08j<  jH :yt ytj@@<@T 08j<  jH :yt ytj@@<@TU jyt00`Ajjj$h jjjAjjjA.jjjAjjjAjjjAjjjAjjjAjjjAjjjmD"jjj (08@HPX`hpx$jjjO$Qjjj (08L$vjjj@HPX`hpxM$sjjjFAjjjCjjjAjjj(Ajjj.!jjj ajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjj ajjj ajjj ajjj ajjj ajjjajjjajjjajjj ajjj ajjj ajjj ajjj ajjjajjj ajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjj!jjj4!jjj!jjj!jjj !jjj !jjj !jjj !jjj !jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj B!jjj B!jjj!jjj"!jjj"!jjj"ajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjj ajjj ajjj ajjj ajjj ajjjajjjajjjajjj ajjj ajjj ajjj ajjj ajjjajjj ajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj !jjj !jjj !jjj !jjj !jjj!jjj!jjj!jjj !jjj !jjj !jjj !jjj !jjj!jjj !jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj !jjj !jjj !jjj !jjj !jjj!jjj!jjj!jjj !jjj !jjj !jjj !jjj !jjj!jjj !jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj !jjj!jjj !jjj!jjj!jjj!jjj?\!jjj>\!jjj=\!jjj<\!jjj;\!jjj:\!jjj9\!jjj8\!jjj?\!jjj>\!jjj=\!jjj<\!jjj;\!jjj:\!jjj9\!jjj8\!jjj:\!jjj7\!jjj6\!jjj5\!jjj4\!jjj3\!jjj2\!jjj1\!jjj0\!jjj7\!jjj6\!jjj5\!jjj4\!jjj3\!jjj2\!jjj1\!jjj0\!jjj2\!jjj/\!jjj.\!jjj-\!jjj,\!jjj+\!jjj*\!jjj)\!jjj(\!jjj/\!jjj.\!jjj-\!jjj,\!jjj+\!jjj*\!jjj)\!jjj(\!jjj*\!jjj'\!jjj&\!jjj%\!jjj$\!jjj#\!jjj"\!jjj!\!jjj \!jjj'\!jjj&\!jjj%\!jjj$\!jjj#\!jjj"\!jjj!\!jjj \!jjj"\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj \!jjj \!jjj \!jjj \!jjj \!jjj\!jjj\!jjj\!jjj \!jjj \!jjj \!jjj \!jjj \!jjj\!jjj \!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj\!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj !jjj !jjj !jjj !jjj !jjj!jjj!jjj!jjj !jjj !jjj !jjj !jjj !jjj!jjj !jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj !jjj!jjj !jjj!jjj!jjj$!jjj4!jjj!jjj!jjj !jjj !jjj !jjj !jjj !jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjj!jjjajjjajjj!jjj!jjj!jjjajjj ajjjajjj ajjjajjjajjjajjj?\ajjj>\ajjj=\ajjj<\ajjj;\ajjj:\ajjj9\ajjj8\ajjj?\ajjj>\ajjj=\ajjj<\ajjj;\ajjj:\ajjj9\ajjj8\ajjj:\ajjj7\ajjj6\ajjj5\ajjj4\ajjj3\ajjj2\ajjj1\ajjj0\ajjj7\ajjj6\ajjj5\ajjj4\ajjj3\ajjj2\ajjj1\ajjj0\ajjj2\ajjj/\ajjj.\ajjj-\ajjj,\ajjj+\ajjj*\ajjj)\ajjj(\ajjj/\ajjj.\ajjj-\ajjj,\ajjj+\ajjj*\ajjj)\ajjj(\ajjj*\ajjj'\ajjj&\ajjj%\ajjj$\ajjj#\ajjj"\ajjj!\ajjj \ajjj'\ajjj&\ajjj%\ajjj$\ajjj#\ajjj"\ajjj!\ajjj \ajjj"\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj \ajjj \ajjj \ajjj \ajjj \ajjj\ajjj\ajjj\ajjj \ajjj \ajjj \ajjj \ajjj \ajjj\ajjj \ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ajjj\ !jjji!jjj!jjj!jjj ajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjj ajjj ajjj ajjj ajjj ajjjajjjajjjajjj ajjj ajjj ajjj ajjj ajjjajjj ajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjjajjj!jjj!jjjajjjajjj!jjj!jjj!jjj B!jjj B!jjj!jjjajjjajjjajjjajjjajjjajjjajjjajjj!jjj!jjjajjj ajjjajjj ajjjajjjajjjjjjbpf!jjj $mjjj$jjj$>jjj<$jjj$sjjj$jjjAjjjm jjj$jjj $"jjj Ajjj)Ajjj*Ajjj+Ajjj,Ajjj-Ajjj/Ajjj0Ajjj1Ajjj2Ajjj3< H/U^j |GiUH ԡ%a)_x}UmT!r>&>Ly[2KaFS &h")dimj"X0H)hI~{݀@ڭqwF6TK &sp!Zz;h+}6݀wQsyJN1P%!k35?bE GE>*OyrW@$e#g^y ]bq~ |_]$ |jiBI%QtD{cG;y_3 wcWDyt . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4"4 (!! "J&J&< HH "J&J&NetBSD|LwGPaXNetBSDearmv54p@-D0D 0@`Qp(@P`F`F&a03/T@p0h%I%A-`0`` 0PpU(pGpG@Pq`P03/T@0US g%XH-x`Q MN h!h1 @`p0 0R0D1<  0S  /S 0S1Y tY9 T 'P#0PUH2H0@3(1*03/T@  0地0 [* PC PE%Q03/Zd 0 P0 0Z}\g% 0xH%$dG%&lp @-l ^P`@P H&UOy`POU P  G@' P P@-@⳯O-`HH2@DRtMH00$H0pWr zP@tH$H( R @P p0: S ?`0SЍl@P0`0x= 0S(0S P0S S0p WP  0S;00 0 6pP 0s 8#8T DT@H)L   PpW'G"|'f"O"p"'i"H0`  BR` pR R X X/'0'@-~0 ~}"' 000/'G-؀P x0M@ K- \00`p C- 00Z/P0 QЍ'Y@k&1&'@-@ M00@   P  ЍX&A-` l1V0zP 0 @P@TV PC  W@@7R~0S@ @0;0P W 0Xp:~V p1~0-S XdHp 4@0SV  W k&o&e&'y&O-5MpY xp z`P` Ѝ  +p` 0r`$5XP0S 5%0 0 5X0S40S* D$尠D00CS0 6@ Pp  @YT  `0 @00CS0X50 X0 Op$008p p@300 80: Sx h+p@ p Qt  X0 0, 03($0000x 00 Q00S> 0 0 `ocp2  p 0Z 1(#00 H S 0P \\P 4 `+X"J 0R 0n0ZZ3r0S &P \Y' p00 R0S ``~0S  0 <(d P <`V k`0 ?oR20S 0  0 0R0P H`P hh@`0S H,` P0Rt00!;P 'k&&''''''&'&'''&/'''0@-MM@P  p  ;0U$C dP TTۍЍ08 P ,(0P X&k&&&'Q@-@ TP DD,P $ 0P@k&&&'Q@-@ XP HH0"!P $ 0P@k&&&'@-|0 &'0$/0(0$/0(@-Y&'@-T&'@-O&'@-J&'0w@-1   0K 0 Ѝ'0(@-1   0< 0 Ѝ'0(@-1   0- 0 Ѝ'0(@-1   0 0 Ѝ(0(@-0   0 0 Ѝ(0(@-0   000 Ѝ+(0(0(<00/@-0   00 Ѝ@0(6(0(<00/@-0   00 Ѝ@0(H(0( 0@- 00 $0P@I!ЍY(o&,0A-`M!A!qX0 p! R0B=0B  P>0H 8 R8B 4!010,!0ЍPP x%=lk0P   0S  0 pP"0P      0 3/R ! 7000<040LC%D00(0(@0(@#=**h1(d(((()8*0p@-|@PtP00 R 0p800 p0  B0Sqs 1(0(0(0 0 0 /0(0( @-$*@- @-$*@-@-80M@0(@3/P $ $H08 : S( 0h 3/P   00 0Ѝ00 0 1/qpxz0S 00*m8@@-@^PЍ@ <PЍp@-(`Vp80@  03/PP$8003/(Pp*@-@P`P U80 (0(3/@7z P H1zPЍp/(O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A` 000+ xpt| q^  ЍO0 P % pHp 81/qp4 %$ ?P p 4 $y0S4 tp0 0 0 0 "1^0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0j004 8pX  FЍ/(a+*0( +*+B+R/ R 0 0 /\\CC  B0R0012/P/  AA  AA  A A  A A  AA  AA  AA P AAC-lBM0 0  P0 0  0 ? Ÿ$  ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!!!! d 4 !P`4r4 " BXX P!d4{4r4 " B   !d4h4lr4 # B  d4U4Yr4 /0 r8p<@0! ]` d @484pPG0`F [stlV000fPXFqh4 0,J00C0Cf 00CS010:PU 0P1` 00CS0X)0 P U Rt0V00!Pq#  00C0S"10 U00CS000 U0P 0@ p | V 0 00 0 @00S 0S YI5(2(`3(2'32(2(3O-$RM` 0000100010S u@0Աq`0#0P 00)<0J?oT20ST SRP 庍0S  RZ  @T  Z     0010S@@  0 1P000CS000 Ѝ S 0P  BR l  @0S Z0 0$2(2(2(5(2(`3('&32(83A-0P!S`'P@ p- 0LpP0!S #P o 0HHH'<00S ,$0@J3L3'T3k35(32(A-P@dp`T0S Po$ t ?5(2'3O-`@ ؀P0S p0 T T R R u0p[P Ѝ PP P   P Pp@5(2(2(2(A-p0`!SPzP@^o 0a @" PP0!S sP ?oa 0HHH*'<00S ,UpGP3L3'335(3O-@P b 00CS0S'p0@g o/  0`001 pTpP@0 pW2tQtTP0PP00Pn8 , 00CS010 6 u0P0CS0000 S0 0 @ X 000 0 T0 `0U0$0T p 0 '5(h4(3'3X3(`3(232(2(5(O-PpP0 SPEUP ЍE P 0C0 X2 Ub000Pcn g 00C0S 20  0 0CS0L200 l0"SR 0.Y@0 @R /Io@P0 R00R  h@PR 00;Y0 00 V@ T0S2('4X3( 540@-@00 00UP0 000 ,R;R 0S  S   0;SPp2( p@-P@0QS@@R0p`V P0C2(p@-Pc@P k, (l$ p 0045'85Q 0Q\S@-A /`@-0S*  0@000S! P|TpP 8ePP %@P 0 S@/R/     0  2(F5O5H5( Q 0@30/@-2(00@- R 0C30N2(A-ppQ1SPS a00S S P4!`0`00`0S0P S@P0.S0 S 0@00`P 00CS0#0 m W  aT0100CS00 :pP2('G-AP 0pRpGWR0`0`030` 001S 0100CS0H89 P00CS0' 0S   P 0Sp`0 0`0R00 00C0p00  $`p2(G-p0A0 SRXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*P`2(G-A 0`0P0d P 00CS0-0 o& 0FSbp _1S 0PEP0Cp00100CS02(O-LB`0pS52P UC!0SR0XPPP00PF 0Q0CS00MO hPP\00`F`0rP0   P*  0!0CS0P(P*SP; 0堑0 S- S   Pqi 'u00CS00  0堑0CS00  Nh0PyP2(T545'85A-ApaV&ʐ0l00NPP.iP 200CS00  0a0CSQ0 QF Ee0S 0`0F0 0\S0pS0 p2(45'850G-D0!10ZPpЍ0S0  $SPPPPPhX TP00CS00 ! `0Q0CS00! P1ȃԓ 0 S)"Rʠc0U```00P 0b0CS00 g 1Q !@o!S/ %S !`V U 00 0P 0帡0CS000!000\Q00`PR# !RU``0``00QPd 0a0CS00km0` 1 1S 0S"21a0S S`l   $P7 0a0CS00>@10`! S:`Fp00  1S paa0S `10 BRpE` S`l   P 0a0CS00   2(V545'85n554(( Q 0@30/@-I2(`01S @-0@!S @bP /WP /2(5V57@-A0 R!RUUʐ0\00P@lg |"xp00CS00+ 0 @ R,\ R P Ѝ00!S KP s0 Sڰ 0R0CS0000 0 Q  vP   2('45'8555?A-O 0 P0,p W !GY\ϟYPPP0  nQ pQ lQ 0 S @ PP1S P PPP0 nR pR lR 00 S1S P P0PP[PP0 nR pR lR 00 S1S gP0 S00P0PP1S 2S 0Sڤ 000@ `PP 0 nR* pR# lR$ 00 S}1Pq PPPೀ0S!S 4 WQ0S 1Sm `P0PPPbL 010,0,0Z0S000@ PN 0!SPH :P00 nR pR lR 00 S*0S $ Q q0PP1S PP"G@oG`GooPbVWP 1019P P00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  dP0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PPPP0 nR pR lR 00 Sx1Sn P k{P0PP PP` 0 nR pR lR 00 STY]P0PP PR0nQ pQ lQ 00 S 5 PP? = 0  P1p PP,0S `Vn0VkVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  d P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S 602P0 PP R l B R0" 0 S1S 2SqW P0000@ 0S0 0`PPz 0 nR- pR& lR' 00 S^1ST1S0!S ?O0S1S d PSS 0S0O 1MP0PPP` gRF  R 0 B Rd `8@p>c0"S:b(pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 (P00PP2P02 ZP P 30b200CS00U. !2R00 2#20# 02 0nS- pS" lS& @PP0 nR' pR lR! 00 S1S" P20 2 2020P0PP P pIPP0SR `V0V pվʈ0 nR pR lR 00 SX1SN^P0PP RPӮ nQ pQ lQ 0 S:8P0 PP'2(<45555p&p&665(45'426G6H>.t6[65(4(F56X3( 5o&666QP000P0P@u Z`P 00 00 P0 nR, pR% lR& 00 S1S0!S M0S1Sz aWWv 0 =P0S0P0PP1S 2SqXP R! l B R0"0 S07PP0010CSqb P b@p fb0"S4mPP00 nR pR lR 00 Sy|2 00S <PPPP0  nQ pQ lQ 0 S[0S @dPP0S0PPX0 nR pR lR 00 S<P m2SA P0PP P0 -@- 00 ЍЍ/'5(@-0^S0]S0]S S]S[S .0L0S>30  Q  ]Q RG-鐁`P@0 SS&tPD(!RGdadqU`0``0,0P,a( $S 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a c` L0 0@S G 0X3(5(`3(7'72(V7o72(p@-!0 P= P@01SE0p0 SS t`P@0P 00SP0P00 |P0 h0T 0 0Q㸾P0 a,0 ,(X3(75(75(5('7'7O-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00пP? 0A0CS0l10G 0P \QH 0 SP 010S mP/ 000S S)00 S [ U 000呿P p` &t00CS0L00 0`00Pp8 PX3(7(7`3(2(d4(h4('7'70A-P0 0p@ W 0 `@P 0 R00R00 1BQ&`@ @Pļ@p`0"S,"@gR000X3(7(7O-@SMpcȳ00 0GS TcsT`0``00 P_ ` \X00C0+0&SK BR D R: Y J@p RݾP_ r00C0S @Ѝh20   K  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WppB@ \ p 儾P b_D @<f00C0 AQ 0 T0 Tpppp  RPu p BR   @W0 `0CS0(00oq 0 b7(`3(2(7'7O-M 0@P0P0s <40S 0 0 000 (0 pP ߍ0P0`#2Cij 00 S pSN(0Y01 Y  $ P$^T PzL  B R+430 # W  BR 200S 0 0c ] 0 0(PP.00Y0 Y L $ 嗽P$  BR 200S 0 - a] P0 (0 P'0 p1pG Y;xxZ ]P@1;^]0 ,(?00C0SuX   R    >P> 00CS000^`W 004 00S |xP00S 0  \ 4 \X 2(7(`3(7'72(8 8O-pᬡA0M0CQ` 01 00C S00`NlЍ'  0P5 P!` 00000`P00CS000  E[  0S00CS0x00` P  P2(2(`3(2("87(2(O-RB0M00bsp 0shЍؑ؁0S 1 0000 P@  0#⩟ɐ Y Fp10S Q0p0000000CS0C01;  \" \   " L\ B  @      0C LN 2(p&2(+87(`3(l4(d4(2(A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT ᲼@ 07(2(p&2(G-@p0 PR` 0 P(S%0  d P 0 ,B(|7(;8'?8@-V\0 .-_8'O-eGM0PS@pM$Q403/P ַ0: SQ\00W +_G P8:D\?0P0: S 0SP0: S 0S 0S 0/S&P70p0oIWP- \ P 0#v PvO+G0P ]D#P]P b/NP/NP W0P+I [(H Z% U8.0. 0ZPT9.0. 0NP @DP ^ PT1RP o R00S$ 0SS 0: SOzPN 6  0ZG=00 04K ZG=00J0SP. Tq^MXG DX'00CS0 p Pp  pYW xX0 X p00CS00 0S P0SGݍЍ0c ?o25000 89(7(9"9G99;90'n9'{9'9\\IV0\\EVX X0p@-@P@@DDT ` U H H0Rp@\\/VppX 0Xp@-@P@@DDT ` U HH Qp@\\VppX X0p@-0P0@44T ` U 8 80Rp@\\UppX 0Xp@-0P0@44T ` U 88 Qp@\\UppX X0p@-PPP@TTT ` U X X0Rp@\\UppX 0Xp@-PPP@TTT ` U XX Qp@\\UppX0X @-ppt t0\@ ^0@\\UX 0X@-pptt \@ ^ @\\U5S %R R S R SSh @-^L^S R @0/0/0000P7(O-QMTh @ `u @ 0@0 @0L0@@ @@D@H@,@0@<@@@4@8@5 SS$\ 0 !00`V0S9 0 0刐0L0St 40D0800$0S00( ,00B?RS$pwp{S,0S d @?C000@$0D0p0H0D0^pbS0$pVpZS$0S00<00@0#0pFpJS,0S  @?CZ㸰张 0x#p0p4S 0\#p(p,S0 \ 0C0CQ0B003/040 0S WYT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " & P 4 04080080 0Sb Q> 0 !XX0$0Q: 0 t!dd0(0$R[(R 0R  P 4P0@R0S00P00P00PP+\0.S0S~ 0!0P$0 T0P(0 $  ( R P0᩸P000ЍP7(9:VUUU:9 ::G-@a!80S 3PP 6rpW G4<0SB|5@P {X@4wX@uX0S5!0CS0\^$ 儺  V00L0S \0.S0S :6@0S40S tVQ6#<0Y?o20S X (B040P7( 7:9:9,:2:G-`xhSLP0DL0 P0S$00D0H0P0pP㔔0${p[|4T H0 `F0P 0 \@P aj84X0 s0X00 00dt |  P PRPS W]( ?R004(0x |0R S S S3 L0S3 T0Sx3 0Sl3Pd#Q`30V L 00Ѝ10@GS0L00P0 00H00P0L0 0T0X0s0X0 00P0L0T0H0~0 00P0L0T0H00X0t0P00L00T00P0L0 00\00`0c0`00\0^0d0[PPX0<0U080 PP0 D0h l0J0D0h0000000>;(00p$080p$0,p30$00,0.000@0(0 0%0p0"0t00D00h00x00|00000000 0D0@PV 00@`0S0\0S00S S S0 /0`0St0\0Sh0h0@:P7(ht@p&9~: ':x7( p&A:'Ș4`ܕt̖80p@-@PT @@\p7(:80p@-@PT @@\p7(:-L0MSM\0 F+ pV宸0 AލЍ 00 ->04@pl0l 0 0  L00S   r::'::7(7(7($0\ 0S `]7(::0L0S/0 0 0/@-00 SM   @4 @$; pv4ЍX0T0P@ CH0@ B ?: 0Ѝ@\7(`7(t7(:|7(:x7(P `00CS`0p S00 P0S X0X /X)': S@-  S  S/ I* S  S%|@=A-|1`@TXPM !\@T10S H10S. 00 00q0p'p *@0 0 0) 0@0S00S 0: S@Ѝ0pp 0GRp0x |B?O 0H00S X7(;`7(t7(:7(7(7(7(|7(x7(7(s@- P@@P `SU00S @JT FЍp0t  Q \0 \@0U +P@'U;7(7(p@-P@Tp0 0C0  $D @C-@4M㕰03,30S`sV4Ѝ0 0C0v 0XPS !$0S 20Sh  4 㬒;$p+ *❸0( \P20S 0< ,(20S  0 : SF0( " 08"$410SP ;1!0 0P 10S10S : S0: S }`}P1 0IR<1 B?M 0 'Q 㬐Ap , *mlN\,d00S |00S 7(7(X7(`7(;t7(::(;7(1;p7(8;>;7(7(7(7(7(|7(x7(7(7(1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ 0P 0 o`0SpnQPPU% Ѝ  B 10`    0S[  L0  $R,   V X7(`7(t7(7(7(p&p&7(410G-S$0@010S 10S,0000 0 0PD0`VG`mipP儠UG p0 0C0 W gp0S$,  `YpP W`X7(`7(t7(7(7(p&0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG 00 0C0 W ,'p0 00 S p0S$,  Ip` X7(`7(t7(7(p&@- M @ ᑳp ЍT P 0@  QQ  00cCT P S  0'0p@-0PS``L@P MP P A{@P4 <*Pᾲp7(L;a;^;C-CM@qL `mQ iQPȐ`T *F 0"pPPCߍw ? P@JQw0S ?@ٲP?oP@$'@-WR 0/p;' 000/7(@-GR0 ;'@- M~P<1$ /p&m>=)>S>|>>00CS0 0 /G-\D`HMp 0008T8$8t0000 00 $0S0V"4`0p Q 30Sa3PZ[PZO0#/000 0K|#PO0`#s/V 00D30p Q   #P0 0mO0"T/V0020"PXO0"?/2000HЍp(0: S P. S+@ P00S`0:0 03V-V)V q 1X  ?H 3 0~\P F ;0L S0 00 0DqpO0S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U NH XPV P 0p&8(:(ht&=(p&<((8(.?>0p&>?9p&@?m8@c(c(Hp&}D00S/@-4@~M0S~, P~܍8(p&0@-p@$0l00S Ѝ00 0KD0Q zN, b.Pp&8(q?L0@- R8-P 0 0 -8(?$(c(?A-pP@` tP@DTP`VA-pP@` CP@DTP`Vp@-P@T0` QI@P 0 Q @;;S p9@P00T@ N(0( -( -p&8(c(@"@s@-R@T` V0a@$00 ?00S 0CS3P3M0 S9k-00@ЍpPڀ;;S" 00 0C0Q P?%P00@00" M0S @@M0ES TT 0$0M0SM0S M0S M0S $0STڄ00Q Q`-T( H-uM(00 \-$p&8(C@m@(@"@@@`1 RS@-PQM R @!  BR0,ЍQ   RR  RQ     P000S, @ 00pT0pS 0LBQo 0Fp T0BQ/8(p&ht&-Am\AAG-P`0 P ,p@P"ڰAQ"BQ 0P P 0BQL@ ,ЍP Pp&8(A@-|A`MPh1P0S2 S VPLDG,00ЍV0App0 oB0QL , P0S(0S 0YBQ#L ) Pڐ0V 0?F l0 ` 0*PlL 0< S,00p&8(ABLBqBc(|>mBO-M4M S0`RX0E@FPԧ0 0S 0 Ģ00rS '0S    G000 E0  0" #T~4"#> D܍4ЍT 2 R - 1[ 0`##E# 0S1夁0 qEp 0   0 #T>4!D #>,1$a0, 000p0 01尐(0C0r  l,00( ,0$ 6E$ 0 Y 000 p #N#QE# Tht&'8((Bc($(>(B:(CCc(p&C-XRXb0TBS0000 Ѝ440 0 0S 2r0S 2 M= 0S pP (0: S0 0 p10S10S PvP  0 0 0S(q<jh 1 =00 0S000p000 S(00(000 P@0S '000S 07FP 0+0P0 D 0`<Hp&:(8((P((($(fC(8(ht&l(C(Cc(Cc(C-M M\ PJH#*E PJ#*SC$0`SH 0`E0S2*pEPu EPp 0 m S( 1**2r0t0CS G)|)p)5)])\)PLEP0000$2) 2 `ލ Ѝ)&0S  R  sS SS YS}P )yS)Dq儁)3)P)P@oEP00000S()( )0S0 VEP C0P)>PP P0000)P0Wi)(CCp&8(($(C0p&(p&D=Dht&DDD mE(]D}EEE FFEEoF FF00@-@DpOp`lt&O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S =)@DT  A/0d#0UPTP&)PV0S p)@X`ꓢ" @2/PL0 !ᒣ#, 05\t&Ps&8(ht&G8(F(G-鈑0@`pP@FcU PppWP<(PЍPT10S (Pp@ 0$03/0PP " R T @ A;/P 80| 3/PrPPTT00S\ T(R <003/P 202(8(4Ght&ZG}G>(8(GG@-AMP/M;@P+ p`pP/0P0 Uh0h (AލЍT0_"C/0P0 000 `(>(G8( H00CS0 0 /0O-S$M00`Y P$ЍP0,03/P00T30 S,@C@s2PPPP 0030SY PV y20S P P P x4 CSR oP8 ,  lP7H7"( H0/S4PA A<.X m 10S  P0S !S 0l!202;/P K ,  41  0S a0S 11004 `]0D0 3/`( 0S 0S 0VP0x0CP0%P!P0403/O(x(>((h(((^(pH>(>(0((8((c(@-@@ePG( 'OA8(H@-p @@G r'H@-@p}G0 d'@Hp@-MPp@mG0S  0C0eG `p 0: S@S NS ЍpQG`C-M~pЍa0H03/P0 03/PâplA]P@ 0AS0@0 a3/PE0 0P)3P/P 7P0/SP@ A-0 0006@ Ft &0(03/ XeZ0 P(>(>(>(0''H(O-MpЍe0H03/P0 03/PrPED50 S 05;P F%&50SuJGBP 0(03/  P 0AS0@0 a3/P|4C003aP H4 CP(40S   P T 0 0  P 0R S = $ `0Sd003p0St00PfP pS`3`0Sd00/S5P?, A=, S0 0  P0SW 0S = $ `0Sd002p0St000S "SD 0 l 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P  x1 H^ X RP$PP ,1P70 P Ex @ ;/0S0S P0S 000[\000*4S 0S 0(@(lt&Hx(^((c(t(>(h(`(Pc(>(@c(>(H(D(((,(pt&(G- R@p T T 0 $@H03/P0 03/P0SB0 X Pqa0 09p1MP \P: 0 P0(03/P@!P0 0 @0S 0 00OP@& mP0 0 p0 0S T/P \0 CX RP(Hh((P(>(((TI($(&Ic(T0@-0S^PP 00H03/P@h((0O-M MT崐 $0/ P`(h(`((>(I c(H(D((((8(p(^(pHp@-@0 0R00  ~ R~<Èʂ[[U 00`00Q rQ P0 S  PFc(Hp&HL((p@-0@0PpP E~>0Pp@|c(Hp&A-`PlplU@0@DTj@P U@0 >00`PEc(Hp&G-P`ကpU0@0@DTG@PğU 0@0 8>0@UP0 `c(Hp&O-pMM =@ P`l>\1 0S P]?:8$!C U00 J(6 0 BR P#?U0 eP0PU0o0PJ+?8h @D 0RP J(L J?80 `MߍT(_Kc(Hp&LLzL Q/p@-JTUPHP>0P PpP>4$ 0 40pLM(0@-PM@ ~Ph00S Ѝ0 $ R\ 04 0R\ Vt(M0@-MP @XPЍ000S0: Sx9PPU >0D %P 0y0>0 t(BMDM(M0@-M@, 0000S# Q0S 10S  P'0S% X0 ?A3c000S&!h0 ?A3c0 >P J>0NS F>0X -Ѝ0>>0< %0S p|t&xt&Mb{M_Mp@-@P`P p P $00>0 p(M@-!@P 0/>0@ (MG-P0`/Sp/M//.@P7 P. kp /00 rP&  P!00S  P fP0 Dkx Ѝ8(G-@P 00/S $QP 300Q  G9ZP=0 0p`0S ^m렐p0 ' Pp=0S@$<lp@D0P/40 I@UD(M 7N@(NN(XNA-M`P@pP5(10S Ѝ 0RP  0RP 0: SZ8P P=0 PW P = P W0 @t(iNBMNN0@-:(4@: SM=0P - \ 00[ P0 }p 0: S ,fЍ000  tN:P/  0 fA-`QFZDT@P<0@!81P @$<sP10SP+(0 0 0 0 00! "4S `Pz<`0 `k0p 40Ѝ(tS|(tHP 00 0L8(<(|t&xt&N(O-Z#Q30` @ (tJM Mp4#0CS0t3tj7P d30S P0: S X P <Z Z30S 0 "q"2pS<0 "X 2P @$<P RPn (4`S42T7P Pu~Pa; 0"0 + }0S10Sa 4m0C?o2 000! "2SJ>0@@z=0 Cz @3Jލ Ѝ  r p G@$<pm ?4S(4R0(4 \ QX00]0S0(4 00P 00L$(NX(@(XNN8(<(|t&}OOxt&%OWO/O-p@M 0W0DN 00S08 0<0 WPP0C080pG0S 0`S * 0R 08 0 x x.  P8 ;@0 X2@ @?0Q*;@0 0嘠P P` hЍXX ᒘ % ` `@OO((O((Rs@-Ѝp@ 0@`P0Q:08  ƿP:0 O(O0@-@MPP00<00S  = J"Ѝ0(G-`QM MJP㠔@ Y #p ⮿P 0p 0PP=! SR J(ݍ ЍPJb:8 I= $HL0Q\ J(L0 000QJF:8 PTOOP/PA-QP |000p@T+`00CS0dpT0 0S0T@ 0S@ 0 djP 0S@ @T@ S P (s&' (0 0 S00@-@R00000S0@000S `P Lfp 40PX(\((L( SP(p@-PP 0S|Hp `V@P` _3@P0/S000000f PR @@@pPP(h0 RX R  H R/< R/ $R/Q/ a(l(T(|(`0@-0S L0@0T R S$ 0@((PP'O-b@ 04MS0S zB>0PP p0 0p4Ѝ5h"0C S.0P20S 0X0(00!P0 000" "  0!$$! 0!㓽K X7($ * R=  R7  R$  R03 0T! # 0J (!#$1$4P7 R  R/  R $-0400S ̈́!!" # "040+04 νP80\ 00  0 0 X(IP(PQ/QKQ $(yQ_Qp@-8M@  ɰD 0`P`U`$ $ @ 08P8Ѝp~QQC-x1lM0@S XlЍCI*`Z("="(<Jp@WpP00 0000p084 40CSH$0"60"$ 0( 4 CR+p ڵ *lЍB>'"ѵS+0  w(QQQQQ@-@XM="r:(Û0 _XЍQ7@-@Pp !,P Q Ѝ0 0 U Ѝ0@U0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq(0C\0S*/ \ 0W!0C0 0C S*CS*/ P@-*0S@L0 ? SR@C:@  ^:R \000C R00 S00 C@ T \A C@T2  0a0C R"  0C\0S*/ \ 02W"!0C0 0C S*CS*80P @-  //d(QA-@((PQ U?-QQpW ':WP`0 q?`S A芟A(0:S@0 R  0 `H>. ( 'R'.R/1s@- `-0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&0!SP@P0PA- 0S`Pp Փ0P  T @R p00T0p0S ,R&@P0=0L&PP@T((TT}Ts@-@`P0l C300PЍp@00S S@@PP 0 @D 400((@-  S㑰'T0 Rr @-/ht&@-<@<S0bR RRs@T'G-p p@@d\P,p`50, Z/00 ``XbXO-lM/(_Po;o@P= `P0p`ᐟ/00? PGP@  l?l/@p\?X?A0sR  S  R4?4/0, CR 0K?zP<N>P ,`>@>0 -R.Q0 000t> l>l. d>`>\>>0SHp/ 4>  ,> > 0S  > 0.0.0-0==P}===|=-=   H-  g= 0@T pPP\_y,  0!-1 @ L< -=@=<P? <;<,<,<,t<,h<,\<,||.c(XLp&8(X( 8(Xt(L(xt&X8(((<(|t&l((x(X\(TTXd(P(t&t&t&t&t&t& (pt&|(Ps&(0Y,(|YYX^Y5Y8Y'eYYfZs&nǙZs&>S(p(4Ttt&Y(h((Yc(YY`(Z ZCZ8(H(D( G 0.ZZ((Lp&K 0{pdoPW0000 S \0 0P  /((d0P/X00@- HP808;,P'  庮3((( [$(X:['A-`  @?\, \PA *\.  Q R( [\SPQU !\@@]^.!Lo \0QS8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W UU @U |(p@-@@0/SN00N P`pPQP`Q*C0CT3A"0L0AS*pS]p@-1MPMUP/+P )0P0SۍЍp.S@T|`l @ @8$(5]h]]] ]] ]^^>^O-cM M 33 "@p3]PW1`0 00S  g  0 Pa` 0+QRV~ @  +  T* R`DV;  _cݍ Ѝ&R* \R%1@\ 0@R R P BR00CR ^ 0@&P\P   (  BP+T- R* ` V$p0!#MS@ 0 8TS -8TS p  0i 0 x@T *0S0T00  R S 0 }( i^^'^^C-`PMM RP  \SP R P0S ۍЍnj@P p uP ;㳞0 D  0S\S R PPgP qgS PS" SS GS cӎ0 x0pS sS0S080 R @@@^^^._W_(A-PP 0SpB`pO@PL PU(40  R p`@@ @|__(L0@-@0T  S  70@(__'T1 RP p@-ZDT 4\p \Q Q 0T*  I04P  0S/  00p0S/  0`0' @0/S000 0D0 R /(l(|(_ `0A-j40@TPp 00S0o`0 00/S @Tt0T0o)P0 SD jp04(l((2A-0@SP' 0`.S0.S0S/S XgP 0 Q CR S.R  S.R0S/S A 10S510S ;P:4 CSR ! Q0S 0/S0S.00 `:' 00C00S080 `V">_ Y P:4Co S Q  S  FP  ! C 0C0 0A0 B!"00@'oaA-Q@pW :0 01 5  d (l} <tx @ |qp}  h=/ 0$  4 =CL2Q ! 1Q) ($5Q/^)040)($84K ARKQ  $ q++  @ 04(4 :(40/S0004084(49)($ q++@k$( (C-Z4,#0C@EMS$0 30S`` EߍJ(`J(J(J(@ ; 00$0$0<0 0 0ݍЍp$k (p@-@ PP hp@@+k@-0p-S0S( P⒞@P# ߂ 0M0` S0 \BPPP00T Ѝ@`;kVk'-@-0@P   tЍ@Ѝ/(p@-@ATp@0 R Py_P ` `P`p(-P@- 00|0 x0x 0 0 h@0S X_00L0L < ,庲$ _ Ѝ@ Ѝ/(P((('$(wkp@-xg@Pl:hPP X3P pk000S   p|kk(kx( -P7@- 000@ 0 0 0 P0S x_00l0l h岝 XdTD 8妝0 s_ Ѝ0@Ѝ/(P(((0'$(wk'k@- 吝㏚k'0@-MM@P@Mߍ00/S~YPtyYP Op TJp  0RP 0RP kkkk 000/(@-t MLk'C-q`@$MT  t0p=hAPDk00CS0>@ Pp< @Y@DOoB0S@$Ѝ0P: S xP Z0S   pW H^0圀 SH@@  0A@ CT0 @00CS0,l0 ( l'll'O-PQAM @p2 l2 00pD4< F0@ Ѝ/R#RR@ :BQ&@ B&Q@0=S0  "?R|R& ~RR ^R X!000P00@=S? >S 00@<S =S 00@|S0 0@&S0 0@=S0   +R'0  -R(0 )%#$0 ((}m((mPmVm0@- (n0s@-0P`0X0`0@S P 0R@P@  P@0S00S ~0ST P000 R  Ѝp((Xu&$n"n5n@-AL ^`X sr^0 \ 1#P? L 0l0̠?0 c0àΌ SQŒQQP0R0R0P0QPQP !mYnenvnO-p`p됰P0@%Sy0V0&S T4m! i0 00 @ P@P@(n@-0@!4Mp PT` 0 P@4Ѝ0@P S=WP@V P @0 F?P@$ P@M rV(np@-@P0)Sp(O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP  +,Ѝ'0DSYA `@V@@P'0ISV'Y00`0` H  V! z! 0  @@P! 0  @PV`'T@@`@P, @ ⯖  (nnnnO-p`M8P젟찟t!@ p0 X@ 0DS'00^* PU @ 0 c 0DS00Y Ѝ` pUU (nC-锐p`  0BS0p0@SP&! "0 00P@@@P@ Ѝ(G-`dP0@S! p0 00PP@(@-@MP1`PL 0P  IR NRpp  PpEp@@0PS@ $1Ѝ(nPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 PM2K2Sp0@G1PH0@P 0,Q@42nLu&Tu&((n@P/@- 0/SSS00(0@-@PMMMߍ00/S \ap \p  0RP 0RPop@-`\0@lP 0D0p@110"SP Vpzz(op@-T` RpH0@Q 8 PP 0pp@(t&oG-pWR 0S)P cxB000000000CS020S @T  |(T p$T\V0{424b0000@/Sp=FpPJ0S0/p0CS0pppW00b1000pA0P00 x00K0 lS `S00CS0<10S 00CS00W00 pR0S/S0@D00)1@P  R*0000t/S0S P 0/0CS0 pG0S 00CS0000@0@0@(((ooLu&(Tu&%ooA-`p0@00川P 00CS000S W0P0CS0d00S H%@ HW 406 R0S 0 P(((oXu&(RoG-2M?7r0@TcT@P 0.S00.S000/SS?X20PpTePZ( ,`V PPP ` k/` E$0Eezz@0-S0Sp1@T@dTP~/┝Pw 0S 5/pP  `P y 0: S W /pPXP pW 0S s/pPЍXu&Vo(Yo^oq(kowooo@-$0Q @ yR @(oop@-L@q60P000S LTPP 0Se@@N 101N00CS00 N 0 iN0pY{x<o(o(ohv&pG-@P@\R` V101 <sP (mP  `I\TQp @p0T \0DQjSh0@0 p0BP!0 BS@p@00CS00 "N 0@0 @T0S 00CS00  N 0 0SZ00CS00 M 0 M 1 0h1@ @ @ @ @ @pp\@@hv&?pBp$pEpA-@ ` PR 0R 0S SMp0S0 R #N0S  NU  NTNw x NU Td@00CS00 M 0 AiMPv&(8(Tplv&Yp\pdv& 0@-P/E 06(@-@(0Q N(@-x0@T   @@@@ @A@00S 4060S Ѝ((Xu&-$0@- R    @(-@-   0@-@(-@-0@0 H@-P@` =@-@-   3@-@--@-00 " ЍЍ/p@-P@ p@-@-   ЍЍ/ 0H P @-4 4QM,P / `pPq(0/(p@-@ᰚPPPP əp` ͙`P 㽙p` `p7@-PN40@T p06 N o1d0@T P_NP0 0@ 0O@LC Ѝ0(sXu&(8(B C-pP`@V'f<0`xP 00 = ِ06S 00S P5 Ѝ  @0t0S0T.S (N@s s 0    /(s@-@ P`TЍp0P0CS0  +000 P !0 C5@ 00 }r0@-PM @T @@ 0@up +P   L@@ 01up @ (Ѝ0@ s @(t&st&@-@P 0S0S 4P 00 0 Ѝ8(G-`0S q0P00#@dT0SP'@D1$@00CS0$10S +Ѝ00S p U᝘Suu6  R )P00CS00S UdB0S|\BUrPo@F#(((sG-0@P`^PM U+릐 s)2Q0U2$PP20S I0S 2$PPPU J ^0S|2 0S@+T ^0S<"$0 0 +^0S2 R$0S0S F@ P0S F0S F^0Sd1 R$ R @T$@0S F 0S F 0S F 0S F  0$ V $0?o2$0Mx0$ R  0S F 8J4aJ ЍXu&X(r(`()sPv&O-@MPp*0 `㠀堠堰G@P@ *Vx0$`W T ^0S W P  0`S*Ѝ(sRsas(((es0@-02IM000000 20S 00S 1Q1{2HH0@TH1 HPP& |1  1@>0S @T H1ӛ C@`H8^H1G0S  1$ Iߍ0A 0 000 0:AP00CS0 0@ 0 00x0 >00CS0 0S *Hl(HD0GX00S d@00S ^(Xu&(dv&(>svs(}s((s(0@-$M00P00 0o0^0S@@T4`p (000pU @&P 00S "奔>7坔0 @000CS0(00S ($ЍXu&(s(C-@?uM000@H0?