  Z pWYdp9P 7/0dp< 7/d`@0( 6/=d` 6/'G-p0 ⁀9d`!6/d`0!6/@0!d`6/`0d`!6/0d`t!6/40T!3/0d``d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < s{000(0"(i{B\n\p@-@H dP05/pp@-@H0 4P5/0 0p@-P`G@`00{{00 p 0 7/P G Ѝ@{$ /`0p<SGH\{8008080(040,0 Ѝ@$ 0 00$0\\\bBLcBL`B`B@-@BP0S00 0!< 04 0 (   !/\ P/0 !8 00 (  , !/A-@yG`0p4P 5/0P4 8/`?0 0%3?0 00 02000%VP4 P0A-PNG 0 3&*?=0 `p?x0@xp( x0@J4 F@".PpP0d 8/0 dP5/fd/// QX0S/X080/@-0d$ @/?z\ Q/08z\D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/PX`0 4p7/  U 0$ PE>U Ay\C\I\ 0!< 04 0 (   !/\ P/0 !8 00 (  , !/p@-P@`U 0p U ό0S Xy@x0tdP 5/0dP 5/@p]\p@-@PT@h@@pp@-@P0d` 6/0d` 6/( d`\06/T00T0spp@-@P`\00\0dP( 5/p@`@-@$X @00@00X0@ep@-@`gP\00\0d`( 6/p@AQ G-@PQ10 d`?06/4 d`16/18 d`6/@0` ``` `@h08`SlPZ2@PႾpC-4M`pz?K?0S,0APT( 0S 0s S$Q0 0$1 0(1@0i'008 0$Ѝ.$@T4Ѝ,SBp@-@`@?PL#rDr@00000 81*Ppp@nr \ \p@-P@$?01S>8 p@^r R $ R $ p0 \@-,0D ,@ 04/01/@-,D@0\ 0@/A-p>P0AT <1S 0,03/$> 0  %o@ \@->0AT0S $P 1@SG-`P@0<   P@Dp0AC0STW0l0l 0!oPPpW@DT >000XT0D 1 01 oЍ \ \ \p@- 0PQ@ `M ` 8qU < 0 q܍p5 \8 \G-p`@ V@0s5 S20s/ PPE_oRP! Q j9P P Q a9PP Q X9PP Q O9PPY U @`FPY P 9/P@-@>0@00/X0 @-Gp(/J \@-><1 S  [ [ 0[, Ys [YcY   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/PY- 0$000003   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/P0 01P000P:00 0 00,p7/ 0p 00,8/0P000 0S 0 00,p7/ 0,, +  P1+ k 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/P \  10 01>  0P 00 R0Su  ,0   \=3/J0 Z㬠P1>  X  X,0   P3/J P0尠S  ,0   \e3/J0 P 0崠,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( N68@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0@ P%6R0P0$0(P3/0P 0) 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P ,T0BS00\04\@0\00[08p,0 043/UO 0 S000 ;p8/80`0<0d00PS\0 0\00 0`\X ,0d3/PP&X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0ZP/0B?o\ `X2 0d,03/\ X@` ,0d3/\ PX` ,0d3/\ X@` ,0d3/P<0\0T 00\0%P\ `X ,0d3/\ X@` ,0d3/\ XD` ,0d3/\ Xp` ,0d3/\ Xt` ,0d3/H\0DH @00 S3 1* W 0X 0pCh`X d,0B"3/P @!/@Q\ `X ,0d3/ 0#T pRhT($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X `0 ,d,0;/\ X` ,d9/ 0\ ,0`X  ,0d3/@P>P,0 [00St <1QU! !,p!;!  8/U\0 0\00 006 \` \@-@M. l 010K/0  $!(! 111 1014!, p1>  ލBA-P 4d  Q'R Rd@3~d`0Sxd3(1$!qd0aVKO0S3 Alcdhh`dV X[dP`WdV3 ,Nd$#0 S(0 Dd @d@T`1d\0Sd30 d0S S||dt d 0SP0S Xdp0S\Q 4c0c0 c0 c0 c0 c0 c0  c0@ c0 c0  c0  c0  c0  pccAwXcp 0S<cQ 0(Ac$pcQ 0AcQ c,pu \ \ \ \ \ \ \ \ \\\\T \.\\:\I\P\\\j\u\{\\\\\\\\0\<\E\W\\\\\\\\\\\\\\\\e\{\\\O-P@pa$!0r0C?o20S (!0r0C?o20SPA Q> .P;P8 Q5 -P2W10S 2"c R(cpW hア@h /0041@041CsC//0Bp Y `W ,b$pbWH\T\\\\ 0R  BR//G-(0PȀ!p0r@0C?o20S !0r0C?o20SP(㕉)Q -`P 1S Pt-P(㕀 0S \p@-@ 0P` P@HTppA-`P12X4S@ @Tt* 6@Pp@-0@@ ThPPP T[PP PT0P4p8vC@-@TPTu0P4C-@Q4MT4P 0p`  8/P /e4ЍT4  0   p  09/@PE |ePT4 0  2/0 , 9/@ TT4 0  2/`*\*\A-@Pp`84 ,<8/p` W`VP `pE84 ,<8/` VO-Mp1@\qdp PT P <ЍOd 0(0  RC> 0800P 5/P d @ 8$D0<4>`P2嬢42 4HVdG 0 P Q CPP`P$0 PP 2 ,42<0424 242$42(484,;/P00@4$0 00  1, 041<4141$41(484,;/P00@4U 0S R !0R "0R@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$430Py ïPd0 幯Pc0X4Ѝ*\dB*\*\B`CpB*\pCCCCxCLCxCCC|CL00 8/P ЍO~04 04 0S E> L00 8/PB4X 00 0| \6/P p`$ (,tx| d  0hl 0 Q Q 040C0T=X \S3: 8t `#8;/T=X \S< x `0;/X=oppT=``S>  0| \7/zA-BMPp-U@a 0L#^P$  RPP $x0$=1S 0"P( P0 "T-X=\R ( 0`6/ X= R\``T=+ S  x26/T=X \S  ``X26/T=X \S  ``426/T=X \S ( ``96/PU_S  06/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/8 T=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=P\@`T=S0> | 006/0 S0x x 0kBߍfPU$Q $]fC1]x6\#E6\]8\G-`@,,Ph_@ X P G@a_ 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T}+M\ 0\ R`"0P x,_ G تP A01_6\B6\B6\6\6\$0 0!0 00 /@-0 ,0@/@-0\ @/@-00l@ 4/Ѝ@-0 4@4/@-0d @/A-Pp@`T d08/< S   S Co    / 0 /80~  ! 0~  cb$@- ? @-p@-t0P#0\?}0@ 0 0$1(10  000 pp@@-hp@- T?P@[T1S `*P 0 p@0/p@-hp@- T?P@=T1S `*P 0 p@ 0/p@-hp@- T?P@T1S `*P 0 p@40/p@-A-(0P#0?T1S@*P0/`?PhW`F $a0tp000-191910919!03/0 Q$1UP!`0 !6/$10C$1 10 1A#@-@-@冤@98@-@ P`  8*80U C0VH0y[ЍpC]0110   Nn@-<0DT 0 !x0  !0@- !i 0 !G-H1@pT`(A- $0S)h0L3/# h03/h0P03/00S "YZ 0 00++R4S0000 1 PtPh0L\3/ PUl0  83/00 (P05/ЍGN8ހIA-@p`h P0000p`h0$0Pl00L p0A&BBB D]p@-@P0d %S 050pp@-@`P0d &S 0U60pU 0h00l00p0p [(BLBtBlD] B/o P" RA-@pP* @&   P_P`P 0 <?7?00??C S0cVS@@@-@l0D 3/ l003/h0D3/Ph003/8-|M 0V|Ѝp@-D1@S@00tP919!03/03/D1SEt0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/t 0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/0p091D1S91P0 0CS910919!03/610616!0p@/A-P`(0pH@@ CP1S T!R 3/0T10@ 0 0 0 -`X(P 0L'0GPƩZ_忩P /P l `0 4[~pހD] 60D31Q0@   D91/p@-@x`tP03/D1 0CSp03/ 0 3/p@dA`V 03/Pp@-@tPD!0R@  3/D1S 03/0 03/=!03/0  03/=!0 3/D1Se;11S/6!Q0061210/-!R $!$10(!21//0| 00Q  Q  BQ6!0 210/-!R $!$10(!21/6! 6!6!061 ltG-@ |?p(,YPP` T1S`Ѝ&P  0$` 06/p` 0  Qp`ܑ TE 1TV 1T0CT 1 C T 1?A3c0占@-\t]t@{t HȁC]1@Xt@1(@jt@mt1(Mb?1S/,!t       000 l0/p@-@P,10,1@1  `N`0d 0 `0d 0D!@0 0910BRS91091R91@09109!t3/P1Sp3/0T1pp@- ?`XP0@ @003/T1S %P 0@0Sp@-G-`0p#0?+T1S@%P D(pZ  SPP⨏ZȀ F0P * 61p061 Y ( A6p61P061 $0( S S00@ 0990`1S@1Sp8@/80OτB 003A1+ \R? 6!@  6! i R6!@ =!@!051( `1RgS61>!0gD!0ETPR;1v011,1 ,10,1,1 ,10,1D!0R3003/08v/!Rs /1AoR6!=!@ 6!6!6!  S61>!061$0 0!1B8@-8O-0 pLM?@P`LЍ0  1S $P P0 `pP 0?RP0 n0`@0Sp̠L1S 3/P oW`>0T1x`0d 0h0S В0 ` dQShP0 h00&091@1 91091D1S91P0 0CS91091t9! 03/0 3/3(V? o  !nf0@=K,!D0t0 D0@00$ )$ $ ($ $06$00`1C|1810<1l1D1咠|1 1181 01,10,1 ͣ`P0  03/`P3 0@00S-*eSw Rh00SZ=9 R = ?A3c2#d S 0"#!0 "#1R 3~?4M@-D]MbHȁ+8\^p@-0 P"6 0? T1Sp@#P ?1S YU,1 ,10 Vp ,10,1S,1 ,10,10@-p@-@P 妝@Xp8O-T!R q#P 1!PR 1! A(0q 01pBR0  R<" 0" a @V`0@S @DWb A!  BR!V:,!K ,! ,!9! 9!D!R:9! 9!90@`FSAV    R<1! 0 03/p,! ,! ,!0@`S @D` BR9!@t4/,! ,! ,! 0!R p 0q3a 4A4qA!@ 0 2/@!  /! /! .!R .! $   h0Aવ ЍO Ѝ8\B0S/&O-T1S @"P tPI03/0`S E ЍD1 SPf03/c8!03/03/`D1 S 0S @0V 3/1q0 R 03/ Q  $ P\ˠˠ \ Q  D!R0 ,!Le `V03/03/`j0Sf0S`VjU3/0A  3/8!0 3/;!03/ < @010;0a>03/ 0p3/ 03/03/P0,,0 3/03/0P 01 03/1Sa S`0 3/1@S` 03/tQ wQ@F]ހnF]'C]BE]F]F]803p I]J] 0!< 04 0 (   !/O-`@P0ȠY p3 └ LF ᬄP U ]0 0 @ T0 Ѝ2J]\ P/0 !8 00 (  , !/p@-@P T+9S 9S 404 0@a 0 (p@@#C\gfff(CD=S/p@-@=P0C==0CS=>3;3p@hCA-=PS`p @PVD=S@ 0 '=@S蠆A-@p !P`P  0P Q- 0T  \HЍ0A S  ,H 0  gJ]J]@-@00PPЍ7@-P@@=S 0 1 00009Sd=000 PH=SQ  L0d 9S 0Q Q   Ѝ0  DH]G-0Q@pP0MQ 0ЍQ z 4=3/|7S (1h70?0?h70?|7S 0 0@a 0 (|7S H/ox"{"0 \%  R # 0Kq BJ]\gfff(CA@-`M MP@P#EUP0U0C0S0ۍ Ѝ S;U03Qd + Q  QG @=Sa2Q 0Q*$0CQ 0Q-0S00?600p2QY 0Q XnP2QG 0Q *0CQ@=S d= .6M04 2QF 0CQ0Q 5>8#8STp 0SSp E /  ("( E U@=S d=  0EIP6M0000@=S d= N@=S d=N0@=S d= N09S >S$[0SW*L  S* 0C#1L 00*H0QN0 pN0N0%*:iFA-όp` 0P@sP 0 `kP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S* S S@@S@@n R 3 t0C X@Ѝp@ S S@ S@S@@@ЍpJ]O-@dM@=S D=Sd?`< $0>=0=S >S3;3dЍ9S9 YU 0S990090C9R0 ߯05 p 0 P 4 0 03/039Sb.030@]  NP303TeW ?9S壌PU 圌PU 0S000000C0֌s R0┯(P 0 S30 03/pP[2 0 t 噉PP\"(0傿)0Rd-! "G\ʔG 0 D9Sㆍ P0S ` P 0!:> *00! 820a08/ᠾ(0"0D100 0>00KC19- S) 101/0< 20G(0 501=0$0P( `!0 aEᓲ/d=  P 0 H00YXZ Z!0  b 0   0 P`D10=   =0C== S-,0(>0>pX K]p@-0=@S 3/`D]U'ٽ PP `V|DpT=X \S2 d 0``6/T=X \S4 h ``(06/ P N&K]C-CdMpL 3` <3`0 dЍP< RU`@ 0D?o2P0S Ppᙄ  V00P`@UHP`DH3@<30G-MMpG@ l$QPPnW`T$A0Vk  V7* V  V @-R lu$VD ? V Vo  V@=S0W GS0N0A Sb*$AS0N08 S06M02 AS0N0,d#VP(  V * BV @ RVd=; #VT  BVd= 1A  3 0 ᑂ0 ۍЍ \ R\P@-R 6  -  P Pd= ,S0N0 S0N0 VAS06M00 PwP 0C. P 0SP0@-:R s.0?T@=S 9S H=S S S!v0>0P30 G00PP00G G0@=S2Pw 9S#Ps 0EP Pl P9S9  09b sPP [@ VF x9i*F%?- S/@-@pP`,M  @a "0 G,ЍC-3@@DM >  H=S  CR})9 N L)"" FPP> ?PP@ [0 l U C% @PU0@0 `P3@ > Ud=;d=DЍSP-1R >  =H=  S9S PPn PP`0 S 30 Q ;S h`T{0 PP` V@pP * !(#<]$ 0d- /p7/@=S/D=S/QG-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> AP=0 .:^^XW3XR=3 ,=3/@]G  O-@P@MX,=3/`P0@= R?>?oH-2R0S 9l&89d=0d=9S00`P  ?;< ?5989H-R%9" ;Sږo%#}> p ;D("( ;t0} 0 0 D9  )%( ~  d=   d=  d=6   d=  :S0?ӥ=x D9S H=S)> P @H=S (>$CN0\  ; 9S 3   9 : 00 0======H=St3X| >0 0Q. 3;@030)9R332 |T=X \S2 d `P05/X 9S HQ(  9S9xR:@+R S  -  @Q &CH=S 0 `Ѝ  H=S ?  00C0S00[2ӕ Q1ڮ۾=-  P  P@ `D@T-X \R0 ` 003/ 㐹1Y@<`T-X \R" D 003/T=X \S4 0h `9/= [0=PS 0CS>02t_=p@>S 0CS>02p@BH=S >S K]C-PpM P@ `@P NЍ1Y0CYD1Ye 1Y 9 - 09 yj94P@4 =#@=S M\1Y7 1Y . 8@P#@= S7 9S    @y S 4 p4P@3@ @ 80 @0 09@P4P@3@ UH=S@2iii9iO-@=@SdM 7 P 3@  T=X S4 h `;\dЍO/0 000T-X=\R0 ` 0P5/P   T-X=\R @ 0`6/<00  0JP L0 T?  T-X=`R" D 0p\7/=-0C==0=1 Kk& T-X R$ H 00\3/00` (0P㖯) 0X*7B?= 0.`3 ;3B& T-X R$ H 00\3/<0 0` 0 P▯= 0)B>= 0.73 ;3 T-X=\R  0P5/` 0p`1,)S { S  BS T=X \S=4 8h `P#85/= l3  d=0S $P #0=00 S0"( 0=T=X S2 0d ` 2 9S8t$8W9Sp02"'ڧ`P' W0᪫ .0< p0pTp(p320@@00` P! (Tǟ:|"!($΃.$ *00! " ( (.60 p07/0)0RSК  P 3 "*8S00C8 yLw 0 QX(;y9_ 8~P 0/∐)` V%0 c ~ pQp  0H(མ=[8%)0== -JZ%8==0= x0F&>=~)0 S$IBb/Pp =W : : : T⼄ገ l:V\:X: )W n`` pQ 0 /3p0G'བྷ=[#)08Bh=~= -JZh#B[==0= ix0H(>=nf S0 0 042<#_0CSy0d=0d=9S9Sm `43/acd=0d=_H=S >Sh"PS 0>P9SMd=09`S 4Q`PEUP#8뎄 U >^pP>PG) 0$ 0 0$ pR)&00 02` S08#82́ 000H-Q0R RH RI x<  0> hP``:g>  L0>YP 1>#F&V   01  ?& 22?2 ?"LP0C.>2>2?5?# R #.D2K] L]`L]X K]xnL]xL]L]L]L]L]L]H]L]O- @ $MⰺP( y9 $Ѝ] ӂ09T=`X S2 d `P0\5/T=X \S4 h `Pp85/0D=0P0D=U_}0 4[P   PXB  9w 290 00 #90HeGQ R)90SH=10S"l90H=0 000P0 0d1!,2# 0L=8( [0(=v p80H=0dp0 0 1!ᤆ2# 0H-P=R0&SS+ 00x0  P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=H=S% %S0B 8H=嬥嬕S L}d\:9"a0@gh8Pdzv:9ȏ"a@h 0$n8 i )+4),|04p@04\r0404043099!= 0 _P z;:0㠠 0I10S S2 Ԋd=베YH08 >PG0  SBQQ Q"< 1?0:H=S0 d=  0 !P0 d0מ0d= d-H-R' R RB d-Pt#Qb?d= d#Qژ0d=T3)Q8<9 9<9< (S:S:/d-P-R j>0d=2R 9;998<92R 9<9<  : (0 P0S909 0 0T 0 Pe 0SbڴyX > 2 t=2(x=6=⾀ᰀ|=tv/u44=4!8=141:1:141=1=1=1 =@@p1X 0>9/  >pL1a  8 >p0T8H0P-d=1R9 <9 p@-@JP3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( /,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002zt`>p: IG0@000HkCiCzCjCjClCt}CuCQ]@-@4S@/G-3PA@,p0 <300 U SH}bVH}3<3㏂> - 2X>00`V  UP 3<300 UHG}O-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \p/0 S FR]|C,C؁CCnCR]R]|CĒCCCp@-@P):pp@- @4P P]p@-DA-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l20  R= 080#8S  ?00#\`6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0.03 \P05/2 ,P5/2P,` 6/ `+ P@U! + P03\` &N6/0 ƒ`xp0 `ՃVAH+$P@ 4+0P,+#PR]S]S]hChCDS]%S].S]#;S]O-P \h ( ` ,@,4/ R@ Wd0 0 ,P5/0D(0@0O-p\h@R`C$x102c000 0Z PPP Ѝ00$10P t0S 3/0 \$8/ Ԧ ,0,3/" t0S 3/0 \$9/ 㼦 ,0,3/U d0@ |PU P\TS]\0O-0Q05ph`  @^ |03/}ユ0 ,:/p +40\8:/  hP l0 [ $0\p 7/0 ,P,5/t0S 3/0 \$:/ J0 ,,:/t0S 3/0 $\;/ 4 ,0,3/I YʠZZ Zp0 PP Zp0 P t0S 3/0\ $:/0\ :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/0P , :/P P t0S 3/0\ $:/0\ :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/P0\  :/0 ,:/0P , :/P Y ЍY;5 t0S 3/_0 2$\ 0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 03<3$Ѝ 4à@  P ^8pP pP#8 ㅝMb\LCA-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`v 00 0vPP 0S  0  0` KsV08 AsU P 0,p p@GpT]\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/@-2 \#1@0/@-2 ,@4/p@-P@2 ,`6/”0P\0p@ /@-P`p@@$0PL pq ЍT]@-P`p@@$0PL p1r ЍT]p@-@P0 \`6/㱜 0 \`6/㨜U0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&p 0!d!0    !0GT\7@-@ &^0202020 DR2|0x@4S0000 ^o2S " x" Ѝ0@x꠾CC̽CļChChC@-@ &@o@-&bpPp@-@P&p2020p@-@4@SS&Mp 0@\@-@&@p/@-00 lq ЍU]@-@8Đ<0\ @/@-84< ,@4/@-00 p ЍU]G-p@d尐PV㬀ʀ 0! $ 0    !&p 0!d!0    !0G\7@-@&^ 0202x02p0p DR2h0w0000 n2S " w" Ѝ0@,xCCCChChC@-@c &@Bo@-&oPp@-@P&o2020p@-@&o 0@<\@-@@&@oP/ 0\R/@-@ 0^   \R@-@0U. V? '  05Ѝ@U]A-PQ+ t@pT'P P q`0d i\0 T@P 0t000 [\Ѝ@U]U]U]^U] 0`( "4`#/p@-PϠ ,@ / p0@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ0U]@-  Ѝ@-  ЍO-M@p0 (P $   `0 S p  .( ߍ      0 (i @0p@-@MP `{  @ @@ @@ D }zw t.   ܍p@- ; Ѝ@-@ .ЍO-MHR@`L @. B?<00p (008 <040,0$08 @L 2!0$ 00,0 0400<0 0 (00 000 8 @0 $ 0 "$ , ", 4  "4 <  "< 0 0T p (08 L @ `  @L $, 4<\.@ ߍO-MHR@` L@ 0(0 0008 00!p000 (S08  } zw.@ ߍ_00 X ( S 0 N 0 p$008,0040< O @L I8$`!;00,!4 *4!. $<! (@p@-@MP `  @ @@ @@ q  . A  =܍pO-M`@l `hh2 00h2$p00h2(P 00,L  @ H P 0 X@\0T0L0D0@ `lq @@!H!P!X !,0( $ OZ`@ h$(,.` @ߍP$0 (040,08 40<00<008%d @`0 H[ P W0 XR00 D 0L40 L0F8 TA

$;(8,5.`~ @zߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

00L0D0<04008p@`HPn\0 P0h0DS 8 0H0 D( ,0@LDHpDD`D@P0,!B( 0'= 0 &90%$04@@ 0J04*P0&4#000#0PeU1! 0< <0  P `F@00V@0 00W`V 0  @0 4 i0<0 Ѝa+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0`pPU 0  %$- @00 

H0 0<00@-P@M  H }@  Ѝ0O-yM00 00P0x0S0pCU0D0y 0` $00(00$0 , 0 00`0@0 000x  0F| 40F0 000E4  P 2  pX0 X/P$0 E80P |2  pX 0dE XP(0 ,0$0` 0 0@0050 0800x  0<0| 0F00 $TP (mP P l1 > pX0 PX׬P $EWE0 ,0#0E0(0`0$0@ 0 0000 0x  840<| 00 E P | J&PpW@@#x0S0S @PdD0SSU0SS Px yߍV]X]ATP P /@-P/Y]A-@pP0SUA@0A` `FV`! 0PE@G-@P`0S 0X  P @0PEp pGWp! 0%H0ppGWp!P Z@`FVO-PDM %  !  !  ! "+P%PP0#0P%PP! PP0!0#$0P 00#$, 0+<0 0"00 0#0@0+(0 0"0#,00 "`@ 0,p@,`P` @`&! @@$$p +! p p' p' , ,,0, '00#0#0#0# P(`pP!!@!P P%`#, p'p@$@ `! @$0#0#4(#0% (8,%p# p'p,$ !$@8(& @$+  4!() ,, 0,  , " " $* * 4 P< . , 0 0#!.(P%P%+0# 00$ 00#0#08000#0#0 00 ,,0#,0# 00DЍt!t1G-P@  P@@P਀` ᩐPP`pP0 `0 pQ@! P A, @.p  q)1 0` p%RPPR$BpP@P@PB! ,"0 @ @  說UUUU3333-$M  $ЍO-RM  RO R p pG pP` 1"A0 ?`TT0000h`ᄡ0V,`0 0`T0 ` S@F0@ S 0`` P   YߍpV \ OZ]UUUUp@-8@8P`\p 1001UUUUO-R`M R. R P P& Pp"Aq  TT00 0F[`N`0   T  WЍP[Q 5OZ]O-EMP@PC 2 00`$00r(0 0,00 0000 0 0`pG0( 0 V000000 0 >0  >2  >2  >2   W  Eߍ0@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:iObPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/ /00 0/ /O-@p`PDM P800,p($@ @@ @e008 <0,(p$@ @@ @VP0 P000<00,(p$@ @ @P< CDЍ\Z]CA-xM@P`` pxT00H:0X 00 000000 xЍ /A-@PM TЍQ  0`P .pq P V P@TP@P 0P0 `0SPPPP 00S(  pZ]Z]Z] /Z]|Z]Z]0/ / @-7  @-2  @-- @--  @-(  @-#@-@/ /@-@/ /@-@/ /@-@/ /@- @/ /@-$@/ /@-(@/ /@-,@/ /@-0@/ /O-M @0_0 00 S0 0SPq020`0 03/  003/ 0  K0C00 <,p 003/  0<3/00 \0 00 :/ \P rQP 0 }0\ ߍ0 0 0, 0 \00V 0(0,0 !" 000 03/0@0 4/ 03/ 0 3/@@00p0  l02"  RP aP y0 9p0 000  $0S !&.LKPP &> 0S !&> f&>ş 0S " &> WP0p0 59/5 0S !%tP p5 0S !P5<< 0$ş45 0S " 5 !P0p0 49/4 0S !$P 4 0S !|4dd Lğ`4 0S " @40( P0p0 49/4 0S !#P 3 0S !3 ětß3 0S " l3XP ⵛP0p0 83?9/?0 0S !? sP ?0 0S !?0 ⎛?0 0S " ?0 ⁛P0tB0&.088/&.GP &>, Qk/&>eP&.⛽00!08/!(P 1 L!1FP&.|00x!0x8/`!D P H1P0 -!01'P&.]00!08/ P 0  0P&.>00? 0@4/? LP ?0X8 $ ?0 Pߍ0j]l]o]ATo]j]_Pj](o] 0A-aHM0 @1P4/@ #@P @0 cÚ@ 0`00 !p7/@ 1Pp @0 q⭚@0pp0 `X0 6/ t`P 0, ?☚`HЍ8o]i]ATo]8p]p@-`@pMP嶡 ⹢ ⵢ`a R ⭢@Th fpЍp07@-7P|@~ Q@00#47 b0 P Q0L Ѝ0r00#4p@-@P`\08M 00 00 P  )8Ѝp@-t @!0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 8n0 p0 P@`pPtЍC-`p0MMPStX@pP `0 (`(07 ` ``G N ⯱7 (4`VIM0bP ՠ7 (ء( G ␱7 (⌱h ∱`⼠0 `0彡7 `⹡` p 0b"!4b4# 0(0 7  (p0h 0p0`_ [Mߍ⌠7 (⏡ߡ ( `F O-M0@, ? R$0(@0 0$0 0p t 07 0001  E0Pppn0ERt  7`EPS0婠@k0C?o200U 00 Q @7 t0 4 t# t0P  U0Q00pp0 Q@0  7 t0@ 4 t0@7 P@@R tRY@0Z_0S0}$Ѝ-q]{]{]6|]p@-l@P  0 ,ap0@-,M@P4\0  ⎰ @ 000Z?,Ѝ0脽H}] 0!< 04 0 (   !/\ P/0 !8 00 (  , !/G-pP`4AWT 1, LaT@! PU,QP N  0 0  0< 002  ,QЍG/@-$M`||p0 ;@P D0!4a000l  $Ѝ脽/0@- $N@ 呃T5D/7D@- Ѝ@- { Ѝ@- Q@05/cw^ _0o`000S P0? p /00p W`0S1001^n80 Sd001c00N8fB0S00d0Q00@Sg/1!p11S4H\!01\(  1!66- R    R    R   "-" R   .R 0  S0@008Sh0 S01 1S  0310@0xj.1S(01 ЍCbX ?]b]p]@SD0.R  "-" R   wP/P/////|0R 0\ R\ !L/P x7S0S/(]8]O-`@u_Pw>0S4 0!px0Sl@TP P W $ 00p꼙^]X]x]m]p@-`@%PP0p@ .00007wnS000q 20|7S S S0< 0 0CS0|7Sx8D!0 0<00;080p0808070B;0;x]/]O-@0`pTM 0<^0 @P qw>0S9+ 3 a0 ^Pp7  0 VPp7  0 NPp7  0 EPp7 0 =PY YpPP0S] (RD[PX 2 0PT TЍ\I0X0 S0   0P 0p Pp7  0 Op7  0 Op7  0 Op7 0 O0 0RʻP 70A  `P( 0 S0 `` Op7  0 Op7  0 Op7  0 Op7 0 Opmꬄ]@B00 S   P 01А/8]G-P@PX"B-\8 Q2 +Q  Q/ QwⴀXa` 0 S&100SP6 P Q$u?0XPpQ0Q Q 00 P PWP2q?0^ PP00p |p  ppWQX" 0S `P48S|74XS h0|w7h78 TI:J4`Vh78h7]J0000 000/s@-@d ^1 R S00#0 0S0:1D!0CR 0 D10D1! 0!0 0 0 00 0%00n\0D1S 0S00 000 R 0D10CD1! 0  R0Ѝp0!0 0  }]]΀\Q: / AA!  ////p@-@8 MQ1P 00#!" 0 0000 `0V :3/P 1 p 0L 10 18003/@ ᣭ808003/000<0 Ѝp]]<]G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::<]8iD`iDXiDhiD0S4 ( QQ  H/_]80S< bA0!RR    4A!/ۆ]8P0P//8QG-@p ڐ1 0  $10$1Ѝt`PXQ1L(10(1<1P1 .0 Y ,X  p7岠`7 1  0 `W p71 ! `80S0S% `03/P1 H!A0 베,10,1W11!1P10o0 8003/ 0`R ᤚ0 9/P  120!S 0! t I0v W㲠`0`4!S 4!j 4 W0f c0000]8]]]p@-@P:3/:3/p@-@:3/:@/G-8p(MW$1@P` ᴐᲠuB0 0#!"! 0 03/P1 0 00R0000 101(Ѝ \0R 1 <  101 :(ЍG/]|]~]C-`@ 1RP~P1US^1 B0 0x1 000P Ѝ08 R< 0 RppSh7p0pp 3SH0L RP00H0 00@Q$@0 00T 0(0 0(00S*9d@P  ෾# 0 3/P d@<]-]p]C-Pp(0`S!R$  X 0@ 6`0 0R@@@N@80S*cPU 00 0@ Ѝ (0 S*!R ,  $03/Pꔉ]<]/A-`P@HM pz&40%YV   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`M 04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p ?*P`Ѝ]@-0<S !  0 b Ѝ0,]<@-@ P0@00d]/O-P0 #`1# $ ( #$0  #(#< 0$Ѝ p0R@-P@0  <0`101(0 0C` F%ЍpG-R@P<M0 % ` 1 01(ppG0G  0BZ P 80R  $ЍqZ$"P//O-@<`IMP 101p    ᔹ 000 S0 0_>1Q X 0 0>0SC Dd(0HL@@00C pS0!@D\pW*T+ `1  5;0 <΀ Y  ZIJY Ό \ ,ਐ, !,00@P^ ΂ a\aNL^Q !^UIߍܖ]ܒ]A-@` 1Qp W 0 0>0SC0 (p PpG@ BR !pG RQ+W, @1  v:0 "IߍP PQ#4%^QY  ZIQJY PP^PQU @ 00 >@1TQ QPQD1@AT00>01S0#0 #ܖ]ܒ]p@-  0 "000e $ٻP$\ 1 >  0 &0C   0SH Q1S=Y 00 0 0S9x 0 $0嬻P 0 奻P 1 $ 470P H 7(= G CP 00[0Z0S  ⁻P   V%PPl 0p000[|7S0E00S0S !R 0<<0ppW9p090& 05 !# #^  #P  R\ Qʐ! +0 00 p' l000101p0S5 SE 1S 0 0D; 0Sp10p180080|7S00S2S14+ * 00?B D10D10 q7/00` 00(0 0pP XP 0`00 01 |78*`S,0X 1 8*0 Z000 03  0  ⳺ P1 90R?C0C?0000`zX0@0. h71 H)00}?B '$00$0101Xx8S1 (00Q?B 000 00 0 2S1 ("00Q?B 0 a6/ 2" 0 S!-0002021 H5!= 0xS!-00C02021  H5!= 0bPQ1Sz 3/w1  H5P1 8M HQ 0SH1L1 P10CP1S0 900S000000 0P0101? 0t 0S0t0`0S*W`P0`  H|0S0S0S0S0SXG TI0 0Sp S SLXX RT00 4(04$0$04SfW `Y (0 0C4!<0V0` 20 %S ! ( 04  C00010100`00$00 붡0 ,0$0 00SG X$W0i00倀00X ! Z >P   8P 00#@ W,0S 101V000S(`T(0 0(00嶡$0S `|V0`+g080 R ,003/P 1 # ?B B2101M00 0@00 GSS2L▲ XP40  0@004th0 0 0040a6/4UZ S  03  CH10H1EHqW1 H2 n*L10L11S 3/0SL1H100PHP1X7S  H2 I1S 3/ S  Hp20 709000000 0Spp0p 000O-S@Pp`MD #0So Sl 00 |7S7S  40040T@S PS- 1S ?-Cp BP000BSh S] S70CS40040500CS 1 ?/0=>C( 0C0L00L0"h7|7S2S 0J S1 4?D/Gr0=>C!0CL00L0S 40040Ѝ, Tћ0d0252 5$YX0Zp0S1 =.Gr0;C!0CD00D00J S*1 >(.Gr0=>C!0CL00L00SS  2St *St 0S ! -00 P00P0SPn xl00phQ1 =-Gr0=>C!0CL00L0zx7S 0450!0P0C2X00Z0Q1 <,Gr0=>C!0CeL00L0Wx7S0X0Q1 <0,Gr0=>C!0CML00L0?0`0H5Q0[0 1 0; \H00H0Q  04 8 <+S0S JP |~0S! 8+0Gr:!H00H0l0S1 \:*Gr0C>C!0CD00D0 R1 *Gr9!H00H0X VY1  D*Gr9!T00T0YQ xQ 1  )GrX9!X00X0A=P:1  )Gr9!d10d1xU !/ ) W101<00<0101|7hWSPm2Sj U   Pd d┮7![0R 1  @N0[ 71w. h7R7!66h7[071?%0#  1  @.0 ?w>0S)  45?|Q 2  yP5`0S ;!0:1h7 0 000T0"08U l7 ?l78l70 000T0"5   iP! T P 0`P00 0WP  x8Xh'* 13/?S PT0- d|wW 7S 40040  0 RY/1 5%0N>C 0CD00D0BP*1 @5P%0=>C 0CL00L0P 2P P00S ! $04 zH00H0lZ1 4$0C 0C-`00`0x8Up W - pPU 1  T. 0 00 00 1 p2"0U>C 0CW   XP   -P0P a6/1 HR  ,2<"0=>C, 0CL00L0㸑qἡ  @. 0 xph:S  0 3/P1  B 000|7S0 a86/h7 1A &00Y>B l00l0|7S0 a6/xYE1S h 00]>B Jꏢ]]g]@]x]]]]̜]ߜ]]]}]]]Н]]P]`]0]]]]]Ğ]]1]e]Z]]]]]@@]ޟ]]3]K]T]e]m]]*]U]x]]]]]PP)]#]i] 0 C  ! 00 B000 0|Q4px0p 0S0HP! 00C0\!00 0- B00000S 0GSX 1 !O00]>B 0S ! !0 0M B|7 "S ! "00m Bo7S ! h"00} BHW W㐑D  2I/Cp BU0000x8U,  PP` 2 020000P ,.1#  Th-H3V P 0 0, a06/r2 u`x8U f #00=B ],P^ #(00=B o P  $>00=B h00h0H(4  T-` Z7S.W) W7,P 0,0Z 1$  T, 0 x8U<10<1h00h0 1 3/P  ,0 a6/1 |5I/Cp B000Q7S 13/Y 0S! %0J?B y000|7Sp x0p |7D&S ! h&00 X7WS 000x8U   PP 2 020a6/1&  Tn,  6 0S }2 ″7WSZ 1d'  TP, 0 x8 U<10<1h00h013/V 1 3/O1S 7w/C BOd00d0|7S?0 a 86/7 W00(000 0 I(S1 t8d(Gr0=>C!0C)L00L0x ∰P 1S 8(Gr0y>C!0Cp00p00S"0 $0000 0" 0A S*1 X9H)Gr0=>C!0CL00L000S0 S  S   0Q 0S"1 9)Gr0N>C! 0CD00D02S0 S P P$0 0$0 00S! p*0Gr:!H00H0Y1 :*Gr0 >C-B 0 a6/000  C !0pp$W,1 > pM.C B0L 4P 8P <S 0C?o020\3bqE0p01D/ d? ,B>C B借! 0?Q.C\ W1/ ?p/C00Z 1/ ?E.C*0A@0P ! ;F.C0 G  00 Q 0  1p :I.C B.D<08 q8 <0 HXB i pG p  1D*R D: >CK.B  C !0pp$W,1; 9 pM.C B0L 4P 8P <S 0C?o020\3bqE0p01`) h9 O.B>C BLL00cWF01 441)  T)0 00S8C0FD CA@8,P -0,0,01S  T\)0 Sh8C0,T 0( a6/ox00x0]00 /Ph7 1S  T/)0 S7C0Y0( a6/C|00|01000040?,0?x80101x8M? M? x861610S @000D0049$0S 4202( 0P 0004P $04020|7S7S 400400LS1 464&Gr0=>C!0CL00L0꺁xXX 1  T(50W 0 0tx8U<10<1h00h0 ᐕ 0\Q<1 h5T%Gr0N>C! 0CD00D0LP*1 4$Gr0=>C!0CL00L02P  P P0Z   P0S! X$0GrX4!mH00H0_0ḡἑ  1  T8(30W  0 0x8 U<10<1|00|013/;X㺯ᴒN  pH 202-wh7Q / ? 67Qh7 !, h7R7!66h71  T'Ÿ h0WR 0 0    Ÿ   13/20276h7'0R40040 0CS1 1!0=>C0 0CL00L00q001 01.P400401  T'0 ^|7S S 40040 1 3/x8U 0q00101 P400401  Td'0 +|7S S 40040o 1 3/hx8Ue pax]]]]]]=]]m]3]]ơ]PK]T]]] ]-]]E]k] -0@-@PM0 0s P' 0Ѝ0@Ѝ/ᨢ]A-p|7@S2S0!1R004 S00R  0 u``R8P`20100010020 0083/ ? 071 0!GR # D1"022222220 " 8," ZN292S988-#87 0C2c70r0Q   0   04Q   ۤ0PP0C03254b]A-P L0R8pL `@x|'R"⼤(R# #0 83/G?G/ @0?@D00Q0000L00 ☤00 R  ␤001H0O-`qF尡MT9 0 Yd (  .00 4S! 0+ 0Q P0 S0#  "0 000083/? 0? 071 0S!GR # K0S/S10C1ߍ(0 ; 0" R 0Q   /0   0" R 4Q   ! XP0pG@b]@-1CMS@CߍP` (@P p  `P 0,ᮏ0Q    R,!0R 1Ł!@p@-2@SP 0aS 0 6/p@03A0AS@-@e ƣ/C-@px8 ATMBR h'0 01PTЍ"}07p7 ~0P00 ! U BP Q 0009h75S0 S0 S00!e R #TЍC7h7#20k70k7#1p7#81p71i72k71k7#200#8S >!0R1ā !@R\PPa4VA  MPP` 8. 0000000Q<<0T 0 0000( P00'  0R 000U @ /PDVOxc n  ᖎ xWG_o`/R χ166S1 000P U0!01S 1PATЍCTЍC"1S PP  `P !ZR !ā BP2괁X PP  `P 2 01 SP0} pl 0"P1UP0UQ  `(0PE("(!p7 0/A0S 0(( %=>000Q00000s#N90r":9?o2{N8y?wh78s"}0p:S| (0TЍC/Ȣ]]DDN]0|7S2S/004 S00R  0 u0000/A- MPp^%@`Pl0$`S9 BS` BS!? S* SU  S `Y$02010?0x8D!0100"]00 j"]0h78h75^0x8?00h7#2^0n^0`P V C VΠ@`U0"0t"]0h7=$`B000i;0d 0k ಠL 000XT]r]v]*-O<ǁDG-p M@`'P`P0'XHS^ + BS*? S* S  S `@'?;CS00$'S?  Sj BSX0Sj p7 h70h7s&Sc 5, BS  BS&?;C0CS0&SDX @0SC00P0S Q>⪎0pⲐWC嶠C ދ %@0Sp9%S BS6 BS  S7 / BS|7SR c8P`K 13/8x%S r S}`=0X SQ`4#=0 ᡋ  (03A0ASXa0S^!V&R!X 1?0|8|7S3A0AS13/4P` XD3   R< C ЍR <3X100$S- p' & |'S|7x'Rp' p' X\08 w0S 㴀u?0Xp  R0\ Y "q?0Q  \ X "= w X "= q X0S p7  h78h7|7S7S03A0AS7S7S4`|h7y  8h7u h7 O ;X > h7 E 0X0Sx( 0•zh79 0Xs0S.0‘mXk W?B0CSe"= |7S! H  ᎊx7 ?op2X  0RQ ÑVP P6P   Q A0 S -]%֣]EOڣ]O-?@Q`|M pX3C>6CQ+ *3>6Q P?Q 70Q  |ЍO" ?Q0 00 0p0PPM.x0@FS00>Q >Q F0Q0 0CS4PP/|>Q7S|'R h7   0>Q $ QL >Q>|ЍOh>W0.|ЍO*=0S-S001S S Sh740 03A0AS[7SX4Ph740h7h740@S)!P& 1(-0CS0h70h701!x8 h750h7h750h75!0B8#8S"= Ñ P1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P!h7R00h7!h7R44!@R8PPH<0 SPo;XK=0S|7S=xhh >ΣPYp:3/0= 8PP <0S0#0$" 0#0 < X^V > PP 3S>ñ:3/V H4U< ' > ` `PPXqs`~!Rj8UPP8Q|7SxH 9tP 1P|Ѝ 9 5 @P DQCA!*R;8&PP80SS*0|7S-9 iR B0<PP" @P>0CS|7S < @P 80S& < |'R R0<P  < @P 81#3/ @8 f |7S PpP P !PP $x!> J!h7R 331Sh'5h7Q Q%h'r Q5| n4y1S p7h7:qh7:m!h7R33g!h7R22P 60"p7 10h7FP!0B8#8S ȕypဦ1S7 W 0p' Wp WUPdP1S\& "0vT!0B8#8S ȕnL!18p7h1019q W> (PP 8ⶇx7 ?o2x`QQ 6P  x@Q @A0 S |Q x0@`P|V` x01@0S S2 Q_P|Xe 8ś03A0AS7SP U|7S cP 13/P]!R8zPPTW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U 4SPP 03/P Z0U 03/!R8xPP  8 m 0P > "p7|  2/@0SX1X  pŸ&%-  PHŸ.  P  B"P9 919"p0000 9100000000 910 B"0k9990 9100 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201: !h7R 0 0h7w>0S 108p'1 S"-08|#8,C("(Riii]i9ii:ii8i8i(7io?v]]) pD]ɤ]Ϥ]]]* *Ӥ]b]J٤]i! 8PPj8` V#=0 7 h9}x! 8.7S (#8 9n! 8PHx 8  0BS !R r39S0S0 p Q ARQz0W8@   R@ WpP:3/>00S 0H pH0P-PpW@:3/UJp媎0SD@pX0 0CR00h'4PS4400Rh7PP 0 0H-HAP h7~N#2000@000S@@T`'  0PP0T0 TPP  > 0S p7  h7 ; h7h7 ; h7N50000> 0 ⟙ h7P:: xⓙ1($S,48 S!V&R! 1?08|87Sx|'R8$S x(0!Sm|8R8h x(0!R7S|7S|j|ЍO^0 00 0p0dPP- |ЍOHLT P   03/P|ЍOOꔥ唅唵Yʀ 0! $%0    ! @aRa/#N6PPWa/ 0!4&0 !    !0G-@M,00 `p@(0#00a0$  @<0P`P0(0(0 0Q@<0$  a,@`P<  @Ѝ]>]A- 8MP4/ ! A0     P,`p$0 0 a,(P @4 \`0P! @   '.$00 0 ap,(P@4 H`0P P#!X0X@XP R T:8Ѝ4 w03/TE{]ؙ8m_m_]C-MP 0`p` @_0 0 00 l00P 0@ 0 [?o2P@@TT}0PЍC-p@P`M(` 2X0  e0 000000X00[ЍO-QM0|MЍOH_QGR0 0P0p 0p;/o0"/6$R ʀ  !Ā .! 0 @!( , $@TR$@lU 1l #T   $`Q)  S  @*Q PP R$@M @(@@ P R$@iN@xP R$@@,@ ASXx( T(Q@, c@$ ,@Tu \ P,@$ ( x(Ri. Q - Q UWX H0/0$6 3DZ <Vt20!R0 o` BB!$ PN 0O ?7!Gq "|'- "bt x  0D!(/( (# 4)%)M/ )6! 0`2$,(p0/0H0E  0<0@ ^P| <400 00!@0 $ 0,(p<0^Pe <0 00@!0 $ 0,(p<0]PP < 00@!0 $ 0,(p<0]P<> 0 00@!(0 $ 0,(p<0]P'w> 00@!30 $ 0,(p<0]P 0N@?P!$ ,(p @P<0@ ]P  A\Ѝإ]Eޥ]ؙLE']c`@-@἞Pᮞp@-@`PUp0S00`00C0  `9-@-0 0 Ѝ Ѝ/?]p@-PP Ul}U`5@P 60000 (k |7@P@pD]c].C-1P@`p x8圀QHL 0x8 S `Ved0 7D  Ѝ QV0 lg(D{]@-1P@` x8pQ0Gp 0hx8S 0 f D Ѝ@  $0 hC Ѝ|]]@-1@  0@ iCꛦ]O-1020`003/0900*= 20T100 0!` 0@0 00aS0@`PpЍAꧪ]b]<] ) @0) 8408008,08089!= 01/l"E,"EGE E E2 029 0/202/@-80000#Q0Sl78l7 .0 0 ( ( #- x Ѝ1@-@ h70  (0(0Rh7=h7l78l7Ȫ]]ê]p@-@P83/p@d@-P` PQVxw- w> G" !@ Br 00# B1  ~m @0@ GG?0@ Q  Ѝ7SD10A@ ]]]]A-`P8p3/@P\00\0  s@-P8 `3/@P\00\0. 1 0  1x ,00x822x80!H0003/090020T100PЍpX]<]A-P`8p3/@P\00\0  x8 0 0x822x822xx80!x8 99p@-@P`F Z@ pp@-P@P xG Gȏ1S 3/pA-P@p`000 Ⰿ ⬏ ⨏0?0?x80101 M? 061071 N? (Q 4 $Q 0 0 ,1SA/@-P ` pk@P 00 0t ЍA-|7PSS` h7M @ iN@p 0 R0S P@xH/ A-|7`SSp@ h7] P i^P 0S TAT20 R0S P@xH0S i V1Sp1 0H0  0#PA Ѝۗt]A-pymPV |7 `S 0 xHȗ T |7SS @P ⹗O@1   0!R000괫]C-P@@@`p AT ݐ  P01S≗P1 }40 $0&E  Ѝ@]G-`X  pR 0S R@ʔOoB@ PU! @ ⷔP 0R01 S  R 0S R⣔P0 P0T@`C-p`@P  匔P@T  Ѝ0S {P 1 0t B0    AT  `P0S WP @-]3]A-P@U, pc &P ЍA 0S0S i V1S1 P0 !f 0!oP ЍAЍD]@-@xP 0x8i <P =0<8HP70H8p@-|7@SP yn 089,8J xxXP 0 022220000990{w>018|'R 13/p脬]A-1@`  y^ |7S118889,8   PPp M(# Fx8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGQ ARꄬ]]@-@xQ `P @P P 1  r<10<1Ѝp⿕+1 h'0HH <<8 8 0 >Qh7U i^` P R h70h7Ѝp@꼙]ê]]O-M80i~ 0<0p`P  0@P 83/@P\00\0 x8 0 0x822x822(7x8 991* h7' 9 000p 01X'r /@1 Iq? BX  000 70SR 200S PZ R 00 v  07 00 0 000?0?0ao`0a M? 061071 0S ;!0:1 N? (Q4 4n$Q0 0h0 XЍO2߾0 [ 0־Ѝԭ]]4]C-`@yPP/⾙08pS% 4(Y" U a !eV T  `P1 0@0C 0%- ЍU` :]T]A-2@P !m00C02021 _ 0  `2Pq 02HQWP,RP ,PP.P.P.PA0SH1L1`P10CP1s.1S 3/꤮]G-Pp```0V x '2G@T 0V ` 9/@Į] $EA-x2!@0SP` 2 L9|QI0S1 $ݿ2Su :0S 3/"<2< "!0!-200C0w>0SX? $~Q A1 0 lY0Sp7  |7S 1 4 &HE2-~Q A1 0 10S1  &h76h7p7  1 t h767h7V @A'Ap@]!]>]_]]Я]]O-P`|7MSS00 0ppp 1 p 0%0W  A@CЍO @T 00Ѝ0W p|7S2  0S 4"|0 0P=-00x8S} 0 0C8C80Q Ro P1S: 00! 0 0 00HP 0SH1L100P10CP1 -H1S 0 R B0 Y 1  0 g1P 0Q113/0Sʐ1  0 X q2S 0 ᬑ9/000`)Sʐ1\  X 0$ 9↑ PLS@\T]^]\]]]İ]C-2@SP`M !Ⰰ8#8X 0 q7/ЍC`< p 92<2<! !000w>0SB p!,20S 4 2 hkCWAⲂ0 ؁P 1S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? ~0001 0 GP202~0001 0 7S 1  th76h7? 1 P eh776h7rpq@]]Ĭ]ɬ]\]]߱]$]Q]]]A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3}@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 4 0BAP00Qp@#]p@-PiN@ @P`>xh=VxHp 0^ 022220000990?p@@>]@-!]0!@S001 Ł<>HP1a 000Z.  yGy u070$8@1}p`Uwh,884X mP10XQ 00% E 0 Ei~  FP L 0' 08' jn P6D'@7<7f(Wox8 p  p'    H ( < ) x8 k Ѝ]TLE]#E A-pʀjPcQ` 0ES  B2U U U ,U UPPH$H@kWpx@'x@@@p*0000>0h'0S0000@/p@-P@ ls000 0t u"    @v w 0  " @x 0S @@p贲]A-0 0S@P p `*|7S00 04  0 ,003213030 0        ꘲]t0/C-@`ME&PP0009g Ѝp0 `ݐ0=0 H02 |7S0000(001011 `ݾ0T A   W00L7SPP7HWLW0P7]@-206 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R"  R  (R  B/o"S0|'Rx  *60R R  R R  1H0S "N)R괲]O-0LM S< P@ 8Ph7 |7S 808 7Rᘐ>0S 39S᚞ $7R.㲢 $7Rpph7 4@ppY80```& #RH L0S0P !0 >0'S 3)6R1 8>0 060000H  0C FR{-%@P000 Vڸ d4%0Y000040  B    004@]4@Th }%U 0      $D"$  (00 #RH L0S0P  (@P000> 40H   CW0C00000 (0`0(00 0|7S000 0v > r 8n0 0 00Zl 060S  S  S#:9S00w0 00#"!# #"0( RR0O+ +Y $3R h7 |7S8 3 R 0@0080 R  (03/P1 8d 81081 8  > x 0 08   >321303(Z !%*0$@00 00 0J(000( 0 I 0 0Z 1! Y0: L嶹$`Y  %P`PPe$ I$0 0嶃 0 010 1 00 0 0 I0, 0$, 00(0080$0`0000 S0 000((0CE$0 8000000C001!0110/1!LЍP`'Y0 S  04x'P 4~'@{'@[80[ 0 00徠SX (, ]<] ]_]]]]ʳ]]O-0S h'0 p  0j000   J0  H)0IS0,00S0Y  R Yx(  B/o"Z00S  0uPP0 = S  岀崠 85 0,Y 1  00:0Z(110011|7S 0H   CR0C00000 `(0 0(00000=00y0  , R :01  0D0@001 PW|'R  3Grq穸 0 嗳1 0100L7SPP7HWX0P7080LW2z@$Ѝ \0 PP 0ᰀ00(0101u|8S>HHPP |7h'S000 (  0/  p' ; W00  . x 7G lwh'0  4 R  O0Q  0 00 0C0(0%3iPP3 h'00  0  ;X00  岀0  " 101G%0h'0  4 R 0C0(0p 101#RH L0S0P  "PPw]]]]30]c]]A-`p@P 00(0K0P 000p~  ~p@-`P@P 0; 0(0 `  ~pG-!=⼠p7p# 50`G@- PP1S  0 000Ѝ j0/ |'hR    0  + h  7~0 pw0S 00000   0-0  00|'RE00 0 ! h7   h72h7 Y0Sl7 00@10 @( #RH LQP  !PP嶳    N  0 00H   CR0C00(0p 0(00㲀0}  } }북?|]]O-@fMP|7h'S000 0 0  ;0h7  9)+ S09h7  h72h7|7S{hgpe_ !PUP0!2!   # 90 9G9S!  p L 90 96PSH(Q PU Q0CS*e1 S`0 `!  0{ ``` 0 Ⱑ PH!}h75h71 |  008 S0R 0C00 S 0S00Ѝ0`Ķ]8]@-`T1P!pR@MX1\!^0 X1\!1S 200 @E@a1 0 -Ѝ@ . ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 0 4`3V1Ѝ@/Ѝw]]@-0@ /2S/p@-@Pa0 6/p@m 06 08880 8077090(10101/* * ED0mE@-:@0S 3/ :S@0/p@-`@0SP0P    00T ,P1S 01ppX]P0/XP 0!/X@-@ '0@]0 R  8]p@-<@P0S,d@T zP@pZ] Qp@-0@P PS l`0FUp@P B^R <`0FUp$0߯c]h]k]e]C-1@pg 4!1000$Z4xX倇X0d4`FV`|7S S 0 8C:0S 3/ Ѝ0 a6/  K|7S S 0 a6/x3V0|'R/I032+ D3Q' h7  {1 C h7C 2 P@ qWX  ̹]@-0@M 60b1c2d3eI{J|K}L~S|7SV 9 h7 "w>0l!1@ABp7h4 D2! i  j9k9 0 g9!01"\0Y|7S!=0S* 9'w>0 02 9i9 00/\0n>|7S 93/1  |7T S499Ѝ@+x829009h72h7Ѝ]d]p7/p@-@f_rp@.p7/G-`Pp㬁嬑Mw@WAL WO WO10@|'RN 5) 6) 7) 8)099!  089 079(!%069059000N9 O)PQ R   00 opWPx8S  19ЍGl 08 @\ X 00D 0590690790890Ѝ@]]]H]]]@-h7#1 @  |Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@<]O-pM`0`  Pw0@0 00P 000 0_o`@T;RPPU!R:"R :"R:0ЍC-MP 0`p` @w0 0 00  00P 0 0@;?o2P0S R0 Ѝ0O-DM ,00`pA(0a0$  @<0P?PJ00<0$   a ,(>P900<0$   a ,(>P)0'0000㨐$ 00a,( < >P0$0h0@00 00a,( @< >P   DЍɾ]EȒE]G-SP Lo `0@4p8à St# 00000SW 0` 01`P1 0S`0 d`廪Ѝ@0@T@AJ0^0P0᳐0Y:0ꔚ6]@-  0 @!  Q3  4qt000 P1#9P00T0SX耖C@BC-P`尀p0@ A0 Rt0S HP `F0` 00\ Ѝ蔚p_]O-P@0MP00p1W;*0S`0 S00qp0少  A$0 t[! P p 0PQ`1P  0 SPP0p 0 0\Ѝ[ <uP 1 0CЍOꔚp]]O-@0pM00P@`,Py 0SP S P S0P0܁ R@*00Q:0S  4P 0 ≐00)  0R 0  D尩 A ቐ 0R 0 s0S0  P 0Pᕩ0S"  P PjP 儩@G}G_PJ!0Rdr X@Ѝ` `fR벰 0(bꔚp]]]3]K];]@-@P]@- 4,4 8 #8p Ѝm]p@-@0M SЍp@P` 00 0WЍpv]-$M840, (  0 ( $Ѝ0@-`plMT@P@ !0 0  ( 0  P0000C0 p0!000 0C0000 0d@S2 001 00@0&H0L 0 H0L lЍ80O-0HADM  0@ 00?PʘPpl0!   0 0 0,P(p$  `W<0  0 0 40P,P(p$  `D< 4 d @ 0   80P,P(p$ @`.< 0DЍ]@/0TEO-\F,MPp 圗0 0 0 姗0d#dh&hV *劗0 0 0 啗,ЍOd0 0S 0S*PP n0 0 0 ,ЍOw00C0F/P W0 0 0 00C0000`P' 0S S S/< 0$ 0 0$ G3"0ZT$S ((0, 0 (0, 3< P P  /,Ѝ0V 0 01`S0300 000 P@ 0S0S 04S J2{q @ 0SʠZ @T 0S 4S 0 SR0"0CS00 S Lq"@ [ @00墖004 0 004 孖30 R S 厖80< 0 80< d 0S 8,P`0 0TD jPc 00o@0D 0 @0D z0S 0CSQ00N0 0S0 T004 0 004 _3 !70 R S =80< 0 80< H  0SP`0 0  P 00@0D 0 @0D '0SSS0@/@0~]0p@-00@4S 3P1 00'R0 0S0StP 000 01S0H00``<2mp@ap p@/@0  BR/ $R/ #/0 0S/d@-P@1S `pv 0 @1j @Tr  Ѝ0S 0CS0@q 0S0 0S;00 : @@/l@-M 801S@J R  R 0@/@-@7 D0Q  0TS   ̜@* @/03!"/03" /L@o/!4! #4! B#4!0 P/60S/p@-@P ]!>000pp@-@`թP@P SpP/Sp@-@PP Sp@-@P I@-@ 0-p@-@P3p@QeO-$M`@P pP 0$ЍT@ @ ` X0@00S @T  k00S 000S00 0T 0010P` ` @Z 0 [0 T10P0T 10P ` 0T 00`0/G-pP@0`P T 4 06 S H0S 4 R30 hwPP@P8 0x00PPH0OZv 05 0p6 06_z`SH0Y 0S 0C @ Q*  " 囥,E],0/@- 0MP30ppp`h1@T @DTϨ 03  !5,0 , @ 0 Ѝ@# 0#000S2 0,0-ypᥨ 03  ! ,00,0 03  P,00,0,0 0 (*VЍ@̩E0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@ n|`pP1hSl l0p nADn0P1p00`0101S0@@PQq@-60!0 0 0Ѝ@-@Td$,d,lH,l $.` G-@phRhb@M#0 p00 @@u0A10A 嬧>   E9F? R 0`p!+0 000,`(p$@ @@ @s70 000!T1000 004,`(p$@ @ @^7 0!:0 0040@,`(p$@ @@ @K70 400'㸐!=0  0080@,`(p$@@ @`370 400MP!0 80@,`(p$@ @ @P`7@Ѝ]TEp@-PF0@0T@0S 0CS d ` R 0\0X 0S @T @DTLp@괚p@-`P0@TB2S D0CS  Rd ` R H000S\0X 0S H@T D@DTp@괚0S 00P0#///0  S /0C\ B /@-Ѧ @d0S0CSR$!@ Q \@D R 10S 0Cp@-P@ sZ0!S <S21p@-@]@Z@-@ B Q00@-@ \@@E0@s2p@-3P @s2S  D0CSp\ T T h T \ d\ ` T X TspH0S D0C/ᴚ80S/@-3`A0ASM;,p7PBT D@DTSЍ@%00S%F0 00oP0 R000 0003/PH@Ѝp@-M@`PBT D@DTЍp@00Sg0S 3/0000ХPYH@@-@$1@Qzp@-@P 4k001Pp0S 0Sp@ p@- @P88@P@p@P@A-pHQ#`P000⧖@PqЍ0 p 000!>00H `P \ P` Bk1S0 d :k1@0H` 2kA0, ,k(10(111i0@-@MPPEUP xЍ0@!>00 T ( P0@PS   (10C(1ʗЍ02iC-0@SM 3/> 0p3  nP 00ЍC`P00S0CSUV^V VY W   P `RPVU0S 0Cp@-@,0P `0,0E"Wt x0Rx0t 1x0 0S  0 00 R000zp@O-@,MR||`SpPp踰 0S YP R R0 00R0P00080S000 Y P 30Sڸ0003Zʀ !  , ! hp !D3@3 <34300  !ḠW㸠 00踰,Ѝ 0SP0 0 00Y00帰Y `P帠3 00 0Sh24d\0Q0d00\00 X0` H0403: $d0S00 0` 00\0X 00h0P 0# 2 U0```10S 0CS-գ 03 7 <pP,00,0. W-+P0S  P 0S0S  S r    R# !,  p3S0St00X%YV 0S PO 03/K0(O-<PQtM p!< R$ 35Q +X@ 0W@DlW<<W26,<,,0 S00<Q 3C5CQX U   ;W +W !BW-`S R R   `E  @ TW" h;W 0 @V 0j@ j0S P j!>d6"00 `0i0 0  00R 0`㿢BT D@DT ۢ1`tЍh:W 0 00 RVd  00 S^ H@ _Vh0 @ZV 0j| @j3 P jP j ᤢ0|0 X{ 0  tЍO00000 V @Pk 6060X`\00` 7``O` 9W 6C 0CW 80S8W1CWf 80 S`8W0ST 0j3| ht80AT @DT I@8@(WW00W0S( T1`@ 0S0Z @0W0S00}0SZ|00SXTꀠ0Z0SX,7,'WW| T$700 `0 0 `0pPeTz?@P7`o 0| 000?893 !>8eg000000VVP600 0 0弚 P3TEy& SM0050SE%SB00| 1 `3  3  00 < 03 P `P )T Y 0}@,0     3 PY0 `Y 4TE0t01x0@t010S ؀SS P0؀ 9JV EP0P0Yd0P0 PY`0`V `000d0尳 !0S` 0S ` ` Y%00 0 -`3 !0S P 0ST  fTR000<2 M} `@Y> `h0S 0S000PS 0 IPsZ V`[ 1 #/``` W003 P R0``0@Q 0S0|`W| Fh  ?h 0Q R0`1 0`Eii ii io] i?]iii@%iߖo?i@'id]oi]]!i#i"idʀ08 P R/ !  / !  |   O- MP@Dp `0@0@@P2ȟ1@T @DTO T100#Ѝ!>00  0 0`P H03H0BT D@DT$ ὟT 0Y00C?o20S. 0S+ 놟P@ ᣟT 10@0L0S H@ 03@@P 0  ჟ80S 3/@P 0Q&@- 0@R0S b$",0S R ;\00S 0CSX #  QM0/p@-`YP 0@0L0`0D00@0 0<0(080,040D00040,000@p褪EEԪEdEhE(E EE@-@-@/0O-,M,00S@(`@ @P 0 0 0T1"T00XS%X+ @P  00 ")a! 1 00 $a$" 1040  0 pP 0 F0 8#8 !0Ƞ$,, " 1., Ƞ4,< `8#8 !(R,B B8#80K0$0$0Y C *,ЍY 0 PP  v 0P0 0@p  V @ `PpxV`[P 0p0(0 4p*4 0Ằ 0!p0x p 0c8##4 Ib4#00 1 00 ! 0 p0 0`p@`A-`p(@P P PU@0 PT8 C-0@SPP @A0S`Დ;pp0 p0 @4"40 0 ^!W  0   0 @ 0CJ!0 P00 R0("( ,00#,0 Ѝ 0?p 0 7@-0P 4!4 8A#81C ! P,000000! R ݑ0  0  Ѝ0 0`( "4`#/03" /@-8@\c000P@P0SA-@MlPlpP@@ @0 ˓D` P0@@ @P 㾓Ѝo]4 0!< 04 0 (   !/\ P/0 !8 0 0 (  , !/A-P`@0p P!{ 0{0  {?;$2020S A꼚(E0p@-S/@@`ܜP0SP \0P 0Pd0 1@p0@ 0R/!&   zP 0R/!&   lPO-0PXQ p`H ($H Ġ)$Č 4)4 Ƞ8,Ƞ#80  qW 0S0U 6S 6 S0V,8/pQS/A-p`P@T0S0S6/@A-@PP2 R0`0p0V0C0 0XP`U0F1 A-P@T0S(#P` (`p0W Z#`pV (0@@-pDMW,8`P)@P& 4  O<00004 000040   000 lPUpDЍ0S/8p@-P@Tp0S 8`0P H R@O-` TMx@xoT$0'x0$04'40婒Q0UZS TP $P& PTЍPPP\V P ,S \ P 0V \ P0;/ 0$ 0Q  ;/P 0 R Q[QV [ ! SQ [ 0 V Q G-P,`X$0p0$0@븢! 4Ġ!Č*4 Ƞ8,Ƞ#80 1 !@T X $0S p 07/PP P  PVTЍ@0S  1S0@ A A-p `XD%XpD%DH$H00!1P03@@1!P\\ Q \\\ P0S 0S0 0S&A- 0@SP0S   U U2 P&,4"4 8 `#80 !R   0 1@&,4"4 8 `#800A&,`4"4 8 #800p&,4"4 $,$8(#8"(000`01S0 001@p&,`4"4 $,$8(#8"(0 000Ap&,`4"4 $,$8(#8"(00 0p@-0P0`l1 QP@P 000S  M0$!00$ S00,P(`l 0  000Sd09d0@0 ` R00@&P4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0Yp7pG-(p0@0SP,``M く ROd0" 0 0  0 P" P c  iP]d0"@0d04"4 8#8260S   &4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0&0 04"4 8 #8 S0#03 00P0pEP 0 ⧐P (00 0`ЍD0 X 10R@10S 0 9P/D00 X +0S 0 'P  (0R R  @!@1 0RD0  0 @1 H0(00 0^@-0S 6PS 0SQ@` 0S  @(000L0!P00!P00Ѝp0SG-0PSXM70S/30SU 0` R@( RK 8r R R S 0S0C00匀XC1#212(0 00p08wpP P1XЍsJ0S 0CS # 00b09P d0 T  1L က 60 0,P.<0+0SQ 0006l0S (000L00  00!0bPd /P /0A-p(`@pPL0S   !R, 00! hP o8p~0SP  Sc0S0 A0#l0S/@-40@0006 (01@@-0SЍwS !>00 000080Ѝ8@- <0b",4b4#  #$  #(  #< 墓Ѝ]p@-@0M SЍp@P` 4"48 #800ℓЍp]nQi< cbK7Q 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # B}ePpEp@-40 R@  000  8 Ѝ@-40@ R  000 s ! {ЍX0 0&-$M840, (  0b$ЍC-M 0P`` @^xp0 P 00 00 0 0@k"?o2P0S B~Q ЍdC-PMp@ 0` ^`0 P  00 000 0@<"?o2P0SP @TP@P T@P0.Ѝ T 0dO- @p`0SDM!  0 ,@P 0(p$  `& 0儓!0 ,@0 040`(p$  `% 0 0 0'! 0 ,@0@ 0 84`0`(p$ %0 400!2 00 ,@0@ 0 80`(p$ %0 0 0!#0 ,@0@ 0 84p0`(p$ %0 0 0!/0 4,@ 0@ 0 80`(p$ %0 0 0!1 0;0 4,@0@ 0 80`(p$ %0 400!h10H00< ,@0  0 80`(p$ n%0400 0 0!N0 ,@0@ 0 80`(p$ W% 0400 0 0YP!  0 ,@8 0`(p$ P?% XP<*1㋁0@0TEDЍx]dE4E,E0F00p@-P y@lh 0S Q 0P @@@040p@Pp@ my00d0 ]O-P|M@0010pC5#21 2 P 0S ;`|5 V#2!12 |Ѝ 00<` Z050Z РJZ]Z  <o(PZ  R` 30 єZ DJZ@ Z| YX\ !>00 ( P0 $}C-ᶐ`$M@P 400   0 IP Ѝ PP XXY @11 pqW ЍCz T)TX%XU d4"4` 8#8R* 1CS0RH0@0!PU:pWPX0\p JU:H @D P *0X0\T E0 @TtЍC,`0d 0S S :\|@0D 0 @0D |`Pdp03/@ꈛ0E8]d0 h\ 0SQ HP/P %/QS  1//8]x]@- 4odO-QpP00P B[|0 0 0 f|02"0`0S 0XA0C?o20S  0R:!R\2S2 HB5|0 0 0 @| ЍO  `P 4"4!8 #80CS@@0SV:V`!P U[èaPU@$0 P(P2(X2 h壎 0`P(Q{1 01  {0XP00 0 X0 XZ[ 8 #0 0 000 040000 0 0 000PP 6vdp]-$M840, (  0)b$Ѝ1C-MP@p 0` BX`0 00  00P 0 0@ ?o2P@@TPQPPЍ蜛G-M 0P` @pX`0 00  P 0 0 p@?o2P0S  0000 0P00Ѝ蜛0O-`,Ml@s ,0 {X0\ 0 X0\ "{ ,ЍOP 0S{(1,!0 (1,! {0 ` ,Ѝ!>00 `$`02z0 00P2zz0 0 0 z0 0$#$ (0"(DRD PP P0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00h! 0 S0!0m X zX0\ 0 X0\ zU, 1z@ @ nzH L0 [H L ` d d` pzU` 0 `ezU 47X (X0P H0@`>z0 @0 0 Hz@11@-!>@tPM `0@@"zp0 :0P+zЍL000!z1O-=|Mm4 k@P=|ЍOsPX y 1$!0 1$!y,=D@0S S y 1$!0 1$!yDy0 0 0 yD0 <   DPy0 0 0 0SP@0@S y0 0 0 @ATy 0$ 0 0$ 0TPPD 0Sy0 0 0 ;`( "$`$"",R a(!"4a4##<S3 D1, @000@S Scy0 0 0 3 :0S P 4"48#8THy(0, 0 (0, eD(S;y0 0 0 X Q0(0 CD D0;00 000E0P(0DP 0D0y1!0 1!40SPDG 00001S0`0 R P0D0U 00400S D0 @p0,P0$800010C 0 0STz 90S@s 0dPPm  d0D0Z Z\ 0S@10 0 0SRQDZ Z 0 0C 0PZ Z fA0d00e070S| $0S @E 0S [@@D 0h08<d10P0<0TZ.@0 TG0nx0 0 0 yx> 0R*+Z 4 v0P $0U$0J* v0$0@K@ hUZd0P00$0  T $0Sh00000@@@T@hLP LT @ f@0d00e0,0Sx 0SJ Zz 0R: hT뱌d0PJ0   T Ɍ0000,0= hLP@i L TYF 00C $RYFY0 #"  02R0; 0IS  S> S! @E@/ f/@0d00e00 0S 80h0][0P x0S sH @H&S000dU0 IT \000 f?0d00e00 0S  h2T!d0P0 > R@T 20S@0@A@@$0pQ201S 0CS# 2SD0CK 00SG =Pi.wX0\ 0 X0\ K W T  X (  (  J #G0  R  Q W7 h W4 ` W1 X W. R+ H0S D0CS@p#@10S (0DS 0 0svX0\ 0 X0\ vP004 S ᠋000S D_ PD0S 000010vp0t 0 p0t v,0 @0<01# 0D3/l18ě]O- LM 8@Pp J0h (`000p,P$@ @@ @000 (0@04p0@,P$@ @@ @' 80 004 ( 008p0@,P$@@ @P7 0 00(008p4P0@,P$@@ @PX7 0 004(008p0@,P$@@ @P74 0 060 0(008p0@,P$@ @P0406 0 0*0(008p0@,P$@@ @Pp040H6 0 0=0(008p0@,P$@@ @PZ 0405 0 0H0(008p0@,P$@@ @PD 0405 0P0(008p0@,P$@ @P. 040P5H 0\0(008p0@,P$@ @P 0404 040h0(008p0@,P$@ @P44 0w0 (008p0@,P$@ @P040T4@ 00(008p0@,P$@ @P040 0 00(008p0@,P$@@ @P0@ 040p3 $0 00(008p0@,P$@@ @P04083 00(008p0@,P$@@ @P0402000< (008p0@,P$@ @ @x0402 00(008p0@,P$@@ @Pc (040  D08p0@,P$@ @@ @M1($0000D ,p @ @91$0000D ,p( @ @%T1`0D 0,p($@ @ @` !0@S50@ T0 0@T 0h@RMuX@0LЍ RPP CB! ,0F1|]FКAGF̚ȚělF(G|GG].Ԛ1@-@p @l A-pr@PP0S PP 0 0100a10 `0 0 0O0 0V *0HHQ0C00 B@-@0ST 00 0 /@-P(0dp`LM @ @ 0 P@  0 P@PP"   0 (02,0(0P@ `"0  ````(0 (({LЍp@-0P@s1 01  p@s103!"/03" /p@-@`8P,@P Spd00S @-ہ P3<8 #8!R "00 /P/0P7@- Ѝ0P @R R00P0S0A-`Q00pPg8'#TgT%%< @P@VP\MX001S 0CS W @#RP 0A-@M`p  XP<@P%0 R@ 00S,UP' ( k;!>00 0@@PPPP 00@ЍHP Ps@~UPᘇ1@P P00XኇA-@ PRp   tP 0SRN`yPl1;P 00b0\ Q FO0 0!0;0: 0!A-PS@` pPl0 A/4@]r8!< 8!<hr91hP/A-p`0PPQPEU `f @ T T@ @T@  N0PEpO-,0,M00@0104 4`Q : 01 $000pBpWʴS r0 0 0 r(,Ѝ0000 000000#![< 0Cf 0((04"<00 00000@ 9 ,0@0,0VP *0C SURq0 0 0 q0 0 0 7P)UPP(Rq0 0 0 qV7PPTt70P000010 00 0$() 000S *000 0-0"> 00$ 000K1 08#80$!$ ("(Q: pB$#400  ( 4"<0 0zP 0( 000@  xP9q0 0 0 Dq000:, ,0@ 0,0 00800`P@18O-QM00@ذ (0 Pp `G4"48#80SY:00(@0000NC10@00px0| 0 x0| q0S( a900!>,00000408000S 0 0S 0 0R 5$@Pn@Pi,PP,0 0b mp0 p0 0 p`(0S004 3SH0L RP0/P Z0 0C000000<@0 @GM(0P 0(0?M000$#$ 8$#, kH0 00@V0g0 00K0010k0R ``P[Mp0 p0 0 Wp3P 0LP [p8p0 0 0 Cp@0000 0^PTp @z0qS>q(0[     Y Z p0 0 0 p0 sR 0 W [U PR LP dZ`o0 p0 0 o@0`0X0` sR 0 PP3 P 0^PT@P H0S Ypo0 0 0 oAP@0D 0@040 D 0  PW0p/Tl@PY`o0 0 0 op`0H4PS0@0D L`0@00 @000D 0ppW 0P0X    J0  #RV  3Q 0S# tPP XVo014!0 014!ao1P80S t80,3/PP tz0 0t  AP* [ 0S% (LPP 00S1PP ,0 ,00,000r0 , 0S 3 Vo0 0 0 o(PW ` 0RX L$PЍ 0S80S W `w80,3/`Pr `p0 0 00S Un0 0 0 hU6 3 lUn@1D!0 @1D!Y0  8Un@1D!0 @1D!n P @4"4D 8#8Q ( %0%<#*Tn@1D!0 @1D!n(P( 0<00 (0(DQ ,   40#0 @0A IV Wp 0 ("50 @000vPP(0ScJn1 !0 1 !Un`J`0<  )0 !><0 0 ` @0DPHP4`P/ 0P+0S( 0#p# 30S  tP3#3 1`00t0Ȓn0 0 0 nWpMpp3 20S ( ,0@0,0 (4"4 8,P#8S G04X 0R0  m0 0 0 H1P00,0 @ %(,0@0,0 3  10S |10S (,00,00 ,0 0 0  /P%3  10S 00S ( ,00,0  (VPP((Q Utsm0 0 0 ~mtU J(0   0, Pp181$e]ě$C-`!.p0MP00  @S000005TЍ0S  Sp BS0S 0 00000 000B00SQ QR I0 TP R 000*A-PpU@(M \ePP7@2 000$30P0# 0CS0 @P0S@ `0P #Rᢁ1@0S  2R`V\e`(Ѝ20ጁ0S0@0 P@ 0 00S"00 0 P@* Q& 3S#`0VV;@ aP 0007@00 0 4 ^ R `1@ 60@ 0S 0 EP@`0  V1@ 1 0 `aR0C000 0S S Q ` -@V]s@-0@ SP& S) S- T 0S000 Ѝp0S`P 0P0@000ʀP00P 0  00O-,M00P`Sd@ %S 4RN *P PG0$0CS00hP 0h0[5 ApP7,Ѝ  $4 [ 0Z'`V&[$ZZV0WH `F` ,R0 LH`hpd@(V ?H`pP0`#0CS000000 CR0ŕ0S@@0S@@0S@@0S@@0SKKj @1!  1O- Pp0`@DM!  0 @ 0,P(p$   0!0 0 040,P(p$  o0 400!'>o@0 0 80,P(p$ ` @PFWDЍ]p@-@`M0P0@@ @0 tdP  <@@T 0200 R00C1 2"Ѝp@]40@- ZPBA@A-@70"0R S  B! "2 2R'2S0p`P"0#Q00S qPP@UP#00C?o2PA0țO-Mp 4"4 $,$8("( H#8! CQD0GBi0 0 0 FCSC 00 Z V`\ "(?AT0&i0 4化 0 4(i u`PE i0 0 0 i8z Ѝ R:Fh0 0 0 iP R\ \ @ 嘕0`R h0 0 0 hhF Q 0 p" 0 崡10T01A0000W2SS}$۸@Px 0000 001<00 00 0010 !0 00001S0@0AL4000S0`0 ``0p `V 0000S0  !Rkh0 0 0 vh0`X1p01W 0 !1Rp00ZY !ᲁ!HX ڴ!X  !( !! B! RA10C100C0*h80< 0 80< 5h u 9!AQ ڴ! Q Ƞ,Ƞ B! RQ  p t! B!  B WZe 0R ` ``d1S V0 0}1`p[ |0R  B   B > `  tX0- 嶀 q0(t"|p   0 ! 0 1C00S,00V(`8 g0 0 0 g-00  wt  P  01-//-/-/@-@MK-@-p00d0@ ` P d0 (00  0 W(0 &0S(S"  Ѝ1M  @-y]@-y]p@-@PG0S 0S 0Pp0Pp*P p!>C-@pPM0 0@@ 0 4!4 1C 04"40X1`V T, 0p Ѝ0S0S S0S  S0S ST@`P 0 ], 0  02# |0R0@l@ Efh0l 0 h0p0l t 0Sp0 t f]bF1-/ 0!< 04 0 (   !/\ P/0 !8 0 0 (  , !/p@-@P<`0{.plp@-P`@1pp@-P`@3pp@-P@pp@-@`P000pA-P@p`0`0S ~S 0S/@0S@00"@f1@p 0A-S@@pr0`0S ~S 0S/@zPᐹ0P d0  0S z1@=0z0@0p 0O-PplADM!0 (p0 00,$  P`+  0!0 (p0 040,$  P` 0 400!d0(p`p00@ 0 080,$ p @`  DЍO]p GG-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 ~l]TE@-p`( PSQMp $ @-0P PUd (0F0S* 10H   CR30C0000Tr 0(00(0 0 () $   R  h 00` 08 PЍ#RH L0S0P  @SASC 0 #RH L R    @P+ 0( R($!, $!$ 0S(0DS 00 0 0`P0 0d0 0 0 d7Pk(P PP81G-@P`p1U0 S8@00S# ~S! 0S/@0S00 @S9@ 0  %`@pU00001/1@p s@-aPU0@ QPd B% / P pP d0R0;;d0ЍpU   Ѝp@3P P\RP d0R00\d    t  0`( "4`#/@- 4"4!04"41@- @ Ѝ 0<P   /  (Ğ G0M/ X1M/ p@-P`8P@Pp0Szp@w 0!< 04 0 (   !/\ P/0 !8 00 (  , !/@-@0:0@@-@0 :0@@-0 00   00gЍ_]p@-P!i@pp@-P@ jp@O- MQ( P '    @TS   RK 00 0 0R010 0! R010A0;S@T 1 R00 1`@ R00 0`R010 00C 0 01 0 i Ѝ HR@T  R1 ` p @0V 000 R / 00 000 R00 0R010 Wp 00C 0 V 00 000]s RJ C\`C^L&\@Cwb! ! !$ !$|b  IW `^K<\CQ B C0 00000 SD0 000 R00 0R010 Wp 00C 0 1 a0R*b1 !0 1 !#b   0 0H  00L0CS@`1@0 pWpP 202a8!< 8!@!<D @![D (!, (!0!,4 0!40a0T0 @0S0ppp@ 0@0 00S0ppp 0H̛G- @`$pTvP0P= Y YH nv,  Q. Q Q 3 ,10S  0PR00@ 0@ @,(#(0 4 <8#80#Q0P @3vWa0 0 0 ba,0 Q Q 0@ 00S  0 h갞HO-@PDMpp4UXDЍ`0V V X `XV0CS0V  0 ;S0000 4"40HPV 0 ;S0@000Sg1h0 0#2S S . ,L . g!0frg. r V0 0= = 0 ;S0<00h1h00l1V 0 ;S<00S0 <00 <]i]s]LȞ@-00SJ@ R  a``  B B<00C0@0CT s]A-8AP`p`80< 0 80< {`PqW: AAdpT1WpT@dCAD@T@0PqTA0S 00S 00S01S *0"PX!AQ1DAT@1T0@#H1;@0rAPqTAHh`p\O-CM0O0 0`0 0 0 ` X(0 <D0< 0`0SP% 0%* h04P h0 QP%*8rPU _1!0 1!_Cߍ PP 0P 0#2S S0 00S00 ᦵP0d#d 0h&h`F0P0000040 0#21VS(000%_1!0 1!_0S 0S0S0S 0S 0(``F 0P0000(0( R`F 00 RP 0 ( 0P 0(  QxPPUy (00CD0080D0 S  0Sw<P  0@0X0m\j8@`(0  0  00`0P@0@@s00 S000P 00 pP0(_1!0 1!3_  pP0p 0h0e0$0e0 p00 h00mpPpp^1!0 1!_0 D opP0^1!0 1!^;0S 0 SZhp%   $ p4"4$!$8("( #8 Ipx:xx P| 0080f L  @ 000$000000 00mpPdpp`^1!0 1!^0 =opPO0K}^1!0 1!^T90S 0 SZhp . jp.$ fp p4"4$!$8("( #8 . . 0@ 0 @HX3 001HS00C8@ă#8"@ē1V0:8Sx'^!@ ! !$ !$+^p0`F001X00C @ģ1V/ w^X1\!0 X1\!^_ 000 0 jS  0Rk(w](!, (!0!,4 0!4]p0 0HX,v]H1L!0 H1L!]]] 0 0CS0S5 0R1]`1d!`h0 `1d!] (p @  0R6 WF9000 00 00000`5 P000`00xy0P0p 4  000 3S0H L0SP0\ 0:X0<   0CS00S0 00040 :Ap0060J R0 w Su 0 hPm xi p@Tg $ d13$0(40D1;S3`1y80S X00 00D 080  0" 70P00SJ S0703\P2T"0P22 T"\@ 0!0CS103/XQ, ` R 2000Cp!0C,0, 2R , ^0 SQ h!\00CS !0$< Co\P  P0 PQ t0CS,20l1\0h1V0CP C\|4!$Rx:+Ru, R0C HQ L!0CSڤ10C(q0``Fh\1x!0| x!!| 1!g\1!0CS0X110C10    BR901! Va0 BR1011 01Rh0S H] 0] i]]]Л\̛H?`D]LR]H00SH00S$0ppܱPpN \P 0 p$@p 0R00S 0@oP @[1!0 1![ >o$4RX00D0 080 0 0h}P `A[1!0 1![@` 000d[X2\"0 X2\"8NPc20ZPy0Sv0 0Sq* Pm0B @S0Vg<0`r !$!01h[1!0 10! 00 0 00/ g[0S `0S !  @ 0l1\0h1)  1R ;.0CS 0aXP1T!0P1>/T!6040^;QX0 0 0 \Xo=00 0 !0R0000C000 0  0T R,;S+ 0C8#8S_ 0BSH00#V00Sn 1$ So Xh1l!0 h1l!XP 0Q/ 0;`80  BR0!0CSlxW0 0 0 W\0`0`SY/4!40p 000C17 ;S;08C8S; 0  10C0CS103/P;S41,041jV0 P \1  BRm103/0(0( 010BS ڊWp1t!0 p1t!WU0404 (0pC{Wx!| x!!| !W,0SC H!R 0L0CS86A 01R81 03/ W91X0C10 00    BR901!Wq0 CR 10 BR!0 BR1;P%0CS908P(50!10CS0X110C11W0#4 500( 50C01 0S 1  WQ 40?0] 0; % 0S 0;841I7 0S 319V!0R1$ S *sV1!0 1!V$0$ 10101\1S$05\150 0 !$10BS$!% < S <0 W0P00J l 0S0 Bb; S1 00S220 0S010;0 0;E821211 uPFj00000`0_Vx p>W  R0Q^:@(Tf ;SX 0Hd1R$0 d 010S h0 h0 0w0 04 S0 ,0P0000  hl h00S!>6 l 9&00090 S   hKH̛LZ]\Л@-0  0'S(P L@U1!0 1!U$0 LH 0`( "4`#/ 0!< 04 0 (   !/\ P/0 !8 00 (  , !/@-@0:0@p@-P!T1PB1AP \gX1+8T@1D01@ xSx0 S 0; S0Ҳ;p2] ]\O-0M@S 0 S/p`V 0S?(<(PFP p( !R `0d  Sp3p# RppWO^hPPC D0S0S0S ᙍ PEUڼ; 0CS0!0; 0CS0!Z<0 0 0R0100 Xʰ\U 4}/00P4%4158s/00P8%8150<01@00D00S_ P0Se P.P%p0'T00Sg 0 0C1!4!R4!480P00L00T000(00 :0Py  10S00(|! (  0B00  00!0CS41a-V`!;p00\00  ;SP0PJ000S Vo`0 Sȃ0Sq0P i ;Sf1S PC0 PE 3Ucڠ!410\ 0C 0C?SPȳ(̟0S" 0  0 !!R: !BP: P* B R +X 0S1 P0;00UA(0SP kUP!.0PEU00(00H00S 0  000CsC Q$1S  A0CR0U,0 0U'1  @0D S 0 0S*0S\1U*0!00C ? ,0Se:, 0S 1,1 0C?SR\0B< SQ 0010CS  010CSP]P8YP90%pwHp30 @P&QR P0S0S0S0s  `201S`PpU1S\PE810P H0Q8S(8&0P H0 8(@0D S8D!00C S:08P0 RP 8P0STP 41R1'!0!0S01Q441q0\=0P0 !41\PRPePe1 _APBQ0CSP10B P0PCU000AQP18f0;V PF03 PE UVX0k80P Po0H00(000S4 P08~P, Y( 0S(0<080``0 RR PP  K . 1`P0H   0% &$!$&  @ f1l`hdX50S?`0`d 0P p(WA00 005`p1`Fh@1SI ` [) 1$00p RA$  p(WA0|a   0000`K |aa[%`$ 6 `)V/5p0S 0 00C00 0#{ Ѝ1 @a0 40K0 _0  W `4000:80U040<3 Q00S0U0S- 0 0 0 2QpP 4 00S<07bQ024"0 024"Q p`)V00/0CS202000000 000000 0 Z00400 P 10Z1  PH!d0QAQQ0 3SH L0SP0\ 00<  0CU4 00 0000 Z 0 S 0 0$00 ($ QbT c0 dPe82]Ȟ GN]8b]L\H]Q0 0 0 0 80"QpP@ t4 00S$!0 P1 0 0 0 1 0CS0 0 0 0 0 0 0 00400 80RHzc8 - Q pQ   AQ U 0 BRU RZ ȡPX"\ X"\P ( @0% 00   V  `L- & " <0,"!R R 0 ,e!@ Q P00S",0(!Q", " "! BR ! 0R !$!,!  00 S(0S0 40< ,00S000S00!0 CR001H1S3cL0H1%P004 0 004 0P` P 0R 0!S S{ 8 P  0;t40p 40` 0(`Sy8d#l$0`(`0Sg0$ 000 000Sh!0 R 05P Pps 7P @0@2PS;S> l   '8t P0S 040Q: Q6 @ Q1J0 A\-Pap Y+ U+0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ QA0 B^0"A10IS1夑S CPP +0p IR GQ PUGPIQP0 CR 00 0AS0PP 1 0CSQ0p CRpp P0CS 0BS0 P 0 BQ000p CRppꠞp@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/@- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R ^1M  H0MX @@p@-PUp@`z0P 4 )n0Pp`d  H Q1Q44!r010p@p@-PUp@`[0P 4 \W[0Pp`d  H Q1Q44![010p@@-0 u&脽  0!< 04 0 (   !/\ P/0 !8 00 (  , !/@-@0  :0p@-T0@00SDP@T_ vT$3Sp0p@zI84]F@- @ FA-0pS@ S P0S S0S0S0s0S0S0sT( PU X( < 0S E00ePP   (  0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8S0SPT0(H 0$ 0 0$  00!/ A-p`媢PUA@T P P (hH0 0 0 (sH~0:0aPl @-@01S001 0SfC-0`S,M(P@%Pt!0@ S 0\q\1 00 DLS<10S UA 0 Sp< ( 0R*T ,Ѝ  0LT0!  00VP6@ 00dSP`00S H00@ C3SR p0/]X]0*H0]F0S,4! x!/@-@0M G<01,0 00 0R0Ѝ FX]0@-( (0 ;NЍhF0P Q Q@\ \2SQ Q @00P1Q0 Q(000S@080P1/G-P0S`(A``"0R^ !QOd2S01q= 1O@T@!A0S(UXA``2SN ̐ He*P<dBT@pp 0;PA`V pt00KT *0D!0 T1GYh"R l2S0傴Pp2S<0h2S lBT@GPpBT<@\]`p@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 X!F1T1S01S00p@Cz@-@tM0t2p S% `0PS C     82tЍUF @-0S6& ЍS6&&Y]0b? S /A-@P(pT0`8@ TL3K@D0S@D0S~@DV x0|  0T@ D X0 P1XVL 0   @T8A%815An`0S0 S(00 b/ R /0SA-0`S0MUPSPQ 2q0@S0@?oR20S@Z P0@S PaQL L0 000 0冿P  0 00TP! Q U0`0@S010@Sʲ0TT#T1X%XS !0P90D0Ѝ  10CSa0Tw00000090P4 W R0( @Q+ Q 0p00 0娽P00S @0G3WS "!>20 2 0 $080  ɽW 0/l]0FTEp@-0P@(lE1 01  (p@uE A-8pP(`@ZE1!01@@(AcE  0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B =0C=X@-@P 0;@0:P@< 04 \3\# i ]\ FO-m0@SM S( /`P@$00#.0#A0@.H>@$00#| 0 00 PU `0S l&P  &PPX%@-0@ 0@00 00@@!G$$00S@ Ѝ]X%O-4b@=PS)Q'Qm0S S8 > t00#.0#8.> p00#`: p\V 1  xQ6B1!0 1!B 9 W00;f1S 0 0A0 0g!P00@0@00=0=eB1!0 1!pB ЍO-0R:SB1 01]B 0SH 0 A SS0!\ 0 X%ОHA-P`ATAAp@O-H0L 0 H0L >>Q<>P0T 0 P0T >PT1X! 1C1S01S01S0# 0 1S ;S>0 0 0 >01;S"P!T11T10P1000110H1;S0;0103/-_lhF0H ]\p@-@Q勘0  p@͘8 P ;` S0 D1 B00R *PT11XC1S014cR ::>x0| 0 x0| E><|,>X0\ 0 X0\ 7>0000lHL؞@-@aM@0  Ѝ@聘`pP HQ>`0d 0 `0d >;S6S00 (  1( 1S D  B0R#*=h0l 0 h0l =00  B !  'x01:T01=p0t 0 p0t =<lHL\p@-@Pؗ0  p@`UP 01; S !R D0D00CR:001"lL\@-T@媗KH 04004 000@0lL\x0 R   R-  R   R   R-  R/  / b /؞\gfff@-@0 Gp@-@TP]0==09#9S p@蛗P 000l@-@8`@0S-//A-P@ap1`P1!`mk; C("(R1S00 111N; SQ0A?0A\C-MP00`0p0 0` @ P  0`  00 000 0@?o2P0S R0 ЍO-M0l4@3`rXVP 0 S0  J@DT0V0 00p020@3壖@`T0V2|p3ߖ+0 S0 00(0 00002JP -(0@D00S Se [030#X0S -(@^P 3岖 ߍ(0 @ D  H d L 1P0 0T00S0+0X \00U(!  (@0 ( !( 0 `d (t0T0l Sh pq xy!&^? 0|10  @J0 0( 0(0 8( 0(0 @ D  H d L 1P0 0T00S0+0X \00U(,  (@0 ( !( d0 x ` ( t00 lqh  p &'T0S^0yx1&^? 0|10P0  @J\0 0( 0U(0 8( 0N0 K =00Hs }@ l-$M840, (  0L>$ЍH7@-PQ@ PP PF R #V]P Ѝ000@-MBc0 Ӵ0P (P W PU 00 00!0 0I@P5vЍ Ѝ@@0O-GMp!Z`@D1LR @Gߍ RP@ S @  R!JoQ 婒[ PR 00  0@_ 00!L> 004p0,`(p008P$@ @_040> 00!$0 0,`(p008P$@@ @H"040= 00!+0 0,`(p008P$@@ @1X= 00!/04 0,`(p008P$@@ @= 00!?0 40,`(p008P$@@ @040< 00!P0 0,`(p008P$@ @ 040L< 00!Y0 0,`(p008P$@@ @ 0 !c04 0,`(p0H08P$@ @@ @0 400!h0 0,`(p0T08P$@ @@ @0(04; 00!p000T ,P$@@ @0 (00 !:H0z0$0T 0,P @ @z 040: 00Dʟ!0 0,`(p008P$@ @b<: 00 ɟ!0 40,`(p008P$@ @J0409 00!0 0,`(p008P$@@ @30409 00!0 0,`(p008P$@@ @040(9 00!0 0,`(p008P$@@ @0408 00ȟ!0 0,`(p008P$@ @040x8 00dȟ!0 0,`(p008P$@ @0408 00ȟ!0 0,`(p008P$@ @0 400!00 < 0,`(p008P$@ @@ @040d7 00!0 0,`(p008P$@@ @040 7 00!0 0,`(p008P$@@ @x0406 00!0 0,`(p008P$@@ @a040\6 00 !0 0,`(p008P$@ @I0 400 0 0,`(p008P$@@ @040H5 00!05 0I?0,`(p008P$@ @0404 00ğ!K? 0,`(p008P$@ @0404 00!M?0 0,`(p008P$@@ @04004 00!= 0 0,`(p008P$@@ @0403 00!S? 0 0,`(p008P$@@ @040x3 00!V? 0 0,`(p008P$@@ @0403 00!Y?0 0,`(p008P$@@ @p0402 00!>0 0,`(p008P$@@ @X0 400!_?0 0,`(p0P08P$@ @@ @?0(02 00!=0D000P ,P$@@ @)0(01 00!b? 000P ,P$@@ @080\1 00 !D0 40,`(p0H0!040 0 !0 0,`(p8P$@ @ @'040<2 00!0 0,`(p$p008P@ @0 400!L0 0,`(p0 08P$@ @@ @0(02 00D!L0 ,P$@@ @0(0D3 00L!0 00,P$@@ @0 400!X0 0,`(p0 08P$@ @@ @0(03 00D!X0 ,P$@@ @0(0D4 00X!"0 00,P$@@ @0(04 00X!+0 00,P$@@ @w0(04 00X!10 00,P$@@ @b0(045 00X!80 00,P$@@ @M0 400!I0 0,`(p0\08P$@ @@ @5% V50`p 050I0I0\ 0a,P($@ @46M 0<0a0,P($@@ @\ dЍ 0!< 04 0 (   !/\ P/0 !8 0 0 (  , !/G-`V@b pP0S@QN  _@0SUQL  B@PB0S0S0s0 00P> 010 f1 SRBAk30 0 0 30;0`1rf 0@ @P a @@P T0S7@S=0f1`H\G-PU@ p@`R000S S @ ᫮@( @@P0S0S0s000A-PU@ `#0pS 0S Q @@P Q 0@; m@P p@-@T P0`SfpSf=pp@-@T P0`S=0S:=ppA-0`SP@p0S9@@+0S ;2XR* 0RE 001000@0x7@A-`@pP&000S S/@X=2D>4c  彪@RPl00S p@-P_@5@p/0S) A-@P`pLT0S1@ 0 `1 &!#00a!0 `10#`11<1/A-@0S `pTP 0S ki@X=@0S p@-@`1P ,p/A-@`00p0S 0S 1;10;0PPlPQ01 1PPQ7PH0PP [0 1Sx010G-p0M0@`0S6@ЍZP V V @|  @  .`Y`r Yt3HX0@P 0R000$@P0S@+S; @P@T 2TA @P@T t2TA @P@T (2qTA @P@T 1^TA1HXg00 0S;   ; 0= S00 000`0`S0e00d10200q0 000?D1 P@@1T#3=P012|=T0814X0 \ 1 l0 1pp|00t00 p x02000020201111*@ T]\[]X@-;@SS8#8S TS0 T @0;@0;;S0(P N; S Q 00?0Q S0P 0PD00  P $00  P \;SYp@-0@(P0 Qp@s@P ip0S p@-P-@p/0S/p@-P@p@p@-0S@ `@Pi@P <@pO-QM⸀ 0S S4 Ѝd1p`1`\1@X1P 0`  0 0 00  00P 00 0 00?o2P0S0S*  BR 0p0`0@0S`` S`V WpS0 0SPP/CjRP#US@@Ӗ/CjR@#TК̚Țd]|pxt@-0@". /@ |]p@-@\41P! P301108480pp@-@\41P!r 00P300x104Q88Q0pp@-@04Q8!0 S 0U0C:x!0S30C x15x1%d!d02S414pL R 0!QP!U:04 ꬞;S/0H @-0@0@Tw (0S w @8]A-;@S0;)`! AR80;p4Q H0  CPPPw 00!0C,2#41000ЍA0404Q0GS0pP0PE<P4Q0!81 BR<10041,000x10   10BS!;S0;/814!R41,000x10 / 10BS!/O-4!81PR$Mu;SrP1200m 0!aq?A3c 2#!0C01' A}t14X6' $A$A! T@T(#3#  p0p [(1!20  0 [@ @0`FB`Ad1 #<S01R4!41$Ѝ 0 0  0 0$ЍOMb̫gfffA-p@`{P  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOV   X]LO-,MBP $X 0 L0 0qW `2`P1!0 1!N0000$0VZ0 S:p0*b 0`& 0 0$0  d1d ! 0!!aPPL 5PB  R;#0R7#0R3 D P- 4 P'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOJ   X]O-$M@ZPP $ЍO+10`V 0 0a0`2 Vz 0 r08800000W  S R  Qd:f"` 0'O 7"0WIt 0 0 00 H1 !0!!PP4 ~P3 E R$#0R  p  r0 C P 1 90C P 190 Q 35 5Uyv   p    4 P000X](O-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D0 P:~ yPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880[000%0 0%00S0 0C00000 00 Ѝ0 P:X]\< C-M@pP `؀0S  S*Ѝ% %0 0R z\UP RQ 0RW0 0 0 P0 /p@-PP@p`0@`TV@@Q= @%0% P 0 0%0P*0%0C0000}>N0`0"#0 0 `/0`2Q 0S@@iV0 =A0 A 0 Mb@BA-P` @|pG M @I(PU@T D0D 0?8cЍ 0@0$@lL\gfff40O- S@Pp0$DM0aV[: R7 0K 00p`00! 0  "  p 0S' pW* '078!800$0#1S<0P%1P%PDЍ00aX]p@-@P!t `0D0034 0 0 %0 0%0pp@-@Pt `080034 0 n0 f%0 0%0pp@-@`?PPpP 0V 0 10 V& :p0% 8 4 &#&#(    % ( %    % (0 @10(0D`04`06% 36 3(00000%0(0% 0 000%0e 00#2%0(0@10(0RO-@PlM3 $00 8%P !  ( %qp P$ 0`@  KPP 8<% 0 ! ! % 0 0`48(0@$00$0lЍX   %`0!&bPP` 8<DT0 4D0%0 010102%000(0C-MP 0`p` @0 0 00  00P 0 0@4?o2P0S00D DSS  S00 Ѝ萞@-@ L101H00H0101p00p0101000 20 2000800 u$00 ohG40!( ( "P @@ /-//-/-/@-$0$ H0$ 0(\-$M840, (  0( $Ѝ\@-5]@-5]@-@-ۗ1M/ A-P0p`09@P& d0 0  0 ᇠ 0PP@("004 0 004 (#Ѝ\@-@(0((0M @X⻺@-@0S 0S <剝P0 0  0 夽P \-/ 0!< 04 0 (   !/QA A-P,p@`|x10 00S S S ,00S @$!,0( "(0P x@(x"0 0 0 ("Ox3 40 0S 0 ዺP/\\ P/0 !8 0 0 (  , !/A-@pP` T@PQoA-@`pP @`p@-@P<`B|0吚7|Kpl\p@-P`@=pp@-P`@1pp@-P@U'pp@-@`P101 000p1S/pqG 0O-@`pRDM! 0   0p,@(`$  ( 0! 0   4p0,@(`$  400 '! 0  8p0,@(`$ @ 0 !' 0  8p4@0,@(`$ @ 4  0 !1 0  8p0,@(`$ @ 0 !; 0   8p4`0,@(`$ @ 4 0 ! 0 M  8p0,@(`$  0!` UP 0  8p40,@(`$ PDЍO7]\p GqG\ 0 \ /OwG-DhM (` 0 0 0 (  0Sp * 00P  00 Qp%p *Tu3W ( 0 0 0 ( hЍ  P p 0S 4"4 8T"T#8X%XU ( 0 0 0 (  ~S A0  PP !> 12! P0 P $00S"(P,PHpWh P 0Xp  L0⡣P L0 Qp%p :W 00USx 28 Ⰳ&0 N3T⼄&04` 0L 0uvp 0(P\j 3 (0, 0 (0,  v$^P2!0$0孙PP4( 80< 0 80< ($ "$TPP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX  0$ 0 0$ ( 0 PP P\3]@-0S0SP0!0@SP R \`0  0 0 00堗Ѝ 0ח0l]DsG\TEA-0`0P@"Xp X/@0S  N0S  ᄳ@ЍV0dS*@P坴@P0S S @d0Xp0 0A0CS0 AAQ  ^0 V.QP00C S0 pApGW0pC-S W0ApCW 00 PR0 B <ǁ@-`P@M 8p.( .h`' .' `p0&Ѝp]0@-ASS!0CS0Sf B +1QA 0 0 0 BA 0 0 0"A 0 0 0 0A 0$ 0 0A (0, 0 (0, A 004 00 00 Q QB 0 0 0 B 0 0 0 @Q Q Q}B zB wB tB W.]1]O-M @0(`PPlpPX T60SH60S  0F00V  <⇘P 1  Q'ZE; 8$(0 8$(FPߍ0P0@`0 >h P9hP 0S!00S 450S  .'%0&0S 40S  .&0$0W0&DPC 0$ 0 0$ |40_P2 0 R 0S ,40S 0  $0O&H  0P0! 30S .&0  #01&x30S 0  X#0N@0S ,30S 0  } #0^z00@ S1 Ko0P [20Sy  00 ]"0nZ0 ((CTTPL20S 0  E,"0%P@ R" 1050 00S  10SC  .7&0  5"0!0C00%-0+0000UP[?DD@n喐410SS~n  f{ w  r0086lBύd`0p0 0wP hb]PLn<0Bύ1]Wܠ]<1 GO-PM'U@50S xx50E00(0 001%ኔV(UM p0( ې(E0/S0㥔@PF ( pT((0K0:00p\(`)2P440P,0( HDP PPPH0 p,&PHKU! 840S .p^% Pp0c$0/S0^@PЍ/PPL 0`00:00pPW |1000p (P( :0,PR0 <0L30 P0#1 PEP0: S |!  |!  V )V `F|!V.`2xtPp0P'pfPP 0P` 'UbD200S F  R"`F|1V,`  [ w|1 000n 000f 000^ 000V 000N 000F 000>1!0 1!60!  ! . 000& 000 000 000 000ܠ]<6]9]O-(POM@PEhhP |1 00U03 8$(0 8$(>|1 0 00  h0'S()@P 8$(0 8$( |1 0 00 @00000 0S0% %` * D0-P D0 Q`%` *t$@V    @P 0 0`0: 0P,0 >0S 0P. `#,00 0PF#(8,(0 (8,(0儝B?! !X2 0HS%@=0S 0p. #0B. #20 02 #0SN,0H S00,H|1X1800S h0|00 R0  0ⓔP 0 Qg:Y ,<0dPPW { 000;[3 00/U]+ 8$(0 8$(6q|1 000  0040004 0$0[ 0$. [. 8(0 8(  (0,0[(0, |1 80<0[80<PPP @ 0 R 0 3SH0L0S 0 `P0@`ᤑP@0 R0  H0P H 0Q:00S U  88<(0 88 4<($$0 4 $$T#|1 @0D0@0D[ U%|1X0p t p tᒔP Kfx | x |vK|1 000UW084(0 084(W(80S U8 UeP 0P0S0%0 * L0rP L0 QF: 000S 70P$`cP*0S00S# $G0S[ PP 0  3S H0L RPp\0p0pG4pGWN$00$0$ 4"4 8#80(00C(0pC0S0CS `p0<000SW 00S S6 `$0 SW`` W  0| rP  b0S|$ P`$0 S 00CSd50 0T%0CS00<5PP 0S `BWe ig0S  0R`%` *  P0⭒`P P0 Q``V 0W 0 rP XW(00C R  RQ p H0 \ ?^R(00CS\HQ RS8000S4 7P4 80 ISp G0 Rʈ 0pG00Sp3```-P{p`dp8`pPPn ỌX((  (0S0  R R )02s0 (0忏0b88<(0 88x4<(|$0x4 |$(Z0嶐<(0 0 ?o2R0S (Pp"`g#10pWT 0 09 ~G40W0~#p P0P$0XDHX$0S5 B9h0k#08 X`p00S(0S `$0P0$0``P P P  0 40S PHX DH   0q0W 0 ~G pp<`Un0XW]ܠ]B]Z]^]h]p 8ǁ<ǁW]qW)024 80R)0 280`0P 0S(0 0(0?8 )0 (  00E0 #R HL R\0P  0800B00V0080$00 V "V481Y~I0(0 00980Y rW DpGWVY~I(0 0#R00 S( *00S 0(0 S 0S 0 0HpS`000`P P P0  0 80S 0S2<24~"Bsc,0800}0 0 0 000 < 姷00< P0000垷00CP100 $>$0 0`8`$00$000C0,00,0ppEpn|3( 0Wp  ( 0 4ṏ04pp(p2l|1 H0L0H0L0S|1 P0T0[P0T00US JP 0XX|1 X0\0[X0\U1P UU|1 `0d0[`0dUP QQ|1 h0l0[h0l'UPljo[Uz00`0S0% % *0 T0P T 00Q:00S  8$(0 8$(  hcOߍPp00,W0{ AWC +W_ 0V`0 0 d0ΏP d00 Q:``V d@0P0^ 嘰0 0  _Pd|0 _0SdU :!;3W <W R00  X0⌏P X 0Q`:00S  3W Q  Qp R00  \0nPx \ 0QB:00So  [00  `0WPa ` 0Q+:00SX ,Ro P 0@`:0000|000P̐Sp`0`0,09 492#0S  3/~X9`V"U d t90S(00  0 |S-O(|0 ⭤0S(hڣᩌ|姌0S80:S50S0S0S0S  P#0S0S0S0S  P R 0!0# U ᧏pPP`d :0S(00  0 |,(|0 N0S({J|H0|0K>V P0T 0S P0T a [ I\ O-LMP`p췟 =000p,P(`$  :@㫯 0!0 0@D4p,P(`$  喯T70D74?00 0@008p,P(`$ }'䶟6 09> 00@008p4,P(`$ f0406 00!6 0? 00@008p,P(`$ M04086 00!?0 0@008p,P(`$ 50 400!5̵ ?00@ 008p,P(`$  0400 0 0!L5 ?00@008p,P(`$  0400 0 0!4 ?00@008p,P(`$ 0400 0 0!4 ?00@008p,P(`$ Ѯ0 0,4? 0 0@008p4P,P(`$ 幮 0403 00!3 ? 00@008p,P(`$ 堮0 400 `!;0 0@008p,P(`$ 凮 040,3 00A! 0 0@008p,P(`$ o0402 00 !0 0@8p,P(`$ Y0〲40 0 00!<2 B>00@008p,P(`$ ?040 0 0 0!1 C>00@008p,P(`$ &0401 00!0 0@008p,P(`$ 0400 0 0D! 0 0@008p,P(`$ 0400 0 0!00@ EN @0@8p,P(`$ ۭC |cc0@bD0^Xc\ XD妥LЍp]GG<ܠ]1WGp@-P @lTch 0S Q0P@@@040p@cPcp@ 01<TG-S@`p0 0 0 0  0 0 0 ˉX 'R 3SH0L0S(@PG  0  RV WV R R R R 0S 00) 0+P,0:S) 0R% * 0݋P 0 Q% *H@Q  8$(0 8$(Ѝ0 #0C?o231 }P (MQMa  #RH L0S0P  0Q@`0 0 0 o0H   C/R00C00000T  10S q? 0( 0 (  /R 3SH0L0S0<@P  [ [(`)p0, 0`1 01  (HzW]XWܠ]O-0p'S(,`(@P  P [ P [P  0 ЍO@ЍO輈Ѝ@-0  廤WC-0@4Mt02`PPQ7P(Rra;V 00SS*4ЍC bb 1`1 VP Z0S  k4Ѝh@P 400   0 ⲇP a@T;aP XX2O@a aXT 40 X`0d 0S S :H0$U0*`EB 004 0 004 O`Pd03/@<1hGWO-p0H0(0  S@D@T(0 DRt*DA 0A0@H((00(0Ap@QYY0Y@Y( ( B8(#8B", :( ' 0 @@@$9PE YE |1 000|1 000|1 000, 0 &  0P !Q 5 R0 5 B B0x 0s0cRa⇃(@@YH@`4d$0 `4d$ <ЍPXWW0@-@$M:T $Ѝ0@KWP0P P@  R @P $Ѝ0 RQ $Ѝ0@=*@@p@-0P@1 01  p@W03!"/03" /L@o/P/Wp@-@P  00p_jp@-@P*ʆp@Qj@-@, , , ,` p@- MP`00 @@0 0i Ѝpp@-P 0#$#"$#"4#  B0 ATp6 >P @@-@P iip@-@PP YpO-`4M p@PP I4ЍT 40H0X @ YP& i@P+ 0x00PH0 &Yf 05 0606jP .  B >G ]6] 0!< 04 0 (   !/0A#$#"$#"4#/\ P/0 !8 0 0 (  , !/@-@ @^@DAWp@-P@P PtP 03  iPp@ʏp@\]A-Mp`P0@TAODTUV@@pV V VT iVЍ `5P 0`RPVUAT AODWQ 0ASQ0@/0@TS 0S@T pSR ^ p@- ^Q0Lpp@-@P0S pP lFP\ P,00,0PPp,0/A-M@p1`PUA_E! ,0 , Q 0 @ЍA0S 0S  P QU A_EU` `00# d d00# h h00# l l00# , pUG ᲃ,00,0,0 0  ۄЍWlGp@-@,0 `0,0Nu]QU 0S   ]@d]PTa]1S! 1! 01 U]01Tp@mWO-R @@QPEMP`0Eߍ调 -0SS/HQT8Q H0PpP;(, )0S00 UP@ 0R R(kUP-0S3P;0SH+ QQp@0W ;0S *Tx0| RS:0S . |*|0,T[ TR@P7T 01X00L:5ឬ300000 PSp H0 RSg D0Cc ^^Ph W \V399(0vP W RW\ \\0S AS-SB/1A )pS \3SG<14 0$0 $00!!!$0BUpP  pX-  p1S A?SB?11ASB/1 81p 0 k<80 >pP70S . 0'0000q\1堷S 0 qO\ǟhp`Lp DdxH\TPD C|0P   0P 0 7|4 (X0006`  ఍1P ~H U  0{ 0HP|0 >>0PD60Sh  .0D&0000  0[! 0R 1[Z 5% 0  P 0 >PBt50S  .R0t%0000 N0L00 M0[0UTP {P  AP! {4 X0004`  ఍1TP tA[1hS 0 [H0U  {HP {0 =Pl %[1S 0 d[CP 3(0,0<,0\P0 dp p-0* 81$ <=40$0 00}~~0S`P L LX=V PX=$3`U FQpKY @R;;P $0S(P[ 0SX0S `P H0S 0S PpPԀ pᖪH0S 0S  PP H)0S  0xP (h0s0 d0000s0 Y000d0 8Q00 00 9\P 10S000d0 007[ Z 0Xw W Ql?Z2SD0CSXX H0W40v꬟ܠl]WTY IW]\C]]8ǁ<ǁȟ@-p@`T0P p@* Ѝ@-@Z: @EZp@-dP@Y0SA?C p@@8Z!R1S A?CSP WWPD0@/S/ \\  R  P $\H0S/D0CA-@p`?P@P QZA-pP/``0@T AODT  `P U p0SQ=AWp@-RUD@E`Pp0S  bPUP $4RPH@T D@DTA-@p`P@P kQP/D@P/0 R R 00S/Hp@-@`P@P IQp@-0@S0S0S 0S* 0S00S# 00S A?CS`  "d  "h  "l  "1Wp@-P~p0`@TAODPpAT AODT  `P0 pW 0 S 0#/00P/Qp@-@p@ LP 0 SRp0011p] ]SRG-Mp4PQ@ $Q !BQ-P+ R  R RR RR P  `VY` ,4Y] 0`9  $ P1PЍ@X$ (0S,0S0 $~p H 8H Y0X0 0\00S d Y 0t0 0x0 $iYW00`00008 900P d09'  `H $$0 0$0 (0$0(0 ,00,0 000 00Po{bVQ1P!Y  $xZ"1YXD p H# 8i X HeU d ^d Z00k0<8  NP0 $00 000 000 00 0PD`FV 0S H`0 X '#PPP30  PP P ;00 d]iikii O-pl8@QP`M #P8Q 6C0CQ 5CojuPiku( iJi(?Ni0Ki i > i ~$niji ߖ>> i i %i Qi Ti Hi ]ixdʀO-pFMP`BTD@DTU  2SD0CS5UWPP0S0 00SpH@T D@DM PU v` Y` `$4RPPQ <Q H0S D0CUP PP80S/A-3`A0ASHM p6BPT,D@D?SHЍ00S1LF0 000S+lVP' 00000S .` X 0 0 00h02EPLH@T D@DT0㮅ȟܠ]\@-@4@A-HM`rpBPT쀟D@D6n|1S  00 0HЍ00S"BLE00S .`  ` 0~ 0000hP)LH@T D@DTܠ,]@-@|1@_QDp@-@P P oppp@-`IPII49K _0@0L0`0D00@0 0<0(080,040D00040,000,_@pGGTGGGGGGp@-P@r_0@`0S9SII Kp@Il0008C00 0/p@- @P!>00000pp@-@P 00000000p@-@ M Ѝp@-@gIPIPp@-@0Q$MG 'R`l P'RX ("($( 0t0  0 P *Q- R00S"!10!0!0!0!0 0$Ѝ@:!PAQ R000CS1]]A-`pP@u 2SD0CS+ XN 40GSDV`#0F0F P@  P: V< c010#S0 8 o` o\Q\ X ^ QPQ `P H0S D0CS #S S %S000 00 00 00 00 00000V0S  0000\dQRI p@-`@M 0 C^.^ P?R1 噡 000 C0PU'X XR X^ XZXⁱ `0 0<000 KP`ЍpA ER PPC/C-40@SMM  S|1 0 0 0|1 00 0Mߍ R@D  Q *40S $0 MߍCU S S #3R l40S `$09|1 0 0; 8T$ M`P2 p   3̍a```0(1,11 0``1P l30S p#0 |10 0(0 S@#2q12D PP `ۿ Ƞ2P<2034P09P 20S 0" XU uPPP20S `"07$20S 00"00000000 00000000 /JP1010 (1,1P /P \10S t0 ~X3"p'qr 41PU ~_EU X VX 0X 4PX>408 0000 0S 0|T P0 D00S T P0Pa8 yQDHܠ:]]t]]]]]O]p 8ǁ<ǁ@-@ G3@6G0O-M,00(` S@( w@P 0<Sw@P 0R 0 0b"#2(1 040 b( 0vpP 0 K0 0 $!, i()Q"TiT% @ Q         R/ R !! ` , 2 0!%Ȍ 00 #8Sql0S  3/P0 2qYd0S0S0S0S0S  ^P9h x[ (0S 0 :0S $IP  CP(0S V 6S( $00, 00 0  $-PU 6S @ff[ ]X]0*HA-P@T0S.(Pp (`p%N0W p0S "Q  P H0SV00 0p6lW (0GN@p@-P@Tp0S 8`p0P H Rp@pO-TMx@T$ (p $ $($ Q/o"  U R Z  "T  R $ RPTЍ Rb&R_Q R rd  S`R``V` RO RL r2d`i@ R= R: r7Q R r``V` QR V   "Z  R V PR`Q R R R R rd   PR R R r d   0 0PR R `Vr  6/0 0$0S 03/P [_ V2S0S:0S70S4 ``V`0S0/ R, R) R&S0S0S 0S `V.Z^ V `S0S0s $0  P S 0SG-(@`P`,pPM00````& R,0S0く RF 0S 0S 0s 0RkP' (00 0 P" (00%0PЍ0 04"4P8#8 S0#03 00 0 P 40 X 40 X 0S. P0S   &4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 06lA-00MS6@S0S0S 0Ss 0SQ`p 0S PI(0`00L0S/P;h1NDPP5k0S3 R0 r-d0 P0S>  !> 0`00S0 FEP,d0)1PgU  PP 0@0Ѝ R S 0S0S0S d0EP 00\]0SE0@-@8P<$MP 0S$ 0R 2nnPnP0S0S0s!.0  "nP $Ѝ0 >PS0S ,0 @@m/8mO-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! *! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  P! R R R R  P0  {R 0  0sRd   @0O-M0 00S PЍ0`S0S/P0S& 0@Sp(00S 00t4 BPP 0SK 0SH0sEd0 0S0S0S0S090sX3#21208S- 00$`0D0 ` 0 X0P 0 Q S R `6CP E*0S0S0s0S0sY vw!>7l0` x0(0t 00` 0dP 0S10 0 P_04 @4帐3 BQx ADE0,%S 0S0S0S 0 0`Pc0`0S0S 0sS0SQF 56l0S (0t00L0|0 t7P +i 00000S 0`( "4`4# :000[ 2E' PU1P iP P1P0PğO-p((T"\P ,w\M0 0X " %X " app@T W% Pa@TFЍ R0S d  &R&R W d   PD @ w(E a0@1T  R0S d  &R &Rd   P @ R0S d  &R &R W d   PP @T R R @@x]0S/ 0@-S0S   Q Q> (0# ,0# 0#$.$ ("(0  !R   0 1(0# ,0# 0#$.$("(0 0 (0# ,0# 0#$.$("(0 0 10)0# F0# ,0#$.$$("(. 0  " " "0  !R   0 1)0# F0# ,0#$.$$("(. 0  " " "0 0 )0# F0# ,0#$.$$("(. 0  " " "A-0@SPM0S0s  0 0$k!0Ѝ0:p|PPU1\Q:  Å0S0CT* S 5 A%CUPP`V\Q:Å0S:350\Q0``ÅQ:P0PC`RQP&b`Å0V0`RS``5U0X0`RS&`5U0X0`RS``5U0X0SPp50]^p@-@08M S8Ѝp@uP`.p 4"48 #800Q8Ѝp] 0 /ဟ">@- '@(㜠F-KCB]z<A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00WG-@Q M`@pI YF 0S BP`0d 0 `0d /@P Ѝ  0jPP 4@@ W i iPA0 0 0 A@ H\-PH0S |1 X0\0X0\0S1 0S.0s+ N 0 iPP-TA  0S# UQ H0Q SppW |1 X0\0X0\di00AR@T WO-7|M#2p夠1 20Z800004SH000[\0# 0S P C@P@ @\04 6PP\`VH0B40@P= 3PAP4i0\00C?o20S B@PP Z@[V `VS 0S0S0S 0SG  ^⏴5dpT5\?P(1PL0 T <PAL0 @E  ?PP ZA<5 #2!12|ЍPP`Z@W 0S0S0S 0S PT ( >PPi(0p0p4P0`UA_E0 0pUV: 4 8>PA40 R=`0\3d 00h0S/ 0 \>P), \>P#0 ,0R030S `0 8$0P```;0s s0@0PQU A_EV 0S8=`=Y 0YXpf0p\ P0P 0  0S0s0s >0@0P0s S10@0P+0@0PD 0RJS 0S 0<0s0 X 0<< <R6R[ | r5h! 1Q4 R pX`02=0SX0W08`0"p`r0s ݔ0@0P}SzRXy R QRX  #  RN 8`$0P$0GpR ZP@nW|P P/Q|1 00/p@-@PL0@ 8PPg P H@Fgpp@p@-d0,`P( 0 0@M 0  0"` `0P P!PP d0!3d04"4 6Ѝp(0 @-HL H 㱲 < WC-騁M@t`W0ʀ 0! $t!0 l!d!  , !Q#PTPV  R0S  }0T@ @ @H@T0 SPPPPPU 0 0! t0 |  , !ЍQ H0R:H  P0H000H00@W10SYp@-HMPH {<0sHЍp$P 0 R0 $1aUH@, TP9PH U@L00PLP P ,$P @ PP ,$P @T0U0L0 -/ꔊmuHW0-C-0008`0,p($@ @ @R'0404 00!E?0 008`0,p($@@ @:040<4 00!I?0 008`0,p($@@ @"0 400!>0D 008`0,p($@ @@ @0 (00!`3D0O?0 $00,` @ @0 (00!3D$0R?0 00,` @ @׈0 (00!2DB0>0 00,`$@ @ @040`2 0V?0 008`0,p($@@ @婈0402 0Z?0 008`0,p($@@ @呈0401 00^_!0 8`0,p($@@ @Pz  ]0P @@@!0CC10@ T0 !0^'6'#R@a0LЍ R  RR  CB! ,0 uH1]؟П̟ȟğܟ|AGpxtl VH|ԟ@aHG@GG].WW1@-ePp@-0@0SP S S%p`0 0 0 0 npL`q000|00S 0  FdWO-Pp0M)S0 (0 (0fP  0Q*$00 C=0 0 0 HЍ0 0⃱(0R`%(`"* (0_fP 0 Q`` `@ 00K R: R R" [" *  Brp*R[pW) 0S0K 0 0 0 *0#[ A0 0 0 c"[ R \q0 0 0 +0 0C 0   $!$("( K[@00Pv l 0b"!b! R 0 0 0 ,0Q*P 000,0 0C&]WO-?MO<?S`Pp?ЍO<09PP `<,0 <,k(   Ac PJ0 0 0 |1 0 00 079)0 9)R @ =02F?! !2S28(0 8(8(0 8(0'S(b0 `R 0 0 0 |1 0 00 1 R  RQ Q$Q Q  \| R\ |0 0 0 |1 0$0 0$ aby0'S(bP _ p j00! !r0(  6bP V<,0 <,a 0` 4P D0 0 0 4 P Q4 PL40P0:*0 00S1|1 000P8:pWP p0 0 0 @0D 0 @0D |1 80<080< ]99LD00H00 \0 $0D^$0pSB pph5l%0 h5l%7@<Pp0@0Tp겠PT(/ "R;( ,Ϡ ( 8 ,< 8 <`0d 0`0 h0d l 0h0 l ,0<0  .@P .@Pd@ Tq0 0 0 |x $Ϡ  0 $4 0 4: 1<02 88#8CQ ##*3'$ ,^.P C=0 0 0 H@` 8#(#Q@;( <C.P $0R (0R(0, 0(080 , 0< 800 < a ((@ 004 0 004  XP "0 00(00_P [0 3SH0L RP0H0 0AaT [P (@(@@42P@TL000S;  U+ . LP. 0#0;P00#|;<3 0&&'0 x000C0吠Z Pᐠ唀"Q  3PX ' wP" $qP|;<3x0S00C0xP唀R P|P;V1q V8 00V41!P 80 000 0 00PVR V 00VჁ#W<`p`!P kV39V0 SRx03V\0 R000&V0 R|0] ]@-@0PS`pM!P7 a,0 00000(000Ѝp@-P`!@P J [P !@p@-@PF@!G-hMP pሠmf@P0S( 0$$0 @@@0 0P @ P 'P@9hЍRsZ ˭0S @( @w0 ,0" r!.$  ,00( $@MP@@M`P H0 '@M@MZ 0(<$0G- pMS@P  )S *@B pGWP P @9pd@4pcP P*0+`0G<S000 000 0 00l@Pe@P9WgWl;pGWp0  R0@pЍ d0R88d0l A/0 d0R88 d0R77 d0R77 d0R66 d0R66 d0R33V  d0R116S0S0S|0Sy0Sv d0R99 d0R55+0 @@0 0@P d0R55 PFe@P A0:PFe@P A0 $ P9 'e@P 8 m A 0h@`@`T  @P 8@`0`0000( 0CS0 PdPr`PP  %P 0'3Sб100S@7 0R;0S8@T5@1PdPP0  R00sh700 dP0S0ĕ07#2120 000P $0 (P &@$0( 0 ,0s p[b P#%  `V 3S100 $]"PpW0 $ P 0S 0 000V $9P p4 UdPr408 0<0spbfD\ $P` P  "PRpWO V 0S P p 5XpTP04P ht!P`5X00 *-0Ed@PN0S S Sd04M d044Hd044Dc@P7IWW > 40SKW$1c#0GS##pc`V S19@ 38`8p40 00@=0 0 pG=g' !4gt# q9 @(0`0(000 @0R] TQ 0# 3SH L0SP0\ 0p<[ @IP kI0 -ME`0d 0 `0d Pu< 0CS00S  00  M 0000 000(4"<0 @  <  R  T     0Q T < 0Q T{ +  @ @z3(`Th0`0T `0d 0 `0d P ` @0S 0S0S0 000 `0 0 -P@Lp+0S `0 0 0 X0\ 0 X0\ <0S 00(  < X; @0t SH0<0R800 0 S 0 b8 4b:#000s 0@0x8000S 00< D0/PP`0D0H0!0Sx1S800X 0Sx1S !P D`@V<HPP `0d 0 `0d %m0P?o20T00S |1 P0T0P0TD0S`dp H PwؖPl H0Rhtp H P^ܐpPT H0RP3{Uyh d00l 0p 0q  1>ⰐJύd0d]P^ Ԑ[  Jύt0MoᩒrYL 50S .d D5`%3 1`00>Xu`0d 0 `0d V |1 X0\0X0\Y1P@ DL P@ Dg `PP T[`0d 0 `0d Pe#QD0 S 4 R000<0R00o @ 0<01 S@<0SD 3Jύ$ 1T0 P08LPpm0 @8P@0S~R p<,0 <,U@ T0<<0 |1 0003S R0 0 0 T |1 X0\0X0\3P P x1S 0S  @I0S 30SR00SN <1 0R00S  @ P @XJD<CF<0PPF9[ 40%UߍT@PUPe\c X ( ,0 <"  W hPE0 0 0 P(P:]ܟܠ[]X$8W$" 0@/D0Q0*$ PP啑P0<1 0.VCYW=0S RG 0P 0P @ $(  $@ 1,PP0 3  10S (10S @ ,000,0D0 00 "p_mS Q0 0 0 P U*Q0 0 0 Tt |1 h0l0h0lk00S p0(0 0 0,pGT2UpppW@00(00S1 0  , @P,00 #  " R 20S @P,000,0 8#8 0 0C400ZT, |1 `0d0`0d#0S ,0R  0    0TEP@#s7B`0d 0 `0d M0@0 pI@PWT+p0t 0 p0t 60 0048900(0@0(0l4 000$0( 0S0 -KP 0X    @P 80DP  80  00J04!< 8Q#8<000,0 pA00 0400(4"<$ 00 JPu @0 0S @  ( 0x0| 0 x0| T |1 p0t0p0t,WPHpP @0$ ( 00/ 0$ ]D000@ p@PE^HVt0 0 0 V |1 X0\0X0\APP/80< S001R  ! @0pS001P0/03" /Q/C-@M )r0(pP `Po T0P4`@0!Q8P=A` A0P4`8@ↂЍ\@B(0s/@-@$H@⑂ NH0(02O-2CS0/a0P00%U?0T000/PHAT ~ODTl\$Hpqp @-4 R0R 0 0' Ѝ䴟H0S%p@-PX0\ @06S [P `C6S000c0#06-C00C0p/@-0@0,M`S6S 6Q0C?o20S r-,Ѝ@C@0 P pt0\ 00 00P p$pMCCC@C|1#(p@-0PM@\`P ^(0(S00 B 000 |0 00@X0<8@400 `4 L@MPЍp0  @`容x]C-1q圑1!M0}#2a12Kd1P@TAOD2h3"`&abЍXAHW0s! k0@0P P_P@TP @T0s kk0@0P000L0 0ꔠl\HqWG-|1P`p M0G S!2S D0CS@  R   ` Ra R H0@T X p  0  0 0 3 @T pЍ 00 03 S #212 00 0BT D@DT 3"(00S @ 000sH@]0@-MW. A{{00000 0|0c00@P d ?TP0L ${0< Ѝ0@{꜠@2pqqH^]\$HHp@-Ph@0@0d000?00:<0?00 0400S 40S3 !0 0p0ul0p@-P P@ɈU0 @@@D@H @Pp@0Sl G-@`qQ@ R HQD0PP ᩈDY1`Q(C 0 0 0 2P ᖈ01 0S@0@H0C Q+Q! H R   0L S L0`S@A 0 0 0 H0S P pmH R , 7H0S /]Wi]Q|Q/P/%p@-@P p@謸G0@-@PP0$M @@|1 03/PJA$Ѝ0p@-0 M @`:P@|1 0@4/@+AU :T06 Ѝpp@-0@SP M 00S&P  xP0@o Ѝp`EP 0U" P @90P 4   H R990P/@- Hk@,@-|1@PH2`PM 0CPi 0Po 7C0CPVP 0P00PЍ1PC '7C 0CPB 0P0  PP  4`PP 6(06 06$0Xp\00p ip,p@<1P 0P,0S0pW 0W p20'u?0040 0S0$8 10-00,0000 0 0$0000000 000S0`V 0V `0&e?00400S0si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$P@V?x00Cx0,Ѝ PP 0 `O-2@<Ѝ`P P 6ᬰ  @("(PR5 ` R !` B? ?? @P P @P .\ 0]>7@ `0n*Z@ |1]4P @0SL0/P @o/P/// O-HPPpM!,PU 38@`  QP `0 Ѝ0  2 0` 4@`0 0 Y Y 3S08@02 804@00<`D0P[ဖl250` 40"@ `8AP00/58z80`V0 g]40 30S  ЍOM  A[:4002040 |1P0St10H0$ k`P D1P0S 810H0(0L0S 6$H0Sd |1#_40 3S0p00 0400` 0P0 uP\0H0S 8P .g0 0 0P]0]3]]x A-@S@PPP*@P8`pP 03/@T@>O-PQ`P 0 Q8X E<(  8$(0 8$(Mߍ0,`00 PP,0S 40S  .$0On0@0+S Y D40S 8$n\ JuP 40S #K<;耝X" 5 000SႡ 30Sv  .J50t#00)h P gP RP! 0 X 540"  s?  P  .t 2lhd00d|P\20S&  .Z@"000 `P Z5_o5 RRPUJ6[06" 0\ 6X0V0 %PᲆU0 1崀00Ȁ@00 d00F06X 6 5 PP0X 0/o" R Y Z06O%;0PSX[ X 5 ⦖6[06 060\ 6X00 0306Y 06"%ܠ]W]~]40GS #S 5S S 00/S S S/O-0MȐS `p( H5P6 PP@P@P 0PU607Ѝ0W 0 0S0V<002101@0` 0(00WPP00d YXpp Pk 1p0,p20 Y (0 0(0000@⺁0@00 A0B p4(4( :00r000Y0ppH V |1 000|1 000A P4T$0 P4T$H5zl1p 04 0 0$00 $0 P H59f14p0,00 0 H0,DZP 00S  .p p0T ?jP 5p(0  pp0(00 00@+0q@0Ap 5 Blo8Wܠ]A-0 p003A0AS@`RrPE%DP 0  P` Ѝ@-P   0 08p0,`(P$ QO 0!'> 4   0 08p0,`(P$ :O 4 0!0 !'>   0 08p0,`(P$ "O 4 0 ! 0 1  8p0,`(P$  O 0!t 9@ 0  8p4P0,`(P$ @NPJ$0DЍO螈,]$\p G@MI8r0SWG-0`SMP@ 0@S>PD PP 10SЍU8 0 Sp* ( 0R*Tk 0k'T 1!00 PU100!L4<@ЍV0dS*@P?@P0S S @d00 P0 00(4"<0~tp @0D 0P0 @0D p0 008 4]\]]8rA-p@`% 0P 00@Ѝp@-0P@֥1 01  p@ߥ8r//C-M@ Pgs0P@h !T@d  Rd*  Pa Q^` V P RW R Q RP  0  @F V ㄞ `u@P5pW w0p  e@P s 0p0 00 0@ | T@  Q 0 \@W IV  DЍ@ -I@- @t00C0 0,01 0 d5?<c3Q#3?P [@P # [P0  R= 080#80C?o2S>^}0 7/,0@ 3 #R(0\\Lp}0 0,00 <0 X\]DIA-(@  0 S0000SA} 0#dt0  ~DP ,0]@[ 3 [iL|0 8/,0@ (0LP|0 5/(0LP|0 A/]7@-@(0HP| 05/0<0(0LP|0 5/040 Ѝ07@-( $ 0# 0@ Q 0HP| 05/(0HPx|0 5/04 0R40 8 S0S 040 Ѝ0s@-,0@!;90(0LPP| 05/}_(0H`G|0 6/0S(PU 0S , P(0L`2|0 ;6/Ѝpp@-,0@ 0  _B⪮`3   0 mB⛮W ,0  05<06]:]]I]L]Z]7]#b]n]&x]]]+]]0]] (Q-/@-z,0@< Up@-P @ Pp 0P0 C2?0S Dp @7@-,0 , @(0HPz 05/(0HPz0 5/,0 0 1! 0 0Q+R ; S@R   Ѝ0;   S@@@ 02#/]3/@-4Pp@-@4RD00@00pA-p 0@(P@pD0(0 `H4z 08/(0H,z 08/0@00@0(0Hpz0 7/0  D00D00@0Ѝ D #D  i 0 D00H (0H`z 06/(0H`y 0 6/,0`p@5 3 2 (0Hy  08/(0Hy 08/ D0   6    60  R  D0 R  <D0 !D00D0000  6 60 60@6 0 600@-P ]A-@,P`V(0Lpy 0U7/]A-@,P`V(0Lp{y 0U7/8]7@-@(0 LP0R0Shy0 5/(0HP`y 05/(0LPXy0 05/ Ѝ0Py 05/(0HPHy 05/(0LP@y 00 L7@-@(0LP3y P05/(0HP+y 05/(0LP#y0 905/ Ѝ0pA- 0`@(P@`D0(0 pHy 08/(0Hy 08/0@00@0(0H`x0 6/  D03D0 I 0 `(0Lpx0 7/(0H`x0 6/0D002 (0L`x 06/(0H`x 06/ D0Q Q0 0D0Q0 D066D0 5;D0@D05<Ѝ 00D0G-P`x@p妫븒  =`<0 000n 0C2?000(p000,0xP0l0xP0m0x6S t NSPЫp ESPǫm0S x 9SP廫| 0SP岫,0 1 1RQ0St1 ?SKh1m$ CQ0$0$003/(00H"x0 9/3 0 3 P(02Hx0 8/F,0  ,00,03880338833m0S t0 0 h T奫GD0]]]]]]]]%]A]L]] ]]5f]]A-@8P`VA($(0Lpw 0U7/x]A-@wP] 0(S4 (S lpW ,0 t0ht0ht0  t0ht0  p8R 0S(0L`w0 6/t0|ЍAF0SS (0C S0.SgpW (0Ljw 0V8/00S(0L`Ww |76/(0H`Ow 06/(0L`Gw0 ;6/(0L`>w 06/(0H`6w 06/(0L`.w0 ;6/(0L`%w 06/(0H`w 06/(0L`w0 <6/\0 0CSXX&23T Ѝ(0Lw 0V8/pWP(0Lv 0V8/pWHK (0L`v ;6/(0L`v 0 6/(0L`t0@ v |56/(0L`v0 6/(0L`v; 6/v (5(0Lv 0V8/pWm0S p` $&8Q8 R(0Lv 08/(0Lv 08/(0Lv0 8/(0Hpv 07/(0Lp~v0 07/(0Hpuv 07/(0Lpmv0 07/t0 (0Hpav 07/(0LpYv0 07/#:0`VS (0L`Hv 06/(0H`@v 06/(0L`8v0 006/(0L`/v0 6/x0@ 7S (0L`!v 06/(0L`v7 6/(0LPv0 5/?Rd(0L`v <6/(0H`u 06/(0L`u0 006/t0 (0LPu 15/(0HPu 05/(0LPu0 05/(0LPu |15/(0HPu 05/(0LPu0 05/(0LPu 15/(0LPu: 5/(0LPu0 S (0LPu 05/(0HPu 05/0<0(0LPu 05/ ,0 w](]@] ]]@  WW Pp Ws@-@(0LPbu9 5/@P(0H`Yu0 6/0 !PUЍp:A- 0pP(@@pD0(0 `H?u 08/(0H7u 08/0@00@0(0Hp*u 0 7/0  D00D00@0Ѝ D #D  K 0 D009 (0H` u 06/ D0, R0  R3  R/  R6/ 0D00@0 R  R  R6060D0(0H`t0 6/0 D0< D0 ;D00D0660D06600A- 0`@(P@`D0(0 pHt 08/(0Ht 08/0@00@0(0H`t 0 6/  D03D0 ' D0 0 0D0(0H`t 06/(0H`t 06/ D0  66D0 D00D0Ѝ0A- 0p@(P@pD0(0 `Hft 08/(0H^t 08/0@00@0(0HpQt0 7/0  D00D00@0Ѝ D #D  8 0 D00+ (0L`4t 06/(0H`,t 06/(0L`$t 06/D0?, R 0 R0 066D0 pD00D0 R0 0@ 0 0A-@40$003/,0 , R^`P(0L`s0 6/(0LPs <5/(0LPs00(0L`8q 06/=S  0"SpT]@-eP ]G-Pp$003/(00HEm0 8/3 03tAI]]]p@-@(0LP.m1@S0$0|$ `J$003/(00HQj0 8/3 03AUP^^^^^7@-@P B 0R  0"S 0"S (0HP"j 05/(0LPj0 ;5/ Ѝ0$03  0"SrpL^7@-@ 0S ,0 (0HPi0 5/0  Ѝ001(0LPi0 ;5/&금@-!P T^G-Ppi@`᠐`՜ s mpp<0 00(`00$00,0$003/(00Hi0 8/3 03GT^A- 0pP(@@pD0(0 `Hi 08/(0Hi 08/0@00@0(0Hpyi0 7/0  D00D00@0Ѝ D #D  ( 0 D00 (0H`\i 06/D0 Q6  60D0 D00D0 6 0 6007@-@P B 0R  0"S 0"S (0HPi 05/(0LPi0 ;5/ Ѝ0$03  0"SmpP^@-AP^A- 0`@(P@`D0(0 pHh 08/(0Hh 08/0@00@0(0H`h0 6/0  D00D00@0Ѝ D03D00D0G-Pph@`ᤐ⿛ + Wpp<0 00(`0<0$00<,0$003/(00Hh0 8/3 03G^7@-@P B 0R  0"S__ 0"S (0HPfh 05/(0LP^h0 ;5/ Ѝ0$03 [ 0"Sp^/G-PMPgh@뺐 Ir?p`0D P D 0SA 0  Л1<0` 000 0C2?000(000$000,0$003/(00Hpg0 7/3 0 3 P(02H`g0 6/!PЍ 0 叛4^^^^^7@-@P B 0R  0"S 0"S (0HPg 05/(0LPg0 ;5/ Ѝ0$03  0"S po0^p@-P0@ P@yT0 0pDrp@-@X0S LP0@` P$P(P,00PgP00@@p@h|IDrp@-$0S 4Й@,PR R00 p@^DrLrA-@ 0S p`<P@UT| P T 0R: $ $0R@pP@@p0<0 0S 0 0 ` 0$00$0PDrLr@-@D0 000(S   0$00C$0@7Lrp@-PPL@T  0R 00 0 %Tp03/Tr 0!< 04 0 (   !/\ P/0 !8 00 (  , !/p@-4@P0 P0  Y pTrIp@- 0P@48<0 00 ` 000@ 0@0 0 ,0 0@0,00000003/ 0pP 00 p@ 0^A-@pP R00 0`0C 0 0p0 0 00 00S PP>0p 0@@@~ 7AZ 0 Tr@- 0 8 00 00 D  0 Ѝ^drA-p0S `P 垒@P D ONX U PP 廒@ 0@P4 0`dr@- 0@ @0@ 夒dr@-04 00 ( $  0 0Ѝ^prA-hp0S@ @`kPP @ s@P 0@0 @Ppr@- 0S  @@^prp@-P`@U@p 0R`P PE @-@-@N Ѝ/ 0p P/0S ///$0\1(0`10@1/@-T 0S 0S 0S 00 @0 4/Ѝds(00S @- 3//dspp@-LP@0 S   R 2/$0Sp p@/dsA-P`P 0003/Di@p 0 R @T"e$0A\0^A-@4P. 0S+ 0QP0000`0 `06/#P`p060 S0P00U000Ip@-Pe0@ d b  pl^p@-P@`U000000p@p@-P@ ``嘗UPEPA0@00倗00 0S xp@u^^^^^|p@- @l!`PQ0LS  1S P 0 p@ 0/ppp*A- @!pP`pQ0AS1S  0p 0A/*C-pp@` @`!(QPP 0S8' ЍS C0QU? @T8 0ll10А p1@0ӑP@ Y0810<1K<@10D1=`1\10 00003/PY 0 R 0YO000000 00 0*II+p@- @!P`PQ\ p@8\  1S P 0 p@0/ppp*p@- @!P`'Q\ p@8\  1S P 0 p@40/ppp*A-P`0`%@ LpP0S 01S 0S  A*L@- @<!P0S, S ٕ0P*^^A-`Ppc0˖P @R廕0P庖P0s$峖040000U0 40S R p R@0X 4/#P P A[000 A^^:^d^dsIA-`Pp:c0xPЍ@qU00004PPQ^ !R \P000U00000SL0 H0 0S800 `8/#P  ЍAc^^^IdsA-`Ppb0*P@Q P P0st040000U R000 0 000 At^^:^d^n 0!< 04 0 (   !/\ P/0 !8 00 (  , !/A-@0 A`!(O00QU0X<000hp 0`0h   8/+`P 00h  P 5/0P00P 0<00Q*=*\QA-Iq@PT`B 1Q@ 0S= 0 8 n40S0400O 0 #0Pp =0 R   8/0 800@ 0 03/ 僔Ѝls^A-Pa`@P p0S`Vۑy P @-@0   00@A-pQ0@`P VP0Q\P `O-Q4M`0I@PT`C P= 0   =@ ]0@000,  ( @$0 4/`P# 00$0 0,0(0@ 0 pS0 @ P *(0  03/`4Ѝ0@00 ;/p, 0 T 0 P?o21 0 @40pS  0 8/04@_ `O-RM@Pp8埓`  m̐ pp00S0 P V F0l P XЍOғ[`<`Ѝ^dsls^^^^p@I^^@-P@t`0`(0PS 0S00p0` 0 0000 R0S @d`$`0@DJ` 00 @$ Ѝds0^ހs@-@`@`P@`0 0000 'Ѝpp@-P@D`0SpKMP@`P p*Q @-嗓/^C-@ 0P`p0 6(000 9/HPH`0S,0,0S  R 2/0`0 ЍdsހpC-@ 0P`p0  (000 9/HPH`0S,0,0S  R 2/0`0 Ѝdsހp0 , /dsހs@-@P_40 000`0 6/ЍpG-PMpPt `p0P@ 04/p@x2VX %'17V. 7C0CV7 0% 0 & 000@PЍ2V 0tp 0PЍG/1Vk 0CV1V 70V@ 0S R  0CPS0 0 0@4!04/S@00S P 0 Τ@P0L00(0( 3/@P0 R  2/0 $ R 2/ 0 Y? 0 Y? J M8|8PЍG@vPWLW`WXW (0Q40S0000//TW@A-pD2 M`QP8' @ $2Q{ 0Q 0CQ= @ Ѝ1Q: Y177Q o37QPl 08 0 ЍA/pW 0 K@P pP  0A@P0 @P  ЍA`00S P 0 #@P 0@000T00@0& p$מ@P 009$p0 03/@0s0S@NW aWMW(^O-Pc @!XK0^\ 0U40S0000 Ѝ\0 0p ЍOA AT Z0  4p0` ЍOj0p $0 ;/p0  pNp *TW@0@-MP@]x0S  8P@YP  Ѝ0 ^@-P 00 0  / ЍW P/ 0/A-pW0@(`$$0PV`T6/ꘖU܍Us@-@]40S PU T0(0Ѝp@/0 R ` 6/@TЍp0@D( 02/A-P`p]u@ UE01SC  40S 00Su0 00P4P00 0000S  R h R  A@@ 04/#P  dsI@-@-]4QT T@0 R@ /P/p@-0@SP` 0P`4 R   p03/P p0S 0004 R   //?o2\0S//Q1S ///40S0/qA-p6@P400S0T0S0 Q@QQ`V 40S@ 0@ 0 00;0@S@   @.^@-@\40ST   @@7,A- @!PI`{\0S8L S 0AT 0S 0S p`003//0S 03/0 R   2/8000S 0  2/ 00 0*dsp@-8P@0S0T0p}P00ds0 0$/pds0 0 0$0/pdsp@-P\P^K`PpNP@0PN p@葝#pU^ 0     R [$X(\,Y0]4Z< @ 8D 0/0 0 /  $ p@-p0`P@ P p@VP000PU P@T VP,0 0S/ R  B /0@-@^0, @0 0 S0  0 0X0 0S/ R P  R   00/0/8@- 0000 0sp@-@PH P` 0H0 00P0000000psG-`p0 @P05/ᘑpW 0 0ЍG/0 CR/ I0S0C 0 P0PEPE0cUP!00:/000P 05/0S0C0 P 5/0 0S0:00 0 0CR 2 5: P 5/0  P0A5/\^ P/s; S 0 0//sQ/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q 0Q0 .0 /`0<AQ0 .0!0 .00 .00 .0/^5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /1A-3A@Qd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0SP 0Spp`Pp^@-0@000\P w0\0`P q0`0P k00P e00P _00P Y00P S000T@Ks\Q@- /6Q@-A/%Q& 4A0&S0&Q  @-.0 .0!/  /^9Q/Q$Q !0AS h00 S 0;Qh0 @-&Q>0AS/h0 S l00A!lTX 0 AQ  R 5` R  R  d    BQ / d /O-`<0@@PpM  d03 8/V䒟䢟0 0 0S<0@  d03 ЍO/`JK[۰ 0 SW0080S0C 0<00<00\ d0P22,c R0 A S:0Q0a BQ00000V ʈ0 S0 0h0S  RG <0! !R[00<00<0  2 R. . !R p q d 1`Q A02 ";/0 Vd0#0@000;/0 d2!cR 0 . !<00~1 803/JЍX^^0S 0S Ҡ /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 ?0 R\ 0Q Q Q/@-@0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@6Q 0A R p27A,Q"S00p|Qg nQ` oQ00}Q[ ~Q00P( hPl?Yp<0<<00000@00D00H00L00P0001010 1010001<0  00000@00D00H00L00P01010 1010001<00<0<0000&\ 000000}00T S tS0C0`0S  0S 0d00 00CRb0`0d0]( hl? p'00(Ap,Ap pp^8^@-PP@ p`E(0 0 000@)$080 \ P`dP  } y u q Ѝs@-0 @04 80\0`0d000000 Ѝsp@-Q@<0 Q Q!R0 ,R0Q *Q !R0 ,R0!R0 ,R0<0p!R 0 ,R 0!R@P ,R@PS00 `@06/Q/!R<00 ,R/<00<0/A-XP@U`1P3p1:PEU`p0T 08/`0S T QQ0T D08/`P T0 P&>`0S  0S 0d00 00CR00d0A-X`@VP1p1:`FVPp0T 08/`0S T Q0 `TD06/`0S T =`0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00= R 0PD05/`P  =0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M ?S +@0C4S00*SS *S *SU  SW $Ѝ*S 8$ЍC?*S ! BS;  SPh`h0S! lPP*S7 l$ЍCbPh`h0S, YPPh`h0S, PPh`h0S! |Pl$ЍCl$ЍCd7 l$ЍCkl0S d8 0TipFQ D\PQ R00)P #  8 0 l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/]0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRC0A0d0>X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0 l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0d 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍColQ3$ЍCld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0s Qo\0Cl0S ekl0 S0C BR 0[l0S SV \$ЍCu;\ 0L0HPLPph Q@0 0` ` 09/P5 `` 0` `  0` 00 ``009/P0@0 0l 1R1R aRYRPRB0dBPP\pB APR40@0D0HPLPpPPPPPPPPPB R p\&P A Rt 0$P(pB R p\P A RtpR  p \0 AR00Ѥ pl0S0D!0 0 '  8l0S S S< 0T 0C 0 S S w o s p ml0 p S03S0!R 0CQccPW< T0X00^J?u&p$c> ^l?p$? ^ ^ ^ ^ ^ ^^ ^ ^ ^ ^ ^ ^ ^p@-PUpU- @\U:0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0W ^A-@P` 0!0`3/V0p4`e%n 0!0p3/ W ^p@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@h ^h ^; S h20/ <8#8SA3=8#8SA@A$210/>08#8S1AAP00/</ >8#8 S1A0A`01Q#0CQ 0CQ 0Q|1 /p1A+AQT1P1L1H1D1@1<1 01Q 0CQ1AA Q>08#8 S0AA Q0000/000000000000000t ^/^h ^ ^^^^ ^$^(^m ^x ^,^2^8^=^B^G^L^Q^V^[^`^d^h^l^p^t^x^|^p 0S S"0A(0,D R  Á(,//0C-DM (00`p@ a<00,$  @P< 0PL @   p  a,($00 0@< DЍ$^ <0S/@-@y0 @TSA-@ S t hP`pP   03/@NT@@AN<^L 0!< 04 0 (   !/\ P/0 !8 00 (  , !/p@-@p`P0p@@0S/p@-P @ 00 R PD  h@ 0P4p =J@0S/@-@@h0@04@O-D0X S(@3=:Pp `0V. 0 V0lf`Cx @ 4JV`@0  A0@0000@Y 0S@ T`` 0@,`@[ L#@080 0b@P >j^A-@PpOA@` 0 R@)A-PU 80p`h0@6p↿x^ @-@}80S 080<0S4@NA-P0 @R <"p0CS3 :  `pWЍ0@ 0p00000P Q D0S/0D00/ 0p P/0S //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@!OT00@-O00'*p@- MP@l T`[P 0 R V ,TL ЍpRV RW SW lp@- \`P&<0S@0 00P00CS0pp*@p@- 0@P<PP  p@p*8@- (@;PP @*0 000/G-P`NP0@x000000\N0Sp 0pW 0S1h0$Fh00h뜐 \) \)h0  @0l0 0p000000t0h0VP 囀h0|0000(00,000000S 0$@.Ɂ TP N!弁Wo P hr0\ #PL  P8Gb^t4[J^(^^^^$DJ^^C-M`MpP0 N5@V7 =5V 4V! 4V 4V l00 04V 4VU 4V|@0000 0 000g|4V P< S0< S < 0ShPQ(4V^ 04V $4V X 0w p(`P  s Ih ~Y3Vr 0V`Qd3VB \3Vt T3V |@000000000 0 0 000`2 l00| 0pލЍC/ 0     0 0 000l000`Be0 0000 0z`P0B ލЍq @000000000@00000FA0 0000 0z`PA 0S*` ,5p 0S 0 S0`唎` 0P V`ҙ00S> ! @DIp 0S0 ލЍCp0h0 00P0`P PލЍCk ``W W @W@W @W W@W @W@WWW W W W WW(8@-@p`L0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0 ЍP R 0 0q`@ @T@@~fvtA-@aP( 90 pA*40( R/$ R R/  /t@-4( \0^@/tT0Sp@- @RP 09'l0p0p@//@- @ P@A- `N9PP@ @T@`V X0S PpW@0`P`p@P Pp*D@- 4"9P@T  P * 0!< 04 0 (   !/ RP RP }//C-QP `M 0q<0 0dV@p# 䀖XW Ѝ0 8/P 0S 00p Wp04&08#8 S$=;G"0C S04W00G?o  2`4W00G?o  2<4W00G?o  2 0T00 0W  00 a @DoQ] QZ > QW QTa @z 0T0 0 0&T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T 0;# 0TP  t0Y S l0 0p3/tT  . @@a0D8#8S @DH$H>; S-< S* < S 0T0+ 00D8#8S00T0S >; S; 0 8T'.T T( 0 0@H$H* 01A c0C S@0{C 0@; 0/0D S0@@0D8#8:S@@DH$H@@AZ^01 ^$'*^s@-@(0S1 $0S 0S+ P`40 CS4 ,0 0, !; S Ѝp0 0 3/Q Q 0 0 04,0 tA-PIx0UTPS@UTp W `W` 0 `U`RT0 0$l00p3/`PTPTpU@ SI 0|KI =^O^\ P/0 !8 00 (  , !