_00?0P@0,@ '@P0o0`p00dp@Td0hP@0do 0lP@T 00X0P0l $00`0S$G'`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T@ xPP H0]7S 'x0RF D>0SG00SS (.0000,0(00 0p(0p  =&0S67S300S 0 0S+00000= 8 ⫓ H=, 嵔p@ P P$= ,`,P嚓0 $= L8 =V  K,( %P000<<0S +U0 0P@;/P  @<$ 0 $ D 0F@ =(<(|;0FhPU p`PkUI0k PUY00CS00 DF 0 ;%F4T 00CS00 .F 0@F`P 00sG00CS00 F 0@`G @PT 00CS00 E 0pJG @P AP @P07L:0P 8PP@HP: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP   7S 0C8#8S0)SS A708#8SAP0 Q A!QD8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  08 @  (00(00@0700407<000L P7 p7H 00R0( >$0SP0070GQhI 0\'000 000 D7 0<'08'00$(0(7  10103/$0 6 aF6& 6& DL0S J8 6 \6 @ Rc 4 0  ^ $D  $6@, ۑ &00CS0 nP60S y☘P 60S%,0oS55$5 h0 K\5,( ,0P0000",0( "0E$0(0S, $ 4 50S 84,0S p嶑t;$040S &0 @0 @PDT=0 0<0$0 0C0 000D0004 8`\XcP00CS030S P( 40S)T0SXNPJ8 |3 P3 L3 \ 3 0L3)ß00:3 0 0S '|0R"C"0 0 $3 BhJ00S0(O0p"0C0000PI8 P2  2  2 \ 2 )xŸ00 02 T0S!00CS0 1 R   01D0Sg$uߍ:10S [0!SSuT1 08 L0H@Ik|10@0@0S 0 @0ST1 0$ @0S  0@0s0 R#0S0   B  @0S @0S7S@<- @0 H00S <:8(((((Xu&X((s((((dv&Яs`v&((@>. 'hv&Pv&lv&s(@(!(( s(B s@,0S0  <,0Sh@ EH0 H ,000gh1F@T(0Sp0 t0?,0 0u,r)DFF0/(0 /(0 /(0/( 0  /(P@-@_'P@<0 QP cR   s(0 S0/(0@-0M0/0@0P 7P 0: Sl  S` PЍ0"P0 : S# PP8(ss tp@-Px@x`M$PL*00S "0`00``00!`#$Ѝp((@-h@P$0&0 RP   BQ   (//C-LM *8[8 p@<(P@0` D40 `G 0BLЍshv&A-@P`E pWU  M(1" 00' p(8(O-pWA R``%` P0S:S SE@ @0S(W@  @0T/S/00m0p0 R00P R:R:RPPPb@DO!"Lu&Tu&<(@-@MP/p P㨐K  0  @ T9p0 @~0!0P 0hpWZ0S 0 bTg 0S c 0S _ 0 Sp @! h`P T T T0F @@T >0DS<(dtA- 1@PM`Rk01000  ;p!XZU pAA Q XATAQ@A 08AS 00CS00 A 0* 00CS00 A 0 ЍQ ]A|AU P000"L 00CS0T00S DCAAA80?t8(ktttthv&t((tttp@-P@@Pp 0S%SpP @p@-P8@Pp 0RPp@@- @0@ R0S P P\ 0t&D(G-`P@唀0吐00|Up00CS0h00SG"0S0 S 0S00MhPPp(D(t&(A-p`P0@00 Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S @$P`0W:SP0R@8('t&tA-`P倀000|Vp00CS0T00SA0Sp00%Lg@T`(D((0A-pPS R+c`a@T"W p000}0 @0 0 k00CS0H00S s`P `@<(((p@-P$@Pp0P0@@-L@000@00 g00CS000S@?(<((O-PM/`@ 0P @@@k (P00š0 a0S ]0S Y000V#   P@ AP @cPM R RA R 0S   0  003 0 03 Z0 R"00Ȳ0  *pP7Z { 2 @T 0|?00Ѝ H" R," R8pP B0000S R  pbVQ  0X/R0XZp Q#P pP tG#P R  R (DP0 * R; R 6W0@@D P R  sP@0000S R    BR 9D R5 /3 P8(tt&<(dv&t(ttTu&t(O-`Pp$M `x,&@Pp2, 0S*[ 0 00P@0  p0Rp`#0`2|P& ZQ4>01 >@$Ѝb@DT@ P  p R  U 01W VYXU' [1 00al 0aS v00@0S v P I?W 00SY0 0 S0 P 0< S0XtCt(D(Xthv&u8(t&\tp@-`P0000S S@I000 00 00000CS0p00Spp@H((0@-x@M0 0000\0P>00oI 00CS0$00S Ѝ0@'Ѝ0(Xu&(@-yP 0SIO-`pP@Md%%P0cS @@ <%pPp vPP VP@  RNcS @ : 0S2UA ̲P08PF UB= PP9 =@=T( 00S$ dB00CS00 = 0 Ue= 0RPU EV=0@ T  ЍK=@W P` 1000  `@`P1V>0/PW1  [ZU=ᭊPU=U~f=U Ut Uh UX<BuFuXu(Auuuuuhv&uu8(`tuuuvv7vO- M$B$Rp0@0`V% VV:V  V /V   BR <` F R  Ѝx! R  \a[  ^0000S(A@P=[P@ @T ~p [ /R0/S<0ZW 0 BR  R  BR    BR    Tu&(Dv(Xu&vA-(A0S 0PS0 0aqP0S00 P000c00CS00S aP 0SRh`hp0P RP000~c000CS00S <((((s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@L `_@E0S00S=STL00 <0 R0AD1U0 S 0SHu&((A-hp@R0@S`P  R RB00PH @(O-r@ᘲ0MR00$`00 0040嘀C3 \40SX00`@ 000CS0D0S00CS010S H`P)0V00)PP b P KX10S 0DC}0@0CS0 10S ]Ѝ0S`F`H`Z' Z$ 0S@ @Q0 /PH  p @P P0C0~00@00C00C0(Tu&((((2O-0pS`p0 Ѝ@1Ա 100   Z :[X0S t@ xQQP  PQ XI[PD $V DoQP @800K@P  QE Q@PQ@  T* R RPP #P Y <P@P@ P(L((v&vA-XPX@X`P0p00a0p0CS00S v(((p@-Pc@d0@ p(@-QpP0` 0S*00E@P`PP `R@ Ѝ `0P@@0`SP0S0O-0R0@yCy7yKyTyYyhyp@-`@000T0``V Z00CS0p400Spp@J0S P(<((@- 0 S  .^\Q   @ S0C $00P0R0S O-PPp10 0%SX P 0@S!!Q@ C$0S 0S  R-S %S +S @D1@YZT$W@1 r9 002#00S 0S 0Ѐ?S  *P T"@` t P P w \0@00SJ R Q !" R @u&nyy<(|yyG- a 0S Qq0l0@S @ B)А0Sʬ00CS00 ( 0 *j0 R  0 S0!)<(y(5rOyyyhv&hyA-pP`HP00Stp10P 0S TBjPp pPP gP`W@ P1 1@(`V Q U` 00S`AJ 0 (P00CS0 >(0S 0 0 00S0 S 0 0yy(z<(5rO0z)yhv&6z800S /@-P `<(8 P  /Q 0SZ//<(`060S/P00S/D0Q<0  40 A!0 S00U(Xu&(dv&<(5rO:zG-Q`0SQ00@00SaZqP000D:@ 0@C  @ R0000CS0010S Oq,000 10.0S0100V000200V+ 00CS000S (萠@ ]0 ZNOꙂ! P00 R @<(((Xu&A-`!@S1@!Pq -%00S0T0S ;tT@XV2 \1N0SM U 0S0PuPtV 1Pp)Q x#u#060S$ n#k#h#V%%U 0S {PP%tX tP H XT00V(((<(Xu&u&xDz08 N R S  0S  P Xu&O-`R0pMxB0 pP P Ѝ0S0S "0@0000 0!P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р 咺* S :^ 0R Q0 [ r; R-z!   B/oZ" R" \    P 0 00CS000S \  @Vz   B/oZ"  "0`((<((Xu&dv&( G-pPK@P EP1N0St `O@tT @tOpP `㜠@0S0S 0S0S `@Y 0 X 000 Xu&u&kx<(A-@ PPT0P 0S {lP@ pP@ ZP@{t06 R0S@@PX` p2 0 P m\z(`zXu&hv&O-`s$M@ PPY30oV .'P  +P |0nU pUV `(`L3 R ZP$Ѝ 3P\!ZpP'0?oQ20S P VP   Q6ZP@@=Y pW  pP 02 QY QnVP  (160S"\  \@ /o"/ S [ (\@ Q 0p0#Pu@T R *  W R 0PS  R 0 S0C 0 8i 0 R00YXcX `Z^ R[00V(z(zzcz<(Xu&zp@-Pq@\a000 R 0S 81GNp OqN!10S 0 00E1  S C00P0  D@ RQ D@@@Q00R00S 0SW00CS0000S p(u&x<(5rO(<1p@-Q00@S$P`0SP00CS00 # 0 P%0Mp M !b$PpP000V0@0CS0<00S tp<(yy`zhv&u&xhy((@-} @ 00y(@-@ r @yp@-`@0 0 p 0Qp\ PU#00p<(z 0G- b @Pr0UrP@Ѝ CR )0!PU0 R 0S\S 0S0S S S=S) " C< 'S:  0!0 S0B 0.Q"0,0  }00 S$0,"0^ 0  :0 1 }SQ0 0 \0$0L "0D  U 0"  @PE<(xzzzu&zzA-@`s布MTL 0SIPU0 S0S p#s#RP 0 BRSD@0#c#:P;9@`1@P'%@PUV0S 0S |Pp `ЍP@DP$ 0S P wPlPcP`Q f `Q0 E`PV8 ? :0 S`A >v P6 P3 P0 P- P* P'xus<((xzzl{zzzzz{{{z {{{{ {.{3{'{8{H{\{a{zzzzzzn{t{p@-@PTpU0PU 0S F@zp@-Px`x0PP6 R@N0S@2@@0S. @D0    p 0 p<(Xu&A-0P@`Tp R@ 0N@T P 0S@@MoW\0HU 000000V0@ (Xu&u&0A-(MP`p 0 000fntp P@ \n0 @>@ On[K$0 (Ѝx{O-PP 0rM00S _o1ԡ R100 0000 S @PЍ0SG  0 Q S/R CoP Q 000S+ 1QA `` R:RV@#00S @xLG!@00CS00  0 ( @0 RH @ 00`((h((q<({Lu&({dv&Tu&C-@M$Tpp``P A0S I60SP 0zP 0^0 P1U00S^0SP60S .0S PtP P~ЍP ^Y8 0 P0C?o20%`(Xu&dv&lv&@TP<8a0 R 0R- *@TP@00CS00  0 Q P @1@XT@Q@pQ PGGpW, @-f9Xu&|hv&t 40\+P@--|Xu&t0S/p@-@PPEPp@!B BA-@1SI`p@DPU 0@P00` PE(O-PP0q刡0U`0SP  -R  RC -R0SD @0+R7 `;cP[ U00PoP0S P ` `U @-rP  R `XM @U@0PP ЍU0S ЍOy((t%Xu&P0A-B00`0Q 0S 00S0S006X pWP P6p60S0S60N0S60N0F0 0C?oR20S  0-S0F01Q0CPC0SQ 0S (P0   j 000S 0 0^0 PA( R   R0 0(Xu&78(P0 @-\@000D00S 00CS000S (((000C S/ @-=P 0 (G-0p R` PU4\ 0S -R Q@ 0L?PC10@ !a,PP@ P@b PPMP-U0S 0@T0:SF 0R@1T0:Y " @P@ P0 T 0:S  @Pz@?:\00|@Y00  Tb@0 0CC!08 2AV@ Ѝx{`ELlv&wP@-HD0P  Q 000CJ Ѝ䂀(( $0@-S Q*0S-QQ -Q^ R0 P :R0S0 ^ HPP0@:T  ($(G-dR@ 0S P@ -R\@@$0P 0S 0-SM@T@F@D@0S 00?q `0@B0A00!FS:0P:0`0@#1P0 0V:0 000CS0 10S =3,3"@0S`p0C 0 XZ0Oa`F R 0 0CS0H00S @0S ;?(΀߀((p@-H@HP080Sp0u`0CS0` 800C80gY/UP0>P0 |P!000P$@@ 0Ѝ@P 0 ,  d0P( 0&P00 0<P_ >P &P 00p0pc0((0 @ -P 0(0  p 00@0FSPP 0S( 4SPP0 RPU (S0 600CS0p00S T0 00`Y0SH((v&hv&dv&((Hv&(O-P0@l#lcMhsP P00P#-9p,`U4@D\T(Sh 0Ta000pW` *@p00S0SAP0SV0SS0sS vS _UPp0+S -S TQ  <Q, R: ~P  1  1PT 0 @0SA>0MЍUF p p0      "TR 003/ r   %5S >Rp/ 00Rp0Y0 M I 0H^@>. 'H>.P(($U@zhv&̉A-PQT 00CSPDq12SK R@ 0`0CS00 `0120<S R 90q0S 0CS>S RSxh R 00CS00 - ,$-'p@-@k(1 R ! R TpPDo\P R R R$ 1S! 0 EPpR!P P " "\060SQ 800S00X(4(((Xu&@-@P @r-PYP蓊@-@P ZP0  H 蝊d(Qp@-@ 00CS0 0 P `d q?U UH8?Up!P0P0CS00 `ꠊA-@Pp0`00 T0h 0000CS0L00SAo0S 00S +@(X(4((L P0  /Q Q0 S//X(C-Q@pTbM1qpWp0S10S 0SPP20S^ XU[T T TP160SPPP0SPG1N016 RB! R>0SPP0QF %p? 0S0 U@Eo p X0RUHY0000 00D>S+00 .PYppW 0a1ЍCTPx0N R T  DR 60SЍQ Q"!030X((Xu&(|PO-@`PP p P P0@DpSppTPA TP@DP:P5@<P,1(4  @P@sSa0S 000*T 00CS030S R@@T00PpӪTW00 T\W! @P@s 0E0`P 10STb@ T@@VPT @Pb1 R 00STA@ Tx@P@UT X@Q0S 00S 4["@@TppYW `СȱPEPe ?P@1 10S AP`0-S0S`TPhvCW W0S8 `0S[ 0@ V0 S R0V00 `1 R )T` 400CS0400S tꥊhv&X(((̊Պdv&fڊG-@PD opP0`p U@DOoBW@TG0S 00S 0@0 @000CS0 00S -PX(\(((p@-H@P02`S@20CSpV02pX(40T0P?o20S 0S//X(@-818!0FM01011@10!!P0@S 10C1FߍT   R X21000LTP ) `0 TL@00島00(P 0S 0 (X(,(?0!!R/P/X(p@-8P\2Sp@OLI\BpX(0-MM01`"R !R X"R   1 1d"1!d2S ,TPh1, i,TP H!0,00T@P 1, @T0dUO`0P, U @T 0S vP200CS0 ! S c00 sM4"!031X(,((( 0@-`"dzX(p@-L@/'Pး0PPp0C/U00p脋p@-T@TP0 0P0 (0 0000CS0p00Spp@۲(Pv&(A-@R`P`p M0PPEUp WD0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S {sDP`0000 0C0(((p@-@P@0SH00Spp@00CS00  Pv&0Pv&0Pv&@-@)P[j'Ѝˋ-@-   Ѝ Ѝ/-@- 0  ЍЍ/Pv& -0@-l0M, @P(0 00SZ0c10 @0DЍ0@Ѝ/G-@'`rP$ 0S! lq0S00CS0?0 "  v00CS000 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' Pv&0QPv&@-@0Pv&@-0rS_0p@-\P@-  Q%  0 `Q R @P@DR 000S=SA00@0p@HpTu&Lu&(0@- 4@ 00C00 0 0BЍ(A0P P PR00/p@-LP@^ ^  R0L0p聑A-鸀(  R ?(p`@pW p0S 0QPU  0S 0S   3/P@P00(0Shp@-@P|Uh 0Sp'SPVP@'PP(p@J EFILdgjoA-P0`Sp@    3/@PP@X 'W "p0@=S0U0 0 00CS00  0 00CS00 | 0 T vhv&zO-@00Sp 00sP㼀✠`V  X 0崳@PU* ЍY   [ QʁVaP`0p((`@0 S =SR/=S/A-`P0S=SPERPU@'(\0\p!0qV@pT 0S YPVpp@((A-2`0@S @  PPe 0 `$ i 圯  `aЍA$q X <,0  8/0`$0X000 0@!,0XH < S   8/0 U U0 B00CS0x00S ЍA%, R  Y0#L 00P P ЍXu&|(((-x0GM00h0 00!PP  <0  40 Gߍ 0  0  V((A-`p= P@ VPp ȽP<P0D @S= O 0V  @G'`ЍA&0Cꏌ-GML000OP00$0 0  Gߍ(p@-JTP`0`#<@VDB_0V`0 0 p@(!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    b$Ѝ((8(Xu&(p@-@`TP000T 00CS0p,00Spp@/@((s@-P@T@ WPP0 P00Ѝp@s` EP 0 @^00000 00PЍpЌ(pA-PpU`A0  #0#@TP@ O0@00`( @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP = @@ (G-pP`0rS@P W 100S V@㐑'<nT pTW`V 00S p`V410PU0 7Ѝ 0`=S3 P& `W000X0  嬭@V 0P U V000 V 00S  0W P$3`P`t(w@-` p9@P6 0 Q0 PQ 0 0   R 0000    " 0 "00CS0 00S Ƭ Ѝ(q(A-`Ā@TP0U0   !!0SpW   0 0 7/0 !00 0000(8v&Xu&A-Pp@P `0`&`PPEPvT eTP fTpxTPW A@V X@ꬍ(PP@- v f豍C-䑟p000P0`-S㼁@TQ u@ 0@00`0CS0Wp10SS ЍC# Y@P=ᘱP ~0 @0 00  0 0000000  0 0 00=Sh X0T 10=S010C0\QP 0P00 Ѝ((8v&Xu&( ( p@-@PTps@p@- P@ X۫NP@ xP@ IP@4P(P0 P pUэ(00@/ 0S0@/s@-@0 0P`0S 0"S U1r0!d%*0SX L咫0 @ R T RЍp舎'0@-MMP )GP Mߍ0!GP@D 0RQH0PP00@-MMP GP Mߍ0GP@D0 SPH0PP00@-MMP FP Mߍ0FP 0RP 0RPA-@`FPI0 0SC PFUA FPPPKpzFPJ! 0RA @- 0-RS# 0S0 00t; Ѝ0SX0 0P0S00 040,P$\0@-0P!S@M0SPЍ0Pi 0SfPUo U U U WFP7 PoP (5 P0(P0,0P,0S ++RP0 0 0) P0(0,0 yP,0T0 0 7 P 0(0,0 cP,0`0 H P 0(0,0 RP,0X0 X P 0(0,0 AP,0\0 bѦP p̦P 0 (P0,0*P,0d0 }⺦P  (PT50,0P,07 dU⧦ P( 50 ,0P,07 0 kE ⒦ P (40 ,0P,07m ⁦ P (t40 ,0P,07\ #p P 0(0,0 P,0x0K ._ P 0(0,0 P,0|0: aK0 S0S   L0Z: ]Z0 },0I 08s(0 ST 3  /(PG 2Y* L3 յ0S(J # $3  0 R N 0( 2000"0,0 0 0 ,0dP P@, 2!Y 0ȐÕO 0= 0, 0  (0 RS P  (0,S ?@pݍЍ R $0<  QP$0 P$00x!CI " Ȑ& 0R ( Y I0 S<1Y~ 0E0 R  (0 RS Pg  (0,S  (0SVu y R(,0(T=ehk(ȶ(((h(8'm`s@-`0PU V  P.D@P hЍp`PD! 00p0@ɵV 8d<$00S 0@-ݩ00v&p@-@5S4 0PSP p@-Pp0S 5S 1S T|Pp5S T \Pp< HPp[$(( PpS((\NedArdA7@-1AP(000(;_5 S* 5S( Pw0S s0S005S | Pl h0hP%K5S Ѝ0< <mP0WEV(fdmdθv&\](gd߸@-@P f/>@( 0 Lv&(md0S/!  -3@-P`T P 0S S@@ P@Ѝ0@ Ѝ/'@-0@Q=@` &  & @v&WP@-t@t0MQ C  P0cS CS SS ,嵴sS00ۍ0)0@-MM@` PP 00YSP ,啴ۍЍ0qP 0 6(0'@-@M0 yP V ۍ@-@ 0@ (0'( @-YMM@p p\YލЍ<0< S <fGP10YS<0<0t%rdAJ@-PM`pV@(VWWMW`8VXEW $Ѝa@-P0@ 0$S0S2 0`Sp( TQBQC0AQ)W410S 8@0 ᜡ 000! S0c0A R%% Ѝ8V 0QY 0KY`(pV 0Y \0"4 :"< 6"$#2"$,."$<*"$K&"P ]""T }"0p 2Q0S*X`?\PQ P "V@p@6O-pᔀ 2MSR R@`aK 8QH ,[E 0`0 Z  ῞0@`"  8 K,  D ᩞ`@0"   0! !R!!'! 0S 0C R^!S[0    0A€!8QI rP !<0P+8Q* 8 0A0Z @l!2<0P+8Q *ЍO0 0 0 0lI! `D!8 7 ЍO ЍA-@T`Pp($!`8SAL 0` 0`( "4`#/A-P@ 4"40 4"40 B >((,,004488<$<4"44$D4"44$D4"44$P4"44$`4"44$p4"44PTTXlXQl`pW(4"48(4"48P`0@`V@  |0TP0A0T0A T4"40A(@-@l40Pm08f/ṡWEV@-@LP TP8#!00Q@mWEV(80@-0@S B08f/㏡( 0\ P0//@-XD0 <0 44寿0@ R( 0# 'Pw&P7@-@ PT厝P0 08P8 0)p0 L Ѝ0)vd0@?o2P0S@- p`Pg@P bP ]P XP@V@lOPH@T@T (p0 4\L@@ Ѝ )ud0@-PM zdP@` (p D=L 0 400+ +Ѝ0)zd@*8s@-Q (p L0  0 @0`D   _0   0  0  0   Ѝp)td@an\( p@-@PM`P< :(p  ( 0V V dPЍp (‌H( (p ,K 0m)}d(@~d(0@-PM @ _P 8K4P 0'p0 KЍ0){dЀA-`0@Pp!匁0M00x! p0SP@XBT 'p  8`KeP qP p`(,0Q 0$0S* @P >KQVW V 0`0( e_PR0ct00(0S0Ѝ00* *  `@@>. ')|d9x[@-P$M 9@P j'p pJ0P  lH0P 0P]P0@p@p@ 0t@`p@U@<ԩPptcidyaraBrbmngnts,28;0D S/ 3C5C$1 4! 8<0/)p@-0A„QUp%Q ? /@.0@1 ^ L043c 0PpQ ? /@.3P0@1@ 2@D4P5H@) 213/P/)A-PT0p(,`ଘ@ᨘ,0T@@DA?@?@@)?0@-0@0 (20,20ܖ0P!P30)> 0R//G-`0(,Bp Pῖ Eo@PPAW ,20CS(20CS G20)p@-@`42SM%^ ! E 82<"@ 0(2,"Ѝp@ Ҩ<"82Ep`@hĨ,"(20X"\mЍp@) x&!*Szs@-P`˜  j0SЍp00S@ẜ0"S1Ds@-$M⍜@d80́k $0 0ZY'A-`P 0p @TʬF /,s 0d  ? Mqp  RЍA!L`!0S`@D@,l Ѝ x&Uk)A-@0@ @`pPpd1ČL0\ D0d^\^ 06U)p@-4@P0S'( 0B1p)O-PTM0x 00$03p  @8 到A ⌠e00,< (0,0S9 3,(23`` 0$4 040D@ ?u 0o  0p g@ D00 d#P 2F $00<p (宦 ` RL` $R0 S 200#1-R0% XLL`P@L,0P00S (2 ~P! 2 wP 1  pP' (r0L00 SE a50g2(08 hE%KU`1Y`?D!C$5\"0P@1\"R@ x @XRx  X20P@x0 0X20UP@x0 0X20UP@`L` 0U$0000[ 00S  0(0$0 00 /7P @TЍ P @) x&X!)'D'S-7@-@M00CS0 ?SP Pp ppBE0 P00CS08)S0 Y@o Ѝ0@Ѝ/'LO-a0 pEPp/B$0e@O 0厐qp Ѝ  R ЍOt`0S 0 uqp `BE,࢙ 0S  x&)p@-@P2S 0p`n/(2劙1!41#41U &"U 80U p@@PC @+@Tp)h()!)G-r@,4`P D` VPmYTLE J$d,U 0V!U ! [E@s_Ps 9X2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@s000)A-\P@PAds 2Fܘ t B B$00C0)O-Q40 ЍQ^H DaXR XD 00!R 0:80Ԣ #ZppWPPUJ U @DQ ČUȌ̌X L X0P0Z 80S yq )O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q 32 $450 (, T02Sx Y< ЍP P倰[R21 RS$ [0 0 2S Y PUCY200p@`p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$~00C0@@PAy`d1S  P0 148<   00P2S. Y  a14a8a<0#d1a#h# 0 $ ^;[䒓 Yx @ pD `H L$ @ t x |  XRRT0@(˟(`PV``90w@21S  /0. 3$00(10,204458 <0T  T  R2`Vd:HL"T 2SL 堠<Ѝ ("o P $ PB$PzPB $P q v`Xt  @D H L$@XB$@ 0Sw 0 pt0x0 |L9p0pW0 0 Y2S00l 0V`!00 0 ? Gb `4> 0 S 0(00 ,00(  ,  0 0- 0@PT0P`  0W0S ,8p@00W(0pS,0@0 n 000 W 0S7X\"0SR ㈀ 00RX0p@0 0@p4` 0S 00 0 00p4$WP2 S2S0  >>  @ `( (0 S 6! R0U0@`^1S  0R01A!D1H1L1@4!8!<@l21S  "/0.0010T0 3`2044`5 8<0 T @`@ H2(0L2,00800 S- 1S* ( U000P,  00SU0!14!8!<!14!8!<U(P,`)(,00L000D(p0 S( 21S$ / .0,40 81 <U ( S  PU 32 $45(, U\(00,0p@ `0 0 000pS0 S00 000p =P  `V[7 0pp  ᬑ0S (0S 0s X2 0 RS   0g04o$$00D#$0 #(#< 0'4 0'80'< 0 0` p?0 @92Sg BT0hP_ 00 q01<A 0@@Gp,2`0C 0@0@ e(2 00 0? @0@X00`Fa ?0?` 1`<A` 0@@+A,2`0C 0@0@;6(2 00 @0@? G*`Fa?`?``0SU 802S,P@O @TMJ041SO),T@!)-39X]`C-DBp42MfS,P42S) 0PHU42S 0S P10C0 42RSfvP:ѝ42S]1!$1(1,ЍC0S` SL` d0 4r兄W2S `p` ؀0_P"PR S0SЍC腝@ D0ЍCSP 0Ѝ))<Bs5WA-@T2 @P᱌P 嬌P 姌P@ `p@T 00S p`V@和PD00S @@兌@PhH) h        RRaArrAaU $ D x     Q  @-p@`P P00 P0 00QP  Ѝ 0P< !@ !0 P0i 00QP 4 0P   @-@L0 \:0\l00l0Ѝ |p00p0l0 \ \ P0 S |D0 | 0L 4  1 P00   G-Xp` P@P  Ѝ0!0 0~XY D $X0 MX0 P  O-@,M0p@l@$0`P PprP$P @,Ѝ ᳇ 0 RLŸV^S PP8 PU @4p2 P ^ ^^^@ \ \\\P  " @P@CL0!Sp sppP0 S 0 P p $`l  Ie 0L $ P 20 2 p(p," "  @ "  p@! P0@ S  2"!"0  0@p 6  P p p0@/ //   O-`@PpMܡ0P0S Ѝ X 0H sA 0B { / 0 s qp6<P0p@P x q$0`2&P 0 00 DP 0 0̀0` NPk { 0|`P \P0 0 <`P   K  1F R0/p@- PBUp2SpP^pA-p`|P@P  PP P0S"R0R0 O-0p` P\PP0S Ѝ$P  qQ 0 @T 0Q\("Q@ PQ A BST" R t D r   0 TS000  R ꤐ0 0 m I1P [P  I BPTR2 Q PE+[O-X`0pM@PPXЍ ㊅0Yl0L (2 R0 r00 PܑP" 0 STR rH 0/UP ᜅ  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX 09#! 0 | QP 00 R P G-@`PpP0S00S <q/p@q9WP$0S! 0S 0S,0( 0  P0S 055P  PPpl Q #P l0p<0P0Q*l0S 2Sl  hTP0P  RQ@0 P 0 .A-?`XPP@@\@#T@TpW @@T`L O)O-P@H@M18p p00TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ0 0 0M{ Q P  P0 W:0 0 0:{ Q P PLJ 0 k P<0T 0qB N)rYO-M@L0Sp<`@DH SgP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T: N) A-@/pp0%B?[`0S ~0ES PC p@@0T?  C0 N)0 PK %/ N)O-` 1aMV( 0/ SP0 S@0P`,0@@D0$0 0<@D0& R# X0p1#r#88 (00~z800 QP aߍ0P@<`,0@`D0$0 00 Cp`02# ꤽ ( PW00q240pGHH04 SD00S    408 2400(000@`PP\; K/TbPP05P$, 5P0h00h00U U0@IP0U*0RPd0x1ST0x!<P %4xQP0%8%\0 P0PEd0U03:T@Rt%P Pt!dx1Zb" :0 0t12P0P0$00`P P014 (40PI 02S0P0 S0 $ U 00 ` 0J000 000 000 (@ D00S8 0(00 w800 QP40(R(0 >PI Y N)r@G O)A^!Pg~G- p@r W pP\aPP Pp $PK/D08QP0Q:" 0PS00  Q pzxPh`P 80"8 R 00 05 !$w N),I}p@-@5%SQ%5 %SPQ %UUQQp  0 0Q0 Q 0 N)A-lP`5p@ @ 0% Ņs@ŕ\ N)O-POMprP b5S5圢@TEOߍt f{P@ ET PT 5d 50 ! S$5"R$%P0S4dP  RR @`0d B2" 0u JQP d d0P Eh0K/0h0 ~0 000310 00 000T0 Ctu(%,5QP Dd d0Pa N) PS))Meh@-@ P 0 5 N)0/PS)0/PS)0/PS)-@-   )'G-P`pf@0S p 0S X|g U oT\Y0S 0S@ LPS)-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @PxPݍ Ѝ\!rp@P=0D@rO}P0: S0RP00 0PP aP81: S P% S  R  rPPl#PPPU ryPP$0@PPS)`S)#@@-40P  0 008$Ѝ  /C`W)R0@-4S 3/ 8PS)@-m~0 @(u 0$}a~@XPS)@-[~@IV}}Q~@O-`M$MpP`P"NX1 b: S/?q0P  rR 3~00pPP &W UP 0C P"V R V  VFyPN P P W\1` 0`PIX1: S<V2"MrPpUPV9 (PW002`` 0!$ $PPx P5}0S 3]`P S R SpP`-pP ``!\1 S R U9GPk`x!|0#4PaY $PtBpUd( F<PP vX ND% ܍$ЍIF F F@ 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0Pg^ $(0 $(9| XX5|ddhhllppttp p@-4"4 04"4P0 @ &^#^ ^DD^@@^HH^LLPPTTXX\|`\ `{p` p{ p@{p@-`@"QUpf@p@-@P]]]]pA-P@M4Q->C]->CBX?X\<\99>]9>:>C]?n:>CF] 0? AC>]}C>G]mF]EnF]E~G] 0X J~XpV  $$((,S>,q]}S>Gl]mFh]HHLLPPTTXX\\O-@ ! 4"4!14"41 $$((,P,0`Pp0WС\5 S L5sT`0$ $ 0Q`V,azTvT`XrX\n\`k`dhdhehplalp^pt[txXx\0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 Pv0H0T0 `'!D0DPQpQLt P+ \ЍHZ)O-PM0M:6 PP#P3XP3X0P#Up` ލЍe0@X  v0x0X68p408<`t0D6PDUpU|tU 6ȯ 0[  H?U0 0 P 0 [U @ 0 p p`4H5PY `g0u P0 c0C CN1L13 T,00Y 0100 0 8E600  0000p0?$04ǔ0S 0!1Ч$0( 3( /?+(?$$0 $(,00,00P ,0 B2 b>"9<Q008u@5pp0L0p $(0Ss| u0  0S ~u < 000 S{:0 02P0 @S,00; ` 9: \08%@5  L0 $(0Sf `\t C$l20SV `0 0 0 00@00$? 0| 60 P 0 ZU`  01S0 ,(00(!($ z(q?mhpn$ h(j$ C  \ 0 t+0P000 R0T A'' 0'A P>;P88  P2 t0 l1( @( ( P%h(@&h`X)Z)xZ) 1 RP1H h 0A P PN H0S$00S T  0S ~0S G A@ ЍCgT-P D0 ЍT8X)0X)DX)yW)Lx&X) 0`( "4`#/p@-LP@08200@ 00 /0@0 ZqpP*D 00 0ˏ (0X0 K00T @ 0`; " !000700S 0C600*P( 0ˏ d  0T0 C c; 뫴 hZ)`X) R. Pt!P!0  S D  ZP   . 80< 0 @80< `vP0 P 0 #x0 S00@ ` R Q\Q\ [) 0X) !|Z)tX) !$!XX)X)>!!@X)00S4  /X)00S0`( "4`#/X) 00S/FX)O-M,M@R"\:[$0 : S`D[ ` pAP$ AP 0 00 0؍,Ѝ0 `(AP  LXAP h0S  0 ! oP =0S, "d : : z  [ 054%00! ?0S S :00/0S 0 S :V00#03*  R00S H:0S7  04 2,:* 0S R %P0@4`PƟ S9U)Q900[0 B?CIpQP"|90S  0|  0p 0 ( 0P080S, c/T  Z9Pp⬸ U0 00(p UxPP0X ZP (000@0PP 8L[HP"$0 S7Q:80S6  V0;R01*h0S. 7('d0 ( #0 ]P h70S  0` AB@ (>J60Sh0 0!60(%R/V+: <V3#\Q RmP   gPpQ^q U  #p# PE"\:U PpWh RTPp%Q_'qP tPE! p 10S0AR 0  Z: 0S 1000S x50S 0S 0)  t ?1] 0S 1000S 40S 0S    10S0ꊡ  0000 04 $0 S0 0  00 0 0D$000$0 #600S440S L4 PP g@pt|3S000Q 0pQLtQPXd00H00S1 0S \30S? \P  0KP 2 0 \00&&p2 0@S0:000S0840/<0a0#PQ8`

hO=\KP 0H0EP0`0An]Pp`1PU 0\485  @5D0L 0T b32 R (@ `0 Q%Ϡ<#\ ğ Q  0  D ?0 `#3 0R< S< `3ē0S0x0@S @d0, 9\ 0 llG`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S  ,W0 S\000 T @T`VT0? @`1 0p20兑A0Y 1XS  0<. 0P0 % _000Y 0;* 0 0VT0Q@` @ T\@@`R0@3T5Q`1:@Q`$ 0@0 00  P h00VT 1PS P   0R`* A y_Z)TP. 0 0p(Z P0SLp0AS0Ss p02G0S40000%P 2 @#R0؀R 00 0E#R0vQ& h20S\20SP 0 ,P    P000 0 0 #R0 R  0ttR> +w 810S' 5Mi#R0 !0S  0R ؀xP0 000p0P``0P00C0Z>#IP7Z Z)Z)`X)Z)i$k$$X)$$X)$$ $$$$4X)!%0%@%O%#g%w%0X)DX)S$`%K$%%%O-WM M'0ASy0G PP d7 8PG BP ,7 00N@  6$-P 60S 60ІF6 UKX [0p`06堶0qY0:6 R W7`PaVsPVyWލ Ѝ8F DP P   -E 0S 9 P` ILv! 0 `?00P(0S Sxxep%`W@`F(`P- 4 6  B2 !  ]a5( 0S X 00]/ E 4 R &h( `A`W4`F0(`SF T0`(0W0S,pZ\40x`S@09Z(0F0 A,0 S1 # (R! S000000Z!"!"Zdxhp20]/  ,0 ^1 #(00 S ^),)-*- 00 xP 0E0Z*( R `,}Z2",0Y(0!Q@E 0 aV!Y"YdxhZQ@E0 `aV P0 (0S $ Q P00r|0SZ! $`l\ \T10!00C04P0 700000C0!" p'0S@0 0 0C0z 00@u$%X)'&&Z)Z)Z)XԂpZ)Z)S&$m&&'Z)xZ)&DX)&0X)&X)&4X)'$'00S0`( "4`#/X)O-̢̒0`1CMa@Tߍ0S Pdp@FDAG@D0 ddp00@00C0 00 R2PU 20S 200S0R0S P0:000RP p 1Q RP@h1 R 00"P <1w00C$ P X P;Y0P0!!0p 0`0L00QpcQTt^X&Z`00!Pa l0 0q 6000Z)Z)pZ)7''0X)8X)DX)tZ)W)Y''`NZ)'8OO-p3张P M`@?S \P  ? 匣 ? G0 Yd#d3 0RT ST 0H#S 3S 0@ 00000CSFTYr P 80R000303L32   ?gS` a2! Q,S Q0tB*?d2D20S  P P 2 PЍS  z %Pj?00 1>!  R1\ 10SK0T!  0d!S@1`0 ? S00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0 ؠ<0 <Pp?pW\ 0P%T਀X僀 H\V00!` 1B`01$dQd0,P0C00h01`l0R!B1d0-0CW P0=SLq QT00H   0S 0 $5> *>==0S %0 08S0 $5B111`R B- 10 0S  $~ꤜ0S%  0帐- 00$%BR0ө`S<B11@%L0 ᶶPP 0 C, PP 0S  x<P` *堐=L<@<0S 0 02d0pA?P0x;3A?`0 =<0T0.L0V \;0WHQ RX0>F@ @0V8 84<ϠQ bz S R㴪,0 S[?^ @3P= :0S @0 # "@0A!" !@0 ! @ @0X ! A,P: @ @V0009\J*=P: D:0S =30 0؍ߍ0<00