/p@-@0Sp@z0PS 0p Sd :!I$T0S` 0Sh0T0`!\Mb@-MP'IX0@S `?$$x0S 0$ P`V% 00S" 0p0CS00 00yP b< p00` P HH'|<~M@H0 ?Ѝt\f^m^^Q @-X|/^p@-`P0@   `P0(0ptOJ@OJXJp@-P@PPP(Ppt@-Mp`PH0@S 00#90S$  hPP: TP0S4 S P0 0!! !1Ѝ@#h0Uh0TPP @ R 00`SPU0P00 P 1H |yЍ\Mb^p@-@  Q != ^Q‘ @@HPTlLoV  \Qڰ wyA9^p@-0@SP S`  ` < Rp؜0000 0O-,M @ p P@DQa|t(,Ѝ0PU T PU0 Txy0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `:Q ڰ 0Co[ 0 S  02""^L^p@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`pJFPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@p贩@@- @ 001P@@- @ 001P840 60 0 1P;//@-P`x㦵@f㢵p0lpp000 P$Uv0@@0 P0tp0 Ѝt^p@-PP@0S `᧵`0Pp0p贩y^s@-PP3 0XP\0p0@`0\0p0T0S 00S 3/ t0S 0 h `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ ЍpWp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HKE3PV +>C 0CV 0CVP t300 h3VPz $ЍOH3V, P0ST0S c lpWX\ 3V0t02V" 6C0CVQ 0VlPUR 0 0RoD0Pj;2V`lPpU``PP \r\\RdXVʀ 0! $ 0   , !0 00 0J 0!d!0   , !$Ѝ0S S S $ЍO{PL X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00[D\PP R 00S0<0P 0 0q`w PP0S 00100  0;/\pP=vt`W~fWdWcW$ 0괩p@-`P f`z@P   pPU X0S P0S 0PpppG-`QT@T` PC vPlpWXPVC@ C <v00S 3/PP\p^^@-@CTT0 TQ S S @Q @-Xw/^p@-@PXY3PpCP 1P X0SP0Sp@ p^ 0`( "4`#/R/`0  B@-"10 S0   ,(0 0//C-Pp@(`V Ѝ 0ᤔ9/@C-P@pW Ѝ 0ᤔ9/`p0S@`A-pl `R#:Pp@Q:AQ Є A8/ 0| 0&l0CS%p 0a B BR%0)0Q*Ѝ 0A-Pl `R:pp@Q: BRЄ B8/ 0l0AAQ%&< 19 P*Ѝ0 P Q   @@-:#:^:,\:( 0 /^A-Pp`@@0@Dp@0@L$<#@`W =0pG`@A-PlL0pLALA$ `@`W =0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh ! X F!Y P0`!pW:X  QY Q  > 0P^S/G-` p P#"Y@PX J=0S  s>00H@PR/G-PQ0Fh pY@p`V8h N>0S h G>@pG-Pl @R`T  Vp P匀`#801U "0S  #>0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  =00pGPp@-@P0PQ@ R   RQ@ R   Q C@Q@@R 00pA-`T0@Pp 43/UT0LpP` 0T04A/0T0A-@p`0S  YP p A Y Q0000000PԩQO-P`p@@DT 0 <p0 SX Ѝ0 'p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/O-`d)@4pS0ʀ0!4)0,)$)   !@WpVP`P 400 $X0@04 00$00 , 0 4 00CSTX40, PR@0 00 P  [  H ^0  L X0SPTUP0000V` W p0``00V `Wp `dp0@ J{: { l:p1ʡhPL|00 10000000  P 0 Tp ` 0h`Waf`` 9`Fd 00C0c& 0R0 0C 0` 0` 0RS0C2x05A45t454545454544 W%00t%W$43 W 0倀TVr Ѝ R97;BSA S S  @<Π` P BP RY 0 S < b0B)2 $ ,. .8S<Ƞ4,<(8N"( #8PE Q ἐḐ Ḑ  ^  [꼐 ἐḐ Ḑ夂01 `@380!A!Q Q ^: 0 0S  u V`@2qg( s&b`0{p8lpGW04 TP    ̈́I 000404040404PTP!  ̈́I 00p04l04T04P04X0,^LzJLxJwJyJxJzJ vJtJHrJ}J(}JrJrJsJ|J{J0sJO-Pp`( 4M&0S=0,0 T0$WpVP` D@ J IL0@@ @@ P,p q004ЍT0     ,o,9 P,0D0 ,@@ D0 m /0P00#0CS04<0@pspp000X [0R bQ" B3Y 3R b\Q" B0Z 0R b] BP"YY !1"0202 Y0XZ0cY0[\ ]0`kX 0D2$ ÆahFh`bV`a"A 0Qc2 0A$ Q0SW ASL 0CS>T0H90 P U=l0 S00P10000@!@1P@@T(T0 [!1P@@TZZZ0X00X00X0 S 0@00 pYD8#  T0,88 < T0 ^^u^ 98UUUU ̠S /0QT0   R: ,0 3 0#1, #2 R0/ R,#@-8/^O-PP L0!p!`W1 p` Q02 !X800#0Q00p0` P b C22  A X80z  " Sy  " 0S  }80p0`   ,^,(^(^S/O-`4MP@XA P^!1 00 Z P0̹p c02Aq4Ѝ W Ġ   ! Ġ ! ,  ,Ġ 1!Ġ !  ̠̌  1!̠̌!!!P P h i P D\R@TqZp0pp PN0@000ȷ@T0 @BpGBS0(01 0 0d$000Cs0v 0S0 "<<"$0,04#$(#$0,0 S "<<"$0,0$ 32# $ (#$,0 0"00#0  0ERa0SP 0G0S@0#Ġ #4 <0!<Ġ< ! 00 Q Ġ    `1! Ġ ! 0##4<0 48,0(4(, L<\0? 00#00#0B0S (0 !%700pP^<T! 4 8!004#  #4<  48 0 0$30##4<"q 0i3##4<44, 1 00A1@00Z@@P0S0$0 00 0C 000Cs0~ 0S N 0#,,#4 < 0#"<<"$0, 0  R ̠̌   `1!̠̌!0# # 480.̠t.4̌ x<^0[ 00#€t 00#0R Bp0(0 0b,0(0S^0S2 4 8 0 02##4<00 S0 b##4<032#$(#4 < l!0!  0S $0 !&600@PW 0i3 ##4< 0 1 00R! 4 8!002#  #4< 48 0 0,30##4<00p,^,(^(^O-P`pV101!00 `#8010 S(1@BpW* Ѝ 0"00#0 R00`00Y b DBB Z Y ? 1!pW:Y  ! !QZ ! !Q  y5 `A,^,(^(^O-$R@4M@ R^v C^r*P`! !!X V`"( !X P",!P Z S $p0~' 0p RhʠS: 0 02 (,0Y4:04!48#8400p0R2##48 0S0`0P 0" 00#0 R00`0PY*X0 0t 0c PRx `R 4Ѝ衯0 :00 B0c 0! 00#0Qa0 !    R h@P  "S ] 0qY4*X0 0t xp0c PR`00W 0PE0s00 #  "0  S r  !  " 0S 0 `Fx4pG0s00 #  "0  S r  !  " 0S  Y40`0P0p0 cR2 ,00 (0 1$0Y:0 $4"4 8#8$04  p r  000!Q"  "$,   P r0  00>  P""$,  Ϡ0 0<  P 0"  048"$0,0 00S $ 30`0PA,^(^,(^00 04040404/ᤚJ8JĎJHJO-MQ@8@Q\1 C\-*P`!!)( !p),!V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  l30 `0P[:004!48#804pQ 0S  I30 `0Pό\00PE0 S 0S 0 `F.3pGO-Q@,M@Q\ C\*P`!!P pV" ! P` P S"! P) 0 $0 剐<*4,2,2  )00XR:0 E 0=R0S  20`0PX<:0 Q0$ Q0! 0 a`0X0@0cP[0$00k0僱 Y0K0c[3\;$;b!Z A bQ"]100 0 S0S  20`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `Fl2Hu^T00  ,0X00500\04/TJJO-@PM@P\d C\`*PP!"UP8 S0"( !i8 剈`",$`!)l&p (ተ0pW0: 0 `S0S  20P00 $4"4 8#8$04  ` R0S  10P0pW*80 0t xp0c `RPWЍP00`F0 S 0S 0 PE1pGO-4S@P,M@0S ^0L^*0p%!P0`P#80!)V` P \"P !)ᇀ ("( - $0⒎($⊠""00 0000 000 0YR:0E 0=R0S  i10`0PY<:0  R0$ R0! 0ba0X0A0cQ[0$00k0僲 Y0K0c[3\;$; `ZB$aR!]18#80 0 S0S  +10`0PP0 0t x0c PpR`X,Ѝ0PE0 R 0S 0`F 1Hu^X0S  0R   Y  Z0X0[ 50 0\04/JJ,00S/  R 0xA-`P<V0@P0# (3( 00`0'p $00$pz-P`s- H0`000  @@x"/p@-P$0@Tp5/@x\0P/ L  \/@-  , "  xةA-p`^@P P@@@ @S PU$R : ^V WQ /P@^T0 N^@D@D\'LD@D BR@D@D\ @ N!N'O-Pp``08@TV#2 Ѝ 0 U`P@xp@-P` 0@Tp 5/@x@-P0P0P`@P , 0< 0 00 20ЍpxO-PcTHHCUDsT# ;T@ p&  Ѝ0QCM?0@0S0P?06?0H$H`pG@00C Q4#0@CW` pU@D 0 w0P6&0`FS A CR R a DR @DH$H@DX ^@;@T@ػP3^O-8P@Up=04<P0XY`LLV 0 @X0` ACP  50 R ;SU0T.SPEP ЍY\ SeP#ʠ?0,̀0@P  P ?#?0<<00P 00U?0P0Pػ//O-0`p,@;8 #61S0SS$ 0S 0H6`0H @R000@0@v00 YSX000L000)o0L &6x3^3^3^4^y@4^D^y yP P /  ܻ!)p@- P1@P`0S BpDD O@?000:0pp@-` MR@@Pu%0  `$!1/@P 08S?F@ Ѝp7@-P 0 @@PpD@P ?00 Ѝ0s@-P@<`>` 0ЍpC-0000`00CSʺ0 V0  =# C!'  Rq&P 0S = C!P0S c> Pc>O-P 0 00$ $/ S h0S)B.0_# 0 4P 40000 P4000S 0 ,00/ 0 S _R Qr4P e> 0X&  ( , P B R   ,0[,0 $ B~ 0 h R0 `2 20S00(< 8$+ B/o0" 00!000 #200#020-4S S 200h0S P .0-400 ,, 0`60A00h4^T0T \/@- 1"\0?0A@P輼l@^p@-PQ0USLpR @@T00APES Q T03=?00QS^T ?6?0000@-A\\^CS0Q Ӂ0ѳ 0ҁQ/0C-P0M`00@V5p Kj 0R  (: {>C 0C"4T0 0  ?d @;c U l0<#\\0B#1E-@@Ѝ0U00T0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ pi@Pod0PЍ耖p@-0S00R0100 ^ P^ @R@@A@0S*? ^ .H@0 ^ RP00pH9^ G-@`0A S0 00.SR0 .QR 0@0S ZP00VPPЍ \.\ B p0P^)ZSC QCBP A R\(\P0CC\ ؑRSp6SPR_0 0S00U^ V X .XQQ0 pW UP^  BP R00 0S B.Q Q P Q Z pW UPQ BP )0g W1 `V 0 B Q  HcR0b~  @Wm*00p  V[H9^C-@PM0Q s.R R 0E $2 `S YA pb0 0 2`P 0P 庁    Y@PPĥߍC-M@@B pS pߍ 0?H `T ) P)U0@ PE UP    `TF`% @P TT@@ YV@@@$T P 0!1RX 0SRRH9^C-P@?00CSLM`LЍ@0 `p0R e a ] 0 /Q 0S*h0 pS  0 A\0S  '0\ \Q^ AB 0  ("(R ! @ B "\ Q?,? Q, ? ) 0 #  Q/@-0Qs.\ \ R 0 #@aAON/100S/0 00/0M000Ѝ/ 0P @/0P0 @-@tPt`0 `x0` @:CT` 0` 00 @@.C Ѝp@H<^y/@-G0@G@y@-Q|L 7ЍC-@$M` y0pS rBL S?xx~D@x  !08p 00$0$0 0040X& 0L00!s0X0P0"L0X0\00M0400X0SV  0Pfd 02\0H00$  0 PP \E$ЍP @0 H0 0I0 0J0 0L0 0M0630-*'X0\0800sX 9L000 35X0@0000H0H @0P0`_Z< 0=+@0@Ny!!{<^l<^ 0Q0A-` @ P80 rGLppF\P:Ppd@ E 02p `0S7:0 00P 0 \-Ѝ\` 0\P)+0 00H0 C2 000\0 >0>00C00$0\ *ЍA<^O-@L8`p0,MP 0s @$ NN,Ѝ0 *\0S* ppd0Ep7sUGPX0XP 0000 h c SpO $ld0T 0C@ BÌ)0@ @3)`<0"$P$0p 00 B 0$ - \P 0;P> r 00 0Pd0;0hl0 Q! 0LP  AH B"     \P0 00S\P00#Sb<^p@-@PF P 30 0`DY`_UDpy@-P` @PLB@0 000 001 0!005Ѝpy{@-PL@P4%Ѝ D{zzp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0|@0 0C?o20p@@-D@᝖<P$ޖFЍ0 0ז{z@-0Pp0 0僖dz@THÖЍp 0S ( `)C@{zzG-P@|xpX `D2 H.W L R ! V xx 0 {@-   11 1`00C`0`0  0`0 11 1/@-  Ѝ0M000Ѝ/p@-`@TPPtPU \ PU*x^\  pO-`0<4M(00X 8@0000( XPQ)L00" d0\PV l 0CP 230Y l0CL30V00R d\01CpS04ЍVRp0 00 00p0JS 0%0 p00h0000Z00#Sk(P Y l0d H BT02000V`pd000 0SNX\0S*(P ^ $00,0  0[ $ ,0(R:P E(P >0(l ,0 B$"P 00s000p0pD 0S (VpP pGhplg{ h00\ %S/A-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0PPpp`0 00z0 {00 0808H<r0"\!o0C008D0l `$0 B"0$0m$ 00R0 ]0P T FKp.0SpK P '5KЍ<^O-R4MXP0v\0@Sq:  00$0 0(l $p0 B$"`P5( 0 z/E 0 0! $1Q- q5 :CQ0 : 8 #8#40 (-0(00t0(P '4ЍZ  R 80 #8R#4P00 0RP ,,P`@-M`pP0 0 0q@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51: Q030# P03S 1S c0?oAQ1O-P`p@P )0,    CR@lЍ     P 0@OoB@@P@M@0  . 0.S+R R'0.S$0pbD0 Sr L0R, R' v0  =@PX 0'rRppW -0@0\P PD PJ@  0p$00, ` 0'p0S  0R4 (`0`0\0<`S H00 (D0P P$ P40Sx 40Su  =@Po[0`[ 0Gb0G@,`00d  D0p0p$0l0TP C)CL@H)0c"$<3P<0 L`H0Si(00(000    QQ[0`Q'V0[ 0S0 00 0 0 00 8P $0S  \3P 000 d)P 08 ,`SR0p00pG0p 0BB00 p0p04 B8LQ0R S`bD0L00D R` 'Q  R 0 v  <@PX 0'rRppW@ 0D@X 'rRppW ,0000  0D@P O-8@LM00 \0pR`:,p Ad01000 0P\ 0  LЍd00 \d800000@ P00lSh0 A)A )0aD@48"03$P4 h0@0P 0 P H0 0I0 0J0 0L0 0M0 0L0< 0\0<0800s@0 00S00p0 0$0p00(000,00 C00 , 0R$:04S 0S{ L0 X0r00L S000 S<0 0P0<0 00^h m04S4 kd8000@ 9PP,l@ A)A)0aD48"03$9PP4 h00P 0P80 0($ 00 0 I00JP 00rPP pd80@ 7P^l@4 A)A)0aD8"03$PJh0 pG 4000 0 Q 04S= 7 PE;PPi h/04S& d0@ 7Pl@ A)A)0aD8"03$P 40h 00 0 pG  P  0CO-`p8$M000 N@P @DOoB$Ѝl A)A)0a"03$P0P [ pQ Q @ 8P $P   P?=^K=^A-@Pld Qpp0 BT A(`P15"^h05L<0 L)L)lp1<"$9PV 0h 00P00Ѝ@- 0$ 8 ЍO-8@0800S 0s \ S00\ }(0$000 0QPP30$010,000t010(0@1T110  00 10:0000l0$0d0 0TLЍx|e00P@8P NT P }}00=^=^=^=^@-0Ms0R P@ Al@PT $0 00 |00 0t@x@`@T lЍ@T b]ˁ=^C-PRM@Ѝ R `  R@ @@ptx| 2|000x00000S0x3 p R0 -@   @P 0S0 $l(= 00` 0&000!:@6T0100S 1 g@P0S c#@0*0SY#@0HML8(0 @`0&00 09@5T @#g0'pp( !3@5T0 @P@P Gl( 35#$ 0R 5@00 0 0@+^G-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0SЍ(,0 sq 0   0!P08< rqHL rq0 000 I@ 09P00 8< rq 0 R 8$sr 00 T0V HL0 0L00000 r 0 0 I,0@9P L000L00000| r 0 0 I,0@9P~| L00 0L0000ЍGB0Sk iC-0M@p0S   RP- 0X0P S 80 \p`H@X!V0 @P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-`,MPP,Ѝ 0SPPp\ Q00S8* 衟 Q@ \@ @T0Q0  R H0C200 00 0@P 000 0 = SO P@d 0h @b<p@ RS"$ \ @DSQT@!\  R0R0@0 PPl A)A)0a$ "03$PP p00 0CS0! 0@vT0PSWTPnO-`$M0S S@ d< 0pP 8 0 \000 0 P0S@$Ѝ00S\0S0000 @\0/0S00-p0d P l0  \RQ B01@ 0:@PV 0 \ c\ >0>00S H0A0a0000 0H0  C200000 @P[; 0S0\ 0T [ 000D 0 0 >0 .0 03@0T002  0 - 0  H0S 0 h@Pp c 0* I(C8RP תp000 #8 *(80( 03P @ [B$ЍOr@<@:$>^M!Ѝ/A-0 @p0`SP , PWO 8 G-` P@UA @P pp, @P 0 -00@  B@s@-@0P000CS;#SR`88 d0l 0C S c10PQ0/`P 0##sr$ 0n00#sr  Ѝp@28l A)A0<)a21 #<ЍpC>^7@-0TP@6"X90@8 w#( #$099 Ѝ0$>^00\ <0X 0C S0 0 ! /+ 0 0 08G>^G-0 S*S* P 8pL  PS  P60S2  I00 > `!E 06S   ЍmO-0|M0(0L0 0@00S<0@ p(08P<0!0sx0`S0040 0#240fx 022$0(0X0S rwL St@T000H00G0s L0ld0S A A! a,3 1T$0 0 #0X 00000,, X000SF: tPF0 @pS  @p   4 R70X@0#d Q a30PQDh00 808p00CS0!H0(0\0HX<T00(X0` Pl0d` C)CT\H)0c03"$$0PD0\ T00CS0H08 S  8 \8 000X :0 L0TRQQ 0S0  00R0 0p5 0 @ p X 0l00m0~00l00m06d8l @T4L0 @ `0S  .3,0$0  0#0 0 0P2  l0 lt0 0u0 0v0   ,0S*\ld0S A A! a.3 1T?002 0D 0 P+ \P,0@ 000 000< 0C( 00\ @TpTp0S [   0w0P0Pw |Ѝ 0,00000S , 0     4 R00 0H0000 00,@0p?L0@0,@0p0"@0,@0p0D Z>^>^A-@Mp0@P`00 R@@500V T0L0 0L0800"0 VT@`00R 0 W@T @M00N0P 000Ѝ@-0`P pMX0S, \0R@#0*x P @P&00h@l@!0 0\0!" 0080H00 0 0p 0, x@P  0 000 yЍ80 000 m7@-@P&P ʄh Ѝ080 000 V0C-0@P8`rr eL dl0 T@d X0S 0S @ `.3,0 2# $0L0!10P  000 00HpX0000(0""p 0 8080B  0M  0 0|0L0 8|0080xp000h \0000000 Ѝ 000  0SL 0S @ `.3,0ǃ 2#$ 0mA-`0M0P@ N80 000p L040S }P3 @PH0 0I0 0J0 0L0 0M0 0L0\pp800s  Ѝ@- `P@P 0   0L 0 0<03100, 0P ЍpvdG-0p` M8P0X0S, \0R@#* 0@P~x $0PP(0(wl0dT A@! 0C#p00$?n@ p 0 @ 0O 00!e   XpLP:!0.e2-8640q."@* X %@P&0d00t@p0!# 0, $00@P 0 Ѝ 000 |@P *>^ 0`( "4`#/p@-@(0Sp0PSP 0 R@TpO- DMhR/@lp0-`p0P00`$,`@P $ @P#Wk`Fhp &h$ 0@o V㨂X@P 4P᧤,奤${DЍ$ @P P0`Ṡ< 0P0 8 \$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PH@P@0 @P M0@SI@H@ R BԠ(0W0 ,000,0dN^nKC-萟M8P Qo<01 @`p*000o, 0 < 00 0 0 )P0S'P7 000Ѝ蠆A-PPP Up`U@ 0S@P0 A-0Sp@@P 0`PP`P0 P K00`p@-@㲟004P0 pp@-0`S@㶣@P P0S00  |pG-0`@ `PpY@lT Ѝ 4 VP0 00@0`C@`=@\O-M@Z0`@P %1 1PPz|0Z00008p+08|p0 AP8b|W(8p ([( (( (  (᷺|P%u<00<0%#0 3!0LVP0@8003!0I@T#%X0>0 SC&P02#@ 05:80P0 @ 0000000$000 p@ 0 SS$ 0$R00S0} @n0刔pC 0Sjà@#!P$$(00D 0(0#00$ 0A@P$p00ʿW0.y!G"Т3" R 0P03Py 30p 0ag@P 0! 0B"@0 0  0U80(, <00PQ0 1 000$00 100@bp0@$0  0@ 0 0fT8<$p 000x$0/0 0 v!P"$0/0 0 !P (p$,0 pW@ 2 30p 0f@P0S 2!@0xT!@@㳟0 R  P0R 0K 0p\! 0  41T 8@@8081T#\ xޟ#0S x 0SПI0pMx!@!x a0\ R巟 0  8@@808p{N^1uO-DM00h08 <00S\ 0PS` 0SDЍ0地0083$000  01$00 $Q!  0 0\:Q0p@(0,040 00 Q0 DЍO<0$ 0P Q QE Q'0008000S  0 Q:Z0 0  Q Q Q ;.0S S 1H0C200<00 0ᘿP  0 P0*&00000$0 0;00@Pap| 060QP PT0 ;cS10! 0p$00:0 @P 060 %.P   *X- 0 0$00 "$Z 8S  0RP  a$0 (000J ( RY#QQY*  R, ( RNڸ \RD  00$00 _($80080000070 pP 00 p p8Sn0RPh #000  I ( JRY ,   J Q 13 145  0(0<00,0(0Y*0( 0Rp* c 0 $00CZ00 0( ,0)!00 ,0( 00 0 0 0(,0 >% 0p0 %,(SR0 ,0 (0 000H10S0|0S8S$00:0 P 0 5Ѐ0600  P) ,0S )!00 AC000  0  0   gX0(0\0,0p,B(00,0 040S W X0SZ%QpN^LO-P $@p @@DM $c T<✐0娰 ` P  0 DЍ`&W`V `v`P  0 0$3 0壴  !< *P+X 0S68T08岜0TSJT0S 0u 0 R #1 T噜X T 0V 4 01 Cr T 0!`u!O!uP0 ! !0Bq  H@o/@-M@P` z 0 0P .@P +Ѝp0@  4/@P2V@002d0  4/@P H+ 卮V 000( (0ȲN^xiN^iN^\O^ȒKC-p` 0TM P p@P m+TЍ. " c!>V4D`Y2!>3`04\@ 0$p 4/@P 8L+ D(00 0O^xi@ P0@@`pu<04 @ 04/@P * 嶭O^ixO^@- 0 0000 0/Ѝ @-0 000 00 0Ѝ@-!>0004!4 0 ЍO-@Pp`LM$@Wpl{*X ҝP0 7 |8/P $劚 LЍ ``  4:/P W* $t $`q88000`8 `` 0( $;/#PJZ@T<P|p0 3/Pt0 SKx0S $0x 00$0O^P^ 0嘚괒Kp@-@P$ Bp@ 0`( "4`#/O-P@Pq1v0C1r(qT 1 Tt #T 000$ 4 0@@T0S000 T 0 @0@0008Aᤠ 4/X0@#P00S% 00( <0R 10 1 @套0 T0 0 0U>00>(m@P@Pf #P Pz R R 00U>000 C(H)10S@0   @U. p) (000 8Aᤠ4/P#P  p000@P@ Ro 0R  CU800000008A ᤰ4/@0X0#T00S 0 #T T0S0S0<&T@0 OoB0CB001 tb00 $Y @ 17匀00008A ᤠ0 4/#P@L  @P #T 0 T0C00S @T@ @Җ0 00 S00  P  弖t60Q &(10(1Thod6@Ty 0S0Y @0 00000D60S: 8, 5(6P:# 80  <0L P0C1001008 ԕ 0`000d0嘚*0<00L 0  ! 9 000d5 000 s 00bR0d`0Y B  P:dd0 00 0`0542(8p  ,?$<'Xy,XX0la0HS^@2 00?]9V;000S  0  0,( 댐48$ <8<@|@00!>0 R03.: QZ# Z3#8#(,  PU0 :8.塓0 0 0 }.M0S<Ѝ8< 8    08 08  0`HX^$X^D^Ĝ0@-@ P0 M0   0CD T P  0 mЍ00@-PM8  @:8v.?0 00  Ѝ0@q.Ѝ0S O-@$MT߻P`L Hp RQJPP0UPPӔ0U  QS 0Q P=`0S00S pQ0R@6 k1 1H!W?Q000 00U0P00H0 00000`00X0S"181ql$ЍP0PP\0001 1pWÏl0Wk1 0<U("181k/_Q^eQ^QkQ^Q^C-DMP` p |a <  0$ 00 0@ "400 00 0 ]0|0 0 P0 S  va P raDЍL\ 0 \0? 0 0 90 0 0 0Oa 0@-8@ h0l P 03P3<P<#/G-@$q`0d 00000`Pغ`0d P Z000Pp"SR \ R3#. 2- 9- n8   088  H@p 0`( "4`#/O-$} @ j !0q00j0a@S 0F  `jF` j0 S  0 `@jjPU- 00jHjo?0尡Z | Q ! |! BR!!j Qoj0S 1S10C1j0S j \jZj0S hj 0XS  0 jj Aj$ X Q^{{ļ @-+j0 00{p@-<@P(j0@Sjjp 0R@{C-@M@jT010#P,q,a 0 0R0U0S; AJj  0@[WPiU    0SP@T  0 0 R0S   0 i !j00C0 jЍ{ļLQ^K\Q^@-@i{O-@Pp`0l儰1 ' ;1_>0,0000` q删!!  *P!X& _! ,++:10 0 P4 ,P !*!0l 0 ?4 ( 40  ++!⼧\Q^R^G- MP  p@` ?@T Ѝ Z@ʟZ R00 00@@!_TP0T00PP᝹ $ P0Q\(0  S  @0 0000(0O-@,MP0p T0P`X 10 T0 0C S 00   @P ᅏZ? 0 噸0P0? P!KpC!0 SH080o@k ty  004005000@@S?0 S0 J?0 B?@<?-Q P@ 0P 00T 0,Ѝ@0S   R00   S @P ~Լp@-@PIh0  ?p@hG-1Ms:hQa0S 00nwhЍ@T0S_@lhU  PD 00 0_h0  $\P ! q" S R- Z03H0 $0X\ RP(0` R  X000 R 000g 040 0@0HL RP0P R 00 !/ >{̼{\Qp@-@ @Q>\0@$0@0$0ppPg$@gTp\0$00$0$@p@-Q@pP @Q>@pgd 0$ 0S (0, 0@@gd 0$ 0S (00, @@p@-p`Plgg@T 0S4` 00S0C040S00  0S00@ p@g@̼{@- 0g@0{ R^@-T@0S *g00c,0Sfg g@u{{A-pM0S S\1 @#P1P!PCh0 O4a4!cf R100 0MT@P 0gЍ̀`V@0@0P `X0 h00|400&0@00S`000pP 4g@(R^R^{0M T 0(T@0 0 07T0S  H8 DR2320   (T @R^R^O-@Mpᜇ84@P0S0㨇0@0\<`4IW00 Q, 3Q00 3`0 0'00C0@@0SPD0@H0`2 #101Ѝp#0 00\30 0400D300P0@0 00  2|Z @H%"[ @ R20 030000 3SH0L RP \0 0@`00^ P ,00 B R  R@0 00  `!H0GS5040v400 3SH L0SP0\ 0 㿆0`@0 <  0CS00S0$000 $ `J430W0B 0 3SH L0SP0\ 0 ㍆0`@0 <  0CS00S0W00  ;<<@Lp@HDTR^@-8@;P(0, 0(00 , @}h7@-P Hc d \@200P.0 800(.0 D@@0Dp Ѝ0}4KR^@-4,$0@H]cP(p@}0/}@-@HQc00H@c}@-Q0   0P0"3 \ 0ЍA0C-P4 " @ 0@P s0  000000) 0@P t2h"1ښ@P 00 Z9@  1 $R00S 4 `P 101@@Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ ;@P1@010@00@1#:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S   000000t c0 R00Vtp@ሀ@M@\h S^O-P`1 @pᐑ吡!@P4|qdVʀ 0! $X!0 P!H!   !,a0S2;b 0! d0    !tT# 000  귱@Pr8o?P 0 R (@- 0@\h}$~S^G-0@@p` !4#Q!PP 0S  0 P4 P 00 0P@0Y00 - 8`hX21<1œ22{<0P PXh 0  l (0Rd"4U 0 0 0(0$ S8" 10 1, 21 R <0L`R0Ca0`a``( R 0dSd0(0$`V !0000S8 R40C BS0( R)0  0&R 0 sP 00@1004 0  08/P Pp00#P00S 0004h0 0 0 0(0 0dSd0(0d00 SPPw4{z{XT  o v z0  兒\DX^p@-@0` P%@PP pC-MHoP`p㨂 h(@P ЍP  ``.PPLO- QDM` @p ,0  0,@(p$` `` `<BS/$ 0'   0  <4,@(p` `,P P0  0<40@,@(p$` ` `DЍDX^pLA-0MP0`0 0p` @J0 P 00 0000@?o2P0SЍȼp@-M\  LP00  L?\@ R` 0`@P  0T@@I @P ,`Ѝp@-t-10 0S0! 40̡@-)@P P /EؼO-$DM00p@00D $0e8 P``8`# #RH LQ\P AVL0S0P0\ 0  0CS]uVڠ , BVOL $8#`P yC800008$00$000$0$000Fa aF1(L}0(04000 0 `P a4( <000CS0(0 ,  PP,  0ty`DЍP 0 0<^PPV 04 (P0 00C/S00(0 , 0 rPP,P t0 PS!t tPXXt p0 PS!pPppQ00 S Qppx0 PS!?0x0S Y ?0Spxp 0 Isp p P0r05q5Q0ao0a 101VpcX^O-6LM$3@ 0080 0p圀0*|W 1 0 %W000 D ,0) WP@ 8Q```# #RLH LQ\P AQL0S0P0\ 0  0CSbtVCK , BVTL ,@`P0080000<0  0 `P aWq 0<0 D0000CS000W 4  wPP4 N 8Lx`LЍ@0000@,00,000,0000Fa aF1(L Q #RH L0SP0\ 0 %t@ 0   @, <  0CS00S0 ,  0 ,0yP 0 0DPPV 80S 0S H8w< W00 0 4 0CR0000 4 PP400'R 0<W0N 0=P:?;;0P4;T0P.p +_[[PpT[tPp?;;0 4;PUĠt (P,pP  0 0$P4P0 P$ 0$8C2 |2 0<0:t0p0x00008|0l 0 0X 00 Pk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 0?PK0 TP,E!`-0  0S0p   0 #E P0S00000c\0 Pp0p  A  P ~ uN7 5o3v1zu(ȼX^X^X^X^h\ؼX^G-PR M 0GS p`0 V Q 40p @P!00(0 0,00000  t p $ x ( 8 , < 0  4 | <08 l D0H0@ 0@ Ѝ0SK@0 J@p VS  7<$(, 0 00@SD@hD @P6Z^DY `0 A@P)Z `ZNDY 0D1@PZ `000髖@P 000 s@ JDHD FD@@A-1Ms1P@<P0< !0 0ǟBP_@P BЍ0( A(0 !    p@Pe  |0p0X0 0(0"@P( P( $fJlt_5`d0@`;Ts!(p"W (.ˁX^ؼ)Y^5Y^ 0`( "4`#/@-0 $0S\ 0 B @B24 b1> 0S& p@-`0 CSR!0@P P o 20 P e (0 0# KPp 0&p pG-p0M0`0@8 ;87PPi "\D00D0 D 0f U@(w 8QPPP# #RH LQ\P AQL0S0P0\ 0  0CSRoU3, BUDL (!PP00$ 0 0 0 013 PP Q 00 0,,PPK s0Ѝ(0000(000000#000EQ QE1(LYQ #RH L0SP0\ 0 ro( 0   ( <  0CS00S0   0 0,00S00  R,0 UpY^O-0lM 0H)@P|0圀\0|0D  0 p,0 @@U`< 8P  " Q.HLP\P@@ @DZL0S0P0\00C SyoZH AZkL ,<P@P rP<0000<,00, 00 0,0r000J! !B1(L<8 @@@ #RHL R P \  BT|H L0S0P0\ 0  0CS nT<0000<,00,000,00DA AD*00010(LaTP QH L0SP0\ 0 zn< 0   <, <  0CS00S0 ,  L 0 ,02<0 D #RHL RP \ ;Ln< 0   <, 8, BTL ,<@PDY2P'r?@ X808 00U0@00S0T0S@lЍ, BR  R ,  0,0 0r<0 B #RHL RP \ 9 0 ,<J@P@004000080 0 4@P AU 080 X0000CS000( (  PP(  4q@P, B[ ,@  0,0?0 0K1 1C! u2P 0 0 XPPX0 080 P000CS (  `P(  4sq@000(2 0R$78 00 00CS000 (   y`P(`X\` `HL`'S R00$00PS;#S R7800C?o2080 Dp000CS000 (  @`P( PP" 0 0D`PDp[`$0S0S P00`X0 `?o2X H(P 4pP0%'TZpY^\O-0pdM00 ,0`0SPdЍlV$HH&圀t00t0 $0   , V@8u 8QPPP# #RuHL R \P   BUL0S0\ P00  0CSPlU`N, BUBL $8PP |p`800008$00$000$0 000EQ QE1(L@0SI\p`?P V8080 0HK,00S0U0SPqQ #RH L0SP0\ 0 :l8 0   8$ <  0CS00S0 $  0 $08 ? PHLPP\ 6 $8fPP~,00(004 00 023OPP mQV 4( `000CS0(0&  @P  0oPP  @Q0$P000$0]000A A1 2 0R44 (0 00CS0(0   @P 3P T.X+'' SR0 000HS# SR80Co4( 00 P 0   0@AЍO-p0PDM,sr`l90V0< 4%P00P0H $0O8 `@@8@C #R7H LQ\P AQ9L0S0P0\ 0  0CSeTHht0 P@ X@ @T@ T0S@DЍR 0, BTQL $8@P2 i TT0S ,sr 0S 0T00 0 @800008$00$000$0000DA AD1(L080 3SH L0SP0\ 0 Je800008$0 <  0CS00S0$000$00P# @04 R S 0(0400 0 0 013i@P A4( <000CS0(0 ,  `P,  0h@fRSP 0 0<`P<T 0hTN0K 00G 0S S@A4( 000CS0(0 ,  `P, L @DЍOsS@ ӑ 0@0T pY^p@-`P@M8  ;8|P00 i  08 H@   0 013/Ѝp^ @-p`@M8 % /   CP000  0H X@  0 013/Ѝ^  0/ R !0!@3 #Q1#1@281Q1#1@241q#@2q#@Q@/G- `08MP0 0C, S0, 0 @8Ѝ 0R@ #p000D (0W8 P@@$@# #RH LQ\P AQL0S0P0\ 0  0CS]cT|, BTOL ($@P g$0000$(00(000(09000DA AD1(Lo <2, 3   !  @P A , 4000CS0,0 0  PP0  dg@hP 0 04PPPT  , 000CS0,0 0  dPP0 00CS0 0  0 0C?o20 0R 1 ^E?P? 0H03!@P 0 8ЍGTM|Y^pY^Y^\p@-@ `(MP0b 0 0$00 000 PF@P A f(ЍpO-dM000/H0p0H0 <D ` $04 X@4r 8QPPP# #RaH LQ\P AQL0S0P0\ 0  0CSMbUV, BU?L $4PP fX400004$00$000$0000EQ QE1(LI4$^0q  R[ 3SH L0SP0\ 0R^b400004$0PQ #RH L0SP0\ 0 Eb4 0   4$ <  0CS00S0 $  L 0 $040 3SH L0SP0\ 0b400004$0<  0CS00S0$000$0h<004 0q s R> 3SH L0SP0\ 05a400004$03R 3SH L0SP0\ 0 a400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0:00 240q u R> 3SH L0SP0\ 05a400004$03R 3SH L0SP0\ 0 pa400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0900(,4q|0 } R> 3SH L0SP0\ 05(a400004$03R 3SH L0SP0\ 0 a400004$0 <  0CS00S0$ 000$000<  0C S00S0$ 00 0$0800,v(s80 ^0P3l:0S#S$Pe PPe"_؀(,x1 3PP!  0JE0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s Q003 rPPЍPO-00$`pT0DM|0T0 D $0  WP8 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS_y]T@ڔ., BTQL $8@P00000H3(4  3@P WA 4( <000CS0(0U ,  [PP, L 00a@DЍ800008$00$000$0000DA AD1(LQ #RH L0SP0\ 0  ]8 0   8$ <  0CS00S0 $  0 $0P 0 0<PPT 0`4( 000CS0(0 ,  @P, \ P 0`?@R 0 @P@T4( 000CS0(0 ,  @P, 2 P 0`H@\WAT!pY^O-0 0p0/PTM:0`<0,0SP0,0(00P 00[M%X00X0p0( [ 0$0400 @SHt 8QPPP$ #RaHL R P \  BUH L0S0P0\ 0  0CSN2\U , BU@L 4HPP! ` 7TЍH0000H400400040000EQ QE1(LԻH0A 3SH L0SP0\ 08[H0000H403Q #RH L0SP0\ 0 [H 0   H4 <  0CS00S0 4  0 40<  0C S04 00 0400$ ,0<0PS5 630!0D008@0 00 023PP jQ0LSf D8 000CS080 <  D@P @e_PM,P< P 0 0D0LK@PLU@4D8 000CS080 < 8 D_@P< D8 000CS080 < 8 DG@P< p0@P@_HP0 0D0L@PLP 80DP @^ P@^ 0K0 00S Oo0BS@T@$0TPUpY^O-M<00`D  T P0 @0/P:0 <(0007^00(0`SX040H00L0m0$`40 P 0S`Vڨ+tPH\00\0 0SP1<0,PS    T0(0 pSd 0Q8```$ #RHL R P \  BRH L0S0P0\ 0  0CShnZV/ژ #, BVZ TdL `P: P^ 4r<0S 700C00S{ʐ77D0$ V 00Ѝd0000dT00T000T00Fa aF00010(Ld0\ 3SH L0SP0\ 0SZd0000dT0QQ #RH L0SP0\ 0 Yd 0   dT <  0CS00S0 T  0T00 L容d0 3SH L0SP0\ 0Yd0000dT0<  0CS00S0T00 0T0C@=D0`8` <0S~ `Y HL D`P   T\P$ A# d X`P0 0C0000 00C00 0 060006  d B 00X0 0`00\000 00`63`P a(0Sp `X p000CS0X0- h X `ZP$ \0] `<  0CS00Sb0T000T0 } T0d`P h L5 0RK` X0 0 0CS0X0 h X `Ph8 0pt|x8 x\^00@000\04\^8HoᨂhlP\0p 0B?o200080@08`X l000CS0X0 h X `Poh >P0 0X 0`0lP_80lSp @0S*X P00pX0?o2 pP VV` X0 00CS0X0 h X `pP \a\`P0%'hUP\Q\`U0PE 000,0C0 0000 0S/0 000$0pS SPpp u5Q> 0PQ 5$p[ P0hH0\\V 0, X0C 040040_ 0 LP0$0, ?oU20SS 0 E000 0C0000000 0S 0 59$0 0P  0⻷$0SYQ0X 0`(0‐PP \[`wꀐ(h|`VbY^Z^pY^[P<{ 8P  # QHLPP@\@@DZHL0S0P0\00C SVUZ ` AZHL ,<@P Y `<0000<,00, 00 0,0000J! !B1(LQWOmY `?@ [808 8080V0@00S0T0S@lЍP QH L0SP0\ 0 FU< 0   <, <  0CS00S0 ,  0 ,00<@0 3SgH L0S0P0\ 0  0CT}H L0S0P0\ 0  0CS UTW<0000<,00,000,0000DA AD $1罴< [ P8@@@N QHLQP\ATDHL0S0P0\00CS TT <0000<,00,000,00DA AD;00010(Lr < 0CT0$ ,<@P ATL ,<@P0S 0<@0 3SH L0S0\P00 0CSL0S0P0\ 0  0CS WTT<0000<,00,000,0000DA AD 1@0000 08004000 00兾@P A[g 80 p000CS000G ( 0 80PP( > `4X@P QHL0SP0\0 S<0 000<,0 <0CS00S0, 00 0,0 0@ < 0CT),<2@P 7t 0Rp`p58 00 00CS000 ( 0 8PP(H`X\` C`@L`HP;P'SR0000S#SR8``Foobp8D0 000CS000 ( 0 8PP( lP 00 08DdPP`DWP 0S&V P00PX0?o2X HP 80 `000CS( 0 8hPP(  4=W@`P0%'0000 R p58 00 00CS000 ( 0 8?PP(pX\p `LpHPP'SR0000S#SR8ppGor8D0 000CS000 ( 0 8PP( |`P 00 08DPPDZP 0SW P00PX0?o2X HP 4VMP0%' `TT1T ZpY^\@-4 0Ü   ЍO-p0\M0 0@ 0 00圐$<S0  D0 00,0*0 00, <00 `SPu 8QPPP+ #RH LQ\P AU!L0S0P0\ 0  0CSPURU  0 x0?R*`b, BU:L <PPP 0VP0000P<00<000<0000EQ QE1(LP0[ 3SH L0SP0\ 0RRP0000P<0PQ #RH L0SP0\ 0 QP 0   P< <  0CS00S0 <  L 0 <0宱P0o 3SH L0SP0\ 0fQP0000P<0d<  0CS00S <0    <                0@x-00L00H0000  06 3PP Q0SZ L@ 00$0CST0@0" D  L`P H_UP\Ѝ<  0CS00S0<000<0D P 0 0LT6`PT0$0UHL@ 000CS0@0 D @ LI`PD 0000L@ 000CS0@0 D @ L0`PD `PFPL@ 000CS0@0 D @ LPD  Z#3PHT[0k i0 08#800C0 0C00 00 0 0C0V` !8888YL @0 0 0CR S 0@0 D @ L`P?D=:(70@S`HTHP1S0@0 D @ L`P D(,kX04 04 0000C000000C0  A0XN0 [p(00`Ḁ 00 L 0C00 00 0 0C0 @0=P H:T PH`0 H ś0 0C0000 00C0L @0 0 0CR. S 0@0 D @ L6P H TPL @0 0 0C R@@L`P`DV$ 01  S0@0 D @ LPDV w  000S kUpY^O-0M0@00`p$ h,00+000\ 00 8 PPDP+ #RH LQ\P AU!L0S0P0\ 0  0CSYOU" E0 x0?R*, BUCL 0DPP$ kS,P Y zЍD0000D000000000000EQ QE1(L'D0 3SH L0SP0\ 0 AOD0000D00 <  0CS00S00 00!0000 400 0 0@000 000000 00x0p00<00$0 08 3TPP Q@4 L000CS040 8  P <RPi8 qP 0 0LĿPLU<W@4 000C S 040 8  P8 0000GPGP@ 40 00CS040 8 4 @P8) [#3P<R 0Sc0  0 08#800C0 0C00 00 0 0C0X !8888@4 000C S 040 8 4 @oPm8 0 00@S<;RHP0,cX0 ™0 0000C000000C0  A000XV0 ` 0 000 S0Ḁ00  0C00@ 00 0 0C0 40P <Q P0 H H {0 0C0000 00C0 0000@4 000C S 040 8 4 @P <Q PR@ 40 0 0C R0404@P8 X 01 00C;@ 4P0 00C SST040 8 4T @P8T a@4 000CS040 8 4 @P8 PQ @4 000CS040 8 4 @}P8 0@?S@ 40 0 0C R 4  8@4aPG88 S> L`P8 [,Hp0 ,⫼X H0,P0 11x C60 0hd,P YM &0,0@ 40 00CS040 8 4 @"P78M<0 H0FPH0T0,0S040 8 4 @P8w P@4 0 00CR4ղ4@P [UIpY^ ^O-00p L0DM✠0L0<$ H 00$0 P 0 `S8^ 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS9~LTڜ3, BT+L $8@P aP800008$00$000$0000DA AD1(L&W4CP?@Pl0SQ #RH L0SP0\ 0 6L8 0   8$ <  0CS00S0 $  0 $08@0n 3S9H L0S0\P00 0CSdL0S0P0\ 0  0CS KTv800008$00$000$0y000DA AD 1篫p00(40  h0p $@P Al00S0T0S 0S> 4( 000CS0(0 ,  @P,  0O < 0CT0 $8@P )*0@?S`0OH@Pl00S=T 0l 08 U6 x3 `4 (p0 0 0C R (  , @P,pl00SQ  TP 0_ 0 L.`p 0 @P  P0AODЍ 0@QLE 0 L  L 0h`L0 0 0  10-@lЍ, BT3L 0@@P ZN@0000@000000000000DA AD1(L0S;;N?@` V8080Q #RH L0SP0\ 0 'J@ 0   @0 <  0CS00S0 0  0 00@ + PHLPP\ " 0@S@P@V0  R- 3SH L0SP0\ 0$I@0000@00"  @Q00@00000^0A A1 啩<  0CS00S00K000 00;?@0q E R 3SH L0SP0\ 0 I@0000@00 <  0CS00S0000000:00 @0> 3SH L0SP0\ 05eI@0000@003R 3SH L0SP0\ 0 NI@0000@00 <  0CS00S00 0000000<  0CS00S00 0000000@0 3SH L0SP0\ 0 I@0000@00 <  0CS00S00 0000000@0 3SH L0SP0\ 0 H@0000@00 <  0CS00S00 00000008<@tz uTZ@0  \ #RHL RP \ H@ 0   @0 , B R  R 0  000408(@%HL@tz uTZ@0  \ #R HL RP\ A Q nH@ 0 @ 00  00040HP00CS@0 3SH L0SP0\ 0DH@0000@00\ #RHL RP \ -H@ 0   @0 , BR  R 0  00040@0 3SH L0SP0\ 0 H@0000@00 <  0CS00S00 0000000U k\ #RHL RP \ G@ 0   @0 , BR  R 0  00040]@0 3SH L0SP0\ 0 G@0000@00 <  0CS00S00 00000001<  0CS00S900000002  0#0<00480 00 0|2 3己@P `AV <4 000CS040Y ,  <a@P, P 8R 3SH L0SP0\ 0 1G@0000@00 <  0CS00S00 00 000D1R011 0008@p 0B`HP0s0 ?@c<4 PP000Cg S040 ,  <@P, k0@?SP8JH@pY^d`hT^ ^Mb\P < 40 0 0C R 4  ,< @P,e00 H0@P]H0VT6 <4 000CS040 ,  <@P,  8{J`Y> x;[PP <4 000CSST 4 T <L@P[UPP% 0 0<XXI@PXV <4 `000CS040 ,  <]PP,  82J@[@(00@2300 h@P(0Tl2 0R 7< 40 00CS040 ,  < +PP,PX\P `LPHP'S R00 00S;#U[7800C?o20<4 Dp000CS040 ,  <PP, f`P" 0 0<D⹶PPDp[P 0S 0S P00PX0 P?o2X HڶP 8IT# i$0 I[P0%'T+p@- P`0 PP@0 {p0O-M , H0 , R 0 ЍO (00 $ $8 RL ( D <  @ /``00`0@0D   L0 0 PS`y 8Q@@@) #RVHL R P \  BRH L0S0P0\ 0  0CSS!ET0$00, BT@L L`j@P H`0000`L00L000L0000DA AD1(LĤ0SHH?@80VT00S $0S S V@0S оT0 ăQ #RH L0SP0\ 0 D` 0   `L <  0CS00S0 L  0 L0` , PHLPP\ # L`@P` 0Q  R- 3SH L0SP0\ 0$wD`0000`L0"  @Q0L@000L00A A1 ,<  0CS00S0L000L0$0S]40`0 3SH L0SP0\ 0 0D`0000`L0 <  0CS00S0L@000L000P0 0\00X000 0:3\@P A 0S \P 000CS0P0f T P \@PT ] X$x`0q E R 3SH L0SP0\ 0 C`0000`L0 <  0CS00S0L000L0T900E`0? 3SH L0SP0\ 06C`0000`L04R 3SH L0SP0\ 0 C`0000`L0 <  0CS00S0L 000L0,800<  0CS00S0L 000L0700`0 3SH L0SP0\ 0 GC`0000`L0 <  0CS00S0L 000L0,700`0 3SH L0SP0\ 0 C`0000`L0 <  0CS00S0L 000L0|6008p<@tw pTW`0 S \ #RHL RP \ B` 0   `L , B R  R L  0L0408]@ZHpL@tw oTW`0  \l #RHL RP \ cB` 0   `L `\ #RHL RP \ B` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 dB`0000`L0 <  0CS00S0L 000L000, B R  R L  0L040HP\ #RHL RP \ !B` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 A`0000`L0 <  0CS00S0L 000L000R 3SH L0SP0\ 0 A`0000`L0 <  0CS00S0L 00 0L0 81R01? 10000 086@p ,C`-H*P0s0{ ,?@c t\P PP000C S0P0 T P \@PT 0@?Sp`PX\EH@zpY^` ^dMb\p `P\ P0 0 0C R P  T\Pb@PT[00 h0⊸@PSh0T00 0S+ \P 000CS0P0 T P \?@PT 8WPP \P 000CSST P T P\@P!WUPP* 0P \x00x0@Px00 0S \P `000CS0P0 T P \PPT  XD@pW@H00,2300 @PH0T0d2 0R04\ P0 0 0CS0P0 T P \PPT=x|p 7P3lh0.px |00\R  4 RI0 4 QSD80I?o200(0S> &QW;pppGor\P d000CS0P0 T P \PPT 0P<0& 0P 0\dEPPsdY`40SZ00S P00`X00(pp?o2x hcPp ( <0R0(0X#DTA80$ R00S x@m#sr8$srH(5 3 )@P/09 ,0 @0  808(0S0ЍP0%' ~TO-@ 0lM/00p0@@P0\@h00h0l   U (0 L0  <  (0" U`<x 8Q" #RH LQ\P@@@DYL0S0P0\ 0  0CY?Y@E, B RL (<@P sCP`!<0000<(00( 00 0(0000I I 1(L600SKPPC`?@0D?o@2Q  RTT0SQVt U8080lЍQ #RH L0SP0\ 0 -?< 0   <( <  0CS00S0 (  0 (0< 0 PHLPP\ ' (< X@PyU <K0q ` R/ 3SH L0SP0\ 0&><0000<(0$  @Q0(@000(00A A\010 唞<  0CS00S0(000(0:00><0> 3SH L0SP0\ 05><0000<(03R 3SH L0SP0\ 0 ><0000<(0 <  0CS00S0( 000(000<  0CS00S0( 000(000<0 3SH L0SP0\ 0 B><0000<(0 <  0CS00S0( 000(000<0 3SH L0SP0\ 0 ><0000<(0 <  0CS00S0( 000(0008<@ty kTY<0 S \ #RHL RP \ =< 0   <( , B R  R (  0(0408Z@WHL@ty jTY<0  \l #RHL RP \ c=< 0   <( `\ #RHL RP \ =< 0   <( , BR  R (  0(040<0 3SH L0SP0\ 0 a=<0000<(0 <  0CS00S0( 000(000, B R  R (  0(040HP Z 0 <0 QHLQP\w 0 (<s@PU<0 3SH L0SP0\ 0{=<0000<(0y\ #RHL RP \ << 0   <( , BR (  0(040<0 3SH L0SP0\ 0 <<0000<(0 <  0CS00S0( 000(000v AR( ( +0 0 0C11C!0 _t<  0CS00Sz0(" 00 0(00 1000 08@p 1B`HP0s0 !?@c@004000,8 0 0D13圦@Pp UAn T`8, 000CS0,0 0  E@P0  4@`"PPK 8, 000CS0,0 0  (@P0 0@?Sp 4?`H@PpY^` ^dMb\8 ,0 0 0C R ,  0 @P0``H0 &@PH0T` 4?`8, 000CS0,0 0  ۻ@P0 OU P-@8, P000CS0,0* 0  ΆpP0 ! 4?@P 8, 000CSST , T  p@P 0 0XX`q@PX` 1 0R88 ,0 00CS0,0 0   セpP0X\ `LHpP'SR00$00S#XW8Hoᨂ0 00 0$08, D000CS0,0 0  DpP0 PP 0 0D pPy 0DSp $0SX P00pX0?o2X H/P 4>P0%'@ 0  y0X0X00,4 3 00 0@PX0T`00@`T ʴU`YEUO-@ 0tM/00p0 P0,@\0U 0d0<0d0$ H 0<@  00   U`H_ 8Q" #RH LQ\P@@@DZL0S0P0\ 0  0CZ;z:Zh/, BZ-L 0HȻ@P ]>Pp H0000H0000 00 000000J J 1(L 0S3P;>p?@`]Q #RH L0SP0\ 0 0:H 0   H0 <  0CS00S0 0  0 00H0[ 3SJH L0S0\P00 0CXQL0S0P0\ 0  0CS 9XtH0000H000000000s000H H10 娙HU0 | KqU R$ 3SH L0SP0\ 09H0000H00 < 0CX 00 H@P 9<  0CS00S0000000:00#H0> 3SH L0SP0\ 05|9H0000H003R 3SH L0SP0\ 0 e9H0000H00 <  0CS00S00 0000000<  0CS00S00 0000000H0 3SH L0SP0\ 0 '9H0000H00 <  0CS00S00 0000000H0 3SH L0SP0\ 0 8H0000H00 <  0CS00S00 00000008<@tx eTXH0 P \K #R HL RP\ A Q 8H 0 H 00  000408E@BHL@tx) eTXH0  \o #RHL RP \ f8H 0   H0 c \ #RHL RP \ v8H 0   H0 , BR  R 0  00040H0 3SH L0SP0\ 0 I8H0000H00 <  0CS00S00 0000000, B R  R 0  00040HP<00@0004D 0 043]@P AU( D4 000CS040 8  @P8  @;`pP U8080<00S0T0SpV ı,003 3 00 0@P,0T`0K?o 2R0S@  t 00@`R\ #RHL RP \ 7H 0   H0 , BR  R 0  00040fH0 3SH L0SP0\ 0 l7H0000H00 <  0CS00S00 0000000:R 3SH L0SP0\ 0 B7H0000H00 <  0CS00S00L! 00 0000,1000 08@p 1B`HP0s0 ?@cD4 P000Cg S040 8  @P8  @:|0@?Sp`@:H@pY^` ^dMb\p `D 40 0 0C R 4  8 ۶@P8 @:00 P0@PP0UT`2 D4 000CS040 8  ᶶ@P8  @:p`#WP D4 000CSST 4 T  `@PWX 0 0```_@P``@U D4 P000CS040 8  rP8  @G:@jp`02 0R $4D 40 00CS040 8   NP8`d hX' SR0 0$00S#YX8IoD4 L000CS040 8 4 DP8 PP 04 0DLߦPLZ㜀 $0SY P00X0?o2` PP @9P0%'T V [ `tЍ ίXZLO-p M0`t0 00Se$㪱@3hAƯ3 1 H`Po 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0*VPP PU 003 00 0H@Ѝ000zS0P]$OZ^$Z^^G-P `Mp'PL0S@ P 0 t003 ՕP@( 0U&2'ЍH0S0 RP@5P @ IP0SH0S300 10 CS 8:81Z^G-`@0 S_Tp  SXἭPڜ0H0S0S 0 Pᶮ@1 3 00000 00 0 P olUU0S 00   sT 0S 0sTᘮT ီ ᒮᐮЍ0 PpO-0pdMA@dЍ%`000D $08 P@@8@# #RQH LQ\P ATL0S0P0\ 0  0CS14T, BTzL $8@P 8800008$00$000$0000DA AD1(Lٓ80V 3S HL0SP \0  B R 3800 80$ $ 00 0 $0t qn0(0400 00 00!@P ]A4( 地000CS0(0 ,  γPP,  07@B0,2 0R `54 (0 00CS0(0 ,   㨳PP,`P T`XP@D`'SR0000HS#VU8``Foob4( _P  0H 0`0p0 0p@D!, 8@0a\à0 Q0 a AR001S0 0Y T80Q [ አЍU Pd^^^f^tf^O-0@40)l"0<  Px0q M^\%<3R=SD^0#S\$0( 嵏0 $0 (u| RP$0 00 S21 00S  0IB˱ Q!^P   ^P P<@@ 00 PE000 ; cP_oQeP?$00P40S 00 _|4000P0x RH0x0T3S !!!$0$  ?00 1>  00C 040S4L3,0A`0 : S 0003#0 #L#32024P rg0pg0$0<Ѝ(0 (0 0 g0P f4P f TU T=_^@-003!z?` 0 Ѝ_^0@-qPM:Ѝ0@@G80@ 3P@z?00`0 Ѝ0_^C-M8`0@XP:@DŔ  8TAVp pϬQ @$ @T@ `8Ĕ< R d(P`Ѝ_^ `^O-,M 0%!@ 0={PP``]\%1R=S\ `1R\0 嵟 %{p1>0S100! 0 $=$Sv 01000W 00p50 00Tp 4$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍO TU I`^p`^O-MO-`LM4000p@ T0$00k4$0 00: S(0B(0@,0[ 00pv0 Ekv?0 dv0 00D0R ,P᱈0 U*Q6P ,0T0@#P!0;vH#0( PS0$3 0000040 40LЍL P* [Y LR ^*[PX P+K(H%Q!4,Z3<8  Y3R 080 !<SD0u0S0055 1!08Q< 0*0 0u 0S (X!0X 3u0 R0P!0 R/0P L#" [0L,"\ Z YH# XJ0L,"\ Z YH# X0L#" [0SB 0C0?,@$@ sC+M`a^O-,0`@p(00P  ` L 0l7p0t ̠\ fQ 1K\Nt0 0/W  06u 2Ϡ!8 [ K P0 $u @?'u,`z@0A u0V 0SoL#" R: Ϡ!800L#" R*080G-p$0P` (0@  ` L 0l6p0t ̠\ TfQ 2I!0Rt0 0/V  0t 2Ϡ!8 Y I100 t P?t,`P0A t0V 0S ?tL#" R: Ϡ!800L#" R*080O-@pP4M ů 0mt`\Ŕ5$!\X    0 T0 L)L,)l"3`V006V ᪣@A(㞣O-`0$MЅpP H@! !   0@O PbX 0 H@$ЍOK  Y T0 T3?Q\ 00S P `0S@ $ЍO00 Y  0 00 T" @pP `@0S t0 SY @i000 $ЍO$Ѝa^O-TM|00@ 00sc000P40`0x Cs cq6rc4D $`<0p@$!c 0 Lr`pVp0 00000㛷P Tk(5 00 00 0 00t0"ᆼT0,0P0S  ?rp,00`2@0(0C$0L3T 2 0$QS8$0<4Q4 0000400S S<0SD@$! 0 q$ 4P`p`7` 000 0p40P0`0080S 00S" 0 0 0 $0 0Rh  h    $  0 0000S! T0H C)C) c1<62 8<0+^H00( C0qH0vH0 , H0 00S@;H00000 00_PW TЍ08S@ 0<0 ?D0 0 0/0S 0/<S X0T0(0 7Ϡ "\Ŗ%\    0 T0/ LL    )pL)l .300^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ LP 7[(Qb  $  \H000$ pH0;H0 , }H0 00S  00S  00R<0D@$0C!d 0 +p$ 40`R0A|00S p b006@4"w,C0S HZ(a^9a^a^>MTU TP0b^]b^O-p`0P4M 0 ?o0@00 !0\%0$01R 00@ ``&!! X0 00HP@? j4*!, ZS QS:]P ,l 00\ Ó\ Z4Ѝ $0 R  X   !,ZTb^U O-P0@Ḡ $Mo0\ `#,^ 00 0T ? A)A<)a>21,, X :@ 0@Pʹ]P h 00Q Q  Z $ЍH  0 0 PZTb^U O-PḰ@ 0$M)o0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X :@ 0@P@j <]P h 00Q Q Y $ЍH  0 0 P6ZTb^U C-`PḀ@p 0Mn 0\Žß0.S\! 00 Q    ` a 00T 40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PUP0s40\pdT80< L31)l< QR>QR!<`0d 0001 P sY40P 1`dP<040 pL `l\0<726, @ P0Hd6:0000@ (0 00[P0d0(T0(d C)CR)0c\1S"8 QR!<`0d 000100T:<0 &"40 `0010 0Mp0$0101 0 "p `@ H0PP0805@U50P%P0L05P000T40 `001 0 0%p00101 0 0PPfd001Pp 0 0T0 C)C)ct00<21 ( 0DP0 c0S C\1^1 U  U `  Rc ` < #.36,P Y*85@%00L 0404 00R  Q RH 00T\%40 R  !!p0p01@ @ 0 0Pp0$01 0101000040 0@0 0-PP <0 B2 b061")(!}''0001S 1' X X0P 0 PL< l52>p, ᇱV Q0:1S 000000 0(ZXU8U@e8 L0PP`P`U1S 00P000T,\% 0 R qq p0@01 0 0@9p0$01 01 01 0` 0Pp@Pu''000Q0805@U50P%P0L05P000T0 p001 0 0 p00101 0 0PPJ1S 01Pp 0 0T0 C)C)ct00<21 ( 0&l0000 0($P(l00Cl00 01 0g00T1 P  0 p001 PH000 0 0 LPPx0gd000 000g0T0 C)C) c1062 *(PPdWPP0 0ap0T000400`0  0 F Ϭ 0f2fUd000 00 00  00Pd0+ mUpG?o< 2R0S R&0 T 000`p<0嘐l0Xyd  0 ` 2( PdT~T< 0(bd0000000%FWP pH0p`d10 `$U040E" 000 00;R.1S0!0Y3 P0 c0S C\1^1 U  U `  Rf ` 4 #.36,P \*85@%00L p00W00W0SN 00T9\%0Ra !<  (001@  0P 0p0$01 01010000<0 0@0p0 0P~P 40 P B2 b061b 0`` 00( 0p !0001S P 1 T X0P 0 PB2 b50>" pPG Q0 :1S1 !< Q8U@e8 L0PP`P`U00T\%0 R qq(0@01 0 0@Sp0$01 01 01 0` 0Pp@=P0p Q0@558 50P%P0L05P000T0 (001 0 0&p00101 0 0PnP1S 01Pp 0 0T0 C)C)ct00<21 ( 0 l0000 0(H!Pl00Cl00 01Sb00TA1 P  0 p001 P@000 0 0 H'PPx0d000 000p`0T0x` C)C)ct02160" *(t PPdSPP0 0a0T00|0400`8P<0d000000(0!HVPPd00L0L 0ql0< R 0P00 Rx0PT40@H㑑P dR80slpJx`40V:[ h04Ch000T1P Pl0R 0 L0P 00 0 0X@H@0H 00 (0 0K@Hp001 P 000 0@00H00 0PPp4ph0400 0000T0 C)C)ct0201<" (" PP4 dVR4ph4SPP480< s0L <001d S<04p80P0`XR10J`Pu00TIL0 010l02H0 0 0p001 01 0000 0,PPV4 ppt0p!R  !  0  T B)B1) b072  0(u PP400407l0 2H0L qpRQ1S !00h  0 0(GUPP  0T0() C C")0c7#10 0 B d 000"00  ( 2 PHd0p ἐ?00T0 `C0)0c VQQ? Qf/" \5 S 0?!>0  0 F Ϭ 0f2f?Rd000 00 00  0 Pd0) +RpG?o8 2R0S R$T0 000`p80嘐l0Xd  0 ` 2( PdBQ>Q8 0(bd0000000%FTPd0H 00dQ|040n 000?Z00cTO-@Pwp(,`PT: [0 S0S PZ@V 0000000@@000@ @O-需TMpPE0SL@TЍ@PUPTPU z"衒( 0  (04 0D \ 0S,0@0H*: 00@0地<0 08000  R0%0%d*@|P# `2P P\SQQS8$0`AV`!QI ӈ@  1/@PE$0  00V$ 0e$@80< \0/\ \00 U0 P0P \0 @A!$ a5.QϠS =0P000 PEUP0{_o@RTP$PU000@@T9  @ ZQ ;Ã9ˁ0T @0 R 0@PPEUPPPPPሹ;8%P@5PL0PAO-p|M00-P `g븰[ 000kP|Ѝ0 00\@000S/ :0 80P0X00 \00&2T 00PT@h@p0l 000<0h0@S < `\P/ d U$4$Q4 P@P OU $P n9Π ^RQR.L N @n 18E \H(@@NUO@&0@( ,,00 IY!$? Z40 0$Zů $00:@  $ RPU@7 kO0@0(@@@ @L @ Q  N. n*< Π U 0 D   L @   D  H  $ @HR( LP@% 0@D TTw 0,0 X zPU@m"OV 0080\0000!Pi0   R  R*. RἜ@-售Zc^000S -/0   R Q   -//@-P`00S-@! < 7@P@P 0@0 0 P]@ 0S R 3z@ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 @P 0ST 0S@Pu@PL t0pI@p p G pp x뼰0@0 0  Cp 00 @W  A Kw@K0P L" l1. Q*s  S0 S 0 S00@$Ѝ 0p@ 0 t pt w t  xc  y@P ?  z  \c弰帀,  @-@@A-P@00S= 00CS9< :PP0Sk@p?oV20#S 00W: 0R R 0000@0` R y@@-A-P`00SE 00SC 00A0 @P 0S 0S@Ѝx@Pp &w뼀 0@0 0 Wp ]@ @ A H wHp ЍAp-@@@O-dM(00p400$00 0080@0000Q.40S$005 0 4$^b8H\0`0P00 00 P (0P6\0 44#T20T20$ ;60 0Rڼ圬t ?0:# 4080$0H0(#00壣\`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPj p$`W0@: ,0W0:F,Ѝ\0Q.0U 08T @)@)`"30&DPd 00\ Ó\ @x@0哸+0[0: 0 TU p0Sp/p@-@PM 00@0@ @@@㙘|`0 0@0@ @@@㋘P0 @@ @@@P ~ Ѝp@T i^̜8 p00CSp0/@- @ @T̜@-0 R  @ @0b ` 0iЍЀ-M zPhoЍ&i^O-0,M H P000 cp唖W X➟@?n /h+p+ 0 $+4fCP υ  0i % ! % ?\%0R004\5 P  ᶅ ,Ѝtl4RR  ᨅh0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3Zi  ᅅ000j0P0<(%0 0R@0@0 0T`0$S> ) %> 1S 0DV<3<30P4T$0X4S E>0X4'40`A#NL V$5S0P=$C[x $k[`P }PP/ *80HL0S40pH0pՓT0 C)C)0c"03BPP  0h  ?80`$%!0, R0 b0P T:꜀ \,Tἠ_<#| YP  0 ?<#Ή p 0Px 0T`0 C c00T0P C)CRQ 0)0c03":BPP ᛂP$Z"   >ዂc0400y0 4  Y?0 0* $?A@P40dɿ00\%R*   D&\%\%<R)h Q)8I 0 6VBQ !@40 0g 51 5 0P R   %Rh ?>0[Y@ %   ' 0S> ) %> 1S0T$0P40X4S E>0X4h04 S=0400P008T0<P C)C44)0c03"GA0P440$ R:=4 5Ҡ  0 Z00C?o200004圀AyL$%,0R00剃L0Y]$5S0Pň, HS4\S944S@040T3 0P1k[110 1<(%0 0R@0@00P :>0 $  * IP\ 0L0L0T h0E0@㿱4P Z=Ub0HV@2@20B00080 H0S0L0 C40œ T0 C)C4)0c03"@0P4 0,0f,04  =,04080q$%0 , Rr 0`p0(0 0t0D0t 0b0?o0cH0T0 0CL08048P0\Z 0 <Ѝ\4S{ 5  0V000  0j* m@tP 㲂$ᭂ00qi^8 TT 8T h^Ui^/i^0i^i^@-0S0iP@  sAY@0T  Ѝ 070@T 1XW070\`0u/PpQ0Y V4C^FX dˁi^A-P00`SP pX@P X@PH40  唑`ߒ@ЍC-@p3$M/P++  h0$+4`P6TO0h 0e0 51 50@0\%R=S04, 030304040 50e0" " 200(0\5W<`$Ѝ,:T8 O-,M@40AJp PL30U/o[" R ,Ѝ80HL0S40`G0`ՓT0 C)C$ `)0c"03=P$ 0je0$000Sr<8 P9G-p MR R`@A ZP   hPV!P4 kVPP0 RPq00mP V 0S 0 0R\RgV 0\P 0]&0 P@0&00 0ܕPϑU:040000 0bPP,V,`H`` P少U0x q0PxUp`y  咑~D~p`=S0 Po0-=S30N0SSP(0 jPPP 0 0S 50ó 5=S  0  PP Ѝ0 5< 0`V000L!L!$000C?o20000\4S 0Su/V0 5 0 5=S# U;TP=S 0 r1C>00~0SUT!010|PXPV^i^/i^0i^i^j^A-@`D1pPP d00' pP@=TSGP 0 U<=0S ㌮= S }$%0,RL1hP &000:0O-P@`=$MS =S  ∙UT㜡T00p@0 VP9UT 00T RdX4X T PpBT=S+ 000CnP$Ѝ u P }T 0(Pj} p 0   ÎXj^Mp@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0bP 9 ;909  000&00POP 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0\M0(0 0 0 ) 0% 0 000 ) S RQ0Sd0$0$ 00 0 ^0X:$0S$> 00嘠 =4000H 圐  0800Z08@0 @0<5 L <$ ` V p ࠱pZDppHpDP ``:` pPkYgQ VYp,pp8 p` P<nj pQ^njQ^,P V- p  0`p W V%  0r80 V 0(00 0 0P40S #H0 .`np`` ? u0:P00S P0S 0) 0p0`085< `F V`!V"40S n#H08<Ř  Ÿ   . ?9xD HLW  < W Q  #&&  "00`0,00,000"R0 0 00T;rTQQ80@ 0(00 =P;H0 C2 00000 0&",R0 0 00q[@0Sh0'C( 0C8RP] 000 #8 '(80(0PK $00(0 +\Ѝ0( 0 8 @  1/[!p@- @P彦 Pp0p@0@-@Pp9S ʰ;S  0"L`PQ 0 SL0L0-Ꭰd0P0 0  ЍԜ؜МO-pLMP4  P3s:Pp R00`5M:eP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@Q:0@(,,0N X !$[0$ [ $ D:8@\:P80' @DXT $@0,0 $TbY8 6080[ 0 0 0 \$  0 $ R0 8P 6 43LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@<:O-@P `R0 pM0 ЍO> 0 P0<:P: 0 6S 0\0:  ЍO㤰0 00S Y  ) R 0P0 1R H0C200 00 0X% P Ѝj^O-需,0 0/\*0 ,\0 0 ) o,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` *a@P 45" 0 @P6<Ѝ8e@5``L0`(04S U6oobT`V 00 0S3 6@-P`+Y@P0 0@P   0 00PV0 /ЍpvdC-0 P0`\M0 0 0S  \ЍC0 ?|J p py 0 00000.0>000 J@P9 W000 04@P, 70S)y 0 ,@@T0S3m 00S00@P  0  0@3 100㹉\Ѝ2 3pP 0   0,0A 3@NŀvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-i ^`R`    O-Mⴀpᜰ0X@P尐`00  0000X0@ 0 T 0X*Y   R  L \ B Pb<P" P VU Y PP\H 0  BUP$7#L A1 a<20! 00000P Cp R 01!01/P 0R0*@0 @!0L A1 a<20!  U@PY<  0Pw0 \000X0,00A0 0P00S<0 00$00 0(0( $0WT UcY000 &R00S P0Y0uL0 C# c 9!300 m0 6Sn 04 UD0 000000$ 00(0]3PP 0 =$05L0 C c#3800 9!600< 022#T20T2.P $r0 Ѝ`(0$ .4D40SU ^0Z000 Q00 R, Y   R 0@ D0T00 S 00!1 001/P00C0000Q0@p00 R ,  R0@ D0T00 S0 1 A1/P 0@p00  X  R@ @ CP R ' '1/P 0000ŀ@-0S    P (000 00 0 <ЍPN p@-0@00P`06/ 000`06/P s00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$0@uPEP0W(0,0ů _Øt1 000040 0 0JpP ẘ$uLЍ0x 0 | P ( 01/Pᤘ0@ 0 p 01/WH4QOpUp(6*C/Q @ ?QD   00ã 0P(NM4N\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-Pp@` M9S% 9S0 0 R( 0)9+ 00000 0000 8/9 ?o209S(0 0R  RVoBh 0l!  0`#Lc hQ Ѝ!r^@-0,@00V@"4/ЍATITs^p@-@0@000@@PD @DPPP0 p P: 08Sp0PppppTs^Hs^ ʠ,ʠ`@*Վ0  j@R  @ Ѝ@P@$A-`@0P00p0 7/"!""9:#:0900 000"" 0 0CR=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SP0sM!srI"srE00sB(sr>0s;x0s8|p q`0$E @100&0! DLQ# 0 K#0 0 p@PX0|0#880'00 Rd0X00$00|0 *P\PW,Ѝ z0s8 0@@z 0 { 3@*0 pH@P 嬰0 Rt 娠0 Rp000*P\P,"sr AQ@e@P#sr` $sr&srxG@00w0FG 0 @@ 0 p~@Pm#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P <0010 P *b00)0 p~@P# 9  :(090*P\Pp+-@@@@4t^A-`p0S t 0d0 0 0P0 Lf@P90V'gЍ@ gO-` 0M0kPR@X1)RP##G*D1 0PA@0 00~PPP79 08C890 000000p07/P |p 0 L. |[ P ) B(B()    ^yU y ЍC-` @PpTLp T, T4000S-@ Ѝ贀 f|@00@ ^L   b 8 00 0P @ x| 070 @ Lt^O-3c000 Qpq0$0 PcP cP cP cc (wX 01(@@3ȭ@-! @P  !2- $MD0< 0 4 40 , 00 0@ u$Ѝ3RN SN@u^p@-@ PQAc>c ;c$0@s5cp@ 1w@A- HP0D`p0C ##R@`V( 01S P ᘱ`0D1X  Q R 1P ᅱ`0Sp@-P@P p@0! 