! A"$5S8GP(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0;T0#ST0< T2T#2!S\0P (TV=SL5s\35 `!~?X00S-[" !>R\ /   B  R\ ?0  020C02`H0T SD0\ 0 2!΍0h0H0DlE "0AS0000 04"0C 00S\0X00!!!`V0: 0LphppPp P`lXX ুX姁0 8PP~,2!~00<0S. d~O0 ST0Tpp101"P Rh"!>2 ԐXdOpO0 0 OWO000$5S `0|63! 03080H ` H D /D VS>h p@,0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//Z)O-|4MX hDhhdhP@quP:0 0p 0<&0|&0P47p0p 60pw>p0 P0p 2S # *HP *HP *.mVXZ hY 4[ 0SV?관X V. 0[L  G <0\;P$V$ Q4C ?F|PPe 2S|3%8 S20#"20$#20PB 2SAt000000' 0@a$`02P$V20A\2@02 G2C`/H `FbG 0| nFH  ?`0P,Tt#0`P\`Q=S/0P 5` ( 2RV0 SS!c 5*< 52h3 \30S 0 0`20S 0d3 0 S` V 10S0DS@ 0(y2= C ,0"000 0t00C`r'? `0(" r0S10Sʸ10S0=S0S PB܁q000F ` 0L%000P%X30,Jda *=2- D10S ^T0 0Z)X)z.X)..X)[)..xX)W)Z)./.Z)Z)"/O/S/\/////$0TS0p081TZ114X)1p.11J22222g333X)0X)33'4L43X)4Z))2p23D32w.;3Z)q4Z)Z)X)X)X)X)Z)448[)0S a{&PDa 5*N> 0:#: 51h1 t10S 0 000S$b V1P0a0*o11^ 10S 0 00<cQ6dP 0\b<0*O1l2> x20S oe0 0r0S0L%r0L%r0H00q" T 000cH00STPP$c*143 @30S =30X# 0 00L40q#  c400cL00S 'Pc*0330S  0# 0 0x4 R.0E q\ `PVR d0SPt4d*0440S 0$ 0 0$d0Q,%R0%45 S R! t0040SPTu*0d5p50S 0% 0 00u(0S xQ$ ]0S< x 0(%0Sv8Pv*d06S$60S z0<& 0 08%<5HSR$ / H00850<SNiPv*606%60S VL0& 0 0v@%D5LSR$  L00@50DS%:P|w*0770S '0' 0 0 7 70Sx,w0S0Sp0L5sl0Sd dh(000(80L50P5?T5V> X5-0$0B0^ Ӏ1`@R$@@B!!@H0 000L 00*/880S 0) 0 0h P^x P8YQڨ0QTڠ r 0 0S Pi*|/9k90S 0) 0 00S/ 2( (U0S0QQ&d @0 0S }Ppj*J/:9:0S j`0* 0 0 T0S T0S EFT0S-(Q\KQK RP+00S  E~0 ppV aF!` . R  ` T0S72 T0Sb]<Q| T0S T0S T0SH  8%L < @%DX<0,5S0SO | ,x000p<0,5<0(5H000/85L0<%0/@5D%4*.<<0S 0, 0 0(=0S 4=0S(@M*.P=\=0S 0lmh .= PA P<= 0S= @PL Y p G@TW.  @?00@1>0A@O@@۪X.Pd7  F,@>P* ^ P;0.00 0 S 1 >5> > ɦ>pæWP?ppY (? "00@DT@8 H4L0d Lc B b"30@`P Y) ?0S  8 H4L0d @ B b"30D60S  6p00^Pt6Z@ BX6PL 0Z0<& 5000,60S 1S BP 6 5 @Q ^ U @ 0`P@@  04 8 <%c#!$c4"x%S X50S `C\P 0 0 R ``0  0 04 8 700S4!!: S *C   S D00S @-4 * R  S//X)4X)i7x1p@-0`S d`@@ ~T D10S810S( 1p10ST00S p@t700CS0P U 00CS0 PPYU NU >YU0 P0  0 0 S0X)|77X)Z)78X)X)7'70'p@-PD0@0`S  04Pp0X)77O-01 (1$100 ӧP `p1 ` ŧP 0P  ` PP P(㴢 @ 㯧PT00 [T X   ZP @@` 00Z)Z)0  <`0@p 0Z)77Z)$828O-pM0P8 0PȀ`0Ϡ," Z 0 Ѝ 0|xc@Z ЍO ?  P (  ? L0@`Z)xX)98?828C-P`U@ (1  UP0 PP0 0T2`p؀*0 L@D0T@S   *8 H4Lđ0Ϭd @ B p b"31 }0S   0P00`0@T ЍZ)i8w8X)N10S0 L5as0倀Sp QA0S  00 X0S | 7A0S q ?># $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT94X)89Z)X)0 \P/Q/ 0   Lq,PŒPŃ ,'TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*'3`30S 0P 0T`dSTSwPsqPUU00Q AP 0S ??@:RPP`"hR0"00S8 lr003Pb0S* x?0S* 0R0E>0*X4H' 2p610S g]0 00SLYP10S L 1TQ `1*'X1` H10S :00 0H10S <L (1P 0*&0`00S 0t 000S d0P` 0ѽY 0GZ)X)Z)Z)X)Z)X)0X)r91p0AZ):<0 0 1S01/ 0S00/Z)`0 5 /H0P 3S P 3S P///====== >>A-@Mp`;@@ Np@ݍ P@00@FT00 ## O-`M$MpP`P"NX1 b: S//0P  rR <00pPP ʜW `UP 0C P"VqR V  V7PN FP P W\1` 07`PIX1: S<V2"E4 rPpUAPV9 PW002`` 0!$( $PPx (P5j<0S3]`P S R SpP`-pP ``!\1 S R UPk`x!|0#PaY $PtpUd( FPP X ND% ܍$Ѝ]Io>w>>F F F@00S0`( "4`#/X)G-pT1P0@0ʟ 0 v  X 3#15`05à121 R0` e Ppp0a0!R00S! G% 0%# 0!ZXl000Z T00!ǁ8P,00X)>Z)>>X) 00S/X)O-,Mp0`P@အ0V000,Ѝ00 ?U0$p$0 0000 P$0S k?400 0 PO-X0X)>>X)A-)@`qP0S<00a 00 0.P000P 0S SЍ0@000 ? 0  r@ A @`P@* D00S ܽ0 0X)?0X)g@??X)#@x@@@^FF^I@r@X)@Z)Pb),@>>@G-QP a3AS0@`` M` 1P11r00`S00 0000P0PU 4py@p@YU 0002 0zP@  Ѝ0尐ATP  0S xC  aP@D/P800 T0SpP8Pap00Xb)@-,P ,\  E ЍXb)p@-@PWp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRppZ)X)P 4,B 5*< 50d30a3210S "0 00@ @7.Bp#x3 Ŝ & 0P xXPA 5*< 50d301$10S 0 0@ d3S+ CQ+aQ# 0AS"P 0@a3d3*|0p00S 0 0@S Ѝ044X)Tb)  T 0S ,( PQ S RPQslG`G 'Gzd@GGGGHhHHPHHHHO-P@p`,M$P"@p)$0S0$020S($2pN P V 00D 0P0P 0 0M fP AP PP XpP$p,Ѝ`P 0`P ,&. ?o  0w0 00  0 ` p| 0Pqp Ip UNp`(I '.IDIIYIUkIG-@pPT!娚p`:D10S:  p o09 6X $$ -Ap+ P%W00S $$ -1p YPPU `fV rV GT!P$$ - p$I 'III JI%J @- F o̅A-@P`pP 4.\ XqT  @@k 0U  A` A,nHJ'MJ ,P/00#01 0"$#HJO-P@U \  p耟蠟 U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G- 0 @,a,q@P^ \ ^0᳀ 0S@ 0S@ 0S0@@0\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PO-0P$`ᒋ@P 0㘹z'0 0#Q P ԍ@ Ѝ P-@-0  Ѝ Ѝ/4A-0 P@$ 咁p'`0 0z#QP Ѝ 尲P404TNA- R0Ѝ耟P@ olP0`p 0S 0SS0S$$7# BS 0S $ & `  HaP`$0 & `H>.sN-@-00@P-r 0 Ѝ@ Ѝ/-@-P 4(P | Ѝ Ѝ/HJO-MPp`7@PЍ  P yP 4S  0PT0P$@(Q$ P 0S 4S $OX 4P S $ ܌SGڔ!0  p`000 0 0  @ 03P 000 00 0 0 "P 2 T`嘖&P%(0,p 0p$S4pS 0  p" |0 J0 `0p"P` 00P0SNNNNON'OQQZQQQQQ @-@P 4B BRP p 84   Ѝ@藯Ѝd@QR@-@Pp P Pi4PS 4 TRRRA- PpP0T@ `{0X0 u4 Fp( @pRR$$@-#R$ QEAS$0Ŷ 8#8"(Ѹ0 / 0T 00 /$4 0T0 / $4 0T0 /G-`P@Pp 1)Pn#$P` A0 `A00 00^PU:Ѝ 1 00L0@0`MP1 00 DPUSS'HSC$$0A@-#P@- x`R@dЍpP aP 4 R 0 H>.QSmS}SO-Pp_o!R0`@tMR(0S00S "R0l U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 60[ 2P#  7/p ) 7/p 40 P m0 $8P  $P P  SP SA-@pP`P 5/p 4 5/p 4 lSC-(00pS4P Ѝ$d@ 0 ""  0d` 0"0  0 `WP SSSO- 0 0pP7@ጐT`  #P `V H<  0 @H>.(T0TT8Tp@-P@`0 P@Tp0TTO-P`,M p@FED0     R  0  0 pl PU0 (P p⻤0 SE ,Ѝ0TSTO-PQ@04p 00` ЍP P0S*  E `P0       04 p p#p p04pp  cTU"U>U0s@-S`@ P,e0 KRP: pЍp%   iQ000 BR00P0S H>.^UmSs@-`V@Pi'`l` d0 ?o2R0S X'0ST'00 ЍpH>.mS@- iR sR aR p` qUp@-P@^P (`Pp OpH>.Up@-@T 40`PPppH>.UiR@-- 0 aR bR LR( sR% tR@#P 0gP0S`00ap`(a0 /UH>.U p@-M`@P`᝺P0 0͵0,ǣ0S  }ЍpSUUG-Q@`M QP  ЍAP $TpP l2B00 0 p`P lVV-VLVO-$M@`HP ,`$ЍPP 0 0 0 $ Y># P0*{!Q P0 0?Y S0STP pY0 P pE00 PU 0ppp $ ׄP 000 00 pqP 4  $\$  0V,S( 0 `$4 80p| Ĕ$%!#,[PP T P R*L0Sh 0p_ L004 0 000 0 PM 4$$  $ 4  !4 "4 $@p7 gVVVVVWN/W00S 0@-@C^M E$吢E$$0 0N1PG1Ѝ0 @x("(!u"`#XT 80 ` @gP8d 'hX|XXXXXXXYYY0Y0$ 8O-`LMPp4 #1D0J00 ᩐp  0S& ! R"|!LЍLRR a0BSS0D1 0S  0= P Ԣ@P   8 @ 㜂Pట   T 0 0@  T @ 0  @ P@ plYXY '0mH>.zY|Y~YY'YYA-p`(P@pP0 p!`P @00 0$0@-@P$0S 各@荄O-@`;0S؀@ `@` 0@ `'  0 T0YX@`" R   0 R 0 0  0 00 0S 00 000Sp0Ѝ O  @ ` 0F@T` T'U@ ` Q  R0P MUpP0 0S 00 0 0 RU Q T0Px n P0 @  T 00S0p@ `-[H[l[[[[[[P/0S//P/0P/G- @$P Pp ` R Q @Y R0Up@-(M@`PiP<(Ѝp ( `PP0  4[2\@-!T@7L0P 6S<嶟445?@,P(@0T㪜\\'T]`]]R R R @-@R R/////l^ Rp@-0@P S  \ ppB \"S@p p_h0 `pppppp, !$0ppT^^^^\b)_l^O- 0`@P+P Ѝ0!S R m0Pp0(P\4S 0D0$$ 0PJK8 S J R RP304S ڠ0"S1$0@ 0   403/p 8 H06 0($P  P 0$ 0 0S (0, PpW_WEVk___^\b)_O-0P`p,M$0 #{p@20S$`pP 0 0!  pT AT fT @,ЍsT00$[p0 0 00@ 0Oqp 4 `00p x0804S 0Q1!1 X R- R02U1 0S.` R@H!H5@1R R8 H0 0 pppW$00(p,0` 0S0 00` 0`Z]p ep{ 0oo`@  0Z p@i@e_ '___l^eX8e^b)z{eA-@ĔQP MP 匀 An`` p pHP L?ЍEp ( 0 uuuuvG-@PNp% U4 d$! ᴀA~ p $$ 0 P ! `" $`9p  D 4`B~0 H0 yu vu=vQ pO-M@/PpKPDEA =9$R 4SЍ4 R $ RQ ^ S P $ 4RS  0I  U08pP  0S5 P; 0  0T`P , ?o  0J0 00 `gp X 0&p,`vtvvvv#w8wUJw[wp@-@M@P`4 t0<000 }p L00S 08 p'@Ѝpw 'w @-̅O-0p TM#$$0@`40#KpP>20SK@0SD00e@ DP 0SD0SA \^<40$ 400#qpp, 804<0QP$ 0I,0 ( P bU@ qU PH04 80pPTЍ0$$ $(`Vp0Y`0X0 0000 WX0 0 0S$ (0 [ Pk$0 0(000qpp 0 QP Р 0Z!p , C$p p  $ x '̅&xxBxrxxO-CLM` I@$P0$0\%spP50S @)LЍqP sP @0p0$  0!qpp PP`0$0I$$G0P00P 0 0 0 00`0K0P(0  0 0(0 040;P 4P 4  0,0$000' # 4PS,00 VU$0StP0T ᒃ!088 X : U S  0  <0P<0 (, S0 R S ,0, S00,0pU000U0   00R 0 00S[W0[ 4SX 4SU $0S  4pW4 P4\ ` 4 "$P0 0S 004 b8 4  !4 "$0 S40H0L p 401ST>0 S 0P 0T 00S!Q` S$NP$ a@ P PT{pT T  0$ЍP`{&{ '{${O-P$4TM⓲(0@xp  @"`B @|巘0P|`TЍ X 0 `ꀠ @000 0 01R0 0|¯P @P0| 0C`l1  00B0 @P0@0$ 00S+0"+ /0@YQ Y 0  0$ ^0P|  V# `F0,0( ~,0 Z 0( 00S$EK%U /0 @P0@YT Y {{{C-\MP0  Rpx`| )X%0CP00͵@ @    0 08@P 0 ,`0S Z \Ѝ{{{@-0@ n00 09 0 :Ѝ{P `00CS`0p S00 P0S X0X /XR'3S @-xMm0 $8|@U|@ T K|xЍ/{C-p2M`PqP0HЍC0 0(p XV pNI !80pp0 0 Η˗P  @08 0@XWF QX9T嶗 3S   PPz8m0 $ P垗 0p UU Ѝ00  ppP冗1S1S}tЍCw2XQ' @ inx{{{{{{{ ||*|8|j|G|T|Q|Y|{^|p@-@`MMPR O L4S xF0S hA  . 00CS 0,!80% ,܍Ѝp A!0 0 0 D 2P  0 %P t# BP@P 8y|||||{||Q||||O-YMp MPm @`  Hі  ͖ %Y?H0C[?H@0 00 0剐0 `0T 巖 峖 p n Q ⨖   _ 0g J.J0 BFFP <#0b⅖0Sq3#Fs#fF?w"袟jF?pn k0$ 0!  <#*Pq V$ĕ 0S,T UV:#@G[ 0000p P 9 m0$( 8u/J(0 B+0z/C&#$ f$@^  @TYލ ЍP!fF? S1># r  SP P `@(VL?X?#P?U`1?`#X3V`3!Yb!V]##YPWU (00  P xH00  P L= Q: ,4   P  P X1  P UP1`P00    PUMHb){0~A~'ht@~b) 'I~ }}}s~~w~~p@-PM@P`4  1L0$00 =p T  3P 00S  0WiR TR LR a0BST plRs0BHPЍpTRp̅~ 'P~~ {0@-$M` 0 0@P!!.R@-@08 8b)R@-@0Q  $   c)O-@P5Me0%sp50S ЍO&0oS00dpPW $$Rh5 \LPA x`VfPP8 nP. 呑@P* bs%0$0CS0idP @4 ~MP oO@0Sa XdPP KPn hn PoLP  <iLP  (cLP  ]LP  WLP  QLP  KLP  ELP  ?LP  9LP  3LP  t-LP XlP  RP [@X $mMP `] eMP Pc @LPT (n"80x2x LP P R0* @,xKP  h]lPh cP  P $ 02#U: $&MP  c@Pm [1 KC tKP 0!xdx ULP x!0xx JLP "lLP "XLP #DLP m0$ 80S mP P "LP@/0T r00ЍdH>.| 'h  \ÆȆXΆӆކ .=Jhlv|ȇ߇0'O-@`pZM*}p:0S ЍO0FS iS:PpC>؀C$dP W h[ЍPP W00  K zPd0P 0S t{cP0$$XP/ m icPP ecP (0XPl0 IP $0   p Q4 pLKP 4PK0P 4 Pq  G P000 00[00000 0S$000,0cP xc0P(0 }kPP m`P m$^pPP0,=$4 KP 4` P `P @ GIPt H AIPn @0 SD00H0$ RL0, 0` 0.qph R$4,, 0qp$0$` Q$4P `$$F$4P` V b`P% bP! e&)bP jP :m`P :md&? ` 0qpz80p HPp6o  HP 5  HP 5 HP 5  #HP 5  CHP h5  2HP H5q ;HP (5  FHP q/  HP r HP 01S 0r/S㲰s?+(Ѳ Ѱ  HP s/| HPt$$嚕$4P}(ajP} <480C(0l`P l$$`0 Cqp\& p0%< IPp3C<pP H3< 5C(< IP <P3 JHP 2 CHP  =HP 2< SIP $ <8 HP" 8 Y* 0PW$ Bp $ Pp$4`  0qp<$ W$4 (0 8\008$0 0(0$0 00,0 40P0,` 0$00P00T0(01 X-`0$$qpDu$$ɔ$4P0 00H00L0`$4+` 0qqpT$$娔$4P`4X 'DH>.\r6!DL|V̅[aeΉU~FTcpTˊ-0@-@M P    a.p@ ⨹ 0 p 堹0Ѝ0h'i@-SM@P,  0 T  \ $ d l 4 @pt H0P0X0`0h0p0x0|00t0`*h 6XB00DL`|`p   D Sߍi@hi!i@-@    0`( "4`#Ѝ10S/p@-!MPM@P% PA. (01P A!AxP 0`0?oS c` 06P ``(΋0 0A. 00P0P A Aⶋv寋0 0A. 00Pl0P AX XA\○0P 00094匋ލЍpoc)h)ċˋ؋s@-1PP  ⵸P 宸 `@TЍp P  00SUV  @50 R !7 O-M@ Ptpp" `P"p  1  -_P? b|_PLw_pP bplp_P b PgEP 0"h 0R00 p!P ! R% R/ RZ  '0P)W, # el@-脑@-M X@zAPH0H+. {00 0o peЍ軑iΑ@-M X@ZAPH0H-. [00 0O pdЍܑi0-M $00; P  徳Ѝiz@-@4Z P(0(, C,"[@00@ P/a CRWC/A CR=C/@-B 00@- M@ 0( 0 p Ѝi0@-PM  \P@@u 80=P , "Ѝ0@@Ȑ?@-@YPP Km7`PR?0L`/0P.C B00 0垆t0@`Vm`l0PR/C B0\ L@ @@@@剆cㆃ03/` `y&ʐB'////0 L0L0/`y&0 T0T0/`y&0 \0\0/`y&0 D0D0/`y&0 d00d0/`y&p@-@pP ~00p00D S 0A0CSr0$P%>Pj 0@p`y&@-p0 c) 0`P/ R/`y&0 O-4M@@!2T0(  D導pď㏲ P(0$`!pSp D@T PoS@ڐAP`@ UptpP`[T000 [  ǂ R  P Q R. 0S $P\(P  1/P @0S  Lp "SR(0 SL\ 2/P W0 c)bɚ;6ep{O-M Mp@p U pP< ( I`P  0Y000 rQr/⣄  B[>Jp0b ۜ 3p Q h兄 A@ p 0 Q (t%_X[ Ⳝ`00@0 0P[: 0I 0囜 48<p 8d0Pt0r 0` <04pLh <D4g8H0S 'P01t%H0S>I0S;X`PU 0 3/P:㸲 "rⱞ0r00S:00r% ⣞r0S X   03/q 'I0.}pNI0S QP E"%J` 1 `E PIEP @0 l1 LAp 1 LJA@!1 ,壃 `` #%J_!1 IA @@ |1 A!1 MA@ =PPU_ 03/P 03/ݍ Ѝ蘔i~imb`y&i(i<Vn c)xiՖO-@PpP  p 僰T V@VPT! oWR`P XlPLU @1O0S aaÀW 6P.Z  /P' ?P! K0S 0 L0S 0M0S 0 N0SO0`S PPV 㛂#4p c)0'@-,MP@pP %WP`( g up0S h H=P00@ 0  گ,Ѝ"h)8i(,9i@-P@A0 Pǯ{G-@VPP0 >`@ Y㌀,ZpZᯠPP  ᷗpp @ H@@@Ge@蓤2h)s@-@~V@P800ЍpYPY}@P <` 幗Peu h)s@-@TV@P0{ YPYT@P L` 吗Pdu kЍph)A-@'UVPP0 |`@YY%PPp Gp4 BFJN@$h)3@-@ \{<PP0P C}D 0 S8800 >00Ѝ;Eh)!'U0@-M@UPUP UPpUP d0P P P P) 4P6p 幮Ѝ0$h)7i7@-@4dj \P HbDPj P! (X Ѝ0S @EꭥA-M`@PK vpp"P  (    ~ ֊p' (( pt"^<@T d8P\2PL RU TЍ0 PBb@P6 $@噊p 噕Q t 0R  k)㙀 㗀Pp L`Ӏ X`Q$R@ɀ ㅀmLP:ЍAcP\ 0P R   1 嫀 0 RSJ囀噀 $ R0` R P U 0pD` PH8i(i̥ͦצަ, 20Pp@-P`@TP V  U`P Y^`V^G 00pTTpH^A-@T 400`PpAY0 p @-MPP00Ѝ`0 00p0@ 0 P jW0P 0 p 0 `P0G-@(P00`(  P1r0Pp*0X!U0"R0 "00"SЍMF0P 0 , \p 0 @0@-@P ]@ aO-`@pP,(0V0S 8@`P$P$P 40S 04S 0S(0p(`8P0S$0(PjbO-M00q W$0d00Ѝ`QB QE 00 :PP0P XU =0ὝP ,,?,p4@[T /;@P00 D0800X5T (^( R R["00aP 000 Ps0"CQn BQj Qf^ 4!<5Xppg_PPX Ჰ  $P VpaWF 0  Ep? 0STt -PPX!0 8!100#R0S 0m8\@  0YPpG@T 0CS0 0 xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@D@S 0@0@D@ T030ZU@5aTl +  RP=\U< E|0 0 0`0&)$+3A-X Pp@`P00HA0P 0 p 0 `P0O-P`$M@ HpX) P W0  ~Pp` 0p0  0PP:PPUpp ` =00Gߍ@SP|S 0@R xF/ a R # R # ,cp ZJi3'CC-P1%MM0 @SF/ <8/ =p- 9pDP08pN/Snp `|0 xh P,00P0P,00U0,(0DN/V{%ݍЍh)Ki{ @-p 僨Iip@-d`dP0S s@ Ppf 㦄p@@pP@@&h)O-(pPW` 00S\1 000xSP p810! @T Z  /P1! P `IR  B`W    <P Y:WWP PND@UWAA0@D@W@D@@@@''0GcQp@-@P&00S#0 000xSz`Vppz`   ,?QQ0S p@$$z 00't{'p@-P M@ U U( `0P0 Ѝp 0TPTT@ !!0P!!`ZPP  @= 0A-p`Pp@ @P(v  Aփꈫp@-@P`M   `ЍpG-SMMPP|! p\!#J`F( p@X@)0#30 Sd0 00#00pH0pM/P41S (0Y CM/Zyꨫih)p@-`M@jp 0+SЍpަP  ?   R # <3p u01S q0/S W i  00S/@-@qyoc)A-P@`TpP @ 0SP |'0A-P@p `PW\w TRPH0 000  (p`YT':i@- M @ph W T3P00 Ѝ0( 1p ?|9i@-(M @p  / R5P00(Ѝ 00S D 3P02 ( p 뤬9i@- pp 0QSЍS   xȬ/ 04 8 <` S $S HH @S/8 S $, @$/ //PPPP  04 8 Hi@-@(M!  0P p@  0 p(Ѝ诮iЮ@- M t@}2Pd0q T upD 08 0lp$ Ѝ߮Hi.iA-M< Pp! Ҥ0@P 0(0, 00` 80tp0@`@$`4 <0[PL100 0(00080, 1p&峤 B!P@0 @ p  :R@00C00 3P?00ݍ@ T0S h}@0 @P0  S 0&i8Y.'7900@-|@4M P7p  tP %N  $p9I4Ѝ0hi,'@-@CM`(  TpP 0 P P PP  8 ! ll pz l RvlmU#0P 6yp 6S30S xv0\P 6gp 6SL<30S 8v 0P 6Up 3Q?vI0P 6Gp 2Q8v8 ) 7p 0S0 7v8 ,pt &p l p 0@ PPo@2Q 8ZvCߍ10S Rv10S KvHv0  `0000p4vPU0``0` Rڬt1000 0:S R DP4v`pPQ  vV pW ,PuFuH0S Lu uu`su`0Q u u8i(i`ihc)) ǰi8iii аװ߰'&#0@-@Pp@u-uM%p@-P M@` QP0 aPp@@S ЍpiP@-< @/P(0/ Ѝ[H@-@ @y/P,03.  ЍpH0@-MP "M~~@PۍЍ0@hS P P+ }P@YSۍЍ0@}0S0S1iSꅱ@-X @/PD0D/ I zpЍ讱HA@-X @d/PD0M/ q  ]pЍٱHO-`MM@ <A0P0< lPgE7EJPơ7U'S(0`0@$0 0 @`F( 0R|'P~$0S0'V$0ʨ).0030070 0;00@00E000$ ct(@!!0 X q0 /C BRY  0  00=C$0Cȟ"!0``F ^u E0Ĉ800IcCP S@BA`pP8$ 0X00p` t!0@"0,0,0SD s0( P0B'S(0؍Ѝ 0$0'S   BS>C0C'S Q:ǟ"!! CR   ##9C0C"!% X'S8ǟ"!2.B$ǟ>C"" ǟ"!/B Q 0*Sz S &S  2S% S`r 0S R )Sx&0C'S000S 0 |Dd |0s0, 0 B, @ R `(vSGs X>;s 0R 0ts`0S ks0S pe0  ]s00C!&⩐`YP0  @Ksp Es0S VE 04 8 <$S9tG@-s0S 0 %su s 0  G0cGA00pGY#q0p`FL`[! i a`V1ׇ!}rxV-0S]  }X 4=4 0rI    #P# $P# #ß P r|3Kl#S0S XcF @r0S$  rS sr0S r뭏 `p0VVČ   "0`r V/A@r0S 0|HrH}r 0p t H~0H≏HA00HZ0  `F[0 pg&V 1 !^ 44 0UrJ    !PT! $PH! D!l P 8;r41KD  @S0 ,Sx0 iͲh)3 $hc)^Mm7txP3Ƴ:)PPȳL8?=FKP[fpxIJ0@-M TPp@@1PЍ01 @iDX 0 /$&/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0d-@-  VV ЍЍ/@-@VY.{ 0S/@-Di)-@-  VVC ЍЍ/-@-  VV ЍЍ/@-\00S 0  0000 0 UpЍDi)@-@yHTyNyp0z뺅p 0Bp@-pMPP2 P0S 0@P 0 0 00 0XiUp DlP@@ ((@,P0P4P8PS900!031 0@-Mt 0T@P \u PLPP @ (@@ 0TP 020Ѝ0(&Li)@-@4P ,p$P<A pm녻')P@-d0 !X !T@0 60\ (0000/ɽ޽Ph0h@-`  !TD0 60\ ,00 00/ɽ޽P@-P040#^4<\$0000/ɽ޽PD0 40#\00Q 00/00ɽ޽P@-H 0:# ^4 0Q$0000/ɽ޽P@-H 09# ^4 0Q$0000/ɽ޽P 4 <# \,4Q00/00괽ɽ޽P@- 0:# ^ 0Q0P@d0 :0# TDD#^<0\ ,00$00ɽ ޽@- 0 00lP Ѝ`60&A-PƓp`@WЍ P 3MP@ p7@-P@U0  (Q Ѝ0CꜾA-0@nS0oSp@ p5P`\iUPQ0nS0oSRPPRPP'ꢾ@-f0 =o li$'O-@PM p0`<"P04"4 P0("Yp/ 2 00CS20%|000& 0|0`P0 +0000 0p00*0 &0Z tpH `^rPdPMP UP4 GP 01e@ P 00 0 00 0< 0~x`|P 00  01P&" 00 0< 0ft[,0t0Z00x0V 0;;0|0Ѝ@>. 'H>.*p-BMMI^@0 P@M00 \ 0sp0 @0 0/ 0 JfEh29B7@-@P #J0Lo SϜ 0 彗 Ѝ0/@-@B0P@A@-@dD0P@G@-@ I0S 00S0?  呗ЍLp@-@PP (勗0/Sp,,p@(,bw@- jg'O-`@ Pp(,000 唐唰00 Xp0@DTq oP0 PTP<IE8 O3@>. 'H>.g\@-M@A>0 0D@00 h0rp0S SD N0 $ 0zgj{p@-@PᔬP (0/Sp+p@+w@-~ WjVg'O-`@ Pp(,E000 唐唰00 Xp0@DTq oP0 PP<忖8 O3@>. 'H>.@-M@A>0 0D@00 h07rpI0S SD BdN0 $冖 0f(,p@-@P P (w0/Sp+p@+2@-  Q f'HG-`0@P $p堐0 Wp00@DT oP0 dLPPA=  fA+GH>. '|@@-M0A~H` 0P0 @qp }fp@-@P᛫P (0/Sp*p@*/H@- ^i]fl'O-P@M P0J`TrP" Wp)@20 R. +x   &  x `!p0 *00)0 &0_ qpM 尕uPfPMP- 9P GP p1g@PUP|0 0|00|0|00|00|00pt`x0 x~Pmi~PZ,0p0Y00t0V 0;;0x0UFc$00|00|000ЍH>. '1\-MMJNP0 @PG00 |0pp0 `+0 0N/0 4 劄0@000g~e9?H7@-@P [G0Lo SϜ 0  Ѝ0g@-@@0P@y@-@A0P@@-@ -G0S 00S0?  ɔЍp@-@PVP (Ô0/Spd)p@`)@-嫔l@-;8 l0 0}0000000R h el'7@-P @FP00S\ 0 傔 Ѝ0mp@-@ PX0 0(pᜅPP(rPdp@J@j)O-@H `p0H `\\T%~UpH50`FVQ< 052@FP50S  5 40S 4 0<0074a08:$0000000t4Dt0@90;H4giP04P 0 4I_0(80@008 0|PP0       +  @   '  & B D# R4#  $# R # , @ ( "  )            N|20  F|0$000 p<|0 000 L2|0$800 ((|0<:00 |08:00 |0@900 p |0,000 |000000E|0909 1R@11r0$0000 00t0,00w0 00xz00007000+ 4 z Ѝ輂&& 'lk)dk)H>.pk)HShk)X^dmw &A-RMMIN@XPpD`p`00EL u눁H00p$xL0mnp0KS 04  R< pL04<0 归p? 04n/`  0HP  0 ,PEP.0D pP! D4\e 4$04 0404040 40$4 0(40,4`044<$@DeRݍЍ$"'bdk)p@-@PP (g0/Sp'p@'H]v R R @-J/0@-@MP`p 09m000 vnPPЍ0P0 0 0@n0 m0P ss@-`/P0@00 lP0 WЍp 0`( "4`#/s@-@P`0 0Pd00SPPP @@ 0 dЍpj)(002P0/0@-@CMP( P41010 0000000 0P [}I< idTH00Cߍ0Cߍ0@o꠆G-0@`p8Pp6 8Ġ#̌ Ƞ,Ƞ D4$03 00p4<40 8j0g,d<0(000pE040p<0< Dp PH00ЍpJPF PG  dj)HbxcO-$M@0 qB`Pp0 @T .V0<00$Ѝ 03/ Z0p NBP P @0 ` g0P":@ 0 `  p00P LH0@3/pP)B 0P 0T@Pp 0 0 c꠆C-MM`p/: 7 P@1L#Pd8$#4d4# N41wD0@@ 0@00 0|@pbߍPHڀ@Td8$#Td%4j)C-P[ 4M@V@}0P` :;0P`P)%Y  00h 0 P  H%0< 0``00S0 V0S`0000 pp  iPPQ8#0!D0D00V 0 000  P0b"!4b4#P0P4Ѝ 000<0k)!NRj)0@-M 00@08 P  ᗓЍ@- ac``'O-`@M$  0O0p 0@"@0"@0 "Qp20Q0CS |2g@xP0p00@0`p 㱏! 0 xP夏xP tPP*0S R  ㅏ P  x| g!! HNPP0S R  ”P   廔P p n+ kp t 0[4S08pS @p @Ѝ@>. '^xH>.4tBDk0@-M MCN@80P0 0E@(00 0jp  0 @a a a(;0P( 0a,@:0P , Ha0@aލ Ѝ0@aa|7@-@P !A0Lo SϜ 0 廎 Ѝ0@-@90P@@-@b;0P@@-@ @0S 00S0?  収Ѝp@-@PP (剎0/Sp*#p@&# 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0P) $(0 $( XXddhhllppttp p@-4"4 04"4P0 @ DD@@HHLLPPTTXX\|`\ `p` p p@p@-`@"QUpf@p@-@PpA-P@M4Q->C->CBX?X\<\99>z9>:>Cu?n:>CFp 0? AC>g}C>GbmF^EnFZE~GV 0X J~XpV  $$((,S>,3}S>G.mF*HHLLPPTTXX\\O-@ ! 4"4!14"41 $$((,P,0`Pp0WС\5 S L5sT`0$ $ 0Q`V,zTvT`XrX\n\`k`dhdhehplalp^pt[txXx0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P`B 0$K]"ZЍp|k)o)o)o)o)R/Es@-P00S"0@00S |000 Ѝp@/ ?,4P0`@V +B 0$]$ZЍpo)o)|k)o)o)C-Pot10MSP#` 1R  0  ?<#΋ 0`x 0`0 C c00 d0`c C ca0b0 0 0 x q\41P0p$Ss $$TGQT`P@UNl  00 ЍO St hhȀӿ XȐP̿U)P,o)o)U TTt0p@-0`S[\@ LL00S000000B0E0po)&|0P000/000/B10B1/101/ \'O-TUM p dϠ 0@ `Ì0 150S  C0 R0S@`Ѝ 0 R` ` b42 R ( o)o)U &'.O-MMO⾟D`, %5_Q0uPSi`50c4ct%?D0Shh,/nD? 0?D4hPp؍ߍ 2@ŒD 0L 04;20d04 0{0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#80Ac0`p 0 40S7{ 3 0 000p0  8`  aZ X &Z0 ``ao,F Ϡ ß\ ^/F222902?"""0Pa 2@őD L 00 /4;2bnb 0d0"0 0 o 0p,2 0r 0` 0W8 Sbp`xSi`10bFb `&!""#0ODD@HL05? 0 04s0hl 0@DE0 L04;d00 0@ `4 0<22229$,4( 0 02?  0@ 0@Dő L0 0/4;$0 Jba 0ldh 0@ `Ì0 1m&|k)o)A`&p&oo)o)TO-)MM00=0?0,8(0a| t<pW:h< 0 ; V먿 0P@P`P  <R P@ 0  ;Fpa 0  ;E7p@ ;T@  =[P@ * =P (\0S0,5 Sx0<0(500; 0,%S00T:P:Q04< WU 0Q WMz* 0 04 0A W? 040A W6 0 4Q W- 00 Q* W$ 00Q(t W 004 QT WH9 @00T 0D\3SB<9\Cp|WXp9X0SW X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R0001kW @4p< 0R@8 a 2! Q S,QdS18$Q<4R:LW  @$8\5?>C0P4p3x00084%$0<0D0t@ 0|00匐XL5P5G   ?8`F  ?  ? pu 8pG!PE0/0!"0 p p4%p8$``05<4RpD`VH466 84<00x$0$ 08pS_PS @i`@0 ?@`0:PP* ?6@P`(6#R0:J`@0- 00 0$5SPQ0&" 0P0 ?00 1>00S`0 c2# S,Z Q Z3?00 1>!00 ^  BB0߽Pp0/2"0$ 0$ ?˽Wp1Wp#T0p10G 0K  ?PPB@TP` 0P嫽똀 00B1  B1 R ` U"B !!0 R0CQE0E ?P0 pᄽ똀 0 1 B0S0`0US0  B110S UVb @P`x1 G084<ĔCPp0S84<Ą-0$5BPS,pQɑRB@L0 0 000020S|0p ?HL404P@0 @t1ᮾpo'F,_q@00" Q4˂H1\5?>C0P奁%4tx0]0(0#T a2!, A3 31 0 @`0o)&&[o)o) 8co)@to)"o)&o)o)o)o)^F>|k)2o)o)Mo)ho)'ht@0'o)|&o)o)TTo)U 04 p  0H$4  E$ ( B, @%LV.  R*h r <  X  \ ! ?.@Xt@+@B@A.@B,-8 Hu pl @40K pҜ0 ,p B8d i A YZQ 0 巜0 XZ R A  pW?΄$t<4Qï80P@D04 0H4(0Āp 2 R 5#< 523pr0S; օ Ն 3׈ 00 d0 AQ\ a6Pa`,P}T `4庅뼠@ ᶅᵆ_ 3巈<000@0P 8> 0,`T 00 SP0\#P !0@P` @(4`Gp0 Q0P&\0S:pD R,T TP0 뤤@t j0JF 0rK0`0S 40S< 0 # (9 ԛ(0+V. 050S  [ 0=S,0S10$05H@ p }]PP04SP0 0R0 S00C0> S< 0,0Q0P0F 0,0S9H p开8嘥ȿ+" < Q \%``R 0  ᐡ, 400@(0 0 @DU, @4Ae6, @R40 `0```0T0(C( g 0 p(7 I `0 P$5\'S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%R' R0C00h0$l`0 R#00B1d0 R*<%<U` p 0 0 0 (0 0C 0(0(0 S x8`R`  $%R0 l ! `8 p  R2d 9RT T  9P%QXԐ R, d0 0    , d  8 @ Aq`Q 㙚+H0BH ,nP+HY 剚H0T u0S ,00C."p\ ^  00 0?d B2 b<10 *'R$01=S,00CU p010T0010X0 00@+DS\0?0  0  B  R\ ?0  ` 00C 0  80 C  0C1448000C ST00C@ p` 48 QT* B!44 T: $5Sl0 @0h pp^:S $%S0! !L`$p$p(0W|0S ,4 Q d,04  0,4 $ 00`  Vj0S   0帀0 X#` x0} X\># P 0?d @ `0 <s 4>\%R @>0SPX Q``ƌ` $$S >`R`  $%R0l ! ` p   R2d ?RT T  4?P%QXԐ R( d0 0   y(   8 @  |5R` /  `@$  $ ppS $S00S0@Pl倐HFP00@8p`0x1ᔤpYU0IX!@@el00@0T: 5@$\8Q 0@08(0 q (0d0O@ 0NN nC 01p0Sڠ30S0 000S.yP08C0`SL3 %>#\Ő0\   0d ? @0 `>B2< $ P0000P20Sʜ2 0,00C0S0 20S |P0S 5P\20S 0E (P00@Pl:h*0EUP 20S EA C 10S303040404 0#pCVW*w}V.,PaV.GV0S  d10 PST1\5=S,41?^ E?0 0S 04 d dLĒH 0@ `Ì014 ,$0S0S 04 L d ,04 0sY 04nY)ݍЍSngU o)To)Xo)|k)(&@o)o)8 o)G-`RM@Xr Q}PP d|P`T ` P P9  ,YYp 0S  .ߍ<0H(00,0 00004008004004 04$0D0(0P -W[  /YpU l)Yp* `|\#` 8  8$  ,V   R  N  J  0,0D 0 @  ` Xp 0`?`a8SڔmPb 0  0**0P0h 4 0* Xd@edAozd@ A-@Mp`;@@ =lp@ݍ P@00@5WT00 ## p@-@PᾑP (+|0/Spp@K`yR/G-P `$ 0p>@V` 07@`` V`@&!D( `G-@0 4PpQ X00000`0 8#8$#48#8X00P a 00 "% ?Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@p@-P`vPP Dd@P  $0$\{ lP@pp)t)O-4MX0p0\00``P0 0,, 0S P 0 +{mS2aSMS ASB0C0`b0CX S0SSU0@0 0DT dS$ 09R "P T 0U8$UQUDT P 0 sS@ @ @U00 @@@ X 00 p Pz0S00 0 004 00P4Ѝ:[@-S,@ $+NA$K'0@- @   _ G-@0Pv t``PE0 00000BoH0UB?E ᴀ@|))P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@p@|)0P  C @-=z co`/s@-@PH` 0080V  @)zЍp|)@|)s@-PX00S@H0`ă5#040<`0V @ zЍp|)|)@|)h10 PS/C-TQ@@MPM`6`@f$a ?1p P09 0 T:@6S0O@  DD6ۍЍC+ 0P \ 010 S a8!#4a4# 0^ P;0T 0+ۍЍ|)@|)|)0|)|)G-DB` p,PP$"y 0F040( 㻳06# R 0 !)wy0 80 0 !Rfy0006&0?06 0  B 00C0( 6V0:!`p`Vp 0z$&0? r0(0 6 C c0 0 &$&?[x0`L0V&S %0: S F0d  &ЍG.< ((@|)@&A-Xa00S FT:pV,PP  0 0A1S0S. P @D A01 S x0S @2106&0i.0& 00C00&101 00C 00@|)O-P`CM(HT?O8fK  0Df?o2U+u&0#6` c2H H0 HDPCߍXAG-`RM@Xr sPP dsP`T `P P9  ,Pp D0S  $ߍ<0H(00,0 00004008004004 04$0D0(0P 1$W[  OpU lOp* `ds\` 8  8 ,     0,00  ` zOp 0`?`a8S=dPb 0  0**0P0~_ ݳ 0* d@edAzd@g 0CXA-@Mp`;@@ bp@ݍ P@00@MT00 ## p@-P`tmPP DU\@P  $0$r cP@p茂**@-`pi  F@Pa00S0?0\ 0S 0 rS\F\GL0 \ gL0 SDKT ЍE%KUJ%FZO%A_0 ,7@-H DE<<[P4@0 ,PEU@BP'{LA-p`P@P V0 Ar,G-`RM@Xr rPP d0rP`T `P P9  ,Np 0S  I#ߍ<0H(00,0 00004008004004 04$0D0(0P "W[  eNpU l_Np* `q\ ` 8 O 8Z ,     0,0z0 v `+ Np 0`?`a8SbPb 0  0**0P0 ^ j 0* I d@edA` zd@ x        A-@Mp`;@@ sap@ݍ P@00@kLT00 ## 0@-<\   RS  0 S' 0 /ጊ*Q@-$ Q:< N O-@M Mh 0Pd00h00\00|00p000 0L0$0l0(0t02000040<080H030<00404040F00G00H0040P0050%+<0p 0S00|0000000S00\?00H R00S <t0S LPt|0p 0l0- Sd0h 0>i/0KpD @|0@ Sp00> DzKP !p 0D@0qGh@P\#KpD r MP (!Tl0S 1 : S  R 5   c`P`0z W`r`Foobr OPV   SP  NP@DH 3}pTrd0h 0 0d 0Dh0ͻd0h QP  h0@ 0S@040x0 0T0X0@0`0,000$0 X0R0 X0R@00@00S@0S100} S0T00RS00 R0 R0S0T0z /廸0P00a+a` pR  W 000ZW 0`S`SV Z T @0S X0S2|0p 0?0 D0p| pcT *ppv @@0S ?X01?0#*@0bph X0S|*Yp_ XpZ 0dh׾[J U  U* >05[R[:L0Sd `!0SV uPX` VU L0 0` V `DIJRP04!,A$ 8!00 >Q> >l0S ݍ Ѝ0o ? C0 l0&3.:pq`P llBH?C&9 0< S0|0| 0$02#l0@ U0000 0l 0H0 30R08 0R000L0L0S0 U@ $ 0004Q t R t L0 p 0H0( S X0S d(0HH00 (0"?00\0S# U0( R030"S Rd h0"80 S  rFp P P(,( (0S U0( R00S $4 0$0 U000 @0,0 0#40*40`00 01@01X01T000 0 <0$00(0x0,040303)00000 0<3 ?@1c4 04 v. 08#$0 #(#< 00 = ?Q p0Q\0S000t0o0 00 R  PT ,p忿4'?  DEpa P^ ( dh74 R ( 4R  R 0( S7071011l0( $R030#R03S 0$ |CûQ`000S  0! UQ0R0( lR00S LK(0 00 25 010 0P B24 01(00(0S  PPp@-P`/ePP DT@P  $0$j <[P@p萊** 0`( "4`#/A-0 0P@n @0'r0 `Tpn 0LqeA@0p@- 44@4P\P pB"" ꐒ*-@=B'*@-ʿ =:>'G-@P ` 咾!>0 P V0 0  PP G٪pP`0J/ 0Pj0S 4i0 孾V ꐒ*L>.s@-pP@ 0  <X 0TTE<LЍp P `y<0 4<ꐒ**@- 04$#$04GQ   {< Ѝ!)A- M`  _ P41@ 00P 0! 0`<))Z<1 (U<0<:P<+<AK<pQ`F@UWPE: Ѝ=<-jp@-8A0MP`  ! 0 0 010R  4    "!0Ѝp@<R  $    "!R 0S1$#$ 0("( 18#! 0Ѝp@;0Ѝp萒*  @-Cpi븓*P@- 0 R * 0 #  @0갞*P `00CS`0p S00 P0S X0X /X<'p@-`ᓾ@P8!R#<10 <10 .810CS81V <1S 0 <1l0 had_`0lPp <10C <1$0 810S81ꐒ*&0''Г*O-@2 8@0Ѝ萒*`*O-ЃP`@p(' 0 0 8T x8 p8 0h   X0 ``l 0<8 0@$CO"ꐒ*@@'80@- 00RPC@@d0 <9;6t+!'@-X`@ X09L0 PX@*9 0&9 A "9 96"#'p@-0@ R R 0 RS000p\RP 0SP0PP'R"R `0S S8P0''='@-@q P l00S\ 0@ !0R3 @00SP $P990蔞+ܞ++p@-P0@000`?0 Q!00B 000S 0 0C!0R3^0 P 0 0*0 00 0R0 R  C=00pTT~8 0#0%0 P/0@0'++ܞ+&I''屙A-@P`p% P0 SR 0S0B0Q3 04@ 000  ➠訞++ܞ+@+P 00CS0 S00 P0S 0 /8'A-Pl@pᘵP  P况PD ` `V :50/S 0Q@0R/SB0S 0`/SS  FR0.So`@/Q00/P R8<P T0t/Sj'l'o''p''0O-cMM00@00<+0< 0<0<00 EP #=R0,3,00,30SP0Pl|plO hhh 7` 庫 00 3 S w@@ 0T S S00 K#]`E0Q`0S+K [OE0S3/S;+K .K @0 U@PX[K> T 0D7tD t4 t$0#-S88<8xS`S)?S DS .  <(8(Vy*@0C 6K+ C 0BK+ e00CS00UD*a0CS00   ^PK 0@P< 0@0 9 90S9 00K +K # ˲hI  7PK 0  PK.  K G  ⰲ   PK P 0K. 680  ┲  @Pjkk 80S H8  | d PR_?0<0>080m?040>000>0,0?0(0?0$0?0 0?0?0?0?0?0 0?00?0?0-I?VH6 @ x ⭳`PK PP H70SD'0 0C!0R3 $70S0Sy K  @PPPh Vpt0@Pp n pt@@hP0X"T  0T\  XpW pHS  0QSL0Qв0P@}0 X\ D`X0D S@0S( @DU2 PP PP<@K 0P@0 K. 5K>< 0/ 4@@jpP @v XI j0S$0 0C!0R3 40S0S 0P`0P `0zP c=0,C0 0 S;.000 d5+ ↢0  d0d0@ 3FS p 1 01 Q 1 \R \>?p@1cD0DH`X(D# R  D)5  Z   Y   \0T0S lD00D0, L0 SH00H0H P0S  A  [P0S>$ = ٰ  FPcݍЍ ̰  ưTa ? 1PP|A80S  0 9P  ⮰ ` P ⡰ 0 Pwy ╰` B  PPi@t0SC 000+ ءKDH'HP+@++''Ğ+'r+'&'+&d)((*1(+9(*ܞ++gfff****++7+@+@-<00iS03S !B@PC1똞+@++@-l@h0\ 0 L$ @4 0   +X+++++Y+@-`0@Px0 B0PU1 S2P T0p0S 0@ SB8 0( p3 Ѝ&ܞ+++0'+C-PD1`0B8! Y!R!tM@p  10S 3 tЍ000iS00S 00S d `P 2W @ 0 i P (P000 p 0p3 W@000&ܞ+++0'++& ,`0@-@X0 B0@T1 S2@ 0P   0S &ܞ+G-lQ0S `` @P 0S 484a4qP0 0@0C!R! 1S1 &Y TP`pȀА U0(@P 0E!0R30S u | X-30S2 @TP` 00 @$ ꨞ+0',0,؞+ܞ+О++B,X+O-0B$p 0Q0US `PP PP"( @P0 D  0S= 0S: 0P5"  UE  (; V S 0S000C?oV20SP@Ye P`P30S  2x#0ES0000D30S ЍY< 0 X@00020S ?P%0 v2uX0000  000S 0@@V2 0 0@0010S P0 YQA 00 0X@L0000S X0000000S~ @0 0 n RT 0@s0S @ 0 @$ 0 r@WH00S 0 T,} D(14ܞ+N,K-+f,0'+,,',,,X+-(-`1A-0S PP9@`D1 T0 :414a PU @T*$PXP@`0S 0D !0R3 Pp U 0S 0S  |1*P0S0S \ 0S < k1s@ꨞ+0'f-О+X++ܞ+--0A-0S |P `p @T V @TL$@ 0S$p$00E`@ꨞ+0'-X+-G-!1 RR0堑S @Pxqx! 0P0:ЍS @L`P 02C 0000m PP@:SR  00y Q ]|`P0pg0 u000 l000ꘞ+++0'-+О+.(.8.'O.p..2O-0S .0b0 C_1P.pP@ "0pP00Z: P0-:p R02:70 R S U+:SR00W 030"S P 0000 S' @@   W0:0 SPhq \ X:0000P@ Ѝ訞+0'.+О++N,8.'C-MM@P Q0S @p T0:ۍЍ0S 0 CO000@T`PP@p0 - uY %  -000PU ꨞ+0'.О+.0p@-0S GP`t0 U0p(p@TP` 0Q0F00S ?@ꨞ+0'.О+.A-p`P@P /pFpDorP 0L0 0C?oR20S  P /'.//p@-/0@P3 0Pp SRp|+@-8 롱0S$$ B0A AR/Q,C//+'A-`0p0O0000 SPڤ/0>+b P0 P<P@O 0 0O0?|+t+&0@-@0 0*0@0Ѝs@-@P`P @TZ TT/?0 00?+"+R  + d6Ѝp/'$0L<S/ @-霡Pt+&O-2@`VCM{ `qP@0DUCߍ貀TX B/ȯ0 S4((⺪j@0PS  b8"#4 b4#04!40010S 0S 0S0000崐{'{{g W:0000Y&*Ȑ0S 0 0S 0 000R*Q p`p.0S H:`X0S  ` ꌞ+@+++0'/0*0@-<5p @,8P50@0& O-h3p0]MS TTPcPC H0@#@ -00RS $#05 B-p2"!CZ_gRPP "2.W 0",00RSZ 0|"t,lp`"d H7gPH"L  Hps<+b  P<>P P i0?0H @P gP%PD  o-L P gPGPt]ߍ訞+0'R0Ȟ+++q0&0t+0&000 +|+01t]d==$+71'&H1@-$@0 00: S+G-@ q `0S+ 4P 00S P0 S00P R HRڄ00S t -  Y`|P 0 Y00:$00S $,О++'g1101G-AM`P@mpP00 040AލG/0 008/P1 00C 0  R+h X ,0 ⭙ 0 D h1t+111'1 2A-MMp00 0/R @`㜀GjPP 0S P@ۍЍ D 8F`D @P 0S ⬩P`t+0p@-0@ @P P @p@-@3@`O-3tM0 S 댣00RS|3 p3p#0l*hC4#S\C3TtЍODc ,8PL 8Z +++)F0@`003Aoز`L<` U+L\0@  PXK= hpWW#X  @P L<0@(e0PxSiSfP 0)0@& 000 +L<0@ QU   AdH dXDL etЍ0 0C0H10S 0pS&0` S\E3XE3h0SS   9890d0S X00`0\ K0P!xp`p 089+3ꨞ+0'=2+Ȟ++0&&c2'2t++223'3++Y3z3A-MpM`@PP 0pp@d!d2@P TT+L5Fh< 0*ۍЍ aD D< 2pPUv2t2 U`k M2p0P *: x*'0S 2p T0TP 8 *!8 [E33'3t+++34(4@-2P@-L@4#S 0 {  o30#S 0 r @e3&0A-@P` 0 P0: 0lhp ?<0@$a@00S$`V SRО+344++M4 0S 0 0/ R  /0S\40 `0p@- P0@P*D` ?0Pp UTp$/pО+4+0p@-P@ 0 P0: 0|Ox` ?ސ01S 0p@D? $ P\@P@ p$0О+}44+4@-MPM@T 0``p/VVP   ]P @T@ۍЍVP @p@-/P@P@p00/00@P 0S 4A-P/p\0@oC 0T@@DZU pDP@D8+4G-pPᒥ`04PSpz @P`0PP0C0 T`4 $D@44++4G-頡FPTp AQ `Pt&0@(0C0V$Q@$0( 6L00v`PPEPP o5 @$@@(`/t" 0`0 @ `P`I0P p0@0 P $9 4++5)5B5]5@-@00$D 4+0@-S@ 0S 0S y 0S s0 Pjg T` R 8dD0&F$ ЀP 0S00n555554+p@-@`PP|80S ? 0P0 @/Pኤm0P 0 00p5O-2p0SlM |20SHl(PP  T Pg(H0`000@,Q 0*` R 0@*@aQg %1@ $10 %1 08`008<0@ z A p/( ]cblЍ 0`0V@ 0 0/ǚ 0` @T`$ a000 0 0($00S0,00S0(0 0S000$0S0400ᚚ@0 1S0 00᎚@ꨞ+0'5+66'6О+4++Ȟ++?6C-20MS CYr 0P0 00;000Ѝ /PP  d `' X80P ԩ 4 $' $@0@D`P .P   q' .1RQ rQS $0!SP P0hX$0 .P \1L ! "H D10S0"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", tA R" ꨞ+0'z6О+4+666'666 717;7++]7w7+Ȟ++7 0`( "4`#//,4->&,+\%ɲ0@-0@MT[0Q@X0T L0LP H  &Ѝ0@Q@@+I+7'0@-P &#+7'0@-Q 0@T0 R ||!#0AS@ ЍH0 D/PϨ ( &&+@+'8&mC8A-D@p 0 0SP( ` `ǎ `@+T8L0@-  Q0 0P ,0X&W# ЍC @++n8'@-0xP 00S@%*S` ,P@` 40P , 0 .&Ѝp@++'80@-0@S 0$P B5/x00SP`P !qpH0P@`Mo  0((@&" Ѝ萞+@+++8'p@-hPh@4S 0SPP *A%D0P00040 4Sp%4@++9R9О++0s@-0@SP  40B3/p00S\0  -pH0P`@  0((`%"Ѝp萞+@+++a9'p@-P,@P@p? P @9p@-X0XP0SpH`@P rP  }"@p舞+&@+'9A-P1a051q0S :p@P 00PCP)Y"ϢP!f%P  0B@ C%V%P  0 5%000@A ꈞ+@+Ğ++'9::+G-pa! ]` \% 0 00D! ] 4q4$ %83(S$1$A?@" 0 Q$ I!$Z/ , ], $ 0 00`2 D x] $83Sx00"@0A$p !$-O00@ J]QЍh+?:0'*:+O:+5:\:'+: +:+O-Tp0EMSP8a  ,,$ @$3po0C 0T*0 ?o2W03S 20S " T  $0S VEߍ0S3 000 |"o#0S 0t"! 0dDm$V V V-   B B B 0 0,"p+ 10S M$0@  B B B 0 0v,   B B B 0 0h,X![ H✡P 8◡P# 0S  V    V7 p0S    V     V l p T D ꨞ+0's;;+ ;;&;;;:;;;;K;V;f; 0P/00S ON+&@+P O-6M M)$ PR P  50S@ލ Ѝ90嬕e@T  500RSQ 50SM\5pE9S)0D0e0000EH0D# #80@$媗B 00 (4 S B#@P%DB9S; B. 0 Q#4B [T U@ 40T 949 dj 2##3NY0 0'#W3B h300 00zBw⏠Pp`g(4 S B0305 3 R s 0#p   ""00K`*b(@62B0 050Ƞ30s33P03Ƞs0 20S )"TxH0040 S X("L#R Q0cÝ\V I $ ;[B "4[ " 1 )a#0)90S 0)"(PU @10S1$10Sh 0 X `y 0W090C/W pC0S 1W 0 ]"pWJB:B6`FVU 4S 0400 ZBJ@+;+<++<'Ğ+#==<=&++=0'=>Ȟ++<>b>>;>++O-dCd5)SW0pW_`R00yu0SW  0PS9 S00P0S 0S p09 R ?oV20SJUMU5D R4 pGW`pVp``S\2 RD R: R; 4<H820S>,P: %+ 909909 Ѝ0 )+"+R ! R  x!EUY0+5p`PlP d<!X (!`e z0S R P n!00 ?wqp V00S |0S 906;#;S T%xO+X@++&+0'>'?+?+s?+>3?L?Z?|??++0O-'BM @R MxWtPP 'P P Bލ ЍDW0S870S ,,00 P 70Si  "4h"42=h:004488<<HHLL%"xx|]|9^EE:^EE"4"42"4"42T%0AA'О+@@@@O-MEMM D$P0@ $NhS @$@$Z 0 0 8**P30S` P V0A 0 ,#0 0 020S  /20S620S $#Pc 0 ##Z 0 0 8**20S 0  m "`b0 0 08#10S 403/ ## !P@Z00 0T10S00S 0 0 8##00S 0 9#4\  03/Z 4   00e#+B'+MB0'++@+B B&3B<^4__^B\++BBBBt]BBB+`+`a%CCA-1( 0  S !@ 1 1R 4S8 !4q04<@0n`P1 PP0S  R-* SR/ A P/ $!0 010000 QP 0PU 0$N N)P Ѝ0PB0P;C0d0P70S050 00Z0 @ 0@0 0++TwA@+7О+WCbA@-cM0S tt`pCpS0S YLP68#044 R05" 3s 0500L Pr5"0C590C990C9000oPpp 0S d2l"h2Q090 9$P ~d P60T S0BP ,- )%p@TlF'FFFhF0@-@MPPPP8 ,0P Ѝ0PG(G+@-0@ M \0 005 }K( ۍ8Gp@-0@S mt0P0Sd P 0@00 . p@044000Sp p@XG+lG'+}G0'A-/`1@Pp/@DЍ/SpPP (0 00%P0000S@-0@S  0S 0 000h0@0S P @044g000S @^GG+lG'+G0'@-0@S 0 000d0@0S  P @0008,00S @/G+lG'+G0'@-0@S 0 000_d0@0S PVx @000 ,00S @G+H'+9H0'C-0M.SPp4`8A0/SS  j0  0PV ! ,Y  4S          l  X z00@ 0:CЍ蠞+PHSHLHHHHHHHH@-"CHA-@P`App` P LC0 S000ЍU00+HHIp@-BMP` 0 @E CR V  u뙘P 0FS \0 BލpAS AP0P S00@ ZB1I+8IHA-P@`'<0 wpW BA+H@-3APB  0S}P  uPB03PP `@wPL 00p1 F0S6 0 00@1@00$`V105 S:; S0*PP 0p0P  0 0h P 0 aЍp_S-S p`0T 0D0FP0;C+mI̞tI~II'I++I0@-CM@P0, s 0  DCߍ0I+@- @ R800+I@-$M0h ` S P'@PPDp$ЍPU D0P AII+H@-d`$MC/0P@  - 18p  }$ЍH+@-0@XM0F/P XЍHQ@-8@BM0   Bߍ/I 0`( "4`#/A-pPᰩ0`V  @  0!S l dtA ݕ 0T`0  0 d0 Do+.LLp@-P@U U t 0< $p@ XL #D>;<T0 <U<@D;T D R0Z0TpG ϭX+Xt+X@-t+0@-6S 8 X+OY@- xm/l`@P" XnTF h <d4 , ^@OY$\Yh+Yt+@-$  k\'0@-h@  0@ 0\Q0CS @C'p@-@Pp00Sp8PU``p840#U :PX0Pp4P8P P XPp`P -7@- 0@P0  0P0S0! B Ѝ0@Ѝ/O-`dM@P ᔎP谟 U0E 0 S ᬛ dЍp | J ]  ^r !0 p h @   ⴎ0  .0`  Y0BP X'F]<]A]@-@`Pp@"!0# U 0 xRph 9 XHvP@TP(*P  ЍS]^]Z]q]-,MC L 0$000000 00 ;0[  <]'-7@-(`P @XT@  R 0@   !000 Ѝ0@Ѝ/ؘ&^$+^p@-PP@ &0S 0CS 23 0 0p9p@ TT 0 0 -, ,Up0Sp $+8+(^M^A- `(p 0hpЍ P 59@P  PP 0QpЍAp01Sd0 \  0T2 0`p 0S ` F$ P `X^$+ؘ&v^q]{^C-q@1MS0`q1SP1SgV1 묁XV a ЍCVU 1S  L1ЍC~V8 p0S* S S  qX HDH x V)ЍCr   n  TX   J X A`R  TTM  ЍC VЍ$+ؘ&v^0'^^^^^^^^^4 0Q 000/ $+ؘ&^G-AJM1MSp=D~`0 Pᴌ c4F0 0 Fxpp 0 S JލЍ;X P0啌A7J.H0 0G1$HL  $`000P PApč Lq0S8j1!0  $+^^_M^A-XQp1`S1S@1SFV1 1SV ^ AV1S A 0}V S D@d0S VA 0  py 1S Xr Q 1S<j  A$ V$+ؘ&v^0'^^<_A]4_A-a0 MSP@ r.0 014@:@#TRT 1S-  IR:1t Y00 ! ` \z@0,3p0wG, Agr,cr|pG y, Yr, Ur뀀pG  y, Lr , HrpG  y, ?r,x ;rpG  `y,T 2r ,D .rpG  0y, %r, !rpG  x,r,rpG  x, r,rpG  x,q,tqpG  hx,Pq,@qpG 4x,q, qpGX 0 (,q,q 'HwQ (  Y\'0Q00S? 0YS; XQ;X PD04EH01HpL001`00pD0 0pMpL0X10@sXp&4 0#Q0X00Cs 1SPdX0@spYG4 0BeYPE pW.- 0/7/ 4pS u,Mq,갠Z 0 R(0 R pP X 0 0 0P3A7/%00D0 Jލ ЍY@ 脟 RH 1 H0pH0S# 0 0 @3S4H  }m8p$W"RZ 0 00@0P0@3A4/d4IpY 0 0 @3S$1R 0) 403001P  0Vp 0040 [*Y Ʌ0 S P40Sr0 00   $ $  0`p`08ᛣ#0S P   B ( P R0X0,( .0P$0 ,( ⁄$0H0pp p0p?  H0pp p0p.;㨀H0 H0ppP0 Sp HpP  H0pW 40 0H0pH0pp Hp0pH@P0P p ppH0p 0H W8+&dq]&$+^<]dddd e+e,e@[yPZ 0p V㧉 0Z 3P }Z. pZeP }Z. _KZZP } 0Z. _C|dHqedA+Mq0p@-M`0 0]PP0@P\ ]P Ѝp@8P  0 0P : Ѝpq0 S C/p@-@PlwP`hwV pp@xpO-Md `P\0\`^V@ʌ oЍJN`60PhH0  HE0PD0D' D0S  (:DHkU U U;0980@ w6091090S9U@800\ 0S0R0SX0 0P409 PH0`p 0D40Xn*0SP ?v(9S00 P 9S00 P9S0P P0SP0 0000000 0% @04P P@! @ H0Tp,0PD00CsD0:\0S ,0勄T0[S00Dt  (h 0`p  @;p HB00780@dv40J~S01404Pod0S 0` Se 0`<04L0<0?h0?l0L0?x0X0S> <00SQ ?,v 04뀐?ɏ 0v0|0 +<+ 0. 6-<0C 0vL@ 0Pu0| 4P00 0P0<0 0h00`@, 00l00,0L0T 0x00T0J~P 5 00,p%?4 $;p L@H% p <0 %C?4 ;$p 0 400.00*<* 0 . 4f-00000P ꀠʟ 0u` 0zu 80@0SS00勄T0[S,0僔'  pc 0p`p $;p , 00@[04$;pu I0 ꀠ 09u `03u80, 000@[P 0&u80008 P0S00@ t4D00{ST080U  xb0`$]p0 ,04@$;Sp& @08 ?#"0@p*@0Dp , 00[04ᠠ$; @6p ,) 0) 0 V- 1,n F`000040Pp PPEV`?,<0) 0) 0 1- 0y,00, [ ?t@08?!@0  ?Pt,0 ? Pt <0DP~td 04%rss8 rrrr Tɚ;>sr_sY@jssssstOt@-z t'A-@p4S`  P>T0DPEE$UX  uPV00uP V0-04 rP $$3MDPE@D +t tp@-P@Q0 ? 0 puP@ R 0S L#Pp 8e00 0, 0p$y#x&,t,u,,,u@-3800S ,0 0$p V 0,,"u0+G-XM0MS0 DpW,Q`@`$$Q0 l+0AW>P 0 0 ۍЍ0 000nS ?S aS ppS qS x0  0 d00L0.0 8,,$u,2u'6,Cu'uSuvuuA-X`0S L00S 08P8@p0Pp006,,,,@-@L0@w2@00S&,0, 0S00&,,,,4+C-RP`tM  4ş4@ !Q RP ğE R`S 6s0t`FQ ğ;   T-P ׇ Ä CR ` 0S $ Lx 84\ P0@04ßQk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\H 0P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+c`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 ȕ00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ ='',,,,,_vPA-@@P@T 9- @P`p0Sdk \0 @ FP ,04 0 0@A{vx&,v,,vA-@P@p0S0P0`x0 R `G" R0T @ 0S 4!P@` ꌿ,@ ,,x&v,uuP@-, 0 F,vP@-, 0 :,vP@-, 0 .,vP@- , 0 0 j,,$,vP@- , 0 0 X,,H,vP@- , 0 0 F,,l,wp@-PAM C0@ 000 0S0! ;P7 0S40n?PP0 0T00aS` 0`0S 0`T0 0 0@0S0@T@ @0 Q000S0&8AލpP8, H0 P @0  ;P_wJw,Ew,,,TwO-1M MP, p4 1ݍ ЍPX$;P @@4@@/ ,P_ 40S d_P 6pPV / 3Ps垏0S30S 3Y30S7 0a@P0 |30 0l3 0# T30S0%Q03@OoB0B)&Q 30S  2` 0dP0002`P0 0R " R `2 T" R E@P L2\"00<2 0H (20S%W 2@OoB0A% Qo10Sk 1pP0001p^,  u 0PA0S0=,`V 咟Q 10S 00S2 0@P- 0! 0 000| 00S% Q0@OoB0`@%Qx00S  `0 0P00080`,kw6, 0+,t,,,,,,,,G-JMMPp 70@ 000 0S" O:P+ 0S(0=PP# T0  1 1 R0 0S0QW`3 t1 0Sh1hP* L1 @JލЍP @$! :PJ)W$Pu0S @'00 R000S00 6'|0p0P0;6qp P0ST00@TTw,,,ܾ,,w,_ww,w 0 0 0 0X,w 0 0 0 0N,wwC-KM MP/* 2 Kލ ЍP"9P @`2`R@\2000/IpP 82 0S@(2E- P0 Qo` 0S 10S 1 1 4@P -p1@d10S x6PT1 0pP 818!00,1 00S RP- 0 0 0.>?0T p orh&t0h@Q00S x0p0NP0 00P0pH,w6,t,ܾ,, 0+,,к,,,,,,wA-PAM o) 0 $P9`P0 0ꌀp @G o_x @0 0\0@@H;@C0+}8P;,Aލ0S 0 pO,x,,P0@/10S|1ЍG艎T`pE8F& P1 Ѝ@k7V@ 0 001"T9pX P(`P 0S jP17|0@0 1\ `T AGlPppTT TV@T 9@P <P 0 ЍGzܾ,,, {w{A- MP% 2 ЍPR0S"O5P 0 1CAkP 00|S 8P wP 0|k@p1l@z) XP#@HQo`010S 00CS 10S a) 0 0 S  4P0 T.>00R   ]tp!4"Ql00S  \0 00P0040@,Tw {1{6, 0+t,w,,@-PPM MG%@p1@ۍ Ѝ )`aT@PC@@T( 6Ya@P@F//cP+;[00S pY00CS0 OU0000 8  l0 0 86P(t@g,={<{@ ,,,Y{00@-MP 0$ `1 Ѝ0P H!F400CS0,P@/0S0P~PP P@ki hnT0S0 @ʴ0h@P @PUi RnU x0xьT0S 0H @>i ;n (0 -.,{{{{{,{,0p@-p@P0 p@l$\0\`0XPS 0S10S0p@虌 $00p,̶,ж,,{{0p@-`@P0 p@F$L`LP0S00Sp@(w 00p,к,,xz|P00P0@-S "$ 0 ЍP | 3P 0h'PL00}SH00S <0<A00P 0,|%|,,,|V|,P00P0@-S # 0 ЍP  U3P 0l@PL00}SH00S <0 0,P 0,|\|,,|,p@-MP`+ Y@T \PH+ Y0ES+ }Y@ 0 ۍp|{v,@-P# <0 ЍP $ 2P  ,||@-Pn# <0 ЍP $ 2P  ,||@-PS# p0 ЍP 0S L 2P 0S0,R  2P,_w||Pp@-,# <0 p00@PP0 6Pp1,,||0@Sp@-# @0 p04@PP,0Pp ,,|Pp@-" @0 p04@PP,0 Pp,, }oQP@- " $0 00S@-,,#}oQP@- " D0 <@0S 0S k,,@-c0@-P000P0S " L0 ЍP@ 4T@P@$Bg ?l,(}{p@- M P{" 1 ЍpP! 1P 0"p`1`墊0S@1D0 0S 1(8P&P0 0S 0@T 0{&`|S@P f d@ BS0@ ;X0 @ 0@3/H0T 00S00%,1},9}N}a}4+8 ,z}v,},0@- 0},,0@- 0}` ,,PA-PPPPU㈀ !00P@lph0hP00`0 @00WT,0P AW,,,},,7@-PA 0P0000 Ѝ0P!0P%0S0P 00\0@0S 0 S  @\@00+TW0 S +<W 0 0P,,},,,,,}P@-00?o2 P d!0 0@0P 0P pP 0H@XR0 L< B S00Y0 ,,9x0000HP1@@DcT@@/S0P  00+L 0~N 08 04@ 0R 0S00}S厀0S @0S 0S@0P/AVP0Y8<00 @kƅ΅օ:,#,8 ,,,Y,,]d,Q'T,O-kMMP|dUZύLHD`\X1 !0PX0C6Q0 B?(p8 DA)XH(La\(PQ尡V?Ⱑ0E?oT20S`dQ 0S PVV 0S#UU>0S嗡|0s0s0s0s0S0s (>0S0 /UP((=0S 00SU  0n 0 /=0S !~P' UO00*0S !N*P$/(>(N0 0 *00 WQ t=0SU@=` R( (@@\,0 R`\C]PP<0 00|S 0S ;00S=0 {v00P 00S0xsl< r|00 P 00S{ (<0SV00-,Kp\ h< D< G:sk,L:`0S00  U j:/ 0S 00S 0P 0S} 'C[o`аKpPp 0S :T0PU0[Y :IWHpPX fp0SU 0S_ *0 0 P%P %QP  08ix!C_/0t1p1l10E?[/ p x10l1S 0S tAT# 0S ib\P ![0 K d0尞d00S 00S P p :'tQQύ[000D!, H!i8 P!0R PP000_ 880,10i/10``P V`08 ,֟PP0S8 ,͟4`U`P@Tv  p 0q_0pPX7/UP70S @PPq/+@&K K00S q?/T<70S00?o 2C%PPx0 P`60S P 1S& P 1S&6vF V[P@3 )rK505MP J00@T Z ^P ;00@T Y ^P ,00PP `N` UEP< (M*P<$50S2P@T4$dL! .(QQ '(R #(pSn ``40 WE:e0 0- Ct$}  ( U@4 04@T Q?18|0/N,0 @L!'VR30SR`V H PY= 0 '0!'p$0S0A'W'1p@00S`aRT0EP@0S 30S \3 <@@ 'V 20S 3 t,@ `'T AL' (paܺL20S 2|Pa 0D0P0Z%@ D0D%P }OpP`P@(``k ϻ0< R P1000@ L%@p`P`(@b>0@`0  D0Pn C@ p` P(@@8+ф,·,,L0'N<+ؾ,Ԉ(,-XF9,x!,5,v,,,Dg H ,4 ,ȉD ,|ŊߊȠ&'q'x1,،,:c< f X ,e э,,@B8+ލф,, ,-,,,,0S `p@(``ࠝZ 0`0P o|0QV00Sr QcP> PE 0*S0 RQ:0-S6 FQ`.0P0*0 /R& *R0 20Q@(0000S!0 0/<:4gP 0, y\0\\yP 020SyP K$P zP uP 2m kPn000\P \WP P  $qIP<0S S W\ <0K/CR032 U 0S#0 0 彽WBUCZ Z8 ,L DP  $2Scʐ$<4Q0SQ?0@0!h4 KSKQP24 <;vs48z(0st4( @ 0QP x20SH50ո5|2S % R 5 P 95P P P ED# 5 6`0Əs 00@T@ \V  &Pu]0 0 尹 2 @R ]0"0C?o2? \"0 "0AuX0 S ;S0 WL XP  0 R RT h0SF0S00?'"0 40< R /$ $ T @ "<ܗ<P sH"RL 0 %PPI%Pp0S0S{l80S:%@P x(X000 R0PT0%  0 pwx'xl hphl tp k\p Pt #P U \  Rt90S l90Sp9hyP $7N0S @DT90S Y~ 0 0S$8 (PZ0S= S E#=0: 0:`00S0T0S; rpqJ  %P Z L@PW@p00d0@@DcT@@d 00@0CcS1S@q,PP00/@-Z (0@  000Z@,H+@-Z t0@ d00S X0 0Pp <0000S Y@,,,H+@-Y@`00S T0 0Lp 8 10 10S Y@,,H+ h0@- xX00S L0 0Dp 00 101000,,,H+6, -X0lM@ Sd @D80 0p   m,,\+@-0lM@60 0 00 0rS sS ld d}Dd XEDP0 0p e,?d $,6,H+,ߎ,\+@-`PP@ @0@s8#80U 0s8#8000@(B(2b! !P VU 0A0T0Ѝp00CS0 S0 S 0 /DO-TMxp|W00ʿ? p00p 0vX0P`0V0W B@g0 @040SD H 8PZ0S= S D0 S00 @P(X0S X0#S X|0pS `1 R R 0Ha# JXtp uTЍ ? 000 $@0 PPX0S X0#S@DT|0S ld@"\]J$0V 0 `{#M"00 "@B,,O-PBM MdEdP$P QL?0a>0 PPP0p`5(p 5 P<$ P@+40S5V $ 0D  J0XD S00H00S+(-C 0S 0 S     R  T!$PP$p 0 I@P$p 0tp9# ap0tSS 00   00Bލ Ѝ@H3@D 30S VW@@cA mI2 0w tW T 20S 5V  R x" R " R W WSh2h <2?02eW @2000 !00D1#0U10S CdPRPU [ 1000P T)T0 0P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V 0    0QR\@\0 RZ P :/ 10 YS P 9/0F3H+ ,H ,!,,L ,,!,|!,\ ,,ؾ,D'$,-A-` @T ڕ 0 ЍAЍ/0p0$ P >xtH h0h Qoa0@S P 5/~|!,H,H+ j\ ,mO-@FMs M` ( @TU PU LU0$0h30(0$ 0H,@V0P SV奸0  v 3 Fލ ЍLV0 @,Q(A2@@в@aGT  X 2 >V 0 PD0P2d mKP h"hd_A T[A0S 00S 4 00d  PP d⪱@0S00?o2 Pe U0@6U6 D01@~p  l傱 81 HD0(66S0d00 0d0X A 0aPS 0ٔP P 00S x0 0|0lP@0H x@0'0,X@!0=X+(,r,ؾ,,͏,h+!,|!,0O-GJMMsn0p얟VXv600S00p  9PX |6  t60 9PLJލЍ860 0 0 097S 60SZ6r50S# 䵟0S5 Q U 5R "P 0S 500CS\5|ir00l=0S P97S( 5D 58%80SX0$000(00000 5 PL 4D0000Z40܀C XSX P4`0(  $   dT C P 4L!>\ 0h0d<` ((0#$0$c# $c4"($ <7 $ &R 3^0 R0S R3)0( 4008'TP30S@97S00000 0S   0p008'PP2 0 00 40I 0 S pd 087PD˯ 97R^ Ś 0S [R0sO0010S ;70:70?70>7='<@P0S,0 00 0<0 x1, 5IP!1 R  @ 0 0ZP 0S 0097S|0 0S [[}X  S[00000IQH+,,d ,h+D< ,,,,,,@ ,,l,u!,qt`+ T`+֑$;@-2Bp`WLM LЍ@  pP=  p7 00011 0S<0 ?!tq((00 Q 00SZ=9Q ='/?@#b!"/"p uS0S qS0#S Pa00+0(60 8pp VS0S RS0#S  pp 90S0 00 0 0= LЍ,,H ,MbKlH+0A-H`D0 82Vp  R`RBR RB`2b  Q  ,>00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41  000d4@T X40S@ H40S@@840STPv40S4Onk 3 3K n Ѝp30SCP Pg[PHd< \3 4LS {P@0Q)2000 3 )bQ gP@$R000 0R0 0|IP  AP L @P  0 2$@NL2P0 S R0S S @T% 1Ao0S3 1o10S x1 P5D10S  ,P01S 0 0S PU P 0S 0S T01S-l% $0 ꀎ,,Ծ,о,,,,,H+4 ,\+ 7,\ ,!,A-M  @P0 8 4 t(t@@Ph(h@d( $ T( RS D8Q  Ѝ 00-S0S 8 7  770SN0<00@0D07 0#PPGE  G@Wn cKPZx7,0<7P3DPPL7`@0 0wKKKP [FKP6Qx AQ ,0 p,0000EQq v 0S 6 @0szD0s{xFP+00<0Su40Sy6$ 0 0  n 00|S  0fpD,,0S95P5<0f ,,0S    5P<0,0p,0YPX0: S 5 LR4 i0 0,0 D4Q PU>0 00S,  P 4 440S!@@5\4@@0Sh4@s `TP@40S 4K040 4 (a 41S $ R 4P 83P P P CC D0s D30SP 30S 30S2P30S&Br,0p` VvU㨂c 48 pcU|,00@ N00 0s400@ N80030CS,0"p,040q402P001!P XQ<0S <0,3/0,0@44@f1 R0PN0 SBT1#@0 ? 0!$$P400@0 0 0 48 dp 400@0 0 0 o$P0 ^w0#Y@9D 5,0S <0,3/4S,,Г,,,,,,,,\+\ , 8 ',5,,N ,P@,T ,,S ,`@-GM , 0 0@_$(000E@P˟_. +,0@@P40L0;K@;0 0;00IIoDD0S>;0SV 080< @ t+ RD00S0X H0PLKNH<41<S$$IP $00|S $P/$@@M0SR M0 SN $ M): 01RS 41S $00-S0S |: xud:$ doD0S $ GߍJ0S : <0s^@0s_JP0080SY00S]9 9 h9T00$0S  T$ T/00Ph90S mM0 S$P$cM0 S$P$ 90SD8Q0SP/PP?D0S!0S' S+80S $(P  8d(880sS<8  01Pw00S  &PlGfQ000S|P 7 H7 R0WBT41SWn$%HP_x74!(07 6 (0p(0p 0: S 0&0&071S ' R 6P ¬6P P P F60SP $60S 60S5PL60S 0CSWD0S8 46 4 (p(`BQ*$ $00|S S@$g((0S$ @54! 85 580$ A((0S5$_00\%p00(0q(0P5P001!KPLQL0 SE4&80S 80(3/0(0030L0S04 SDQ  40S 8 4R qp~ `%'0$`x0pr3X@$P$r  0f 儧P$~D0S s0 0 @ 0(@冘P`\ T0(0 00yPP sZ,pJ P @`@#=0 ? 0!%%P0 0 040 e P@H0S@ (, pU@000@ K400K0 SE1(00@N K,00(00@T!000t 04-p@ TL0Da0L0 TUA @(, Cp%P1 G1#BXצ@PbL  fh00S 0 =< @ (0S 80(3/0#,,,,,,,` ,\+\ , 8 ,,ݓ,,,|,P,,0'@,X ,,5N  ,  /09h,8oQP@-X@ L0  P _@ 0 ^ !,,E@-@J0 Ѝ\Q p@-P,@P@p P @ؙ&p@-T@P HPP  0R  p,$ ,p@-T@P HPP  0R  p,LM,0P A- Pp@T Wp`W VL\ P  R/(&G-@p`xMET oTP ЍGFT8,^,a,1  CQ@  QPH ЍG 8S 0S TGP pP  0 @DTЍP 0 hX0   5 03/ (  ꂘ,(&Ә8 $R!R(R3 R 8( 0 Q Q QG (@-R ( R 8( "^'  ^ ,QQ(88S08 S08 ( ( !R0/\^^00^ "^0 00Q8/8S08 S08/,̠&p@-H0H@8D0 (8080$8P Up$80v,,6,@-A(8S f0 S B;0) P p p $8S 80pP\ UP 0S ,8S0kf (8S 00CS0 [q0 0` 08)4 8$ 0`3/48S 0S 00CS0 S0  P0R H@ Ѝp%,v,'/B D P/@-@P$ P  'N@-@@0sE,00p ƪ0CoР&,O-4$0 MM00/ t )0 `$`V (0PZ`V= ' 4@P. 00 !X4`X0 0!PP@ !P@0H044P@30#0  0#` `뼳 P A  3Z C00 0f `. Z 0f 00#`<  < 0f0 "0` U  S  RS0"1D0 0;f#;Z0S;#;0d("?;#;0 #5;0?;#;0@#5;DE,"0@S0Pa 1@V0\ 0PV 1QR!0 P JPr m! 0 !` L\!djY` f 0!b`< <7@f 0  R 0$ @0S (P0S S d >@ d90 S00p Mߍ%U[0DEP,,,.A,,Q,,,@-]GX0@ R0D00S 80 00p WGG@,,,-$M?0 0  $Ѝ0-4M 00 000 GP4ЍO-pQMFV( "0`h&0 0P00000 PU008 0R0PU00 6"R u0*P\0P 00$00S+ (0s0S  pP @50S` l%Aw``5[06 <5 R 0 idXd@0f$V4`4Z-JP Q@JZښ$$壢J f2 :`0xğ Q  # 3S  RS0D$1D0@0m/f00` `V480PZ`V=  3k  0 0 "d3PT0@` 0P ["M#@`$5 T;&` # 3W  R@pd KqD $K "% 0-@0  j2 @ЀX0M|2|d0Z,0@0`,00  0P0X00.*d"1\ ?\0E08"P@,2 0@p (0S!0 J0U0!x@(0@PSd!o@h1 0p Qߍ 0 XJ ,E" 0 "X0PP 0P  B`P<t @0p<@f0 -@.',,,H ,,(, 6,8,Y@;,Q.AV,t ,c@~t@-XE@3TE@p@-Bd00` pd00CS00p ,P P00 @R0S"P7d`Qd00CS0*lp "P \Pd00CS0_p000S8A PA p0 0 `Vp0 c`Pd00CS03p 0@S P,P \Pd00CS0"p `V0 0 @Pp@@,Ԡ&A,A-pp@`$P@ .4PP @P PE +P@OoB@@,O-(U0mMS plEPd D0S  mߍP0P.0͵144PPd(0P/S SUpF Pd4P PP P4$0CS0p- P P ~ P0 PsdLy?P P q?P d0p P 0? l%h#dp P 0S I d0p P0? p P 0S- 0S dg0 P P d00CS0(p`2`!a P Q82<0 0 dAQ 0 p0 1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\0p 0 P`, ^0!S^0C0 hYP\\ ),@,5,ؾ,ʞԞ/,`'%,5,ޟ,x!,0p@-00 000P:@x3`P /s3V0#03P0S`@F@@0/S /Q a3P@@@@<p?U3#`Q3V0 V # 3P R P@F0@ @0<pP @C @<p< pG-Pp ` 0@00 0 0A00 A 0 A @ 0 0 A 0 0 A  G-`@P A@pU"W/Q5U0.S=0/S@PE .S6U+ /Q15P0@0PE'0.S%@P.QU0 0/S@PE . C/oU" R 0/S@PE  / `5P0@0P/ Eh4P``@  MA@PEU.S:O-PTM @`0$ P(,pL0H0D0@0<0 s`8;0D@8 (@X ``8;0D@8 W00@S0 0 @U TЍ0/S  :`8;D0(@8 0S! V/0 `0@ ;p8~;Dᾡ0@8 (@ 0/ 4P @P` @ @-0 @0SP  x(P  0 00@ x0 lP T0 LڢP 00 ,ѢP 0 'Y^ܾ,cot00CS0 S0 S0 /1A-0aS0P0\P3U 'P 00.S Pl`1h \H(T1P@  D( (P00T,!,!,0 $1$ /,U 0!̾0@p000 00000P0 0p0S000P0T h0h0 @U t0<P$0`^@ ,,y~!,!,,,о,Ծ,,,ܾ,$, -Ԡߠp@-@P 0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p|!,,Ծ,о,ȶ,8 ,,, ,,x!, L0@- O<00S 00 0(p k,,,2t ,A-@y@Qp30S `0S p [00`P0000*0S t`0S p <000080uT  7@p,|!,,,4O-`"BM |2MR0pB  h" R S4 P 04 SP 4SPP004BލЍ$Rg1+ +B>4P/S + *+ * P i2pVp刑0儁00g00000000 0S P1o@19 70@ R 100CcSppW00 0S 0o000 000{ ;$RV~@~PPT{ /P006,,,,, ,RTb,,,,N,!,A-Q0qS0`00@S Q`Ѝ0\tP /P 5~0 R 0000@ Pl00}S0s00T 0S$@,s\ @ ,,ܾ,,ס!,',O-a0AS04M00qSP Q 1P\4ЍPH F/P0.0t@/P00`8P$ PH:P@1(,!姼2 (A 1 0  ? ❼@, =8P 0 叼@ P 0$06qp00P0}S0s00U 0S(@<[ F@ ,,ܾ,,,ߡ!,!,c{@-,@02$ ZP腢,A-`Pҟdp͟ 0@P  *@P 9$@㹟͢@-@'Pк, 0A- 0p0@S0`P0gP㬀" .P 0S 0"S x0S R00`P"S0"S0 00̶,@ ,,,ж,!,0@-M M P 0) @I9Pۍ Ѝ0Ph備4/S7 @ !9P;0@TP/P "O-@pP`V1@@P`3:8`Ez80P԰ Y/  0~7T@1PSZ 0 10S 0Z0 R H_70S*00 0;0 Ѝ,,@-=P0@0 @p GpP0 0SP0 0=@Ѝ,ht@,P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C ,,H,,@-0 000 0S R 0Sh0000S b0C("( R@ S0 Ѝ ''M7@-@P0S 0t 0p0xp\剘X@0S 00@ 0,hp( Ѝ0@w Ѝ0T ,rX ,G-@\ᄐpA`\P ^T1:00"\ \ L 9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR%0R0PMU30S2 2"0S0mPE_o C0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^ 0 BA R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@P0LG RS QK 0TE*/0S@*<0 QS8*90S2*+0S-*> @ S'*000GS0P#0!,ؾ,ȶ,̶,ж,/A-p`P @zP0  T  `00T  h50@ R   `FVp`00CS0 X PpTD000`000 T00诣'ϣG-̀P`75@0崠TXp , 00@)ax0@P 0D00< P 0 Ѝv,?,',,O-M M@ P" 0<`0  <3P`\ U0P # \G&  C&30S) P Q PUP p;0@00002F.,0P |"|F&;F@lލ Ѝ 9pp08\ o ,p \d020(PS @ ](0, 0/(0, pQ:0$S,F␡0I00S @0h$Q000SZ=9Q =*/?@#b!"/E տp5:0S :0#S [:0AS  \0 0 PE0 P0p 0S :0}: 0 ᷿psP0\ {A|Pl:<00#h ,%8jH ,Mbp@-@P<p@ꂿp@-@`00CS0pP0 @ A:0S0`009:0#S V 3:00p0 PA-p@`pP0 @ :0S0`00:0#S V :00A-@XP`p65P  15P0S o蹤@-@ᔗP 7@-}uP/@-@up %8P@-BPY0A-PhMQ@00 00 T  40S P 00 P 0 0 0 PtCcXY 3c0S ?3@<3@@p $ \$ X$P kpP@ 0S &@P@ 3 8 k P@ 3 8T0S  @P@p2 70SIH/x0 S9 ,0P 00YP12 qCAڶ 1 PP 00 @T 2 7 P 0 0@T 2 7P hЍT寶[8P@2 7T 11@T 0P 0`V4PP)#F000T0 0 0P@T{Q DP8 ,p ,,,٥'ץ,˥ȶ,,,5,x!,v,,,ж,̶,7@-P 1 Ѝ0Q0S 1 17P !0 CRxA R Sh10R P1P 0S4S,1 0P 0S 10S 0 0@@P U#0 @0@M#0 @G#0 $@A#0 )@;# 0 00S 0S,,ؾ,$,O,,0 ,R,,o,,,H,D,$, ,l,h,,,,00S%@-@0M, 6 0FP0S8v@0Ѝ0@,-A-D1< ȠLȠ\ @ P0 [!1 巷;2AލЍP0 SS  S0 0< ȠLȠ\ 垯p 0圠0CZ 卷Z <X> 0 @,,,,,<,T,,/ &D,,0@-EM,P {P~@P1>Eߍ0 ,PU  吷 {ꋷ 1x0 <  1xTPCu{ >뱨ר/ &O-`3MP@ pppl`1\#aP3 L.UPE!㇍P$c00CS0'0p00 R0SkP18C8S9 P%cP22l18C8S   0 PP 1 P8C8S  P < P^S,18C8S / P 0 S 18C8S <18C8S 媮l18C8S 0ㄱ0&l1 Ⲷ \1/ R LZ= U 118C8S WpG(P`^0<18C8S0 h ЍS R   RMP0 UA 0QDD,,/ T,,,&,,<,,D,'p@-BM,`@P4P1 H%00(!g 1 4-PP<`1p@-BM&,lC@P4\1 T庵>0;04!,1 (ɵPPu<` 10@-@hP4M$Ty+P 0P,,<<0   4Ѝ0,ZD,0@-@DP4M{$0X+ 0P88 0r4Ѝ0,Z@-M, <PJ0A [ 0 001  1 010000 0018C8S 1 0118C8S1 011t 8C801 012 02 28C8S܍]&,dZf,@-(@ $n @g,{t zt @-@0Tc״@#p@-@PPpvP p0@-AAM M^PAލ Ѝ0PE➵Pab/0 '똵PPh1LA`1T@㲴宴㬴00$!0e"u Ԋ坴围嗴+u@吴 ∻U 0S S 000 wLT岊   T xdl  10D0 S B/o" R  0C&jv,',@-MvP Ppmp p.l@PL\܍@, HP 偵܍,0 < ,ө,&p@-P MeP'@S?o2P0S ۍp@:P55-` `PPPۍp@ʫD` 5b  ۍp,,p@-tP P l*@PpX[gP]<p@裫4P Lml18C8Sp0p@ːѩI,&,p@-P MP,P/o"P R0 ۍp@B:St`1@P`ۍp@lT l! (B(R< < 5 ,+ۍp,@,G,.