000CS00SP0U:00p@O-HPM1p0SЍO0 0 0S6 0S2 `` ;AE@P0jT! 0A0P `` 0<`P  =00C0 0 A;;; 0D0 0p0000C0u^u^p@-P@ ~bP$0$0p 00 $0Cp@A-@P`"v$0S000000A G-0P@Sp`P0p0S(W !R 0 !V R"*0PE  1  BS !!  100C000CS0O-p@$PM 0`TT00 !1R 00B0 00TЍ1X0 0HS G 0  0I 0@!1Rp0p  BZ F 0  0G p  00 S[ 0  0[ ^ @G-H`傊p  V@ P B5^:0\P`R  \ #RP  iV 0S*0S  {  0 D@PH00000  n#P0S .v PPH0800S00000000C0GD  !! !R  !1   0 S  B!000CS0000$00Cs0 D0HPD03A-P$0@S`p000$00Cs0 AO-P`H@,MDG0 P0 0C#& #6&& 0! `0p $0s  }0  BwU  R!$00Cs0x,Ѝ 0 ` 0 pB`FW 0K0D$00Cs0  0SH$U0@ s 0R0 B{ $0H sF q  &C0 $ 0$  C `F!/  C0S 000D 101PXÕj` 10$00Csp  H`p  D`  @`  <`0 RS00P0S W .`0S (`0S "`Z  ` Yq0 U0B$00 0V  !C0U0 00Z  ! C$0!/U V  !C0W$0j UP  !C$0!g/ 0$pR0 B 0H0 P 0Q _ __0Is _0 `C0 R ! B!0 0!0 uC  0 !0 0 !fC0 C 0$p 0 0H0`F0D`Y0$0U A-`MP `p1@0%T00S`Ѝ,0(@0P,0(0,0(0SX , X00(P\0HP<1 <(0SX@ @S , , , P0X0S\ , \ 0P0SP0! 0 R00R0S"000Pv0000SHO(0X@S, , , 0X0S\ , \ 0UP3(u^ 0 !6/ ! !Bp@-PS`@!V 01P 0 _ 0ap0 1 Q000 !  !AR !  B /A-p@P` 0 00A0p@-@P`0S00p@S000 p@0{ /-@ $M0 4  *( 0 0 00Fp$ЍxhN1u^@ @-@rP00@A-P@T* 0S' 0pᚿ 0S L`Pؿ@0 L 0S 0 ; 000C0὿8u^ p@-@\ P pP MPpw PP `PO0 0:d7/7p7V ppAu^@-@ P3O0 0p@-@PT+ 0S Q 0`*00C000k 000Bp@ LqX 0 0 0p@e:7 0S"@$p@-P@ 0 0 0=%7Pip@H 0s/ cJ0( $ A\ @-4 00A A"1S@ ^\01,0//O-(0`9p"AR0,0Paq04`0AAbATW" Vj@P 1@ S0@A ,PQW`p V000 YZ @`W``fV00C00S0S   k@3O-|Mp0夀P@`@, ` 80 S6 ? 8P  80 `oᩒ |Ѝ(P,0PU0%VZZ 8 00`0 < 08 V 80J0 0 8P "SR 0 !53 h80S 8 0J0 00 pb8 `$6:0;0@  000R  0  0 06P[ 0;Y% ,8P  %OY PM5:V i7 !, 8c0S]8 0Jp@0 00`qTu^\u^|1G-p VZ`'v& TA0$pp P(00@0?o20/ $ AP0# pB"   40%V0X (00(0XH.\$p@p P(p@#\,V0h )/Y Ll@/DP M@18@AS8 80< <@@⋽@hu^@34@/0@-`0ML@T LPL   @A#0 0,0 0X0@@>gЍ0@@3u^ @-QP@ MO-plM $@6 `@ ylЍn @`  t!@N@ S * 0L0|s$ @$F *7 J0 0 0m7PPK"7"R0   |47 7Z(`,  [t*u Z444j 0S(0,#6~4u^u^u^ A-?Pp M     6  %:&p`@T @0 ЍQ}4p4344 0D0 07O-$MH L $P!AYpZ `4!C20(2>B"  YV[ pf$ЍOC 0 AT  QPP SPUR QP  RQ  R R  0RIi0@P 0 K000 A`P X0P`@ď T0,0PK`@$Ѝ$@3 0s/p@-@`M YGP1<λ800`S< < # 6 0`Q6PP60  R( $0AQ0%4 0T2.HcZ`Ѝp5ި 0 P J35(0,#6j3,DZ@4u^C-Ap w@QU庻` Ѝ<0@8PU w媻|"AR0@4 R`001S B XWP Q00P `ZV U T,0!X00W0S `"V0P `U@3@4O-@M ` @VsC f %  ! . R  ;)  0SI?!#4T    BR - 00> $!*͡6  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO0 @ =P 2 q2 2X    0 ,  4 @, ꐡ[G- P@   U `D`(00@0$V0:Ppy$01S0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P(0pu^v^O- 00S #6:008  $ 001/#P1 0B!0S @00fT:0$DЍ0JsK6 0$( 4 0J0S Y: rP044820̣$ (0+6 0 ,02P04 0{/,0   0 Ἕ4w04F04-0404 Z 00 0 0ꐡ\v^0@-,A,Q0  M*WP & W0,0,  P0 P0$( R*0 000p0&YP pp ,#004 ,0  $ 0,,Ѝ0@QꐡL$v^@v^#xev^}Nu^/O-pP@(0oTꤡS4v^v^@-@P  06   0R  06,0 3100S/ $Q 5/p@-@PpPU  p@ p@Rp@-P@ T p@p@-@ 0S 0 0P`^P   06p 0y6pO-0pQ`HPMrPP U 2@0@T0@ 0|@P" 000U## 0@ .P U(0W 0 DL 0D0 0@@0@ 5P 0%+6 Ѝ&&6< 02* / .v^O-M@@0PpH/`200 0+ 0VŒ 0 `P Y ,,,, >4P ` 0U2`Ѝ0S ,,, 0  G/(0, #6v0ԟ 7P ,f,,v^O-M00p0`H8@P2 x+0 2 00 0帙`P r,e,~, r4P ` 01`Ѝ0S Y,?,e,. ၟ >7P D,,P,v^p@-`$0S 0$0P@%P   0F5p 0@5pO-`P 0M553 p3RL"H"  L"H"0U0=0@T 0S I@#T; 00  05 Q, f 0d"+-00S [n WV PC0 0  @ Z 7W@p>/!Pf S10U 00  @@`,@P " 0&43PM 0<61  04  Dp+Z Ѝ 0 }+L+3++ 0D0 0.ZU  0DAV  0 v4NpMp pv^v^v^O-`pAM$ P@\~!0h0i0j00$0Xp?0S / 82<082$1<0S$10$1:}:w^\4w^Iw^Sw^]w^^C- @! pP)g0 P RSPP P ]JP  &P 0@0S ϙ6`P 9' 'E'JT03P5:P 9 Ѝhw^p@-@P`  p@BQG-@ 0S`pPU@# * 0 @P U  ZX 0 xX 0xA-@p@`@P@ ΄0 _@x@- .    Ѝ0.   0/Rp@-P@ 000Tp@赡00굡@- 80000  0 ;  _0ЍPw^ġ 0 aġ 0 aġ 0 8aġ / /A-D0Dp0Pc00S@ᛙ0000#A @-,0@ ,0,0t ,0 1,*,*%& 00S:%0@ 6, P0T80@-\0Cዞ0h0H0a፞2(@$ ,30 HH^\w^0 1@-@0S#{400ȡ@-@0SmfP  ;+0  _$N4deA뇝!B ) 85%1<7 : ]wЍȡw^?w^O-P$MU p0E0`#*DW`$ЍSZEQE(PEN1@@@TH# p 0 0U 0 00`P 0F?o T20S 0@ TJ3DQ! 1`PE000 pP  Vx4 0S/(0(0 S;3S8#0/tC-pbDMPA  p101U 00 1 000! P |e 0  0P$P(0PD1P 000  P  0 ! B)1PPpJX000P P0:PP00 atP00PHu0 00x(0x0)0:00 T P@tpDЍt?裁['w^w^褁(x^8PTT-x^LKA-, N0RǠȠ̌' @N@  0 `p0PP |e000嶘UXKP(0 P00 0 P dЍ1x^lx^G-p`0P00@ @@ A0  y ᯗ T0XhGj 04$pP 0 d $l$bP$(W q$J`裁t[$x^O-DM@p ᄠT:DЍ! Z`VU3#:E} c V@P`3C$[@-. .   Ѝp@-N@N@`P@ v p@4  O-@@04M^,00|10 NP  ^P  , P5,`3 10@p5A00pF0Y0,`0S +P $0S)Q)0   $$0P 0S  ,0`4Ѝ zI "@0 \j裁t[x^O-N@N,M@$0`*rPP)$p`AfX0孖$00 )0  N$0PV  0l($`0 P  $rr,Ѝ H J"@0 z[x^tp@-P`N40@N@ 0m p@Mrt[p@-8PPps@s0P3#pt@-@P  06, t  0R 7 0(,A-p`V@0 0SP%PU! 0B0 0S0S 0  B;  00S 0S0S"U A`FPyP0 x^A-Pp`VX+ @$A0S0S"000""`0 0@X @4$Tp@-0Pp0 P"@"0S R""]"Rp@-@P U Tp p@O-lM(,$0 0Z @p (0TdL0,0P0(0X00PX` P LXq@$0 SV 0 RP0`PX000 00Cd Sd05$0000 X0X00\0d080D0<0H0S . 0` 68 4000 R 0F 0H0S zLoX4;Sl `0< IpPe 0@ P 0  Q 0S `0L$ Hs@lЍ000p``0 HL P r #RK4 0/ [n 404 J,00,0d@0S `0LHC$0 S@ $ 0CA0S!000x!!@ 0S  `0R $@Hp0Q L@@`0 ( I @,0DHD0H 1/Pc L`0H (,0 I HD 01/P #P2 |0/ xL(WX KD0 @FD0 0 &X `P 0DAP LD 0 "!D D.!D 00 0Y D 0  2!y>Y 0 |D;PskD000 H H01 0 P&0 0p 0@!P 0D00 0 0H0@000x03d0. LE 0DV&LP X  H!\x^x^dx^O-4M$0X0 P\!@lX0T)X0 `CV6`  $ ?0\0q 0 ,  p 0,`1/P #X% T \h4Ѝw,X Y , !!  !0 / rR@\x^/5@-$C0 @@5x^d@-`@ 0 ````!PP " 0@0 0M 00 0 0SO!ЍpC-`M 0 ````p @P 4 P!"W' 0`0C0@ 0; 0! 0WD0 0OtW1 0S1  T 0001Ѝ 0; 0p1І 0S:0P//0 R:P3#//p@- P@~00^p@迧 8Zꀫ0 @0 p@- ` H0@SP`B   DD00 $p@2p(0, 0 (0, $0Sp0Spp@/0G-8M,00@p00P  0P0(p$@ @ @`~0,0T0P 0H00'>000(p$@ @Ppi8ЍNy^`NG-M 0p` @`)P0 P 00 0 0 `@3?o2P0S0S 00S00Ѝ R 0000 0LZP ꀾP @-bYP010耫?p@-P 0@T @,6,\ U@ 0C \0C0060* 0 0Q0P3#p\0R 0B  UL b  pp̡ 0R  S01 R  S0100S/0/@-0 0R 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B m$0Sp@A-Pp`^@P (0H10@0P 0A!&0D($P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```$0X   B ZWW 0 R 00W L XGVV 0 R 00VA8A-@lp`0S #S Pᴥ,0S  \000p@-P@VP 0S p000p030/@-P v5-@ $M0 * , 000 00P U$Ѝy^4A-P`pP @'0 1000000 @ 0@AA-P`poP @'010 000P 0 0 @ 0@A@-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-$M 00@`pVPX\0@p` @$Ѝ< R:0[0*=) 0K& WHk8W R@W@% 0 0 CR:0CS`1`! 0 @p`p P 3  0/P0 SW0@@@`S@ 0 0S:0CS:0 @0 0 @psp P W 00 S0 `V 0S %@# : 0W 0Q:T  Q*Q%*Q Q@!PR*Q \:`PT \Q*Q Q*@ RR#Q W 0CR00R: 0 `pp: Pc 0S:W@?0BT. W 00 00C0@ 0pp Pp 0S*W00W @0S  R*0S*W00@0W 00 00C0@ 0pp PF 0 00CS0!0 0@pp P4 W00 T@@ @T@@%PvQw*Wq WO- P;@00CS@0Z pA-P@pUPP0` 000 PP00`V D#&R ' p@0S 2 PU000pЍ4 R @ R  00B W $6SV X130PPV40S @0S00 80$0S0 0 0p@00@0 P@0S P080 FpP 04 R@  B@  0VP`U40S @00CS@0  `̡O-P@4M0`<0UP!@0, T@1T@!Pp4Ѝ,` 0 Upt230~0 000C0Uw0  opQ @ R fp U 0 R H$Z 0  0 U01 C00 0C00[ C$A U1Y ( ,p  0Qp   D @J0@@ 1/p @ `D $ d0P P  $R  0S0S 0S   c 0 S K\P 0d 0  BR 1@-` Pp6P@0P  Ѝ\ 0S400@ T:p@-@P0*0000p*O-Hp Wp1 @00 P$ 00S` A0BpP00S  P0 'n H R  R0 R1 1 "$ R44 Q88 Q<< Q22 Q@@ QZL ( ,(  R,Q RsXH ? QXH0 Q Q0 Q1 "$ R44 Q88 Q<< Q22 Q@@ QZJ ( ,(, Q RXI @QX5H RX  kP*Z   R 2/"" 0 00U000U0000C0 00 wX D0D0H0H000000p ЍXXX  3P>Z   R 2/  U   U    B    AX D D H H 0  0 pG-|@ pP`00LP0PP@0|T Gy^A-pP`@ ` 0 S0A0T #0@0a@@-P`p<@0 p Ѝk)p@-H0@SP 00p$0p@@-00@ $0QH0S@KO-p<0M@RP!@0P1Q1Q`1`! 8 P  R* R I R   0 R V  Y R: 000 ^ Pᔝ0<0TЍOӝ R : 0@ `00R0 Z  7  R    B     V 0` `F`  0  $ r\ 0 UH R  T M 倈 YЍ;y^0O-/L 00C100L0 @  0L0 ! 0L00 00FN `@` r0 S0 S00P0$00 0 0H00  FQ 00SP3_ !05P0P `@IPZ0sU P3h^v^hu^@-@pP`MR  0p? P Ѝ@/ЍG-0@P0`Sp0S 00S R 3/000嘅 <@  < 0 00#0SX@`@@Щ$@ 0@00@(0 B0 2@@ R"` y0p0?U0 0S?#03@, 03030300 ߍ̡(ʁC-MP@P`` pS0  P嶓H1 R*Q, ! 0L CT04 ,  0000<0@0D0H008  00000000Ѝ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221TR̡0a/Q/0S //C-Mp0@`00 0` P0 P 00 000 0Po?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0Sb^ 0 B 10^ 1300,0堰0#3[ I: 0$ S80@4600 0 0 RP Y 0 03/:#:SSX  0 6 0D %6SP0S 0P 46Sd0 x00 0#Po 0 i[̡@- J$JL^ >00>0^0 s *0#03<@ Q03 R0S O-,M Z%ZU@N@>0 0Y*1 00000W0$6 0 0U:@O0,Ѝ 0FpC W|#$ PP9 @Tk0 @Y@PP Z P R:Z 1 0 $`  PR0 HX mV h0V00'0J R$0 0$000$0S Z@X 0! $0 (,0 D 0PJ0SV 咸X 厸$ DDP Q @w@xv^O-LM$ 0qP,04 0LЍ   P@D @\ 03:N@ @@v 0C,00 #@3 S:<0S03:QT0P`0 008040 { 5PP 0 0(0S 00 0<00800400 0 @00P0C-0$M@؄SP`p0 0Lp@07/p `P ,0 `00000 p00\$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 08$ЍO-,MP\  `P0Tp@000:X#:SQQB,  R Y :< R ,ЍZ P I   RPZ (0$080$000 GP'Z0 ! 0L @0:/ 0   P 0U 1 !00 xP0 hUh*Pn$ PG $ 0UV 0RR$0SOH0SL4YI00[E 0UB$P ( , 0\0R !  R 02/ $$(,0 00 0001001040408080<0<020@ 20\Y ZX 00 0TZd t  0SXZ   R0OK 0S]X[0IXU E0 P0'X0p@-`MPD@T@ HΌ00 .   `P@@ЍpRp@-@`P 0D00 Pp@p@-P@U õp@p@-P@P T@@pG-`@P $k T0G´ 0pT'`JPO-|M@$0$0夀@T` K$0 $F00J0H0圴p"T 008P@ 40b0 000 000400P 01/pP 00 $0|Ѝ40 S4Q3840@TÏ6  ?00S 00S 00 0   t (,0P0<( ,0hh س0S 0  0 00 0pPy^@-" "&*C6QP Ѝ@-" "&*C6P Ѝ@-" "&*C6\ Ѝ@-" "&*C6+P Ѝ@-" "&*C6* Ѝ@-" "&*C66 ЍO-A11 0R tqsA0\ ,R 0 (R 0!L P u` Ѝ P @`V2 QE A00S00S  R 0  JT PP\ /P101101@@@U5̡G-` PpP |0   ( $ ( $Ѝ@0 @@0 pP@ T@ T 0p@- @P!  ` 0( 0S始H0;H0( P0RP  0.  0+  0< 0000p^ 0p@- @P!  ` 0( 0SwH0;H0m(帋 X0RP 0.  0+ 00C0 0< 00 0p^7@-""&*C6@PP 0 Ѝ0 0!< 04 0 (   !/\ P/0 !8 00 (  , !/p@-@P@T@Pp5p@-@P@DT@Pp5O- s@0PSDM@0S^ D0S@Z b10  B0S#0 0)`0@`F`0`0@000S @0UDЍO) ?@@D @00r@P 0 Q"0p`0[) 1 pW1 @  P T Q)DЍP 000  00Y+ RQ3 . R!: R*  @0>."    !P@@ 0 ATQQ@@     ̡4Hy^@-T R*0B 00 (BR0\ ̡0z^A-`Pp@P @P0SPD0S TnB P  Pgz^A-$aP0AS aw0!>00000000 81Pn 6810`U 0CS*2B뤀p0WEwW000N@N@W\0tЍP< 0 jqJꐾ̡z^z^[z^O-B2 ApP LD PsU@@pA`@P$Q(@少!T@0D 00`@061@A0@e0C@@@ s0 ᄠ0S 0PP`E@0   S0P  w/  @GP 0>0000000x (0D0 , ``FF 뛦*@7 {^̡B}4/p@-`P@'0`P @ p蔭0@p@-PU@qAp@x0@QX00 1Ġ  S0 Rp@RAv{^̡6{^  @- 0pt0S(ʁs@-P@ ` `"""&*C6 00#  0+0 0Ѝp@A-@ PP` ""&*C6 U`" 0pk P(,`0p S 0: ` S 0; 0ៈ`P Pᓈ^hu^@-@`P0p@0:0嵯0 p8 Ѝ0 /@-@0:0 /"&*C60S/ 0S/ 00CS0/@-@䡁@-@ P@ @-0@Sy000䡁0S/@-@ P@ 0Pp@-0@0P*p@߇@-0@ R0 @00@9 A-@ P ""&*C600S7 0⾇ P 0 0; 00  0:0 08$0 00S) 0SA0S 0 00C0 @ 0 ; 0(00 00 0S0SPU 0}P `V' 0S 0x0FU 0  :0V681` 0 >>⣂RU P A 0S 0 `(0`t0p 0s1Q;9 0 6 &! R  010@ 0"61@ 0"601008 00000[䡁5̡O-M 0DP @@pH뤲2 a  00"603S P0 PYYHP Te?Y  PY ,"($($ W     " " 00W @(0 0p,0<  0+ $ X  Zk0L PY 0 P0 PI ЍP  00P0SX  R * |R + 0`ᯆ  P ` ᣆ ̡{^^hu^A-Pp`VUA]A0Ds 0 0 0P 0P 0  0 0b`0 00+IԢp@-0@ RP0 d@00 R ]TpP{ 00T00PTUpp@l @-@@jp@-@P0p@j@- I @- A @ @- 0S Q P0Sp@- 0P p @nP T  0Rp@pp^000 //000/ S0/000/G-@0 P0LS#%p"&A6 ppYl`Q ` p*6/P0U00000Ѝ pY`Q`*6/hZHZ8ZDZ@-@QPЍ@Ѝ /A- @@Q pPW`/ Q 000  0 +P(P0@/@! R!/! !AT |P 00S 3/VFrp@- 00S@ SP` Q @p1r/r@@-|@|p0 S 0R``&0000P0HQ &0( Ѝ谭̡x0@-@t0tM@@@0 @LP @帄 @4P00S 3/@TЍ0蘾x7{^O-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P Z偄 0S 0 z0 0廄0 6$0$pU0o$,Ѝ dc0X 00L b0 )lPEz̡D7{^{^@-PfMl0@o0 06S 50 0Ѝ@upep 0 RP" 0S  p0b P :Ѝ[̡7O-P0M  R0 Q" @K `p0Z000 U00 0Z$[ T{ XЍU Z `@ p ( , "&p@ `p@` T@ 0S0`ժ 02000S QU  0@ @0 0T  0 Q00S+ U 0S 0 0 0 0S  00 00`T 0 P0  ( ,"6  U $nU A}Qz$@-0 Cl Ѝ[G-`@M@fo PrEVY)X 0   P0  ( ,"&G 0>00  V0 #a{@Ѝ0 p@-8P@t `0TpWp@-P 0?A3c S 0 S<` , R0L <0`ODS0@ @@@?CD0p̡QнVUUUȭC-@PpȐ΂`VR7#9M7P@`pV 0 p@d0@P`T宂E<4PTPE_o@RPꜾ̭{^̡ŀp@-8@PP0`0K`PH`pEPpp@-T@?=PPp9@0Spx@0S @Pp@嶂8ܡ8@-@@$"P1S ] @蠂8PEA-@L0S:P`:QP2E4QPp0#L0R00S80@AP@00@0P 0`@0ЍAe@0 ,pЍ{^8̡|^\8ܡ@-UD0 < P@@0PPDP̡0L0Co/ࡁP/@-,a.0,0P@m@Pࡁ̡A- 0@S0p# PU# ၩP` ܨὁ 0S `U 0S 0  ; 0 B 0SP0S`PV p@- 0@  P P 0 04p p(0, #6 P kO- Me E` \7 5@5 `n`P 95Ep#|5 xL K&P<E@0S 0SPUN010P>  y0q00 00 4R0V `$wn000@0 0 0S*1.2h !0S000C0< 0S0 00 00000/@-@P R00 O-TM`x0 PSPS#2Z@R V0!:3A00C 000|0N@0 V00 $FT0So ((0, 0Pʖ0S] H0L00H#0c(0x00c$0{0D6,0P @0$#6C`0#0P,0  $0$ 0SZh@lTЍC$0Pw0#v!Wo'Xk*P6PP!P1x0Wp!#60c(0 0PE PPZ P 00KXP1P!Pp1PE, PP0x R ( J%  B P40 E000C400Q 00SJ@8 4<0 48  S <0A |  T `k `0 PP 0~L 08 0H0S0H0L0H0 S00R0S6D (0`pz 60C0, 0PH PEP PUP1UP1x0S $00UP1k0fS`1x0S $0x0V`!0FS0%#&pG :0 U*0804 0 4 80 00[[pG V:T P`T@HPz  0  R0L0 0`P8 0|000|0 R0L0 08 0j|_+ @ 00#$(y,"(0, 0P00P0#0P0 0 0S 0S P U 0S` $ (00P1[*Y&*`` V `1[p! p1FW-PX `GFZ0 0 @T" lPY`1 `!Pp1gF 0  |@T `PP|mA 0DP[̡0|^|^ y004 S/P @- 20@:|^/0@/@:/0 \/у0P1@:A-@p`H1ƒ RL R^!^D*   R `V`F`P1 E@V P^@o#PA A B R`V`F` V P L@@:|^p@-P@y2 Q*    0R p`VHr1`F`V @ LPp@:|^O-10SW1쀟`Pp U@i/0 @b/`/W00 Ѝ/ Uڌ2Sᅢ \ J 2PW@` P @ K̡}^@:>}^y}^}^p@-@X0Sp/"R\:@\*QLp@0C?0@:@- pP 02 0  Ѝ@:p <0 P 0 D R 2 P///@:@-P@-@@-P 0@:@-P 0@:@-P 0@:@-P 0@:02P 00 /@:02/@:02 /@:@-@P02 @:O-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 0000wp@:̡@-@PL0"D0S 03>4000~ ,02Ѝ000}^4@:}^@-0XP`B 0\`R 00P@0 0 0 Ѝp@:s@-P0@D0S00Sx Th 0P: T0`A P8/0`P@Ѝp}^̡}^ ~^D~^n~^@:0O-M`  0p0P0p-00ЍZ4? 0$$Q0D0BS0S Z5*a/P .0P Z`V/0`F`@V @ DpD @R` 00C 0R P 06# 00 P 00C 0~^@:~^|^D:̡O-,MPP@P U.` 0pP 0㤠N@T P,Ѝh ``F&&$ $    01/ 00`@0/@- P00 }QPC-(P@D Q0 3S 0!  U00P`\ ࠱P` \ 0 CQ: U 0 00P`0S6#P `0 S 8P`P`P `0 Ѝ U00 Y  0X^A- p$@P`m0vw6 00D忝Ѝp0 P/0S  4\Q 8< Q < < 8H  BH /80d̡ P00S/P 0 (Q, Q/8d0P  /p@-0@` PU` S R   P00 `800d <0@8@@H00H0pQ0 P0S  00d̡P0P/@- T000 T0 @SdG-@0Q00P00CP0u%P'P""R,40Hq0S)4_4140P !U" uL00CL0$ T00CT04;P - `vu000P00P0u`0``FV`??``u, (<00 @^ ZGu  `̡>dP^p@-0@P 8u"|u2uT00T0uuP00p 0 a?d@-P@D`940 00` uv@ 劜ЍppqQO@-P@H` <0 060`0 [v@ pЍppqQO00@-d0/@-@004",2R0$P00042042$p@-@hPowt420C42tp@O-80@< $,M)Y V00,ЍOT$+%VZSt.ptW00$000 `" R V0 < 80`$+4#6: 0000T00 00$10T` 04`(0 PEQR R  ,?8P<0,ЍO#$ŻTX,Ѝ0("0? 0  4n# P>"sr9 (b ?  0&" 0BS0000L Q`P( 0 0 $ 08  <hps0W% t0PÿH X >O~^OO-QMM`M6 1H`V1 Q` q`, [P` KPD墚@s<1p@0T sV000p00000CS`4@0U +MލЍ R @ pV 8 aJ. 01 0 08  @0< $ P$ 0D0Y 9/  ;`P @̡p>dp@-`@0M @H@A sP0 PP 2+ @PxMs"000!X@ @@@@;P0p  (0 Ѝpd̡>/_^^p^pS Q9N//O-@0CM`S$@7H00CߍPdX0P'0CS087 03/@- t7060`J>  p:0 0000 0 &@P0 S 0  dP!l6pf2P G@0S &($0QP0&00CSu00hd`P0S %h{ $0T T0,0h0X 00$\,`Vh $@@p 0S@0P$5 e5:ds`P"rP`  `L]rV @ P? `0q04p00S 00 < #*(qP /r0q @ r$ 0$ 0P0 @* !h340X !u`PY& Yp2`0P i30X !nq[q0HZq U@b!h`P0 0 0(0S0,2?d4;&fj0S0F0Ye 0H0 210X!10 0 4C#"#04>0CYC 0[1 '1 I "'넱"x!(07Phm0S !0S     , $!,;P  )(0,`(0q00000L L P P Qq`VqPdEq@0H>q ?@@̡p8^-Ł$^-^@^>K^T^ e^^^d ^^O^1 0S/G-H0Sp`'pPUU'qG5@T P 0  4 b ` _ \pV  T3'#R<00# H00CH08@̡!^p>d_^5^G-0H0SG0P SQ@ 00xppW R00S0 00@T p 0$  0 0S0$p` #R<00# 0800X<0@800 00 0T0 0T0p(08@ p̡>d@-T@L0S@ D.pdX40 04P@T@@hp̡>p@-@4Pp@e$0 0$0p@Rp>$p/p@-`LPp@( 0F 0 0C 0T00CT0p@7p>̡00S/O-4Mpo bP$pV# &4ЍO ( 0C  0 @t0&0:@ `W4Ѝ@@`>p@-0TP@S` 0S00$ 0 B&$ 00$050000S$000T0*0p@/O-lM 0003`3sL0PQ2@P 0  _ plЍ?&6&:$+O4X  0 [   XM T2XH0 000<2H082t00800<06$0 00;o0T  T }o0Sp 1 01#1L0R0000SpQ(:P00Sp  % X0 o0Noh0S n 2pS 0; @  0 2+o00 U( 00C 0#0@ 00|0 &0:  0 0!CepZO>000#1 #7@-@HP"t@ ,0 6@Po Ѝ0($@-@aM }0Pn@  N@@ ,0D $\030#R0#02S n `Ѝ. & R n`*t 0 D`P n 0 D"60 B+ 0 B"6C00S"06BS@-XN, !004 0 #6:S"& :///R/>0 0 @-@nH0 0?@LnO-$MPH0TQ@`LpP0#0@ 00S 0Sa"0S R0 0`P60 0 H00\XTPLp$ЍO  O-$MHp0SLPP@2`00T0 00EP (, RQ' 0"Y I30 0 P+0S 04墔P""   ,  @   $Ѝ OP"SRЁ^ׁ^O-tMP@U` &!  P0 p= I pZ I0 ! 0 P`hP Q 0Us0tЍpJTJ0 I ! 0 P`IPZJ XpA-@PP`p(,0^PU  sq X  R 0 00  0lbbmЍADp@-@`Pߓl(`,Pmp@3H/p@-P,0@TpջP @0/@-巓 0 tA-`PpR  0P@0$0 pP0! 堓PPP 0S0@P@P000P@U <@ЍP$ @Pt^ 7@-PP@" nP 0|S    P T 0S0C0@4峓T@,   Ѝ0@t^ -/A-pP`@`;fP@ 0S@ T@  3/@`兓t0@P0/0PQ/Q   / P/P0S  /@-@ ,00$00 000 000蜷OĸO̷OhO P/R 0R /@D0@D \0/A-P@pT@00p P`@T"  P P @ `@T  P  P0`S0S0PPP`P P /z` 0   /0PQ/Q   / P/P0S  /@0@-080@0000(0 0 00OOLOO P P /1?tG-@`p夐 0IZ P1P!0 Z0 :Pz E 00 0 0p000 0`FU*G-PM0S : ` 0C0@ H@IT  Tp1{#I0 PL@D  \ 0*WAD 0!   0 00  * @ ۍ0LSA-@`pP(  pu q mЍA-`pvI @1@P@00| >!Z<0 009PPD0 !00F? 09PP 0 0%0v Ѝm^O-Pp㠀AM  @a`pdH1 h0L1l01Jp0@@ ~ mq `0 0&jl0`001 0$00cj0z 0?$`0@T8 `"~@P80P$0`0G8`Z@Pi|pW@ UqK@P j 0T ;cp,hP@ 03/1h0 it3`0p3X* 4!P3d00DCDcp@00 0 0RЍl ` 0 ,` BPT O@OOP Q /@A꠿O-|MP`x Dwh@ pT PF 000000 0 000000 00($00(0 000040 0802<0}>@00  1DH00LP00 0TX0\0/S@)@T& 0`@hP`0 mA0PT00PE 0000 @.P @@ .P0@00|Ѝ`Ps@-@P`>P Ѝp@rЍp@- L@P 0S 1(S2S P耂^O-0|M3S `PP1S S2S @$,$@P $|Ѝ22 0)00 00 0$pP $@@ 000,080402S-00l0@T D0D0 04/@PD7Z\ 0@SB T!3P Q*J J@D@0> $@"R)0&0CS$x@ 0000 0$>@P $e0SW00CP $X@"R"T@10 @ " 0TL000@ @,@2S0$50S(0 40s0N@N@4@800XSB 0tp<1W00 @P tp0t0Z0S3 @YaC0S S0,0p 00D00$@0 P h@D0480 ,p 0P*,00@0S0000@!\@P00( 0;0@P40〰 0D0@PDP5S7S 2$0$00` 0w@P[ 0 x400 \%Q ß>0 l0 4 0  @L40038/<000 0'T$0( Rc@dPS01Q PJ[<4 qP0b B 0 0<0@0 0 0<0'P# @0S4 $00 . Q 0 0A B0\ 00C \ 0@R:0R5 B0<00<00@ @@b 0(@1!00L0 0H0VT ,0 S0002 02000x0h@|0l0$03/@P! ;0@H0 20@0@OOA-PpU@` U R:P  Q ^0P { R@T !P 腂^0O-Mx02 CR@#2` 000 00 0$V@P  p2 S OoBA Ѝ0S%P U"0P0 0$1P PEPPE0PPEw@ U @-P@`pP  0 001PX0@0X0 ЍG-X0 `Ѝ0@S P <`P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ 8Pp3  壳Z`  (  嘳`{p 0700X $p0 $0X 0  0+;`P0 =` X0V X  R!X0`P 0X0 0\0kR 00dX0 "Up^W L! pP 갂^P P Pk<<//ȿ@-0`*p"*0C00@ 0 `0 8q> 00. 0.0 0 (03100 >0#60ЍЀA-P@U 00 ` 00000ppU`  =h`A- $0p0 $0 0@R`P:    U@` P g00 00$00x @0D0@0D0S/p@-@P`0S)000p P )PA-@T1  0`/ @+ P!pG@P0|0000 q 0  0 0e@P 003/Ѝ@@-$Ma01@00 0000 mPP0p  LW 0 00 .  00P$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 PЍ0@Ѝ0 -,M $001040 00000P$P,ЍA-X0@ 00$@0#,pC0`4R `1C0PBD`` !0ŁƁŁŁedA@-<0DT 0 !0  !O-Qz ,M5 `0S 8a3D P䢟D202 000*0@P O/Q0  _,\00 p 0Q  \PPPU DJ@HDP`$D P{PXDP D0/SY0`0DP0F-0p 0pa s0!00 "0Z(PSq`0 U  h  00`A(P:0 0C4/,`000e P0@`@ 8 c*(P#$ ,A00   P0U0P0S@ PP@U00@p\Ѝ^Tx^^ D^x҃^k^^^^^݃^^^^^0@- ! 0 !@- @0S 0@ƁŁp@-T0PO`d !0UF Ϡd 0!T@!p謭@-0`M0@ 0 Q00 00 Q .@`T#ʴI@Q   4/0 0 &#:- 4/?&6 :  !X 4/`ЍH=@DxATcj_x^k_k_^X^NTj_h_^^^^ 0O-p`'DM@O! 0 0 0 00`(p$ 嶩0,0> 00!0 0 00`(p$ 塩'0 !0 ,0  00`(p$  匩 0 ,00!= 0"00= 0 00`(p$ v 0 ,00!= 0)0 0 00`(p$ ` 0,X !/0 0 00`(p$ pK0H ,090 0 00`(p$  70,0G0 0 00`(p$  #0,0O0 0 00`(p$  0 ,00![0 0 00`(p$  ; 00!e00<$ ,0  00`(p S0,0 0$!`;0o0 0 00`(p Ψ0 ,00!x0 0 00`(p$  庨0 ,00!:00 0 00`(p$ 奨0,0: 00!p: 000'> 0 00`(p$ 厨0 ,00!:D00 0 00`(p$ y 0,00 0 00`(p$  e 0R!0 ,0  00`(p$  pQ9 00R!0 ,$ 0 04`0(p :0ɟ 0 00R!0$ ,0  04`(p !0ȟ00$00 0 0R!0 ,0  04`(p  %0,00 0 00`(p$  &0+,00!0 0 00`(p$  (0,00 0 00`(p$  ͧ)0,00 0 00`(p$  幧*0,00 0 00`(p$  奧+0,0< 0 00`(p$  呧,0 ,00!>0 0 00`(p$  |-0,0;$05 00!50>00'> 0 00`(p b.0,05 00!K?00'> 0 00`(p$ K10+,00!N? 0 00`(p$  720,04 00!O?0 0 00`(p$ !30 ,00!|4 0Q? 0 00`(p$ 60 ,00!(40S? $0  00`(p 70 ,00!3 0U? 0 00`(p$ 90(,00!W? 0 00`(p$  ͦ<0P,0Y? 0 00`(p$  幦>0,0]? 0 00`(p$  奦?0 ,00!= 0 00`(p$  呦,c? 0 00`(p$  }@0 ,00!1 0f?0 0 00`(p$ pgA0 ,00!1 0g?00'> 0 00`(p$ PB0\,0j? 0 00`(p$  <C0 ,0m?0 0 00`(p$  'D0,0q?0 0 00`(p$  E0d,0u?0!^$P PDhPp`WR|PPPPPXTPh^d PP PP P PP<PDPtPcj_pj_P 0 00`(p$  ڥF0|,0>0 0 00`(p$  ťG0,0}? 0 00`(p$  履H0,01 00'!?0 0 00`(p$ 嚥J0 ,00!1 0? 0 00`(p$ 入K0 ,00!1 0?0 0 00`(p$ oO0 ,00!(20#>0 0 00`(p$ Y 0!?0 ,0 <00`(p$  pD 0! =00<0 ( ,`$  p00$03 00!3< 0?(0  0,` ;d$0 0 00!|30?00'>< (0  0,` ; 0 0 0!%>00'>(0  0< ,`$  0!?0'>@A( 0< 0,`$ Ф 0 '!?0< (0  0,`$ 帤&>0,0> 0 00`(p$  墤05 00! 00 D,0  00`(p$ 匤5 00!? D,0  00`(p$ w 0!5O@,0 0 0`(p$ @aDЍO-ADMP/ `p  0  0p,`(`$P P P<B , $ 0 /      <0p(` P P+ ,  O@ 0 <0p(`$P P P@DЍ^P(PpC-QM`p \@ ,\ \ 0` ;0 P 00 000 0@֟?o2P0S R0T8R \70Ѝ887|^@-p|0M@P? 0`` 0 P 00 000000ᒟЍ-C-p0MP0 0`` @0 P 00 000 0@q?o2P0S  Ѝ0ƁC-p0MP0 0`` @0 P 00 000 0@H?o2P0S R ЍL/uA-MⰀp(0@P``  0R R#  L,* Ơ$ d `  L\# Ơ1 00X  00 000000Ѝ謭̡C-@0M(0`SP0 P$0p ` $0 P?0S S P h00X  00 000000ϞЍހG-MP 0`` @p 0P 0  00 0 0 p@孞?o2P0S  0000 0 P00  ЍO-P|M p嬀`@` +0H`000 00 0@ 0 u0P?o2P0S 0000 0 PPP0SP +H0|ЍO-P|M @p``  +0H`0 00@ 000 01?o2P@@TP0SP +H0wP|ЍC-|Mp@P` `e0X X@0 XϜ-@X|X H0XS  00000 00 00p0000۝X@H[|Ѝ@нC-@|MpP`` $1T0 T@@Y00?(P @6 (V(RX,X @H YR00 D @0  00 Q 0 00 0000p00ၝX@H|Ѝн@G-pP`0MҾ 0` @0 P 00 000 0@T?o2P0SD0Q 04QS03"# %05Ѝx\ NMb@-1P3@Dk `q70VM P0 ! 0l:01 00$00_$00$0P@Y$00$0T0(00,0 0S00@000G8p0900S  @0VH00L0H0 HG0 0P00T0<00 %0`00d0`0h0$Ql Ѝ0 `+ 0 H0$ l Ѝ@车^^@BA-`MPp@El 0`  0 P 00 0000@夜?o2P0S'l0PЍG-@Q0Mp000` @`0 ` 00 0 0 `@w?o2P0S, 000 0000 P 0R ئ<0 $\ @ 00/( 0$ Q0 0,0 $ 0(0 zЍPɚ;6eA-M@P`p(0` 0 000000X00"ЍC-`0M@0 0p` Pg0 P 00 000 0P?o2P0S@0S@T0K 0%PS0 0@PPЍH|G-`RMAxp P` ($$1 0 1 010P 0@Hp?o2P0SPЍC-鄐|M@P`` puHr0X 00 000000ᔛ|Ѝˁs@-P`00@0S 0 㚎ЍpŁO-PM@`Ȱ0¢U0s 0ȰĠp@ЍOX 0UT@@ pvwXU2U`010# 0ZC L R?0|P XEUT|pW>U4Tl|Y[$TE[E,U  P  U| &T| RUJ|# W!`IKq@p UXQ 0`FV`G: TL`pP0T   ;?0a|`TV TU010#`| 0ZT|Y[ D ET 3 PT|0S Z1`IK@ʜ Ѝ0 M@XH T@TO-PR`@$MB @p帜VT0 RT륜@D @$Ѝ Z X       jDzT  (+TZ0 H @p ˁO-|" 00,p$@ @@ @`֛ 0(00 00,p$@ @@ @`ś 0P(0 0,p$@ @@ @P`崛0Ѝ蠇^P ƒ #60 P *R  P 0 / 0CA-0@`P P(0p, UP1p1:PUp0S S0 0!d 0 )P*0d0oL0 0!d 0 P:00 Ĉ^؈^@-L@P 0S  700P 0000萲p@-;w@`PUpPNx>00ST'4@x<0 80w^^\^0000 wꐲ0@-M 0000P 0`@PP8 ⚽@P 0 @@0@ 0 @P hЍ0S  @!!@P @0Dp?  @Sp !@@Dpw@Pp yw`0S@|w0000 +@P L0S00p 00=@P ꐲ ^$PO-RM0SP@ AXr @w0SPcs,0 Ёa,0zXMP08 0(qNP0(@8(0H> C'რ(HP(1P01QZ=P 8 (0<0, 0H0 @L lPP0= @ @H0L PD!@!$0v$0 ( $0,0m!@0<]|x|O[0) 100S$ ,(O!>0 00000000 00 @0X PP  @,0a0wЍ 0ꐲ@B\XT*^O-MQ@L @pP `VTP@%ЍH0 0D00@00 01/PP P@ `p@-P,0@TpP @@-@@/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00@-@-P0S  o` ЍX/\/RA-PR`@P\p 0!S P d!6X@PP@@-X^ :S!\@  is@-D0`P  @P`00Ѝp褲@-@0 u褲 0  ꤲ0  ꤲ@0@ S D \ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W ,0S ` 0 D  P  X R # \!00@00H00L0 0T0000/03/A-pP `V@P P6uP uV @000V 0 `@ 0S 0 00 P000 @  huꨲp@-@PM`t@@ @@@`0      7 O h    $(Ѝp褲G^4P/H0 R R 0` R R p@-@`MPlt2@PTtBp0`0 00$P 00000@t@ꨲ@-@Pt 0S 0 0S0   L00C0t@ 0S 0S 00  ꨲ@-$ P P PЍ@-  Ѝ䤲0@- 0 Ѝs@-@PM``WM0 0Ѝp7@-@PPPP8P 04   Ѝ0@ Ѝ0褲s@-h` }P0@0@PDPHPLPPPTPXP  0PPЍp褲7@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\P0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍ䤲Bꤲ=ꤲ@-p@`MY1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  YЍ ꤲ ꤲ$ꤲ@- $Ѝ䤲@-0 0 0$Ѝ䤲@-0 00 0 0$0Ѝ䤲8 0(  R@0/HP 4/@-  @((vP @ tP@Ѝ褲 @-K0 00вp@-000@S0S00 K0P0pв00CS0/0Lв@- ;LPв/0/@-p0M`0@ 00P0$00|0 0, S00` (20 ` 00 000000̑ЍXT\0S/$0 R/@-@@0/0O-aA CJ "H0?P.001P )PP0SPPS=U]`P P 0 0=0d1  PP 860S @ TPP 0LP80S101?1?11` P@V@@pp@-@HPD@080C@00S  0 8Ep@DO@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PED @0 PUEt#3p0@00XPS 0  P@D003`EDpнODp^O@-@@TTp@-!2 A!R!!r`!U!,!P!,!001SpA A2S^ 20Q 0RQ Q !p0C B 0  Q2@-  a>Q 0 "Rq0 o`/O-MAQ( <0@@|UЍOQO(0pS<0(00 0 00?o 2?@0HS=0 $00H?oR20S30H?or20S,UXC`xW01x0#L0C4`P(000U L0S:Z0S7 $0S`0$ S0C0@0 P 0B@DT`?D0vk`P D `=,0C1@4008040 0S`,CCDkP80Z80 @T XH3$ 0R 0 S030#R0S 0H0C`0H023W`x XDZVX@\0P XP@T` 0dV`0(0h000l040p00|x0P00P xT` 0V㌐0P00P T` )0V㜐0P00P T`Ґ(0S V0000P00P T`"*0V0000000P00P T`宐H0000 0000t0SC,QCL00 X@`,CVT00000 00C 0X0 0$000000Cs  0007X @00S0000P"CX<C,(0S 0 '" <0 Ѝ`,ƁT@TO-p3tM3 WW3@03?0 tЍZ0@ T`3 0((00(@P 0B,B(3(JP`U L0STZ0SQ B0 0000P 0@BT?? 0+jP8 B =$0jB1@0000 0S 0S  @T  TB00S $ 0R B000?Z0F 0B $B@-@>@@@-@P 40 y@01 O031 0gNgJO-`2 31 L2Z0@1=0>q1WPPӄaՇ0cU.  p`P n;  J PR0?Sòʂ?1?1P1`11Q1儡U> ЍSP >  彬X Y P(P1SQP`[>00>U"00002q EŠ0 3 1OO-13A1LpgPP넁`pU/^U 8 aQ020?SP !011QPk?QQ? C?10 O[ P 0SW ( R 尐U4 P00Op@-0Sa @1S@ @A1S1SpPk?Pa`1Sp0S  R R    PQ p@-@T 0`QT@dPT\=IPHPP=UP@pT 0d3"IPvtT1R  !/1R  !/G-pPt3a @P    T\@@-@`Pp0P @! W#!! 0@@ @ 0  @o  0  @P@ ЍO-%upWpF@Pd3졓10S?` < 210030 10 .11 R`` #=%+ e- ThX 0\P0 03 [V  Ѝ3 <)0P  < z^0Q`/wt@A-@PxM␀ Pp`x ުdp` P<T HP  /m,<xЍdHP 0 GmTA-P`h0hp@0 0"+ - 0(00  03 b3Q-//-//-/-/-/-/-/$0 0!0 00 /0  c P0 000 cP000/0 P000/ 000#0 $000#$0/Qp@-P@ X <P0 R 0SP400S! 0"PT =<pOp@-XP`@ PD03 1pV T( LP p8#pOP0 100S/ION@-@;01@<O@-000S Ἃ 0#  ЍN@-@0S0 R 8000S 0s0000S0Sp$00``_VPT00SH$A<10 0 0 O^^^NPP7@-@P Ჩ ᘋh0,t 000l00p00 Ѝ0wPp@-@P, ᘩ00 00 0X0$00(0tp@v8wP@-@ B@ `@s@-@`P0 0 00h1d`S\PZ_`0W 00 0O !`0`@GЍp%^ ^p@-QAM0 0$0' 0S$0 S*:01S< `10XZ00a01;V  0 %c:!(0,0(0,娊  彄  0R1!0CSQ B0 00 vUP t1.S1! B0C 0:0  4xPOvP\P(PO|X^h^^A-P`P p吀H0L,A0 U P#H0LTp0    0S:|03/0SS:@ON@-<0DT 0 !0  !p@-00P@00.pP0@- ! 0 !A-p@d` P0S C C0CS0#T X$ h0l0h0lAO@-00@0P@-00 @0 0Ѝp@-PHM` P@ ('P P `9( ă (ǝ $ ẃ  ⽝9HЍpO0@-AP0,MS 9 d0S&  BR,*  h嗃00 000L!h0l0h0l,10Sf0P=P,Ѝ0 R t,Ѝ0@9 ,aR !00 0` 0@,P(p$ } 0!(#w?P  0 0,P(p$ } 0`!2" 0y?0P0 0,P(p$ } 0!2"P0B>0 0 0,P(p$ }0 00!8"~?0 0 0,P(p$ `m}0 00!!< 0 0,P(p$ `Z}0 00!!? 0 0,P(p$ `G}0 00!P!?0 0 0,P(p$ `3}0 00!?00< 0 0,P($ `} 2)I21 ST,AT0t tl00 <8r 8ⰖDЍ8Jt@C^^شЈPPOzP {PP@- ddTj`0PTP@0   040 P Ѝ@꼃PP^^{P/d 0 0// 0"/// Bp@- ` pP@TMpA-P@0`Q ៳P@A-`PD0@XppQ ᆳP P@ഁRp@-P@ R" 0t  0!R4 0 R R 0`00  0t0$0p\ 0\0\ 0\0 0`0000 0ꔏ^p@-P@@1tP"2pp@-@`PP1'00p`t02pp@-@PP1(0, 0@@2pp@-P@@1$P1Upp@-d0Q@P` 1 @0, 1(0@S@U 1pC- M` Ѝ0 SpA" S) S /0㘟P@H10@ 0`01 . 0!0 UTQ30 y?P@0 pP@`S@T0P@`FV`@Tt0P@00 P0 0 000 0!ʚ;@Bʚ;R7@-@P R: 0- puX0 0X0 0Q 00 0@00C@0X0 0X00"eP 0p`00q 0 0\0 0" Ѝ004 꺏^Pp@-@P0@081@0 p@1X0@/p@-P 0X0p@0PX00 0@008@0$p@&p@-@PP0(0, 0 (0, `q pp@0p@-P@@0p@0p@-P@P00`00p@ߑᴑ(Ap@Q@-Pu0<@P0`Ѝpi0x0t0 0@ 0000`P 0 ` 0d@ 0 0\00\010Q0Tp@-`@ $P  RP|00p@-@|.0@O-X`M@``x0p0x00P0e0c0 00@PT``p dp`0 0h0h0l0l0\0\0`0`0`0000 $`%0 00"00x 00ᇲ0X005 \`$0`0/(00,  /@0#?0 $0>0/ 0 000p 0D`P 0 0 `100 0!#4#0 !Al⻓ ///x00CSx08ЍT `[ _C-pP P`P' 0堐   ( HB@ r/@8l&`0@@<%+3 1 03 Ѝ^A-PU@d0p00`h0Q/o%/,^p@-@d0`P@/`%p@/p@-@Px0Sp8UpA-@P pP&/X0 @ 0P  d/x0S^/o@0x`X03V00  R/M/J/A-R@P` |p.h003/8/h 0 * !01 0 R) p .X0$ @00C@0 R 00 X00X0/ /h00 l⚒A!#4#0!10  .p@-@`P @0 1p0@00F=00`'t``c pA-A@ `p.@0Q0@$. #4 #G P 402 /,0P/0 0R03 0@2#/ഁp@- @`0PT 0T@)0,9@P"fUP P@ 00tUdUUP ,f~<U0.@p U@k 贁A-P` p@0U @TP  . A-P0@(PP3pa--@01@09.1S1S 1.-8A$H1 Q  PP10SPh0 0///C-@LM@ \0 0`0 0PPP P:~ PLЍ(b`P 㾎pp-` qp` 0"-0 忎P@-T@ 贁,P@^O-P 0pQS lQ`TP.0P <T r @ TP$ @0R @R0@ @ D [  ϯ  @@000㓔$  0T 0DC1 00  岯V00Tഁ贁p@-@P 0S &TP |}Tp@P\uTpPU @nTp PP  P`Tp贁A-P,hAT h0pS ``,\0$ 20S$0 -@A -^A-Ppᘀ,ATA,h0S ``,\ $00$0  uP$00$0$0S ,@^G-p㔀!nATPP,P0 C;00 ",p4(0 0\ 0 0$0!0$0X00X0101,0S 0h0/\^O-M( 0$0 0P 0 (0S $ Pߍ3S 3 083/PP803 000000 0S 0S| (0 P $ 00S0#003 @04/PP0`3,00:00 p` )SP 0S< }SP3S 90?00P03 @#04/PP30C3000 Z WS P MP  +1 1 R!Z @Վ0 d0 000 0lh0 0\00`00 00!)h0SS  Q  R0Q @><0!#4# 11 | p+h003/PPp@pP |+0 0Pl+X00X0+0 P_+X0@0 X0Ry0X008 0@@0@@0@0$i!f0 R 0R @T @k 3+Q 0#$# AT  S Q Q @ P 11 0R!ŃVP|V+0@ +X0@0X0H7300J+ puRW Y GU0@,0@`S 0 0C 0000P*X0@ "+P@0X06300x0S  ++ * P+ 0\00`0; P~P|3Sp< 5310 0P3S7 H@Xp0s0( KPӀ h0`0xP*00@017[@*s@ 0S 03# @04/3pC(0PpA 8@P @0!S3S XHPt@ #T@0p00h t0 p00*s耍0 A*?* @hTX0x# @00 00S R 8i r*0SZ 8h*e*j 0Q 00 0h0T8K3S Q*{X0 X "0X0@00C@0 ?*|00) (04*)X0 0Z!0X0@0 0C@0h0 0S\ 0 @0 0X0O @ X 8" 0@0#X00 @00C@0)  )) 0S@ 8) ) 0#03 @04/@ ))0耍000 0pW00T0SH 'R 00'@ 8) ) 3/  $!0X0@00C@0 !00 00X0 0 0@@@0r| S)000h0 0S 0040E)h P 5/P40)U ) })6贁p^@-,0 00000 00Ѝ䘐^p@-P@Tp`QP y@G-`p3aM )1 PUGK)P (p@-P@``( 0@I @p@1)p@-@PP( 09 0p@%)00/A-@P@pET|`(h0000h0)@꼐^00/0S00  0S00o/p@-@PP(X0d`0)P("iX00X0F(p@(0 I@-@LÕjPP@H@-@X0 0dX0dh$*`03$!;$'H@ ,pP 1tP -@ 0'P| 0a|O-p`@嘰  HQ:/PDPWe \   0P ?P Ѝ0S 40A3/0`@00@`ŁG-M@` 8pYP+0xP@@0/S WЍ0 0 S?@# ,* bT0 C /  C1$@ O00<`00 o` POV@ k`F 30W@C0`F`00S/ P 3/ှA-P0 `p00l 0 0010 (@0vP Ѝ nP'0P 0@00 0 0CS 0VP`V pZLPp GP'0sP 00@0G-PЁM! @@vN a0 @@9 z;Qq 0 @0pb0 \Pp$@T `Y-W0AU2(@P 000(` S'Ѝ 00S S S  00@0P0p 01@ 01p@ 00P!0 R Q<xy^^C-@PM> (0S; $ X7 `V6 1i0Ԑp03/ @0^P00^P 00` 0 `P O003/Ѝ E DA0 (0p`003/x^P/(0S/P/ R  00/G-Q @DM08$ Q!P( U Mp PU PU ^Mp R(0  @` jpP PU *\M$0P(@S0`$`$@0S   0 QG-PQ pEM@(`T `(䀟VM&t! 0SX&@0S LPPtK&d{Mv"$@T 0Q S   0 U`@QT|^A-@`PpU 0S A  0S SP@-@bGPz]_%hP lP 0t@pA-@i`00Sʬu#Ѝ0 0 0 PPᘋ0 0,0pp00 00 0P ,0/pt0Q0!*~RL|0S/@-@h3/0|0h0O-dMZ@$ ` +|0T L0P $0(` T ݗ`P8p$p* dЍ P`P$0p$p" 1 00\`V /&uP0S{@! PPv!(PPp00k( 0;0!PPaP1 00 0000 0 XPPPY0$ 0C0:P0(1(T0$1 Rcj! `( !l  2/`PH0T S *P S:00S18 ,0 0Rl pP ptP ztX0Z `xZP PW`PO-`4Md@qԔ 0L0 ?0KX) Cg壑4LP0 0/0 0,0p p00 000P 'm,0/pt0Q0*#P,00 06PPv,0L 0P0P000 PhP|P0倒0(0L0 C5<0X0pPtPlPxPq,?K >PP X0H(``QcX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S x20` \(0,PPTd,0d(0l H000C0`1\1 $  BX! 0D 0TRo:D04Ѝ(PH! E'b$ s$ R!0 R $0 ]$0P(Pt`10`1Q\`jX00X0 dP\`\X00X0X0 0dX0u$;!$N$: H P >pP CtP ?dJJ`0 0R0U0S \y Ñ^ő^QMRMRŁhO- `0  0i RR⯥  00 q$1|pqL0 48<0L0 1 111"  "Jp RhO#p <0<0$,0S F,p,[ppPpulP`0<1xp8p=N4"P P0$(, 0P0 #T0T0(G(`0pQ h1d0l1=0c?0h0040083pp0 `040qd40pbW 4p40qVa40qU`40!0R "40p:"o0, h001q"10 0S [0[00[0x0Sp p0t 0x@t00H05`0`Sl 505`0@1d0Sd d0h 0d@h01 R @0@d 1\D03/9"(Jr40004Z0bt"@r"1S' Al"[II(0 T 5@ "5`0`S V"<ЍD'4040pWev $Y!  S @liITgI 3""Y ls#@@ϑ^֑^ۑ^pPT@TQ0O-,MpQ #0!`P#@t@T ,0〠X2 Pt@PP xT P` X !P P`j@#0SKb㨇sV 0[U> :$@L$ =@PB B`0V):< `V 040 ` %@P0 00# $ 00`00 @PQ  $(@0@,Ѝ 0S S+$0/@P X X$$ ˣ`PDRLPO-a4M00PS@!Ub!0S 0081S aU}X0T P3,00000>0#6040080>0#60D0>0#6000<00@00t|80S TM 0!.1000L09L0@02!5@ 0 0  0PpW(pWL0<L0u0P -. B.`1Sp +pP0  j0  jVpUW pLWqLW!0R y p3 h:T0  j  [0 ha 000[  [ 0D6p30pGor   GqP  $($01 0Y:p⿽$!$$WpWpA /'pz XpD: DD0ĐN I1 0]`1H!<1d1D1l0 p 07/pP\T!@0AX0  81 0<1$0@1(0D1,0 pPG l0 0,03/l00S 3/ZCl0 0$K(0Sq [o Yl 00Lp @07/ 0 03/3 0000  0 0pP 01K 0 03/GZpG X T#x"HD RpP WtP S0S  EpDW   /o"    2/pP#pHd1S p l0q 00S p0SD$@^F$0p  $@F0tp0P  1S 8 R l Q 2/l0 000S 3/l0 0 1l !D03/<10S lXFZ0F X 0"#  "p PP0. pl 000p p p $pKR0 0Z000C0V'X%D0 ] 0S ]K=p4ЍŁTő^QU0@-_MP P@P0 _ߍ0@-(000000 0ЍLP@- $0000000ЍLPO-dlQ R00 2   00`00(000(00 0W PX (፟0 P>X (X0Ph >+10S`10$0P `^p@-Pa|@T 0Sp 03P T  P06P0 0S P0 P08P0+]A0C0  l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/ဲH-wA0`SM P0P:P00Sړ00P0*  VIP|GE0l 0\000Z 00C0 y 0 ,+[(0 1111&I0Z00S H81S d뒏+CTx[6$l~0$04G !` 180S 3/U>mT0  o0[0 00[ 0 [ 010S2 [ ` 0`Z0|`` 0  0S  LH %8 `0 000 0 V ~&[ p 'ឱ$*5 x `V 1S!! !1 0S   l3 R @@00l`Z0000x0S p0St t ' x0Sp p0t 0x@t0L0 `Z`H0S( x l変%0@ ( H R( S0,0 2 P   , @0`080(0< 0 D0(00H0K0(0 <`|ᗿ(1S '  01501 0Z0C000000RBl BlKV ;=b 0 Y4l$895F1 P 0PL 0S 0S5p@ 5 =5l0Q Q*00pN `* x0S `Jꀲ^UT8T*^@T^p@-a@PP0  $ !O-M00S`؀  ΈX Ȉz80S0r 6Z3qYY10$0 Px0 HS,0 0 0 0`, p P [;,02 H0S5P0,0,@Ti U5  Y5y %P0 Z0S 0W| 0 `0Ps $0 R00SDh PP f%@H0SPT,0Z R R ,0! RP  !P  00C0X 0000PB ,0Z R R%@   B X !.  5@00PPUPP0,0 ,0p0bZ0S000lP030dP00 P0 0Ѝ0W 0 `0SP sZ0S000W 0 @0AP aP5l`@? 0V< }5 =5`V2`H0S& x 0ⵇ%0@ @ H R@ S0D0 2 P   D X0`0P0T(0 0\0(000`0I {េ|p(;(X;((X;0S X (ÛX (0ཛ00 20Z00S   00C0p0St t ' ` %D|% a P ,.<(0>P ĵD  IG@$; B/o"S R0 400P%`0 !^0Z 0RP B+ 40 0?  T@TTR0@-q@M QaT0P0` ,0 TP X 4Ѝ00@-P0dM 0 0@S0 0S0 Q  U?o 2Q0S X KdЍ00@-@0P SMS0R  0 0 0000?o2Q0S  +?o2Q0S !?o2Q0S Sߍ0p@-5lP@0U5Pp@0`P *Py/-5<50 Spp@f@-X0C50S[0  J 00S @]QŁO-`$10|0L048<0L0 !80 !!L0?! 0k  g> 0 0? 'C001P 9DP  CD+ p<0<0, y,0S(h:0[00,00[` P055 l`0<10x080B4!P P0$(, 0P0n\T0T0(2< ( _ht4[$ =0c?0h00400h0 0`00,00?2 40!! 140S  3/10 0S [0[00[0x0*Sp p0t (0x@tH05AAQ  RB0BS  R ly505`0@1d0Sd d0h 0d@h03 R @0@Y 1\D03/2022! Z! ! ! ! !20C22S pV`20S OP1211S ljT0  exp(Jf!>4pP04B 0 0Z 0000 l0S `0l 0005AAQ  RB0BS  R 25A0AS l0k G&@ @ 0 JJx$80pZ0Vg0S5D0DSXPFl0 GRLh0^T^[^d^i^,QT@TŁ@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- ! <  S 3     1S 1S 0 0000 Ѝp@-QC 1|@e@00@00 00 !!0400000, !  !(<X<P 0 edT@0TgI<PoE<P3S ̽0@-@0PM 000 t0PP P00P0@00S 0 022201Ѝ0q^4QA-`|p0PS dŷ @P U *< p0S0@U@` {<|(Qp@-P`@0`S L塷T  <PUTpp@`<0 3/|(Q@-; 0;p@-PP@ ;0S   Upp@=< 0@-0@0S R 2/| 0@-(@ P0S   |$0 0S/ R0/0|A-Pp`C@p `Pד$ 0S0@ 0@0|0S   )p@-`P0@TP  P @03/PP p|@-i 0@T@t 03/@| 0Q]Q 1 0M ! 0 < p@-X@P0`S @嶶8";@Tp@ y;03/@|(Q 0@-0 @T0 3/@|A-Pp ` @P  p ` d00$ (R (@$@0@0<|^ R 0(0 |P@-@`$PP0!4p( L00 PU,0,0S%  Ѝ@3S 0 ,0 3/00PTp$PU,0 S 04 0 3/P Ѝ|^^Ē^^p@-`P3@  `b c000p@-@PQ@0S   G-P`CX 0003 0@T@T. 0pSW00  @pW @b 7/0SpW U  FW M@ @@EA-Pp`ᶱ@ ``p0S0@@P-A-P`@p0S 0S   唱A00 00S<0 3R W pWp@-@P@Tp@- @0K^O-`0Sp,M@PTXdP ` x/o 00 00P0" 00  `00 @00 @`P d,Ѝ[  -$ \0 $$0wZ`p?p[  .U 0S $  0P 212 2<22@022 02R|Y 00@@-|0C0P $l!Q2  L1S  8 Q(Z hT^^0@-@D008180S >ЍMp@-40CQP0[;P0WU6Kpp@-@00S?P00#;#P0ETpp@#K@-0 0@/^ 0!< 04 0 (   !/\ P/0 !8 00 (  , !/00S/A-@`ăPqPX`00S P P FP4 00$  XفNٓ^^“^Ǔ^ѓ^0 0 0/@Rp@-@`S1S 01_000p@3H "0B0S,0_@a`3 @R@R^G-霐P`VU`P@@ t@p0!0C8R#8 @< A@0J2S P B!0@@R0@o/@R 0P/,㵯R0@- 0D0R@00,$00P s C-p0MP0 0`` @`0 P 00 000 0@V?o2P0S  R Ѝ>0@-@0$@0 @0 @PZ<Ѝ0RA^#Q#QR>@$Q@-p p@p@0@@SC 1X01q@ Hq@@<<80@˲RRCRN^(V^A- 0b@SPpbsb0@X4100S 0 !!04L0H0@000, !  !@-@Q't T 03100|P0P<Ѝx5 00SMP 00S t T0 #!R `0ST@-P 00Sp@-P@9PpTUpp@-@P`psPpp@-@P`hsPp@p@-@P,Pp0U p00/p@-P@0Tp@P 0 P QPp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@O!>0S P00 0000@-2 @0 0R  R@\ 0CS00S$@0 - 51^p R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3Sr@tp@-PP@W t PpP0 l t BR 8P08P0P0 jO8P0MP9^p@-@`Q6 P08P0Z0S P0S 0 000C0.p@>O41041/41!0CS41/p@-@Qp@p@-01Q@101`41Sp PP/@P/|0S/@-P1SO-頓MsQ[0`J`V  00 0C0`>8AT@ K0`` 0M81S-8AEZ. Ph`0 !0L @0;/2 00  00ar`P DRfЍb٬8APU 0RR `0SNPX¬Pܡ  2/0@ ! * 0 0'r`P /X㨬  2/ `0* l`P  0*sXᑬ 0000@ :0<`0 |0S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  10 2020 20C22S* xM'#x#1[  00/p@-@8aP 0PEt 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A- 2Q@Up` 0S Qspt1 00$V;0 0 `!`0  0 0 0 004 00 0(00/1S ! !! 1 00C000C00100C0E 8 <  gЍ90S u9ZCA0S \P ˩00$P 㘫x^W,0 县ЍFTRO-PM`pDT 3RU q@r,0 \ *00 0 0P 0P r #@T  ᠰ8/zL h Q4Wp 3: 2 @,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S zL0P0<P0t`m mZ20H0S@1 1]X@00#] ؼ@p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S KP ̨00OP 00S  | x p@0@@SC 1\0100 1<0SЍ3/RCRN^V^l^ TRR A-0p3a 8Q@T0S 00(zq X081 0*lqXL@x03hl2/@-@1 0S@NA-Q 2@si 0  BR 00 1@0S 3/#VέFlK 5P0PSE P0   1hS!!1 !  5  P01 P  !<! @P0#ᇯ0$ 0P+00C00S  P CEWh0 IXr(1S,1S |`V V8^a[Te^\^G-@QTqYKP` 衔 医5P03P0< ẽF7S  <P > 6 00C0   0 I &  0 000P00P0 O-pA000,P0   P  i W& PP_ 01^0USS [G  `W lP (1 S0(100C00,1})|PW !Q, Q0 U! 0ae 0W( Q( Q0,1(10Z0C010r  Q 0P 0R u`P ` ```A- Pp`3@2::P@1@!<`JVPP   2x0@D@P0Q @@up@-@PPp@U``FUPP@p R  B PR / t0Q   0RL     / Q ` p@-P00@Tp0 P @`p@- P0Sp8 P`@50 QV , Pp!!0p@-P@ @0$P0p @-@000P  @@ C-MP00`0p0 0` @ɋ0 P 00 000 0@dO?o2P0S R0 Ѝ7@-D 0HP0PP0@EU Ѝ05^x^0/ -@-0@00⋿哿(↿Ѝ@Ѝ/x^O-P`С,M @TpPP VPp 4P @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #X0S 0 PP 0x P H0 000!R00! 0V0C0@`^ ^۔^O-0@!T0TX q!P `1 !R  !t1 `V`i ` 10 VP n`P `V@&0Q@D0 剉P `Y0 `  S      X>@ͦ Ѝ`0   0P (  p`VP^` d^7@-P p 0@P X Ѝ0Q000 $!@ ꟕ^^^,^-@-<00S 0,0T\O ЍЍ/Rh^^G-`"Q0B  @PpX  p$0S00SpQp @W 003/pP  P 03/p80S 8QT$0S R0 0C0!R 00! 0S% P $`X!P  Y0000000@0@@000000!00C0}^^ǖ^^ ^`4^A-0a0Q?,q@T K ⓽@Y$0S- 0* V~<0P000@03/ P R00S ' :0S (0, 0 V"P<000@ 0"  ` ̡@\RI^g^0 /$/@-@RP` Ѝp@Oꉸ0 0 00 0&P Ѝp@-Q`M vP0 ( 000@P @P ȺЍ賺Xp PU@ 0  @P0P S  !  00C0` O-DMB,0RbS20,0Ƽ `002"@000S200   ĸB/PT:0`PhB(0 <0 P0`,P$  @P MqЍpp@-M`P =qP@@ ~V pP@ 0qЍpP7@-@P 0 000 Ѝ07@-@PP Ѝ0P 0 0000@- 0 0o ЍxQxQp@-`@PP 0S Tt M~ `Ѯp XP@r0SpT  8~ 弮갶^^$^,0 0S @-宮@갶?^A-Pp`@͖00$0p ` P@ p@-l@Pp^P UPU  PU0^00 p@襖7@-4P\o@P $000 +o Ѝ0vQDsQ@-` ㉖@gtPp1S`00X1S0@<0 AA0,000 o Ѝ谶\xQ@-0@p`PM  000@尡另|埦0t t@p`0PP P02@P =0X ( Ѝ@XZ^ȶuQ(Q Q@-`0@0 0@0 0000 0@00C@0T@S|0H S/P  \\1X^ |000S \/0!`0 SQ/PQ//T@-PZ00C0 -@-KeF\2O-0S0PrPRM 0@0\* 0 Q00S  0 0Ѝ 0@`g`@  ᑕ0V  刕 0倐 00 00000 0\00  0#00 00000V00 @`F BDZ0@@D0?Z @T0@0@h @0`0 `ذ P` P@~@STT0u Z9G-MP 0`` @px 0P 0  00 0 0 p@y<?o2P0S 0000 0埩P0S0 0Ѝ@-@TZ0S[00[0&&d@@-p0 0  ^8 0@0000@00C@0T@S 0@-81M@T,  BQ 㟔 0  P@@   t!00P 4 0등0 x0@@ 00@@`@Q 3@埦 HЍ0@ |^TT0u@S^4Q^Q0O- 000p(P$@ @?0谟,00 000p(P$@ @ @P?/0,00 000p(P$@ @ @P\?00,0T0` 00`0p(P$@ @ @?<Ѝ@X^DQ4QQ000/p@-00CSP0@@$P,eU ܓTpp@(֓T A-0 0 2#PU 0`S@T AlEpd0S R@D:$ 0R @TA㧓TT8A-`pb|P@X @0@00T0S@1S q@m 0S 1S TA-pP@`pX @0@00T0S@ 0S@1S1S Tp@-P`  0 0@0T 0R0S 0S @P4Pp@Qt 0STT7YWD 0  !"P/ R0S//TQp@-@ @PXJTd0P1@0P !0@@T@~pTp@-P(/0@p`opTp@-`PW\ T `@00  RAP @pQpTT `0S  0  /T 0 崦p@-@Td0QDSh h h0d 01&0Sp@p@8TA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0  BR wO-SP ` (P`Lp"0 0*@T 0 SV`0S f0P @,`Q l UVC! R=T R8L  P @[ 10S, P(1 QSV00@#boYQVT T R S+@0`00@p@S V `0P @$00@01 00001u[00[0@`@`p `p * &d0Sh h h0d 1 RA0Sd d0h Ph@*x @V (ᜑW ᗑTT8@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0Tp@-t`@3P1S 00SP31S pP0  ?S000Pp@-P0PSA,00S qaPp)p@_XG-0PPpa|@P @T P03P0<ATAU YL0<L0W3TG. 0  0I0@\s@-xR   /@ m8j | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/  0 R0d1`0S00#0H1``0S/00 /0 i/6& *P 1:i@ 0_0`0/0? ?,0l`00000DC嬲t0*|`tS4  BЍp@Y^^<T@S@TDDL>X[0@嬭@-H0 0@Z07-pf@ 0 @崭0 @ȭs@-@P`V`V`V 00 P0SЍpBp@-P- R@ *B B0 0CS0 B " pʡ`ǡVá@ġTp\02S SMp8000CPp4^Lp@-L0@P P`7Pp@$* p@0u 03/@5pDO-TM@  0{ w000kQ  PwT T r(, $Zp`H f0 02/P0pUV @ *  0  :0#::c4 <@@00D@8Pt 0B@P ?0 QF R  QR03@0B  x00ZO000Ѝp0 6=0!0 /=~0L1O-pSMP@   0$ 0$0, (0(04 00,0< 8000D @040L H010T P00 %(0W`00d0`00` `dp<`h`H0l00p0L<p00p0P<p00p0<p00p0[<p00p0Tl<p00p0`0t0<1x0"(0B(-R #=- . A. 001Wa1`00` Fdp<`1 1mRq qVq`0`!0Z0[&h1Z |bx"1k1 "04P B+ 000 0z> 1 >0/h2p0l"/`2 Z0S CSY 0) 0`@0101010園#620!6夒0C2g0W/p2t"0 00`00` dp2< 0h1P<p00p0T0000 0S00@00hip0j10S  b=0W100`00` dp<`00H  |0S ,101D04H0 (L  @J@p PNPTX\`p10S7 $0 |01f0010 0Sh00h0100Sh00h01h=1 0=[0 100S R  W 0X00\0`00` Xdp;Z 0BRS00 0#0i-( (!!( 0!!0 00X 080`00101 01(01(xp` @"D !HL  $ (,8"04<(h X00` p R=)B0 -BP2T"Ѝ0`` dp&; 0` `00dp;$0` (`00dp;(0` 0`00dp;,0` 8`00dp;00` @`00dp:40` H`00dp:1` P0dp`00:儰 ` 匰 吰 1 00^4^`^|^^^@B@-@P`t Pt]PЍpt  LS0 00000 00yPP t 0AT@-P`M@pu P-`u 0S %V RЍu 040 00000 009`TO-Q4MX@dp|4ЍO6QT@@Z`P; J[m@MZ40 @PB U>0 0O0$@ 0;00 Q@ T VJ3@y 0/40  l@P DAT@ kV@yo44Ѝ0Z 01 J/@P0Z@0 Z 01=/@P0Z@4l1 P& +[00 @@00㙟P@ c aVJ0700Z0 CSRL0 N@꒟ @ET@ @0J0 @P Z$0,0 00.0@0 \00 0p`@T4QC-M p@P0S !PU  A` 0 p@P`P uЍ@@-@w0 000 0@0oЍO-LM00|0 P80;@3p` Up0s 80 `|000xtpLЍOI50S0000(00S40SU YPEU U00=03 P 1L0:`@M40@A0C?o2<00$0000,0T0So l:ATk 00L0SZ0S -0 00080@ 0回P f @U 00?09Yb 00`PP110$[0x0/S 10 R 0S0SL 0S0`0`@ 0(0Z$<0 R0S ; 40SW; 0000  YW000 [8  Y YW& 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@XH0WH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0' d0d0h0h0l0l0p0p0t0t0x0x0|0|0000W0000000000000& 0000000W0000000& 00000--....////1W1 1111 1 111111111 1 1$1$1JυJ?W81810N/N7<1W<1@1@1D1D10Q/Q7 RRl1 1lW  11222!.W2 2 2!> / 2W2,2,20/|70 &$0Z 01$ 8,[ 0S%ES 10 Rx ?RQ |Xv{v,i f1UP00 +70  %70  70 70  70$ $70( ( 70, ,700 0704 4608 860d d60l l60p p60x x60| |60 60 60 60 60 60 60A/A60B/B60C/C60.60E/@6@0F/F1060G/G60.60/62@0@ 0 Dp6060 O00C0$0 0$0(0 0C(0,0 0,0 0S @T00 Y0S $0 C00,0Y * 2@,00 U=0s p1 LЍ R@SD^T1`00/1`<10/1<10/p@-@Q100pTp@-PP`@xV11 P@ 10$00@pTp@-PL`@_V11 P@ 100@pT@-@ p@-P@p@-@@-@p@-P@p@-@p@-@`P PpR0p@'pp@-@Q0` f`00p R0Q`R X/O-MPp8`eu@w5xGuYw ᜘PWx i  ጘP @ መP  0 1P K ЍoP  hP  dP[P    TP   PPGPBP ᫚u 9P 5{MxM널I,iyM vM0x /w ( PzO-MpP`8Yw@u6vHwZu PXvl   P @ P  0 吚P  ЍԗP  ͗P  ɗPP    ṗP   ᵗPᬗP᧗P  w ᩗv ᨗu ᡗ ᑗP@- 0  Ѝ"0@-00  Ѝ@-0t`qi@ufPa$0P 000 Ѝ7@- 0  < Ѝ"0@-00 2 Ѝ@-0t`q@@u=P8$0P 000 Ѝ71M000/s@-@`l00 0PR@PЍp@ʙAЍp@-@PT@#a8?1  h ЍpT0A-a(M 000` 0P᜙@P p0 @P ?T@(Ѝ1P0 ` $0R  XP 0p0z/`00 T0 00.57T^(0310S/00S/sн@-d03" " R @" B"2S %@T*P p@-P@Tp y000000@p@-\03Q0S m@T 00@ ^TpG-@`T; T[ T[VY h1*ERU:0CVQ ?p81`3 t 1 0S`} P U* W0@ @03A }L @T@0U00CS  @00J} @@(A-@ `50 0S\ PZ0S=Ɍ ͌pWX 0 S RQ   ЍS@-@M `Pj50 0S ^ p0S PQ S 00U0Us00Ѝ@-pP`#@P 0 |0| 0 00 0 P"3S<0 R00Q wIŁN|Nޤ^Xف|ȁ0@-M 0000 0@0P     vP ЍBA-@ `$P B  p9P6UV#3*P)U V VX031S ( ,02 0P03#P A-q`pQ T=PP<@ ovB rPT@-QM`@P0T  R 0@ 00 0@`凗PP PʔP ȔpŔW ῔p徔WP Ѝ,LO-QM@p帰Q @PH0P @@0P 0O@P:00CS@5 aL0` 000 0Yf0 00P 00 0 0 p)0@?o2P0S` 00 0@P  P0R00P0 Ѝ^O-QM⨠崀:p0PS5` =@P0 @@0 0@P⒟ Ѝ 0` f0"00  P 0 0 )?oZ20S@ @@O-(DM  ⷕ 0!% Ppa B, 0  0p ,`(P$  -0 000@!<.  -  0 04p,`(P$ @\j-+0$ !H.  6 / 00  4p,`(P Q- 0!V {Đ U`P |_`*V { {` PXNhp@-@P`@RhPp@P {P{Up@Xp@-@,0SpP,0 R p@000,Pp@O- RMpЍP` Q@ 0:,p2p\^ 0R Qp 0 `0@P 0pP!0F, SM01 Q8 R 1=|1P Q118 R 1H10 ,&*.R :  !6:"S :P 004^\ 0 S L0 C  B0p10 B 0B0C, ,]d0 0R 1H00/S05 5S05 50^0DL>O-QM@p 0VP0KSQH XM ZJ$ PA$` @ 0MP5T' 8`  a^, (\^[( 0 0h 00@0Oo0 p!BP@T (0 (00 0 0` 0P  Ѝ00@-MP@ DP 0 Ѝ0G-@`P,@ЀzpĐ`P0W G1zXO-QMp0@T$ P0$` 0` 0ʎPⒿ  Ѝ zY@ 0 0` 0峎PO,PР 4+f+ v(0` ]0 00000 p0X@[!0_oRPPU*0 P0@` 0僎PcZPP @^\PU   R. BRPypP   ] d `yԥ^p@-PNy@  Ix f]pNy0O-ADM(0p<`0 <0 0p,`$  P<%<0 S] 'p0  0< 0,p(`$ $0 00<!0 0  0,p(`$ $ 0<!!0 0  0,p(`$  $0 00<!+0 0  0,p(`$ $T0 008@!  