&_g@-  wK'O-P4M$`4~`=@PȔtȴ`0 `4$$p0Z$ dQ Y  Q|x$0l ;)P0\$\40X4L-@-4-(- 0$坪!PS pP dU Ut @DOo0B#10<13 B0lS010S P   RppJ qtS`S FS4 9S/S0Su(#a0CS00yES2M'PPS2P(Pu (PZ x(PP[ W|2 @|(P[  d(PW (@PD D(2!00=2 1 0 060S1/ P* T9%,00!0 0 㐡 "0,P j D1 U hUP0 0  0 00C6&`@@@P 0 T0@0?o2/SPk0SPP54Ѝ,,D,,$& 'P,ޯ,H,,W  ,0' &,'AثH>.®  =Ey@-и,,@-@M hU, \0P0 0D0@10S E, 10S0S@Ѝ▸P  ;00S˱0@/P  0 00Sٲ0S ɱ00 P0P@0 S090 ,'+O ,,P,,,e t A-U`V7P@^@PtpW0Ph% /Q4 } LipP@uDN8e0S+ (5  5@5 5 5 R- +4 400000@T ,`P004@Ѝ0400/S@%P w w w 㽦PjHj@ 0SQt0S 兀p=0#~p;#s00S: R}`P`|` R  V \3Q 30S t : h7}PX3c0S 2Q P &o2: @}P 2 : }P 2l!: }P 2 : }P 2 : |P t2!: |P T2h,!: |P 42L<r> 04Ѝ08,&@-`0S@ uPe)0S 0000q20\ @ӄ8,s@-0Pl00@0`h R R  l R  R8G03/@ЍpQ P&L&8,ޱA-$q`AQT 0SP @D$P0000:$0P 3$P0 ,$P0 t%$P  dd奦\0H@H  "  \ &8,#(,1'Ԣ&,00@-18C8S 0P |&,(0@- ĭ@0 ܭ,,,p@-`BM Pѭ@0 S0`018C8ST01y0 d0Pn00x0 ┭BߍpB/ BR 0⧭00P ky0001,&&,, 0?o2 0/&H-AM M''0r0' '00000P0000@0 qPڶ0 ȑ dP0SS WS BS 0 +TP  yTcp(0S [h 10 S0Y` 18C8S ؠ0S Q  b   |P Y 0@^S00CS00 S00 P0S ,_ ,,<,&,p@-PH@P@p"P P "P @& 0/@-Xo/A-@PP p 00CS0 `V "PPP0 P00XAU3 0S P0000 !0S0R 00 8(GA-A`P0E!S qp!0!0P0CPSJ0`00CS`0p S X0 X 0P"SP, s0SP`0P0CS`0p SX0 X ! 4X!X,0 0P0 P 000P lP0"S0T0A28 0 0P0 ,'00'TW[c@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 eA-x@!P0 =`P`PP2 00pPF 0P 9V @P  @0S@0SؼV200@!PP?P PPP P 0!SPbp,c&t{p@-@MPP\1   @P`u00u0ۍp0 3P 0@ 0000S T1  P00 f (eP&@,p@-`@;PP 0 q8Up$)!P\@pt7@-@P  嗬 R 听 匬@T| Ѝ0(R( d0PP O<P K(P ,'f@xt yt +,0@-@M@8%0(@,0 0 厱@P ,%Ѝ00,,x0 ⸪%PPP>P0S %00@SPpl ,&,@-傢 (,qN,@-@ P ~mP Dv Y0P3P xYtW2h  XF(Z wЍ,xt yt kqtf@Ƶp@-0M`5PPT 1<18C8S |)xAxe 0 9 0a+ <4R,P( ,0F R  ;P 71P` 0(0S q=R 00FS0xޡhܡP0Ѝp\XTP D̡&̵,0'ص޵,!@-0 孩@6,޵-@-Q-@-0 R   ЍЍ/,-@-c0 R   ЍЍ/,A-ARp`P@1T rpP@T`@DO-dM @P$0P 00P0 0 #880 0(P400Pp`,@@0,@ T R3 U&T  (? 0 (d(0Kp ` Z0 000_o 0,@ @,@0RT ZPPU <v 04 JR (0 R 0S0b ރ 0S dЍT 3 ` 0@D(0,@8O00(0 RR `:0@D(0,@(0 R40@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q  p >W :80"(A3PP (3 R 8 %Q  R P`(8:c8@Ht  N  $P T0`000S(:( 08 40TU (0 $(,Q@D0T,@(0UT(0 $(,Qt0(00@DS,@T_m<,Զ K%7I_w O-lM(${`xPVPP*8@ 0z! x! 0<0d2d@0`2 @0P 00K@P 8%@P NpP@0S($"P @ ኂሂ [lЍH<`@40S( (姧 Px  , Mp, 0P¯4 0FP00FP<  B,$( p( ,0RQ @(S<`@ 0QKP%<0%800%4000 0'<0'800'40\ 00ݞ $P$@_(& ';AFUgC-阑p0MS@0P x-`0` 00qp@  %?sp$_@`0 P 00: pppppW0@ @ Q@Op`6t0` }>l?@h@ r00 S @.  C8 pЍCÞ0(&xŸӸ0'A-MpYP`ЍA蓁0@: SPPT@8`P00S 0 00iQTP1 ᢦp P PU0DsLS<(    , O-0]M-SP MPP50S ]ލ ЍOv/g]ލ Ѝ@p ΧP$ 00S0W0S ,!0S` ~pP    @pt{0* R\ D RP 2PP,gu A`ᬧP 9X0v: S+ p  3 P@`P|3  KP pd ` 0 0L:0 00 0S0S`- ޥP`=`v `0S 0 4ץP |V ϥP `z{ R 8MRK ᢥpP Z "P w!1Z[  0ᣥ .YႥp`l: 0S'HQv00 0l! P: b ; 0S- apP  W ]ލ ЍOP-Cc 0S^p|P P : R S00 R0S 0PPdST},(&,;M[i ֹ Z_'{0 R R /p@-0SpR @ PaPLU APLU @P AC\ 0Tpp 0@-@P@@ bP 5FP00S D00S  40 -F!SOXU,H-|,,&@-Hۻ@-P~Pp@-P=@ʂp 000/P,p@-@P0-S@@p GP0Tpp0p@-0@S`@MP0@  P@ЍpPU P B0P0X&P,@-@P @100S@P,p@-@PPp00Spp@8P,A- `pP@P000 PP0 0@-@P P0P00S@JP,p@-``MPU> 0S; XP2 @@?T/   `00@ C @ F00 *S 0 000?0`?2XP10EE>P `Ѝpԟ 0@-@-@Pl00P60@P2(P 0 Ѝ|tlP0ml0PLP0P,KNQTWZ]`c,fC-TM=YoDu<604EP00P00P00FGP00P 84P 40Px4 p hdP00<P00< ~PV x4P0gS 30Sj f< SlP ]P 0S0`0Q0S P 0S0`0HBP  0S00$3<5P  0S00l<2 ``P1Pp098p QP@Aqp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@,%-@-P X00S S 9(,0 @ T ,p0@-@TI0 qp0@ @}01p,%-p0@-^ 9 @ 0@&)60 P@ ^@T,0 R& p@-00S0C(0,S0@ 0S!‚"\pPQU0000p@/,P0001S0 0/d&7@-P R I00 0# Ѝ00R 0@!"0@@/ qp Ѝ0@Z?,0@- 00 qp Ѝ80098<@ q|/ 00\ /,G-pP` @P"9  `0  P09   ] 09 rPGD,,@@A-p`VY@  @ @ 0 uP0 0z0 /T 0 0u0@A' ,D,0P /,\ @-P0S0@  / P2:1S0BS /C-@4QM@`@|0S1UA:ЍbS9 .S8 00C S 0  ?OP >cS@U:{>0@0CS000 000C/  0?NP @@@,,p@-@P 0S`PpPQ ~P@dPQVL<>~mP0S  p Pl&ħ&A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0S/P@u0C?o2,@-XM-vL#@DN@M<M8MTr,3,!4!!!8!!Rp꼸& $0 (((( 80( /(,& 0( (( 0( /(,&C-@ 㼀`p0S Ѝ @P0S 0S 0 ( ((087P 0 "PP 0,(,7@-D@P@ @00S Ѝ0 NP(,@-PP@X9E`8 R8 R8S Ѝ 0p 8 0S087 80 8 00S087(,,0@-@M0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS 0`(,,@-P@`8000 00C?UR 0 R00C8HiЍp l 0P 0e0S 00(,,s@-@8 R 0S0` (0 RP 08 80 8680S Ѝp0CR80S 20S608(,,p@-p@XU P8PE`V` D0(  p8Soppp(,&080S/@-@(,p@-D@0S PX. 8P 0( pp(,&p@-|P`@l0 R(0p0CR0R: $0( mp00(,&7@-@@P@P Ѝ0 AP 0P$ /(,0S/0G-0PS`p@U @0 pP0@@@ X  P00nn @ P00-P R/:,@-4@$P(0,0P  $8 (,&O-6F0`SMPp(h- (R008(h8! 0S0S Ѝ0S08R00(h8PY08T0x88S08"SPWP $(̕?o02Q0 P`Pڐ%0@S0eP 048XЍO0480480488080 Szx0488S0S S 8S0S S 048804880S W048|048ЍO048ЍO048n0488S 0S S8Sb0S S_ig8SY0S SU048~Q04880 S80 SGrp80?08<0$48X5(pPWxpG(p V(PX  PP pH80S 48PS8P Lm088 0Xt28Q V 0d48 #Dh  00 Q XPP@P0P0 0! P 5+P P !R0100zc>Pu0P0 0!Pj !R00@00`p,p,<,%-,-4,,,h-&`&>>--x--4-D- &-5P,{-D,3,&5<,-,x,-0P0 0!=`P RPZ=qp 0 d0P0 0!=`P0P0 0!P$ /81`P&P 0`0,`BPM(P 00,00  10SV_@! 0 gPP U U ?Vj!0> LT PP U U |!0 DPP U U =!~20S %0PPq U U.P1!0Pj#% (P0 0S ,#00S<30գ?00T ϠR0  B  3 B0 S #00S30գ?0/0  00 3 330S080>00S/,@-@0 S!0O-S`PpM``@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0780  @/o0"S R 0CS0 Q  S P R 0T@180 0P R* 0P0 x  80 0dP d [0J0C,O-pZX& RP X`P|` P U[ ``F 0R@ 0R U *0@S0S  Ppp@-`R P@ ]UG-@@` PР @PUЍppP]7AP ]8p0ShЍGD,@-T0@0S @yD,0 R/%R %R0 sR0/p@-(PPp@P@p$,/G-`d:d@p00CS0Pu U   0DIS  !_\`p@P0 P00@-@,P*/A-@H0 0pR`@0S00 R0R@@0(`P0S U  P@00&&O-MpG`@ P!Q[ Z@P[@P) 00p00 0xЍPP P K hPT VPA^P b_P00pWp&&jA-@MphPPPЍA@@@c`H0 HPx[ H@[ЍqwA-PPЍ0S `p@@@ZPP D 0 ` BoxW P[@-@@ A-p@`P@0S  P@0S0# CV* UR@ R %S0P 5@# CV* WR   R %S8 P0^@@,D,C-EMPPEߍ@ 0@qp `,qPڬ嬐P ` P:T0S EP @  ^0pS `P  LP@,-C-MjX1@0SGp0@QSP? HcP ppp``c0000 0p0 0wZ+0`@0PU `ZV P0SZЍ Z@,&&0A-0S@`e@P0L Vw@ p`PZ@ZZ,@-@@P ,P o@-M@P QPۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` d~P TP @>#@ ЍP PP  0v !Z ` ZV @T P uX%X@P B@T@P@T 000d0|@`<P-@)0SY-,0A-`V8@P|&pP0 PЍA"vPs`@@@@50 `ovYY@YT ЍAߌЍ,7A-M =P  @oЍ0@-@P0MSP H@\5] PQ @Ѝ0@T@0: S )*@\-&&@-M@P͡0 00%Ѝ0@-M0P@ Ph0 R\P0 R\ tu p0St00Ѝ0D,,,/@-@P P0@/R@-@ (0@0T`#@X-@-40 R\00S@#@(,-h00S /pp@-qp 8#qpP@ QPpp,@-P$#P3#0 R/  (,O-q$M0S@vP`0S\0SO@jP`@@100CS kDP`@ 0S"P`vu00 @0 00R  0嘠嘐00 000h 0 0000000P0 000`0HP$ЍX-T-,p,,x,O-M<`p@P8@V t30Sh30`So`V D3``F`V`utV-$0S 300CS QP ""Tq"QP ""0S6 F`+20"`Pp0X 0SJY/Y @ Pg"V<"0 40 ut  20S1"0 000 _0 0 10S*P10S o)*qp@PZ "P|"P41Au"P  "qp ,10S J"P ЍO0G0 0 ЍO,V utS 00St001 ?Q*)@P9ut`dp,---,&,(,- -`&tX-,(-,H00S <0P/000S $0@///(,--p,'G-(pP@,`qP"V 410S(1`V``ut 10S100T T0 003*`#*00oᨂY J}) qp00S@P W ЍGv!Vo V 'p,X-(-,-O-M`hP P @0P! ЍO!qp@PV00SЍO0Ax!P0 00@YЍ~!pP@PT p 0Z qp0 @P,p,%-A-p` qpP@VЍAw   0@2Ѝp@-@4P0SPpUqp @p,0P  P/0&0P  P/0&@-P@p@-@PptP0S 0 0HS @ 00C0+V)Vp@&V  B 0D,0&@,0/@,G-`@ qPU  IP9 Y* V|UU&8o@q|0 "0XPP00040000 (@0@000S < 0P00SP   00&@,P/P // / /00//000////0/0/p@-@4PPP U4Pp4/O-M cD[ {rPX 000 0  0(GP 0000 0(XQXQ> 00  0 'P*Ѝ=ЍO" <O-P@4M(0X0 ,0ut@@ P4Ѝ40SU400 ?QO('@PPp8d00 0bp P7ic  ` 賟V0,? Yp` P P@Pᨣv V}, `5V@P,0S1 h3Z1 @P'L30pW0+ 0$ `P" R $0 S S` P P  `VʏZ:P `@T_@P[ |20S  P0 X (0 S  $PO 20S 0 @ 1 R00 SA> P Pe p 4ЍO V  P0# 0PB R \A0 Pp``@P41`!Z 0 0@P_ V V@P P P P P~@Put 0t 0@P_|l00S V V0 0 0S `@Pm`0 (-,,%-x,-----7@-P@P ,0 R  000 Ѝ0x,O-`Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000Sd  RD = Z* P+R( PE0P*!H(P3% R R R000#=R00S 0=S#0E0P0 S0PS  P Y PdP P P 0S 0P  p&D,& '      c  \ A $0 RP  /`,0 14/`,0 Q/P/(&@-o04 ,    00,,,,G-P㌐剀6M@2MPT`ppP _NT [N ^ ! Y NN LN @`匀`,A-8p@0PS` 0P0aP `,@-@$ 0 @z`,P 0 R   /d-p00S/p@-`@mMPPPpP 0S8@pPp  -`, @-4@NP00,GPl0 0Q  M;D0&<&8&4&0&00 `, ,,, ,,,P/0/`,0p@-@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00`,,,, ,,,C-餁P0@SpM`$p`xx!0 0 0S]0@ 0 - @P(a00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tP--\-p-`,P&H&l-,0P$0 00S000/-l--p-p@-H@P0S0000p01S 0=&P`,,Pp@-`0 p@X10S P@@p(1@0PSP5P/`P0@@S  1CP0 1C"@P 0S000|  0p  0d  0@@P| 1CP ,`, ,,,,O-`CM00dwvP1S0& 1S8  0C# RfY) Q 000 00P20S P wv  1PS  ps000ap1U 0S \ 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[0 `0S% U % 0R 0Q0tP 0C001萄 S vI  0`,\-p,-,,-A-p00PS` HP ` P @80@0@D@ 0@0TЍ-`,,p@-P@ 0p@2A-`p@@PGE$1S 0P $@@|,7@-8PPU Ѝ0@@ @ Ѝ0-0 (! ,!/`,0(! ,! /`,P 0@-qP/`,P @-@P$0`P/`,P @-0000/0@-S@ Q+ 0S \Q@AOoB@0Sp IQ S Q0 0I0S0000P p@-`@P 0Sp(P pG-lp0dES`P01SP001000PW PP- U p P Ѝ010S00# pP0J0q# 0d` F$ F# 1R P@#1 PR0(d0 d0 0  0U*P0C0#0OJ001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0JP 0S0C 0@` 100P0C000jPPUF` 0Q 00}0 PQ_VP P0SPPA0SV_0Sh QPd v 0 ЍG(_V` P V10S t! RS 0  m_PP  P P0 6PPP0  B01S0R4AB@D pP@DT0CR0S*A8A@DP  0 )0S pA-`,,,,,x,4--,0-(& ,OIA-A`pP V P = CP  V10S ! 00|QS 00 0S$ 8QQ 0XP< R0$1a 0S0S G00S$1R0$aʈPPt` F F)00x$<0s0$10P0 0S $`,,--,,|,@-(@0S =Z00`,G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000Ո0 0C0S Y10S0 0S L G5 EhY 0 0R  5x00S U d00SX00S D00SX    `,,--\-,,-<@-0 R!  ^ !0`,04/`,0 R 00S P@0~0/0P 0/\!4 0 / B  0/`,- 0 /`,qp/G-p`@P?pP 儐u U 0 " 0W 00V@00CSaP P 0P@P`,%-PG-P0P`SPpЀ@ 0@D P V 000U00C0C0y Tʌ%P 0 BJ 0 Q@ @D 0@DSB`,%-G-p`P@0@@0W  S #R0C00C0Ѝ PP   [G 0 ppGA-0PP@q1`EP q 0P 10`,G-1@l`Pp0XXqp00 R00STDP0pT@,p,`,p@-@ppP P0S0OJp 9P(&@-p 0(&80P/ R/0 0S 0 /,00 0S/$0$ R ,- <,A-X@ 0S0dS 0p(0,`P` p U` 0,( X0QH0H 0.4 00/ 0 0,,-A-P@T  ^#0pP4 044 R@0pW T 4` 0P ^@Q 0࠱`@ 0,qpO-PP10SPU @PP0⼡p`@` V  RXWA 0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00  0` qp )@PPAp ` W0 0K0  0`qp @TP-,%-P0G-`p|PU0  SXW@ U W0S P)BP @P P`@V0 0 0 0@00qp0SP`Ph`@W 00 0@00qp0SP`V@,%-G-`P@Apတtu00V00S 0SP@`P@tu TUPp,G-@Pk0p`Ptt80@ p 00 0`Pqp080A ,%-800S/,00/PP//P-X-00CS0 S0 S+c0 /O-0P-SP | z x 5] fcjpjP[j@ P0S,5@ 0S 0S%,@T SIDi>ji;XX = ;  h 0  ЍO/`P B@?@ @T 0A $ ,asD\ ^ ` o r <,f G-@P $`P( xvpP[ `d   @yz  0Z Pp@ ;p Tt |p@]w  40 { p \ ^ <,C-`Hqp pXqp@@PPP.Y T0 0 Ѝqpp 0  0a0@S@-TA0@S<0'@ Ѝ'P( #P   --h- .Pp@-9 $P" 'P= P !srp p^P 0 &- &P C06 pPtd0`@P\0 L0Af&P,@m^006p D,- p,-G-@`pdP4T#0 5T Ta0'0000aP0 ]C@6T P'0-@-o0@-MPh@P  ! sroЍ08!P 5C0 00&D,-@-HP!sr@Q 0! 0&-@-G sr @@@60P&6 C0606Ѝ-D,G-6@PP`j>T6k.sq 00P6 B06PU pBP0PPЁ  G P -D,-@-P ,0 0R  D, l0@-0`  ^ @^TSa04S '005S #D,-p@- @P 0QA 6R 0p-G-pP@P P`PmB`jBp6W @-00S/A- M`p`@qpp6W @ Ѝ 0 PU~P4|P P0 _t- -  @-  0mS Ѝ 0 Q0 ?@P 0 S# : PPP0`0 S  Q0 R pV`PPp Apv00p,17@-PU0P( P@ PZ0 Ѝ000S@PP AP5A5 Ѝ0@iH00S< Ѝ0@ 0 0$0 ,| 4, @&    0 8,<07@- R P(0(@?@0 Ѝ0&p,@B-@-P M# @0.S 00S Ѝ 0S 00 00S000\ @ ` ^ P0@ 0R 00@0@$ &  - 5 < <07@- R P(0(@?@(0 Ѝ0&,@B-@-P M# @0.S v00S Ѝ 0S 00 00S000 @ ` ]P0@ 0R 00@0@$b &d | - 5  @-@P[P  @ Ѝ @-@PP  @ Ѝ 0Sp@- Sp00S p@t l0p`pP p@"qpP@ 0p@ , --P07@- S Sl0 Ѝ0XP@T0PP k@X@ Ѝ0@b@0 00a &&1 P/L0@-0@S 00 $0$ @$-L, -@ P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P@ Ѝ04@P,0  0 10 &&X%-&-B 0/0o-P/SP @P/5p@-@PJ9  !P0UxSJ{yw0@0tr6pknp@D &\  @--0@dS!@S1 CR&0C  R 0Q0 . Ѝ@A C#R k C Q 0Ѝ        @bP @# d- .  : O-P8M`00P@*0 S  0  ? 0p00C/  0?pT*000C SX E0!R1PT*0@ S 0,S U<04 P0EPE1!0C 0UЍ,X&\&@-PMP M 0@ݍ Ѝ@` @PB0Sp0  x@ݍ ЍU XB HP0S(*BX&T ,\&o B _ a d P@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000&&  @-PM 0  0 |0 j @ph P 0S>000H ;0Ѝ004@P v  -- P @P/h 0 / ,P/00S|-0/@-@0SDx-0/@-,@0S0 0B00Ѝp- 0/@-,@0S0 0000Ѝl-  0/400S/(00S/@-qp@`-D,P@- 00@ ^S00S00 Ѝ0 &8 @-P4M & @"`P@@0,S p  h0S  0 ,R 0x 0X0S\ 4Ѝ80D@0P0 00 xZPX-T-L R q | 0@-PMO  AQA0S1Ѝ0RS'DSSS 0e C R E C R   C R S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  R ` n D-  800S ,00S 0P//-T-X-$0P/0 0 0C/-p,X-A-PU  @Ѝ`p@wP|`V 00S0\V0S 0S`@W 0P `@$V00 -@-0S0*00 0Y( Ѝ *  Y -  @-Q00P 0R C Ѝ0 @- L -P/0S/P 0  //P oP@-/R 0LP/- 0@-L   Ѝ- A-`@P᛼0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍfL0 @Pp88 0 R @@-PJ &$PP 0@093@!+P0P0h0 P @0+S9P <↼<9P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PcO   0 p0 @ =RP    B  Xp00aK[0(!00CpS0 0U?o 200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0fP.00S -$-L,  f  @-@PM @PU`p0@ uTЍU  j  B U R{  0L"00CS0U0S U3/U@`y 0 KV00SYS_U 0  1 U# U U 0?o20 0 ?o2P0U U U W0 0S00P0S00 0P W 0  0S00S000ESU U U I 0S0mPS000 00SD000V S  #  <,> j  p@-P`@Ẻ000C S0 ` 0 B ^ ST00p pS 00 000S/P/-$-@-XP H0H@ 0S0S  0  03/$@ $-`& 80S/S/ 0CS/$`&O-@pM,Q0S [; 0S0 0 Ѝ`V$P  B0P  AAQ-P $YQY0 0@@Oop B0 0S `0 0S Wp0p`&@-'PUP0D( &/@-0M@20S4GP 2     ^2 0S@ 10@@0Ѝ0! R0< "$01 S 10S 10S|1 \11S(  ^2 P!2 R@ z$10P@ 000 0 R  R^0 @000S T0 0S T \0!PL 1 10S 1㑹K0Ss G0#So @--%-%-,-&,&@-@-従-@- 4 Ѝ@-P*L;`@@@ᏹp0 `U ЍT( @-@?;P  [( (-G- @$p`P 0ွ(S%0 u P@@@0^3#@- d 0 Ѝ,7@-P@2"@? Ѝ0@B@-<0?B3c/ ( 0 0 ]ЍMb@B40@-0@@T ]P  0 &<-<,@-@0@&0$R/ $妾<-p@-20SX` 1``FoZ@P 0 @PX SiX1)`R@Put0`V@PP@ 0S 00SL YJhG qp QP 0S 00S3 h%-d+ E+ (-- -p,-+ @-(3$ 00000S@\ %--@-("$ 00000S@K %--ê@-馯8, 000O00S@48 %--@-@P x0x0SdP@8 , 0 1A-@TPP0 @빮wP]Oի 0@ P`p 0RW 0` ?00f 80 ,00SA?%- <,,p,<,-G-pl0P`  @ P 0S 0S S%-A-` pP>@8-0Up0P r),p@-HP@T 80   p 0 )))&%-O-0bAM McGp)W 0A 0= PP o0S0000Aލ Ѝ0!S  PA>004S S S }0PS  0 QP04 j0S  HH P? 0 ^R0 P\ S$R 0C 0M0`0000 \P0C R 0 C&+ %-O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c PU Y< 3T \ ;PA tPpp@  @@5 0 p$ʒW (l Z@ (T<"0S000^P ;04P S@ 7 Pp 0S 1T [P 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P ? U0`00002%-&'%-'+ 0@-@KPDP |?P l:P \5P +MP@M&+ + + + + @-@PDP P@+ + O-x1M0S" @`0 ЍOjPp000 0 Ppxy@`Ѝ00S 000S  0P @`KP 0 00Q0 p' n' 0S%-%-, --p@- LLPR^pS @T 0 B%-&p@- LLPR^pS @T 0L B%-&0/%-0/%-00S J/%-@-ATP MLPHLP, @-0%-//@-L@M +p0 P@S0PЍ%-\ QR0* /QS QQ*/0000/@-@P &000000/0S0C 0//p@- 0#A3P@p@p@- 0@SPR? P `Q  &` PЍpA-`pP@T@  G-P`"F$@p(, QP 0$ GeFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0 00Pa0C`@S0 PЍp  000@@0 0 0 0 0 0$, A-^\^ ^Q[\9[^V ^\00]QQ$ ]Q0\[Q`.FQ5 `@p 0]QV0@Q@\\@0[T T nT  \TR  @0\00T, |, , p@- Pd00@S S R 4!@D@[ p@z0 @ ', 1C-p`Qp[@P0\`0Y 0 0PA \Y R T R 0 0P@0   [R .0B0S830 00]RT[T@ 0QT 0QST[@[T0Q[S@ 0 R Ѝ7-, `@-00@-M M00P/S $S! +S00! 9S\S @P 0IS@P p00ۍ Ѝ00@00 S00M@- , O-@T0tS bS rS aS @{S000pW` Gp 0S0QU 0V庿P 0 0 PUP(b`Pm$%-@-- O-pM>4Mn0  PIW ܍4Ѝ000Q 00  R Q  R  R  R @    0S 00@0p00pS 0S @P#S ;S Y0@0 P00 ?0P YP  0S @,SP0S 00@YP  0S  00@0r0W00 r 0@p0ST @;S }S p j 0R @\R 4 ZPU P @ Q IY ,MP  <,0 \\^ ^00\ APP00WY0I S NYP0S 00@:0S00)Hp m 0S 00@0S 00@00P0S 00@T0S P @0S( X X 1@( RP0U0 2P  P\XX $X I0Px $^P I0~0 , 8 SR0 (  xX 7哎00H00 PP R00C0 0C S000XW,X, `P0pL\RC [D Qx␸0S <,00S ,, E 7P00A eX 0(0 [^ 0  0S 00@MgQ\ R9QI0QcQ Q \[08 9R/RR0C8 &R$ +P 808\R \ 00AR0  S S00( 0  \ Rl  ;QY IQ00pQ wQ$ iQY 00Y E0"S YK  0S 00@<,0 [  RR , S 8x @]3 0S #Fp p  U@P IW[ 0SD @;S> BTW0110P\SSpE ND  PP< , @P 0S 00@00 H"pk0H "p Y20S!000 S90S 0S @;Sa }S0 @)  9099090H 0 !p000 XH 0S  !p U^k   !pYP 9)0     囱!V1 ! 00 $(9 09909 00'-'/-2- <, ]- &n- - O- - - - . G. 7- c. Q. f. s. z. %-. . . . 8-'-G/ / / / u/ / / 0 @0 e0 0 $'0 A-D@`@PU@Tp00S RVX0T0KVD0 0pS0(F P%-@-L@-`@-\@-0 p@-P @1V000P @pd&@-@#V 0  @0d&0p@-PPUph.>@P 00CS0xp ѐCxp0 :x7-1 A-p`dB R3 RQ R P$0SV0(  R R =$0P ,njP0 P0!<PQW#$00P0PT0, PP (00S(0 #R nR0V ,0 0200#0$0,0$0w( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0P $w (0V0(0 00  T0(0V0(07-1 1 1 8-1 @-|@X0  0S 0S00CS0wp X0  7-G- D`X0pSM00S 0S i#3X 00X 90C\ `00d0弃XP 00CS0 wp XяX ,pP0 W0 XPލP3 -wp0S $E0DP 0DP p4S E90p0p4S \2PP wP 00\0uDP|p0`0d0S00d0000S 0@S0k EP0  ?i0   0@ @.i00S ++廩 P0 i+0+0JjkPEJl0l!Pm; P@Q*KE\ PP v8<P\a ( p$ /D\0p !)D 0`PS(00d<PX10 00*0\`0P l000S SP@  0  lC(00(017-2 '(2 @8-H8-.2 H<-0'72 1 `2 x2 2 2 1 1 --AMM@A> 0$ 0:0 @0 h8-8-2 --M MA>$00:( (  0/ۍ ЍЍ/8-8-2 @-T`@PP  0-pS0 - ЍH@-@-`MQqM0S000@03 0@0S   0Ch 0 0S S ` 0Vl;@P *0 ; Pu 0B00ڍЍL@-48-88-$3 "3 @-@P  Pth `p\0 P `P 80P S x g ЍL@-+3 E3 G-pA嘁0 0`PU , R:(,nS0(0 &U# \U   0 R`Z &R\RP` , R:(,KS0(0P    "pr P qu PE ,  R:(,'S0(0   O 0 L@-'A-@P p0R`*SW00 / 0P P 0O-x/MtO00hPЍ080L?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0  P0 R p>0R*ST>0@oP0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0 S@=0@oP 0 -=0C>S00L0 R: L HR `0p00c0800400S<x<8 00 `\04 0嫬<0S  +H0SP80S4PU 0`  E:P0800A E4 00T P !0  004 0| 0 hh 0L;7 404{ 0 8;0R0 <0p 0P 0S XP 0( BP2S 0` H⇺:0C0 0S0`V: $J G00@ \:@崻0S  00e  H0$ P y0 H$0R$ [0`V: $ ` 0 0C 0 P 0`V:T  `  0ݫ[ p 妫0P `V:`:00(CE 90 aV : ` 0 080 SH88 00 0h04 0埫<0S P50800 0 P%80S!g04 0y<0S  80S04p  G`P <0 00Fpp40<  0Y<0S pV 0400<068 00 V04 0A<0S XL0 R: L P `0p]00p[  R  Q 58 H4000  P 04`Z Z Z000 G 0X0 00 V~ Z0 0RP  0\ >0   PQC p0V `XOdH0p0<Hp<(0000S \t04 0媪<0S p P[ 80SX0sFD$DY?p@0 (sdQ0 0  0p V0`0  `=0P  0 RS0 0 p0V R`0 0 PP04 0>4 0P >P"0 000S 00P80S0s">p 4 0>40P (>P P R0Dt0`pL<0p<80S4X ! 0`Rl0004 0V*0000pW(p0 1(W0 \90H ! R 0ܕP 0 pW*0$ ( 1 0X`xpH0`0h<Hh`<x0h0E0| 06>8-L@-|@-'-2 48-7-R3 @-0'l&T3 ht@s3 \3 88-$3 _3 "3 y3 d@- 3 3 $'@-3 <0 0R0((Q 0{Q  '-3 @-p@-@P`Tp0wS {S sS 0p 4>P 0 D7c0`@p %>P `3 G-`pETPtPU00c01@ R  wPVAGWp0!p!Q <0A\S00 0  b0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: ᪨pP 000BS 3 @-3 3 3 p@-P0`@T P ႳP, 0S)00 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@@-3 z5. 0@-MMPB=@P  P^b =p4Vb+ *= PC=ۍЍ03 3 H0  BR R R#6 /''@00CS0 S0 /  6'@-,A0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@mA-0@-01S ^00oS^ P0\ S0S Q0S R P0S0S0 00Q R  :.A-0@-  `Ğ\ @ T\    %R    A-:.p@-TA0 5S <0S -00$!<Pa0U&!0! R8  (P  0  ,P  ٦0  4PP ̨p@̎00\P rP @ 彦00, 左P$$Sp:.`" 0B-,B-'3 p@-@0` =l1T  e4t啨d lP`PT p ۦP000ST @''3 @-4 @-@P 刟PC@P @0?SP@ ׯp Ѝ/kP@UP 0S SDO4O0SK00`4 4 !4 >4 @- 30}4 '@-0@<TQ T0B0 30001S R0Sd0d@TTPT T@0$ @<,3T ,  @ 3A-4 ':.4 4 4 5 @-ֵ 305 '7@-@P  0S 0@T ݵ00 Ѝ0׵0"S sr@-@F P  p  `Ѝ6 <0A-@X`c# ^p "RG ^<0c#N R 2& 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,կ0P01pܩ--01//00/00/00/00/00/ 0  /h-7 0  /h-7 00/7 00/$7 00/-7 00/67 00/<7 00/K7 @-@蔔-00/@-@ 輤- 0  /ᔣ-7 0  /ᔣ-$7 0  /ᔣ--7 /00/00/00/N7 00/V7 00/^7 00/g7 00/t7 00/~7 00/7 00/7 00/7 00/7 00/7 00/7 00/7 00/7 00/7 00/7 00/7 00/7 }O/gb@-0  0Ѝ@-@ +@-(-0@-%R  +@-  (-u @- 0蹧-- @-輚-(0@-% R 輤-  @-7  @- 0著-- M@-蓓- @-  蒖- (0@-% R z蔔- < @-  qt-< @-  hq- < C@-_蔒-< @-  Ws-  @-  Ns-  q@-E蜣- e@-=- e@-5- e@--Ȝ- @-  %t-  @-  躣-  @-  r- @- 05-8- @-  t- @-  q-  C@-蔒- @-  6- 0$S00 @-8- @-@DGP d 0  8 8  0@-0 |1yܩ- p@-S B/(B(!  20S 2 00 m8 p@-@` P  0p@J8 0@-@Q10%R   @ M \P \03S ls d` \ \ T0 6 - - --8 --7 0@-@Q50%R   @ P x03S / xt p pl lh00S  0c 6 - --8 ק-֨-r-X-0@-@ Q80 S00 @L C   ĩP `03S  xt p pl lh00S  6 8- 6- -q- t-5-8 S-R-r-X-0p@-PQ+0%R   p@| t/ @duP 3S/ <8 (A. p6 (-8  T0Q@ @8 8C0 , ,( (/6 - t- -q- t-\0QH H@0 4 4000S  /6 Ȝ-h-r-X-H0Q4 4C( $ $ /6 --q- t-`0QL LiD D@ @C8 4 40 0/6 --s- -q- t-H0Q4 4CC( $ $ /6 s- -q- t-Q Q Q/ '  꺣- t- (-sQ Q Q/   --(-///00/////////////00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/ @-@0@}H-@-@0@tH-0S00/ C@-{蔒- C@-s蔒- C@-k蔒- @-  cq-  @-  Zq-  @-  Qq-  @-  Ht- @-  ?t- @-  6t- @-  -r- @-  $r-@-.0X-@-y.0X- @-  躣-  @-  t-  e@-- q@-蜣-+@-(-A-T`)qW ?1@P |A圂0 Sܩ-A-@PP 0S ]``/P  .`1S0rKP M/P 0p R> .`@-@PK P ~ n0 0^n000A-@`\@*T<0p " RG\<0c#N R 2&@-@[@-@@-@]@-  D&'8 p@-@0S*IP) bd]P   R3p|PxxH@ & P < 0@ S< 00ppp8B-5.&O-,M@0P0 T; R0AT 011!0 S01  R 01 AP5dP ,0S  R3/00S 3/[1P PP Q0P 0 0S^`|: p` 00 1`@S0` $0"P$0pᒤ$0P``Pp1U00$0PeUP0S$008C80ᨹ B@S SBڰDP@_@8C80$S@ STd 1  pP$ T(0 `p B BR V` Z `1Z0Z/d 0 00003(2%0 "P P #V`y 0CÐ   S CUPPEPE_P 0 |P c 0 0@0 PG%P Pro1  0 | 墂 Q l7|;XXW`^PP000;!?@  S0010 SSQ 1S b !ġ1S 0C" !8C8R11$PUZesvptv0 ^|P u1|ag `P 0PSY 2I p5o0 o j<] P ,500xP0 qP- >P( dP& <PV 400C`F V$P SuP4P 0CP  @@PPt4P P0S 400C`cȁk1SR !0C B/!?1I]1NSAPN P 0^A88#8xP  R11@(zP`PxP@a@1S020,(PJ @$3@P, #0@S002P0CP?P <P>P P2P 0P\vP tpP1aH P {Z1S'ʰ1 H P {KP 00P1 RE40S 3/Pk PP k P,ЍPR0v Ib 0SpW 0j 3/pd P 0`[H P K{ k `k00x00AJ!0 b02P _00P000fhk 8B-8 8 'F9 v9 5.'6 5.9 S'R6 6  001/8B-P0 R0//8B-O-p`*@PP [ ! :0P @ Ѝ0˦00 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @8B-9 P/D0 R/0@-A1 P j@< て8B-O-hBp0 `$W`D5m0p 000倈 Ѝ0P@P 0S 00@ ['0 0 2tP -]0S ']000 00 `[0S tP ]000 [0S tP ] ]0 00U P0IS0SPPs0 00s0S st ?C S \PU  Vp0Y!0C0S( 23PP PE\LB-'VUUU @O-$MH0[S0P 0L`Dp|D F0Y0 0S 0g l᳠Pss s@` 0p@0@0000. 0ESET0D0T00Ө?0S0 CR C 0DS0  0mwsX 2 l 0  B5切Z P0{ P>  PN P P!VUA`E D์@DP`4wl tl ql@`"PD P AP;  KR !   ` D0呌0@0!P`1 V0p00@  `` `~`F`FV0p00@  DPEf@DU`E¨` Y @ V@T`— R   B[00000S 000 0 04$ЍO0Y S LB-; ; ; ; ''A-pP`Pp `r@r@0T `P@ P P0000LB-@-P@p 0y,0T0* +p@Ѝp0 00㘛 0l` 0@ ֋+@t 0P & 4&LB-; Pp@-@*TP0Ps D` R :P 0S@@Q@p4&LB-@-@aE0000LB-0pLB-00pLB--@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@; @-@; @-pP@`M,0 0( 0 00`Ѝ@- Ѝ"; O- M P`@pq@qUjT0 0bP 0!D0PSY 0SV L00SRD属PPL00PT^y@DO@W =p 'PSWpV`KЦo`0 S`K0 v@PE@0 @PT0 0Pj00L0D 0H0T DZ  w g<|ggЍ00D R00S 0S QL0X3#Pp|vP 0 Pw똰#KJii WDB0 EG\vbP` KJ`iiLB-#; 5.@-,, ($ *Ѝ"; @-P@`$0 0  0 00`Ѝp@- Ѝ"; @-pP@`M,0 0z( 0 00`Ѝ@- Ѝ"; -@-00c  @Ѝ Ѝ/"; p@-Pp@ppLB-@-7@- z@*A&$]PU !% !̕[00h@PU %T !引[00000S$$ Ѝ0l-$ ) -; pB-'R O-TCM@!0PD0`@ _&@ `!]ኮۓPP  P[CߍPpW > @ pPY Z  ` a @ =R@8X@0尉 p ẕ б α 'ұ l ٱ 1@-n0C-MM 0p@`P0 $PP* P P 0S0 0   HPP^P 0 Q00:0PჁۍЍ0.0P 0 >0 0|>ޱ ,00S/ 0P eR@-Ĝ-\-@-TP )P <(@("P@$ C-@M @冡0S0x$P.  y0S%|P  e0Sn Y0] 2)PgA@Pc$D_'DJ*A^&'ЍP@RQB럃P'P'20S @`P'.+Ap 0$!P'Bu X$ $P 0)AT PUP FAP p PP 0O+Q !Sp 07'SpT+pAW32pp0W3:X# @PQ  R@4Q p0Q  R@@P`Vp003/P,00  h0S  R l 410!8dp-k ܩ--h @-MM+@(+(⭌B+(܌B+⣌(?PލЍB?P 0 T @@@@@ @@@@(&B(>z -MM+ ᨌ+L p+ ࠌ+0h ?P  >ۍЍz 0@-@M *1@@#P @  P A0$*!PRW)Q`n&Ѝ0RN00S 3/P 0$003/0$6*E@P5P1[P-W@P)@P% 0P 囌@  0S 0_ Z'P Z@PLX4m0k%(*00-ܩ-b 5.5. @-@M ⥟0@@> #P* 5@  0P 00*!R00$Q )a@P  x0S 0` E'Py%f()Ѝ-ܩ-O-`M  0 0X#*0S ` 0 SS 0Np0 S00C `@?0 S:᪛PP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 '7@-@ PPU  : 媑W00 Ѝ0lP T( H " 咑ꢟ$ 0 [-¶ ٶ  p@-@Q`T8080P00S0S   0p@7;-l- 7@-@ PU  )Y^W00 Ѝ03PP x C`00S OqH 0EB[Fh( $l-' 9 L -` i 's@-8Q`@?o\<} ,eivdir !ei:idm; k 0 Ap@Pxx=t:݅P EKE#d&d fЍp5. ' O-Mp@` , 0$ "p| 0x%x t0z%k(P TP ؂pPT Pe## #$RX #0B? $0T$50P F}VPP =tV00t尙Pd嫙PS; @  @N; ;0S ;#P ; #%0#0i3$"0ߍ3Jf3 t3< 0~"!031<0`0<0&2  00 \<0(    \00=#P,00  㼲@~?"!!0# 2# PO  XT $ |L2P ||;H0S%@0 "U0 $"QS "#$ #'1P  1 Z0W$2p@t1@T  s@~?0XC "0@0S@ @  0R0SQ ʺx0S  M=P 0 WcH~s0 p PS $2Ĝ-ptl--߷ r- η  \-]  B I b 00@-,M 0000P00 000 0 00\PPP @P DDr@0Q ,l,Ѝ0@H 4&'e l- -O-iMs?!0Z#P 00iߍOЍ/Px`P<1P 0!0/`P z[p P@& [P pT00Z%TU0P 00GSW 010#S 00PpP@ P/ꄸ l- Q-O-p0MT@X   p$pR `V  @P'U` ֌PPGP@P FH E0F6PU m0'SP0U*S / qP0 0}X/0 0P 0@ 0 0H0 3PX1Z K z8p`PUQ}X( "2S022SP0220C2  S |S``+ ᥇|$00 00( 0=`0 VPMUShX PPV   0%S @S B* B⶚ 0.S 0 0P1Zp@P^ 0A0 0Dਧ $R;dl{Y|00 (@0 0 (PYhZhq0S  aV0A 0E?oX20S dvaf$sa0fh|V @ x 60S. 3h@\a|00CS0000SW0S ^$0S  `L;Yk|WU e7aeX P1aq|NsVG0ЍO Ѝ/Ḹ Ը ht@5.' 0@-CMl7PP 0S .Q個@P 4PCߍ0 PI tB-sC-G-p@ 圀PB`AT:00Y W ,/Y 000 MP EQ 0 @' A-`Pp !p@ ᥙ ,p !P) @rD-A-Pᐔ@⍔opl 0S DQ0Q.S&P @$ $᠅ 圅tB- sC-p@-M 48PLP   庅 8PLP  嬅 !p@ ( B  Q >M‷||}`ێ,Pz0尪S  W:-8 4e0 w=C$ C/ k 3Q00b=0ܽpQ>e0 "P400弓0 )P40  U Ur 0YR?$ ;/ 0yp @*<: R0 :P'P P 0X60,0:P<J0.̟   0/P `h< B 0 0u`````wPp,00ۮtl= LD0L lq0,ݍ<Ѝ>0a X囄 婔`P  壔P `;{ 1sS1lS<+2 0P%QPL cP<;▔`Pp},n*0x*0wn~P\8 0\8VW*0yU *0z*0}\8t*0|\:U :L*P0Q8 8* Q9ʟP \ʟW^ |9   +9 @H- A)0p 0HAxp p=Sr9<)a0hh eP 0H0 H0Axp , AtY`P( 0Vi 㭊PSUp`jve j! JfH p00n`<X(0~fd@ѓP T,̓P @ƓP P }JA⻓P ⶓP ⱓPg0:4LP '04\6S '0I3`P 5| pld('[7S0 '.Pt& P\6 AAy0\8P ?P &6 jP `(:4S ( 5YP 0: APڴ  VF\80%8\8nP䥟`   %P0%08P $  P0040\%S\880\8P ւ 0S %8P xǂ  dP000S\80\8f3P0S\80\8`: 4S4P l 0@?S \@P H3 0{C:$P0R#R#t$ßRp#lW%RP# 2M  D 0S2 "P 2@T ᄴP HHw* 0G0S x"d0S l"O3S6 U] "R?0⸂0N?C0C `.W`0  0F0`%{Px:A?FDێ80I,07>E`I00x 0,P"H p^0S 噐(WW5S '!#orXv嶈X60S`0 <IW4D%0`>t @$pԠ+ spqd L H +q $0Y 4p <J0S 3Sj `t ? ;0`0? (`p䀍0oP 0S0)#0C?o27 #3RR  0"R6p7 'Sn`F0'Sn`pF0'S``Vn`F0(P~ 0C QY > 00B,0! c4吀@<# $0p ^IP\P fP ,04! k`~<#`#`ḉL2P  @000@A0"p 0N?P0S J` ᒎ ⎎KR ≎0`0K?(081l1~$10 100 P@a C 01/@P00pЍpP@00003/003/$Am O-`UM MM.x0PeU.Q Qi\,6KnL@6Z@[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7 \4040@P#`ύ֯N⌗ 54, Q~W <S X7h4F>D0C287\41 [ V?h4F>D0C26A\40 40 000000000 00p@ 0 0}<55ps 1yt0 00 00000 0p@ 0< 5 5s qଔT1 @t00, n4E "w5@0\qW 42XL1຀`0pNόjppr຀qh p\  t00$? 000/0,0S00Ӥ?'N?,$"@p0 ,0mS` Eh40S N?,$"@h4PU\4 0}108A $$ŸP  ^|Xz !ԢH#2P0$100$4; |2P X2l >ؠC $10R0$10LP00: 0 q0H55S  Pe $003/$p PM pQD!> ,! )7$H0@:S 1 HPfP= <;S9 $10>C418<100S- @xa 0bWQ!!10Ab/L0,1014181>C0(1}1S0}1$1S p E@-5.'X Z} &ܩ-`--- l-a _PP$030/0@o//BO-P@ MMAT0*!Rp0)A`T0 $0   P f Pp ,*(0t$0 `$](pP H4\,: ܍Ѝp 4y0Spp0 P0 4p0SW00l , Ri  000x;8,9/PV 0  x8;,;/ 0 x8;,9/T08SS "0CS0S "S S/ Pp  R <pWP00P0 *|2YP0 T Pw' (pP 0s &P }d0S "8<8 PO@d0S !8-\0 @S !%8`0S !8X0St! p!S0 80` D$L0@ O@\0S ` R !8A8  D@D~@x@D@Dq@D@DjX0S0A@`^pQWppc  ^ܩ-0 4 f: S   -d j y O-uM0M*QU$e U&X'@&h _ Z &0 0 6T Q ލЍB )qW nP7 FP' P - @P' @ pH0X p40؄P40 ] P U Z@D`@ E p PU   c0SHS   : 0S #S 0P000P FviP14s10d#5:`#`S /,&5*&;(&0@`S D"& & 9A0{spp`0 0 ,0S T0 S00 P0p0SS0 4 0  0xP;8.5/P>0400S8RT0RP S@" SA00 800P80P QL ,0@8aa<th<0X !L! 080$ 0  40d( `C S/  S" 8Q0PE $PF_ P005S0+4^s04  u0 S r0 jh%똰0ܩ-D l-   - 9 M D    ! * 1 = E  4  4 w N  O-@BMTM) Pp ` fR@PpTp$;ZRPppp PP@BލЍ D #M0j@0@ #M>0 $04@(8 #M>0@00P@<DT@0 !RP pR#\0A00@3 0 ! R, Ap#0 $03(408@00S0ؒ; QP Q o 0@o/b0 !!/Q-10/fp@-@4P0 `>p1111pQ-O-P@p`ԐԠ԰0/ C !  !0  P00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 ЍQ-d  0 0@-P@M/.⍃1, 00 0d0@00 0T0@@@@1 0 000@P,hߍ0 Q-O-Pp@`4M 0SpfP `Ppp 0S00V0#S 4Ѝ0 L03/`P0 L03/P)   Q 0S  o P00P0 $04@H008p0`S,000TT0 0X0$0\0(0`0,0d0pA- 0R 0  DQHa@1QRpB   !LAPAP0 \A0Q     TTAU @@Q- O-PBpXQMU<2PX\1S2\U \QUЍ0C`1`1Sd`}001PS \1 X:X1! 0`1Vle.0X`0 T1QrX " \P6 \ ! {000: S.X1 2 \1`0*0X1`iP 0 S 0.S nh3 p ` XXPa SX1, 2 $ egnQ-`&, h t p@-MM`|lP oۍЍpP@P+wn P*+h=n P*+7n P*i PE  P< p@-M@(_O`P; n <0 0"| P (;a;(?a nA"c <3@P  Dލpj k -% ( O-@MP! c0  L 0Lp`娢Y pP 0 0 P0SߍP W%]P0}P0 a0CS0S p g `Vp08Sڠ0S`p R SX0  0 a00L p 0X1U0ů0 0s [+ ,pY 0yL @0tL0t00 00S 0 ^P0[h!R@PO  O0㏐ 0S* ?0!CVa0 ,DL4 ? d@edA@S-M R G Q-A-`@pPd01ST0D@0S@ V 100 1P!PQ- @- @-G-x1````1`1`Ah90T 0 'S Ph9_!P h900 ! !PV0<1&L#P DTPPH x{L` t{V !Dpp1 p!l{W !T``1 `!d{Vpp1 !p!]{W P!40P CO@ЍG Z t ` Q- @-M@ %P @oЍ@-| 0S lP \0 T0T0P0 H0080< $ Ѝ Ѝ- --p- q--@-p@Mp9t)0 0 0T00.00 0p $0t !ЍQ- p@-PPA@EEFs8p@ -?@-P @ Č R ,_+0$@XЍ0@ Ѝ/  @-0  0 P L0L L@ 0< <@0 $@Ѝp- r- p---3M M TqJP0  4|P {o3ݍ Ѝ > E -3M M SJP3ݍ Ѝ 00@-M  0[ 0S@Ѝ0d0d d@P T0TP P00H0P @@<00(0P (8--I -s-- p-q--@-0  0( P <08 0440000 0 Ѝ䔒-s p-s-q--0 0!S//R- 00/ P /R- 0( 0S0 10 1/R-Q-11<0@ Q !@-0 " !/Q-0 10 1/Q-@-M /.~, 0l0d 060 P000@ 0@,ߍd& Q-0D D /Q/QQ Q/Q-d&@-@0@ 0 0_PЍz @- @0S 00蘣- 0@-pAMhPN @j  P<04Px9\/o0Aߍ0 Q- $-@-P@ 0P  Ѝ--@-   Ѝ Ѝ/-@-\00@P @  Z7Ѝ@Ѝ/ -7@-`P010@P B  ;7, Ѝ0@Ѝ/ { @-,P P @E N X @-@xP@ [ob @-4@HzP 0 P f -q--@-4@4zP 0 P f p---QA-@@1@#PP1P#T|p|` eP (B(Afg.%+%DDs<q<_A_5.-@-@5P `~ @ 0nDЍЀ '0@-EM2P@ i nP00 40U0 ((0x:@vEߍ0$- Q-@-lMRdA i2xD1DQn `0x   5}<+0 00`0H0 0 00 00 0 PP0 0``PPppR0p2c+}Ux:X JP (Gi((Jߍ Q-$- `& @-@P !0`RxzIyP PP pxZP` 1  >G)501K<0pPں@T ;^ ЍQ- `&@-@<z+0@- 0 Ѝ0@- 0 Ѝ@-0@M00 0000 0kЍp@-P<@0/SpQ xPp@d&@-0P  p-t-C-$M@`pP: 0 5P) 0 PP0P00P l @`0PP0L`ySa00ͅ0݅000͕0ͅ$Ѝ  h-Ȝ--r-@  O-4MP v$m@apTPk $rmp`V50S` ovppG WV ``0 (z0,  ` ($0(b, 0VRR  S  R$0 0v(0@C@J$9m@,0!00 0 @  ((<,0 VSS00P0#02S `F { 0p Qv(Pp$ m`4Ѝh G G-p`@PPU  fPP 7/G11PG- M$lAP`pP Ѝ0 0 @`0 VSSXP$ l-@- 00Ѝ Ѝ/l -@- 00Ѝ Ѝ/ m C-@`PM MP\ @@Ep@ F^F43V00CV]DADVc&  0Sn 0CS+PCS0)  0 0S8 0S r0S 0S QN@taP$ 0 TF0 D@n<2P 0(0C?o270  o0`(H0Sލ Ѝ!7aS wP5S/F B !F? !@Fo@1Pk0 < 0M a' l 0S 0S} q0Sy 0Sv QN@<P  0E0 @P`F? Q. QmFOz. y{ =  (---e H-`&w @ & v-t-y -MM P  zP  ۍЍ -MM P  eP  ۍЍ @-hP( `dP! %  ` 0 S0 @XP00IP  S@TTdЍp |0|+R/ @-h@|+\0 P0}D0y80"u,0&q 0Q- -,--(- -0-P@-@ K@0[꼛-p@-@PM H(@y000H ,0@@04P,P:4hUPp0: S HuP e e܍p,[y 8WyQ @P@PڤaX <PT8|1| BWxp8<|DQi, H1 0880'8PP  QP00S nz < R t00 00000 00l0p@ m(Wt(0Q!ꔒ-, p-q--X]- / 2l --h]-X O- 0CMSP0q `@n0!`:0`SPW!000L @@3/@P CߍW! 000Z 0S&X 0 @T W  00 0 B 0S l00S \  P0W0 ! !  000p-r-R -Z X- Q-7@-PQ@0 SS <_4 000] Ѝ0 2S<0  O-8UMP00 $4Q 姖  x$ğ0/ScP3s0܃C0`/VeM3 P Q6QU@c A@ pPKTP HDC};z@1 U p `PP$ 0RP 2<P 2`.P$o3^ 0 10S 0S6 0 1S20S KPpG $1bIy6Y 00a H! r R R` 10 1000pZR `01S RB  0 P a0S  /SPR  Uߍ` 1 02UV U@P@T T` - -d&Q- H p  5.5. p- p@-Ph`@TUdpUP`ZP  p& G-pMMdpp@ P DD2PPC P1P  /PڍЍ DуP DɃPGP@ `P GP/.PP00/ (0 ,_Âq rP 0=Sp  @ ŶP//W  P P P\hP86 H PP 3a y 20p@-4 P@ j B $, + ? , q O-0c(0M<00PSp@p`00 # 80s 3 0:mh0@l0 S@3` 0X@[ "<0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0D002 p0 0lHL048  l0(0,(, 00 0lP23U 40p0P<0SPP0 M T00SI0Sj00p0q  0 0 000000  \0 v0 00000PX 00808/l0 PpQXQ Q(00,0p 04 80\`\kp a X0S l^ 0$0p0 0(00,0  04 800p90d-- d- 7 G-tF`0pSPhM^Xrl0S jl0 Sbl0S[l0SkTl0SGMl0SHFl0SI?l0SJ8l0S`1l0Sa*l0S,#l0S000$ R$000 "0& W40SW4 QQ00Q00Q00S 4 ehЍG ( k0SWCL4W@048P Q Qu0 =3003 0k0  hЍ3003 0k0300 0$p3 0xk0 0TS(0p`@ 60  SH0pP0`@SH0pP0`@SH0\000 SH0`000S#H0rd0S tP`@0 # N8 MP0 J  R>0 ? H0L0 8 H0L0 1 H0L0 * H0L0 # H0L0 t H0L0  \ H0L0@ D H0L0E ,hЍG !耟SH0000 #0PpG0  d :/ 000(00d-0> B j q H _ --h , + $, 0W v LW @ \  ? C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``w0 0pp07/0@-EM0@P 03/P 08 00 @@X003/Eߍ0@-`,MHP [@0 0 0PP@;00 RS THP pW kP00H P00P0,Ѝ @T@0/W  /0 0Hz[H P00' p@- MP@D0 L ` 0  040PP`H0Dd Ѝp G-%(M@PV X PDP`8 ,VV !R "2 Vr PpP`"pVp$UpWYb$U  0 m0 00% 00 0 0000M0ppppPP (Ѝ\- P  , C-40PS,MJ S S S ,!S SB @P? `q`/`X 0 e000 00 000 0 00 0 0M]`P :~80S>,Ѝ /  P 7 0 A-Pp`@a!p0P  p0Q p\Qp iV`P !@ B"FQ iT0 01`0(`10q00007PN O-RUMP , X! 3 #1Q1 B2q Bq BQ B B  0i`㰰0@ X@@p0 0,(0 @@@@@ p@@0`PቿUߍpv'0( | p D`∀+ 00*8b0A-0<0@SH04 `pPQeV09Ie?V090VP:0A! 0S/ LP0 05/0P0 8p<  @  L 0P4 P p $ Q:  BS:Aߍ L`0 (06/P(0f 8< b @_0`4 V  V  R U  U  RE ,A0  ( c( P0 cp $, ( ( ,0P 0 pP`p0  c 0P@cp`LP~P\ p `P@0` xO-0@AM-- O-@`,M0P\03/0 X ĀX p ppP(W 0 Y3 2 Z "00 " 0  C" 1 " X "0  !" " 0 " 0 "  C" 0CCW 0B o@eg0E0 0`20X2 0P2P 0J00000O,P<1@11(q(,Ѝpz'0 8 r P  dPp0XH D00p 0~P P`&0,000P9 @ p0 ZY00SYXP YP00S`(0,(0;0V,00f0pb 0i3/`PN |e-qT ? dG u/ l2 hD rd- @-@P0!dP/[P0S0 O-pMCP TUtX4{ 00 rs> ,b0  * 0` P  1@0 B )R R-EPQ0R r Q0CFS0TR000US0a0Ѝ@0  llEPT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V b @DP0 /S`Sp`` [XtT00U0,`0 e-( f-, e- T8 Tf- 8Ti-H- O-0MS@pأЍ`  W0@ 0 P0S% cS2 %MS) CS, GS R 0aP PSS! +0C?oW20S 000 00SmS sS gSR 0R RO-OMM400 00 P00 <0 0PP0@@00P(0 P 0H03/00040 00!6 0R 0  0(3/ 0P`` S08 \&a0P&P=UTa`0$08000,00 $0 &-p(`DpWP0`05R0dh0`  `pV S` `U T` PU` VU 00 0DPLs=;P864@ 0\PX000S400O>C<0000D040 40`$pUL0 R  Hr0 00H0 F0HL0S p8bP 0S80Q00`Q0S 0L0 aA3/P 0P0P 0%003/X`\0F0 [8#p@P0?V`UP 0 [0 0 Z0R0 P<0 S@00D00S8 P' a`0 "$0]$0,0, 0,0$0%$0匒 X0 0`0 p00  0` 00 0` 0 0p0`00d010` Dl0h#+XLQ+HQ\ Y`*pV 0 LrU 00 0pLr0 DL rH0*,0$ Q00Q03S (0A( 2PIxp 0 % PB00`P3/ A0`XPQ2ViP04PL ( OލЍ 0 [0A 0 Z0= 0 [05-5 : C -S N z ? I H c m @-@! 0$   0 P0S 0$  0"O-Mp@( P,`|1/0@T0P5@PZ@TP0 00_ p0)_pW U T 0_Y00 @$P $ W<000$08<8p1 0` S04 $ia0$L#L0d00h04O0l0彿d  pW P㴿d pQ㮿d WJ 0 Pq FpB@3$ 0 X0 0\p0p00@0800<0#0pWP0, R)  Tp0 0@0pT0 F0pTP0P pJ`PP $Ѝ LT0 PpT0 0S! 0S4 `Q00Q0S 0L0 aA3/Pb  0开0S S 0%PTOwp; 0U%PJ003/%B0K0 p01( 0R, Q ( , W (p,  R\ 0Wp(0S,0 0>900p3/ 0pXc0%WQXc׾pE0 Z0 0噳+Dyp ]pW000 0Cpÿ D0]pWPW0W000 000W 000$0=-N 5 : -c z ? 0@-@M0@L0 3/P" ! !WQ 0 0 SS@Ѝp@-`MMMP;` P@P b O HMލЍp{dЀ@-@P H,_P 8'_P ("_o p@-0@ 8M! 0`P@@ 0 KP8Ѝp^PUJ0 00  0 2P@oC-X1M MPN @a0P *1SE$A T )1S ݍ Ѝ Q 0 1/PPP@pG 0S0 L03/P ,0X0uP  0  x;H 8/P H{@ܩ-Ѕ-@-0P   H-@-0 /PR ЍP/R0 R/R  0 ؅-@-@@@-@@ o @-P1P@c@`P  Tp0S  TT M T @LP  0b@ Ѝl- - '@-@ @0# @-@P@@-M@  M  M <܍ 0@-MP@~  Mx  M 0TsP <ߍ0 @-@_@]A-pP=\`,@P P  a$0! 0PP kЍ0$D Ѕ-p@-@P4Sp@Tp$ @PpPDpЅ- G-pt`DTP x]PP@ 0 0PP$0R04*Ѕ- A-TP4SA p`4@ 4 02M .M DЅ-p@-@4S04pTU TU Tp`040 4L0 4Ѕ- p@-@P0 p@& p@-@PH@ Rop)    @- @- @-  0P/Ѕ-0@-PM  0xPP' U@  0PPP@]P,WP0Ѝ0@` h u -@-F@gA-aJ?pW;$AT"0 6PPЍ @> C  01/@P  0Q$AHL Q>0 R 0S P P 0$003/$qܩ- %0pQ@-4 #"T R0//s@-(@T@ЍpHr0Pn0 0003/@P廻㻵/@-tM`P @0P p@@&P  70@Tp@tЍT0@ Tx0 Cdd0d p| o`P D 8oo p- - H- /@-@l/@,` ///@-0@Q TF@o?0 \ 0P00P0P//-@-@0M0  '_H00S [0 0000  00Ѝ-//A-pP@`VT0S0S P{[P $1800SZ000X0`p@ -0SR00/p@-@PY<0P4`" 6D0# A@$!lp--A-<`P@C[Pp( K A-@-4 @-p@-M  ^0 h0S YPL@L`@呴U 0 0( $܍pcB - 1G-1MP`@1P!t1t1t0ppl`PBL@_D0 [-ߍ ᤞ@P jOY Z@P 0=SCY?A@0  4@tT@  P 0 l-]QP P $TQ@ UAE9: l- 1A-1@P-`p1P!P0P0P`P`P0  @)Q4 gl-9:  1 p@-0M002 00`P 0m@P @T 1T 1TO/11 ,'PO/11 Ѝp\ ;R 0@- P H-C-CMp `P]P 0@PC @0 0p儳0SO/11 Cߍ i Px0p  E0S  b8T w:1 1 --O- M;HJp@-P@ 1 1  p$-1A-@`pظT,@P 0D@`и0 A/ @-@0 3 @0, 3-@-@  ]$ 'Ѝp@-0P2@ !pM<`".   0`<01 @S0pv@ @qppЍpp@pp p4 $ p@-0 P@8MQ p 02`\PAI0 #8Ѝp4 0, 0$ 0 0) U 4 X [ ^ a p@-P@ᅸP PN/1 1 pp Vp@-P@1o1(1 P1 1 p V@-Z@p C-@eM.pV\T P2P%Pt eߍ20$0`V@n"$`|B(ppP0Sn Sh  @)\ 0` 0P@(z r0"%8prP SP !/0L0!0&P !(pW ( V 0( Vp *WN?\1`0p0@!(P P110@`P!0FS05P0@= |H= 0 0 & F 0  000 p Ẵ@(☱U-5$---O-&3-, -  m =8 9:l-. 5.5. K̇ 0@-1aM@= Q:H=.`o[0l0|000000P00;20(4t t0 p 0 & F 0   ` 000Y@7ᤴaߍ0 5.5.  ud @-T A-`$?>@P Qq-@T 4 .طP( 0 0!P  04N P kW@9oЍX0bsy D$0 0P  l- > ~ h//O-0p4@T Ѝ@T@T( ^& @` PT[Z [СQ UZ@P@ @T@D @B@PB0"/P-O-$6#Sp 0 NP` ;#S0Np0 d00到`0\ h0Xu P$`P`t0 (0KH⬷000 00 00p;( @-`X0Sg0'. CR\0@S0h - C`0S0i/ Cd0Sjp0!. 2Bh0ST0k}/ pP S 0&Ó Ѝ  O-MpD001PUЍ` ؠذPE0S Y0@  0 0 p1/Q S@@@  Q  Q @ 0 @0R0 0p1/P @`-( A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-ȱ@P`p1S 3/`V@Td0@@ᳱT0P0S@000S4000S(0000A( \-`-(  !p@-@4`4P0Sp@߳10S 3/@`-\-0 0#0/0@0/p@-@8Pq, 00080sp `^/ 4R R0 0`40$ Rp `083/<0 0"0P000`0X0S 3/ P0001S01 0S0P000 00//00/00/00/10/Q@-@@@ 0A0003/P@ 寭 @E C-B`0SPEM;0园L0pS㓭L0 St勭 L0S ㄭL0S@}L0S(vL0SkoL0S00$ R!000ߍ08 L03/P H0 7 L00S3A 0Sj0 00000 P@T 4/@01 0 KP 0K0P hA0 R Z/0 00T h0:/P h00S0U0S Z K 0U/ 1Bh e2=0P 010@P0a --f E C-PMY0@U0` P " N `b0  r00 0qKp!0@0 0dK!0g0p@& @ǭűlld}K@\ 0 D!m@ @p0 !c!p 0Z`䀟0 R < P~<哭Ѝ 0p!0i `< `j<NT 0-0ȗ0@p NR S3#:@`0a --y ы-  !- A-@0P\03/ `pV@@@P< 0쀟DV  \-V0 W  0  !   0 00$ 1     t   Ch  0SJCT T0T4 NN0B@@ rы-qh 4 u, ys@-P,`@01Ѝp谋-p@-0(M0P,03/`ᯯ0@ S:000 00 0 0 0 奨p` ၥ0A0ð(Ѝp0 O-PM4,@?PЍ ʯpP 0p @r @< WO PZ0H03/0S@`H@`A0 0J`P p" 0 Q"d2d" 2I0C 0 0 000 0A 0 0 0:全\0S'"0 L0P 3/P X0P@T`@\0`0 S8P 80S ,3 0, S001|40P ∡0L0 3/00 P0 % 0 F   0  0d 0q]p`偬@צ0,Ӧ0Цͦ `t80|$4`@ pL!0@ pEd40 000 f0,0 d 0$10壦0\$10坦\0d00h00`@ pl0J00S< p0 PÁh ,`3 000000 000 0 0,0pp` ԣ3d,0ἠ)l0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV $P2Q iЍJP00SZ 3/@@OoBS R@0&0010@!Rl!@!x@|@pPpt@It0S|0X*@0P PQ 0!@x 0T:x0S@ ፣dt@OoB@|0xT:X@ܩ-Y -- Ra 08H X \-h uQ < l- >O-UM8 ST44@`[D 0P(0 pP($ Uߍ0P,0j30 40S 0RD 80S:(1SK 1<00J ,HLAP4#0A 4 P#H@; $DA 00@PP\@T ( (0B"2 ,0!P0S 3/P20 SU@0%0cD0`| p2R01@82PU?000X N ,H! L䱟H@@<#x`P`T@P D` CD@ @D0=D000 0040( @ƭ 1D   0 廭 &D0 ⲭ`D40P1:> +H뮤@0 000000 0000 0(0p` DD0S#, 5Q7ZTX .,(*,(v K!\-`-a x noG-/0@JMM`0CPP+#5P& 0S" 0`"`!p/<P T` H 0@T* /R  PI@+m+4 P:I?0 `HvP+0: S pWI>00ꨠ t!PJ>0@0/Sa0@!c+ 4 SP`+4 P*^ P 0/S`0oo`bS FCpCC0&000 SV+tc4 P*+]4 P*PrI@nI@`JލЍ  @-z*@-M @PЍ(0  {@P p P 0S:$c(#"c  8#8S G-`)PPp X`p.@P'Ѝ0S @ p=DP0 \ TpL冤 P Xp0 @K  A-tM `PXP HP4+3{@P@0 @ DcY@Pp+J3iJ.0a+J3xZJ.0LLRP PP|<I, PPs^+J3:0J.ҫPPcN+J3* JB`" ừPPL7+Jz3lpd0\!0J>P 0.➫P UT bލP@[+JM3JPPp0J.y@+93 nP h J>gPT  + 1 ; G  & +Q V _ i /00/00/00/00/0@-0@4M#|0$P 0dAP\ P0T0670 P# @P 2ῧ4Ѝ0- -Ȍ-O-AMAd2 ,000PB,0 00000 80s0`0Q, p $  ?(0 $0L 0s$00 0$l5 h%T` @@`=@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0T2y@&T"@(@@,0S:0G(0$"PP@0@00 +0@080s=0 0@( Y ϥW|Ѝ#!!@&(w00\1 0D?`!00 XT,@!0(P_ R P@ 0! 0 h0 @0 400t0S00XT00P0 ֟P@ 0(l ,@h̟ *@8q 3/P- g    0@-)M@0p \*4 +㡟@,㞟P0 *㔟P ߟ-㍟ 0 F  .ミ 0 BЍ0!0P80 S+P ,gP &0  - 8 -A-@  "(0MC( 0PlQ2d2 5  L! D!@` Pp0 _u P,`-WO-Pp@\M4 `儰A0 SU 0 Q$0S   $ p嬡Ph9\ЍO*.TA P0#p #%L*09 y0`0000YF(0S` ` 0 Rp`H03/0`0[ 80s ȟ0Q 0 0 0X  BR0S0pS 0[p08 r  *   * PU0'0U " [P R 0S  0; p0 .0PP  P 0$ PU$0[0 0 [tp0 PU[n0[( !P$:p0 0 00$0 0$0 0pS 0pW ;pWZ 0 p 0P Z$0 0 S*0 0S 0v; 00#0 P4S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S 0 R 0 0! 00 00000000 \Ѝ,`VT` V 0 S 0 p0  ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P 0 0 , 0R 0R  `xR  q<P` j<P 0 Q ``T R T  R X `( 0SY0L0( 3/P <00S D0SS000(( oA L0( 3/P 80<00S (0, S004 Q 0 `( L0Q =0G0[^80s[ 0*0 PQ 0N[pq! 0 QQ 80s 0  00UPppy0  R 0S  0$: p0.  0@ d-x ܩ-- O-`M,p@0 40PVZ p5pPU Pp0Z:`PU`Jl?ERUB \\03 D)>00#h R 0  80s0`F`pHU p G?h0S 00  80spHY pPp 4?h0l0 0L03/, 00Y:pPpp0ڞ0P804>ЍOp0H03/,0$$ (08RPP0$P(<00WS:< R4*p,0, 0$` 0S `0S< $`Sp $ PR( P`$ (0Z9PU` P0 Sc@D S \0S 0 `p8P0VU:00S40000040,0(pWs08`<00< R:pp8`/p< p 00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (08`V`P p0k  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P}0H03/0@08P0D00Z|*p 0 `<080sb00_ <0 0SY04 @0SD0  0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0  J8 V00 400P0 00 Q40 pp<0Pp80s00  h0S l Y* 0L03/Pt !0 儐X09/Pj 0$!000400$00(0 00 0S(0  0 H3/P- X$ 0 03/p<  0L03/0p Pp$0P( 0S pP$ (07 W00 40! 0$!000400$00(0 0$0 c(0## < 0  00 H3/P<00`0<0l0 S04$( $ 0S(0  0 H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0Sv ,0Ss P0 P  R0P0k 0$!000400$00(0 0$0 c(0## < 0  00 H3/PP80s0 00- Q ( 0 S% 0 Si$ , 80X T3/00T00X0 0\0 $0`0(0d0,00Sy 3/p]p0`0W:0p Sm:Pp`,0 0Ul:8[P  0$ 0S0p0$ p  Sp`P 80 p0R:pYP Y:PpW00 U0#S )p`ЍL0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0Pe00   8 rp0ip` p!8p 40U 00 0S 0P*p ` ;`80s0 L0 3/P 08400H0, 00,0+$0T00X0pPGm۶$ ]d- 00 80sh p z;P:p@-@P(ME<(0S)(`,`X0 00P0F0 P P`0(PP,(B(P(Ѝp000,_(60,`(P5. RȌ-O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X: @1XS<1@1\1(HL1X\1Pp ,P!#0@ 0 '8 0 ' 0 W %&, 080000, 0 70080000  0'1cZ00HH0P00T00LP (X0G:W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000'pp 85P,0lXpW* 0GS(> $P A$ 00S H @3/4pGWp@ 0L0 3/P 00S 0Sp003/0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0KQ  01/ 0S 2 ;C8$Є  0<P 0 Hp0  @D@0 ᄀX60X< Pl;,0S5pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 000ܩ-- p408D ` p \- P uQ  0@-@P`4M#}p@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80 s#   ` 002a8  Ԡ`0SQ,  R) 0 0#Q! Q0 2A8<{# 8 0 r  1# 000 S   XW$ 1 SR08C81/-!0 /-p@-@$P x1SP 003/p@Gx1DP$ 0SO-@0`PKMM~p⻞G0DI;0S K2 @,07 ,0崋 0 < o=(05#ਫ KP@T80U 00 0 00000@00萍 @@@@0IՐpK܍ЍI⭍+R*<o=(02#8 ;c&@@X u7O-`0@PMM,0h1h0p 0S (0 S> 9 H7 00 0 <0.%"@~40kP`0V,p0U 0000000 0 00000000p 0{p`ލЍGS,0S*< !,00+C#X0S000C0C0000S0 0,0B$P-X u@-@-470  !<$10(10,1P001.@-@ 70 0! 0O-4M\T`Xhp(0P  啒"\ @,@;/,P R7P PpK 6p WpF2 6 0" 00 0(0 0 0`Ō2 (04ЍO/P"4Ѝ[;0p@-@Q*PI 0 PB40 Pt< <0hp@P380 P@-,0 P,'00 p 1@ 23J 56p@-PBM `@ "2 V`P 0gP ]Bߍp`P00S0`40Pp`80PS<80  4X0S0!.@Α 0PƑ\0 `0S @`嵑d0Ph0S @l0S @|p0SH @XT`呑t0P^ CT ^ EFGj In x JK| MNOp@-`M<P@u  4" 1U%P0DPK0 @0S  !  !8PU@U 0 PM 0܍p(0S t 圳@l,0S L 咳@00S , 刳@$^  9T :| ;x =0p@-M01P@Q#  ! !0`N 0S (0S p !  !,`V HV܍p8  ! t!0`N 0S (0S  h!  d!,`VP!ΐ $0.PŐ 0 P忐0 Px幐0 P㳐0 PL子0 P8姐 0    C-`RGMP@8 C"Y0S0 `F` x0p⇞ 0S j  Lf `,p WV o$ $`ȏ &0`0"  #`ߍ@嵏 0  0S  ^ `PV 1 `S "㛏 0  0N 0S @0S#@兏 ߍC<0040!00ӱ@0Fo$ 0DL03/00 M0S !0⹱{D` 0S  (8`Y0 p x Q0X 8 < RFO    ኱ 0@ /5@# 0  l R0^l 0q        w  @-x @Y3+0 @0p0,d' @ @-D @F3000(0,0000d @ꐯ @-hQ`0@sKMP!   071!S=0 Kߍ0 00@ @@0P(@UTpp (`0 0  0`0`pڏFPF ],@4P0@00@P&u >?| A0@-QTM,0$0`s@|!   0(ы$1 Bl000B/ ґ`VxX 00  @8 PQ+< 0 \x S|0L@T܍ Ѝ(-X-w    & - 4 ; B I P \ c j q x | 0C-pP@㰐,M0TJ 0^ ^ 0S 0L @ɪ`H)P aV@,Ѝ@`-  C-@4MT2P`p!PP 0 L0T3/P  Q000T0SX0`pS@, XT $0Sb S H H0S004Ѝ0CS@D&7#"- 30S/O-@SMP 000#\t3x`PRX3X@ YH3P  Rs 3  0B00 Xf00,pP0S* XZ'0 F⼐PP Tq 0 x0F/0I1P/S L(0(0 00e0SvU (% %0S `P0 1f00!15:%  ZP p Q 0, ($!` $ GP^ 00 8a4Q101T,--`-` &  0S@0@-S@00 0S/-< O-P2EM 2@T P0 |2P p|1S$ $P| 003/P 02P ( [ Eߍ$0 R P 01/0P 003/P A10SX PaPE  <0 040000,00800 忎pP@3@0S. $P+ 0 x0D 0-< - ,- - - -C( A-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T  @T6 @pW3dpW0V82# @  R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0----(-X-\0p@-T00P DPPp0AS@  1SAuꐒ-ܩ-`-0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2"h-l0\ Q0/\P ^U Q0ppp@-h-0O-`GMMzl7\2@(T H2V 00 0 0000000P@@@@ 0@E!p@a< ('(G܍Ѝ$1SpA0L08 3/P `7Z Z ZT7S p$ 0ST7S8 P P C  01/P ,00 H$L Q>ܩ-80S @- 0 a"/P m G-`@Pጐ匠X0r2&S80S00 00 S80S0|1 P S$1S00 0_Zp@-8M`@8  #T P $Q`$00S U 0 |1 08ЍpyP P P Q ᣬ @ P  , ᧬P -A-M`}P8 "U`ЍGP $A003/0 R   01/pP 003/@P$q0H03/0 p"VEL2 `0803/PD@ 0!! 8# p 0  3/P"#"#00 03/p p0` L03/v# ⱬ` 0SWp`@`C88 0U i!0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv j 0 |1 0> P  -G-`RM@Xr PP dP`T `nZP P9  ,p (#0S  ~ߍ<0H(00,0 00004008004004 04$0D0(0P ~W[  弩pU l嶩p* `H\ct` 8 ! 8Z ,Z  Z Z Z 0,0Z0 Z `! ^p 0`?`a8S!Pb 0  0**0P0b   0* d@edA zd@e   . A V A-@Mp`;@@ ʼp@ݍ P@00@§T00 ##  /O-4MFpT(t$ ,`&X\pAT  0YY 0 0<R. R 0Xpp @P R$ P#2Q4ЍS0< 0 Y+Q X( Q   0T pTp 0spWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 00pWW  00 R R\p\ ؀0@-4MP!! 0  P PP@4Ѝ0 00P/S0D0SD/0@- 0S^0$^ (H P@  @ \@0P00@0/A-` R0 >t!ṛ000㛓#000X    ,⬥( [: ~T  P ؀!\R 0 0 B@0St 0  0@ H0 0S4 4 0  yd|d' {dЀ J R [ 0$\ (00t S S  S00/Q 0P/0S 0S P//!R80@-4 :CCR )r0@/_  80R*@-0M@"P0 0! 0! P0Ѝ/00S/8(-p@-,P@0S0S< 04 p(-@-@0S(-A-pP@0ST 0S` @ JP<0@P`V@(-s@-S@P ' d4P Ѝp<)P `P (&PP )"P`  P P(  `P` D PdZPP 0SL` P P @0`0@0 0 p@-M  tP ڔY @P"` }ЍpHZ0S 0 (q P=Pk} O-@QMM@P;.,@執pP}0` Fpw p㜢00p$@ @Q&D0S8 CR0 N 0 ⍀P[0D04@T.4@0@T50@`T$00 0μG p P P    00wP  p$ pp00#Q؀|@0V  00# l#?000G `#APQލЍ04 040RP8< 8<0RP00 S 00#PD tP #xP@p Y #YLP@k P # xP0'% D00S00 D أ0 S 0 0 0 `@0x0#Q@#000@10 4d@  . P j 0@-M 0{ 0@S( V7|P\vx0P @88 P$0$  B@Ѝ s  @-|0SЍ@-@M O|T0  CR$00S ЍwA-pP@0ST 0S` @Pu\^ \  0@@`04pXp^S G-`hM8p@V0 P 00! ! 0 (?PV$ hЍ 80R:V t04 Z0 WyPPV008@D0 00$00sP 0   080 0 0$ <0S 0$$ 00000S S   0[z{$ G-`0Pp@ TR3#:?o2R0S%0   @ T000P0 04 Q\* xPW000 #0 00 04 P 08 000< 0S $ R0" 8< Q\00d- \1 0p@-@0PS\ UR00p0PU 0P0000 04P 080C 0 0<$ 0 0$ py/k @-@ 0S PO-VM M06$  0 <0 t&t 0 _B@n`60ST&T0 Bp(0`S,0000 hpL0 pTJV0P0 000 0ShpP@080 0H080<00a@08`00S W'U 0T S W0U0Q0SP 0WS 0 0h0S h$ h pW 5`4dP800X@0H00D0q4WP0(0 0,0f 0Sc X4 +<P pwPP] ` Dp8`00400`#<04S``V< +P0pp4`4000S000PP 00P0 01ZB xsP8 P$ p*|P2P$ \$|P,$0H#P{P%Hw@P P P|04(000,00@00D00800H0x|PTPx(0S,00xVލ Ѝ5$0 0!(00,0 0@0Z/ 0D0`$0500D0;Dz0p PUX XP\P6P 0``vPX\`,hxᴝ0S 4 R 000 0#|0P 0S ͳb뼀 08$ <0S P 0$ 080S0`X P`d0S 040 Q\8<0 Q\ P   5P`WxLPV0L000S ~ (-  -    I |d @-0P0P -0-7@-@ P000 00 0000 P  S  Ѝ0O-p`LM @P880 6(080붳 6⼳붣  B⾣@A0sS 0lS#` q 8P1< 6#Q  p%p0 8,0P,0"0 '"QG0$0F0 0E0| 0D0 0C00B00(0LЍ |ppW0`Vp h C-`PPT\0(Ѝ!SQ0P a`1/T 00``!O-DM  0000 00 0 zp  00 4`Ro04`800,00  (0$ fp ,08<\@?! ( _5#ZP0$P00p/2#<*_.0 RP80 \X  PTuU G" ?P1 0@LH0 R p ? 0 /G$'@ T R`@`000 00  0 p 0S #"01# 0?04 SQYL0 V`00P0pYkXUDЍܩ-/C-`@40M` }p\ X \^ PRPR VS  RQ \R  0    pЍO-!@-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p<--08S^;/-- p@-@ 0(  P0R0PS 00Sui 4ppG-P`NM@< Ѐu ᠠ`0|  ` ⱋ000 ;8PP <孕p7Nލ3 !ydG-xM` @pᜐ堠XP" !0 @P 0S PU 0 R=H!H0 bB 00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZD   YZ  %! !! !O-p@PBM M`/0 ;P( ⚨0P@0P0iP) Y  $;$  n P!14"S5 0S|to@  U01U01Bލ Ѝ k0P0  n?XY$0 0I0, n?X Y 0oS 1 SR 1S  RS1S1S p2?R0_Q   @0 0@QD 0H 0L0@!1F41Q 04 8 <" 0Pפ-@¤@Q Q' Q0PUTi 0"0S0S0@0\lP P `@@=02s 2 02@F @DURX A- 0MHL`Pp l1lR/ fC@ P0l@P( T00ݨ 0R`0 !?020 2002p#04 p;m0Ѝ 0S" $0Q00 L03/P Q 0D Q 0 SD S003/!>-P/@-\ @  0 2BS02D0C@AuOvO0w.#8\0 A- P\\0@@ \ 8\ @T (4g@ `Č `Ȍ `̌b` ` p SČpȌ`! 2/ ``~``a0q1P lp`T8{BuP08} ^\ 0Sp`82S04@11111111108 l2~`S@ P0 P0,b0@SP0 0HL R   ?  ?/Z[`0P `@10d ἐ 09/0P@\Ѝ!ܩ-G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/ܩ->0@-@0M 410810!m`0 P0 0P0Pq`0 J0PU ! 5/ Ѝ0ܩ-!@- VH뀌@ @-@p 0]  lk!'@-@@0s(,00p g0Co &$.-$M?0 0 c$Ѝ0-4M 00 000cP4ЍO-pQMFv$ "0P5 `0000 00 0`R08 (00R0V`(00(0"R 0*`Pş(`0 0 0$08U0S $0s 0SQߍ$0S zpP @mh40SP $AˁP4[06 , 4h ᦳ 0 뽵dXd@0eL$媁H4P(4Z-JP JZښ$$壢J e2 B⎁P0 ß Q  # 3S  RS0#1 1@0 es00P PU480PZPU= A 83忶 H 0 0 !2@T0@P 0:P ᯲!ᡶw@P$5 T;%P # 3W  R@pdHKq !$K @"% 0J/j 2 @ U0)1p R0, d  0P0U 00 *!!0 o(0V0!@$0@PSdd!@\1 0p 9 0 UIJ ,!0 0,!hԴ0PP0P  往`ᗟP<<pᏟ@f0| 媀@(0W/⣀8.0..H. .p !.r !.Y@u !(.Q !.A ! ! !$.@~ ! !@-@[@SRG-@  700pP ąP:`X:00X0 `P !@-P@`pP0S -S :S S  000`  0 0P0 ЍU0S T  `P'@-`Mpᢈp@ $p Pᰈu @0 ЍpP PR*tbP  P ByPp@-P 4`wp@  MPᆈ@p@-M@ ̉p $ ЍG-`p@T2 P  9P0IPE 0PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝ !p@-P R`@0 @ =0 00S 6UP3PE Ѝp@-@Pp Mcp` j f00T0WC WCU00   P 0h0 IЍ ! ! !p@-@0  ҇0 S ! 0PUPUp@sb0S   0 0S hbfb0S   0 0S ZbXbA- 0MSV00ۍpP0@U< `0S@PE.  XP=00X3700"@ P0@C RPE @ @0 00 p 000@UXL48@0S 0#S 0S % !@-AT00 0S @A-Pp@P 0ap 0S700`V$_@P 0P p`00` 01`0@A0@-QPA|M  {j0 0p@) p$  p p  ݆p P  @0h p(,?|Ѝ0;t ˆ{ !dA-xMPp@, ` p P'"2r sRp`~  Çp ᣆxЍs} `p  p ᠇p - SQ@ $0 pA  !p@-@QUqpI b01P⨇pPp@-pM Hp @ CpB@pЍO-QMM700ۍЍ   Z  @`V @pP` A-`R00ЍPp@ RT_@PT 0 Q*S@ 0 S   0 0S0 S *_P ``` 000`0p@0@P  0 V p d0 0C-P@0 rp@ ЍWP  PP@  0Vp@ `P  0Vp@P 0E@T<` R@D@@p@-CM00 0;P `00F00  0GpCލpP@  F Fdzpx0"p 0P0 000"p 0P00 0 !p@-`@HM710S aAHЍp@K  P(000 0(00,0000H ! 0 0p0 S 09S m$HЍp@ 0 S   000 00P0 PS @ d0 t pPYAK Xp0SHЍpP ! !d !0@-@ 0 0 0Ѝp000  !@-@%@ P !$1p@-S@,1S"<1S, RU6RUp bV7E_bp1C@_$10C$1S(9_0(11C3_,10C,1S0,_0011C&_<10C<1S@_0@1$$2,P0C$2$bV _ b 2,P0C 27@-P0 @P" 10 11@<0@0<01808801 809800<00<0#  Ѝ0@" Ѝ0Q@-@   P p 00\~Ѝ@+ `Q @ ,0 p-Ѝ@iЍg !tQ@-@  0Ah VσP p 00PЍ@ X1S70T^X6\PT 0\1@ 00Z pAЍ@/Ѝ ! @-t0M0@Q0$,pЍ  ! !01/@-@\(P0S P 080L0S S@B( ! !@-H@\M Q L0 ` H\Ѝ !0@-80@@HCP@-@Ԃp ? @q  !Q7@-@  ,A U B&p  PT Ѝ0@U P \1X1P\,T1@ R  XT(`AQP` x`00CS`0 X|@ P0 p ,A Ѝ0@t X0 X Ѝ0' !0''tp@-PD߂p4p@ G @ẃp? p@8 !J !p@-@0P  ( F<0p@<<0@P !p@-`1 01PPPp00@Tp 0S 8<00:8<000@@-@T 0S 0@@-@0sЍ@ d  0@q Ѝ C-`P080$:80<   10080< qH,Q 0a(!"4a4# 0F0 >Q & Pp W  g<08<0 P<04<0 Ѝ 0b"!4b4# 0S %/0p@-! R/<p@- 8p\p P@U  <8<c&1 P1pQp@f 0Sp>!@-t0@SPLM 0$Q0@C*p 00 p0 `P X LЍUP @  P`  U` 101yF![!m!O-@PP 0p4` R & 0 c08<  8< T0 0 XU DP 5 *> 0S 08<  8< Ѝ!@-| R x !0 ЍA-`@80 & P  ЍA # 0 p  0 ~ 0P1PU <0 0SJP ЍA0GT 0S 80 P P Ѝ!!!A- M@` p.0PSL`$# <0  PH 0Sx PPUt 0 `@PU.P  6GA ЍAD%01 tQv EA8%E:>0@0SK $0P  g  p0S { U8 A ЍAU W0 0S V H P0S t`QP  U.t R "P 0S %X= 0S 04$ ЍA Ѝ!!0!B!W!x!! ! 0@-@P P $ LX@ L0p@-S@P` 0@PU $00P   1 0>0>_ $00@0S  p, A p p@!@-@@O-M`80pRP@T)Ѝ _P X  R  RW 0# o$0   V0<0 0B8  J@X 0 00  :|YUP0| 0|x0!!A-11 @ `CPPj ` p Up  kpt ЍP. P P0 P6 lq P@ PTQ IE;  pV (P .  18*0 1 P # P @ p )@ h!410B0 1P3h 9@P 5Pʞ 0P !Q!0!!!! !@-@  A@  @0vip P1 Zs~01ЍPH0/1 P4!!! Q/@-@  0S@C-q`@ P @P00@ 0S  fJ0 SP   05 @ Ѝ1  0 pPpl @P 0@0PEX  PY PP 0S  ,$0$0> R>  **X e 0S &@0 S   000P1  @  0SP L 00 S   0!!!.!0A-M P0 0E0@!0E~p00`+{}`pQwC07S ?0 S X \0E 04!81 L `PP1 ,ލ % R Pp P0 S   P0  pP 0P-PUWP P P   P1p  P  0S 0l 0P@!e!!B!04Q@-@  p A@]-p07S@Z0 S 0VS0S@n!A-`R@p@M PP U 700 "@ЍAUP"R 0S 0 )r>XU%  * P 0S <0 *h p   <0 &V>P  *@ЍAm@Ѝ!!!O-,M 06v 0@` PP  P 0A ,ЍO /uPx ?pP0pp N bPp ,ЍO 0ppXTP ,Ѝ 0  ! 0pG pG0X  J Vp4$ p_p 1 )!(kP NP 4P0 6P000UPpP xP0:0 nPP1!#0p  0  p ^ 0S  00[1110$0P1X 0S  0 P ZU p+0$0{0 00 $p 0SP1$ l 00111f0 00  p X0 0 0S $00$0 0S X111* 0 sP UU 4 pQ 0 * I  URP!01 :10Pz 0S @ [ 0;P U 0<8@ 00S8<  S P8@< 08S<  ?9 X UPvq 0Pu0P 0S ppWpap  0PX 'P!!|&!!!i !@->@T( 4"4p P`0"@4"4 0W $QL L0 b"!4b4# 0@> *>0@D Ѝ耼p@-H1PSM"`! &@P T 0H1!0V gU j0S X. SP <@LALЍpH>0S 0P1@T D1S   @>0S@ `D1S   {0 @ [P 0  @  B.(0&pD1S !!!,!!0 S0C?o20    /p@-M@0`( \.@` @@PA 0H # ^ @ P@`@@@ A00\  L00B#zpЍp\ ` @@^ @@``PP@ A0p@-@Pp0@0D0X0\0PP `T0 0P `T000v0p0P PT00840P PzT08<0pp@-l@`T@@@0St#hPPkT00pSP hl@pC-@RD@T@P ЍP@`Vt#``JT00@QpP 0 P@P\B<84`(``` 0`fy@$T/qA- 81`0SPp@000S= @T@T2 0 S   00S0@0 @@00000pp10 ` 0PppW 0 S   00000@@0au0Q@Ppq0@-PM@ 00Ѝ00S @T00 0  0! 0!  @H0 @ 000`xpR0000C00u0p@-P@SQ0 0SZ0 5Pk9 <R0p@-M@`yp p P 0p``F\ Ѝ0S *p0 0 0CR00B *S0C00ʚ;G-P`p $0@T 0 S0 R  S 4  0pT@ST 8@T 0 S <  00` pQ 400@4@P@P0S 0S0 @@@-0 S00 Ѝ0 Sʚ;@-0 Ѝ@-@P`p,p0 000"#| ЍMb@Bp@-0\pQ@ PUPUR PU PTP4PP@PPS,00@"!030@-@Phdp `w`p \wh R@ R@-xP@P  sxpQ@0 0  0  004  800p00< d0\xp`ip@-@Mxpd0 0@-LM! @P0 0 0 0dAw0SLЍ0p@-d@t 00pPv0@d00G-@apMt0t0S v 0PRv00u0U0Sp6# 0R Q/0 S 4  003/00<00PP\MU*V0P0\ЍU!700@ p`R0 PU B0>000 <05  ,> <"PP> *x!@-@Tr?@Q/@-@T?@0P/@- R 0 R00^ PG-`P M0(0S @ P P P:`P 0!00 0   08S0 00 Ѝ080 00S # `pP `P^0P 0iS.S  `PN04S 040:S'0@-@PDM QP@T Q00p@DЍ0U  vP @0S@-`Pp@MTЍ 0S P 0S0pQ   >@P @- 000Q/PP1P/$0/@-@M    0 tpЍ~iO-YM `F/@H9X0KpPpYߍ0pzM 0S 0S PP@ Y P @T0SL0P 0@S0@S@@,1S 01 +PA,1S@41S81 P541 S S R@$1S(1  P&$1PC_oSRPU@!P0LS 0s0PAB@@$P00S$QU LPPd@1 ̔P P<1U P `@ ` 2 0[$0D  H) `0 S 9X001H \0sp X0 SB000S0 75S: S  CR4T X d@@%S' y R02 > 0*p  1!000S p pS 0 S -@@ 0?H0N p 0P0H0}>H0 @$ 000L0PPP!!!!i!8!@D!A-p X`0P M0 @R  RT T 1 # o0@ @ QPUP!@TZ00 Ѝ R @rr@-`p@P@ Ѝ ӣ0PX1L/Lp Q,(P PPx!!@-4@S 8 <0040%8 <#  +#+":# !9 R50#,( Q( (0,0!A-p`@ lPP.00 @P 2D@0$20606 00@!!@-@PDD0QT@pp yp |p wp rp mp !hp 6cp :^p ;Yp wTp`@-`RpP$M 0S0U00$Ѝ/@P 0 00 0  C0S dU f8PP, T/00DU q8!!O-`@0p"S0W"SpG` Y yPP u 700 ЍTUfYP T000졟0W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R T0 `T 00T 0T 0000 0    00 PP 0S& T  PG0 `P0A\0SP0S  9GT PT0PT!'P /0 S S /S/P0/S S S/0/O-M ߅PPЍO=`P ЍOPJ@Y@S   pWBJὅPP  ֡P 0QA00Ѝ=t0@S. TP( 0S ᛅ@PJ@`@,I0P 0 @ 0 0 @ @ !p@-@P I` 0SPI$` PP(0S $I0(0$0p,` P,` PO-P/ L0P5 &6 /@h00Sd00Sf T 0 080580T <0|x>0P I0 GPPQ u01<0<Ѝ!GP  03pA 0S P^I01@T  T80780 0 pp P  .RP  80R7780T k 0p@  AT <01S|ᚄZ80080T| LP00z (0 00 0 \P(0Sk T<T_ (0!00 0 (0 S S TK 1M$00 (0p$P _T; 1=$00 (0p $P0 (P 0 (P0 80:80 t2P480x<80T# 0S /`P /`P00x tV /0P0 | Q800<800t0x0<06<0T (0 00 0 O(0S  hQd700 0 a p P 3 0T T ,`P 0SX ;TJ0 p, 80580 80580(0$ 00 0 ,0(pX0` DXP@dT700 J 4 0tZ0J p PN 80480TH 0SE 4S 04S<0:<006S 06S<09<0N@T) (0 00 0 O(0SH i7T <0( I[(80;080 80980T ``,pPI 8E`P 0&:d }G80Q7;80TDA TP0D1 <P0D1 $P0D1 P HyF0PH1L80080T101|P01 uP 01 tnP hiPX ,8008080280T  0p@ 80B;780{80280w80680s80;80o80880kTd 1f$00 (0p $P0 (P40 (P0 *%TD 1F$00 (0p $P0 (P0 (P 0 (P0 (P! |T =P`T 0Tp PW80tp080x0 SxtP80<080 PW xpx P  PW|p  | P  lP  XP  DP<W  P  $ p 00 (p 00pP  $ (  | P   @GPWZ  y  p pP $$ $    L P^  Y`!/!$&n!!!!! ! !( !K !e !l ! ![&! ! ! ! ! ! ! ! ! !!!! !!'!!3!!@!!S!![!!j!!!!!!!!!!!!!!!!!!"!^"!"!"!"!"!#!#!%#!4#!M#!H#!w#!#!#!#!#!#!#!$!@$!$!$!@@%!a!#!#!$!8$!h$!x$!%!@%![%!u%!%!%!%!%!%!%!%! P  PW (0 00 0D L(0S@ xH P\p /o" $ P/P0 $0P 6 ! $0&0 $ P/P0 $0ԜP 6 ! $0&0T <00 K0<02<0<0 00<0<00<0<00<0{<0 0<0w<0 0<0sTl 1n$00 (0p! $`.P >0 (P30 (P0  )$8076800D1 p?\.0@08T1 13$00 (0p 0 l(P$ 0S@T D'PPT 1 <0H $0 00 0 K$0`S( 4`( "4`4# ((0<08<00 CPP0 0 P 0 0Dq8018080180<00<0<05<0<05<0<00<0#';#T<09<0m0d T0h 0 Xm^ nn^(T d00S@$( PP\(  (00qK(0 S@P  PP0:0J`P! pa `p`(0`0NK(pW$(TEP4gp@aPP` =#pP``p%P  eDXh0@ ʎHXd0@X XT 606<0"80<0<08<0<07 0<0<07<0T 7P$ X X02 X0280080<07<0T `P 00`}p؃P  jP ePV [P VP18<0<04<0~<03<0z# 4#u<02<0qTj Z0  pe<00<0`<00<0\80@080XTQ (0 00 0 8I(0SE T= (0 00 0 $I(0 SL1 T) (0 00 0 I(0$S  T (0 00 0 H(0(S T (0@ 00 0 H(0,Sd T (0/00 0 H(00S qu&!%&!@&!O-pУ@`P8P P `sV1T ЍOR(RZ4 8840 ЍOg Ѝx!!-!O-SPM1 @ 0Q  8p<`tj⠰1 0  0@0Ip0P   d   8PP X #$: 0#Ѝ '.!-!|&!H>.G-@`pPU T >PPP@@P  T@0S DD0D @ @D@DYT 0@B @7@.!k.! .!" @-@QM} 0PS`<0S`A TD0;pl3P1`S9 @@@V6S:@V6S;@V6S<@V6S=y@w@Ѝ@s@r@0`Pk@i@0`Pb@pW  P 0 S pZ6,P0C6S6,P0C6L6,P0C6E6,P0C6ЍO-PDMx 0>@Pd@n#3&7#0000 0$0?000 @ 060 6~0!<0e0<0 80:8080 380000% p ;e +8 0 #0 0k# 0 P#X1Q0N,>P06!Q4 >P4 !@pDЍ`14,04,P00`,6v 26$26v SJ`,?v6v SD?0&6"&666 "66=o/p2 @00>p0P P0 0<  8  0 0@ 00S  Q QR\Q `BW`T`4 ?o`201,00p0S002<`8` 4,P0 0*  n+00h00P P00' %  M P<0P6 X%< @⢖`P$"K*$ $0@00S 0 S S0P\S  @<08:0`8<0 ჆pPp`0@a000|5!6!@-@QV6!6!C-`TM@ P `^jp) 0 j ````j1pWp0`V& j 0 0 ^@ AjT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0!`!!!-3@- P kp@Ѝ0@ Ѝ/@$pp@-@RP`@p0Sp  pp6!RQA-}000B`pV@0PS:V 1S* P aT*0S 0W R 0S Q 0`00 R  Q  \ U O-A 0MTP` 0 k%E@P 0A@01 0S  fp CPЀ l<P \7P L2P <-P ,(P #P  pPp0S*  0#@1p Ȧ 'p  0$@ p  p 1 R Ep 01#3S<00&0&0p L0S& &S  pz H pt P pn $ ph  p` P0S t0$0Q0Xp pX pN 0Sy 11L1<X0P1ZrUp8 XZt X p( P80d p  p H%P g%P0 P1`R@ Dxp X00SXppW0SPKp@tsP  >Up ]F Npp Ep 0S P XG[ 0 00#@0+p X'Z  Tp  Xi"KxTp(Po Pj Pe hP` P[ P P X00S 0Sa Ha FEpP^%P `V%RM pHN0SQ   ^pC  dpC<p@0SB   4 Jp/  p4(pP" 0 R,0S 0 P Ѝ0Sp{ pJ8!87!37!B7!J7!R7!\7!n7!v7!7!6!7! 7!7!7!7!7!7!7!7!8!8!5!%8!88!@8!I8!r8!7!6!8!68!98!;8!T8!d8!8!8!p@-P@pp p@RRA-P`@@pL0s  S$ U@ p@@@dW0S R H R U pR7!J7!Q p@-P0U@S 00p @P@i@T:p/8!0'A-@p1SQU  bp`|GPЍ `PЍA!R 00 0 0 mpP $PqW 0  pP{pP )p R0S |00(#40  L< SP g7,0 %8!8!8!8!8!8!8!8!A-PP 0S @0p 0S @@00 S U   ^ @ .S0.S0_S-S```&00  @R"0T0 0D0' @- @0P PT00Q    DP `00CS`0p S00 P0S X0X /XR'p@-`0@SP XpPPE @p⟿ .RRPP XP HP 4P <0  .PP9!9!9!p@-@P'Uh 0 mQ0 hQ0 xcQ0  h^Q0\/T,L)D& <#@4 , $      )Q0  $Q0  Q0 Q0 Q0 Q Gp@x BP9!9!9!9!9!9!9!9!:! :!:!:!*:!0:!::!B:!I:!P:!U:!]:!e:!j:!s:!|:!:!:!0'0 R@-, ,P$\ / ,:!i. 0ƒ @-\   Q^ ,\ ,@-QMM@pP_p  0B BHPQލЍA> 0!>0 0B ;Pp`0SPE@E p 0SP:0@0D:!0 R/\0/0@-S@ P@@-@PP 0@-@PP / p@-0P@SRP  ⹊P 0Q00pU  0pp0 S/@- Q 0 SO-0S *╪P PU@P PP`/0P@-00 Q09 C/C @E!E!A-` (M00@0@SP  0'0x B0fpp i02 0    0 0S0S 2@0 2 0  00Q2 PP  (Ѝ0  0=0S 0P$P F!A-`VPPFPP2X@p`E,P "20 cV0  202@-`@MpP!  ( (VX( 8pSPU@ T1700@Ѝ +i////0@-M @ *PPЍ0 3"Qp 000)00gSp0000@ 0YSpl 00 " 0MSp< p 3 F!F!p@-QUp@p R,01p@,@->`GMV 0P0Gߍ@PF/ h9  0l0 p 1`0 DF?TSP> *0 F?GS ii@-@MP4@ $P P@Ѝ\F!Q@0@-< C;0SSP`///|F!$0 /Lp/@-Q @ ?t0@0Q00@-P@,M(    S `Rp 0,Ѝ000S p$NP8i(p@-@MP  `  &  (PRPЍp:iO-PQZMMP3P C 0S838 CCpW 3  CC@㰐I`#0010102`000`V3 `00000P  000000uP0 00V000[0 < 0 "0 ";0R 0 00000`0 0F0 @ @@FGN 弡0S00C00@0 [B X1F0FᶠF @0   l0S00C00@0 0F0FᶠF @0  P P0S00C00@ D I("(KPp`ZލЍ(5( (3[K @F!F!F! C-`p"0M` 0$`  0,pO @T*ߍ`*PP@   0m,p0 S *@ ``T*x0V*00*T00V:0 (P4P<{(o ᦶY 0@PF!@-`@DM pP@  e  !> U 134  R2$ $@0 +DЍUi@i@-@QM  <00p 2 0"2PЍA-wMM⢏@HP#Op PP XR ]002S2S S SS wR2S HXp?VPS CQRS 2  XPr@P X(`0F Bp 2S$H  ) lPp 5 $ L 80Su S S00,0S  R000@0S  R00@ H @ 0 H!>50H \0Pp]0S 01S lQb2 00F0 `F000p`GTRY1S SM H HwލЍRHP@P< @*"{2P/ 2,"H(BMPTX#2S H0 M  N00}Qii@F!@-40 000 0*ЍF!p@-0VM2S `@Px  QV@ <00Vߍp@ (G!2S/2S00/@-@@V002@-S0@0 @@ V0002S }/G!@-P`2@Sp0$M  0*004%40 0 0p`$Ѝ@-@upnp {p 0NS NPG- 0P0UM@ 0  M0SPp00p0S 000p00 00 0Ѝ   0!`*PEVX0T0 S 1t 0P00 0 v 000 pS0:000 00 0@-  O ЍgB@-   O ЍBO~B RM@-@p M;(@8(A-PM`p (P P&@P* @@ZMp0 (!DOMpP0Sp 0 ` 0Np PU0S@! (( Np | PNp 7/PP Np %P Ѝ@G!G!qB@ H!lBpBfB@ 0`( "4`#/Rp@-00@ ^ 0 # R0 pP0p@-^@P T00p``0@D^"000 $œ\p@Tp0,QRO-M@@0}0`1Q uV00ЍP0p Q :8Q@SI b0\> \ plP p,lP U  Z4\[Wpp\X @ 4Q*0S0C 0 I&P 0 04B0 % 0 S02X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S Ѝ@-@ 000YP  R  Ѝ0@-00DP Ѝ@-@\0S \s0\0@-@`q0`K0`0@-@0@50p@-80@P >Q &T0P1 RpR 0S TT0Q  T080 >0S  p@6DH!A-p`KP3%P@00<000S@ (0? `@0K0cScO-0KM@`Р 0Pp Kߍ0RS*R?  <00KC$PP d R 0HSX (0Q 0S H8Qh00 00> 0200BS * 08 380 RS00 T'<04 K wB'p/$ R$p@ DQX XdQ h00R 20 0 $0@$ R D RX0S <0S 0IS60 0 <@X 0IS80 0 @D000p H 327r0p0I 4S 0 IS+00$J 40@Xz80  0ISn20 0 t@0S 0IS`300 $$n@Si(K F(P41(1"<181D5%#810X0WX (1S 0 I0S2=00(  D(100@0S <P 1S 0 IS<00! *10@X 0qx0 PP 0IS0P  p@0 (n1pS P 0 ISQ0W0 01 0000W00 @ @X80  t|P 0ISt00@5S 0I S^00%Z 50@XE0IS 700 0 2p,0 ,C$P 6,0Q4X,:@P  0VP0  W , ,0,S\ Q:X,:AQ ,C 08P0  Wd , ,000G0C90 P 0ISS90 00 0C4 <"2_p3S MP@3 I0S6M00# HC@@B?S8, B?S8a 00PD0 KS:KUKe0P0: "1> ޽0I R 0    @. 04  $W I\H!jH!cSc5H!H!7@-P\ R%@P\0S t0t <00<0 Ѝ0P @ 00p4'H!H!.A-PR1 @ `Q80 pD t R1 x00| R0 07 30 0 0P0 0:0 00P00;0 00P0060 00P00ЍP 0000000 00pp0 00dp0 00H!@-@PTM "P@* 000`0001ipH00 P00Q`80  (.#0(180<P  P(" @B  ) 0Lq P( pp(1 ( 0(L!H80+"70 (P 0% p>ppp P( p"(1* (> >Qߍ 0*  @I!rI!HI!^I!s@-@P@0`=P @T6V@ЍpA- 0080-PP pW 0S 0$pp @K P` 0$pp"ЍO-GMPp᾽P@D4 @600 0z400` 0 _p00,0 PS2 V30 a2@00 !,0TH?0 ` P ;?]@PGߍO3?0 P '3"GߍV\` 0\`0T?0 8`j?0 PI!|I!@I!I!I!I!G-@pPQP, b,`$2S#PU`,@ ,x?P` ?, Q 0S ,9$> P,`0I!I!I!RG-00!`p@1PT:Xp T  X ⢑00U *"0 CpЍ0R0   @>0 D^?p  >  R?p@I!p@-RMM000PS`B S@ |00 0_pۍЍpp p p `F DaL>, ?p VI!0@-@M0S PU DP 000 PЍ0 R /0# DPD3O-04MS@ h@@ 0P0D0y0PDP 000 z0P # 00 y0o0P#  R @ r00!P~@|Pu 000 P`Pl 0 $ ( fXdpP  ,ɿ$(, P`@p W0⣱  Q*"00`P 0$00Sp $✿0 gp   ,(p吿w 0$0Y(V,S P@0 R80 0h0  803804Ѝ 00!0 `Pw @ rYq $U ,Q,0`S 8pP@,0$S  S S`0P !R "ROp( $(, xP@ I!I!I!O-P40@pM0` `2##pp#pX9 X6l0S,0Sp,0 0噇 $2Sp,0І0噇 6Sp,00噇 "R r00\0,p00 $2Sv\0,p0,6S < 0l pߍ0$000 `2$p$p  p$< 0 p $p  0 p 00 `2(p r< 0 p(f< 0l p#0z0,D04l0 ,40pl#0k@0"04,0 40p]mp]jpcgpi,P,0& 0,p00g S , P, `"P 00<1,0,0G0  0 jY00, }R0S 0050AP 0I    0,K,P,0`"dP ,0 0L0 0,0G0  01,p"J!3J!EJ!WJ!lJ!J!@J!lp@-PUp@0L0pp@- P# Mmp 0` 0 ` 0@EpC@ Ѝp ` 0 Ep )X` 0Ep  P00; U100Dp@-p@`P18 , 8   '0S  0R  dp`L Ѝ@Y@ 002poA@ Ѝ@ ЍJ!1G-`@p 0SP$H` ;000 0 0 `00`00 ^80 `  $;. 00003H01{ HqЍGy<0 $:딣 000H@00Sd3H0p84$: @P0 080S$l 3@o840S(0l 26o40ԢS,d0S) $0P%h0": 00BS:pl l2ob 8`a8 S0al 42 oS 4(R$: 004H0S0SU h R 0R<0S 0S11H000s8040 P14 P|18 Ph10 804 P00@0S80i  0.0 0p  0S; 0S<$65  0 <`|80  @ R 0P PЍC 0PP 0Q/<0, 0 00 0SЍCЍO! 2O!,O!H!cSc|O!CO!YO!O!O!O!L"0p@-<`@d0P  Xh00h00L0p@40180<iVO!P!N!Q/0S/80> d0S  t0R/". /N!O-0M0$0 0SP <0p,`8 0S @TQ 0 Ѝ> R*P6Sƚ ƚ[  Sm4  !  Q 0 S:50 0 0Vp00 <0 <  Y 0 0Cs0  0S0 S0 0L0 D0d 0P0 YL46P 600 0("p0 D0 00 Sw 01 hi@5P %P0S0 0<S<0P0] $p lDP l00 0P Rh532Y@0KSK?3<%(0530 (7Y0S0 ,  P   ^ [  i%0 p4 @0S Y0 % 2)  Br  Br0 S $ 0P 0   0 Y * 0  t3@S R@00 $0DYY<0<00 0?PDP: P0 P2 0080 0800 0P00S* &P )   p$ @ 0]+}600 0<P0 ,t0S * P ^ p`1 000H 0 000 `0`70@\0S   :0\!YP  0 R @ 1E"Y 0 Y 0 [0SlPDSP 00 P0P\0 O2 | ;Q!&P!PP!gP!P!P!P!P!I!P!4P!P!P!N! Q!$Q!Q!?Q!GQ!K!$WQ!iQ!zQ!Q!p@-@l PT[2 0 Lp@$`D N\P d  p@`$Q!O-,M@`!P Q0 ,ЍO`F RVWP0@SS 0SP0t#tx'xVI:PQUE0VB:  "4"48#8S50V2:1 S/ 0 0<P!' 0S 0`00a0<10  !&  !P 1  ,,Ѝ G 0  BcR!=R!p@-` MQP\@M   00 0 0x p 0S T A @f ۍЍp  0V`V \@TTR!$ZR!G-`Pp 0P1@TT 0S R T0S> R*P  0 @R!A- p`@PpAPUS1 0 HA0S 0A\0S 0AR!R!G-0 ;M0MNp`p Dd`80 P480EL80H8$0ED80@X@8<8 ` m@W0(` 0E 0>9p$ݍ0Ѝ`R!R!  7@-P<0@ @tP x0S+x >80Q7Q7;800A0S80<2780800800 0 Ѝ0@a}ΈP?b@cb 00 F@ 0 Ѝ0zDR!lp@-@P0( Uph0Spp@lG-P`@T Q Pd0S  0 h*0Td0ЍP0<Q 0S 0P l0  08p|0!  1!8 0 $ 0R0hd`h0t0S80, 00C0 080<0  P`00 60 00S $0 plWp P 0 0 R0H0@S 00pW\0H0_Hd{   p00S!N!(S!J!,0`( "4`4#S /0 @Rp@-00p0`PQPE@ `㏱ @d@$,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/@-000P b8"#4b4# 0SP1@-@T P@P10S/ R0 " /PP10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScG-` P1PM@T+ 0S pW$ P ⇝ RPP@h0 d0S4J ⺯pd0 0S PPPЍ 2d 0 20 00d0 00 0 ) P pnPgP V   PP$0 l#P PP 00]ZdVdR+ ͝PPn  2 0 2h0d 20 25DU _0SP  P  KUd P 00S   " S  ᅝPp h  5< <0&  XpP6 2020 00 0dQ  PP n T UO ?pP ]РZ $<0% h  5< <0  r00z5!S!T!S!p@-PP1 yC⊮ 2p`01S 0S 0S 0S  (N0 @T 0Q0 PSP 0|U d0S0h0d0p@?T!YT!LT!p@-@T PP@0p{T!G-Pp`P @Ѝ0<0E @P00 4 @P 0P000000 000$-70 ,$0 P pEp-0 ⚿bp0S <ſ0 FP  0@R 0 0000@@T!T!T!@-@0T #PQ *:SR h0S dP 0h0(H-` Ѝ$` pdp P (0Q,0Q  4 `P m800000( ,0BP0S  0h dW $0Q 0h0d`0SHT!U!0S/0S/   O-MPH0<`R8 0@PPc00ЍpP PX0 U@ UP R R R0 P 0S8Y0000000Cs ~@UЍO4 @PЍO; p    @@0 0+ 0 + SU!T!0S/G-P@M T 0p `P500 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000pjY P 00p0000 S0 @00:S 0S @\S000@:S @.'0@-P:P@A0 P\:R \:\P@\\ @R0/8' 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO0E`VK `0P0E@ PP 00pCލ Ѝ@@\;04pW p40(0= P 0 `R0 :R `d4@0  0(880P4 PF0 {0S )3 p PP ;000P p 0S#0 0 0㏣p8`@Z + 820P R 020SF @ 릭@ 20P 0O008`0 SWC p@DW:SY @\Sp S Spp00T:C P@D m 0SQ 2Np0P0@ 0 Y@S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0B P0@DJ`F  0S a2  002  @ ` P D,0  ,0@PE P0S >2$ D0A00T* PP 0P:SVr.8'VU!@-0  0 Ѝ@-(@ P d0 0.0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ }0Pv Ps @ d Q0b*P ލЍ }0P P 0@Pqd0 PP U LA*P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  .'YU!p@-@PDp@NG-`= @P@ d Pi 00@^S0S:SQ @0 R0FAd P= \S@0S:S: 0C\ 00C Z @ 00CY0TS @ ASBC\ 00bC ^\ 00:0 0 0Pd 0:SS0AR0@A P Pd pCU!0U!A-p= `P@ d8 PPd0`F 00@0S @Ad Ps Pd0 :RRAS@A P @-@# P 00S 00XS @00A ^a0ASW0AA0AS70A\2" 0@-4@0P (P.\U!G-A0SRPp`ʏ PU00Ѝ KP00CS0?c Pp0 Y( $P , P sP00SW  R00S 047σ,P R   S@T PR   R . .iU!.@0@-0S |P dP. .@-@[P08G.p@-P@PPp{bPp.@-@FP Q 0@87ST . .p@-@ PS P@p p@-@P * 0@87ST . .O-pWP`@P @ ЍZ K P ]PT  RT@ Z //////O-8r@00SRP`  4PU00 Ѝ  0P00CS0$b Pp0 0 吨 hZ PD 8 P TP00SX00 S yP @P00S  jP dP x^P \XP DRP ,LP$ :P .lU!oU!0@-4@0P ='P .qU!X0@-0S ;@@0@00DJP0DЍP ..@-@`0P0`Sp 0/P PP Ѝ .@-@P08D .p@-P@PPpaPp .A- P@`pPЍ0 (0P84SUP @ .@-$ 000B;P Ѝ.A- P@`pmPЍ0 (0P84SUP @ .@-$ 000B;P Ѝ.@    /0A-P<<`0@ >D0p0D0& SQU! 0@/0PA/A/O-@PD7pDpG``b0Y:0z  Z# 0@@D 0DA\0:Z: [=0 S: p `$ Ѝ `p.A-@`Pp Y- S- M-A F-p@-0A^ 0 n /o$P b2 0.pAT doP$ n  N$ A0p0Rp0@-`pTM00`< @Pp TT0 .p@ 喎<0@˧40 4/(00S 0TЍ<'U!.A-`@ 0s P0.0p0pGWp0P-P @P @pT 0@@PP @.p@-@P?@0 ?@0R:@@pP p.@-aM$0Sj Q1@ 4/1@A C"+4/%0AS&0  S00PpDU7/'0pS(0  S)0S*0  S007/ ,p0# Dn7/ p0# Du7/ 0p0# D7/ 4p0# D7/ p0 7/ `w0 6/0 P5/Ѝ.<'V!U!O-Q<08@0(00iPS @t◒`,@48pT:(㔉)<0( T:(㔉)p@0(pT!: Ѝ  y030IP@`(4k008p D!0? `@4Z<08p4  b "0 0+ `0@80@囦00 4/0SD0 .V!V!<'V!p@-@0`,0DPSp1S@.0D0P/.G-4DAMHPMU0`00000P0P, p0,0ي0@00`o`SLXp Xx ++po A>004@ptpG0SkXX$0`S D"0ß0 R 40<L>T @C 0 B3^00@  C310X  2` 3 d ! \C 2h00C0'0hS8 0 p0 00m+\\埑I,`D| <喑.,`ZPPDpAލЍpP ,P 00PpWA C9RQ 0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0vh0 :/1, !FkP 0H0.<'W!U!cjW!tW!.."W!1W!0H0S/.0P /.@-DAP|0`SDM)0S&+0S S f+0P 0P@ DЍ +pW*P 0 0000p+p0@ Ӌ`0pX0 7/0S 0SP 0 P0DЍ@..<'U!G-\qPL @0P12C001b5R 0 0&0S  M+h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0RL00屐0S0PS =&0S,P P,@GJ.@-!\  0L0#@0.@-p0M  L0@31 ^AP 0C! 0Ѝl. @-L 0 0@11D ^Q       .A-Db@0Mu L0 @2# p PW%cP_  Bc p\  Z$0 HD@,X#1010 2R01   000 S" V00 S ┐ ЍA X 1(410~X1威42 ᦞSV Q`ЍQ0S ԏЍAΏ`\c  Z㚢 lj@lR%0S Z 刢 c0@0.U!A-Q`0MS 00S` @P9 0s$@Ѝ pW   @0p0|0S0S @Pp)p00FV@@)P 00T l@p`W 0S:S* 0Ï 0p0pp..O-`LqL1P0SU$,@T,P@P6 h0d 0B1 `P 1h L0C R P!050%Pd @T: ត 0 p[L0CY1T*Q@@.G-qT0So:\0`S&7 2 c@Oo @d(0d$0P0@U1 0S. 0 P B N %Q * RG  Ꮱ0B408@S 1:X 0@D8C 003 c0?o< @@D@  PP  -PNPP 0 @ S :    b01"!00000P00,0P.<'A-p0@@ `P PP0`0P P@lT%Q *0S  .$00S:@-@@R.@-PP` U(0SP@P )@T \0@T0 4/9 00'0S 0 $( @'Ѝp.<'V!jW!O-$MPpPeE00U0SXc )Z@ D3@<3 4/W(0Sp0eWD@XU0XW5 0PPW00 # 30+*[@C@dQS: ?LzP5 KL ` % J2 10X0D30 2%Q b*0S _Z_1)Z @] 1@叡1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P0P0 K D K0@D   E%Q   0@P0'0S 0 H0p&$Ѝ*0S  .<'V!.jW!@-M@pP0aE(0SWTP )@T; 0@0 4/0#880 ớP0Ur@P  '0S 0 x( @S&Ѝr@P %Q|0S0S P 00.<'V!jW!O-@QpP$M(0S@ P xP'0S  p@P&$ЍW "0`TM\0T*P* 0`0  `?oo 0c `S PP T 1b*᤟A4 T!P030#P0S X $200301S%T#2QZ FD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp<ь`0<0 0 %pP ,PP% 0   D  %T#2QZ J*0T00S  D۞UKP )PU @0@<0 ;4/PP  004.jW!<'.V!@-L0@'0S 0 00 0K%T Ѝ@Ѝ.jW!J////L'/L'000/'000/'000 /'000/'000/'000/'000/'000 /'000 /'000@/'000/'000 /'Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/$'R0 0CS0 S Pg0 /p@-P@,`TPp@ TpY!0A S010//Y!0P/!R/P/P/Qa/P/0000 /'P/ 0S S//0R/0000/'000/'7@-@P@@P 04PSPE0 t Ѝ0Z!Z!Z!'PQ 0S///'03P 0 /g!0 ACP 0AB0P CoSPS//O-MX@ @ЍO.%SQ`pu rTp 04S`\kP0@`S@T~WlЍ_U` 㚔!U`PE`0r>T 04SJ:`\H㌱  T  QX ( Q   E  Z P   $T0`[?oT20S@ @ @0R @T`0-@0S S @0V @ X 1@@V X* 00`00P 0g!o!00S00/"'p!00S00/d", 'p!///@-@H/0@wP ( m :@噏',p!/p!-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A N00ЍQ@P @@p@-0P `| @P  \*. Q  Rp R  (  p 0 B '.qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00{ Ѝ0S/1>3 !/0S 000/.0S*p@- @P0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0m0 "0 00 0W.p@-P@0`QP@@p TpXp!Q 010//Xp!,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`$'''O-P 0R@pM XԔ P&  <͔ P 000Ѝ 0@  *QPP ЍO 0 PS@ ; 0 00<00S*^Q0R08 ]R00-R @@g Q* ]R -RS\V0]Sj-R0 Sc:0S006000S80S 00000 |0 hS ,FhVKX ,0Sq40Sn$0Sk<0Sh(0pwd  0(` pc 0 @`F p@ ῗUh 00C0c-R [RS :R =R} 0S: N .S0,S0`0`0-S]S0S0`0`40\ 0 IY0 S:0`S0`00S00``E0 ⧗0I{P  0 (S0<B(R$ $PP    tP  $0  0$ 峠S0tS0`0`0-S]S0`S0`0=  0 S:0`S0`00S0 -RZ QW]QT -Z00  YI 0S. Y0`S 0`00S0<Y00 Z0S  Z4 0OP  .  uI400!0ⱐᲠ40  7P0S 00100  *P  %P (B(N [ 0]SS0<V*0P80 P <0S P pH00勰P00 0  EB#ЍORW =RT ]RQR :R ]R001p!p!$'.'''p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@'''A-0@``Pp\U [U_0V:0dS0`000 4\U=*Ux .U; 0Sf0 `S xAPu 844U\ 0CUUt0SU 0`B }t  t 0D OU &83U F 0  , 0000h308@0S* *Q2  0  B  BA   B0|  B5Ѝ 0  0S 0S 00t200}PT\QR {RO00j0PS;* ,R8 Q 6 2000/ UU0 R  !   