0,p(`$ @< $DЍܥ^ŁŁ@  0  /Łp@-$0@S,$0 P R$  Upt`0@o>0x0@0C0000   0 S p4G-@`Pᰐ1qS21 0! 28* h R R R # kxX0@00P0#*1S0Ap@0 0@00002S0000SPGlB000@!^@@-@0( R (   B "R  B  \!RA 4. R!R b /o" Q AG-0@Sp00SW GSP0` 00Q2@I=` T`W p ᏨW 3U  GŸΟP 0SԽ@p@-@P, p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\03Ap@-TPC對%0C0\0(@T@ 0S 0AA럍Xp@- 0!0@@0  /L^0/000S/@- 0@x ЍXف^Dc00/00//O-`qM`QS@20" 00#202  Y0"<3" B"2S 3 "Ѝ `00S: : 0  ƧY : 0 ,0 :V 00S 0^G-P@0 psp8< EY ᠧUP:`P WVV `X< 0GE;<0 X <0 QA-Ppp `D0@c`  bT;@A-P;`@ M@V`f:pX# >@m:0 "S 2V@0 A:Y:p@-P @H0c   0S@;p0 S pP/0S#/P/ 00@o/P/P/ /p@-@P(v@0000p]Ӆp@-@Pv@P 0000p]Ӆc@-@\;$cPW;@4v/O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @/00/0@-003/ ЍC-0`M00pP@TЍ 0R@ 0` Y0 P 00 000 0P8?o2P0SP00S 0@ 00|03/P Y ŁPݦ^^@-P(^@-P P d``PL)[ Ѝ $;QLŁ@^@-DCꌧ^@-@| ;p4Qڀ  !L D<, !  +꿧^A-P@Mp1 p`y@T,0@400000 ,00(00!0$@ @ @00 000'>0<0 @P<0W0 00PSPDT`@ЍWPp@@PŁ RŁC- LM0.0 0<P`pA0D0a0,(P$  @p 0P  ⭌LЍD  I    '. a 0,(P$00 0S P X⑌PH0H@0<0pP ,<儌PU@Ł^P ^X^s@-`P 0@T T0@T  S  0D 0 0 !P, W o`ЍpŁP¨^Łh0#(1< /@ !΁P PQ00@0!!#/ 0S(0, 0 (0, (0, 0/ B@- @ ݆P 0S,031!10Pp@-P`|@Tp 0SP0 `00C0A@- Cp@-Q@Z0S P0S00C00 00 6p@4 \/Łp@-@dP(Fbp@jp@-@803Q 0dP 0 0FMZp0P/ aŁ0S co `/P0`o@`/p@-@00C"0!300 P p !A\  Q` rW000PUR0(00@@@#pp@-@P0M  0@0@@@P|嵅0t` 000@0@ @@x㦅85 0(6 $Ѝp@ Щ^HRUT$(RRp@-4` Q[  `pT0@  z0P8}+W`Up@-@[,8_Pp'8e0p@ (Up@-4`8SpP0P @  I+V084@p@UO-04`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@ T^p@-@T 0 R X0 _PP T x XV0000@pt B0U0 0S/0 pUO-pPP`@U#`V0[00 U00 t  !V` @T 0S V x A00p@-@0PQp R00  )U0@-@PPM RS   PP P 0   >PP  E2 1"  P0E"0A 30Ѝ0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@M04`pP,0 000"!       P0?S$P(P,P0P4 PЍ L0QQ 8QQL02 SR|0p!!!!!!!!0S Ѝ^@-Pa@H6i?,10!(1T00!41  1 00000110010 0 ]@Ѝp0D"! 0#@0A-q01P0c?@0010!" !0 & 0`0(0 ạA210101A-0P`q k( 3@T  0 @P 010 10010@-A!  !!! 1P $P A-@ 0S Pp`MP0 8P0P@0D"0!!#  0SW00S@ p0>S? 0 0CS#0T P@G % 0 S 0 0000@S P@@  @@ȩ^O-Z0M0C01@S F_P3 1,<00Jp"@03 qp[`) `P iP p #@k!QP @Ѝ! 1 0S P 1PS01ąpp`$ 0 0    0S @1S Z RP Rp Q.  L0P pQ   BV *V .`P [3  1@P gP4 0@; B "Vx1Sp` 0rS 0p!x!ZR|||!x tZ0SP RU 40|POoBU  0Q?o22P L Z  R Jo ⪢ᢢ S0Sl00C00Z0P0U1P0R !.1P0jWЩ^@UUG-P葐lp@xU" PP1@T' L0S` ZR`f 0  ``؃PX P@T P @TUЍ`0SL``: 0  ``嬃PX Z0S 0CSPnd@T@Tp@-xM@!>x ` P`>0U0000`0 0΀(0$(P lP, 000HP0 f>xЍp@-P0@1P00Z00l 0000l@ A-p`@T$ L0SP0S@]0SP`PU ,UVA0P@TTTG-1`pAZ0S'P\W 'P0SP0SPB30S|PP0S G'0 QU 0TT0@-|M@t P=00P[ |Ѝ0p@-PRQ0@2  0$1\ P P P$8p@zA-P`p@TW [0  d@p@-xM@`Pt a=0 0 0`xЍp01 10/O-`P1Mpp0ALP0  ;(9~gS154c@㇒) l 0R[0"!> R (`pap0` 1R_Q PX 1 ` ^0% ЍO/0G" 0# ?o\20S d20 d2ЍO]YP k` 0 0  2ЍOЍT^O-p1|MSA!P0  hXN TɆ%@4|ЍO R (alS86t }<0! Rp 40堀尐1!` p$P0  kWl`0STXP 1`@T 0c/ 4/|Ѝ\T^p@-@HP`50S 3p@0@!p@}TO-p`PA$MZ0S P R U 0 gSZ [Pi?!0000!0!00000!00 00000P0Pg8J?X~ 2         0000  000 00000 000qPP߽P04P0ptq$ЍPPp  㸅0E⣒@0 !!W QA p R!` O !!  Rv UX [  l Q W   0 0!>P/vPPP p402S SU 000 000 000 000S0X 1Z; HQL!`0S7ڠ01,0 [ Q , lP( $0 !>PP01 P07Pqo TЩ^A-P@q` 4Rk`;2! !! ! ! !! !0  E2 1 U"! ( !, ! !02AЩ^p@-@P8`0` V` Ƃp@ &Щ^@-APP0  P08P0m  !p!,' :P0|`V0S 0 00囃 市00C0ᾼVP08P0üa7P03>!.000X :0XHqL1' 䀟|P&  03/`00S P |z?V` 0 t`qVP02P0P0 :P0嘯Z`$]H^R^Щ^A\^^C-@1|MPCT!atR 40T!md2cX0d201S" H1Sx  &:` RlN1嬁p0P  1 ` X 0 8/Y/ gP  0 Kx |Ѝp@-@ 314020SS \*Sp@J<@P`Pp 03/p@ګ^@Ap@-@P@`PN@  03/@p@@p@-@P@`PN@  03/@p@p@-@P@`PN@  03/@p?p@-@P@`PN@  03/@p?0A-PpZ0P01P0!>`0Sl 00C0|@Tျ 0SP0 ᄻ R AV   ` p000G-`1SxMpA 1 0t 49001Wpp00 0 0$00(00,0@ 0 90( S :!~P0  U>0 R (! xЍ%@ S]`40` 㠐p0`1R6M P 1 `@T 0c/ 4/Z^A-Pp@ c0`V S R @0RXڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/A-D`DpP@O0S 00U@`00VŁ00/p@-0@00S00P00R -  P 0Q 0 p@$;b 0 u~&0C0d0l2P $20 0`p@l^p@-P@6U Op@-TC\  P 0 P  &9~`@32p@-@P R` Q00l=#0`PP0 ع p@P0=P0/G-1`S0Sp YP@F DP@@D P @P0Y0>00P@ >볱U ||ЍQQGPLP Kp pz|UKPKHo| =KPKd|^^^^^^ ^@-2@M` T} 0  20S& GP B0 rs |#PPP  30T"0 !& @0! 0"P| @PPKPc'>P@% KPVKPQ WPPM pt0 ps`g 0rbV9|FP4>T cK P`PZKPWK1 40 0000PsQ0FK~`KP ?a~~ЍF=0l`0`)K@&K7:!#: $ : 000@0|-Ł-$^)^0^zd@3^8^E^H^-O-@0pSM700770S >PP7 730:TQP>@ADPP 7*FP0ST I\70S ~?CSfJPm,0 000000000T0 0 ` 6{T J/{JP a({&{${(⣃ 0P00S J ((CQڧ0 0R`A*S 00B(0 0LPP0 0(0CPP 5  J 0P"zZ [Jzz(]`PZ D%0 +l5 006 #:: 0 $0 `#4 1hV(EP>   0(`P " 4$00[.Ȥ z(!P0 dEPX4$ J@PXJp} JP 3$?a}<4PC`D R  :EP hP(1EPP((EP (5C0P D RSzx3[ MzPX(EPD0S T>zh 2 \+45z30S ЍPU:T) I NPP"IlbP40Lb I w bRWPI˱Q PV0%Zအ Z PP  PsIPpIV0%ZZB  0PPa " QI@PPVI}pIP 81d?a||1Pm 1 NP0 `y81PU 0P0000{(!0 Pt (]10*6 0 (1000 0y(uPP( yy007-Ł-R^U^Y^-p |]^i^E^v^x^{^^$^-J^^^ǭ^ˁ^^^^ ^ҭ^^\/^)^ ^/ p@- @RP` x0tPS|0|Pp@dx0Q0R h R t|0 p@tP|0p@-{<^p@- 0@SP`pP~p@<S h0S p p@pPpP00SD0P 800S,01@o/NlفXف 0!< 04 0 (   !/7@-h@hdPx 00@0V 5000V H@@40DzV Ѝ0<^xG-`P0pP&40sQ!D Bp@ D0@G0, ЍG|&ЍVv^O-`zP 0@ Ѝ0 P&40sQ!D   @ H0@0 0 $ EX@0Vv^C-@CP  ЍCx0TP`  p <0P0$ TP  Ѝ^D00S/p@-P0` D@c0 p@qNVvL03"R  R P2@@-/0#202/P /@- @PR\0M( \ %*0q R!0`!x0$!0^z/ 0(``b`adad`0w\  0 0#0 004 0 004 004 PHP 0 LP3 0S @D0S 004 Ѝ^^^^C-@M Q U c r@p 2 p0Q1 0U0C?o20S 0 0 0S 2S(@UPP 0 02220l0報@0#0$@01S3WJ@S0x"2R '.|2x2U j 0S$!0002h2820h20l" l"X40\S R   WE 222,10S 103/ # 0rPSr$ r$d0S 0000X4Ѝ1Spc k0 02P2p2ZQ222@0#0 0@0}nz282墰Ɓ@-0CጰW@@-(0CၰL282@G-pȁȡCRU 0S #Q t!@0D0@0D#2@ #dVʀ 0! $!0!!   !0S f 0000SPR0 0 0 282202;20C2x20C22S/|@-$02020CT@-P@[0p@- @0BQS05@ !>0S o000 R 0 0p@㼯P08P0000vw2R 0 0p@趯s0 ``'0 0Pp@s4^l^A- &1aq@T. L0SL00 ^@Z R  BRl  00Z0|PU 3S hP0 P R Qg8@,6T  @SAiT@TO-030#0c$M[ 3 10100S0#0˾2PU L0S¾0p|@0T0"W50a2 R z/` ?uPP0H 40\ 0S؃0$! 0Pz/ 22  u40T000T0>0S P0  0S 0CS 0!Q500 #" >d 0500pA0S,0 P: ^:pzO@&0` u 0`Pt @|T  @ `00S L_uP$ЍOf`` 0Pc5U50x\T@T֯^^^^ ^\^BP00p@-0ll@lP R Pp0Q# R" 0RR ppLRoRP00G- @`p PP\㬀P½PUU@  `R0s#0"s#R Q0Vs# LRoRRT/0$ R @- /Ł 00S/Łs@-80`SP 000 89 %U`q@P  Ѝp j@P ,+P` +0`0P40P0 R8@0`y ^@-0 <脽Ɓ@-\0#202(Ɓs@-@PP  <0`0S 0 {ЍpЍp@ŁRSA-Ѝ@P0p P`U`dV0 P`s@-@\P  Ą<0`0S 0 @ЍpЍp@Ł@-Q @  0R_ST`00`0P O-M@0P0 4S'Q Ѝ0s0S0 P0S0  0 P0S0p 880p 0 R  +s0 000 00 0oP0pU 000 0(]PX400?8000C S 70S@R 0`8PtUpa  4 [=X R 0P0S(0R (0R0S x0S60S60p ; Sy 0+0 p05   B 1  RlSPQh AA0C \Q-S_S_ R[0 S0 8p=P0 0 00(0 0"E S`P  BPR7  `[ ` ,` R)hX&d 0+0!0`PS0P  ұP `Qn *0Sx0S0SI80Si6Pc X ұ S0Sx0SH`P ;P`0S  㜱pP( `P*,0}P ?[ ᬱ ` Z8ER*ᣱ"`0PE,0PUx0S `0 00 0P S0Sx0S  Ā0 pP t80z4p02` 0S c:00S?0P0 `08$ =$ 0|)`0 p0p0QS8F080`04  Rp B0|<`0 ])`0P@4 YG 4 8 ; 4$ X@P0 4 G 4;00x0H00800P@T( 0 SQ0 00(0 0#  R0 08P@Q ` 8,P 0 Q:8 R `8  P0R: 00S 0S S`000 S`000&#`0dkd00`( P0^?^b^O-M Qp0a4S  qЍQ0sVz@0P@T0p 20p} X 00 1$FP` ((84匐0尰 ThZ `0  ]Q4QB P 0P ^ 0  XP U X `  (<4 BQ  B8` B ;4080CSE+`  d(P4@@DT4@800@8@0PPU(00ZAp00$0( {0 000 00 0gmPo0pujYS 0B;P0[ [ @`00S @8! P08004Q (0Pv^O-$MXp0 H$RLPT  Dp@$ЍUQ RQX`Y`X00S0p``V @  0 0 0l@P 00 00000 0l@P  00`0`S@80SY @0Z 01 ]@P 0H!@00CS0 U0  @P00 U0 0@ g U2pP @~ 0 @P Dt0@S@T@ U@T 9hU  ;0 > U* JS'%Ʇ^^s@-@PP 0 <0`0S 0 EЍpЍp@ ŁO-M00$0p0尀`$R ko Ѝ0SQ0s ȮPP  0X8@00m (00 0$P 0Sa V `40, [ SĮ0 0 0lP ^ `0K$P0S ( S2   0P0S0p p 0 V X0S pPl 00 ;bP\ ၮ(00 XP v0( X00'000V0040$ S4r  ,0RX0 H+&XPP0 00W0(00 000C0 0 0  S "Pw 0 B   B p$0s) o$0sQ0` ^  P V :(07(0倠0 00000 0]kP`@?. 0 P +&&0ȱ^p@-D+<0<@^O-MP 0`0尐崀$R l@Ѝ0S@Q0ps 000 00*@PH R Xp40S& 0(0PR 0P0S(0R 1 1H0S G0 0B!B P04800`08 ## 0S PIQ Y0`00000P0Vp` SJ J@ȱ^O-@RYM0Pጁ堡1 @T3lPl R  U Y ,$ .0 @ R4  00pwp pw  0>! a v```P 0?P8F. !  q!X  PPP Р   ( X# X X 0000P`1PP0@p400 80<8@PP  ,kYߍР010804 P00F0p<0,MP`Br6P H1R0!sR g |kPP1 00 400 80@8@UpP` `84p40SR40 8✦$@TR4`Smk` `0Y8 @T2Ǫ@P @ªP۪0S1S X@T01X0| 4pᩪ@Pt  87X@070l@ "00 0@0QP P0S p0 0R  O 0$0S !0(0, w0P$0 , "$0 ! 7刪$0Y 0(0 0 0S W[  B % 0 0C 0!  1@0CP(  P0SQ 0 P0S@jvP 0p 0c^^^Ѳ^^-C-M00( 00P00q0PE 000 0g@P aT@ЍCЍ/ S?@X X` p ;"4X001 ``\    p @`$0$@JBPP804 \@\CRQ f%PU Q@R0 0P @@`  R XP L0@ 3$嫩@P 0$ X96 0 X@' A-`1V`04S "jAPp`8@T 00S8@P 4p0p8pPPUV  0P 0p0 XP Xp`@4 802#T*0 R0 R P8@(Ɓ.^A-P0 i0 p RAi sA S s `Ci@Hi@,i@0piTS^^^s^^O-`PM PU (.` Y! S(&00|Ѝ    p @$G 1( P,00 00J P 0 10P0 00`0 0@$0$ C 00 0(ƁC-` $MPS@p@ ppY 00H0 0D0@00@?oV20S @T @@U00$ЍA-pXP@(`/i00 T @00$R01 @00-蛳^Q|O-//0 R/ 06S/`UlrR@- 0 h ЍƁ@-@0 00 #3  0 0 0 0 00   0/@ȁp@-P@03/0@0pp@-hP@0S03/03/@p Q \ :$0@XA-@0pPP`@0V P0SXO- `0ptADM! <0 0,p(`$  @`P<<0 SG 40p0 ,00!1 0 0 0 0(`$ "<040p0 ,0@0$00'!0 00 0 0(` <040p0 ,0T0@  00!0 0 0(`$ @DЍ谳^R@RDȁO-lQM @p@ `0`0` 4@000 000 `0@堰0poᨂPX #pP V 0S``Vp00  0dpP Ѝ2pP$`03/03/`0S 儱XNHȁO-в$MpT@P0P0P 30PS 03/0 0 0 %(,0 00#0( , 0$ 0 0$ 0S 3/ 0 00PPEUPa0 0UЁ%1!80 SH4 0000 l?;#;0 #5;B%!!  埱 QP x0Q 0 0 m000PEP0PY3_04`0P`D0 $V0Y@ 0D00K@倠HD`儐E@P00SP00P0$ЍX@y@Bʚ;@ȁO-M0 SQm@0pP?oU20S奰@ ЍWp@! ! 0 0000p g [`0P0劰 x0;0S,p@I$PHȁ@ȁX߳^^ݳ^p@-8PD@tz@`D0Tp@yp@-8P@th`0Tp@yp@-@PTp0/@yO-0夐@crW 02PP 0С*0  00#0  0 0 0 X P0SrX@-@  00Ѝʚ;@-@  00Ѝ@BA-@0pPP`g 0cV P0SXA-P< 0 ""> O!$" (@,$[`3# 0SP@S  "! ,   ` \@  U R   4 0 ![e0ЍHȁ K@y@ȁʚ;^1P; @- 1CP2 1 @@P+0P@ 000P 17P$0Hp0 | 00  |0-/11(@1(|0:0 0|0/p@-H0@PP0P0a0 0 0P0 R00pXO-@Pp`.0$(0,0 0#   \$0 $ $@ \ 3 Q\ P0 00"0(00(,40$P \ P \ P 0  L P0@ rPpQ0 jX@yʚ;ɚ;0 ,p@-d@ 0$ 0S 0pP P崬0S k$000Stnp@@ȁXHȁp@- x㔬p0p@Q0}/’\ \#3$07P, 8@#4ie03/p@0/Hȁ\Mb@ȁ@BX^0S0/0G-P@M@(p(0< 0800,p$@ @@ @`P0 P000'>0,(p$@ @ @P<08 @Ѝ^RC-Mp 0@P`` 堐.t0 00  00P 0 0f?oY20S 0S0ńЍ80< 0S 800< /Kcp@-@ @0`0@0Bc,PU 80< 0 DVbp@2cPMb@-@PP@J@-P@`0S 44q4a 0S@0 Y( 0R0000  b0 ^㎙b 0SƂ 00"#! "#1)bP3 $103$!0 3/ᖫ0 00000@000Mbz\@-c ^0p@-`Q@P0 *0`, 6bup*0` p@,b1^5^0H-@`,M0bP0S? T$PU? ,XO80< 0 80< 嗫 ]P@ aH  @R ppD ̱00P1D H员p-W  ] !0 Yxa@0Iqap00 0P00000pEbps6J0S 0R 0(0 0 ,P0$  R 0(00$P 0-i6Pb%۪| Q 0   P bᚘz9^A^R\C-@,MP` 㲪0 $0(  ,0p@0000 HPD` @a@U  t000000 T0 PP `ሪ,Ѝᇪ00aɪW^`^Rp@-@`PP9I PpP1I00p@-@X0M 0@0@ @@@ W[  00@@Ѝ@Hk^zhȁz0SA-@p`B@T兪`H Ps@P `HH0V P@(@0T@SP P0PT TPX0\ P0 X0\ \U `H@@H V P@hȁz@-@dX0\ 0S X00\ @P0ST T % 6T@`Hz0SA-"<p8`۩@T H0P!`P P0S OH Ѝ0V @崩@0T@S 0 |0P 0P0 T0 0 U O[H@ V @hȁzRRĵRlȁ@-@h兩0 0S 00 @0S   $弩T[O@/Hzp@-@7OPGOpp@-@PO@p0-@- p@ 0P` 0_0`00_PЍ@Ѝ/p@-P@9`V {`_ 0  0p@__ꄹRt^p@-@8P则 3 $!厙4R`00p0S/p@-P@x4,0S  (0 0@0(07`p@?0 0R0000 000 @0S  Sp@-0P@0ި 0R 0(0 0 X4P `pp/p@-@PPp0Sp_@-X0@SHe@ ep0S/ R/h l00hpȁDz @-(厨 0   V0@zpȁRDz0 ,P100S//u@z庨@zA-xMmp`@T嬨xЍ&Rl00& 匀p0S p Rt00CJQ0S \0s0\0x t0000x0(0\0\P0 Tpȁ0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0Y0 0000 0@0i[P H0L 0P0S 0003/(@ʚ;pȁ0@-@,Mf0003/80< 0 @0S P00$,Ѝ0@WX0S&P 08gH \0AQ00\0`0S;,Ѝ06p@-PiF 0@   S%0S@#p VF@@- P@zT@-@ eP LoЍ \Q?/ɚ;0@-@MP nP0 Ѝ0P@-@ P P0 T0S000305: 0$QPʚ;ʚ;@-@ PQ  nЍG-p`@M00  0`@=eP <PT 0 00 @Ѝ R  T@0@C09#PPPU 00Sg  zdP $ 0 S (0@P0R0P100Q:UGeP !S R(QQ\( 0 BR0 \00 \0 0 Q R^ 0 R R 0u{|^ʚ;0@-@,MP 9mP0S00 0MPQ 0 >nP,Ѝ0p@-@(MP` m0P 0S000, PQ 00 00(Ѝp n0P @- R R S12S1`01 0m Ѝ@-0@SM 0Q  00m  b mP Ѝ0@-R@P$M 1` l]]T U  lP  @04 S#*/00$Ѝ0脵^@B@-0 ЍA-@QP  Х0!`Ap0 R pW=) -` p`U嵥P0 S00 10\00 1 p 00 00\ @@S0P S0."? Aե꠶Hȁ@BZ{c /pȁ?B0p@-0M 00000` 0PX@PP  %l0P@0S!Q Q  +m@0ЍppC-P `0EQ@P XP\ ` f HUp0Sp0 0@S((0,0,0p0 pRpȁxȁ0`0X00CS/@-@8~X0S000S(0S, , " @z@-@X00CS@<0@-@00S &R, l00& 00@CpȁA-X0@0CS8CPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0@zʚ;ɚ;6ep@-P0S H LA  R5k9 SAUt $\RnA#P0SRX Wp W xt 0xt00  0xt00W W @ a 0 00⌠A: |jP^@-0 Ѝ䈂@A-1`PU 0FS0!RX00CS 0S 0SxxS 0oHHL@LpH@L@PPp^P@HL@P0ɚ;6eO-4MX0YP4Ѝ0@S`p3aP/aPP`ATPW 8H0L 0P0S# X 0BQ%SR  H aP H0 L0 H0P L RP 0 H0LP p YS ~ HaP H0 L0S H0P L BRP T0SH0LP0P0S0 $0P0Pɚ;6eʚ;p@-@HM` zhP P1U(P0 0WPU (~iHЍpp@-`V 0@S@@P(P'p}"p@-@ M P Xi Ѝp@-1@`V 0DS@P1Sp0 S 00pQ)p@-` MP@0S PP  0!  Ѝp 5!!04 ?A3c00?A3c0/Mb0@-@Q$M   P h$Ѝ0Q/ЍO-MP`_P_P@p0 0PW 01S 100[%T ?@W DpU0 @ U 0  0t pxP 40匐P@@Ϡ0H0L0P #0 RQ @ U U% p FT#>H_P H L d0H PL QP H LPV?6e^ɚ;C-P`U@p,M0S U 1gP ,Ѝ p01P  ?10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@Xp@-@`P20SpuG-1C0(q%@@XP`X R00Ga 00 CQ'Q QC400 0C?ƒ10Q0 0 QC400 0C?ƒ1 QC80#3:xP(A Ѝ (($0P^W ^^^R^ 00(1 (  S !$00/z00/A-@p`Pp ` Ap@-P@~ p@p@-@v0 0  P00%pp@-@Pe0 0  0000 T  ,03R p͞pp@-@`PD` Pp@@-@=@弞$A@@-@40@@@-@*@婞@@@-@!@堞A@@-@000@蔞p@-t1(AG 0XP0 0!` \ \\dPd\`dP:C$ `C/!P \\dPd\`(d( &C( `/!P \\dPd\` d #AU^ 0S // 峜ȁ帜ȁȁ@- *Pȁ0@-PM@U0 `|p#000p"P0S[VЍ00 R Ѝ@S@Ѝ@/^ȁa^0O-,M  f00 Sp0 R0#p!22 0#002?j@T   T QT PP  R0SLK03/`qP L,RV< <2@ P0@_@`2S0' T0/ P?#1P0 []`0 ;f[ 1 !/0 0`|R,Ѝ0S dR`WXXR 00 1 PP03/`P ,hRV 00C S!00CS#0S$0;S~%0<S{i< t0`0@_U@n0h  T 0P>RHTf ^ȁ^,^PB_з^^^^QK^j^D10S/p@- M P0E 1@TA 0S P< 00\?0`P0 MA@RQ%0S < 00\ 0R i`P03/PP $EA@QU ЍpȁP^^ p@-P@{p@y@-400S (峛P@Qi@iNȁ^p@- P@N JU 0D P@\p0P HLHPLTPTX\^X05\5 0H^O^ȁA-`@ 0 0qPUT9@`p iWp0SPT 9@ȁ O-2DM0 S@3 #1U3`p\0A (0a800,$  P000㈱|< 0a0,8 ($  P0000< 0a0,8 ($  P000< 0a0,8 ($  P000< 0a0,8 ($  P&000L 0a,($  P<08 'DDЍO-38ȁo^R,RO-p@Mᴰ0T` |PP(`` 0 X J*AXX 0" 00 0000`0 0=Ѝ@TH^@-@ @@-@@ @-@@G-@pP@B $`Y030#T00S d`4!M8#8#40Ѝ/@-`0F S#*@\Pb M0 0900@0<< 0raP@TЍpA-@pD`@DTPM0U090E0U@000E-0,M$00 0 00 00 00 00 0 00000000 )P,Ѝĸ^-,M &  O,Ѝ^7@- P@0000#4000#40000 P  S  Ѝ07@-P@0          00000 @  S  Ѝ07@- h0Pb"@!4b4# 0GD000 P  U  Ѝ0s@-P@`  |0b"!4b4#00000 4"400000 4"40000 @  T Ѝph R/!p0!?aAS/G-0@`pQ@M(0( <0a0,$@ @@ @<@<0S+ 0 0 ?A1c00 0 0000< 0a,($@@ @X0P000a0,($@ @ @P< @Ѝ^\gfff@S@-p0@0PP`M:? 0` 0 P 00 000000Ѝ?@\1`SA-@PHpkPUTPE 0=p@-0@0p00#1R  p@舾3Sph0SpS @0@0 P@00@0  RP @00@0pP@@- 0@ CSR0SP D0@0\+V@ 0 ꄭ/ R/@-@$0 B @ꄭ@-|@T&.Ah0S/@-0@; S :#0@|000000/yA-P|0@`嘗l0` 0|p BG0S `|P0 00C S :#0Aėꄭy//00/p@-P,0C؇0 0 S :#0p@ۇ//P P  P! // //@-M^A-@P`Tp` T T M`0 0N^ 3@0<01 00/p@- P  @`\ QP00R0S 0S S 0CS 0S S 0`O@ Tp@^^{^0SFA-b@0PpP TUSQ #P RR  BR R R  P R @  r  r   0 /^@-@w @- 20 2O-M0l2lb `0`@` 0 0L2LR@P<00P00P0 2000 0 p0 <X< W < <<@ ЍOX < Y 0o㫲0Z* RR00@R0S2  R0S 0„2 @Q002  " P2 0R ;00R 000 00S 00 0@H 0 S0A- @`V?000Q|LPURPU P   \<,  \0  @ \@0@ @U P  \ 0   \0   \0 @U P   \<,  \ 0  \0   \0  \0  \0  @ \@0@  \0  \0 0s@-@0@S`=Pm0 @0^ 0 3Ѝp\\ \†$$ \0S0 CR.@-@€0SS 0CS0@S0s 0s 0"P0,B0S2 RQ P/͹^/QPG- p@@ `P7/P @@U@- 0@0 0P DЍdS@- 0@0 0P DЍ(SRPA-p00Q0SP@` @ R 8/P W@RQA-p00P0S`@P @ R 8/P W@0 0S S :*\#3//@-@Q 00 0000P A-h`@pPUpW0P@@` 0RP PA-pPP0@T`0S  `0 RtP @@-moO-p( |0Rx`P@P@:/@P 0 09/,JQU 57/PITATع^^O-Mp8 Qܠ ` PU @ 0  7/PP 0   pF P :/VJ VЍ@ Q `0 9/@T*W @  pG1S @ITAT^^p@-@P 0R| 0 00 0 0  @  1 Rp! 010 00p Qp0p@-0P0PToP@0 0p0SpPp0 0  ꀽ@-@4T ,0   @ @ @@菓ꀽ@-0@ Q @2@f1p@-P}@Tp 0R000 P 1L2 L1yIHVl0S 0KD0S CD1ꀽ7^p@-d`P(@TLFπ R0,0 ( < 03/1ȁ0@- @.T0 Q PTKQ R 4LKR        d^^O-Mp0 0R8 `@P4 P[EVP P  P 2 0 00 1Kd "P  <P 003/PЍTSܺ^^^^@-D@r0S Id (00 !@媒ȁ\Mb @-@o00 00000/0@-@M0 RPU0S0S   Ѝ0 Q0 PPp@-@PP`D p0 R|P @TA-`p@PPPQ 0 R ^P0s @op@-P@Tp0 RBP @ 0!< 04 0 (   !/\ P/0 !8 00 (  , !/@-P`p 噑 啑Q0SOG@0 xPt0 hPd \@\08< 8080H@0<0V80:[

pPR @> /T`@ A@0@~0 @H0@x~ЍpȁO^S@-d@0P 0P H G0P ~0P  G@/ȁZ^p@-P<0@Tp0 RCP @A-Pp@P`  0R-P `VX00PW@ G0S PP000@-M@PPP, +0QPaUP 0S   p00S  QR000 !R  R 0PЍ0 @-@x0P@tp@-0QX0P@ @0Ppp@+'Pp@TpO-,MP`PC MpP> P .Pf. 0@00尴00a00h0l0@P0<043\0 0PpST U0Wp00 01S PU 01S PuG@,ЍpW1 00S00C00 001 . 0S 0R d! .Pԏ!  G!00S  Y0 Sp 0p%0%0 UC0PPC&P PE0S  H 050"0CQ 0 ⎏\E$0 $  X0480080<00<00S 0 P5.D0 D 010 D!E0H "HX HPep  .L.00SM 5 PPJ 00 X1 `P. 0S # 0P0 k pP   R   W 0Z l`YI  LHV 0A P^̾^ƻ^Ի^^^^^^^p@-@P`}0Pp p@0/A-`0@Pp t Q A 0P1 P P O-`p0004PUX Ѝ@0SP  R@ 0S 0CSP  0\P tP [ 0 ;/P ȁ0@-M@P Ѝ0O-@P`p||0S Ѝ P @pU 05/T O2_!@-@ =0d000uE@}ȁA-X`P>X A/p,@,%,0p P0@,@Acȁ@-@<P0 SP T0 0D X @T@D@@Nȁp@-40SXxFP`,@400(0P `L  @L@p@0,^ȁp@-h0P0Sp@/`,@4ԍ00(0` PT  @T@p@Nȁ@-@LP00CSP0 T X0,R( X0D0X0T D@ȁȁp@-P`ᦍ@Tp@pV0  4 R SD   ٍ 03/M, 凍0@ȁp@-@$PHP(p@p@-r`P@Tp崍={ R0T0 L 媍P 03/<0(E,Qȁ^^A-0P0`SxpX@ 6/P0S 0S @T+@\0` P0\ȁA-AP!A@0S-cQ0SK`XPUKV0Xa0XPI@L1@0 X $0S PyCAT!TA0B $CvAp @0R :<RP!`%`56/@@T 6//0t"#0RC6/T@3/P0 3/P` R0\0  }+ȁ82_|^^\NTJT^^Mb^$0$$08S 0  |Sȁȁp@-@PH嗌T 0S 0AT 0 0 @όp耽@-@LK,A-P`ywU㰀q@希嶌0S 0@T 0 0d0S\0S #S`0S (囌0BNȁG-MP8 `p@PHD 0S0 0,20SV 20SR gCVQ5GE0E014XXpPt0 00r3A0 03/HT\4C4=-$P`6V<0ID77VЍD D EW 7/pP 0R   P0 4S 0S p^ȁN$^7^ȁPȁ^.^A- Mp` P @P 0 A@ ЍU H00S <00S B5/ 1p/EȁNع^@-$M@P8 `py0 $Ѝp@-PM ` @P 0S0 0(0 03/8800\0qB zjЍpȁȁP L0*ȁG-@pPPU`0S23`0p0{APP \RUL0 0 4F$(`P6B?PЍb0005=0S0S<0K 0SH 3/PPD0e0<00<0ӊx!L0z*h4P 0(0S 3/4Y.0S  D崊0`0A50U0C0   S(0S%_-P   CP  0R  P 0S0 4S "+00ȁȁ^W^p@-@Pp@A@-@P 7@-@/Ѝs@- P`@P 0 0@ЍpCꐽ^@-@P @-@=P@@-000 ЍS@-000{ ЍS@-000 ЍDZ@-000 Ѝ䄭Z 0Q/P /@-00 0XP ЍS@-00 0NP ЍS@-00 0`P ЍDZ@-00 0VP Ѝ䄭Z0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0<0`0<00Sʸ0Sp@躉@?@-@x0P|0S@/|/A-`@ZpȀ<0P 0S#Q003P0 000?00C0u@ႉp@-@P200CS00d@p@p//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0hpS A1'0`S0Y030#@D 0Shl`}W ' P0!!0A-P@l`hpT1S S@ R Tjh@l@NA&1GQ @p@-P @gP0P  $     PU $  U p@pDQ P  80R 0 Q }P 80R 0 ꀽp@-Pڇ0 0S S, S@t@pm@P`F`i`V80S@[@P``W` 0V80S@ꀽp@-P`@P P p@@-0@Sl00@s@-A_P 00` `@t000TЍp L @P00P@@?Ɂ^^@-@8@x@-@0S,0@T   B B  @菇ꀽp@-M` P@P U 4 @Ѝp R 0 R G0 QS8  %PPPP н^p@-MP` P@ Ѝp U @P C-Mp `@T ЍTP/ 0 6/O-@P(0!夡M#&0 1 09 ⃡p@Dtqa` h(dq0`P@0 0 007/$08`$ 0ЍO/Y`_ 0'7/#$PQ,7/ЍAT^?T^^^^@- P0Sp@-@`P hpt p0|0x0X0 0\0`dPp` @-@f@ `A-@tP`ppP@T @ U@ 5/@p@-@` P 0 0fj@@f@-@tph@p` ` `r ` G-<@Y800P$A`Ϡp ? V: `V p0 W$PO-@8<M Q00Ѝp0(  R:8 R ( X`Ϡ !R F f5 $8 0  / 0?V;; 0 4; $U *PU0P  X$P f PV FP< Ơ8Y X` : 0X*0 600 ( 0$8 0p@-( \:P80S @<4;$< 80(0$00600<08Q5/p@ p0@-@MS 0 0C?o2P R R R4 R1 @Ѝ008@P|@P"080 S  `"008S9^ ^A-hfMQ`P! Q4 Q, sv 3Qe B3Q ,7C0CQ 0Q @tpSo PUV` `oVV@ @}fߍ00@ <# T2QQ1 f/ (R@E/2QR 2Q 60Qr  EfߍAH1Qe  8fߍAFQf/@ @0 S0;30?`aV! 0S 2     *! R R 0S fߍAqH# {I hH<?`P3a:*@pVp 0 Wp0pGd @]d@edAd@edA|dhd ydG-0`S<$0@b /o bX c0?o 0c\0 P$0 ," S  R Q $JH!p  R ("( R ("($ R 0< R @  pV  \pU `  n 4VGbf^w^^^^^^^^0 60/80S/p@-(0@S ;;S0`s- P S  R8SP peo(0aSR a#"P R 02UXҷf/ep"2P 0R*pWEVs@-P p5 `@PA@6 #:@$:@ _P  &tL N@P TH034( 0&$; Ѝp^^@ 0p@-M0@P0( `Pk0P X <2 CP*P0 Ѝp00 0 Pzd@hd A-0(M pP0`@P. 0 @P&`'d0' pp)q ap #@0T p#! * * @(Ѝzd@hd =^D^p0S/@-l0@ 0P 0 P0p0Ѝ^@-`DM@PP `& l0 00S p0StP p0pS0l0@0 0p0,pP$00004P`P0tpt0DЍ00@-́A-@(M`1x0P |PU0p SZPU=p  0R0 00?Pp *+P 0DP0S 0P=9C =CP 0x@(Ѝ@BO-@,MpxP `|倠PY XZPU=  R 0B000?P 0 P0P0弰ZP=J JP弰xhPl0PYp``XZPU=i m 0R0 00?P `0 P0P`<0嬐`VP=iF mFP嬐`h@,Ѝ@BG-@(MpᎴXh0l `PPp0`VZPU=i m P0B000? `0 P0P`0嬠`VP=iF mFP嬠`hX Y? 8 < 0# 0$ 0 0$ (Ѝ@ D 0$(0, 0 (0, @BP/004 0 004 /p@-@P@|0T00  0pD 0!< 04 0 (   !/\ P/0 !8 00 (  , !/ G-0 M P   @ p X@`lP X 0000 ЍG@1  @PD́A-X`PpW0S8 Aq P@m@́^p@-@P0 p@Dp@-@0PD@TpD@p@-@PDPpUp@00@p00S:)/D00S:*/D00 R !{D0 ,D0 'D0 mD"111/"111/ 211/ @-L0!0\Q S0D,0 0R/Q0 /D@-0 |oDD0 0R/@- 0RD <0Q/1S co `/ D @-@0^1 0 co ` D40@0\/@- 0\ D40@0\/@- 0\  D40@0\/@- 0\ DA-@`P$0pW @PD 2 2A-P`@$p0SQ @DA-P`@$p0SQ @DA-P`@(p0SQ @DO-` Rp;:Pа$M0@T$Ѝ0S:?T@*Q; P 0 ?0@4'V`1  L      T: 0I37@-@0@T t0Ѝ@\P0 1 8*b0 PЍ`p@-P@P  p@-0t  B^\  @ŠP0 !@0. . `@-0+00Z,@  0*Q耾^/-@- p$P0 P@~`0 P Ѝ@Ѝ/A-pP`b@j0P U @0p@-@`PW@P  00p@-@P>@{PA /R/qN/@-H^N/@-B^@->^@-:^N/ 0!< 04 0 (   !/\ P/0 !8 00 (  , !/p@-`PS@0 0/0 p@Zp@-@`q`@PP 0 000 Cp@`0@-@0s@-@0 PЀ ``0 <**B`0 000ЍpSp@-@`Pᾞ0S &`0 0S 00 Xa`p@蝠/~,́G-`MpP@ᰐtP!0 3 0000X0P3/H3 00P00 [Ѝ,́&^.^AT^^p@-T@d_\00 P@ B?"@U$ `p 00C0/(0, 0́@-@ _0@ @@_0́p@-T@`_ PUP 0 001`00 0RPP_p0́a0@-$0P 0 0" Ѝ0́@-@_0U@_0́p@-A@ <`Pq_0 0RpU@_p0́p@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \P;_0L$PBU 0P{_Pp p@ !0 p@"|f~f0́8́A- pM`P_| 0R( p@T1 00S 0E0C@S@1T( T@# 00S0 Sph?_ P@L^T W 01_#@ЍO@P &_0́ṕp@-@T P,0,h0^ T_pp^0́H́G-頁@0MS㠠$ Ppx1 R0S! 5S-@Z@W 00@ ^ ` P@U`1^V @0@0Ѝ 0`` "0  00  00P 0 0廤@PEUP!U @ ?&0@S 0 㼗T0p`FP@0́a0ŁQ/p@-P0 @AlP Q PP  @ 00H0p0́a0O-P@S@@T`臁 13/ pցՁG-p0 @0 0 P  (`,(0, 0/X(0, 0Q r000C00Ѝ 0$ 0 0$ P@  13/P pV 0 :P^[A-@Px`Q@pPEPE804P"8%< 40R:AKQzp@-@Px`PH0,PU< 40R*p@4Qp@-@Px`P0Pp@*QA-`@xPpP? 00+0`@`PPPEP0p8E;8A Q//\00S /@-X <!t  L  R0S @-P@ṔO-PP@4M?4ЍO/lR5 pR5 cR sR` SR0 RS 0S! X4/X0V0l $ $00 0000000L0 0H00<0 0 4/4Ѝp0`pttb(4/X E4/<0Y0804 ,4/P00@$4/4/00-4/Z 0S E4/ 0S 4/ 0S 4/0SJ4/Wx4/X Pp 0FNP `` `0``` ``p$`0P Z`\P,4/, 01p4/U4/Yy r4/Q`Us  4/p0X:P\4/ r 0D4/p4/^&^0^5^\^^^^^^G^]^p@-P` 0@Tp @A-@xp`OPU  PUPU  lPP dP POP WPP@-M8PQP1 ! !1@11/ qQa 0 [ V 0 V03SpJ0 0 [ V 0 V03S00"    +t^^^^^-0@-M PQ0$@ @ @800S @ @vFЍ0@Ѝ/<́-@-T031[  1 0S 00 00 ZЍЍ/-@-T031[  1 0S 00 00 @ЍЍ/-@-0 0001Ѝ Ѝ/s@-P@`0 `"Ѝp@-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@eXف@-@P`00 `TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <&!1 @P >`Ѝ 00 U00S`C 0S. z,@T@p T @@` 0R# T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG?@1c  p U 0 %^gfff(^@-< 0 0 0,0; }@ Xف^ t@-@@-?@-@P0 @ @ @800S @ @Ѝ0@ Ѝ/<́0Q   <^T^@-`@P 0 P000S   oЍp<́-?@-@P@P 0  000YЍ0@ Ѝ/ 0S JP P@@-0`Mp@  P0 Ѝ0-@-0 000 ЍЍ/-@-@Md0 4 0 000 [Ѝ@ Ѝ/g^@-P`O10S A3S  lPT @z#T212@00@00A0S<$10SA0 00S 0 0Q000 Z#p0 Pb 0 pp0 0S `0` 0Q01bP/0 `hفXفD́4́a0^tف^^l^-@-`00/s@-@P`T 0 ,@J0 `Ѝp@|g^-@-  ЍЍ/-@-00` Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`ppT 0 H@ 0 `$00S Ѝ@2 Ѝ|g^Xف-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`BT 0 ,@0 `kЍp@9|g^-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppP0T00 0 \@~0 Hy0  0SЍAЍ|Xفg^^-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``T 0 H@/0 p$00S Ѝ@V Ѝ|g^Xف-@-  ЍЍ/-@-00= Ѝ Ѝ/-@-   Ѝ Ѝ/ 0SA-aS_F8XF@(p F01 010101/A-a(P!R Ap@1!#880Ro1F$1 q0$12020L AE@-`R( q@_ET0  (0!R@D!!!R Ѝ@FA@F p P EE Ѝ0 00x P E_^p00S/@-`0`@0S@0D 0 @0D E@0D 0 @0D @EXفԽ|0P@-  !T LD.!      /l 0CS@-T0 !< 04 ,   !/^@-魃P 0Pp@-9 0P@9OoBPp$0 0!0 00 /@-<0DT 0 !0  !0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P`@l DPp@-@ D @i00/A-@Pp` i00$0@p#0 rAA-P@`wp R0S00  0S00 Xx0SAA-@PpY` 400@000#0 <A[0@-P@`xpM00Q ` 0 T 0S0Ѝ9D {D[ԽTTT?/0 0 1PS/ /@- @D00@-^G-@Rᜐ D PU``1S `V PQ pq  0 P00.D`VTp@-@PC0S` p@D0U* `V 0a@-@@ Cp@-`PC@Tp00C`0S   0SCp@g s`p@-@`PC@T 0S@A @CpP/0S /O-p`PzC0S R 1 ЍOCCiC@X:C 10@XC@T R ACC  ЍO  R !  R   wCuCT  Ѝ&^@- M@ ᧓ 0 R0 00CS0 R=9 = 0 Ѝ@- M@ ᅓ0 0S 0  AQ0S00  00 Ѝʚ;@- M@ :0 0S 0  AQ0S00  00u Ѝʚ;p@-P@P@p@-PM@ 0 `\0` p^Z\k` 0 R S Q 0 Ѝ\ 0S AQ0 0S00  00,ʚ;A-qP M3 BqBT t13AT \B@ ЍM@^B000 dBB 0 000@0 0@P! /00B! 0㨀!!3Ba4BT _2PrBp@zckB! @ 00P P@I̒Tʚ;@-P@ 0 00   `pP10e 6 0S0  @P0S0 0  00Ѝpɚ;ʚ;C-@` 0M0RPЍ0 QPP pYP  R0 AQ@XPP0 00S2TP Ѝ000 @ 00@- X( b0A*(P Ѝ@- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-@P8 X0P4 R0 40 Q Ѝ0@f0U @-,^ :@!!<  12@X0 0(X 0 p@-@P8`Qp@81S3A-@pP`80 00@8ЍO-s,M@0`PVP`$ 0+t3B w8 s8  o8404#C8("<pXw/ 0C0CVp40 2p8<000Td0a@PY `h A8d0H0> T`X` 0u0J1 Pp@W U P!T0L0X0$ P0\0 \0q``a a,Qq1011410Q&3*`5WpF&8!U. P0`Pd PR0 S 0 PSD d0 $SP= K@,Ѝ`QH  B(`z`1QES 0 @AP h00<  W0O< @@ QF? P q`F pఃd0 qL7( @,0,@SI$1((0(17ځXP^LTTU^܁ A-@p0 M`00P 00 0p0@N0 00  0|0p0@0 \0\ &P(X00@0 p0P0  Ѝ ځPTH^T̺NN4-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-u^00@-M00|0|@| 0x00c00PP X ) 8倘40 0 Ѝ0@>H^ځ|T^^uT\,,00 C#' ,00/н400 Q0000$  B',#  /4A-@PM` p60 0 0! 0?P W 0  \ \0P  $PP 6Ѝ$ 0  0 P#^ T^p@-P@6 P6X$A-@P6t0 3R 0SP` p!VU A6S0G-0P3x0@ h$T6p `V 00 06`03/V>60 0 0 s@-@G@Qs@-0PQ0 7 0@S 60 `0ЂЄI 0S O66_ @Ѝp@U`TO-0Pp,0 `0@ `F`! P (0P@0 0 PP PUP@4p@-P@5000PPp@50@S@-%0 /^/G-@+ p尐Pd嬀Vʀ 0 ! $ 0  .!4/ 0!d!0    !4//@-///p@-@P^5000CS005p@ p@5p@-`xMV 0@S x P ᐣ000(`(0=5 e5xЍpTC-M 0`p` @德P0 P 00 00 0 0@V{?o2P0S RR! %*Ѝ\C-M 0`p` @厷P0 P  00 00 0 0@&{?o2P0S RR Ѝ\P  0R://O-0 ,p`@\ PU3 \\0\ PU0 0 0 @\ \0 PU00 R \\ PU  0 0p@-@R 0Sb0S] 0S_0 R @0 R  R 0 \0000 R PU \ PU 0 \ \R  \0\  ^  0 0 0S 0 R  R 0 \000 Rp0 0p R @0  R  R 0 \0000 R \\ \ R R R   \0\  ^  0 0 0S 0 R  R 0 \00A-S`@1 \. P\P\ p^ 0S0S0SP RPP0P0SP^ 00SW \ p^ 0Sp@-@P$`1@1(p@)2p@-`P@0U S0PP @ p@@]pp  P 0P@-@Qp Pp@-@PQpp0 P0@ 0R  R/P R/0P/ R / 0R  R/P  R/0P/ R /0S/Q 00O-p$ 4MX1 0SPX 1`%ꔰ[Y( ┟@`@P  (@`$ .10 0`P ( q14Ѝ@A$@(`&Rl00& 0T0C 0Q `1h 0l0P$0hP P0$0M1 @100 E14 PU T`h0Ss`P@$`(Pp@-@ $0P0P@ P00P0@PpO-pP`$0@T @ 1T 0 1000p 0,pVp0 ЍG-@Q8@T80S <`0P@0U:0@8Q080D0@00~0GLB80兑P p W 80 0   2Pp@-PL(@y "0D0<8@0 <N008 8  0 S  @0F080S 0p8@0A-@`P$p20h`0l0@h00 00 00Q0m0p@-@$P`0 @T`0p(0S H0SV0p$P 0$0SI0@H RB0h07@-P @P@P 80S10@ Ѝ0<00*018P /p@-0P@ PP00' p@/^@-@/@ K@- @/0 000oA-`@p/ 0S P a00 00/A/QU q/00CS0/`/@-@~/X/@s/@-@TP 0T0 @>80@-p0 0mPP@`TV P Ѝ80S /V  P@00TP TP0 <0@ 80}/V  l818P /O-pp3TM`3@ P00?STЍ,0S 0S 0SV$0S S8 S `8P3 $0@ 8PH0P @@ m   Hp p.X L尵T]`P@ `P80S .00 000.T`i @p`~D0<.80!0S0 80R1``80a8000..$ 1 P 0R,:. 0 5 @#T 0T0>W W  .T0T0TC0. G.0Y00000.18\0SS  S/@- @P1@8@- @P1@8p@-P` . 0SS 0 000p@A.0AT -0S 00 0$00CS0,.`'.@-@-0TP0s0XT0.L$@z@- @   0 03/@P0W0>   {@ X3V0 0,Q *Q :@  0  !@001 1 000       @w#000 S 30H 00C 2 0 0 00 3/@PY 0  "  00 0 0 3/@P 00 3/B0@ 0@00 0| 03/@P 0 0 0 0@ 0 3/ 010 0 0 0 03/ 0@0 0 0 03/@  (0`S10 0P@0+@ 0 03/0 0 0 0 00 @ ^D~f}f3{f@|f@-@6P p p@-@P)0P @ 003/@p@-@M P lЍp@-`@ 0P @ 040S-@  3/@p@-$M@P @, 00`V-@% 0 10 !0S! S S@ 1; 000 00p qH 0 006/@$Ѝ0A-@PP @ 08Q-@ b00 0`01/@Ѝ@-0@0! Ѝ@-@  nP0000Ѝ7@-@P mP P Ѝ0A-"0`p SB@ pP P`0 @  O-@oopb W T0!03SIP (0S0P p(0SY @ 1!H  @@ PU @+P-dM"h0 (00@#0 00 ,8;dЍTA-0P`p@0 TЍ@- #0@- G-pP1SA@>( `R111U @ T 1P Ѝ@-00S0;0 ЍO-`0#MPܰ" 0$0P @Ѝ(0SppzW @P (0S0pWpWpgW @pGorV X_ @T    A0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  @P 0 00000 00 L-P@x  @q0  @P @g0  @PP ([1 01  0109 0PPQ`,0 @ @" TTEp@-0PS@`M  P0 Ѝp0000 O-14M`@PX0`0CS: 4ЍqP  (0Sr[X\00X0 00 ` X  &0 J&%  0?&[ ^O-0p IR@4M, [P  @P!@T  @P @  @0` @P "@ 4Ѝ?@-@%p0t 0 0x0 @%p@-d0d@P%&r"0@3@#V%pp@-d0d@P%h0l (00, @@V%pp0p@-Q@ 1CQ 1CQ pPo%h0l 00010%p00f@p@-d0@P0S S p80`h0pPO%m%p0@`0^D^p@-@d0P=%@]p@%p@-@d0P1%Qp@s%p@-P@P  @%pp@-@P` \%&'00F= 00'`P000@0 7%pp@-P@$A` h0l 0H0` &r0`3:0@%pG-0SP'@  pPP srF $h0l Y^:0 h0l 1u$A$ЍX#x0S `$P000p0t 0 p0t p0t `0Sp0x0 t S PP #`PA-0SP-@ `i$phl 0 y0S 0Q h0lt $@u$  ᧨PX!x0S P$Ѝp0t 0 p0t p0t P0Sp0x0 t S PP #PO-50S`5 P`P-00p嬰 0 0(0 @ #@ZH W@00y0hl`{t%+  @{ 03}00 ЍX^0 0R0,00 0 0/ᫍp@-P`@t  Pppp@-P@L`#U<<P@P PPP@ @#p@€T€D€p@-@`P EPpQ@-@ K@ ۑO-`pP(@T 0(  Y }#$Z # @ #IPW(@ X `#$[ # @T 0( q p,0H0@0,0#PPp@-@ⷨP@oЍ0P :0Q:///0/P$ Qp@-$PP $@*#p@# #0/P$ Qp@-$Pp@G#P $@*A#>#A-@`PUD,"pP@ 0S 0S00!#T0`"8P40S$p#"(PU "#P"""8 A@md EP@€T€D€A-P0\!Qp# `!0  ᔋPP  PP0S Ѝ@9@P P0 0$pP^" 0Z"804P(Pt,0Y"0S``T0`0 }PP`("U0S K^@€T€D€O-STM@xp|N `PP#@E W 0S@P;0  00 0  R0 0200p f@P(P !,UH4@L@$ ! P  5"#@P ,B!TЍ!,048@<0P80,0" "@`!H@TK 4@TH VWm H`P0  RS> QQ< <`4@0p!40S@  @004PD0!0$L0!!!!!!@0SD  D 040S8!!@!T0@P0S 0AQ 0S 0 P  ,#P`,`ɚ;6e^ʚ;'0@-@M0@d QP#!0  AP@   r@ T@Ѝ0A-PR  p@P `VP $!0 pPU!(0PЍ@P/@-MP@`vP V0 ! 000Ѝ"RS+ P `V $p RP2U0!=0P  RR   .!2P2U0!P!SSp@- ( 0 @Px p@t@€^ @€O-,MpP  S T 4P   X`\P% Y P00\XT  ,ЍO10P ,ЍO;0P 0 $07JY )P@/ [, $ @P&$P "Y 0 0 0` ,$`P > P :,Ѝ`P#@@`P0\0XT  00J/&>2  L+& &bR0@P} 0S4#,S  @P @P 0QS P \@Pa0+ S0&%&b"x1Y, 0 $0=@PM$ 0RXP 0 00,P[2 *"*kA 0 BQ    "0C?o2S0S0S000  P S00S00S wPP IPN@H^^^^0@- 0@SP$M   P 0 P     $Ѝ0 0 R  //p@-`Q0@0 QFtPp00p 0@-@ 0P  P ЍC-@$MP P 1` z?0 0?$ЍP`p崀P`0S X *1` z?0 0x?V bPPPa_X V  ^@BU^@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P U tT00#T0S@D0PE0S 0 @WP0P4ЍŁ@-P@`P 0 Ѝp0 ` O-R@|M PP 0 @|ЍY 0,Q@! 0000 1/@P0qlX X@` @P V  8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @WW (( R LP0DWP ᩼ y@Ł0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0U tT00#T0S@  T  0h3 5NP 0PED00S 0 @VX0P4ЍTŁ@-P@`P 0 Ѝp0 ` O-R|M@ PP 0 @|ЍY 0,Q@ 0000 1/@P0qlX X@`  @P V 8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  03 M9 (0X0B 0 R  @:V᣻ (( R LP0'VP ጻ \@ŁT0@-0 0I ЍO-1PMp0%P P @@ P @f  0 03/PZ  Q@f [ $/ x  P 5/PP [ $/  P R 0 iU  0 S @ 0 0@ub xz/  A$4` 0 , $(    TwIf rdAedAedAŁ}f~fg~^G-pM7 P ㎺0` SP 0  @,sЍ>    7K@P  07 000LP8'7 (P0S6  S1#U S1 #0 LP  7@P0@7 L~@P  7 r0 @LPd ᵟ@PU @[P0 HP @ꈽ^^^00@-@0,MP 0 00!00T0@3Q100 0 0S N0@DT@,Ѝ0/p@-P@8_ ֹpG- P @`$pX X X@(0WPP@ ?0 0@`020@`A-P S@`@TQ U20 Q@ Q  E 0  c@#MkRЍlpp~Np@W02A 0 @  01/@A-@`Pp 0@G-pP@` S!@"0R  2  00@ 0@[0"(0  ,0`$0 @A-@`pP[ ᣈ 2`p0#΅"^0@@}A-QPp Q! Q`+ai`@2` R`   Q`02S@20JC-Pp`2 ; Ѝ S @ R0P0@A`0 00a(0 #Xj 0R P A-`Pp S@"@Q  0" R0Q@H0 00a 0@ "%jЍG-`VP:Pp L @ [ 0 ePP$!i2 022PP 0 ( h @  &a  00Ѝt]  ^(^G-` R P0S0R@9@ 0+ @P)V  U @$P0p @PᛐP`@ P0 Z@ LpW ͷʷO-0TMp$00S00 0`P#`TЍ0 0`P0a 0`P003 ``3 1P00GCp$`W[3pWb Ⴗ~0`op@⫲W[<3pW4@T0,0 T 1 #0p$, p,0 @Tp00P00S Z 1 !, ],0` T00P00S U 1, M` <9VP P 04P={0`$`P PPp0`$`P PPp  h R<  <` E}h`` P  R , (l( $ , 0 0@@00 0$0000pu  Zh R<  <` EQh`` P  R , (@( $ , 0 0@@00 0$00pOxP@tYP 0 03/`]NV`S@0`S@ 0S@ xD10Ѝ0@-@M P  P , _Ѝ0@-PM =@P  p@P @p0`S  0W000Q  4@ЍO-@$M 0Hp0` 9PP  PP<@ᯠ3 Py@P   (  , ^ R !W$  RR R0R PzԳ@ @c8`0j/ 0R( P 0W`0" ∗1 00 0 100嬡@VpP= @"  P $D1 00? 0@0 4<00000 P  Py0 00 p>L0 T# $Ѝ0S@P^voe`rτn0X@Sk/1!p@@PFV0dP^^^o €€0p@-P @`M P  PAЍp/G- p0`^PP PK@nd 0 Sj$0SD `V10 c /o 0b4 baQ  S  !R!0C31$00C$0[ PC d nU 40  ?oW20SP   P)ЍV   0P P` `0 20y0"20 #P<#(P@- 0000@uP 00Ѝ0@-@PP$M  xP 0 _P 00$Ѝ0O- 3P MⰰR`)0S: S: Y`  _@ P`P 2 # P `P  `Ѝ rdU(`; p 0S:$ 0REXc00 40h!  @ 1@1181$0 SfPU `x0S P x ☁|0 00$0080匰$00$0y A(`  VU 0 Cr[ 0A P `P   P0 #R< # 0S000@@ P0 0  @@P(`(`ld€T0@-00 Ѝ@-@PM  PЍp@-`0SA 1X03/5H0HSp<5H0HS p@ !p@QDTC-$M@`p(dPP @ \0 0@0 0h00<0p `0000@0@P d$Ѝ^\UA-`AMpI 1PT 9@P*0@& (@P! 0  0c? 0  0@P B/@TЍ@-10/10/G-Qp<j`P}@W0S P0 m @@P P @]BP P0P@@G R H@p@-PA+PP>p\h7pp@-@Q@P)@pFP0$P R J@B@.@s@-@Pa0 6@TQ  @Ѝp@-p|M?WP$x AP` 00`0p 0\0$Xp0pPP W ?P |ЍTp@-@aPw1S @T 0S 0QU00001501 0S  pPPO-03pP@`ᄠT P 0 S G y@ 0SPP02P0^C-p`$MRP0P P0C{P0 4P0%@ RP0 0  0"@P $Ѝ0( .G0 ` eGp@ #P U<@ .@U  ^@-`@V  PP  ` 0S  PQ Ѝp jP P0 \C-@MT;0 p0I S@#* aV PZP K@P U PЍ 5@A-p@Wq>0P a@P ?T0003ak@P %@ $q$QW@@-0P@3UQa@nPPЍp$Q  d`r 0R # '@-0S@P ЍG-pW@ PP F0`0Sp 2b@P0S qt@/p@-@1P 0cy iu$ Q$%~180p_p@-`R" 0P1S 0@S PpP0  00pp////// B 0@Ps //Q 0S P 40 P0@1S///$A-@ut03@`P |0S 0 R0`h`d0P0U TpH0AD0Q00C0 R0 QTR$O-0@pPDM(0( <00,p$@ @@ @`<@{Y<0S% 0 00< 00000'>0,0(p$@ @dYT0P0000,(p$@ @ @P< RYDЍ^$,U+UA-@pVW 㵭0 P`㨀0 V:,?T` V 1@`嘭*WЍ0`1S 0 + ^ ^$^C-M 0@p` PG$a0 P 00 000 0PT?o2P0S@.0S@*VPU@$ N@pU*0!R0X H@P6@$ /@VЍ$@-808@ P 3  @8$()U^0@-M 000 00 0p@P@,P 0R `40 S |u @ R \@0`80c @@P Ѝ$@-0 000 0 000@tPЍ@Ѝ0C-Mp0 000p0 0\PQa V  0RI@P0P X@ЍwP w3pU W @0U@ PU0pPpU# Q  z@0S  P ӪP d T @ Q0S 2>4/ QRT@0G-M 00 00 0`P@ hg pP L @Ѝx4143P@刀S 0S S@ u`q tp P@ TQ  @u`L@@@' |PUj Y W 1S 0ሀ03QT0"!S/ 00/P /A-L0C@1S`H1P @ATA/ pp`@00@-^€H^T^O-@QMp33!! Q 1,0<S:0P>0BRUbPEQᆢBDU$XQW]YiP @Pa0X i 0Pg  Z  0!0ЍXWYPELD  0P;P 0  0P.P  0P"P   0PTP   0PTP   0PTP  IyW < 0PY 7  0P0 01 0100/oX" R0  0/oW" R  0/oY" R]  ᕰ 0V y  y0U>^p@-P@U`0M  ]PPP  TP P 000Ѝp@-@PP4M  >P0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V PP @P81 00H@P @ U Eߍ|^@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  PP P  P0(ЍpE/08!PR/p@-SP@HamP@10D1@A `0p 0 pO-0`SP 0S 0@ Q @280SP81^0S ? @0@ 0 a0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!$%00~    0 b@UT: Ѝ^U  0 L0Z  P2pp1   \ 0R 081<10<1     P    ЍO @ P€H^A-`唀p?`@T|@0C0P@PEP > 0 F0 f021@& 0@@A€4@-@( Ow@"p@-@!0Sp 0P R @1S0@1  0S0000p@* @-0M?SU1p`0@SPT:4c`P Z@@D@  V@@ S @Ѝ$`}V00S @@0` 00 @P@T  7@Tt T T 0 d0 Ѝ@80@Tp@-@xMP` x v` /P0 xЍpp@-P@xM`x v001`0 0"0$ uxЍpp@-@PaM. vK 5. ލp0p@-MaP. @P 0@ / 5@qT@ލpO-A$M>ZL`0R00pPA 0V4U 0S31@0b Lv " ㎊h H0 00     WP   P L  `Q((L Q`Q''L  "!    apR Rdb 00000 0 0 00 4W`1 0110 0T0S|[l[1S L0  1 [" [#H0S 1Sep10Sa[LH1H0S ,1 e[0(0[0됻H0SP2 u2 02000008`1 01 1R 0  04P P0 4P0 Ps0S 3$ЍP[H0 ^U0^@AT0@-P@P@  @P $Ѝp@-P@a]i( ,0  4!0 0p@@-@  Ѝp@-a@P;0cτT1m|0 !! !! ! 1013P P04P0p@ZUp@-@Q T1S t3P kP04P0pp@@TcτmOQ@- 0 #DP ^0@-PMP @ P0S Ѝ0A-`q@PV 0! ! ! U 0  1 @ 0 S @3:0 ! !01@0@-P@PM PP0S  R PQ UЍ0O-`V@p MF 03/PPO \PPK `P0 0`0S``UV 8/PP5h2X!@0 X!\! \!`! `! d10d1` s? 01 P ~Qo@00ys 0g1PVj#PЍp1ZS^/x1|! 0A|1 壻p1S 0p1x1PS|!|!|1x! HV7 xX4 XU 0 $0S 0( $ BR( %0Sk) , 0$( 0Q0 @R 0S0h000Q 03/PPPX` 0@3/P PUʚ;@-00Ѝ@@s@-@`Pb 妡@T ㍡Ѝp Bp@-P@ B B poP h0T @DT p0PpO-M0s 0Spe0@SbP@ _PPh ЍSHL0 (13QE00|@0T 0S 1 S2wh0Y00S mZx` h0Yp` S` p`Y`F 0 `P凷P hxAT@- @ P0~ЍC-`0PCMJp@PP 0 0001 00TPP 1Ѝ:phB10IS HWV@-@ 0 P  PQ  ~Ѝ0G-M p 0@PM؁XP ͠P 00S@00S `P x@$PmPxDL0 @al0` 000 0ܶ@P|p U EP 3ЍZ 1 S 0S qWYP %U PPTA-0MS90PS5 f@P`P@p @@@1 00~P 1@GЍ`Q e15 @@p@-P@`Gu 0SP S00C00 xP|PU x0sP 0C0P9p?U p0PS ʀ000h0S x0UP@-BM-0`P |D!DA@M!0 00`,P($  @pp@-P@P ;Pp:p@-@P Wp9000,03/@Fpp@- 2PQ@1 #2=C 0CQ 0CQ 1!0S01Q0#30I <i S01 01(p@03/1Q 0CQ% >+1Q>C/1C  Pp@P1QB 1CQ [?0Q Pp@ 1R::1Ppu!0Q 0 0!0000c0S: R :SP0C BS000KKP s@^s@x~f s@-@X0 0 0h0囸@Xp@-d0T@`X0\,0(@P@UXp0Q/p@-t0@QP d0QX\0S0010Xp R0*X0\0pp~fTf@p@-PU @d0`(0p`h0Xp6Xpp^p@-@d0PXp*p@Xp@-P@PX[[hVp㹟pA-@Pp 6oqX\00tp00@`0hX00F= 00'`PP呱唱 @-0 @0 hp$@A\  \ R/ A-0SP(@ `/Xhp\ 0R$S$X#P0S0 0 0 0 P0S00 S PP XЍP S XWP\0 PW  ˄P@zp@-A@ PW\0S`V0p@bWpO-50S8QpP Q1  @P)00夰 0 0(0 `@h⏶p*PWWKK0 ZW%+  `(0300 Ѝ@@^0p@-@PႿP D0R Xp`W[WNp p@^@- M0@ P  ЍO-P4M`UXpľPP EP  81R  4Ѝ@HWW [8H0L 0P0S XX0 S'-PH0 L0 H0P L RP 0 H0LP Zp 0\0X0SPP0P P WҾO@^ɚ;6e@-@LM`p 'P P0U(P~?oU20S  ,LЍ B 0  @o/p@-dPp@dG| 00C/(0, | 1R@0@@1B @@Vxp8QQ03 0# 1Q10C2q0Cq0CQ0C0C3+C? R0//p@-@pP ,p@N8p@-@pP p@B8O-M0(0P`p` @肁\$ X $  Oo0EBP@T$ЍOЍ|-@-0 000QЍ Ѝ/^ 0!< 04 0 (   !/\ P/0 !8 00 (  , !/88@- P8@-@({080峵(Ⱶ@8݉p@-PnAT @fP,坵p@ DPp80 0 00`,(P$  PpDB(0 0 0!?0 0 04`0P,(P$ .B1 0 00!? 0 0 04`0,(P$ B000X1 00 00!*>0 0 04`,(P$ B1 80 00!?0 00 04`,(P$ A 0!?0 0 800`,(P$  PpAh0 00!X0+N@0'> 0 ,`($ @<08 ADЍ8^|U@jU|kU@- B 1011 S!1 0 !q 0@$K0|8p@-@PXA0U00 00@1B  ypuP8@-@$I0  (@Wp@-@P LQ 80Q + _? = 0>;0p0<0|Q h/$p@p@-@P  Ic/0000`0001S 0V (p#8$ހT;6RH L1 S S RP N1SSQ1 e P P p\ p0U P P  l p0D P P V  "@ Z1 S S R ,L 00 S   | 1R"Cy  PX^ U_ H1S I1S J1S* ( U& 0 08C0  :/0H1 S S R  P PEUP#U PE0 S = 8^@1  p@-P@$;~p/8@-D1 M2D10@9000 00 P090 Ѝ@-D1@ D1L 0X1SY1SA-`PpA@@ | 1R@ 0@1B @ TPT Q X @8p@-T@p`<?P,00(@@Up8O-0DM S @0 Pp#48@3@(00D h1 Q/[ , S) d4!P[01 0S4`DЍx U$p3`Vp<0Ya00VX0FS[`0#4 0=0 0PS!RRQ   R V`0# 0 # ?0cR81  TP hp P000@1 t1S 3/P000]"Q8 SQY0C@0T0R@2 @A0.@!B +@) ;`qQ wC!008  R(00C?2cO 0@CdB$@FSzYL0S800q0)T0S 0  8 #`?0 `X1S#V V#VH /S0`PhC0CU 8<U ,<U50 7A<Q ]k0CQ$0CQ;0S л3!1PS &|;U;U0CU;+0S00p;U %40cS KS V0CS@{< bP 0 :/zCz MP 0  9//:Q ::0S[  S 1 0S [0 vP @ v S"( n:P Ѝ90AU? 9UPu S1 0R0[0- PP 9U908 @0;bl9U 0CU 0Ui, 1/10S 0RS 9U 80SQ8U" 0CU I0CUC000 8U <8U 0U0508U 7U-@ 0嬤Pt eD8U >0Uu >C0CU 0R000U'U L7Un70 S' S00p7U  d7UY_ yP4  Is I+70SL70S  P;07U0p p1S 3/P  4p }|00x0| 0Cr0;PUPPiK@c8vZ + RT 0H0HS G]PP  0D 80< 0P@bP #]!$.$]ZS@TЍO, Nr+$0S ! S c[0 0S00c0W 1 0R[0 0S00\1 0S[  $0|00@1$0\1(0S`1 i,4U D1 "    2D10D!810 R<1 0;; 0D!"0D1 Wr 8P D12D100FTx Ptt0D!  %<D!0* Q}[z   Q0(03/zs0<0{}P uP= 100100@[00[0xCPR0S ! S-[0* UUpePP 1 0R5PPQt(0 :iE P 0S ЍOvSL]([ЍOX( Petrtht@t0^t 8t,@Bt @utf@^tC^I^Ct gtT\vtt nt ot st@jt@wt@HtH~ft^t,T$ހ}^p@-@P0U R  @  @1B  T0pR00P8H/H!/81 - p@-U1@ C/oS" R 0\ <0 9yP 03/pT1 S S R 0<0l1S (wl13/#/#p8/p@-P,0@TpoP @/@-@PTD0@PP  80P  R 00 08p@-PP:L0@T 0S 408 CTT 00 0rp@8@-@P($08 CTT 00C 0@\8A-@kmP/ pPP` J]oPa00|0p @R 07PQ 00400S  R  0?8^@-$PP E^0^@-@XT08 CTT 0S 00S   8/ 8080 1l1S 0 0// 8080 1l1S 040// 0 601/p@-PT T0 601@0003/(d0lQ00p8A-pt`PQ@@@ @L0 @ S@P0/@(0,   AR SD1 WzP00C80 /@-P0 @"6 0<  $0000P0:@Op@-@Q@ x0`"6 0h Q0000X00X0 0$02p$p@)G-0hMS~ 1P!0 & q`됀@@,   XY 0X0 p@P@  ,Q,#NqhЍ YY 0DY0 hЍGup|0S  @ Z; @P   ]p@T0@@ @hpdRd #A@Px p@\xT0@@ 0R0T0S3@#@@8O-p@`x2Pt"0tM & 000LL @  I L Rh00 4 Xr 0W#000  ` @P R8m XaLPTdRd #AQ@!@1l\  mpPOL @000(KCT GT p RdR@1d@#;  LpP. @ `D!L"$ L\ "P R (d ( 2/H@D83( Zr 000 tЍ8G-PH!D1 60q0`A@ 0@ # | R    X0S  Y0S@ 0@  L0  S  0@ T@  BQSD1  @T Q sY 0n@8p@-@p p0 601 R R p@ Ph p04Ig p 0Pt^8^p@-@pP50Up@w8p@-@pP)Ip@k8A-p`tP @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @@W28p@-d0PQ0A TT 0SlA@OoBU $p@T@xA-q`0S3@Th90VT@ PQt,0TS@ g R P!0m0@@ S01S`K@0Pzxh}01S Prp`2}0A^xA-P0` VP@P@ x0x0qPPl1S X@H0@`l1̀0003/D1;D1@E8UQp@-4Pp@$*0S@@lpx@-@ $T@ ׈0x,sr/p@-Pl0@"6 0\ \ a $4 0$0,p@48A-`A0` F@PpPP840101@0@$lj 1810<10D1K<@1=`1\1Il1S000( 0 03/P @ 0bP \PЍ00   h0PP0C0 8+p@-PP0 601P003/@@dpO-쑟p3`!1 ر 60P@ @` \1 Q$ L0S1 8pL0SP@T:L`pV#51 0S [ X@P { [  S #P m@< f#@ X@]T @|Ul@dT L0S8@l1S 0 03/@\8G-`,$(4 6 0Q4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1;esP h3R `3Vl 9>C1CV %@3Vm 0 $p 07/pp{ 0 *ppr0o 2 Rk0S Y`v2V, 1\0CV|h||2V" 0CV 0TR 0 00gI0,2V0CV20S0S00 0R 0 py00u 0R 0 0P0E>Sx4D1S0 008$|00D1  0 1V )1V 0CV X0@0X000S81< U1ST100C?o2 @ S) X0@ 0 0X0 p0V T00SSX0@ 00X0`tUft_t u wt@8pt tttut 0!< 04 0 (   !/\ P/0 !8 00 (  , !/p@-`@PTU VBKP0P0 0`p@-@P :P 0SB1000p@-@0SP \P 00AS  !0R30T000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP i0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 SpSP 0S<  0000`P  BR1 " 0010 0000S000pl^O-`QI@p0 S> S 0S4 000 0R*PP P%PEUP h R A00N \ᡡ:50C010 `F000p0S000Vc Ѝ@ ࡡ0030c00 [ ^0PQP/@P @- Q^00@S0\3| X0P/@-0^  0CS0\3 |p@-@# RP 0 BS 0 \0C0P 0CS0Q30TR  pp@-@PKpp4031[  10 P /@-[  \@@ W@- @ [0  P p Q  Q\z1P!  S[ @ [ @@@@at Tp@-`d0@31[  10 PU 80 ᩒ@᳔p@p@-`d0@31[  10 PU 80 u@ᔔp@p@-0@1[  10 PU 0Ɇ ˑ@xp@O-DM 0P0<0p`<@ @00<0,(p$P PP P`;/*<@0 0 0<4,(p$P PP P@`'/DЍ^p@-@P0Upp@&@-@H $0S 44 0 S   0 ) A-Pᔀ M @T eP$p\ TPP` d  4 p20S Ѝ@^h0S/&UA-tp@h P`V U0PD 0 p@ eP ` h000@-@AM,P RLA cQ c, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01"PLaPU 0S 3/P ͂ ʂ0$L1G/@-PAM@zU 0S"Aߍ@, `P Aߍ ``3pP ` 㚂0PS 0S ㏂ @c0 L1S0Sp0LQ:03/PU`P n k$|GO-MRQB 0,P|ߍOc-Q 0S 0 S 0 00L\0$00(0+`P+ pߍ00p3@00T 00PS, (0S)pW& 0( S"0$ 00S0 000,0p 0P0 S030#[0Sw >00S@000{08S 0 0`0p23w - PjQ0 P 0T000X0@0\00XK 8P0p01 `00' 'QJ  e0S QE b e ) 0X 8p> "2 2" 2" 2" -8⮪pᒡTPU000 W >0 =00 =C00Ks 0 0  U00 0 HO000P0001P0100 >000 *07000 00000 +0)0p,ᘣ0S 02* pOO@-8C0C0$ C@0 CxUUp@-` P00P0T0@Tp@D0DCP0SX@$0S 3/,P \p@-h T00T0\0@Tp@L0L 0?0c}CP0SX@ 0S 3/,P \gfff0p@-X00@ X  $Rx01X0S 3/P0S P 0S00@ 08 04 0c0p0S 3/,P 84@ 0S000 0 00HLbH0H00v p`F0Sp0P 0 3SH L0SP0\ 00<0Cv S0!0  BR ! Y^^@-R Ѝ@-L ЍO-0P0td RP@ Ѝ0S@PETUT 0S  #RH L R  YUP`C "XP 00 YP@ X0 P 0 0SP]pH^\\S Z QHLQP\ $ QHL0S0P0  A"Q \  0 o0000H 0CS00C R0 0000 X00C0P0PX 0 YDPB ` X00C0 00 &000b00rP^G-0P p@P: ;  0 0  000HLiaH0H0`堀VxXPP P  0  0 00HLHaH0H0`[Xy@l^/-/-/-//-/-/-/@-@b`-v@-A-PUp1p!0@W`DS W c ct^PW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  lCXP  WWPp  W`G-4pPPP8 `=@P 00 00 `P@ЍC-P0S`pM 2Q@0S @Ѝ@50T 0T @ 00040"(P 0  0SCBT D@DT@(P U1V< 1CV VM `@4TC@@ @T 2@H@0` @T*`1@00C?o270 T:0 `T `V4 `V1 m T``P @ U( @0@T@#C  Q4@@iiip@-@PPPU@` V`Pp Bp@- P`8@Ԅ<0P pф@0PppPp@- p0Pd00S P0pDP<@|80 @l 0^ĀDDŀp@-P`0` 0@ 0AT 0S`0S @ 00 0pDŀĀA-@Pp A, 80R) 0 R *)`00<00@0 0$0t`|`p00S0x0 00P0:0K$`P@@A-P@p0`,PVU  AWG-41p!,10RC*Q`= R PP<*P00 /R0S /SPPr@ #`Dr@ 8|◉0PP 0,`8$0 Pa<@<D9$^@P?ĀH^@-@P q00@-@<&9l6 0S \#0LS   x,P 0qQ@DqĀĀp@- 0@0CS`P 040,PP_oR&U vpp@)p@-@P 0S 80 31R00  pp@-P40@AT ,TPp@Ā@-0 00 0P Ѝ0A-0SPp` x@dTPP (0S ԑ@| 00 0@PĀ0@- @P ,0S@uT p ЍЍ@D@-@ P$0 0[  Ѝs@-` @P)P,0S(0S@ 00S |0 31R@坑4T <00S pЍp@Ѝp@@07@- k@P@P$0sT@ 0$0(0S 7 Ѝ0O-@PDM TP^DЍOtQ @A@AP1  j @88D4q@0 a H(00<0,$@ @@ @0 00!00'>< 00,($@@ @ 0\! 0 P0< 0 ,($@@ @uFPP DЍĀDŀDV^D^Hp@-@P8@p0 c@P 7pp0@-`PP f@BTP ЍPPp h P0XS   @00C@0 `V40040V"ĀĀA-p MaP 3/@P@P 0 (00 0<1R 0ῑ@ Ѝ0 @P  寑0 PQ"03̀1 01@BP 0 @0@ 0QPQXX   803/@P   Pb(^DRSPĀDŀĀ@-00 0 Ѝ@@G-p`0 M 0*@Pm@P  Ѝ0 (00 01R 0 @@ D H03/@P% PhaP cUZ0@@000 P @  @ FT  P G`P 00 0V @x0!0R:@@1PPS0P1@01@Q00  PƐ(^ĀH@ŀ@- 0000 00gЍ@A-Mp yP@$`'X``P$P @@$(0V0(0  0 @P  ⊆@(0T0C(0  ЍW` #@0 0@-@MP 哖P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0pP 00 0S 0080( 3/$0    P A1Tpp$0p@SmT]W qq 0SVqT|0S 0| 0090#0A-pP`@0 0S@0d00T T0T H0'&@P9$ P @LL̡xT@-@ 0@xO-ؐؠ`PUV 币Հ00뜰0H0P\@P `N@@ p @@Dῲ奵 $`+"0 ,0}UOLLT[ O-TMP4L0p0L 00RZ(Y`|    "200 \20\2x0S@|0x@3080|00(05<0X008 P z4S @|  $+ +LxTЍ00 ?o2Y0S 9@40SN " <0R0 YFTD0S0ST00à R0S  6|0 3  8 Pa0@0H0Z|0 L 000L0,0?L0S 0c~ 0`(0 000D4 R8000S3# RQ. $ 0  0 R& S 0!Spx 00 N@H0P$0  H0 `0 @P(6@00 $H@ 0S@@ [fYD0 T 3 0{b W p00K M@C0`H01`A@0 D$06D0@0S0n0$ 0H`\p:XP#:0 P000L L"4040T 00 0C0000 00C00 R0000C0 0SK ,0p`L(00(08p_TY,`C|00001`P LR   Y;( 10R04 D0x 3/0@S000Y1;ò10PL02Y[xY Y p{p [ 0 0 RppR@@TKd V`0[00S  @@4 x04/'@(@#@ @0x0L[@8*VI0O-@`'~V01VLp@-@40400$03/4P0C8#84?o2P0S Dpp@-@0 (PU0PU PU 1P0S 0003/PAy0P1101p 0 !L00H` 1 1 [PP PP  \C-` Mp@  "#@P ֆ@P Ѝ&.R  ┈/  ᙈ=ES 0T00 00(080  01:180W<0 ^Qp@-0P@`@DT0p@ 0//pA-@p`P 4p`A j@-@0P }d@ 4p@-0PS`@ 0T 1 !R p JP p0H@-  Ѝ@-@MP 82R 0S 0S  3/@[`1V7 VV; - V(V0FSqPe   03/@T*@:!:F S0l1 F32 0@V0y@! !@-@xx@x P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,0/d0 0!T!0    !/`t@-@Q Ѝ0l  R:` <P#!, i` @{'P 00@H 0TD@D0<0RH0t`G-RpP`0=  ( 08`y  0R<8 P/D @R+ @ BPS@P P PP  0H@L 40B300\00T0X00 6W00 CX0ST0S@L@T@P{^G-`Rp 0 PV T0SPLPT0XP0Dy@P  UCUP`(0 0(0@Q`Q@PU7^A-@R0 yp0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@P^A-`@PpTXUZ 0000 0RX 0SUG 01QT0S0T0q@U8  R0#&  3SHL0SP0\00<0CR1Q 0B 00080 080@P@0P00@pL@Av^@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@rQ/T RT 0 0Sbp@-@QL0LPpS00S0T@@0Q 0 00000 p@D!R R0P00p@-PL@Q``U`QV 80 x0S0C0000800C80Q 0S L`L0SP0  RpT0pPEL`^@-@@0S87@-@P1 < @p%0D0 Ѝ0A-0Xp@P` U[<S !P  P71 S010S0PR 5TA-4$P 4p0?RL1S(@8P ,1S 0,1010:01 01`A@P 00000111010044P0P041418181@1@1D1D1H1H1姿00 P <00111100!1.01 0.000003/P&f``& 1R 101u@-L@Q0L00P0T0PL0SO-(ppP U [  u@`(@@P U U xPP  H@L BÌ\PTX0(O 000P , G,^@-P `@P   @Ѝpp@-P@0Tp|@1p@-X0,`0 ( P@,  t0@U pt@-叾P0P@-醾P/ R/@- @@ž@lA-P`X0@0X0V,@p Dt@0W T It@#@X0, 0X0up@-P`Q ]t0@V p@t 00S/Łp@-@P᳽0Upp@o0BSp@-P@`ZPP  $0S0$S0ĕ`p^p@- 0PS`(M  ?@P- (Ѝp0  *}@P0V" 0;;0@P R 0  R ! 0@P  *@ 0 S@ R  @P |p@-M0000`P @P }00Ѝp@-Pp`|@P 3@q| Ѝ0@-AMP@ fP Aߍ0s@-P`|@P ,@P|ЍpO-`MpP8< e|P (0S <|&@Ѝ }@P 1| 00PY ᐶ00 v 0 !* 4S  #@k,v@Pd!401  504DT04U0S ⃓0 1Pdu0J(0=0@0  0, 0  ::1@P@mPTP z0000弼*{3 }{Y U~*.  ~ /~3 |-@{40 3|@@ @] ^^@-Pp`{@P'~1%@ @P 1 $@Q@1T tT 101t@Xe{ Ѝ$ R 0@4 @ 0@-AMP@ NP Aߍ0G-L1p30Ma0$000P 0 @P/$0 (00000 0 @P*$0r,0 (WP@ !@T (∃@P , G|( C|0Ѝ, O| 3( I|-G-Pp|UUpW @0 S0S``F``T@PzP dz@O-`RYPP Ѝp@0 T    R R @ 0"P0l UpW@@IYW 0JPp^O-tM  ᜀe 0X  q_ RL R(@WYP RD 0!  0$ (\F! RL` 0 0 0$ 008A 4/ 0@0BPS 0C pP  #P ROV= H! R   @)Y.0P @P 00U YtЍ0P  #J WP gY `7=VT `0O0X` `@V@@^ŁA-PM`p>z@P 400000 0>@yЍ7@-P'z@P w@y Ѝ0p@-`PV M  V00 R0S@"  y@P0kV Q0@0    @P dxy Ѝp@-%50S@,M]32121P0 a p 0@PF0 000$000@P& (00(0(00(01:11:1#010 S;305<0@T Y$ ozS iz $ Qz Mz 00$00,Ѝs@-`Pmy@P19@ 00003/@xЍps@-`PRy@P 00403/@xЍp@-pP' c@0P0  )P ЍT@ 0 S 1H05 /PV00  %^0p@-M00000P0` H@P #0@P PxP xލp@-p PP`IM  @P0 0000 0@P # 0@P PxP wIߍ@-pP* c@0P0  P Ѝ RT@ 0PR 0% 峀PV00  ੀ^p@-0M@P` ' 000 00 00 0 0`4,00002PP #0PP 0Ѝp@-P4M`p X@P&043,0$0 S0 0 @P$0S 0@ P T @ I@4Ѝ @P^O-PPlM%  (@PnB00S@i8(8_wP- ( 80,00< (0 @, Q00(0H2 , 000 w@PG0DT@0` S;# p0 @ts0S@( 10@" H~@P 0冲*S`  ? @X0 S$0 00  H0P #0@?oV20S@ P &TV0`D@ DwlЍX0S- 0HL@P H0 Hd0@P`0`0S 8V(,08< SP00@ S00S p $ HA@P P000ɚ;6e^@-@0M 0P 0# ܍@-@0M 0P 0#܍G- pW`P_R/R-?U@zPP 0L00 H@$ B# \PT0X0Y P~`P 9W@ W ` 0 R $R ÕP`0311  U`pV 0 0F0ER8m000  R` R^^O-MP 0S 4qM Q6 Q(@AU` R. 4  0$0 8^4 Q Z R7Q=@20SF 4WP? U Pf98@` }@P @0V UvtЍ@`00\J 00 0@P  RM[00 0 @P P0 Q00 04A004/0@P0 0* [ tT00#T0S  T 0 0$; |n h屶U T00S 0@ 0U0K@@^ŁTA-`MpP u@P 0 0 Ѝ000! @u0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` |P3`$00 (ЍpO-DM`  u@P0P S;# p0 ts0S 0 P03u0U@DЍ |0Pⅲ! 8p0P ,0 <0}0PP^-/-/-/p@-^. ` 00S0S0000 0 0 0h 0@@0 PP00@@0P !@100D1 0ppO-P0㄰U`!R `VP R@ R R ppG'qZY08/0噵p@-@PL0Upp@0R0 0S  0Q 7x^ @- @-p@-@0`PVp@0 ``p@`p@-@P0S 1`0D0eHe@0L0@0pp@-@P  P @PS@-@-p@-@TpP0P R  RpPp@  R   R4Hm Q  101p^@-C-@MPe` 0` P 1 p`00feeefe eee0S GPЍe`sC-0`S' 0S$0S P@1,  B0001,0 (00C  @0(00M  X Ѝpl^^p@-P@e Pp00Fp@-@ 000S0S P A-@pP`V (pmPp0S 0`VJ`x` 0S  0S 0SD@t0S R0a/@-@0  R 0  /0@-R@cM P cߍ0a/#uP2P0S p@-@`P4Nt 1b]P\ps@-P`  @P @IЍp00^00^s@-P`l@P0 @VlЍp@-KP00KA-@`p PY@P <N 1]@B\@-P` p @P0 @I Ѝ0@-00 Ѝ^0@-00 Ѝ^s@-P`;l@P @kЍpA-@`p\PBN 1\@[T @@-P` p: @P0 @3I Ѝ0@-00 Ѝ^0@-00 Ѝ^s@-P`k@P @kЍpA-@p`7 P@Ph 1k\@/@-P` p@P0 @H Ѝ0@-00 Ѝ^0@-00 Ѝ^s@-P`k@P @AkЍp@o `P/@-Zd^ 0((00`O-QM0 | @ЍЍOQe0R 0 0p hW01h0#0@T_WPUY b3^P2^PPE0Pb|唫P@T d2`VPLЫ0 @ [030#Z0S@x 23ɿPh  0 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HP#%$%0U  &H & 'L ')(ၫ  sP2U0S' 00S 0/ o}m0  `PH0 h00P0 p00PL0 x00P0K000|@000Jsg#Plŀŀƀ0P R0+x/G- P@ U `ἀD`00@0$V0:Pp̪ 01St0 H0L 0 H0P0L T 0P0 T %R0XP5\p52`Pl0p^^ŀ0P @-P8P/ 0!< 04 0 (   !/\ P/0 !8 00 (  , !//P 0%%#3/| `0R 2"@-D | 1# H LH RH P LR P ŀp@-`P@TQx`0S<@@ @DX  S d (J F0SpP!p_Q`_|^x^@-P7310! 0O-3#SLM  R`#0S @@   D ,Pp_b@$@`3`c 0@@ @0@0`Z000 @@ @@00Z Y#3 pB࢟ 0(<0zHg V< "0&5o` V00 S"0  0 ,SXpXW0@`p<"[z 02 À $2/BL0 ,00Rp((0,+ (00 0>P0` |@TX 0#0L0R    ^@^ 00 000$0l0 PSp  p p0l U A%)ŀp@-40P (ajZ@P ;UP00p@-@"^`@^p@-@000l^05000  岧00;00)000 Q :0`P =>09#900S? 0 0R9ڜ  I S `P 40083/w0` =V0 $$屧^ 0S 1pp@|Q t  | x x |000900000 0S"ʂ^x0p@ ZxS0000 |  @|    , 0C1p@Z^ŀŀŀp@-@POp@Xŀp@-@ 0  _<00 0F PU 0 0<0p@/0 3p@"^p@*^p@-[  P8 &l0Sp p p0l X  @P  0,P Hx E4 PllpA d0ic1p0 9P00ŀ@-pM(ppP,`@P" 0 "0V060000hS0#T20T20SqP V 0 0 0 ЍV 0 0 0 @- (pP @ P@P $0 O;`P Ѝ`q0@0O-@0@Dp8<P @ Pw4` T庣@P@0 !;`P Ѝ {P L夣10 k,T@``10@0ŀA-P`pB 0Y@P 0 p 0 0(90tAcAlŀ0/202/@o/ 0R:****+//p@-@|P0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@+ƀA-P`pAT 0S *+P A030#A(0S A- P$`@ZV Z Q+ a 0R010 %` b!ᥢ0 S(0 1D 0 (00a@00C@0ۢU *AQA 0R010 0A CUƀǀ@-@x2Sn D!1,,N0 N 40N48 N8< $N $<@(,N(,@D04N04DH8<N8<HL @DN@DL$PHLNLHPT(PTNPTTT X 0$, ,0,0=@>ǀh\ǀp@-]@L } Pp@Z PT0QP3Q/p@-@P|@0Sp(@\DLP00L0P00CP0T00T00QpƀHǀ20C22S/0@-PR@X0\M0 0S\Ѝ0 0 XSX0# t0 0 P4/0O-p048 X001 0A S *LD!000@ Ѝ  0 0Y "!Wm0o 0jP'D!00000  xD!000$YX)0W0WPPU D!@000t XD!@000g >PU D! 00 0D!@000Q80ǀ@-900pЍO-p0M0  $2` 0S *"D!000-ЍP G@0MY P D0s: 1sT 6@@T 1R" I  .  @ : #:0 1!Db  0DT P T  mD!(00(0 0PP T ZD!000$`VPD!000Y T@0@`@D!000ǀO-T2P 0MS ao@ph@0S; 1s@1R@"T 1R" I  .  :D #: 0 1!b 0T P D! @(00(0cЍA,1T !D!$00$0R/ @ *0.SY Y+0.S (0S X 0 0CX:00Z"@ *p" f=@MT X0 0000$ D! 00 0ǀO-p00 0 0S:tRP0lbT 0 @Sᦟ`0cV`V``V:HZS ߟWq 'R` $@ 0 80)0  *" V tq P0(  0P0D00`0D0<嫟T a_zW 0 W7 .R4 .R1  ! `1 ЍO 0=0P0 Q L  L 00 L0s c$*=!R 01a@ ЍǀƀHG-`0 S@Pap! ZPp` Qq arGo0 S00 ///0S/9@- 00 Ѝ^@-0)  0SЍ^@- 0  Ѝ^@-@a`0,($@ p@ @`<08 DDЍ ^p@-@Pp0SpP`0S  ! JQPUQ 0L 0000 0C0p0S  ! Ip@-@TpP`Pzⱜ 04R00 0 I00pp@-`嚜@PT ?H@ 0 S0S 0R00 0 0 ,000R 0P0@弜@p@-@k0 0C0@譜O-`40@SPp0E  0S>Q  0RP?S 0 ! I 0 0S 1z7100P+wGp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 0 0 9CR:0S 0A-@p`PUddG0Pp `P00S 0 000$ 000 00PA-@ `PX00pQ7T0S0 R\S  ! 0< 0C0 00C 00 0C0 0pA2^p@-@0PS`"00\ p0S0S 0S0 0S0/P: P/O-CM81 `Q1P$ 81100 0$0`V4`8868X00$0V@$0S  C$ /  C@ UJ0@TJ@0 S$0 0P 7U 77Cߍ870 <P@@p@@0$ p@W`<0S hJ@T P$<  G@Pp81X10  hG@P HJ0 0 :800<024 @00D04RG@4J T Xf p0 W|00 0{9 i<@P ~7 0 H%,,H0pLXp\> (0 H(I0@?oT20S 0@P'X0 0GS@%(Q  RRPD P> @T ^7 $00CX"#* $ I $9 @T($0S C$ /  C"701 P0CVS @@01ڀp41p@H X;T(  .G@P" I0CW I d^@-0 ,0  oЍ$0 1P$0o/Q /O-P$M U U@"@(Z@8`F F !p$@ 0TC0@0 |@ ]T0 F a@8$ЍC-P`M0F000Fp00 0h@P t@Ѝ0 C /  C07s0 0pB@v6T8 1 !S X p ' P000`F %00 候@-@,僙(0 R @0@™@-@TrP00S@ S @R 00婙0p@-P8W40@Tp@嘙0S 3/@A-@`Tp@H0PU4備 0S  3/@PP B@-  Q &Q  FP-/p@-@@P0S0 0S!0Sp00Q!7` A00`00Q \R H  vO<YQ C0\S|^^h^^p@-P@@0Sp0700P 0S!!//O-Q48 Q8 0 8 4(@40 8 04000,0S((@0 0S 0 (00+V0 0 0 :"P 0a1!sr0  R 0`0` 00@0 0`00@ǀ^ 屔@ǀp@- v3@ r3PP m3p0P00p@-P@ `APp0 S 2 A0/S$0/S  A 0 0C0070 R99 R999 0R .Q  .R:0p07:?p0/@-0@ P !10P@1O-PMU@  CPC R& R#     TP 0T R@0P@**P W *pW`/oU" R 5 0Ѝ `P  0e*V O-p2`M0 @U Q Q 20S@0000-   R  w5P Q P``zDz_P0 P Ky0 00000P @0 Ѝ 0    0 0w0]0 0@000 0S 0 .5 ?PP) MU  5P BP@U 0 0  P<00Pu0 7SP PUPPT  000 B 00  ^ H0R  R/R20R/20@-@1@ 1@-@ 1 @  p@-PP@P 0+P 0#pp@-P`?@P P 0+^PP@ pQ@-@@P 0@-0@S 1C000p@-PPEUPp@1PpO-MH00@,00D8 <000 ,0(P0SP00000000PP  0$PH0S! x?0S 00P0n/0 k/00000 0 0S 0S E/0 00H> c0 P 5/0P 0/0001$p@w`0V  x.`C0 /RI 0S  0 0 ` 0 0S !/0 P /0P /000妹0S =|P  `pR0"  ! P !PS o0 e0 TP 0 S !" 00 `Sv Lr 0 T0000 00 R000 0: 000 00 0 /RL R 0T  X00090 000 0STP S0S {.0S00T0.0 X.0T0S P X  Q   P S0S [.Xm.0 0000000S 0CSg| J 0 00 00C08+  Q~  00x0d0 p0Pm pP\0 00 c03Sa d׸ (.0T0p0-XX0S00TX0T ]XX0S R0S 00 S0X TP TP S0S -0 00000,00SQ 0N <0< (000000,00,0(H0(0b0S .P 0p0p00S 0  0UG U- .dl[/ -TP0S p00Sp吰[ o.P 0 pP0  _.P0 Pp0p0 P00S0b 0P 0pP -0p0  P-XdPU (Sy-zX0 0T00 0S 0S0'0-00 0S S0S I- [-0 00000[S009   R S R S0+- 0T00US0S 0S0?0 00 0 0 0C 0D0S0bSf 0 00 40p6 0$0 S$ d 1 000 40@ .=P ?-B .\0 p00['`0\pp0`Pt`P40p  +? ?X .ꀀx.80Sh50S 1@0.80/P$0 `@R0 r {R`" /U  0X vP@0" > 0 S o*000/U  ` `k0/P$000N0}P 0X0S 0/U00S 0S*0S 0EP0 SC*/U 0  L00/P =00`$0L0 /UZ Z2* 0S/ #P) 0 S*/U  `0 00 /P$ X$ R  $0 $06. 0 0 S:..?//U  X X 0S P 0 S */U 000 ` s/U X X 0S `P @0 1  0 S */U 00/U [ [* 0S Pv 0 S *000/U   `6/U [ [* 0S xPh1 0 S*0/UP <1 `00g/U[ [* 0S mP 7 0 S L0g*/U00 000#/U4[V UP1@?0 d}E 0 S 00J*/U de Ł^Y^@^^^ ^8ǁ<ǁ^k_ ^%^cj_2^4Ɓ8Ɓ=^k_D^K^H^T^P^[ * 0S /U X @PU@H?0\  dAE 0 S */U00[* 0S /U X X 0S P2@+?@ }U0 { /P 0R00Ǘ 0  0    - 04 0 00/S + 00S0 00 .R  .R0/S0 0 00 +40 0 /R" 0 T0*0 00S* 0 00`pd0  P0p0gP 0  }  { -4 0 0 0 00C0S *wT00 0X  900S00@TP *T@T0 0X00(0S ,0Ѝ*6*Q** R 0CSP S0S m*X*0 00000u*00 RX R=0S0 X R B/a>P: X 0S /U[ t PE?@>:@-(0M00    0 00  @ Ѝ0@-M0(0000 000000000  @ ЍC-04MP@ P?Pq/o `PPkP( ,00,00`4`p 0,0:4`8 @(`p$09PPK804 Q0C00 0,0ɀ,.Q .R: :9,0)0 0PS Q<00U0S R 0S ,0  0 PP )U`V ,0 v.``4ЍA- 00S : *E0pP`0900@   0S P k)@00WP@F.@P [)j^~^ 0@-@DMP\, 0\ 0\ 0\P  D 00 0=>T4@P00DЍ0@ ^A-P`pO@P P 0 P10 A-P`pF@P0 @Ѝ0 G-P`ሀ#p'@0T00/ 0P0Tb(P X@ ,PV  6/P 00S0P00P0=)P07@- 0P @P  VxB Ѝ0^p@-P`@`` TP@͋ @ɋG  Ë ⿋ 0!pǀ;@-@x@Ps<0(G0ywuP b@!p@-P "@@ "@pp@-P!P@@@ !@p@-@!@A-P`P 00up@T巋00 0S0PPP@ 0S@@墋V P@Kǀp@-@QP \00SpPT ` @ Vpl p@-P`('@#0 R000@00P0^@pp@-@&P 0P /R 00/ 0P0Hp@>'0A-`@VP p/R 00/ 1UP p0000@@@"VAO-`M@k'$P̡̱$00K?PڗG?@!OCAd@8 0P p- 0 S   s'4 pW Q,PÚ 8pP# !(7p 9W Q'W' kPUPW00S XPrX R0 R 'P &P ڔ  BR)'''PW Ѝ\gfff@-@@!0 !!|0x0t0l000, !  ! 40 o@P@^lف#^.^ 0 F0.F0(AFp@-P`6 (0P0P0P@0㙊㕊㑊`0 40 0@0D'pȀA-PpՉ0`V@ W@Ph`d0l0d0PP @ 00 N/ V?U 0WI=.Pǀ0(E 0 (E0 (F0@-0MS@PV@P@ 0  IVP V@P@ BD&Ѝ00@-@P0UP0S# S  Ѝ0` @P Jqp  0LP 8`&VUP0P (`@0@ R/"A-P`@ 00Q30Dp6@0@ 0ShaAqAXA[ Q TQ1@010ǀp@-P'000@ 00,0$ R @@0@/@pǀ@-@P V0ۈ R$ 0 @'ǀJs@-P`@P !0R!0RЍpA-`p@PPЍT$ P*R0*T @A-sMPx% P P8 P L?@,@3 sr* 0" "@2qp@R P* 5@7T >Ѝ@2P `P' PPf D0SO@ 3/@d00Cd0T\7`dPK0 (b90d00d0 @Pa @PU D0SK d00d0XD03/@ d0T0Cd0<AIU|0S2h@Vd `>L@T)84@> 0z> P0 r>p>O@ PP) 467$whPh0`V>h@0P  $ 00$0$0$0@A]ˁ4^^-W^^^^-:^^ǀ<^W^^^^^^p@-PP&PP@ P$凇 0P  @@p@ƇǀO-dM0P刀 00 0`0 p:P  dЍ0S   H@P 8x3 000 0PM80 |}pP` 02 2PT0P00L$(08T$Y8P #P ?0S # 0!P 8#0 000b0A8@#"PP  gP10SZ L R$[ U UJ@00 U # 00 U # 00@/ Z |#Y x#婆Y쐟0Uk# # 00 Q#0ކV P S#00 P0400弆V$-^^T@Tp@-P`b\0@T Q   4 垆p@% R R @ǀG-@#pP3 P000;`@00A  0'00& PP( 0@`000`A`0cWR "0P440OPP !PP 0E0`0V0PW.pW <I4c>"V "#^,^7@-`0P @P  P 8N?U.0 V? > Ѝ0D^O-pP`0M⁩Ё @P Є c P N?U.0 V?A>p V  lV,<V T&<[ H"<@PЍn^o^^^@-@ < @^@-$0C00S@Xفd0P0S R0 R 0S 0S/00@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00yЍ@- 0 0qЍ@- 0 0iЍ@- 0 0aЍ@- 0 0YЍp@-@H0  9PH0 0S010H00A PAH00Q00@@@p "0O-DM@00(00p0<T00 ፧Y  $Ѝd P1 ! V<0[ V I08/P 0V+c4V  h0UNR@TPPP 05/P +` 0V8/P T@,Z 0@-p0MPU U@ UPЍ0Ѝ0@: v /00Ѝ0@_Ȁ0 0 $ 6::70//0/ 00w/^@-@/0 0/00/00/00/00/0 0/G-Q MCka@Pa}_0p hq0S@0@0@T&&XY0!,1 (偽0  0 R8 R BQB03!`P`k P0   1-`0S SV(3 \ p^@-0@/0040/0H0/@-L@/0P0/T0S000/p@-T@ $00$0$@@T@Up~, @-@~0U@, @-@,~ 0 0 00U~, Q3lO-M  @ (R0UE@PBU1# (pU< ` P``0 @P 0JF@P( 0BF@P  ,$ЍT   @p @^p@-P@`M$ !|`+Ѝpp@-@P`M< !! *@G-Ѝp@-DMp `P@P 0P,@@00P/4S@P DЍ -@pC-p`Mb!*PP*0@S+   0P0`'01PK0  000`0&01PK0S@$! @*P,ЍyKxA-Ppo@Pdu` 0/S <@P0 6Ѝ0 du@ 0/S <@-`Pgdvp 0/S <@P 000dv@ 0/S |<\ ЍC-1@3p MaYP9+ 0H@P, @P'L10S 8 BV0<00@00000.D@P (0S" ,<,,(0P(@Ѝ4  hP @Pf0P0$0,( <0P0T0< P0+@P(,mŁ^@-DMpP @P`P0~ @DЍ ,  @0 0a.4I@Pp0!0S RW# S+R@ , 3+@-OR@, *@,|+W+@G-M⨀`P pd@P ^@P0@0 .@@P($pY +H0SD00 SD0 .R0.S 0t00S`280x00L0 0P0-L|@P}0d``PSx08x0V o+0tS00.S @_S0 .R0.Si 0W@R0T03/@PL0 `$@P<U `PU 0R'S)XD X 0S#YH 0RD@P 0 8 B*0@X03/# ЍS@@UV  + +0X03/ *cU _8 * ZX@@@8 @-P !M`#q @P 0,00@0000;-4#@P E@T ,w*T &$5@Ѝ @0@0$0 0 00+8+D 00, @0)@P A-pMpP`.@PE?`00\@4@80,4d@T pЍHP0S@00000 00!0$0100! `(0 `*@P !'@P 0`F0`@-Mq` P@P 0,00000@0,4@P 0S ,)0P@Ѝr@U0@0$0, 00:#:D0@0N'@Pr\@-0Q@ z, O-5LM@P $ p`tUP P p$P$P NY @ LЍA8, $00x0PYPSPUQ |PUPoU00&8pP|P|P0E S p!#P# *| p AP6 0S U0 (.FP T X41Q (m<(Pf0((0P 00 ((w(P pP pG |0S 5$` @ 0000{-P0 ZP0y0 M85 0|0i 0M( 5zd[x0S | A |[By0S Pz~ $0  @002 00   0S 00 0$-P] PX0y M8M( 0& 00001 0! 0 000 |0PW  <p [* 00M(  A +%R-0y[0dV 0 oP V/040w    R 3Vj 0 RPb tV/00|00 0$PO-^^^, w]^^@- 0 0 0000 yЍA-`PMp @P0@00<@@0*D@T PЍ(P.X(0 @@0P 0Y,@P 0 0@ @ T(Px0S Oy, s@-`@PЍp0xP @00!-0@P000x@-P@pM0 0 `P Q! T@/0 /!bR 0ᳶQPU @C0 lSЍQ^\#^lW@-@-T3\M` @P04#P0 S0, `@P,   \Ѝ P @P ?@$ Po @P$ ( Pb >@P  @P(  p>@P( >@P  >@P@ `3@P@ @ >@Pp@ `>@P @P@ 0000p@ `o>@Pv @Pp  |?`@ ]>@Pd @p\+`M>@P TP @Z@D^^@-@M 2>P ЍG-@!S$`p!M WP0O80-PP%W$! P?@0Sp 0_<P0@0 P ᯞU Ѝ P@ Ȑ  P00/S S 80SP +4@+ D  ,^@-PX0M`p @P 0 0 0}@ Ѝ^p@-@`L 0P@P >@p @-PM p`^6@P  04 00#0I@6Ѝp@-@`Ls 0P@P u>@dp O-1MP`@0DT`@ p0 0P[0$0P 00 00P*U!@UT@H0@0 UT*0 0 0P@0 3/0P` P P@@0 3/0P 0`0Ѝ ,^@-0 000Ѝ @G-p`5@P.0  0S@ ! #PPY {%$@@)0S&   P  PxP @K5Ѝ L@ T  k@ _TG-0Pq$@(@`P  PPP7<($( GJ0@-Mp 00000` 0)@P25@P0`PJ0S@@!"@$Tl4Ѝp@-@MP `@PU?000,@@0>'4@T H@Ѝp00B0S@@!L"@P$ 0s@- Q@P $P@`a00帜Ѝp0 0p@-M 00000P 0`(@P0 @PBЍpO-5,MpT @P= a$$5@P 0 00000 0P  000 0z@P$0  5,Ѝ R  5$0  7@P$00P@P?$$  f5@ C-p0MR`P0'!sP 0 3/@'sNT T+ du40000 000@S 3@ @P0/S %4@P0  gЍC@-p0@ @`mPP @ (0 T@M Ѝ@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR000BS` F00S03P R30Ѝpy! ! C- pሐ)P@``V`31P01 0@PP  ЍT0p@-0P@00P 000S 0 p@Fp-p0ASG-Pp@ `:PP00S!3 T` TS @P0p@-`M 0000 0P*'@P@PT0P00L@$@(0v%T$3@T `Ѝp8`{p@NT  G:@P`0 0S030T;@P 0S@3:J;@O-P0!M0#q` 0000 0&@PcUPd  b4@PX  a@PF@T0SG  .@P  @P  3P 0S-@+" 0$  , @P  0s0X  X Ss 0 P@Pk" 0  3Ѝ-@@@- x Ѝ@-M pP 0`R&@P @P`@!T%@Ѝ@-M@ 0P :ЍA-M P` 0p&@P @Pp@T 00 00@DЍs@-P@PE 0`00@P F:@ 5Ѝp C-P0M 0000p0 `%@P  n@P{pP0/ @Ѝ @ @0<$D@PZ(`V@&P$0 00:#:T0> -: S'  S"  S0 0@ S+0  S0P00TS-sr@,<)!,P5V% "00 P-0T+S S ,P0< (@P ( ,<!@P ,< ,,P0< (h@-@# Ѝ@@YЍ@- c Ѝ@-!  Ѝ0 cD cp@-HMP\0  1 1 0-@P+X@P$0`800 @4`0`# <H@P 0$S@0S 0R@4 @$ $DU@HЍp@4 $ 0P5 P^^@-; 000c0 Ѝ@- 0;0 00Ѝ0 c" 0c000@-DM 9@P$P0@,P0000"4@P 0S00,4 0P  P @DЍ0  , @P ,  0c I0F0 cA@-0S@`@P]00P @ 0,Q@ 0P000 1/@)0ЍpC-pM`A0PP 00 @Ѝ 0,Q !!1/@P Q@@/00@-MA0 0@RЍ0C-pM` 0PP 0/ @Ѝ 0,Q !!1/@P R@@/00@-MA0 0@RЍ0C-SDM@`p.  E_U_`V@P#00P,@@0"|Q4 #P!!!! 4P@T W$#DЍV@ `c  @P @0@-0 c Ѝ@- 00 Ѝp@-@M` P@P0P,@@00P!4@P @ЍpP>@ @-0 c Ѝ0@-MPP @@0cP 7Ѝ00@-MPP @0cP 7Ѝ00@- 0MP00P0#@3P s7Ѝ0@00@- 00 c\ Ѝ@- 00T Ѝs@-P@0` I@P w@/ Ѝp^@-P`/@P 0 pb@. Ѝs@-P@0` @P L@ Ѝp^s@-P0` D0D0 0@P D@ Ѝp^^0@-0 c Ѝs@-P`.@P0 '@i.Ѝp@- 00 Ѝs@-P@0` @P  @ Ѝp^@-P$0` L0L0 0v@P@0 +@ Ѝp^^0@-000 c Ѝ@-PH0` @P00 0 @ Ѝp^@-P` H.@P @0@-Ѝp@-00 00 Ѝ@-P` +.@P 0 00@-Ѝp@-PD0` I@P@0 @ B Ѝp^@-PH0` 3@P00 0@ + Ѝp^G-M0`@S11\p @T0s_ 0s0Sp 0PPp?X!(.PP 0 SP? P0UPP(0 s` 0 s pUZ0!(00PeW  0S  4PP Ѝ 0s◾P0PP^^p@-PM`b-@P @0 @0c0 f@-Ѝp@-  00 0000#30 SЍ@-0 cHЍC-LM@hPP$ l0S (J4P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` ,@P @0  00@,Ѝp0@-0  Ѝp@- 0MS@$P0` @Px0S@ @P!@P #!)@ Ѝp^p@-P@,0P @ 0<Q-@ 1/@P,pp@-PM,@P0L` 0 0 @K3,ЍpG-PMj,@P2 0 @+ 000  0- @`@0! 0 J R@@`pXaP0  @ +Ѝ@p@-PM&,@P0L`> 0 0 @+Ѝp0@-c 000 Ѝ0@-00 Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp+@P 0 @ 0 @@P0 0@0@0S 0 u00m+ЍŁ@-,0@31!$ p@-P`Mt  @cT0@&0S00P0@PЍp07@-<P @P@ Ѝ0^O- ` 0M&J0 S1 0C 0 p P+@P 0  @ PTd 0S@  0 8@*@Ѝ@G- `@ 0p%J0!S B   +@P 0  @ PP4 0S@  0@ *Ѝ@@-@(hk$0S( ( (0$ @k@Ȁ@-@, 0Uk,0$ @R$$ ((0k@Ȁ4 0S ( #P QS//p@-@p3k 0S0\P 0 %0Sp Q R$0y!u!@Ȁ4 8 D 0@-@ 0 r%H"@Pk4 @Ȁ00CS0/@-@P $ 600C0 @  4 0M, 0S*00Ѝ/4 p@-Pp0 0AT 0S P 0SP@p0S00   @4 A-p䀟3AT j`Pj0S @000jPU PPhjX0 $%3`U3@103 P000 @@Ȁ4 L031S  R R0SQ 0/A-`@P 0S00p$P P 00 $$V DCjP 0$0 j @Ȁ8 0@-0@M@P j jz w |$0h 0 \ \0  00  , $0  Ѝ0@Ȁ4 r^W0W41S/p@-P`tiAT`7j\@Q p0S `` ```@` $@Ȁ4 A-p` P0@PP0PpPP$i 0 0! Aj@Ȁ4 p@-P@`i0P 0 1S 01  0S 0 0000p@i@Ȁ4  . + (G-PP0S0C04q0S $0SB $$wi00 Gi`li3}?@T iV @ $#` R   R  R R R A 0S  B 00 0003``}?00G#4 @ȀD @-P0S003@oѠ@-P003@oG-`P@# PpW@ Ѐi `d#@TW% V@ @00\@P Wt% `.i0U 0S  3R  P $@0304 @ȀD 8 @-K0@-E@iȀp@-00S-@ `P4@P V\ 3iP#@h@P (hp@@ @ ȀA-@t`ph0@00LhDPp `E0S0P0P0`@ȀA-@`pkhP|h,@TXIT0S0 R @S    @ȀG-0 PP;0`0Ss5P $10S00@S00 " 0S' "h 0S00\hpW`0;00S0C0ʍ" 0S "ph0h06XChLPT00" 0 3/`Pp0" @ȀD 8 p@-PP@1S  DP7Tp@p-@- RA-@`PPp}VP,H035@A\ 0P R04/p@-0@S`L Xg0SP P Q  - `0SPE 00@0@@U04 @ V @ 08cU@P@ 0R08<W0S  B2@ S * p00Sd% 3 @0T"#!p@,g0@(00PpVȀ@ɀ\ H\Mb^@-@g:00CS4g HL>@0@ l\ p@-@@P0SSpoP@-@ P ET@GpP P p@-0 l@-> g0p Pf>T@P:x0P00 00""00,p\ ^^Hɀp@-PX0t p0ATp 0R 0RP @\ G- P@ ܶU `ἀD`t00@0$V0:Ppfp01Stf0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P0p^^\ ɀ0P/@- R  0 RP <04Q0 4R/00C-@2 TMc刀pn0S @=00vfH)fH0   . b?PH0<9H0cf响 00@SPP0S f PHff0 000P T BP 80S ;40789/0 00CS=3`P !0SP `0S h`e0t p 1S01  0S00e0U hep0 0000e0DP00eTЍɀ^\ O-@`Pxxxp 0R0S TP1 U V eae|PP e=`P ! P{4 [P01 X0S "r0S$U 嵌V e3e`PP1S  EPU4UQU \0R|Sz ЍL 3S00SV 1P RereV P VV `P0xH0 0 U 堌P,edPbH0   . b?H00 @m00PdP;0P0p\ ^p@-``Pd@HcD00@ R000@00p@PȀ@ɀ@-@dG:0@ lt\ @-@-R 00- c@cȀA-`cP@PPkЍAcp㈀Pp @PW 000S$% 3  0"#!夡Ȁ\Mb ^@o/7@-@T\c00zPP$ Ѝ0@c0SȀp@-P0P1 [@Pp:c p@@p@-@LPPp+c p@p@-@@PPpc p@P\ R\/P01/iPɀ@-@ c@Lc\ 0R, @- , BR\ /P01/N^Hɀ@-@b@0cp@-@b`V  P01S  cpc8}PbU ;p@-@HkbQ  g @"C-@MPb|0SbЍ`0FSPb0@؀b p 0B/P 0aP p@-PP@T  !P1Tp@p@-@\00\09\0 0CR\0 SP01 bbO-p`M,PT@PT|0S`@0S*qЍP01 bP P010S Vb@xPb눀pP IbTaP P,a j\Ȁp@-@LaHP0S@CP ᴸp@b 0 ȀH^O-0M P0 0 ja P`P 0S aaaIP p`;|apP5PĐȠ@Pa P,8!t0p 0Aa0 (p 07/pP` xa0t p 1S01  0S00ЍT \0 0004Ma00Ia {aaɀ\ G-04P0p`P5P 0  0 @ ,` 06/`P aЍ0S pa ?P"0t p0p! AHa0 0004mL`` ",2a0a@` *aɀ\ O-M ` pD@  `wPȐ`İ@l` P MЍ@0 t p0 P! A`Āp` ɀ\ G-M L8<p D`` @ P``Wp0ĠȐ t p!R !  R t  At `!R ! 0 R ЍGɀ\ 7@-@PX`0t p 1S01  0S00P00000`P hr P p qB_0)`L000000i`]  Ѝ0ɀ\ ,^ 0S/T  BRT  @-6/@@M^@-@P@oC-P_P3` Ѝ@.`x0S 0`_0Px00ptp`t0qW P UH` 01jt010qHȀ\ ɀp@-P@`v`00p@s`00/0S S\/ //G-S `@H@ VBQA<`IQpQY/ `Pv_,_`V `$GpQ`n` N@PT0u0 (00 `$GQp^ @-@P` p0  Ѝ0S0S@-l0  C0 $ , 0 P *0!_嵏d_/T H /p@-@0 0P0:0P0<4P`0@ P P  p@ ppOpppH0 /@-@^H0  .?H0#d1Q\7 m @P 0S^\ 800C00S\ 00S00@Ѝ0Q 0S'0H0 @0Q@Tl0 0 0 ? @ 00400S@at Tf@zfzfG-pP,0`S @0@L0S' 0$ MKJ   P 0 = 0  X > L0 H00 0 O-,@ 0!@L ( MKJP`Pp Y]0FoSVY[ 0S [ Y[ 0`Y@ 0 F00 0  O-@2M0L 2Pc0聖,000 6 00UP48<40=  , L06   03 00zpP * P RP[P2 PV UG@0@01[D00, 00@0P by[y] " Ѝ4 ,0D0PK0S? 00S=  !  ) P ZX  X B[, 0P0[P0L P P@| 0&@ P -OY 1PZ- 1y 000 20 p@-PP@`e ZX00CX0Z oPZp O-,M\@`ကP`dpP>0 0%!X0ЍS`! =P@V 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H# 娡D0@00<@@07 D@T A(`> 0RP  0  eV@ ^@-PGM`p0 .#@P@P  @0 0 0@Gߍ@-PGM`p0  #@PP0 @P  @0 0 0@Gߍ^@-PGM`p0 "@PP0 @P  @0 0 0@Gߍ^@-PGM`p0 "@Pl@P 0 0 0@Gߍ@-PGM`p0 "@PL0 @P 0 0 0@uGߍ^@-PGM`p0 "@PL0 ]@P 0 0 0@SGߍ^p@-PBM`0 d"@P  @P0 T@Bߍpp@-PBM`0 H"@P@0  @P0 7@Bߍp^p@-PBM`0 *"@P@0 @P0 @Bߍp^@-PM`p@P 00D@jЍ@-PP0M`p @P00,@Ѝ^@-PP0M`p @P00@Ѝ^@-PGMp`0 !@P0 @P50p 000 0 00Z@T0 -T0V@0Gߍ^@-PGMp`0 !@P0 k@P0p 000 0 00+@[T0 -T0V@0Gߍ^@-PGMp`0 d!@P @P0@0p 000 000 @T0 -T0V@0Gߍ@-PGM`p0 6!@P\0 @P 000 >@-TV@Gߍ^@-PGM`p0 !@P\0 @P 000 @-TV@Gߍ^@-PGM`p0  @P@P0@] 000 @=-TV@GߍA-`0 Mp @P'`00 0@PppU0PV0 `F000pP P@p!00-TV@ Ѝ^A-`0 Mp l@P'`00 0@PppU0PV0 `F000pP P@p!00G-TV@ Ѝ^G-P M@P)0 000 @PV0`W0 pG00 0xP P@!00-TV@ Ѝp@-PBM`0  @PP0 @P 0  @-TV@Bߍp^p@-PBM`0 @PP0 @P p0 @-TV@Bߍp^p@-PBM`0 @P@P 0@N0 @1-TV@Bߍpp@-P`!0CS@V3Pp0Pp'.00p@-@PS0 *p@Sp@-@PS00PPSp0@-P0M 0 0P@P0 03/@Ѝ0^@-000 03/Ѝ$^@-000 03/Ѝ@^@-M0<00  3/@PЍ\^@-M@000  3/@PЍx^@-4000 03/@P~Ѝ^0@-0M00 03/@{TP PS<0 0R 0)ZSЍ0^ @-000 03/Ѝ^@-000 $03/Ѝ^@-000 (03/Ѝ^C-0M p08@P% 0"sr`@ P`R $S0 ,03/VP T 0"Y0 3:UЍ` ^@-M@0000  3/@PЍ<^C-M P 0@P @ 0 `R $pR@0403/ 0P Y` X0#3Ѝp`X^@-( "!0 803/Ѝt^@-( "!0 <03/Ѝ^@- 000 @03/Ѝ^@- 000 D03/Ѝ^0@-P0M 0 0PT@P0 H03/@Ѝ0^0@-P0M 0 0P<@P0 L03/@}Ѝ0^@- 0 00P03/Ѝ^0@-T0M0 0 P @P0T03/@XЍ08^-00$M0"!#!0 X03/$ЍT^0@-,M\!#!@0 00P @P0\03/@,,Ѝ0p^0@-@0M  PP 000`03/@PU 0QT 0p( 0QЍ0^@-@000 d03/@PЍ^0@-,M080\ 0<0 $0 0P @P0 h03/@,Ѝ0^@-M@00l0  3/@PЍ^0@-@0M PP '0 p03/@PrU 0'QT0'0dQЍ0^@-M 0400 t03/@PNЍ^-$M0(000,0 00 x03/$Ѝ4^@-000 |03/ЍP^0@-P0M 0 0P@P0 03/@CЍ0l^@- 0 0003/Ѝ^@-000 03/ Ѝ^p@-x0M` 00P  00 @P 0 03/0@P  Ѝp^7@-00P00 03/@ Ѝ0^0@-,M!80\ 0<00@0P 00 @P003/@,Ѝ0^@- 0 0003/Ѝ^0@-L0M 00P x@P003/@Ѝ00^@-000 03/ ЍL^@-000 03/Ѝh^@- 000 03/Ѝ^@-000 03/Ѝ^-,M 00H0400800<00@0 0D0$00 03/,Ѝ^-$M "!00 00 03/$Ѝ^0@-X$M 0 0P @P0 03/@G$Ѝ0^@-M@000  3/@PЍ^0@-X$M 0 0P @P0 03/@$Ѝ0,^@-000 03/ЍH^-$M0(000,0 00 03/$Ѝd^-$M0(000,0 00 03/$Ѝ^@- 0 0003/Ѝ^@-(000  3/Ѝ^@- 000 03/Ѝ^@-^p@-P@`P00@000000 09(0P0Pp 0 //00// //0/@-@-@-@P 0P hP @-@0$ @  @-~^@-0\v$0@@-0Sv/// / 1R *1 4SHP// 0 //0S  0S p@-@@0S  p0S  /0D 0C S 0 0( /, 0 0^p@-@PN0Upp@CNp@-0@ R R p PT `h 0pPDX0^0PSP 0PU,0%V Z1 S\0<=0P0 A!⽷00(0S#0(0fI`IX 408  (0(\*40X803/P  0R \ $0S40S  Zp"R 0$0S  0R \} 0 V,0"&0:808 01<0D0 000<0000 0 0P $0Se <}p<< l0& $0ST P<` 0P0 00S8 00l08 Poo 0bp @4\  0P$0S* 00, PYV`` 0U`V <\ 00D0 0000000,0U0P $0S p0`@00@PS 000 $0 P0<731|0L0S  0PX0 @00`V,0P0U`PY0 `@0$`6d0d 0` X 00 L R  PhI0   %6p1g 0@ X0 I P YP,T0Vl 0 U,0"&0:H00H 1 0@P 0 0c5qs0 RZrQZ3h0000000 h0PJ  _L0S4 00S ?@XT0X00S 40S 0| d0  d / ,01/Po@0S`oG$0S T < V?T001:#H P `VH h 00  B b320S V0# . R HH @ P! @;*"*X S0t00x0*sr0X0 C ׵40St 3^P0x >0 PS 0%VZn0H 40U n0T0tPx`F)0 0, RS00V00S000 u 00 E 00)0 C ch00172P pPpUP0 b7pr QSqQpP S10 8p<00P 00 000X 0##@0 080UDWY 0@  0  3P0SvnPι 0D0 0p0 P  0<!s$0SL3 L00 mX Cnw$0S0`0~ W_pZOO-EMD081@ @$0<1(000@10008308L00@1 0H000P0000L00p,00`S P00 0 FH0  d0SFW ,0S 408 03/mPEߍW5@12 0 SpPP) mm`눀X `,0 0om 0p,08P @1 40/0\3/PP 0 0ᘹ$0( 0` @1]V` @1 0S 00<0 p0@`D800 0 0PP "$R( 0XP ` FX H0  0S0000 0S 3/H0  NP d0S/cmL0+ gH`*Fi&gfkWe ,0S 408 03/5$01(00 S0 0<0H0S00@S  @T0jX0*P (`,+m뒅l 0`! 0  D1 SD1P P0  S 00(`,S Xjjt$>(0 T0,0X0ܿ040 2X `X 80` 0S4`08028`QP @ x⨳ 0(`,0 00p 0 h  01/9v0 )V. h0lS00V#6:`0d030 000x0*V0d000d[ `x0 A !d` B[x0x0   ^> !tPp k`  R  R"&*QNƠ  ` 0 x1*0`000d `0 0`0`0 \0`0S"X# d (`,0C6`ïRl0` x0P 05/P!kU 0xP`0dx0X P@0PD0  $0P(0 R \0S  R ᶼ ၼ ¼`40S  1  <0 0 S ᜼ z ᶼ0 S\ 101T0S@` T0S k__̡@-0 000! Ѝ 0  /A-@0MPb ᛿,0F00 00hЍpZOA-@0MPb Ⴟ,0F00 00OЍpZOO-$@ @` pLM 00 0 00 0 0 0AOoBBLЍ06 ?\0uk@@ok|13100 000 ` 0`p[k .0S@卿jQ(T y1 0@  @& (  6, ?(#<@$8Q 0(@P8 R  T 0@ 0 0J᫻z᷻`G-@0(MP3 聓0b־Fa@Ѝ @ 0qCT0 0T0C ፛0000 0$@ b62< RW1Q00Wrp @0(ЍO-0TMPS@$0 8Q"'  "$ $ # Q $ R0,00S$0S 04 8 TЍO/4 8`#6/P TЍ0S0000C0H#Hc S``V 0 0 00 000000"R 0 0;;020S(00  p a 0Q2! QP#Q0q0Xp a8 QWQS1WqRk+pi0 @20>00 0  .p0 P(0 S00 ,40P1~pp p,00 00pG<010801 1!&ᰖWK8-|1 0(0` 000 :#: 000 *8-0 x ,ÓXE00000C00 000 0C02DH8 40P)qp% D8 40 ?y#p{00H <:+ 04 H*[_xx̡8Xp@-@P1B0 p@pBG-P`$0@p3/@PZ@00@800 4/@P 40T00S omVx P P$03/@P P 0Sf P @0S|00S@0SP 00L0D 8/PP H0U00S @2@ 0W4 V4 P 0S m P 0P e 0S0S PP 0S P P i<0 P0Ѝ0P PPSSA-`Pp@ T BW <AO-P @`TU  (T $0 0 06/@ ЍG-销@0H?oP20p`PS V TXTYGO-DM,00000l h 0 @P QPሠ$0 3/@PF`V@@800@  ,04/@P680U <00@ p0l 4/P@<` P#<0Ux X880 R R<`VS <`0S0S VV86<P @8-DЍ8pW0S@; x0S@7 U l0 0Rl0 @P*   03/@P0 @t 4/ 0tPp@P 000,0p 0@ 0 t4/@L00SF0 80S @@400 @ 0 t4/@P40S,80 0,0B 0<0 0p0@000l0P0 0 #P`@p 8p40<`S0 `p@4P Tt o<0 0p0 000l0@080 0,000V9`@ 0  4/@P`t0 @ 4/ 0Ptp+0@t@P000p00l0` 0,0 0@ 0t4/@Po00 00g 0R S@`@ 0 t4/PB@VS@RA-P `@0pz0S 0rW 0kT0S A0`p@-P@ \ pp pO-pM0<0P0H00P0 8`@DL 0t@P& W0V04 P0Y04  0 ЍO  WP0S NP @Ѝ /A-@` Pp8P W $0 Aj<@- 00 00! 0!""##$$ ᭾@- ?d?Qp@-@ Q  8PPpp@p_Qp@-@ @Q\0@$0@0$0ppP>$@7?Tp\0$00$0$@Qp@-@ @Q ppP> 0"? 0"p@-Q@pP @Q@p>d 0$ 0S (0, 0@@>d 0$ 0S (00, @@p 0S/S 0 / E/0S//0S-/@-_//@- G-`@0S 00s  r Pl 0 r 0 pW S S W   P UȀ- //@-0  @-   f  1fo    eZ400C0 J 0S00Z<1T4ZPLoD 3R 0 0CP0S l 3R0 0 40PS \300#4Z400Sd4X4000D0 3噯PPZ  Ѝ,1sT8ˁ __D D0 4S 40 60CpS//._0S@-0/@-@  @l_X G-p7`3Pn3"? !@T0@@0 @@@AP0p00 0` l 3TG0 R\ \ @0@0   ˁ G-`Pp .3"? !@Tm30S0 SR3P Z|X3S30@V 000S G300@2@3P$0@ ˁp@-`P20 @T 0@STQTh#3pP@T P @23gP@pˁ 00/0@-M@ P PT0@ D0D 30000⬿P+(Ԃ%Ѝ0zd@p@-P@`2  Q 00C0 0 2 Mx20Sd0 2?0!0S 4 0 p@20 0ˁ p@-0@HPZ20`0@,0D02Tp@ ˁ P  800P////p@-d 0@P9 .02 p/pO-P1S0l*`@PP @T@@}>w0;*}.0d 0P"<[%@ 08P<000@P WY0* [@_ [@_ZYp㠐~@_p W0: 00C@_2 <0# , ! 0Q:;,O-Qkp0H"᭟@ ` 0P㣟2 S n2@`{? ᖟ!2@T`0!匟!:#@T`0!借!ƒ1# @T.`1 2d Z%0 PP[?T   P ?T )@.0 @P0< I ЍT`@PT@`P[?T `T`0I 0@:QO::P/G-(p$`P@_Q<0S00$00V (`嘀?`aV $'0#$+4?P W8P< * ?%!  (T$0 Ӟ V (00100 @ D@-0@00$00ӉPp@-@P`R/ߞPP`䛶 Pp@-@ z00!( :@ @-0@a0!80@f0A-P?@ `!tpR^0 W\00\0  WX00X0%0S`00S 3/0500A-@`PP p:0✿έ{0p@-0@pP)0ŭ@l0Tp@-0PS@p 0x 0000ᖾ\` 00 $A&kI00@! Ѝ@)__0/G-P`t@/U 1P0I{0SG$00S0p SڬP嬐UiPP /003// Z#Z P &00C0Z $00//p@-@PPpp@p@-@P/00P 00$00弈+p@/O-M00pQ  (@`TB  0 ᆝ : 0 3دt 0U0Ѝ0 @00D0 0(g 0S<0#T $&B! BT#? `kߍ#T# BT'B2+B B R!t  up`83T| +16T !7Tz 26T `"T "T " "T !Be'BT%B 'B B T"T BT T d2Tt 7C0CT 0R550`H T @2Tf/E/6p20S-0 700{`P1 TT *600 0!00 `070-f 0R88@9S}E/@U-P`  }`-0$0> 0S`: 0w`P3`8-@T 00v-T{ ٪xT @ Y{dЀwd~d(udd@d@gdmdyd|drdAgdedg~hd G-@P`tp@ W!%6000!0 0pP Pt` l"}(0S00 3/v0%  (ЍGm0 (p(P  Wpt UPT<$',P * S8SЍR 0030#  P0l> 0$0 "ǃ Q0* 0 (a ,__ _T__O-@ᄠ?t`pP Q4,0SU`V` , Ѝ`0S 0U%0 Y\ 50\0  YX 0X0%0``0$Q 00 001/`P 50 010 8Sr0SU//A-@PKSkSG-`p`@,0P N`PO00kP1,01U,agŶն0   0 嚩  0 t+ x00Cx00S  . t',匩'T5R 0!400HS+R!__P_ A-@|`8 P X0 0 1@01?::0 5:1<,Q@p``  0㮙Wp0G0A A-P@᠀呱0 0P`tpx+lRdPR+{ sh++ᅺ᝱00g_  ΞG-(pP`,@렐X Ll0P0PP*>:2<.`DpP0 p0PpЍP@-p@-`Pp0S0X0S C\ c0RC dPTP1#p_p@-PR@DP0Sp@0kR0Q 0S |@ _O-M`8, N-tDN, R 0SS  !ᯩ NZ 0Y ,&N PZ)8ἐ0(, WP, P@嘁iNU &x0P0Cx00S  . '' &劤$MwPP$  $@M 0 4Qs :s  8  /s(PP0T8 d p?P 0 ,00YP6ER _PMQ _ _| _ _O-Xp@wuM~ X0p`#00 0?PP+0P X夫0P P" R R0gtX8l&  #3, T 00S 3 Px{uߍPX X3 : ,4L HZ\PGS Z{3 0ߢPE}`X P L0 l:0 ,qPP  0# t Pp 0⇓  ,PpX & 0ⶈ& XⲈ  }0 P70!*" Xr Tr(0, 0 0S 1!3S$ 6~?.0S S*Q #?0000. [ A00 Z Xr P 6X>P.N  Q#?0000Q 00 q Xq PhX0 ,qR 000X0008!fPd _ _o _ _ _ _ _L _ _ _T0Tp@- 60@@P P!0S@@D!p*A-@Pf/pǏ<(00`S3 #01 1@ ##:!#0<,8  p00 p0 H0<0 0008|0X``00``Kk8 ᔏ(0 0<0`0,0$0@000(040,0A蟲*@ _WEVG-1( @"6 0ࣔPP 0S00GPz꤀! $0 BR0 08 pRvW00 BR`!`1Pe0W  '*\00C07!*A-` P &0)`W@P@ |p  UT00T0  UP00P0%0SX0 !@ !D æPM@Py * G-`<1 0/D0R-/40R>0/P-/}ft,@{f@|f~fp@-@D P & 0 pP$ p,0 60S0!L0cpp_p@-@pPP1p@Sp@-@P`0S$0C @P R8@ (@T( $0DS R @TP/oT" R  R 8 R 8  0 R $Uᔻp0 p@-40@SP 43\0!,0S S 00 008@Tp`0 6/@ p@-@P` i 0P6 #::0t $00000@0`0AD: 0p_A-Pp@k3A`1`00 b`0S60S50S 0S E`LPO Q 50S0 xu}050 X@-@BqD0S 2UP$@O@-@&50S0500S @aA- pPPFҺ9@0(0@P<1``00lx}P SPPPPPPPPlPlB9 00 0`S 0 , ` 0@UPЍ<Y T_X_@-(@,0SS0 DP 0S @T-\M0Q0 0S 3/\Ѝ G-`1@p31`00l 0RP[50Sx|0550Iou멒B R  00 0S#P< 0 0 0  幟PY0 0000&6Q  R  R   0 0  pPP #P 0SPU  P P r 0O-DM!0p`hA0 <0 0,p(`$  @P<]e<0 SE 40p0 ,01  00!0 0D0000'>0(` 0$ Ae<040p0 ,00!0 0O0 0 0(`$ *e<040p0 ,00!H0U@ 0  0(`$ @eDЍT_(XXXO-QdM@0 | PdЍdЍOydQ0 00000`0 HPPPV0/op"/8A  @T@DHX01H0#0T0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@ _ RH  H j X  P `J@ GrpT @DP O-造Mx@P` p}0` Ü0v0l ,1 0(10$10 1H00XT` 1?o2P0SЍ YC-M 0P`` @哜|p0 P 00 00 0 0@+`?o2P0S  BP Ѝ(p@-@P@T $@DT\TpP 6A0S(@0 (0 0QP0 _ YA-0pP@TU, `T`1 5@DP0_D0S/0@-0 H ЍA-@dp`P0S$0C(@@ R (0S $0CS `PA _p@-@P T-p\P [@<0@ @$ } p T_ɀ,X @-<0DT 0 !0  !O-@Mp,@T P0b0@DTЍD <0RTSM (▤0 0 0  @0\P: Ui000PPPEz;0 0 0 ؾW  0R H/  0 S" 0S#,U娾0 0 0 峾P@T @DS00 6P5Hoᨂ0 pQLa :/0X0 g MbA-@p `PBM 2SJ@ @(@0 0@S  ˆ02 100 0 0P`9BߍY0@- ! 0 !A-@`XpPU 00`0S 0U0  03/>X p@-@P0 0 0 0 00 0 00  p@O-Tp4M31`00#212@T Y 0"0#!"4Ѝ00 030 ^Fh`P0S @D R 2x# P1  PT  C\0 : :0 @0S ( <X0000< 3SH0L RP\0307 sR k "Px"P`"PL"P4PPE_o("RQ :07A>?00A0Q01 0ۛP00 R 6: b:  P( U 0S40S 81  00000C0( @D0P0*>(  2 ֙80S 40S 0 @PU 0 3@PP220:00lp\ 7/U P @p03/ɀ_ A-P4,a @T @DT@T $@DTA=0S 0S1.@0S&$SB008P0(00S pP ZN<ስ080僵00r=(@ ɀ@-0  Q:0 0(0 0QS Q  ] Ѝr[Y00@-AM@0 0 0 0P00! ! 0@ /=Aߍ0A-P@ `%0H   CR'0C0 0000S  (  ( 0Sp p A9#RH L0S0P  <-CM       rCߍG-P<p@|` PPl00P(P$P,Pi0$008P$PS( (0 y 0P pGE ɀp@-@,00,0PS0y0,P@8PUp`0 6/PA-80P4@`pyT  0A/(080/(@-@P 刴P @ 〴A-Pl@`qTH1x`31`0050Sv0500S 00000P IP D P ?P 00P 0000vPh dM-+B" O-鼪@,M3p1P`00O50Sxv050`V `:W 42CW >0W >C 0CW H,ЍO8(0 S008(0 Sz007W 0Wp0S 00`7W:> W`x0S  `d7W  ;CW0CW5C 7C0C07WC H,ЍO6W^ 97W >C0CW1`ܖ W 6W)`VfX# 0 W0@P0P20|&0`W`ppwPVhfV N$6W! 17W 6W 000 RV 5pW $pGW`5W 000S0Sp%0 R01 5:S 000%#` XX  ᒲ `P ኲP `~00mVf0S4 R6`P0400 R0S 0 S? `00  05  V` 0 (pW $pG`Psqo0S R0P WS R (PU $PEU`4p000PW l P040  0 B R`-0 E0 0A0CS…R'X1 ⅔`P,0(S(0SݱP ױP`` б7`,0S S 4000(pY1X*,1`z@?P 01 1z P 0S 0 00( , 0 !(00,00|060y000u8000S080n<00S<0g0@0d@00D0wt@HpB@~B f@pB\XzB ɀoB@|B@oB@__fB@{B@}f|fvtgBBfBwB(_@B/P/@- 0`( "4`# Ѝ0M0000# Ѝ/+*/Q02 //0p@-0^PN^00p@A\" \ @@T00 ^< ^  80p00p 0p pp0\ @-L\ 0 AS/P 0000S000/AP/G-Q@1 P`@A0pS S0P@S S S @S S 0SYS 0SQ$0PUp(0S 3/XP @-5p@-@PPp0S00P00C04@-@(p@-Ph@1 01  hp@C-M 0`p` @宐P 0Q 00  00P 0@ 0 EToP@@T0SЍ 0605o7G-p 0P`M !` @uP0 X0 000000@P T?o2P0SЍ<,Y@-@u0(@@-@ i0@ t0/0(P/0S @-  0@/X @-<0DT 0 !0  !//0@- !q 0 !p@-P@p@p@-A`k 50S 6PU 4 R040`0,p@ 2S 0C8C8_o2RU0nTʀ\A-P `G{<0@TA00S p3/qX@ p@-@P`03/,`D 0S 08 000 0S0(DNnp@O 5_\G-@d`@ 0  +PP0 0" P00@3  Jp@ 1@DU& T" @ 0S  000 @ G@SUQ Xl =$rX 80S  3/XX 80S  3/XTʀ A-@P(p` *R'7PJ30 0 0 UhX004 0  004  @0D 0 @0D h[3 000SP0PP0P0A-P`p*@T  R    B 0Tp03/@-!K 奾0 +YM_x[YC-`M  @0 @0 p 5OP;J00߀h ?0l 0@0GD   80 q ЍCW` ʀ1_TʀH^3Y3Y0-DM000,00(0P0 0H0000<0$ <0< #VDЍZY_㍪㌪@-0   Ѝ_O-|0DM S4|00^@S40p0d(00,p$  `<0UP` 8)440S I<0S/ 8H` px l l0@a 0pc(00,p$  `<0UP Tx0L#LLcSSD3x0O 0000@000S ~_S #S1!~_O@nPDЍO~ 0!<0$   ,(pzUP 0!.00<0$   ,(phUP|0 00!<30 $ 0,(p80SUPg0 00!700'>< $ 0,(p80=UPQ0 00!0>`0,(p$ `80< (UP? ; 0!<0$   ,(pUPg 0!p00<0 ,(p$  U0PU    '.y` ,(p$0 @ 0`< TPB >P1S ~?S?11~oS1O@GnaNfY8,Y__ 1Y_X.Yʀ` 5Yp /YO-LM@c 8`d` P@3B  t埰~ 0@Da<00,(@$  `D0TP <LЍ 0!<0$ 0D0   ,(TP 0!00D0$    ,(rTP 0!L0>`0P,($ P @0D _TP 6Y|,Y__/Y@-@PA 6 @ 㹨l.Yp@-@PR`彯 Q   į 0p@P   RP PP  尯B0 <0x 8RR00R0S 0S/ 2B5YX.YA-`pS oPTP@ p jA0V`` B`,Y1Yp@-@Pap0p@/A-M`0P@Txp~OD*ЍA -P AT ~ODT` Tʀ@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@,Y ,Y$,YX.Y(,Y0,Y8,Y1Y1Yl 0@o/,YA-@`pBTD@D A0HP0UDPES7/@T@-@4 00( R @@0000@T ` @-@0 0$S   00C0@B ` @-`pP@MPVP@2 ЍT@UP\0pWU  X0S   @PpPE`?@` 0L TʀO-0M05p  w3PP, 0 X`0@"40i300  _3 v$0(0`0`ЍTSY0@-@Cl0 P>l@,/0p@- 0 `   H0D0R@U DPU ?D02DPSH H0 lR0p@ؓPH0S D0SH0D0H0D`SH H0  lH`0 Q  ! H0SD  D0H 0D00H0Qp@-@ P 00`VpP000p@7@-0@S MPP0↓00 Ѝ0p@-@`P5 0 503Upp@0o0 L KTʀ0S/ L YTʀA-M@`P>p0SP00GWPBT D@DTs>ЍAh ->PH@@-3M@03XdXp-`RU DPEUIPP70PUЍ2' `HP0S00P00C0+.,0S 3/XP G-VM@V/ upBT][ }?8c !L3"02Q  ! R!{0S Q-050p h, Th8ߥ䁄刀 2S ?  ե0 2ZRU DPEU RU& DU# 0ZHP %0 RS | R H0 3/0,P0 8P-&U$1PU" q  8/P Q{01wL!Vߍ40S 01Q 403/0SXP0S    H03/,Tʀʀ` _h,Y 0L PTʀA-00S P`~CW l0SB 1S @0 R H@T D@DT%P 3 P 0S %P~C` ,Yp@-@`P@P HpA-0PU `p~_EU l0SQU@3B T D@DT 0 0R H@Q x%P~_E` ,Yp@-@`P@P  pG-pW0S !S* 1S l QP0PU ~oEPVl0 SB aV ~oF ,  H@T D@DT 0SP 0 S:UP3.P,Y` p@-@`-P@P Ip@-@P\P@p@-@`P@P .pP/D@P/00S/HA-@p`P@P tA-`P$V00l P0S/PD@@T0S0S $P Q $P  0S*p0  H@TD@D,YA-@p`ᦿP@P $P/@-(0pMPL0`  @P $(0, SS  3/ЍTSYp@-@P}  R80S U U U00 p@ 00R  00000TʀA-`p!P40@TA.80S 3/X@ A-pP@H-W` 40 p0H0(0B AB#P H@T D@DT02S D0CS   QH0L0S Q$` @-@p@@-@g@|0/0/0/0S/  ɿTʀ0 R0/@-Pl 0R,YC-0`M `00Q@S 0`8`0}?`>Caaq cX,aab pbT!0 ʺ 40!` 0$10V!0 $0 p䐟00S0 SW \pP0Q:0PSp`W !\`2$AЍ0Tʀ4_ʀ` <_@-@n1@0A- P @0L ^U 0S |0`@Tpp~OD; 0S0@A;l0S P AT ~ODT` ,Yp@-@`P#@P 0 ƾpTʀ@-Q@MP@`YpPP@ \ V  @LЍ0<S %0! :F@0A- P` @0L ^U 0S 0p@T㈀~ODƽ 0S0@AAT ~ODT l0S dP0 \` ,YTʀO-`0M#0|8@QX 6^0Qpu TXGP  03/LNZeX8P   03/<NZUW(P  03/.0S  PK `F@P@pW P  0# 3/00880R 3/`Q`31H0@0< !N D!0/H0L 2m0/QP @0D P @qP 0?S@ Ѝ@S``iui vi iiiO-hq@Q`PEM L1Q-YU4⊷ݰ0 00 0`0屲P Eߍ 7X "P  0R ArBT1 ᐹ5EPV14  41D@DT 0Q H@i i_C-qM@`P)  03/P!NU# 0S  > :Pp@0S   l  0SЍ7PpP  Jx0/p@-`Q@P R 0 0 0 "%47p000SP0PP00pX*R 7P %0 0 0 U `0SP0PP0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P`M 0# R3  LlR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP$Ppp@-@PPp0@-@0M0S0=@P  WЍ0ϖo_p@-Ph@ၣ1 01  hp@芣@-p0$M03`A0AS P R R R1  $/@ ?$MRY R @ 000 S( )04 0 #RH L0S0P   $ 0 001   01^000000000 0 00000 005@P #T@$Ѝ3  "'0P0C@0@ 001 0 S#0 < 04"48#80CS=10 001   \110000000081000 00@P @j0 y 0H   C Rw0C0000P( 0 (00(00   ^0T0 0 S0 @P| Qx 4@u2@7@_33@-3A0@S AS S ;<2@S 3/4P@.O-Q,M0 #21 2@P0 40S 000 " !",Ѝ0S22 20 `HZ2Y HYRpUHp0 0pW0\ 0 0a,( P @< @DЍ_ _huYlYA-@`pP0S 0Q  6/P Pp@-@PL0S| |0 @Pp@-@ B@?6@/p@-@P,03/ 0&@P@ D&!R @A000p6@/0S   6@ H0600C0/p@-@00`P 6/P 0S| |0 P@pC-@4 `lMPd540"p  8P PpC 01 p?\x0 p0Tx000X`\p1A`p0t`0Gx!O,03/d1`0\1#$C,03/0& B0R  ! !/0 \@`` BϠ ,>o\࠳ࠣSp^ 0(0Xp\`F>P|p @0X@\`=>0T`!C`@400o @$ ⻦@`y `_\ĮYMbq_O-4SM⬠1 K&@ pt Q  O[ P`+ P`x RL R 2/ H 2/@ l 4~ pf@ R{ x  Bx < 2/`P27v 0 8@4/Y 4Sߍ&R:[ @ P`& @`pP&r R W &Rpڰvp 5 HQpHp0 $2/x RoL R 2/ H 2/ 00 04 :/PPU@@ p&& &[Wp@DPPTX \ @`p) &X \ ppVpW9 x  Bx < u $ 2/pP  & &`P@&p R @&vP&R@` @&& &p B x  B x E[@`Pa=l h_G-@0pP 1@M@3`` 6S06E6S0606;\ 5  R !o~`@Ѝ08#8S06đ6đP0SPp  0Sp0 S6T00T06#` V@` 40A`@`X0\ p06S)ʲY&06  _o003/@,89@  04@ 4/,XPI0P0fT00CT0# @-@P6S@0 L0!608#86 S0\ 6X00 @ 0/ 03" /0S S/S /Su//N/0H00徧ʀG-`p\ @0S@RP P@ UL n0D坧!P Pm@00@0pO<@zPPpPʀʀO-0p#MP2`12圦@PlD  lᷦ@@0S  x|Ѝ1 3/@ʀA-P`p0P R@@L |n0D<0@ \ QQ 0LQ  bn@00C@0O@A ʀʀ @- 0ʀ_ʀp@-@x2dPS|"|"|2x" DQDM8DIDEp@ Zʀ, 0P/p"Rt"R/xʀp@-`P@P @@pbtR N u $ 0@Sx2| 0|2pʀʀp@-@P0 p@A-@Pp`  W  OA-@`pP 0 x0@30   0@0@30 @0 034 p@-@P pO-@Qp00$MP 0 `P 0#212z`P@0Sg $Ѝ褠D  @P㊥00@0S JNT000ᅱ ;/0P0 R0SPʀNu/0/@-@呎000@-@@倎@-@ @ʀ@-Lΐp@-DP@b1 01  p@k   @R0S`R0'S:/@-8@0S Aj00Q"нG-M0@P`` pl` XD嗴0| 0S(,0 0$ \0000 00000000`i0ЍY@-0, ($ Ѝ@-0, ($ Ѝ 0!< 04 0 (   !/\ P/0 !8 00 (  , !/A-<0Pp@`L嘏!0 1L奏Ap@-P@ E0DP@Rp@A-`0@SP NI p`!PPဏXR@ ` 0\HP@Dp͏L@04@SP P0T T`PʀYܼYYʀ@-@\P0PST T T0P LIDFHU!R@Xʀ0/O-M8p ` @kh`d!0S X!SD P!SC H!S0 00!P `9 0x00 00 000 0@hPZ/oPQ0 S S S S cjP @tp\jPq00Ѝ0000@TļY̼YYY_p@-\0P@HiᲢ`8^PP H!2pнp@-HP&tp9t(lP@ pp@-P@UP0S00p@3'P!)CP  0P $'8H!P) & &_@-H@0S <%0@T@P@ʀYʀA-P㰲_&\@p( `P @@TP@O-,1 ARF@0@S` pqP0 S-0 傲@`lq`E0S ކ &p(廋P` ,8&  ᇋ0P нdY_C-M 0P`` @|jPp0@ 00  00P 0 0@.?o2P0SЍO-`@p4QDM(02048 0<08 ,p$` `` `1(<080408  000600 <0,p$` `10(00'>4  0 :  <08 ,p$` `140AP 0@00 ,p($` `P<08 1DЍ_LYY Y0 @R/p@-P!A` ! 0RpC-aMPp@Aᘱ0p 0` i0 0000P@``000*r-PЍY@- 0S0!Q\ S0!0 BS   " 40 S 0 / \P:/p@-|0P@`T   @PHBp ,U00 000P`0@4_0 0R  0S/0 R/  0Q/@-   QO-` @ 0  SR00N\ : 0P PUP 0 @0S 0#0JR㊁PPU @Y. 0 0S$PH 0 0SP *P  pW 0R  Z 1Pp[Pp@- 0 BRPNP0@ ` T00Q@:T:@ #pQ p R\:p0@-S>"0000( $ #0 0G-@P`p-  0 0 R:00Y' 0A P! 0` `0S: 0  000 @ ``0 A@G-r@`0T@PR{ T @(@ЍU Ef Df0Y`* sR `FU T`T BS` 0 ` @  YnP@0m@P  0 0S f0  `0pS`P 宜p@U *PQ pI Q`FBo B10P0 00 00TPÏʁ4,__p@-@Q`P 0 g0P @pnPTp0SpPO-P0M`Q@0  HpP ` @Ѝp0 0@S 0/ Q V Q P  P P [ T7@   P QPP0 0000@ 0V `0 0 000 00pS/PUP 0S$0S# RP0S000  P0SP0S 0 SQPPUV~ 0S{ p0S00R0SpPUff0 S0 0 T婛VV 00 0PO P4PpPb_A-P@k`P p   BmP TO  mP@ 0@@T  RQ 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@+Q %  BR  \R\Q 0 Sl!0 SD 0S0S0 0 S0Q00 R Q RSR ՚0Q `U P0P0 RPPQ AQ  0 __4__0A-`pP0S k@PT 0 P 0 @6/P A-`p@0S KP@U 0 @ 0 P6/P <00S/p@-P@ 0P@  p4A-@`pp :Q( `0PX 0 0`0d0(0 0 0P0000 04Y|YYY0Sp@-@Pp0P 0pp/p@-Q R 0000Q R0PpP@$X\ 0  P 000P:hP`P` @TpP@ 0 0034_ 4_@<_F_A-Pp`@W$)#PP000q10S0@@`p@-P@0`S   00(P0S p@3l1/1M/ G-`pP 0@T UK 0  PAG!0R"1S RP  jP P  jP 0SU P 3/P @ P 0  P GG/0 [d0  VdA-PS`p 0S lj@1W0 S00 0 3/@P 03/W@ e8@KS9@0S @-/a_ B 0P//p@-@P0@UPP :^N3A"Up Ep@O@`@@40 0 P/@-@M \ \S R   %joЍ@-@P 0P P 00000 _P00SA-p@W 0S `᚛P0P 00᳛0/@-0P00U-0  Ѝ@,B 0$`po0W`0S   R0 0 8Yl03/0S0C0$d@TPP\ YPl_@-@(A-P @T@A0p 08Dt80S``X (1LL0C(1H\ԍʀʀP 0!< 04 0 (   !/\ P/0 !8 0 0 (  , !/@-\PX0S0S;@0Sn S S $m@P  $0X\X\ (, /  X\ 0?0::S $0PP $0PH9 R R |!$! 9/ Ir450", 00 Y Fk $ 0TP' 0EKS0 P,@K@m$0P000T00X0 p$ 0@P 0SZ& @-@p@@>0UpW01X㾁V 000 W"010 D(0SS`AUpXp㾁k!_2!_8\ P/0 !8 0 0 (  , !/O-QM`p @tЍO*\h^e崕t00px0\00`00d00ch0 0l0\PUU27[x@6T6tP6 pt0xt@p0 ER 5034 | 0l@43!"堌4@00T1 ~OD0T+ ḌU `0S   0S \rP@0S T @\ [P\`PP&U`0S "Se2Sb DS` 4L ~0 0 |0,00\0Pl0吰S8 x[5 h0S2U U UD XPE D ,0| \;/ [ N[20S 2 030,M|0 0 l`Pl0 0l00Z DJZ+00004ATd ~OD`HP8  R  Q^ H$0i$00U00000>000 \0|tP%l0S" x0S h R " ,  4  |  R㸰 R԰0 lx$ Pl0$ 0l0娋H$ 1[$0 ċ4rP  0| \3/ vW HxT pod h00 R l  BR 3 Ѝ , ?A1c0@ED!_p ZHGgfffA-P`,o,00@Ipt e`P0X0 0P0 0V ,~o000@008Zp@-@`!(PQ $go Pp@wA-@`p 80P0 0 00@dЍZp@-P@Xpp@-@`P>KpO-`A@PA pP: p( 0  pU E>p1GS ! R``B``00Q  FL0Pp W(0S0P0 Ѝ@!_@-P@`pM4 `>  \>2 0@ 0 qЍA-@PP`@pD0W ⊆H0L P0 H0L 5A0 `0<0SP@0P8P0\03@P8 1@P`0PpH0x0AP 0 T Ѝ000S/0@-@PM4 = 8=2 43H@0B08 0 00 TP H0SL0S 0 R00G0S  $4 $0@<Ѝ0` 4 #_p@-`@P@THp@0U@w$ *H_hp@3<Lp@- PS`@(M 0S0 @fT!>0000!>0000P @ 0$0e(Ѝp@-@0S00<@-0  @0X0S ( 0 րЍF#_ 0 0 C-0PM m 0!S1000ⳀЍ蠁\ R00ЍC 03 HgTq@=`VT4~ > 0!S10<000U`jT HЍCg  9*P\0`` 0 0``0`@X0 @S p `  D `0peU3}80cI 0( (*ЍC5h#_d#_<L\ DZ@-@MPU 0   0"S2000)`# R   0LS@20 0rA0Q 2X0S  0 0:W`V )H00 @ @$1 03/@ЍpO-`0Mأp P@P 6 6S 5 I@Ѝ3 T V@1T2a$1 0@4/@X T060@m0 0 0  m@&P0!  x~@꬀P  *$1 03/@~T,@ 0 8ЍO<$_$_$_O-M0( P0`pW08 0(PP8 L}l`0d 0 `0d l0S@P 3!  UIz $OI00  |l004 0 004 l pW$pW8C#+$00G0P @P(Y Z!2 50R% <{Ql@0D 0 @0D \l `5 0 ` }U L{ pQ Q Up L pPـpP LW W LZlX0\ 0 X0\  l5 OPZlh0l 0 h0l l `2`0 }}P0 帙4"48#8000 0SlxkP0T 0 P0T k$Z @9kH L,9 H Lk\0US 0 S SZ00 - 0* PP U NP40"` P P ( U`  0 0_`0C  (`(0} 000 0 Spkp0t 0 p0t {k\0S ` 00,x0` |0$0000 0@0 cPZG !.T0  ∰ 匰PT0Xj0 _  ajLj0  P PVj 0Z R Z &o᪢ R" R&{j 0$ 0 0$ &j$0QP0P  F00 FL= F $F<0004 Q0P<<00000(00,018i0 0 00 00 i 0>8ⒿЍS!>0刐匐 $1  03/RY 6ᬰ  Z   bF ^F @ <00000Z4LP(<(%_Y%_%_%_%_=&_&_d&_&_&_G-aqQ@PG0 |_i0 0 0 ji0Sa@PI ~-P 40 ᐐIoᩒ S)~Y ;i80< 0 80< ~0iX0\ 0 X0\ ;i 00S+@P  4"4x ;C R 4"48#80CS?i@0D @0 @0D  ilHˀ<&_-/0@-(0,0@<,00S 0S 3/0000008004000 $ \ R0@GZAZ@@ZP/@-0 Ha@FG-0S@@P 0 S 0 00S@PP 4"4D!;C R P}p{`P 3 k}Gt40S 4(48#8SX [}G X`0S d0Sh0SP Z0 X0 vKP 4ED  E0h0PT0O-laMPh00TT d`0E@P 50(p 0  5   DP t0? 0#PY@h0`@S3  pD \DЍ00D0 <00⸰h\&_TPA-8pP`@g1!01@@Ag<p@-\0  xp^0 RP02Ƞ@,Ƞ00   ! 0 p@ 0, 04('_0 p@-@`P< 0  p@O-<`P\2M@0 ( 0/42U4P(`4`2P|`@H ,dء< dQPPqPU:0|Ѝ 0 S/ R 000h  |0S,pH0p | @$04/p{@W  | W V h| |` 0S 0 S/ Rh  |{ @$04/{Z@  |P Y V h| |`  Xˀp@-P`PUps{@@8C| @ D`w0LP0pˀ'_'_p@-@0@TpP Pk` epXO-$P2M@0p8 0'/!>4308P倢@0 0@P0V{L <\P< \⊁`P8`VMi{U 0bh@Su Yr  $09/  |Ѝ 0 X/ R 000h  ${0S<L0 <{ $09/{Y  ${Y U h{ $ | @P 0S 0 X/ Rh  ${ { $0:/zZ  ${`Z U h{ ${ @P  { XˀO-$M pp@P0 `nP 0倐hS [  $0;/@ {$Ѝ { @ )@ˀO- qdV Q ʀ !  , !p0^@p (.00  0唀0 0$ h*{ R #@ !d1000  ! ЍˀG-P`U U9 $0pp`^@ \^0Ud0 P  B B$0h(P 0(0$0 00T0z 0< bT`00`00<pXˀ0SjO-0S,M"PPP@1 P t10S T, 0 0S0U0Syp4`Vy 9,Ѝ`` 0 vP 0h z,]0S" 0 S S Rh0  0mz 0S  0R y 0 p$07/yp hnz`/]ˀA-d0Pxq@M0D 0S S2T1pH1p(@< ṀU`F00< <0奀@P+PĀ$y'hdzz]pw]@Ѝ`0< 0C`00(<0S `U0P@S  0 h@x=zˀXp@-H劾DP@`L@T403L0$t@P ¾pˀˀˀ@- @@p0DL0u@@豾ˀ0L03@o/ˀ0 0 0 /@-@ ]O-p 0M !P``  @@P0凈 0\ d0 000000@Pf?o2P0SЍ,nZO-,`tWʀ 0! $!0     !c@ȐPUc 0! t0 x   !00C0 00 0S0ؽ03/ klO-lM0!PpH t \`1!`0`H0c00@ἇ P 'v0$ ` < g< x0cp|< Da0,($  `pD0P !0tlЍ 0!D0$   ,(PP 0!H00D0$   ,(P 0!T0O`0,($ @ `@0D P '_H^0oZ'_TnZ'_'_pnZA-Pp` c@0S 0 0 0 AchP 0@p 00S 0 0R000NQ @-v/+(_@-mop@-`$P' @P@p(_p@-@P@D@ pp@-P`@PU`U`*0UPT p@DT@DTTp%@DT @D@DT @D@DT @D'T<(_p@-@`P@T`T`*\0T@H0PEU P p PEU pX(_h(_p@-P`@yPU`U`*(1U P@D T T Tp+T p@DTTT*T!@DT%TTT@ T@D&@DT,@DT @D@DT#Tw(_p@-@P#@TP TP 221#pp@-@P@TPTP*D0T @00CS p p(_@-@P 0  0O-Ppl@LM(00 0D00,p$P PP P`<,00D0 @<,(p$P PP P0 003@00<,(p$PP P@`D LЍ(_/p@-P 8n@ Qn pin ` n P n @n ,mp(_sZ`tZtZuZvZ wZwZ@-8@nnn n n n@n`P@- P0@ P@ ` \ X N@P DqЍ,0N@P qsZ|(_)_`)_B B  B  / 0 0CS800S,00S/00S/ဲB  B /00CS 00S/00S R0 R0*@0 R  ,00S/00S/*_$0000S//@p@-@0P P 00T@@@ppD*_G-P0M`0 0` @p^=0 P 00 0 0 p@?o2P0S 0 S$  Q0Ѝ 0O-DM(0 0Pp b!0 ,p0800P$  @80 <00!00<0 (p,P$   0'!|1"< (p0 0 ,P$  0!80 (p,P$  .0 0 0!08N` (p`0 0,P$ `(pp'㌠ 0 8 a,P$  v 0',0 0 a0P($  cDЍD*_D|Z@- R0R0 *0R \ \ 00Sn`\ \ \00SL00S0 80Q L\00S$*_ R0 Rp@-0@P*0 R .P@D T00SpT @0P \0P0 SpSp(00S0 00S9*_ 0 /p@-|P xSkp@ lkk \k L k <k (kpD*_pZzZ{Zd{ZTZ{Z@-0@kk kkk@kP@- P0@ P@ dd 0 \ 0L@P DoЍ0L@P o{Zr*_I+_+_@- B 0RS d00S Q PQ @yjP4 0LPЍ+_@-B B  \03< x00S @OjPX 0LPЍ$00S ;jo@+_ 0O-RDM(0"0p`008 000p ,`$  @ 80<<0)000 00,p(`$   0!'>P Z#Z Z[Z ZUZ Z +>P ߍ Z#Z ZkP & ZeP  Z1Z} Z}\ >P Zh#Zn ZJP & ZDP Z` ZZZ ZZ =P ZE#ZK Z'P ZC ZC x=P Z-#Z3 ZZ- Z PZ% Z% =P Z#Z ZPx & ZPr  ZPlZ Z =P` Z"Z ZPU & ZPO Z ZPG Z Z g=P; Z"Z Z W=P+ Z"Z ZlZ Zd B=P Z"Z ZP & ZP  Z '=P Z"Z ZZ Z =P Zs"Zy ZyZs Z!Zm Zm @<P \<_l<_|<_<_<_<_<_<_<_<_<_ =_=_ P0C /@-P, 0C A-Q`@PHM 0 6/|0 p10 0䀟2pC0DPTQ 0#HЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ T6/  00\H0 00A00A 6/,=_^@=_P/Q //  00  00  00  00$  (00,  0004  80<0/@-@Q@P @ !G-@MPXp @p P` 0@DS @Ѝ@`Q@ WpO-0Pp@<4U 0 i I3il8` Q`+ ZU0D0 ЍIP\80S   ZU@DDAD@P U@IyU@DDAD@C-\MpT@T @DT00\Ѝ``KPP@{QP000//o/00//p@-@M P@ `@,Q@T@@YQ@T*@Ѝp@-@M@@`PpeP(00 0 Ѝ@-S 000ЍG-@XMp@@pPB`@@@DT00TXЍ P@ QPPU @D@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP=T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 0gPEU 0 R/R 0C=_0R/@-0CA @R A@BT R LP^@- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//8@-@P//8R0* \ A/Q :@/Q* @@-000 0@0 ! 0#2 /UUUU3333 @-X// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00 / B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?@- ^ S@-c0o @-@oQPO-(p@@@, P`T @D.`VPW:/@P WRQp@-@@P@T@ P`Q@!.PPPpQPp@-``` P@.@T`PpQPA-`` p@P-W PU`@@@-0 0(0000 0P 0@Ѝ䌫Z@-0 0(0000 0P 0@Ѝ䠫Z@-$0000 0vP Ѝ䌫ZO-`pP-  !M@P W  0 0W M@Q A-HR @P,30 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,U @k0@P`TF  00 0S !,! @D ...|.q!!,/d=_0A-@R0@P0`?S + S# *S, R& M[S0^\PP^4 ]^F S -^>pQ[W; 0]S8 S030#W0PR'&R' `0Sp0 R0 P P P p`0SW pЍ0B?o2^Lo  Sp@-@ "P P 0#<# "PQ Q Q &" p`04`@N8<#<# "^@E00("0$"00#[@-@!  T/Ѝ@-@P $L/@ ( 0"h]_O-@0$M(`00p 00P0$00D2 0@00  (/ $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0]_]_A-`P@. $QY ?PU(p8 0 8S($)8 c7 `}.7XPP0Q`pDa(!"$a$"  j.0Uh ЍA@S )@ c8 7 )0(0G-PR2 p@q?p` @g(U: ;. 0$ 0 @PE 0$ (P`p(,?XG? %3PUF  (. 0$ Q0 0$  0$ @H< 0$ @ .  0$ @H< 0$ ?XG @-Z@-@P $-@ ( 0"^_@- @-@@-@P @ (- P 0$$^_0O-P \M@000 0Pv00 8`$000 : h#R?0V FAZ#E@P7@-@P * !? 7R8 bx b8   X  Ѝ0@a_0`( a!"$,a c"/G-P`8 p#T0.@``T%0  Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T-M Ѝp@-@ P` !LNC! !@ApA-PP@#*pL`P @  f@P _0@PWP )P m)PMUP@@-MP@@@`@pT:Ѝ Pp0P00 3Jm_m_00yara0tcid 0 - 0 -yara 0 -tcid\ 0/\ 0/yara\ 0/tcid0S 0 }/-0S 0 r/-yara0S 0 f/-tcid@-0p3A+`P @ 0*.P 0@PP ng@P0(ḕ Ѝ /p@-@P)0PPptcidp@-@ P) 0Ppploob@-@@ @-@@ @-@@ @-@@1 @-@@H @-@@T @-@@O @-@@J @-@@E @-@@@ @-@@; @-@@L @-@@] @-@@k @-@@y @-@@ @-@@ @-@@~ @-@@y @-@@t p@-@P((0P pP pgntsp@-@`pPu(@0P pP TpatadA-pXP](X0P `@P  P @Ӕgntsp@-@RP aP'pp@-@P p@p@-@P  p@???p@-@P  p@000p@-@P p@p@-@P p@p@-@P  p@p@-@P p@0!P/a_@-ZZ@@P\DTPP= P! P; P\ÀP0 P P\(:%P0P0 P0P 0 P@\0 0 P@ :\0:`0` SP $0 S 57$00$0/@-@$ P *  LTP$00$0Ѝ  00@-S@ @$0,,0<000p@-PQp, @Rp$0( 0CQp>$ (0$  BR00C#$0$0,0(0!PpG-@P8MeY@ , `0a0000P ST ST S40 0 YP^`P@pWY FWl g:W =W *W # n@Q ( $00CQ*A$ #_ \$0,0(0W $0SR00#  C R00  R00  CT$@8ЍL3H3 S R 0C# M0   Q S@0S00S > @ @@0 SbW' fW ?R0@SfWQ ` b6b` B@S8a8  C# c,1 c0 0 FW'Pf0?Sp Rm  P  c5S CP2QPU 0  PU H  0  Y=  0 fP0U08  0R4 XS+=W 0  Q  @U 0S Y 0 P  @0  0S @ s $0S,R$00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` ekPp-@-@`P YkP@ Ѝ/p@-@P ELkPp-@-@`P @kP@ Ѝ/A-@`Pp 1kP-@-@`P #kP@ Ѝ/00/-0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;0 800" <`!40" @0," Dp" HP"$ L@"( P"T,  "X`&\0#`+d*h(lp'pP%t@$x)| "`&0#+*(p'P%@$) "`&0#0+0*劰᣿(p'P%@$) "+ .0. 1 0+ό$10,000! 00 !όበ,ࢯ0 / "p0?0#`@P%p`$ @ (@$p@Op@X@`.\@q@+~AN\@@@Xp`,D@s@!$}C&M@``@pdp`$ @@$u${E&K@@p`,@w@!xGH@@p`(@z@"uJED@ @@p`($@~@"$rN&Bd@0@`p`.4@&~@+r$NB@`@p`$ @p@$yvIF@H@p`(L@t@"{DK@`@pp`$ @@$q$A&OA@`q@%`#w&yg$i(@%,@剭@#ढMB@@尠.@婫@+KD@@Ƞ(@)@"$D L@@%@ @#$D)Lဠ@p@(t@刜 "h@墓,#,l@娪@!JE A@,@(@!$AOA@@.+.$x@%|@媼@#LCA@,@嬡!P8@ P%T 0##:%6,