h0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \a V 1L  0 S *R \R )R003 0S00000+.)>{^ ]'@-0@``P?Q $0A  R % S 0^Q [Q \Q 0S Ѝ{Q |Q720V:0S00500 @0` V1@`(P ?0 S*0)S  ) V 1L  ,0 Sf:0S00l4000 S**@?PQ{PR ($  "!,Q 0S 00300\0 0S 00300?P  *P 0 B-  B   B0!  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   000p0<20to kmi0V:0aS0`000<Q >Q x`$P |O &   B 0  B  BZ  B. "Q A% l0 `S0* ,R-  0000< V0 R   0 S*}Q00A R 0}Q 6000S 00Lp!.'^ ]0S G- `M pQpG CpL2@P 6W:} ЍP=PP P $PPxP @!P 0uPP6|    $ ( , 0P4 8 < @ D 0 t000L R:0S005000 S8:   0A0KP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RpQ00< 0 g  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:0_0PS, 0E10S*P8I@00CU00C0 RB  \ U B!U  1 EU, X 0C^ဗ!1LX0RU!U!  R0>P P PS 00 00H0@0 @000 0 R00d000tL 80S@ 0Q10CRZ/TUUĤ8.Ee,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0wP`$'''0p@-0PSQ@ʡ@80P p<0S P pH0@0@P(00Ppp@$'''O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(  fmP!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ 't!O-Pp`0,@Q V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. P`F`FV00@>N>0> \0C~>!0>#0 R@u @O-4M0\0, 0(0 000@$002   0 X = Q  0 R  R  PZ$P  (    R    ``S  R  Uj k V pw p (B( _U RQ v   _V R up  (B(   _U R w v  _V RQ ppX u0^ v  (B(    _U_V QO  X 0FPyu  p $ V    upv  w( ppu  v X pX qX0wo u`  _VX 3"  Q$,ZS (  `X M 0P#v  _PU PRPU00000S 0R0 4Ѝw_Uw^RwOu2'O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 YS  D>31># R 0800@ 0 ~Y_  DS S- S* S( @` PS 0 b800@ 0 YY  DSU S S 0>#0FϠ2@P0  =P0  0P P 0,VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0 PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(  hP!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ 't!O-pP,@ W`> ^* +^` ^i ^O ^a pP ^o ^Y  3P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>00 E0  ?oR20SpG pGP t0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-u!'O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 ~YS  D>31># R 0k800@ 0 bY_  DS S- S* S( @` PS 0 F800@ 0 =Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-u!'O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 ~YS  D>31># R 0k800@ 0 bY_  DS S- S* S( @` PS 0 F800@ 0 =Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0 PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(  aP!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ 't!O-lM`-PQ0n @-Qi   e        Q 0#R`S- 0pp WG,[ 4\ 8^| <HZ01S 0s x[BoPR 0C1!S 0D~0p [Z 0000 ,@4H80: 0; $ $ B20fq4pQ0@-M@(,4`0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&0@-(M B (@{Ѝ0Q0@-M@(,0  P#U` `0`/"`o R?#0.o^,AVU-00ĵЍpFW`&0O-M@0p`W PV P'Z P2Y PyX PV P:$  iW Pr i  iV1  i iZ  i iY;X% h iT 4i9ЍZY!X3  i ,i  i <iЍ wi $qiXVZ  PЍO,nmmmmmXm@mllllxl`lO-@Q0M0R0`0P$0ट 0 pP R nRl a BR |$  , wyP Q DqyPL Ѝ<4 00fyPY U000T0003 0$0SyPNY U070T070 AyPY U000T000h P/yPY U000T000Yc U080T080 oR 0yPT000U000u }0 XxP 0 4xP] 0 `xPW 0 hxPQ 0 <xPtYz U060T060H0 txPn 0 xP 0 |xPXY: U000T000+T080U080"T000U000T070U070T000U000Y U080T080 ЍT000U000T080U080| sxPY_ B0 jxP T060U060k`k0kjjTj jg 0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  p, 0 |p@ |p@  p@@@d|0 P||P|0 P|P`Ѝ|00@O-1M M(@PDhPp \"(` p (-pmp^ @D;@h@ 08 0Sr pءp 100 0`00p@, ` )@-0p t0)07 PP 0S Rr|001ݍ Ѝk|0S 0F\ R Pp @0`!@DD4 [@ 0 0 0V   02 0p,R 41ݍ ЍpeFtH`e(eegt0@-P@M 0  PJp :`p@ PW Ѝ00 0NЍ0@A-P0M 0P@qqp"  p Pap@P00 @`p0S VS00 S0Ѝ{000/0/ 00 /p@-PPP@t 0@0,PP00p{ 00p@-xQPpN p@! _P1 03p 0S$A@p< 00A@00p0p|{@P@p 00@@j0U0pq 00|@P@Y00[{PpW{ 00S{ 00O{ 00K{ 004T00@-@P M0' /ykP( 0Pu 00bvP'0@00S i Ѝ0IpP@H0@Tz@4 0 І@ph0D_0p@-XRMP @R 0d TU //kPR b`Pu* 20vP 0D2pi @Q P0@pqp^ P pT ЍpPui/hpP5 0TaS`) $<1P0z0@00z0 @@xz@ 0  \ @pp00 0 0 @}zP#U7p@ tz 0 nz@kz0 @fz0 P@`D^&@\xt]$@-XP`O-$(X,p.S`P@+Wu00Sb [0 0^P: $" 2Q > !4"0x"3S20*rW00Sa [0 0^ P : )" 2Q >@AQ!Ou0 {0Qq w{` p^ P : 4#0"Q . ![0 0X^P:t' 00{S' w{Q e 0C^P:  4#0"Q .@AQ!O[0 0+^ P :[y'@w{ 0^Py:0 )Z@0S20n2" U%> "Ww{T ] P \:4# IT0S20R2">" R01Q"Oi 0S20XC"""""""""""p@-@M@ P, `~0P 0PQ![Q00<0S 0S 0$>S 0S1h! R 0SP[F 8<0P>!01P?, S(00c!1$0 %>A03Q F< @@zP ( 01CAF,  /PV$ 0P  [ `0% [ P$0SP 0Ѝ00Z`F* 0C!< R Q!h! R4 @Rt000Dp|0x `x0p40|0pt00G <`00W1000QP0Q% [ yQ4, ^4 S*P00<$ 01P `% <+Q+ !hQ0Wt000Dpx |0@x p4 | pt0@0 P0@ $000J A!h! R04 SQ:t000Dpx |0`x0p40|0pt 00 00W\0P0%Q `30LQ0 0,^0F <P0A  0=R@<%0@Dh0(00(0000,00,0  F 8<P! Q F"x000 P 0S  F%0S   Q\8s< F`%d  0 Q0*0^*r@s!FP&T8@<0 @0D 0 0h$% 0S 000000(00(0,00,0(00(0$Q0PS (R" :"  R#Ό01"?!x"0u$00$0q 00 0m000i0S <\ } H@NTLX \ h@0DhR 0RkLQh$hB` &R0Ph 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#P0L dS<0 `0d $F%#F#"F$!F$ %(0S  R $ R %R  :6$4&60%E!$0/!!> |5 Ã111N`ş P ?$LUE ?H /$ R  " RL@\P E%/L@< 0H 08#1 _LA%:6$4&60$$$0$΃4HP#111L4 U >.0tT0.ό#! 0 0PL0LHP 00UP00 0T 0#0m{ #v$0S"xl$0S"xc0$0` Pl3@h0P t:($^0o<P0j 0=RH dH %0h00c @D00m"%:600$$0Ϡ! $>0H!!!0C" RH 0H  Ό l" U`? PŸ 0/  "1? A  L L H0U 0\ 004 P1@0P :P0 0<R$0h00c 00'mL!%:600$$0Ϡ! ($>0H!!!0C" RH 0H  Ό " U?  0/  "1? A  L L H U0 \0#POPqPONnM mLLK""""l'.%Q(\)\²0  0C0  BQ $0 h00$%c 0dR@  Tw \PPQk&P@T8<G  \0` Q00000STPT8< 1 F , 0 F!& 0 ! 0S(0S8 P1@0P .:c 0^l00%:6  00$ 0Ϡ! "$>0!!!0C 0 \ H @"UL? ,d 0/  "1? A  L L 0UH  R0# F# #$02p rp t t   0 RN  0 & F%F000 P 0S %F000 P 0S!F% &( $@R00<\=QHPNUL0X\m@ D@hj0 000$0c0$0` Py#Rs Rp  \Qd% 8&<@0dP(00 00@ % :60 0!$Ϡ0! !>H%0!!!0C h% Pp5!" ?.Q!QT$ @00 #0BL00 h00%H00 B00 00S ^0  $0h0 C0000S ^ 0@D h0 B\0 $0h0 ps; 0B &R" 5O-Mp@$q0Hl0{q0W`0 T) 0 2c1  ?<0PP/ 0v> 0`0?d000P0?T0 080?4 <0 00$$%"\˟$@ 0000  000T ;0h0PJ 0TP dP; P< $`Pm0Sj Rgʰ R cʸ R _ 0 0c 0S0`@dp?O$@T'pET0}Np0`@dp00p00@D 00000 0H0X PQ h 8 v^D Pt PE PQPHJ004 嘐lpx|PVtRSY Y  h@p| Ux Zt 0Sp0Xl0[h0 Rwt XX8P0:=Cȸ0p00@t0p`VPu x0S p0pt0 0800@4p0 h00 0P  ' < PZv> 00! 0#/!! !./ B 0S!?.P  PɊ 00#1?lv.C BAQS| \xt Pt/p 0 qp  A 0qp `pV@P0 ?oR20S p00ߍ 0p0h0qp@p0 Z Q#! !pY@2NRp/ h0 P0,Pe000 `0  ZR 0`S 00@ o0h@ `o0S0 !0V0ZS 0#0dh` C0hP0? T0:0h80? <010h@0? D0(0hH0? L0X$`\SZP L`loT00io0S@Tpbo0S9 )ß䓟園"b^2":##c2S \TP(d<PP 0 lß0dT0BP30@p=7o000h0 `0@4psP8P ? /( Rß&0Q 0Z/0 #10">/ 0C!a 0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 Epqp> @p(pKJn#00n0S @㼀p h z@pn00@pߍ輀X) XXʎ 0n0Q  s!P nT00n0S10(` #ΌQ0"c01 2c1@T_mnT00,`lV)\P(\ ףvɻ %I$@-@! Lpc`]Tat X00 R 0 R 0Q/  /  ꨺AA  DQ p@-0P S@@H  ^0 S  Q 0#0Sp(p/< A AH  Q j.0 0#  Q/္00Ɠ\ p@-pPo> 0@" \ p /(A-@P `p@P0%  P @PPA-\@`@P pjNP0& P @PP(A-\@`@DP pH@P0& P @PP輷O-@ M `P< p p$0n@0PP P p $ P pP0S 7 Ѝz T0 0V f  CS0`0S,>A-pPQ `@Q tP 0@DDB(000S  JG@- M`qPPp* l 0 0@0S l0"S# 0p000S0 07/ Ѝl0"S1Ds`0pX000S @ Ѝ1Ds( \ G4F@-@ @O-PMU@`  PP2S@PS  PW PPp B `Xa `L`@ EP) 0nS: P= \P0 0Q Q P P 0 IB"S0 000P Ѝt0 00 S = ; Ѝ0oSP / zEtDO-@pdBMM`p"l SP:[\PPx , 8RPT00eP PC @P`K( 0 PPrp 0P 0 0 PPdp t @PX dP t Pp   0 gP @PC 0dSPkPU0 Pp`k00P/U ` P pak0Ss  VPBލЍ V0H0PP0  pa  oV@P0 Pp k0!S0 0 0 & m kok00BލЍhk00 X0yV P\P PQk00 X0bVFk  0x 6^00,k00 0PM 0 A XPЍ00@-@?PM 0 A DPЍ00-,M 0 JPЍ?--l0$ S   0/ 00@4p@-PUU@pj? $0$`0 6/pܳ>p@-PiUU@pj? ((0`0 46/p>x@-@P 000l3/`>(@-@P 000l3/>p@-P?oU20S@p 0 0 P5/=p@-P`UV00P00S@p$$ 0P5/P=p@-P2?oU20S@p 0 0 P5/<p@-`P&@Ppi(0(@0 p@/h<p@-P@P p$$00 0B3/pH<-@- M  up@,,000G3/ Ѝ@ Ѝ/;@-lup@  000G3/;dO-`,M$ ХP @^$0Sp,ЍiХL0L00$00 MP@ $0( 0C\ 0 CR$ *#0$00S3 5$07$050$0(0,0!PpO-@XPDM@p, ff@ [a P @: [ [|7$0P$  0@X Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S,3 5407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P [ S>3 57,05  50Q,0R 0 CQ * 0CQ,*# 0 ,0 0,0S3 57,05 50S 5,07,05 50S,0DR#00C R700C 1L5$0qS<3 57,058`0,0 ?R0@SKg,0 S#3 57,05 50,0 QS 57,05 50S,0 R#00C R00CP,@DЍQ `0p@ FQ)Q* AR bQY fQ ?R0@SP  b8@S B;; C c3<2080 S ,0 S,3 5407,05 50,0FQ0 0 ,0R S5 7,05 0,0 5RS=3 57,05 0 ,0 0bw@0fp`F2$0?Qa R^  2! a, A0!p @ `+ 8 Q,Q<3 57,5 5,8Q,  P,  , Q0@5p`0``` VRQQ W  P [P=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R0`W  R `S` 0P0`S<3 57,05 50,0080:Q,3 547,5 5,@p`0%#jo%#jx5%ju00@-MB0@Ѝ0p@-`PM0@ 0 4/ЍpO-PRM^  `WpP+/a@[VP L0  D pp Ѝ@0S 0  D ppe0S Ѝ贠 e0S(0D @p0D @ ppe0Se00e00D00//@-$$@M ЍO-EM MaX@P+p `EP X0P@(T 0 X0P@T 0 70EAP bP ^PUEލ Ѝse00Eލ Ѝle00.@-@`  pMP`P, /]X 0R rR  P    P@0C ЍP  rR 0rSX 0 @, 0 Ѝ@v%e 0 -H-,A-`@ >p 0P/S /XP @0 Sp 0 S K cp@-IMM@`PP ~p 0: S \0 040pp IލЍpdO00@IލЍpd00+p@-IMM@`PP Rp 0: S \0 080Dp IލЍpdO00@IލЍpd00*0@-@PM 0 A PЍ0P 80Q 0 08080//p@-@P PP`  PP u UVP  p@*[PPp--00 M (0  ЍЍ/\DP --M  Ѝ Ѝ// -@-MO<@P@ 00  0Ѝ@Ѝ/D0-@- M@OP  Ѝ@Ѝ/O-q`Pp,M;  PR $ Ppp @P$( PY P@ 0 @YP VO ,Ѝ000:Q!0P00,Ѝ@T0p@-@P(M & (Ѝp0 00 Dp@-`@P$Opp p@p@-P000 0 (M` & (ЍpDp@-@@ @  `  @PNpp p@k<Dp@-(M@PNp a& 8 [(Ѝp@-@PP P  ,M` @Np G& A,ЍDC-PP,M/  @` p`FV`R V @`0 @'T N5 ,Ѝ00 0:2 0,Ѝ8T0p@-@P(M % (Ѝp0 00 Dp@-`@PnNpp p@p@-P000 0 (M` % (ЍpDp@-@@ @  `  @PFNpp p@wdDp@-(M@P8Np % 8 g(Ѝp@-@PP P  ,M` @Np % M,ЍD P $ Q80 @-8M80@08 Ѝ880/LL0000 0<aR 80880Ѝ/dlP/0@-@0@0 M0S 0000 X0 |0PP 5 h00C0T00 Ѝ0DBKP0i,((DP!8!O-3M0PP 0 @&0 `0D p@ P P00U pp0 0CC Z 2ATT00  RF LD@D T]:[ 2 0000~`K `M0 V0 W8 \2ATT 0`Fs 0Ry GM 0 S 0 BM0SH 3M0Ѝ0 V  0 8 "M ` 0 -0pHX;0S2 0   Mv 0 B@ 0 B  BL`FtY  0 B  BL 0 z L 0 0S 0 B00Ѝ 0 ] 00  Dp@-@PLppp@ 0RS00 /p@-@<0<00P  @Lppp@ D808 00 Q0R00 /<Dp@-@`PpLpT T   p@pp@-@P\ \  ` @SLpTT  p@pDO-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDAA|` ^Bp2  W R ? P QQ Wt ,0 000IC1100Q0 0, Ѝ000[$0 00w D@-@0@ 000 @T AP80@080@-@P vAP80@0800-M  Ѝ0-M  ЍO-ϟiM PȡЁqal QP@ P? `K͌U PD? K͌T P? F͌(Z P> F͌(1S Pl> C͌ X P$> JB͌8W P= ̌V |P= ^B͌`d=@ 0S078H H0P `P P  P P Pt P T P0 Pp( qP P`P (aP Px PP'( tQ780D0x100C40S000C,0h0Hp0L`P$׿$0PQ ,0 p0`@ , V @  f`W/0!1AQ 0 0 @T @壾T, V   @@dqXhP 0Z 8Piߍ P 1 S  ,00 0! 1S 0D 0| 0E@p00nP,,0`L0!!\V, @  B  (8<`@ [$ 00A00@S9 00a1 P Ua P(U, [000 P,0匠0Zp(0p1P0@`@P㾻P`  V 0@0@S P8<`@P$04 0R$0'HpL`P1L00P@@X1(@P00P0$001T00PPP1 PX00P0000ܾ0P0, 0pBPBHPP@ 0T8`<@OH U,` p@PW 0g1pV@10P00 00Z00 嚽Z,0W0 P ܰa[@@P4P  Z @pV @@ PT 0P@ UT0@0p8`<T4 ! , <B B P $@0p8`0[T0, q 0q00` p @@HP\V 0f1`W10 @ 0 0 P00U00 P&U,0 V0 @ PqY0P@ 㿺PP  U `W @@HP\@4P,00 0 ,0H0 V 1封0D|A>p`FR ( `[( [( [ ( [(  [(( J[5( [B( ^[O,0$ 1@*,  BU00p@8`< ?,   , 0 H T0封.1D|Qc>p@T[1 0p8`< T P 10 0R_ (0Sk ,0P0 PXC h!(0SY L0!11 @ T p @MT,00 0 @,0 PCT0p8`<,04 10 ,0 H0T0 就!D|=p@!(0R1P@PB¹0P@ T  0PT0P0,0ST,0 00C, P P0 X" 0 0 B00 S: 0T 0 q!1 @Tq` @һT,000 @,0,0Q@ 0@1>PpP`f Pp- W  `P P$0SC ,04 1@X h!$0S5 P0!11 ` V  `冻V,0 0@ 0 `Tq$0W1`V W  0 0P`0p08`< 0,0 SV,0 00C @,p0 [# 0 0 B0!0@SA 0X 0a!D 1 P U a P4U,000 P,0|!0RP0P1`@˸0P` V  0 @ 30 0R80000S 'y 0p8`<^p!* p!:! f0p Q R 81 R 0SЍQ @0 0 0El0T0Ѝkkk<0l 0̃ S/|jO-D@p`ጤM[ +㢶(p( $WU0CS0S<K3W([P 40/$ % 0:ГxsȃH pß|8xh\`(TrLhÃPD弁<x40,($ @2101: R 0S 18p10S pWЍQ d2 0 0DLr'>ppGl`( HT(@ T (0Ѝ>˵rp<Ƶ^õv8#㽵:㺵0'㷵#㴵0z# 0寵H#㬵p-㩵-㦵`_㣵|㠵o㝵p㚵r㗵y㔵z㑵{㎵@|㋵h}㈵`aPlht`k!i+!,%!-!.%#0#%of&i`"%{j%k %l%m<%nq%t$%u4%v,%w%x~#p#rd"ye"z|i<gh00p@-0['N( S(0S(@pfO-8g887M`  `P `0ǟJҭp 7 000 S00U0S}`p  @00  4` S 0 `0 40 s 00bR$ 4S4 0((&00 Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Q ph0  T5 U0pS p ! @00 4 ` $R{  40 0 ;0| $Q B q/ 0 ;0 mp4 S S040ST 004 0r0  cR$GU  p p P p0np P 440 s 00bR4 44300fS t30l3#` pS 83003#`s p 30 B  `40q0cR 4S02$00$0C?o r  aR$2#y p St p  0 s 00bR40 ; 0̳p P `R pa 40 s 00bR4 4$R40 s 00bR40  ;0 媳p E  `Q q 4 00 0q0cR  0 ` Ѝ 100 ?c p; 000 ?c pv/` 0 `00! 0WC 4 00 40 s 00bR 44 `꠹hz8zPyxAxvQvu(8p@-P@,0 0 PsQ TT TprO-T4P@P0DM 8 `$Qq  :Q#R3Z 300S 8 p`   pwY <0S pS 0S 3Wg R 0CQQ00AQ0S  B=LZ` 0*"R S 0"0W DЍw WW & p pp 0@s`00 <0$DЍAPAPQ~ DЍP30:Qx !1 0!,0: 0 P @ 00Z 2  ! Jpo p W2 B#3!0 00S P0 @ w ! !pFQ0S0:3S L00D00! 0*u0sܱ <A00 00ꬭDp@-@P=ppp@p@-@80800P  @=ppp@PD@- MP1K!pP 0@T $T` @@TP  Ѝ<V>0AP0@P@P@p@-tQ@PLP LP JP10S. (P: p0@Sp0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S00 0@Sp0@S mS 0C;S P   0@S;Co O-0pvSpP`MXf` `JP tU0 `r(ʍ"(0I"R` (0$00 03S9PK eT$9P [ 0XSڈ%$ |T 0p50 h5"004S03P00S5 p0S2 4S, 4S 0t %W、匑Tp"2 0Pm 4p2Z& LQU# P P /P jgoH5S4S 4S0?o2 T44Ytx2 PuX  KP3Zx2  wKPx2?;~0x2W  mKPx278x23X|2 PW x3|2fЍ0 D p$l h $ <%$(JXj GKP Y @KP! Z$ 9KPp2?;~0p2|20P?0 r("(0H"R`p2Z* L➯$<(A-@PHPp p@Pp `E`PE0 ~2 U@0 q 2@ p@-`\@PT 0S1 RT0S@0@Sp@G-lp@`S0 ST0S"Q0S 0STA-@0M0`@ᕫP- 0, @S 0p0pjp@†R~"  2 0QU G P*L 8 ]@Tۍ Lr_l_T-P PM 0 R  *’0  ЍĝX0 Q0L 00S P@-: #k/hp@-0 0P0S$ :#`Ra# #p @ၬ0P:##C Bq30:#!Ba##p -L0LM0 0\ 0ʌ   > Ѝ,8 80 00\ T 0//ԛp@-P3|`p`@0@ M0SP0P0:3S 8 80 0 L0:#p|0O-tt3 0lS0hh M*pB`P 'WW p p PS p   r  `R  00/"1 R" @0S S8 SW0B S p20h2#`pw  @U ` Ѝ R j  P  Ѝhp P ` Ѝ0 r  `RR  1  S7K @y ` 0  S q`R Q  1  ЍVp  B/oq`R"n000 ?c Ѝ 0`0`0 0R<<  0 [[[D[QPZXaP` 0p =P?6odcτ00 0#d#lm0 p _F?2? 00"sͭY/ ` "  bP`0  0 0܍p@-D@D0@Ppp (0l0m 00 plp@-@0@P:#Rx x# R- # 0p zP`pI:p <hp@-@0@P :Qph^p- p #MP`p :X<hp@-@0@P:#Rx Ó \ "R-- , p #"P`p:p謊<p@-0@DPSP @p (0008 <@%8 ppD@-H0H 0@0:#R#R"#0:ꠉ@-`0` 0@ :Q Q- :D@-0 0@ :QQ σ #p P} :Ј@-0 0@ :QQ σ #p PT :,p@-0 0P@ :QQ à Ãp #VPp% :ep與@-0 0@ :QQ σ #p -P` :Q̆p@-@0@P:#R   #Rp @8 %8 "R--  p #P`p:pp8 :$<D@-<@<0@00:3S 00 8 @-8@80@00:3S00 @-0 0@:#R&#R) -̌“ ƒ$@ $ "p" #ƒP`]:#R蔄p@-@0@P:#R(#R+ P- ","" "- $ $X R p #QP`p :#Rp訃hp@-PPP/ 0@` :QQ" “Tƒld l p #P`p :Qpp谂h0 0 ́D0 0 ꨁD@-@ MZ8qQp* c0 0 `000060 00608003 Ѝ 0< 603 ЍL L0 0`0` Vj#cP`h<0 0 000:P/L@-0 000X0X 00:3S 0@-p  {:P`/\0\ 00 :3S 0-p @- cP`/$0$ 000:#Rs/$0$ 000:#Ru/~000 000:#R s30/~(0( 000:#Ru30/p~0 000:/4~p@-P0P`@0M0 0s hp 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝp~ht@>0A- R BP0@SMt QP 0S `^ 1 P00p %1p0 Q61 1`p0V0S  l100V0S  034p 9 03, p &0$%ЍP  QÁP 0:|   000 00D0 ` 0@D00L>}0>ht@0DP@-,@@0S}D00 <@-$@@0SnD00;@-X@M@ 0S Ѝ< 000 00D0 0Ѝ;,@-h@M@ 0SЍ D 0R  (00 Ѝ D (;:@-LBL2@P$MQ :cVW0r3p p80Scqp 0SQ1p0SB 90  B0*1`00|PN 1@ O400 R 8 D C400 X=40:60  :3,p 4 P`$Ѝ0`00|P @  D 0R` 00 `C00T @8 300 C|y`:H:l80pC- M P  S L`<0`00:3S V  Ѝp v 0 000:3S/CXvX0X 00:3S 03@-p  8P`/(v@-@0@ 00 03, p P`u@-<0< 00034p 7P`hu0@-PPP M* 0Q0@00xP 00 0[3000*CT5 Ѝ0|P H00 0H30000*@5 Ѝ0ul/0@- 0 @P0:R M# P P&tP 000 305 Ѝ0`P D000,PP Ѝ00tl0 000:8s!@- Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0 U@Tp#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@VЍA-PPM Q@`Q00?`FV`V` ,p(L 0@oVЍP/\ 0,  B0/\//A-`MVP@,p(L 0@CTЍA-`MVP@,p(L 0@)TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ,@ 0(@T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/p@-PpPU,LQ (@0 P0C0S0 U^pp@-Pp\pP#, 0 BP 0 PUp,LQ (@0 P0C0S0 Up\pO-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0-;Pp4S-`@PP3@ 0 00p) ,4, [ 0  : 0 V lЍB0  9lЍO0O-:$M$pdZ0  r$ :PUw P0p 0 p ա Vp(:0PSH8 0  ;@P$Ѝ0SI S5 SpV  e?p0004S$ЍOAp @0S S SpU 0 ?p`Fp@0SF0Vᨀ *HVp P @FXp  )?p`FVᦀ* P@Xp P @0S SVp @Vᦀ:Xp PQO-PM 4 3`S,[*Y= @00! 0@ @00@ 9TP/ { @p ` uPPE @0S 0  ᑠ`PЍ` D \ P 4A " 2Ѝ @0 @hP0  0 /P 404 000S :P /f<0<0 0 0S :P /`f404 000S :P /f<0<0 0 0S :P /e404 000S :P /e@-DD 0\ ʌP 0 @P  0 P?p@ 0 5@ } Ѝ@aP  P /p@-JP }3S P`4`^30PVX  0s3 S 0P 2 $R 0X0S 0D3 20X #$04p03ppHp@-jP 93S @P4P30@Sp@A-`Pf JSU?sW< @P3$S3 SW*0N, SsH0S0 WP3PSSpP4Szpp3PUp,0\4000?a000401C0010L10|1spp@-@P PX0:"C0T0XppG- ؀\/P@p  `᜞P LTL VW PT VW  P000S;0 ᇞ0 0 d]|O-($Z Ap`PDP@8P ( ;T2HP* T >P 0 ; @00 ;0WXT P  RX8 @(  !<@0t\|d @-?C0 @   @ (( ;  0[TA- Q@PP% pW# 0 0S0ל,՜000 R   R   R  P ᾜ4府`T `TX *P Q Sp  QW02Zp@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S nP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0p tpdWH0H 000S P@ ?# Q@ 080//UD(0( 00Q0/UD(0( 00Q0t/dUDp@-P0P0 0@R`  P@ ,0H1`00 0 0 05U,00pW$  0$ 0 00 0(p PEU` 0 偗P@@p  p5 Ѝ-,0 (0 M0 ЍBD- M0 ЍC-@P M(p, P00S 2`0 GR 0 O@0L"Lb ``8 ῗ 0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ000 Ѝ0`00SZ00&0   0T S00% , W10X0PXp T0pGR Wڠ`P`W 0  pP Ѝ80  080 000 S0CpCfyp@-`@P!pp 0p@- M Ѝp@-@T T  M` @P~!p 0 ЍpH?Dl l0 00S X  8Q Q @ ,@ /&R//>DH H0 00S 4  !R@ ,@ //d>D`0P0 T 0008!R !R @0<@0/6S//><0P0 0 0001S@0<@0//=l0l 000S X *" (Q Q @ ,@ /&R//L=D$0$ 000S @ /<DP X0:20(!R !R @0<@0/6S//0P @ /A-p@Pp" 80  P` P   D000T ! $000S0 <H0H 0 ?o20QQP T//p;D000 00 0RPT00/;DA-`@P`$ 80 ! QP}p~ PX eS Q 800PU  000S0:0 00:D?o20SRPT //0PPT00/,0, 0000P/P/9,0, 0000P/P/`9O-h3@P0Y Q T# PU D#00SPH00SPQpP0GP0HS``HpHW, 0 ^  1  !!P3pGPI@Yep0S a[0q SV,0 0D |000 P0pP`a`0IS`IX`a,1 \  0  !!3pW`YHp0Sa>0 S;,0 0D | 0 00P0qpI PX 00C 0HSP 1TX[00CS``[TY0IS`YPY0 0CPY 9|0 005Dp@-@PpP`0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CED40 003D\000S  Q R P (!00//H( \/Q,0,  R/1S \/\/1S \@/O-A1@ 0QM5 P`p, @p 0S# Ï#SÏH000C  ```P 00(00(00S0000C00T0 03/p 0PS@  ЍT10P(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0 O-`@ MP /VT``D0S  00C(00@00 T0@ 0 S `&, 0 S@p @ RᴀD`Dps `| p Ѝ@ 0 S RR Ѝ,P d,0ڐ0P 00X p  ``F , B,(`aaA0  T p0D`4ᯐP  Fp`,004@ 0T` p0Dt@U   PB  0SQ 0 0PC 0$ 0\R <@U 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP ,D0PQ8 0 /$ $\/ P/)PQA-a@`؜1Pp0$ TY 10 0 QT$ D 0R U ESpL @10 0 QT$ D 0R U EAp: w0 0D  Q SC$ 0R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q4)D0PQp@-P0P`0*Â$ @P uT00PU pwp 0QP'P- 0S* p@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 Sp/p?o2?=XA-$@0S00â?P4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P  0 BS0@( p`0,,0A0C1!0 00`S@( 8XE?*0p@-B  80 P Rpp 8 $ P R  Rp 00Sp0!Rp$Rp R d1Sp80080p080$RQO- M4|ڌ`ᦌ@Pu 0㈰(ឌPp,q ᲍PP0` Y4& 80!S0` ``pX08 0 T``0a$ <@0H0|0L P08 4!\08 `0d0h0l0p0 ЍP4- `P' 0*Q- Q80 SpG V P  PʪP Ѝ ᅎ჎၎@ Ѝw A-0QM@PP(C p`QAR   B P1 \.X) P$,P@PP H0 DH00R00D p0$`P!b@0SЍPЍ @-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI tL1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @|$00@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ04D@-44@M00 MЍQP-D00M  ( @05Ѝ@P8 /00@-MN 0N00 P@ 0 0E DЍ0QPO-4ŸDM PPhlpt@x` RK SL0[ B\ 0CQ@A PDPU A@A\UQA PNPU[[H p @D11A0100!0lp,00@0@0-*@0l @ V 0 000@ [@: 5 P Q [@* p0pW  DЍ 0Q0 AAxO-PDMlP4 (0 X0,00S80 S 0( S@@S@00CS@@h T4 L,  p04@^00^0\00S@80<808080H0DH0D80PX8EXC8UaPEA8pp00 8 P(@T ^K00AQA ,0 (0h&h08C8S6 ,, P (@^ @@P8Ph4P XEXJ^ Nh4P.P XEXJDN^( n@@D ^, 1 00UC@0<0ppp8`! 0!1` A S `1 0C8#820C8#8S弱 80yD 0S 1P 0xX0EX UJGx08`@5 0@0@0@0  00P 40 0)4 0@0@0@0 00LP 40 0@08@0400S@0@@0 0 (P !R 040 00@ 0,@   8P !R 30 00@ 0,@ T!R   P 30 0 @0;@0  00P L30 0 @0:@0  00P 30 0 @0:@0  00 P 20 0 @09@0  00P 20 0 @09@0  00P <20 0y @0;@0 004P 10 0h @00@0 00P 10 0W @00@0  00P p10 0F @0 0@0@ 00P ,10 05 @0@0@0 00P 00 0$ @00@0 00P L1S 00 0 @08@0Ѝ00@P L00 0 @00@000e~l\|0@-h@h0@P M006S 0  Ѝ0(0 000  Ѝ0@ lp@-APQ@`: Ql1000S 1Sڸ0  @T @TU p0 0 pp1S1)0C8( #80B0C8#8SB 1Sڸ0l0 00:h2P000S  @T 0 0t | -M 0ЍG-P @$p(P `?LH\/ ONI ^pGPE ࠡPJ@($ @ 0G@-B2@`P0 M@0 !p Q,  !1pP0 0 1 0@00 @0"! . l!OP6X10 R00S Ѝ@,QP: * Ѝ 0pP0 00 0@00@0 0 0T0 @00P@0 Ph0p PX0 0L 0 @08@0  0pPl~|~\G- @Q R`Pp,010`, a 0  G O-p/dM h? 0 P0:3S0D?@0T000 0` `Q0p@HDHT , Q   0 8 @8 @ @ >0S>@|> 0000D0 P00  0S @ PV80@080000h0S 0QP p0PXEXU 0, a  d  =0800 RP8p0P XEXU , a  G  0P0`V#= Q00@ 0,0 (B( R TQ00C^Q~ 0,0 H P<,S000,0 100 JQ 0 0\ `0Z/,0 0,0(01V00  04 S 00p "0H@0H0|0`ps L0[1H0000 !0,0000,0 !0@T0T 0^0^!C!`@DT BڲD\PLPLPU0P4`P,PPP x*P R RT@DP $  Q0C0P @0T0 P3 0 @j0@0 0$ `0L00S0R0S0!/`V 00C S00S80   p  !0QS0!Sd 0 S  `800SV0A#0 0C0Q  0 0 P\80 p`dЍ!PC(8`A0$L@@@` !?3 PEUAD ?P 0L@0$0@L0L0N 0Pr `0S@(0  0S 000(0 0 S(00 R( 000:3s <  R<   VRx0    p,0 0RD,00S?00C S 0LT 0 0T C BR1D6 00S0X *1h"0@P 860L 0 00 0  , 4e ` @%0000Si0 00 P0p 1@11YX5X0 " m 0S` P 1 @11RTP@U0S<80p;@`40 0 D@l@ 0@0@00@ XX0ߩP0<0I@D`$ R00CQ,00 S0L,00D QA @P | 0@H W L PD D2 D | XpP0 0`0SV 080  000  00S^ 0X *1h"0@00/P @T2 00zP0 00SiP000S000 0080@080@ @- 0D U0E000 R 0 R PPh R{dЍ 1y 0000V00C000C0|80800 ,R0400B,0Տ 80 ` ! a , ^@XP ppX@P wP80 `04 ,PR,cJ0 P  Q  p, @Wp[@ <|0 D2Ļбt(̯8l[@p 6P80 P0,, 4B P4,@XE q4EHP PX  \40040R004, BCQp800D`,040C S$0/ ` @@p P10C4(0@<Z ,,( ! 0 B0S @ T PN $0ZP@$0@T<`@ppGQ00CW00@ 0C[T)800, I y 9 P,p0, P\ @ 0 05000   p pPP1U@  U@ jP80 Pp R0@D`$0 80Xp0,, Pp ,04 @YQ $4 zY $R  0D  40 p40g  $ 0D 000$Rf  4P O000!RG ZH804UpP:Wx W@ P ~@DT GpGGE@p80 00:$40Q  00 0,p0QC,0A0R<0@ p@`8`( 4 D <0 K  [ [ R !0 Q e, R  Y R]ZZ)0S 0 RH`AA LD ,HL XL LD `0B0 BH B,!! p 0 0C40[0004,0 10(0, 0R(0(00P0,@7   000 \n0,0 000 `P440040)@`Z $0 pC00 0 0W0YP$ pQ R$R, $R" R8 ,  Q#H5S  ,  8 @P @0  P0 0p30 P00P  #80`0 0 B0P0 0, P00 p  0 PK D0[HQ R dP  P d1S  t:P  R d1Sg0D  @0W  p@0 $ 0D JW000Pe 4ʕ0 00S @`PH@U HePP `P0 0H`WvP `NP  R Q RY$R[PU0 0P 0 0,< @0 0PpW,0 PC000P 000PB   Y 0 MH5 0S0R0S+ 0, 0 0 = @0 0HP8WH%R 0 00, 000 =@ P 00 `WPT p RQ $R$R R  Q R; L5S? , T> @P 0  Pe`0 0p0 PX00Pl  80`0 0 B0P0r 0 8 ,  Q0,@00P 0 ,000P 8  T P$ K ?@ 000 000P. 6 10 0 0  s R- W `L1 @0 0h`WP 0 0L\p1S7 W 0 P@0 0JpL5S% 80, 00RW `p0 @0 0L1`H%R0 00 000OlA-`@P`M4 0p0 R    8VxtP0 000 000P 0 Ѝw80 D000 0 B/ 0C?0Ѝ0 00DC-鬐M@P 048! \` d0hlp`PpjP?80  D000 0 B0C 0/? 0ЍЍ@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT:#80|0`p @V0 S00? Q R!R0 S  0 00D 0R" 0R0 0#0  @-QR ^ Q QR 0P //op@-PP0 @ @T $U0` VP ` ~Vp`{0P 0@PUpT` @}T @pp  ! !@-@P@}T R/A-p0,SP` @T @}T0`SP R0Q/ C0A R "" Q/p@-`Q-P@0N R "" ^ R "" S \ 0L R "" Q\PV@pp@-@@@0S P$00C$0jO-:z0M*p$P( ,pP \*00\c S@@s  nRXan HR @@j`40IS0c0@T ^OoB@TP AA  RT0)\ 0  |  bR\ \)` R&L) R! CP'$I@, 4R S[80S 0P0$ 0B$0X @C, 4R CPg S ^\ l( 00Q L80, 0@4(0RK0$$H 0@0( $P)0S700S00l0S$ 0 S! , 40R$0l P, 0S -0P0$@P$T70 R(,Ѝ 470( u$(00 SBGg@`X & (00 S4$&P0C (00xP0S  P$00C$0G@p& 2 d60,@(@0 R 50,60, 40RofF`@ 0 0, $P,