U<0E@ 2-([@- @ ї d_P 0R @-0,QS"o//(d_p@-` @PB"P !P p@b"p 0S }" ,d_OA-pK@P PⓍ`P @` P-A- $`0 `'N@PЍAЍ/prPP  0`N Q0c_P/0 SP0//c_C-@P ЍPo0 RQY0 p 0p៌`P 0H S00Q OM p`P꧌c_(d_C-@P Ѝ0Y0 p 0`pPP 0S00, p$M `PP|c_?d_0P @-?o42 ^0S0 S@1 /c_P/0, S@-P0o/c_P ?oH 2\0S 0SP00Q|/c_(d_fP 0 SP0m/c_f@-(0pSM c`@V `0P PP 00 0P S Ѝ`0S 0 "R00   6PDd_P 0 0#/@-0 S RS R RP/$0S @-K8@嚕-$[ݕ@- 0@a(M 0l`S A  DL H P(ЍЀ`, P ( id_xd_pd_p@- @P!Bp @-S06d_ 00 S  \: P03#/S  \ P0///p@-P0S 7@P S^[@@P tBTLPP <4G0=B@p$@-$[d_@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@ d_ /P/ 0R" 0 !SR* R0*/@-0  ^: P*0  S */@/ //@ d_P 0R//d_P 0R//d_0P L P ! R0* /0 \0://d_0P L P !  R0* /ɒ0\0://d_0P \ P  !R0 * /@-!0 ^0# %/d_0P \ P  !R0 * /@-!0 ^0# %/d_P/ 00R!  S //d_0P D P  !  R0* / R0://d_0P D P  ! R0* /R0://d_0P 8 P  !\0/1 //d_0P 8 P  !\0/1 //d_0P < P   ! /!S //d_0P @-?o42 ^0S0 S@\/d_P/@\   JQ\//d_P/D\  Q/S/Q\//d_@-@pMPW ` `0S$(0S!0+ C 00 0S0xSW  000000SЍ  pPd_0BR"SO- sKP`0@ pD TWpp-T@p` +T@`00T 00XS0 A B0C QR@`9U70T PPſ 0  000D ^aD\WDAD\7D U0S0:0QP00\00S 0!0@P0 pY ЍY S Fd_0BR"SO-@ ` J0P pE UWpp-UPp` +UP`00U 00XS0 A B0C QRP`>T<0U @@gĿ! 0GbW R B b 00E Xa0ESW0EA0ES.70ET+W PP/Q PPPSPPU&P!U P@\PQ PPPSPPUP! 0S ZF0 Ѝ0Sd_H-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P W P! Ѝ00  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/A-Q@Pp`S0V @P0RDWPV @ G @g@OoV @d 5Do/oAQV@@a P4B<@ XP^\0O RV0P@W(0B V00 X 0h0?o c0B0C5R?oo@pP!  R b42<P0@b4P^><?o/o0CS 0P 0b0<SÀ0 0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#80 (0 0C0S/13/p@-M@P PPP$PPP(P0fSa "S6 [S0 +0C0S=!239 1tS2 {S1S.  P3/P0 0 P0 `PO PU# 0S }P@1000"S0(010rS ``0 PP ލp0uS0eS0 00(0 00aS0lS0sS0eS0  0P`5/0 0`0 6/Po 00[E[\[|[|P[Q@- o/@-IM@npP`V P0P P Iߍ 0P  PP 0P5/0 p3/P0 0 p0 _P ` 0 0P0 5/P 00e_A-`Q@Pp pEoᨂ0<S 0S !S0-S -R00S00P/S=PEU0SP ,P 0B0S^300/R>R '0HV0 S ,P0/S0(0U0(00>S0>S000 0$0PR0S 0S   0A0S0^30=Q00SB0"S0S 0 ~ "Q  @$ 0>SuQpQmO-0pS` 0@P0S "S \S0@0 uP mP bP /P \P "P }H3n@PfP 0000@ 0V WPU  0 0 0 P ;8#8 S:0Z Z 0͕l S P 8#8 S6J 5# ## < ,!  0  S*-"-0 #S * 0 ##:.10> #> 00 YPX@ Ѝ0S <S8 &S@ aQmQ!pQl;Qi@V Wd0 lQ"0tS\0;SY<0@0tSS0;SP>0@pQK0oSH0sSE0;SB'0@Y gQ qQ80uS50oS20tS/0;S,"0@e_A-`[pWR SSS P PPPᾃểP(0SP 0p P V` P PP   Pe_e_|e_e_e_{ RC/A 0\R#R! R/Ao/0 P R   //p@-`P KPP@pPH8@P <rS0 P`000U Oe_r$0S @-/@-83[@- @   e_ieG-@pP`VU@ 0@焑QPU@ `F¦`@-@^@[p@-P@@wPOpp@-@P X0R@ʂPP@p,00$000@00 0e_ 4[:[ f_0 0C0s@-@P 0U S ⺳l9Ѝp1PP`P 0 0(PP0 0C0PPA-p `Pz@P V  !V @pሂC-P0pS`@M>0}S "S o00Ѝ000"S 00  0KP 00S80"S0:S@@0 P  P 0 (P ,0S*0h P ,0S(0S  ,bP \P(A[f_f_p@-@P `\0 R@VP PPPV @pIe_O-0bPS00@0ݲ0S5 ЍO ?P@' Ѝ(P pP 0IF0 03008P  00C 0P C@U R\ Q ` V `` P 0SoP 0 03/P  0R#P P f_f_f_0,S<S}8@-@ p@-P@PE 0 0 0p@蚲G-@P 0R@ p.PP`ᄲ@ 0冡ᆁ!; 9 0冁 0` 00V:000e_0P 00R@-0P   0/e_p@-@P000p@Kp@-@P ,0R@P@<pe_p@-@P L0R@P`ϱ0S@#*+@"pe_p@-@Pἱ@pA-@P x0R|P᧱p0S `VP 09`P pe_p@-@P @0R@ P`ჱ v@ٱpe_ P /o00"\ R\0\`/e_O-@Pi pl2 R0V  .PP @kpj@L0S ,# PP Xc0Q=P8M/U h P,U<UU p5P` `. k 8P ,PP '2P)U@V Ѝ` V P 0p000000 # P [K !! 0P F@ B!  0 P 0 0@e_-83[,f_G- pPW` W 00@ >P 0S0,S  0 G0P @-?o<2 ^0S0\ S@/e_@-@P+ 0R'P`k0 @P 0 0 B! 00C0000nl Ѝ@襰 Ѝe_0P/?o( 2\0S/0\ S/e_0P @-?o42 ^0S0 S@/e_P/ 0R/,f_0P @-?o42 ^0S0 S@/,f_PG-@6 @`TPp P*  0 S @A? ߯ S 000 01 0 01 $0 0P@ @0SA-pP`y@P (Q@~0P@ A /f_p@-P((4@P 0P0 0pf_P 0RR @-Jo//0Sb G- 0PSGt, h@PR  pPWW(G0 0"!00 Pa#+<`P%c?P6 0!P0 `0P* P0P$ pGP唀W%10``P R0P&RP0P Wa<`=0P =P/f_f_@-@0P ~(5O-`P@豟衟pQ( A R<QV\ Z"  P V @$ V/ V U T *`=Q0S V' V5 U  X @`U  X @`U T*  `@p<S S CR=SQ"0T 0<S@(0Y@SS 0CSR30f_A-p`PV@PS}PP  P `PQp@-@@ P`=}@P0p  0P@ PTJ}PQPp@-@PP@PP @p@-@P D0R@00S G @P000f_P/ 0R /f_P/ 0R/f_\ ?o@-H 2^0S0 RQR n 0 /f_p@-@P D0R@ P@ |PP@p R f_0P @-?o42 ^0S0 S@/f_P/@-@@T ?o 2^0Szof_A-0S6 (P@U2`P& 0$!P( $0S%  N$ 00 Rpk|PP 00  0{P || 0pPЍ 0X PP Xc|P@PP U X|@g_"g_/P/?o4 2\0S0SP//0@ 08pg_p@-@P L0R@P`Ѫ0S@#*@$pg_p@-@Pᾪn@pp@-@P㱪000p@p@-@Pᤪ@@@pp@-@P @0R@ P`㐪0S 0@Apg_A-@P `0 R@pPx0@0S@Ȫ 0 0a000~ @g_p@-@P <0R@ P`N@ᥪpg_A-`PV p@PW U 00P 0Sx0,S00 AA-@P 0RPp0 0a Ai 0!1 0S0C0000ZA g_0P @-?o42 ^0S0 S@ /g_ 0Sp@-P`@P (0S p@:p/g_@-0!!00!1Q100 000000 0#0, 0#000!R0Q000! 00000p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0}!000p@t000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG- P`pX@0Q0000R0000@ @SA@@ @H :/P  1P@0R000000@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/@-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!00000\00!0000000T   0Sp  T`"P P- 3 T!, ,  1000 T R`T  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SG-8`P0@ pD TWpp-T@pP +T@P00T 00XS0 A B0C QR@P(V&0T ``f[ 00D \a0DSW0DA0DS70DV P   S  R 0 @`  X`EXRg_  0S S/P/$(0#   @// / ////-M tЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / Qs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/3  0RR! R/P/0@ 0A0S)*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R* R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/00//1A-M Tp @00S 3/P0`7P V 6/0p `Pލ0 03/V@ 6/T T T 00P00S 3/`0@ P T 4/003/003/P T 4/P0/A-PJM U0`0p 0`` 0R,0 @0 4/@P T p0  P$ 0 0 0PU00@0@  PJߍ0 000 003/ 0/0/@-@J@*lp@-P0@Q (lPp0< 0 Ppp@-P@AQpPp@-0@APS`0q< Q< <Q< >Q@ &Q@ 8 TT0DS0f@\P /T \T "T T0 q, P  Ѝr@t@b@n@@T(Pg_h_ h_h_h_p@-@P 0Sp wPpPQ@-@@ kPp@-0`SQ p@tp<@PWPpfP U>H DP VPp@-0PSQ p@Ip<@-Pp/%P 7P >p@-0PS`Q@p$@P QQ p@P<P@ P /P >A-`PPQPP0p 0SPUj@P  jPj<WP0 Pp 0 03/P P 0S PP|PjPjX 6P P(VP Ph_h_h_p@-@P` CPpp@-@P CPpp@-@P`E CPp@-,h_011/A-@pP`P ZjPp` P102 P @-@\& P QRS  T00MjLQ R S "  T  00 A-% M222bM+ (_a2: J'x4[. BI'&Xo@9d}mjr"qkM@}?c /L뗐scxy(8孩.que(X-:l_(nd 4<< 3Q% 30S#* :3#Q% 53#Q% 5Q *c| 1#Ft{ͅN߇qg뗫np{p0  08S  *@'Ĭ5$U( 2R j@00@0a..U p2p&RBI<S@(g\itgiE"뵬},0X"  000M[@P4;0Ls~sspm녻NeAq^P'^ 1܁.s1@T(ps@+U  1Q @ |1Pdv` P. +`)0 000rs/r!( A0( ?A3c01|pW8s@Uc 04[cq0AD 0 =`P!Xr0x0*@sv|HD N'x ^NԽO"^Tˁ- Mb@TH^K^aO,^iWxmd%d: internal %s image area dkmatch_bootdisk: can't get label for dev %s (%d) mainbusno mainbus foundsdwdldWARNING: double match for boot device (%s, %s) boot device: %s iicziicnonei2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!@ 0A @ 0H @ P `@ p @ p@ @ initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partition: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller couldn't map registers scoop%s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoopzssp_init%s: not configured. can't map bus space couldn't establish power handler zssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846%s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferdefaultSharp Zaurus LCDcouldn't establish power handler w100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) console =@4=@@=@X=@p=@=@=@=@lcdctlioexp_set_backlight%s: this kernel is not support SL-C1000 couldn't register event handler ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_ couldn't establish power handler zkbd$[[ m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] F !#%'), <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    : pseudo power management module zapmunable to establish nSD_DETECT interrupt unable to attach MMC controller couldn't establish power handler %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference  %cconsLwGa@j[0]@0^@_@_@T`@MR,a@Sa@LR base 0x%x-0x%x irq %d drq 0x%08x core %d mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus**************J***************f***_***U***Z*gmv******C~Y$&/4~mxo>sI^ 3!!!!!!!6>0x%08xr%d, rrxlsllsrasrror, %s r%d, %s #%dsplrpc [[[T[[T[[T[@ƺ[ʺ[Pͺ[ʺ[`Ѻ[T[_Mպ[ٺ[P ߺ[[[[@ [[P [[[[ [[[[ [[[[[[[![$[![([![-[![pP1[6[;[?[pC[G[pPL[6[Q[[Q[[p U[Z[p 0^[Z[p `c[Z[p pi[Z[P o[Z[P s[Z[P @w[Z[P P|[Z[- [[[[ [[[[[[[[ [[ [[[[[[[[0 [[00[[00[[00ƻ[[ͻ[[һ[[׻[[ܻ[[[[[[ [T[ [T[ [T[ [T[ [T[ [[ [[ [[ [[ [[/[ [o"[&[0/[ [p )[.[0[5[@8[5[=[A[@E[A[J[P[S[P[Z[P[a[P[h[n[r[n[y[n[[n[ [[ [[ @[[ `[[ [[ [[ [[ [[ [[ 0[[ P[[ p[[ [[ ļ[ȼ[ ̼[[ м[ȼ[Լ[ؼ[ ݼ[[[[[[[[[[[ [[ [ [ [0[ [@[ [P[ [`#[ [p'[ [+[ [/[ [3[ [7[ [;[ [?[ [E[I[N[I[ R[I[0V[I[@Z[I[P^[I[`b[I[pf[I[j[I[n[I[r[I[v[I[z[I[~[I[[I[ [[ [[[[[[ [[0[[@[[P[[[[[[Ž[[ʽ[[Ͻ[Խ[ٽ[Խ[ ޽[Խ[0[Խ[[Խ[[Խ[ [Խ[0[Խ[[[[[[[[[[ [&[ [+[ []-thumb insn eqnecsccmiplvsvchilsgeltgtlenvund%s %08x %s%s%s aif, #%dT[T[[[T[T[[[T[T[[[T[T[[[, #%d#%d ; #0x%x%c%dp[r%d][r%d%s, #0x%03x#%s0x%02x%sr%d!{r%d-r%d}^f%d0.01.02.03.04.05.00.510.0#%s.%c%ddaiadbibedeafdfafafdeaed, #0x%04x0x%04xspsrcpsridie_cxsblsdeppmzp%df%d, c%d, %d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown] Dk@Lk@AToshstoshnshstnshishstishstsycpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxtmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxundstrtdaWldrtstrbtldrbtstrldrstrbldrbpushpopstmYnWlldmXnWlblimbimbrangeswistrhtdeldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsdpmsrpFmpF2bxmclzdmbkptkmovwdZmovtswpdmoswpbldrexdaldrexdldrexbldrexhstrexdmastrexdstrexbstrexhandSdn2eorsubrsbaddadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnmulSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsdrfswfcrfccmfPRghcnfcmfecnfevandNuqwvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddINuqwvtstvsub  "No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxmachdepdebugbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() -1single-skdb-k-dask-auserconf-chalt-b-2-3-4quiet-qverbose-v-xsilent-zw!N_bus_dma_busaddr_to_paddr%s: curaddr %#lx not in range_bus_dmamap_sync%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botchD[R[R[][k[y[[[[[[[R[[[[L%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x VA:[D[2PVAN[D[2VAZ[D[2AVAU[D[3VA\[D[3 VAc[D[3pAj[D[3qAq[D[3qAx[D[3qA[D[3qA[D[3A[D[4D [|[4D [ [4i [[4`Rf[D[4 i [X[4qA[D[4TrA[D[4TtA[D[4TtA[D[4TA[D[4T A[D[4TA[D[4TPT[D[4T`A [5TE`A %[D[5TE`A %[D[5TE%V /[D[5TEWV >[D[5TE iP[[5TE $iW[P[5TE0$ie[P[5TE ,iW[P[5TE0,ie[P[5TE .is[[5TE0.i[[5TEAi[<[5TE!i[[5TE !i[[5TE)i[[5TE )i[[5TE-i[[5TE -i[[5TEAi[[5TEAi[[5TEAi[[5TEA [D[5TE A [D[5TE`A [D[5TEJ`A [[5TEJ`A[[6J`A[[6J`A#[[6ZK A2[D[6KPA?[[7ApAL[[7AAY[[7A/Af[[7A?As[[7AA[[7A/A[[7A?A[[7AOA[[7AA[[7A/A[[7A?A[[7AOA[[7AA[[7A@A[[8A0A [[8ApA[[8ApA)[[8AA7[[8AXVE[D[`AE[D[XVE[D[?AE[D[@XVU[D[ AU[D[@X/VU[D[Processor failed probe - no CPU ID %s%s%s (%s V%s core)2[:[?[H[O[Z[_[h[m[v[{[[[[[[[[[[[[[[[[[[ [[[![+[2[=[E[unknown CPU (ID = 0x%x)%sHz: %s %s : %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled %s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DunknownARM2CPU_ARM2ARM2asCPU_ARM250ARM3CPU_ARM3ARM6CPU_ARM6ARM7CPU_ARM7ARM7TDMICPU_ARM7TDMIARM8CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM250ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15e[l[r[x[~[[[[[[[[[[[[step A-0step A-1step B-0step B-1step C-0 [[['[0[[[[[[[[[[[[rev 0|[l[r[ [~[[ [[[[[[[[[[step B-2 [[['[[0[[[[[[[[[[[ [l[r[x[~[[[[[[[[[[[[ [[r[x[~[[[[[[[[[[[[step D-0 [[[0[[[[[[[[[[[[[(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)[[r[[[ [6[G[[[[[[[[[step B-3step B-4step B-5 [l[r[x[['[[[[[[[[[[[step Bstep Cstep Dstep Erev 10step G|[[[x[~[[[[[ [[[[[[step Jstep Kstep Sstep T|[`[g[n[u[[[[[[[[[[[[*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15[[[[[[[[[[[[[[[[|[l[r[x[~[[[[[[[[[[[[userkernel@+[$@<[@N[$@a[@s[[@[[@[[@ [,[@=[][@r[[Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=%08x, Invalid, spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x data_abort_handler %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap badaddr_read%s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)  machdepkmpages@````` ```pmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table providedpmap_map_chunk%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx  dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable %d device bad device not ready area improper i/o error aborted from console error %d succeeded vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes) _CK.A\M%s: not supported ERROR TIMEOU DF%s: status=%s wd_flushcachewd_trim[[u[[[[[[L[c[u[[[[[[, %s: (error not notified%s%s) wddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %x %s: disklabel indicates BAD144 but BAD144 not supported on this drive%s: disklabel indicates BAD144 but BAD144 table not found%s: invalid BAD144 table%s: error %d reading BAD144 table(FAEA@LA[A_AZAXZA4S *wdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed DMA errordevice faultdevice timeouterrorrequeuechannel resetwd, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramswd_setcacheIDENTIFY failed 2[>[I[%s<%s> SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jd)WARNING: block size %u might not actually work @LAHA(FAEATDAHAt@A=A >ARAcouldn't establish power handler hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate wd_standby(FAEAl[A,[A[AMR?USPXZA4S *address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASdAoA(dAmAxcAwdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwaitrecalpiomodegeometrysetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq cAԫCCCdAcA cA}Aatabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitqataatastart%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout ata_thread_run%s: unknown type: %x %sunable to create kernel thread: error %d couldn't establish power handler %scnfunable to create config thread: error %d atabus_thread%s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d,32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported atapibus at %s not configured ata_hlatabusԃADALRLRAMR?USPLRatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxferxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't establish power handler , " "%s%s%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x)%sat %s function %d%scouldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set sdmmc_select_card: error %d couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed init failed sdmmcbad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short #(-27<FP d'CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: , %s %s: Manufacturer code 0x%x, product 0x%x %s: function %d: SpectecSDIO WLAN CardSDW-820writereadextended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz pauseerror waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't change bus clock can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d e @ can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostCardHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) [a$[P5[;[ ,B[@Pcan't get SD status: %d  SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenance can't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x d' #(-27<FPunknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s, %u.%03u MHz %u KHz blkno 0x%llu exceeds capacity %d error, retrying ld_sdmmcldLwGA|[[config_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270PXA250Kernel is configured for %s, but CPU is %s : Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxaintc pxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %dpxagpio: can't map registers pxauart %s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaost: DMA Controller Can't map registers! dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedStray DMAC interrupt for unallocated channel %d pxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacpxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicsss: %d slot%s can't attach failed to map MEMCTL pcmciaunable to map register pxa2x0_i2c_intr_sub%s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't map registers couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer sdmmccouldn't attach bus   CW[jM_a8]o8vB tBapmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM : %s reserved# \3 \C \APM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %s : Power Management spec V%d.%dget power status%sunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM defined0tBtBLRLR}BMRpuBSuBLRapmdev couldn't establish power handler pcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) , %s%s (manufacturer 0x%04x, product 0x%04x)%s function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! pcmciaJXjj[  "$CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x , %s%s: function %d: unspecifiedmulti-functionmemoryserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS 5\\5D\8\=\\=D\8\V\\V\\P\\\\\\\\t\h\P\\\ \\\\ \%s: using CIS quirks for , %sSVECFD605 PCMCIA EtherNet CardNDCEthernetAPCMCIA MBH1030201%  8  @!!@! ! #/ ''w0 g'' c0c <+\C+\L+\HTN+\Z+\zc+\p+\z+\+\ +\+\ <+\+\+\+\+\+\+\+\@+\+\@+\+\+\+\C+\,\,\",\l=,\C+\O,\Hc,\C+\L+\l,\q,\<+\,\,\@IeII,\,\I0I0E+\,\,\,\@&II  I,\,\+\,\@"I0,\,\,\-/,\,\,\-\,\+-\,\?-\,\S-\,\h-\,\~-\-\-\,\-\,\-\,\-\-\")-\.\uE o@o @o @<+\.\%.\(.\8.\<.\C+\L+\@& 3BI@@.\I.\ @(#0can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAEthernetAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETAdapterSVECFD605 PCMCIA EtherNet CardSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAETHERNETcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0NDCDYNALINKL10Cne_pcmcia.\.\TBcouldn't establish interrupt configure failed, error=%d %scouldn't establish power handler MEGAHERTZMODEM XJ2288com_pcmcia 1\-1\<1\>1\2'EH1\O1\V1\Y1\q1\1\1\1\1\1\1\1\1\1\O1\1\1\ configure failed, error=%d can't subregion I/O space memory mapped mode i/o mapped mode wdcattachunable to establish power handler Digital Mobile Media CD-ROMPCMCIA Portable CD-ROM Drive NinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEPCMCIACD-ROMIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmcia6\6\7\7\7\ 7\87\?7\VVwh[7\g7\[7\{7\7\7\7\7\7\7\7\7\7\7\P8soo P q q sMklt7\7\tt37\7\ hC8\/8\ h&wiinitcouldn't load firmware configure failed, error=%d %s:failed to attach controller couldn't establish power handler SMCSMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC Cardcorega K.K.Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11coregaWL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaFILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~42-# s%s: %d silo overflow%s, %d ibuf flood%s  !)com: unsupported I/O width %dBBBpBBpB %d (%d) wi_start%s write fid %x failed init failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout wi_rx_intr%s read fid %x failed wi_rssadapt_input%s: null nodewi_tx_intr%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundwi_tx_ex_intrtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%x wi_scan_result: unknown firmware type %u O]O]O]O]O]"P]KP]tP]P]P] P] tP] P] P] P] Q] Q] Q]0Q]0Q]0Q]UQ]UQ]!sQ]"sQ]LucentSymbolIntersil could not establish softint could not get mac address, attach failed 802.11 address %s %s: using %sUnknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: device timeout %s: NIC memory corrupt - invalid packet length %d device enable failed yyyyyne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete THIS is A memory TEST patternwhere did the card go? setup failed 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT ##$atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1 atapiatatimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdy%s:%d:%d: setting PIO8_EN %s:%d:%d: failed to set 8-bit PIO (%d) atacnf(CCChCCatardlC,C@ C,C@\C,C%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so/libexec/ld.elf_so%s-%s%scompat_utilLwGCU]invalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow?Z]Z]Z],&Y]?Z]Z]Z]n@ Y]?Z]Z]Z]JڧoY]?Z] Z]Z]aY]?Z] Z]Z]Q?}-~Y]?Z] Z]Z]@ZC˔iY]/Z]I;0hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6cryptoaesselected []x]] [](^] \]^] AES is bustedaes: self-test failed: %s AES self-tests failedaes: %s  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN%s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed    !"#$%&'()*+,-./%s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed 1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }%s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed   !"#$%&'()*+,-./%s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed cryptochachaselectedchacha: self-test failed: %s chacha: %s LwG Di]expand 32-byte kPortable C ChaChai] DD(DD D,%DD@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[xchacha_streamexpectedxchacha_stream_xorjUS_&)ûIt~._dyz,(4y:b,ia /A&chacha core 1"3DUfw̻wfUD3"-chacha core 2  J1AY'A;B'{BP}sՊtS.&hchacha@}]|]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q@}]p|]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽH}]|]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTH}]|]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@}]p|]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rieee80211_crypto_newkey%s: invalid cipher %u ԉ]݉]]]]%s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s ieee80211_crypto_setkey%s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! ieee80211_crypto_encap[%s] no default transmit key (%s) deftxkey %u ieee80211_hdrsize%s: control frameieee80211_crypto_decap%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckipieee80211_hdrsize%s: control frameccmp_setkey%s: Invalid key length %u, expecting %u ]vDvD|vD0uD4wDsD,wD[%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONE6]yDyDyDyDPyD yD8yDƄ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize%s: control frame0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-out of buffers with data_len %zu tkip_encap[%s] Discard frame due to countermeasures (%s) tkip_setkey%s: Invalid key length %u, expecting %u [%s] missing ExtIV for TKIP cipher tkip_decap[%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt Ԓ]D Djm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt ieee80211_hdrsize%s: control frame|]DD4DĐDȍDHDDWEP333,*,**F$(Kc & = ieee80211_hdrsize%s: control frame[%s:%s] discard %s frame, frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: %s[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed null nodetoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6D:too short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xdatamulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued WEPPRIVACY offmulticast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%xrereassocassocWPARSNshortlong, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d authdisallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s  JLPsgS5A\_b-/V13#%:]]]]]] kվmmMxxPUhv버***Nj*YV8CKPSw (4:@".4 maccompat_20link-layer statistics and controlslinkIEEE 802.11 WLAN statistics and controlsieee80211ieee80211_sysctl_treetop%s: sysctl_createv failed, rc = %d client/peer stationsnodesdebugieee80211_sysctl_setup%s: sysctl_createv failed (rc = %d) vap%uparentinact_runinact_probeinact_authinact_initdriver_capsbmiss_maxieee80211_sysctl_attach%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done %s[%s] %s replay detected [%s] michael MIC verification failed ieee80211_load_module%s: load the %s module by hand for now. operating mode %ubogus aid %u, max %u_ieee80211_free_node%s %p<%s> in %s table node_reclaim%s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u ieee80211_free_allnodes_locked%s: free all nodes in %s table ieee80211_node_table_cleanup%s %s table %s: %s[%u] still active , ieee80211_reset_scan%s: scan set:%s%u start chan %u ieee80211_next_scan1%s: chan %d->%d ????essibsswepno! %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s _ieee80211_find_nodeieee80211_setup_nodeactivepassiveieee80211_cancel_scan%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULLieee80211_get_rate%s: fixed rate %d (%d.%d Mb/s) not in rate setieee80211_tmp_node%s %p<%s> ieee80211_find_rxnode_withkey%s: add key map entry %p<%s> refcnt %d ieee80211_find_txnode[%s] no node, discard frame (%s) ieee80211_find_node_with_channel%s %p<%s> refcnt %d ieee80211_find_node_with_ssidieee80211_free_node%s: %p<%s> clear key map entryneighborieee80211_create_ibss%s: creating ibss stationshortlong, protectionieee80211_ibss_merge%s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s ieee80211_end_scan%s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %pieee80211_node_delucastkey%s: delete key map entry %p<%s> refcnt %d [%s] power save mode off, %u sta's in ps mode ieee80211_iterate_nodes%s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d ieee80211_node_leave_11g%s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble ieee80211_timeout_stations%s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivity%sstation timed out due to inactivity (refcnt %u)re, QoS[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated ieee80211_node_join_11g%s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s ieee80211_node_table_resetunable to setup initial BSS nodeieee80211_node_table_init%s %s table, inact %u scan$$hhu Penadis[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!ieee80211_encap[%s] no default transmit key (%s) deftxkey %u not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!ieee80211_compute_duration%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuPPPPPPPPPWPA IE too big, %u > %zuPieee80211_send_probereqieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u null nodeieee80211_send_mgmt[%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u ieee80211_mgmt_output[%s] encrypting frame (%s) [%s] send %s on channel %u ieee80211_beacon_alloc%s: cannot get buf; size %u no space for 802.11 header?ieee80211_beacon_update%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued >{4%$$ U]U]U]U]c]U]c]wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl"%c0x%02xieee80211_newstate%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%s(%s)TODS %sFRDS %sDSDS %s(%s->%s) data %s type#%d WEP [IV %.02x KID %u] %dM +%d   0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x        ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparams%s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon miss%s wlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtsctsackcf_endcf_end_ackassoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocauthdeauthreserved#13reserved#14reserved#15linkieee80211rssadaptdebugexpavgctlieee80211_rssadapt_sysctl_setup%s: sysctl_createv failed (rc = %d) %s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d -> %d %s: dst %s thresholds %d-byte, T[%d.%d] = %d d]external%hu.%hhu%s:%hhuigmpplinetigmpstats.7}>]J)JJJJUJJJJ ??lla_lookup: new lle malloc failed inmltplinetmulticastipsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinternetԚ$F.F-F/FԚCEEE]DEԚ${GEEL]wGԚl~FEE]FFFԚbFEE]ԚCdZEE]cZԚ)CdZEE]cZԚsCdZEE]cZԚCTEEE]EEبEԚCbFEE]gF.PPUPP*}PPPineticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutstatsbmcastechodynamic_rt_msg     ICMP: redirect failed to register timeout for route to %s, code %d }E#(Dicmp_errorinetipforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumstatsdad_countanonportalgoavailableselectedreserve(@AAA==A*28;OOOOOOOOOO  ;% ?????HC  .   ip_output%s: refusing to send from invalid address %s (pid %d) inetipmaxfragpacketsipfrenplrip_abortrip_acceptinetrawpcblistTbFLbFt_lastm == NULLtcp_output%s: no template%s: %d < %dsackholeplS tcp_inittcpcbpltcp_new_iss: unreachablesyn_cache_respond%s: impossible (1)%s: impossible (2)synpl @@@@@@@GdGG0G 1DW]e_ace!!rfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlavailableselectedwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localidentdo_loopback_cksumpcblistkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnenablemaxretriesmaxholesglobalmaxholesglobalholesstatslocal_by_rttdropiss_hashabcaggressivemsltloopbacklocalremoteremote_thresholdvtwentriestcpinettcp6inet6`9G@G5G1G G3G|4G\@G@G7GG G5G5G9G7G8G5G6G IGCGFGCG0CGrenoIGCG(EGDG0CGnewrenoKGJG(EGFGIGcubic""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwwwudp_abortudp_acceptinetudpchecksumsendspacerecvspacedo_loopback_cksumpcbliststatsm_pulldown malfunction|sG@rG rGuGPqGDvGsGdwGFN2:BJRZbjr/7Um%Ybx[<<(src=%s dst=%s tgt=%s)m_pulldown malfunctionicmp6_redirect_input%s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_reflect%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d _icmp6_input%s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) inet6icmp6statsrediracceptredirtimeoutnd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknd6_gctimernodeinfoerrppslimitmtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtudynamic_rt_msgicmp6_error%s: ENOBUFS in icmp6_error %d NYIPv6 address: "%s" is not on the network lla_lookup: new lle malloc failed in6_update_ifa1%s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s in6_get_llsol_addr%s: in6_setscope failed in6_join_mcastgroups%s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctlin6_if_link_up%s: %s marked tentative in6_if_link_down%s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 headerin6_ifattach%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled in6_ifattach_loopback%s: failed to configure the loopback address on %s (errno=%d) get_ifid%s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x in6_ifattach_linklocal%s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6)bHtGܟGG:CGIHIH]G[IIHIH]RIȧFIHIH]IHFF<8IIHIH]<ēG+FI,tGCfZIHIH]cZ)CfZIHIH]cZsCfZIHIH]cZgCHIH]HC<8IIH]6I?Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %d3!inet6ip6forwardingredirecthlimmaxfragpacketskeepfaithlog_intervalhdrnestlimitdad_countauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyanonportminanonportmaxlowportminlowportmaxauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsstatsuse_defaultzonemcast_pmtuanonportalgoavailableselectedreserveneighborgcthreshmaxdynroutesparam_rt_msgip6_initm_pulldown malfunctionip6_input%s: packet to an unready address %s->%s ip6_get_prevhdr%s: off < sizeof(struct ip6_hdr)ip6_nexthdr%s: m == NULL(@AAA==(A*/1inet6pim6statsregister_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p ?cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full m_pulldown malfunctioncW\E[OT  D6 0$*<Y2DP %WWWWWW3WWWW-)!WWWWWW`WW9Aassumption failed: hdr not splitip6_output%s: refusing to send from invalid address %s (pid %d) m_pulldown malfunctioninet6multicastmulticast_kludge ))))))))%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timernd6_init%s: workqueue_create failed (%d) nd6_options%s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt nd6_resolve%s: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest%s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 nd6_na_input%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %u, NA packet %zu) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_ns_output%s: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer%s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found nd6_na_outputnd6_ns_input%s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %u, NS packet %zu) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) nd6_dad_start%s: %s: starting DAD for %s RSRAnd6_rtr_cache%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: src %s is not link-local %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, %s packet %d) &.3;CKS[cksinet6raw6pcbliststatsFI 3I0I5I4I3I 3I0I3It3I2I1I2I2I 1I(1ICI1I(3Im_pulldown malfunction  sa6_recoverscope%s: assumption failure (non 0 ID): %s%%%d in6_setscope%s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s ]] ] ]] ] ]] ] ] ] ] ]%]interfacelinkunknownsiteorganizationglobalinet6udp6sendspacerecvspacedo_loopback_cksumpcbliststatsm_pulldown malfunctionudp6_output%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket RIQI MIPPIpOIPIOIQIQIQIMI(MIMIMI0MI8MI,gIMI$OI addr 0x%02x(unknown) ()%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlisti2c-indirect-probe-strategyinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-bytenoneunknown probe strategy '%s'; defaulting to '%s' WARNING: ignoring bad device address @ 0x%x : I2C bus i2cdevstcouldn't establish power handler i2c-child-devicesi2c-no-indirect-configi2c-enumerate-devicesaddrnamecompatibledevhandleWARNING: ignoring bad child device entry for address 0x%x iici2cexec,i2c_subrLwGDmI9]=]iIiILRLRgIMR?USPLRi2cexecLwG`vI]iic at %s bus %di2c_subrLwG|I]     mii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4x OUI 0x%06x model 0x%04xmiiaut!A  !@@@@mii_phy_setmedia: MASTER on wrong media, no media present HomePNA1%s%s10baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXauto couldn't establish power handler RRTRRRRRRVh]]]]]] :] e] ] ];].]]7]Z]}]]4]]]51]6V] z] ] ] <] ?] ,] -7] Z] ] ] =] :] ] )]"M]6q]$]] ]8]P']##   1 @IxIIIIIIIIIII: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX  22     * #hhu hhhBCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyA L]: Media interface : %s, rev. %d IpI8IDP83840 10/100 media interfacensphy) 28]W] v]]: Media interface : %s, rev. %d I0IhIDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyter) 2]: Media interface : %s, rev. %d LIIIQS6612 10/100 media interfaceqsphy) 2U]U]U2]U3 ]U1-]: Media interface : %s, rev. %d IxItIi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphy) 2]U5]: Media interface : %s, rev. %d $IItIi82553 10/100 media interfaceiophy: Media interface : 3Com internal media interface @II Iignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexexphyM V x]{ ]\III\IpII: Media interface : %s, rev. %d 100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphy) 2]]]^$^: Media interface : %s, rev. %d IIIICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphy) 2}^}^}(^: Media interface : %s, rev. %d IIIusing Seeq 84220 isolate/reset hack IItISeeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphy) 2v^v^v/^v M^v l^v ^n`^: Media interface : %s, rev. %d IxItIDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphy) 2X9^: Media interface : %s, rev. %d I ItIAm79C901 HomePNA 1.0 interfacepnaphy) 2: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d : Media interface xIItIukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroyxor8xor7xor6xor5xor4xor3xor2iscsi-crc32ccopyfill8zeroI|J(IpIJIIIIpILR%s: emergency X server detach screen %d-%d added (%s, %s emulation) wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted dmux kbdmux %d: console (%s, %s emulation), using %s wsswcouldn't establish power handler wsdisplay at %sloadedwsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDID =( dumbd^J JJxJTJJ !!!c        BBB257#A^bgejzuxwsemul_vt100_output_c0c1%s: ESC in kernel output ignored "JJ<JJ@JJ`JJX JJJ Jvt100^ &J$%JJd9J Jd!J!JW\))GhntLAu  "$&((((((((+=????????B`/[>24;20;0cP2$u%s%d\P0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!! ,$0("" ^^^^^^^^^^^^^^,^2^ ^^^^^^^^^^^^^^^^^^OIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_versionwsevent_copyout_events%s: unknown version %dwsevent_readP?J|????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????cwccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not locked&8&&+^ +^o-^-^                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~.^U/^ag/^)/^2/^#0^$0^ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠBoldfacecd9660nopl.0679 &..RRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991APXtJJTF0J$JPNJRR\JCEJSTJNMJ$JCLJ0PLJ0REDJ@RR\JCEJSTJSLJRR\JCEJSTJSPERJCEJSTJcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] TpXCD001%/C%/@%/Eroot_device7^X6^4^LwGDJ3^ cd9660_strategy: spectag VT_ISOFS, isofs vnode ..y4^|^LW$^mX@^$X\^$X^$Xx^$X^$Xt^$X^$X^$X^$X^$X^$X8^$Xp^$X^$X^$X^$X^$X^$X^$X4^$XP^$Xl^$X^$Xh^$X^$X^mX^$X^$X^(J^yX^J ^J<^$XX^$X^mXT^$X^TJ^J^LoX^oX^$X0^JL^oX^V y`6^|^LW$^mX@^X\^mX^mXx^mX^$Xt^mX^X^X^0X^ԊX^nX8^xXp^mX^mX^mX^mX^mX^mX^mX4^mXP^mXl^mX^X^4Xh^ X^pX^=X^VX^dX^(J^yX^J ^J<^؍XX^X^mXT^TX^TJ^J^LoX^oX0^JL^oX^Vy7^|^LW$^ mX@^ĺJ\^mXx^mX^mX^mX^(J^yX^J ^J<^JX^mXt^mX^mX^mX^nX^XmX^nX8^ pXT^mXp^dmX^mX^mX^mX^mX^mX^mX4^JP^LJl^xmX^TJ^J^LoX^oX^dJ^J0^JL^oXh^J^mX^V^=X^VX???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥmsdosnoplmsdosfhplKKloadvnode(): pcbmap returned %d TpXpKPVXxK4VXdeextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld updatefats%s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. .. msdosfs_rename: updating .. in root directory?x6K5K6K5K5K8K5K5K6K6Kmsdosfsmsdosfs_sync: rofs modRRaArrAaUmsdosroot_device>^LwG@K=^   msdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu .... .. {>^|^LW$^ mX@^"K\^eKx^mX^mX^fK^|\K^yX^`gK ^NK<^4SKX^UKt^mX^mX^mX^nX^XmX^pX^nX8^ pXT^4kKp^dmX^PYK^mX^;K^kK^YK^mX4^p]KP^mXl^xmX^p K^ K^LoX^oX^QK^hZK0^[KL^oXh^\K^[K^V^=X^VXAaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Zbind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d BDZ\^`bdfhju_acknfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwK@KKKnfskqpollnfskqdetnfs_sillyworker%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initKKK4VX13/nfs send error %d for %s nfsd send error %d nfstimertimer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s  @not respondingnfsrvdescplW^W^|W^hW^\W^JW^6W^W^W^V^V^V^V^vV^NV^,V^V^V^U^U^U^U^ ?BEF   build > MLENF''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  nfsumntnfsnfsstatsiothreadsbuild > MLENnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%u/nfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootP]^[^PZ^LwGDLLX^ build > MLENnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llx writerpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)XZ^|^LW$^mX@^$X\^$X^$Xx^$X^$Xt^$X^$X^$X^$X^$X^$X8^$Xp^$X^$X^$X^$X^$X^$X^$X4^$XP^$Xl^$X^$Xh^$X^$X^mX^$X^`L^YL^yX^42L ^@yL<^$ULX^pUL^mXT^'M^0K^K^LoX^YL^$X0^YLL^oX^mXĜ[^|^LW$^mX@^X\^mX^mXx^mX^$Xt^mX^X^X^0X^ԊX^nX8^xXp^mX^mX^mX^mX^mX^mX^mX4^mXP^mXl^mX^X^4Xh^ X^pX^=X^VX^,`L^YL^yX^42L ^@yL<^TLX^TL^mXT^TX^0K^K^LoX^YL0^YLL^oX^VȜX]^|^LW$^ mX@^LFL\^Lx^DL^1L^$'M^ZL^yX^42L ^@yL<^SLX^pxKt^mX^mX^mX^nX^XmX^HK^nX8^ pXT^'Mp^dmX^M^UL^M^M^?L^L4^VLP^SLl^xmX^0K^K^LoX^YL^1L^XL0^YLL^oXh^LbL^YL^mX^(K^VXffs_mapsearch%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%sffs_nodealloccg%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%spid %d, command %s, on %s: %s uid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s ffs_freefile_common%s: freeing free inodeffs_blkfree_common%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free ffs_blkalloctrimwqtrimwqcvffs_blkfreeffs_realloccg%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %sffs_blkfree_snapffs_freefile%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_freefile_snapffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataffs_truncate%s: unexpected snapshotitrunc: newspace   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblockte^te^te^td^        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffs_snapgone%s: unexpected snapshotffsdoclusterreaddoclusterwritedoreallocblkslog_changeoptMxONPVX|PN4VXffs_newvnode%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mountingffs_reload%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2ܛMpMM@fM4MTM|M %s: options QUOTA2 not enabled%s root_device%s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' ffs_sync%s: rofs mod, fs=%sdn^l^j^ufsLwGdM h^j^ffs_read%s: unexpected snapshotܜj^|^LW$^mX@^$X\^$X^$Xx^$X^$Xt^$X^$X^$X^$X^$X^$X8^$Xp^$X^$X^$X^$X^$X^$X^$X4^$XP^$Xl^$X^$Xh^$X^$X^mX^$X^MN^yX^5N^86N ^P8N<^LMNX^MN^mXT^M^(N^|M^LoX^oX^ N^܎M0^KNL^oXh^NN^V^@MH^dMd^M^lM^M^M^mX^mX,^mXl^|^LW$^mX@^X\^mX^mXx^mX^$Xt^mX^X^X^0X^ԊX^nX8^xXp^mX^mX^mX^mX^mX^mX^mX4^mXP^mXl^mX^X^4Xh^ X^pX^=X^VX^LN^yX^5N^86N ^P8N<^dLNX^LN^mXT^LM^(N^|M^LoX^oX0^KNL^oX^V^@MH^dMd^M^lM^M^M^mX^mX,^mX䜁ln^|^LW$^ mX@^8N\^3N^@Nx^(4N^4N^4N^yX^5N^86N ^P8N<^MX^$Mt^mX^mX^nX^mX^XmX^pX^nX8^ pXT^Mp^dmX^=N^`>N^/N^AN^LDN^QN4^ENP^8INl^xmX^(N^|M^LoX^oX^ N^IN0^KNL^oXh^NN^NN^V^=X^VX^@MH^dMd^M^lM^M^M^mX^mX,^mXmfsmfsidlfcfsmfs_rootq^ffsLwGtM,p^Pp^mfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closeq^|^LW$^ mX@^mX\^mXx^mX^PM^N^mX^mX^mX ^mX<^mXX^mXt^mX^mX^nX^mX^nX8^mXT^TXp^mX^mX^mX^mX^mX^mX^mX4^mXP^mXl^mX^M^N^LoX^oX^M^N0^xML^oXh^mX^mX^V^pXmfs_initminiroot() called more than oncemfsufs_inactive%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: dirty filesystem?%s: bad dir ino %ju at offset %d: %s not roundedNUL in namemissing NUL in nametoo smalltoo bignull entryi_size too smallufs_dircompact%s: too big%s: nospaceufs_dirgrow%s: newblk&N,&N&N'N$'N(NT'N'N-N-Nhard-linked directoryufsdirufsLwG1Nt^ ufs_whiteout: unknown op ...ufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qd invalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpagekN4xNmNXsNuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_putuao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_fault\Nubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_object udv_detachudv_attachNNNXNflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmemkmemkvauvm_km_suballoc%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainfltagain2loanzeroloanuopgNMprocuser_va0_disablevmmpepl8NdNvm_mapuvm_unmap_remove%s: kernel object %p %p uvm_voaddr_release: bad typevmmapbsyvmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressguard_sizethread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using package allocation scheme, %d package(s) per bucket UVM: using NUMA allocation scheme uvm_pagealloc_strat: bad strat %dhu^v^^$v^emergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! pooldrainfork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slabuvm_page_physload%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.uvm_physseg_unplug%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG  U]rr:r$swap_off%s: swapdev not in listswap_encryptswstrategy%s: vnode type 0x%xuvm_swap_init%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedminirootswapctl: miniroot copy faileddisksortswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiodswap_on%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d done MRMR|OOLRMR?USPLR|OLROLRLRLRuvnfp1uvnfp2OOOO\Ocopy-cred-on-forkbufq_disksortLwGйO^disksortbufq_fcfsLwGOH^fcfsNetBSD-CORE%s@%dELFNetBSDexec_elf32LwGO^#!exec_scriptLwGO^vmcmdkillsextendscallsinit/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path҃^^Ä^҄^ (default %s): haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d pgdaemonfork pagedaemonioflushfork syncer%s %s (%s)%s %s %s%stotal memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/init  maxvnodesmaxprocmaxfilesargmaxhostidvnodeprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetroot_devicefsyncipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timeconsdevmaxptysmaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrlwpforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetiddumppathownergroupmodeno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionversionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvmvfsnetdebughwmachdepuserddbprocvendoremulsecurityA,@A#7$wx@g`8@O@Accounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.systemorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptcv@@PDRDRx\Rdeadcv" """usersystempid %d (%s): %s write of %zu@%p at %lld failed: %d %s%d%.*s%lldcoredumpLwGDP^Too many CPUs. Increase MAXCPUS?cpu%dMRMRMRMRPPMR?USPLRfdcloseincrease kern.maxfiles or MAXFILESfilefiledescfile2dup2$RPLRLRLRLRMR?USPLRentropy: ready entropy: best effort <cpu0entropy softintentropy intrdropentropy intrtrunc<WARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) <WARNING: system needs entropy for security; see entropy(7) |xPdwPseedPentropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategatherneededpendingsamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)filt_timertouch%s: invalid type (%ld)$^LRLR P$PLPܬPP0P%s: %s is suspended by %s (delegator %s) pmfdebugeventsuspendsuspensoridletransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classdriverbusPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.self%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: giving up done Suspending devices:. %s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueueȢ^آ^Т^^^^^^^systemdrvctl**** RVY\@TTfailed to reserve PID 1 for init(8)procplorg.netbsd.kauth.processexpose_addressprocproc2proc_argswaitlwpwait@@ @@ %s (pid %d) changing logname from %.*s to %s reboot KKK]UKKkorg.netbsd.kauth.processcurprocpaxflagscorenamerlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememoryusememorylockedmaxprocdescriptorssbsizevmemoryusemaxlwpstopforkstopexecstopexitcoreschedcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x rw_vector_enterlocking against myselfrwlock`xRRDRRReader / writer lockcrashme_sysctl_forwarder%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old paniccrashme_mutex_recursion%s: locked once %s: locked twice %s: initialized crashme_kpreempt_spinout%s: disabled kpreemption crashme_spl_spinout%s: raising ipl to %d %s: raised ipl to %d, s=%d crashmeselfdebug_crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s crashme_remove%s: unable to remove %s from sysctl panicplain old panicnull_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabled!!sigactsksiginfoorg.netbsd.kauth.processAD 0  trapsignaleventswitchpid %d was killed: %s sorry, pid %d was killed: %s sigexit 1sigexit 2pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) sendsig: bad version %d proc_stoptraceRR<RWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s/%usoftint%s block/%usoftint_init_cpu: cannot allocate memorynetbioclksersoftint_picklwpparsediskhaltrebootuse one of: %s[a-%c] %s none halt reboot none%s%lludkswap dumps on %s%c genericmdmd0nfsroot device (default %s): dump device (default %sb)file system (default %s): ?use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured root  sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesleep@CRDRDRx\Rkpause@CRDRDRx\R %pWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU\sched$]R8]R\Rx\RA  ( *$/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLkernel %sassertion "%s" failed: file "%s", line %d sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version sysctl_lookup%s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content version %d type %d len %d: %d end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings %s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destruction/%d@%dpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone Rcallout@CRDRDRx\Rcalloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleepdevice-is-system-todrdisabled (not system TODR) todr_attach: TOD already configured WARNING: preposterous time in file system todr_gettime%s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! todr_settimeCannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcntsbsizew^^ ^^^%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%ssched4.4BSDnamertts acl_posix1e_mode_to_perm%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %d configure: attachment `%s' of `%s' driver %s failed: %dconfig_devdelete%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachrootlocationev: %s %s at %s in [%s] deviceparentcfgmiscbootstrapautoconfdetachallconfigintrconfigrootconfig_finalize_mountroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namedefaultlocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported swaiting for devices: %s done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sdevice-register^^"^%sconfig_detach: forced detach of %s failed (%d)detached root device %s not configured detaching %s, success.failed.unable to detach instance initinit rollbackfinifini rollback not configured unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected range NULLbufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbackcpu0%s/%unist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testkernuserurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? corepkg1st%s %s has %d %s siblings: %s GAVE UP %s first in package: %s ureadc: non-positive residureadc: non-positive iovcnt   device-get-propertydevice-enumerate-childrendevswbdevsw_attach%s: block majors exhausted cdevsw_attach%s: character majors exhausted readwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorgeometrytypedisk-infodkopendisk%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%c%s%devcnt,%d/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extentextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not found hashdone: invalid table typehashstat KMGTPE kMGTPE %qu%s%c%sB Bdisknamesiostatnamesiostatsiostat_free: iostat_count == 0kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS (^3^>^ I^(T^0_^8j^@u^P^`^p^^^^^^@^^^^^^^^ ^@^kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pSDSklogmsgbufsizemsgbufSSSLRSMRSS8SLRrunoncepcu_lwp_op%spercpu%s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) poolpr_phinpage_check%s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u pr_rmpage%s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocatorpool_init%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s pr_item_linkedlist_get%s: [%s] page emptypool_do_put%s: [%s] page header missingpr_item_bitmap_index%s: [%s] %u >= %upr_item_bitmap_put%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p pBjfqTqVX`bCd ݻ*,,,,,,,,,(null)0123456789abcdef0123456789ABCDEF%d[% 4jd.%.*ld] |/-\%s: table is full - %s %s: table is full %s: Skipping crash dump on recursive panic panic: %s autoconfiguration error: mismatching pserialize_read_exit()pserializeexclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificDhT@hTbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehashvmem_rehash_start%s: workqueue_create %d static_bt_inusestatic_bt_count%s/%u%sInvalid IPL: %dposix_aioaio_listio_maxaio_maxaioserviceaio_%d_%zuaio_jobs_poolaio_lio_poolHT TĮTT TT,TTaiodoneaiost_process_singleton%s: invalid operation code {%x}naio_process: invalid aiost state {%x} aioLwGT^"*FI8;TTTTTTT^TpTTTvPTDTT$TTefdreadefdwriteeventfd _X$&( $fqabortfutexTTlT\Tinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit WRsys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s nist_hash_drbg_instantiatenist_hash_drbg_reseednist_hash_drbg_generatememfd:h^UT4TTdvPT MHLENm_copy_internal%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]m_pulldown%s: m == NULLm_copypacket%s: no header (m = %p)link(^V VVVpVVVVVVVVVVVVVVVxVunix<ĦVp^ĦVp^=ĦVp^$V&V!VVhV(V(V@VV(Vpsemorg.netbsd.kauth.systemposixsemmaxsemcnth^VvPvPTvPdvPVPVlvPtvPsemksemLwGVl^9;=?)'RAAsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %luorg.netbsd.kauth.networksopendfreesoinit1 %d.V-V.V/V.V/V.V-VsocketnetioAsbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lusbcreatecontrol1%s: message too large %d mbsonameacceptmbcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdata%^,^3^^<^D^^M^unp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadsendspacerecvspaceinflightdeferredunpgcuipc_init %duipc_usrrequipc 4VؖVОVDVVdVHVVVܗVԐVܐVVВVV̐VVܓVbuf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadynamecachenamecache_statsLVLVncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table ..vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultgenericfstypesmagiclinkstimestamp_precision^L^8_org.netbsd.kauth.systemfailed to attach file system '%s' because it shares the same fstype (%ld) with %s #lf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../machine_archmachinezaurushostnameosreleaseemulkernel_identdomainnameostypeuid%uruidgidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags ^^^^%s: failed to start extattr: error = %d syncing disks... giving up done vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system ?root file system type: %s WARNING: No file system modules have been loaded. Supported file systems: %s no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... syncdelayfiledelaydirdelaymetadelayvflushbuf: not dirty, bp %pinvalid specnode type: %dILLEGALw^~^^^^^^UNKNOWN^^^^^^^^^)^1^9^C^M^T^]^f^p^z^^^^^^^^^^^^^^^^^ ^^^^^^^^^^^ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd) %02x %slrulisthd %p %s:  syncerACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADVT_NONVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFS@` !.AS]issymlink-targetH^L^P^T^Z^a^g^n^ufs%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %d%d syncwait/lWlW,lW ffsnfsmfsmsdoscd9660fdesckernfsafsfstchgfstcntfstlwpvnfullvnodevcachevnode cache hashvcache_reclaim%s: cannot reclaimdead but not cleanvrelel%s: bad ref countvcacheplvdrainvreleholdrelel%s: holdcnt vp %pvcache_make_anon%s: cannot lockvwakeup%s: neg numoutput, vp %p  *,.024vn^WhW WW|WW,WTWtvPWW|W8W0WWxattr-listsystem.user.security.trusted.xattr-namexattr-val`^l^H^X^4^@^  ^,^  ^^ ^^ ^^ ^^ ^^ ^^ ^^ ^^ l^x^T^d^<^L^(^4^^ ^^ ^^^^^^^ ^^^^^^ h^t^ H^ T^ 4^@^ ^(^ ^^ ^^ ^^ ^^!^^"^^#^^$t^^%`^l^&H^X^'4^@^(^,^)^^*^^+^^,^^-^^.^^/^^0h^x^1L^`^ 24^D^3^,^4^^5^^6^^|^^$^@^\^x^^^^^^ ^<^X^t^^^^^^^8^T^p^^^^^^^4^P^l^^^^^^^0^L^h^^^^^^^,^H^d^^^^^vop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedefaultt^dead fs operation useddead^tag VT_NON, dead vnode ^|^`,X^V$^ mX@^*X^+X^mX<^+XX^(+Xt^mX^mX^mX^0+X^8+X^P+X^P,X^x+X^d+XT^mXp^mX^@+X^mX^nX^4oX^X,X^+X0^+XL^oX^mX^$,X^ ,X  /X.XD.X7Xfifordfifowrtag VT_NON, fifo with %d readers and %d writers T^|^LW$^ mX@^,X\^mXx^mX^2X^5X^nX^yX^nX ^nX<^1XX^X1Xt^mX^mX^0X^@/X^-X^nX8^mXT^mXp^mX^mX^mX^mX^mX^mX^mX4^mXP^mXl^mX^,X^mX^LoX^oX^,X^mX0^6XL^oXh^-X^mX^mX^pX/usr/src/sys/miscfs/genfs/genfs_io.cgenputgenfs_suspendctl%s: bogus command %d,genfs: bad opmXllXmXlXmXkXgenfs_can_access_acl_posix1e%s: ACL_OTHER missing @ @@ @ @layerfsLwGyX_layer_bypass%s: %s tag VT_LAYERFS, vp=%p, lowervp=%p   spec_fdiscard: not a device dev %llu, %llu spec_write typespec_read typeinvalid specfs vnode type: %dspec_ioctlspec_close: spurious pgrp refspec_close: not specialorg.netbsd.kauth.devicespecio @_|^LW$^ mX@^X\^mXx^mX^$X^dX^nX^nX^nX ^nX<^؍XX^Xt^mX^X^mX^X^0X^ԊX^nX8^xXT^TXp^mX^mX^mX^mX^mX^mX^mX4^mXP^mXl^mX^ԆX^X^LoX^oX^X^4X0^XL^oXh^ X^pX^V^=X^VXdevclsdeviocdevoutdevindevwaitdeviodevopnerror fictitiousdefault label%s: %s WARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) dk_subrLwGX_X,XdXX|XX p_size (%llu) fcfs%s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) dkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d wedge:NAME=%s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) dkswap%s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFSQ _ _a _ _%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfsEFI PART%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC (s*K>; _2IчH _|nQn- q+ _ZIчH _|nQn- q+ _SFU0eC _IчH _IчH _-чH _-чH _SFH0eC _S'@ )Ѹ _*1@ )Ѹ" _1x )Ѹ' _3Dh&/ _=rGy=iG}4 _|nQn- q+; _%s: wedge named '%s' already exists, manual intervention required %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTmsdosswapffslfsraidframeccdcgdhfsvmkcorevmfsvmwresvntfsext2fszfsfictitiousmdidlefcfsXqQcouldn't establish power handler %s: cfattach_attach failed mdXX4XXXMR?USPLRXXXXLR0XLR2KaaaaaaaaSVXMRXXXMR?U\XPLR/dev/randomXXXXtXMR8XSXLRJ3/////91?%wwwwwwwwLXX@XLRLRLRLRMR?USPLRbpfT_LXY8YTvPXXYXtvPmaxbufsizestatspeers_bpf_mtap_softint_init%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterLwGYT_@_suŇ! Ȗ" % ˊ 6 C Α Q ՚ ] j w{ MO 7\bpf_filterLwGY_bpfops%.*s/%hhu#link#%hu]:%huif_%s: watchdog triggered org.netbsd.kauth.networkifnetifaiflnkstifwdogsdl%s%dinterfaces%s: could not attach sysctl nodes sndqlenmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. ifaddrpref_ioctlinvalid argument to %sinvalid ifnet multicast command: 0x%lxether_outputether-get-mac-addressmac-addresslocal-mac-addressThe multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooksd n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jc-7ezyund_set_timer%s: invalid timer type pfil_ļY_̼Y_Y_YpktqsyncpktqrenqifqlenmaxlendropsļYzerocurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_init%s: workqueue_create failed (%d) rt_updatertentplrttmrplorg.netbsd.kauth.networkrt_timerrt_timer_initrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d %s: %s: can't handle af%hhd (%s) mZV%[Ag%=C+ˮ{0w-0 jB;rt_deladdr%srtfree 2 :qqqroute_purgeifroute_abortroute_acceptroute_output%sroute_enqueue%s: queue full, dropped message rt_addrmsg0%s: unknown command %drtablestatsroute4$Z$Z ZZ| Zt ZZ%Z%Z Z Z ZZ Z Z Z8%Z Z Z8tYDZ!_ Z<inetarpnd_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintmaxqueuelenstatslog_movementslog_permanent_modifylog_wrong_ifacedebugarp_llinfo_output%s: source can't be determined: dst=%s arpannounce%s: %s not ready ???arp_dad_start%s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: %s: starting DAD for %s arp_dad_timer%s: called with duplicate address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: %s: ARP announcement complete for %s arp_rtrequest%s: arp_setgate failed %s: bad gateway value lookupcreatearpresolve%s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD duplicate address %s from %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp86ZLAZ4Zin4_cksum%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinputwqinput_create%s: workqueue_create failed (%d) wqinputwqinput_sysctl_setup%s: could not create a sysctl node for %s inputqdropsgpiobus at %s   "')  2;' +B#/49 is-rootmodelssuserTraditional NetBSD: Superusernameorg.netbsd.kauth.genericorg.netbsd.kauth.systemorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodeorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d LwGyZ(_ # # ## 'is-securelevel-abovemodelsbsd44securelevelTraditional NetBSD: Securelevelnameorg.netbsd.kauth.systemorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodeorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d LwG3_5_F3_5_M3_5_T3_5_Y3_5__3_5_d3_5_l3_5_s3_5_x3_5_3_5_3_5_Xd(ā L ܔ|ȑĥHУܗ<`4ܡX,pxauartcom_pcmciald_sdmmcwi_pcmciane_pcmciawdc_pcmciawsdisplay_emulcpu_mainbuspxapcic_scoopzmcipxaiic3_3_sdmmcbust7_M3_mii7_ata_hl7_2_ata7_2_3_3_pcmciabus7_>3__3__3_wsemuldisplaydev7_d3_wskbddev8_s3_apmdevif(8_3_i2cbus@8_T3_3_3_3_3_`-@- --,,,,`,@, ,,++++`+@+ ++****`*@* **))))`)@) ))((((`(@( (('X:_;_<<_:_;_:_:_$;_8:_X;_;_:_;_md9_t:_:_:_:_9_swwdog2_drive-17_9_9_addr2_9_9_channel7_:_9_gpiobus0:_function3_L:_9_atapil:_@8_consolekbdmux17_:_9_:_:_t7_phy7_:_9_ 3_controllersocket7_;_9_;_9_size0intrindex3_9_9_D;_I;_K;_9_P;_9__3_3_(8_basedackirqintrbasecore3_;_9_D;_I;_;_9_;_9_;_9_;_9_mux8_:_9_8<_:_; ΔHWIn(l QrYTᯨg?RPQrYTᯨg?RP; ΔHΕ#w.jRmQ3h8UQrYTᯨg?RP; ΔHΌQ3h8U 5,+Kыͳw'F3%s: %zu bytes @ %p %s   0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGxb_b_b_b_b_b_b_b_b_b_b_b_b_b_b_b_b_b_b_b_b_b_b_b_b_c_c_ c_c_c_c_'c_,c_4c_unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs  gnts[ [\[[[Dd_Kd_Kd_%s%s%sstring"propstng Md_%llu0x%llx%llid_[[rbmn[T[[[H[integerpropnmbr(d_strtoull%s: invalid base %dstrtoll%s: invalid base %de_\[e_|P[e_|P[e_lM[e_E[e_[e_|[?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelYUhbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanif\@$}[VLAN tagNONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersaveSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchanSIOCS80211CHANNEL%sSIOCS80211hidessidapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragIEEE80211_IOC_FRAGTHRESHOLDrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA@_v7fsffsmsdoslfscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfs#*/8?DHPTZstrdupmallocusage: %s [-G gid] [-M mask] [-m mask] [-o options] [-U uid] special node getmntoptsegG:jM:m:o:rU:stat %scd9660%s on %sbnorripbgensbextattbnojolietbnocasetransbrrcaseinsuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedupdategetargsextattgensmaplcasecasetransnrrrripjolietrrcaseins  %@-49BLPU\ unknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node getmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceffs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountednfs4aclsposix1eaclsasyncsyncupdatereloadatimedevmtimeforcesoftdeploggetargsextattrdiscard $ / 2 5 : C G L Q X  ^ e  m r ~   @     @    @  realpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath getmntoptsGsl9Uu:g:m:M:o:t:stat %smsdos%s on %sbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirroruid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdategetargsG Q \ _ b g p t y ~       @   @unknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.Conflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cstrdupgetmntoptsportrsizewsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iL:lo:PpqR:r:sTt:w:x:UuXnfs%s on %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacbnowccmsgaddr=%s, port=%s, addrlen=%d, getnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedforceupdategetargsbgconndumbtimerintracnfsv3rdirplusmntudpresportnqnfssofttcpudpnfsv2maxgrpswccmsg  $)5;B@JMR\ad j@sz @ @realpath '%s' failed"%s" is a relative path.using "%s" instead.Unsupported socket family %drecvrpc%s: reject, astat=%d, errno=%d rpc_getport%s: %srpc_call%s: error = %d sendrecv%s: short write! (%zd < %zu)no : or @ specnfscan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableffs4.2BSD%s partition type is not `%s'Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointO}'$ 8 X     !6!V!!!!")"userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatimerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead.%s: %susage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%susage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s &Y+#*Y /YCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood @gSglggggh,hLhlhhhhi:iZiii%s: #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: %-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s UGHRBD M@dmCLS1@2plbunspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260718NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260718NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverUnsupported redirection Location `%s'Too many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%cْ421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) "&*.26 ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETA***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiBToken in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.2failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEY_ c pclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGS./1%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'r setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %sr%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-imsdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgzFTPSSLNOVERIFY1/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 11.99.8 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.8 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.8 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.8 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.8 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.8 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.8 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this? Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.8machinezaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy##,4#54Ԏ#AJX#[eW#v~V##ɖ#֖ߖU#4s#4r#4ژ###"#,48#6?#C#M^h#jw#|w###—ʗ##ߖ# 4ό#4΍#ܙ#)ۚ#:4ڛ#ES܏#eߖٜ#q4#}4#%sFTPSSLNOVERIFY/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7FTPSSLNOVERIFY# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed/dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula!%s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalida%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:863: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF ¨̨ /sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS$+5?HO^ekrzŭ˭ϭ׭ۭ unknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%   "#$%    "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmd%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICkern-C700modulesbaseetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugxdebug  %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s ]=1Lcs%zu%llu - %llu %s, %s/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSAHMWajq˺кպٺݺ!-=//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi C700/dev/r%saNetBSD11/bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/etc/resolv.confpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-30s %40s%-50s %-10s%a, %d %b %Y %X%Y%m%d%H%M%-30s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c%s%c/dev/r%s%cr%s%c%u%s (%u)fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sghx5!E!M#Y#A",i%Uu#E(1*Q9+SA%unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS#+08=BFOZ_dhlv|U %s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %s%s%sUser answered no to destroy other data, aborting. %s [%s %s]%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------   "#$%@//tmp/usr/var%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%d : %s%s: %u%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s-%s (%s) %s ()raid%d%uvnd%dcgd%d (%s-%d)VG '%s'%lli/%lli'%s'lvol%.2dvg%.2d%llu%s/%s !"%*s %s%llupartman%s/%s###Զ#rrwlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s -l %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s%draid/tmp/raid.%d.confwCould not open %s for writing cat <%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sgpt destroy %sout of memory-a PY`it~ ,gpt %s %s -b %llu %s%s_%lli@%lliNAME=%s/dev/%s/dev/r%sr%sStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1181: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullUnused Pri GPT tableSec GPT tableSec GPT headerGPT part - gpt resizedisk %sunusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs !)-37@HMUqݸY/eɹߪѩ,m=]GYͫKwindowsefibioslinux-dataappleraidvmcorevmresered $3*/H6 U!biosbootbootmebootoncebootfailednoblockiorequired%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBLSFH0eCSFU0eC Hah!IdontNeedEFI(s*K>;$(|nQn- q+3?|nQn- q+NX|nQn- q+en|nQn- q+|nQn- q+=rGy=iG};Mt?mWC 3KOOyD<#*=(YbBRuoqr3Dh&\ M}-/@@Mjy֬Qb-чHsw-чHZIчHIчHIчH2IчHL6 %?aS'@ )Ѹ*1@ )Ѹ491x )ѸEPST.qBHo6֯i`k/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/%u%s (%u)%s_%lli@%lli/dev/%s/dev/r%sr%s/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal error%d%d%d%dugeIQ?o-I7,A)E }NetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition 2AIVaqAv usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s| %5lld %-3s `dhlpt %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA ***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiB-%u %uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x ?%s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu %c\%03o. --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms pollrecvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: unknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)%s%s (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Host UnreachableDestination Port UnreachableDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededFrag reassembly time exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr8, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %d HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid maxwait time: %sBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -s%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address%.2x/-4-6./var/run/dhcpcd/%s%s%s%ssockcontrol_recvmsg%s: no terminator%s: no arg buffer%s: no args%s: dhcpcd_handleargscontrol_handle1%s: unexpected event 0x%04x%s: eloop_event_addcontrol_startcontrol_handle_read%s: getpeereidcontrol_handle_datacontrol_handle_write%s: writecontrol_handle_listendhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOPadi%s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %struefalse--version10.5.2--getconfigfile--getinterfaces--isprivileged--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:dhcpcd_handleargs%s: control_queuefALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.5.2 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid.main%s: asprintf/%s: chdir: /%s: eloop_init%s: signal %d%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_senddhcpcd_control_read%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.5.2 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: if_init_ossplitv, backoff_cutoff (%u) is less than initial_interval (%u); raising backoff_cutoff to matchnd_dhcp6_invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled out%s: set_default_allow%s: set_defaut_allow DHCPoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %sinvalid initial interval: %sinvalid backoff cutoff: %sinvalid backoff jitter: %soption %d requires an argumentoption requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:default_configread_config%s: realloc %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupreadgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosysloginitial_intervalbackoff_cutoffbackoff_jitterallowPb[cbdhelfsghjijklmnO opq rstu-vwxzyA BC D%E/F4G>HIHJRKYLbMjNpOyPQSTUVWXZ146I|~}"+;MY^ejqy~3 9   *08?EMRb~ kw{ { (Uz Uz ((null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt_new0addingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deletedz z (rt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_deleteAz Az (link#%d{ - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%sifxname=%sY^cjmsprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceifxnameprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncated%udhcpcd%s-%s10.5.2%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt lo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)+++++++if_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif( PT@P HEPT$ @CDHD/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkeley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initfromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %sn7y7777 %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %s77777407/ 7BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated lease%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAKIPv6-Only Preferred received (%u seconds)no address offered%s: message: %sreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %sipv4_deladdr%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifatcrer/etc/group: : :r/etc/master.passwd0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics ---     : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc  : (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B.= = = =! =9 =Q =i = > > > > alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646tolowertoupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~(>DT,>BJ4>FJ<>B>H>N>T>Z>`>f>l> r>@x>~>ASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincs_path@KXK bc_base_maxK bc_dim_maxK bc_scale_maxK bc_string_maxK coll_weights_maxK expr_nest_max K line_maxK  re_dup_maxK  posix2_version K  posix2_c_bindK  posix2_c_devK  posix2_char_termK posix2_fort_devK posix2_fort_runK posix2_localedefK posix2_sw_devK posix2_upeK stream_maxK tzname_maxK atexit_maxKUnknown error numberUnknown signal number%m (%s)"T (T .Th4T :T@TTFTLTRT@XT^TdT,[:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%ld ,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!  HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n31RLHD@;75+)++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cb'''''''''''''''''''''''''''hn''bk'''''Y'Y'''etq,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K-}Sjr_LvcI 36 TA@.f-}Sjr_LvcI 36 TA@.f acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C059N13xfr?tZunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`K #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @ inflate 1.3.2 Copyright 1995-2026 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.2 Copyright 1995-2026 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.2need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger0963array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist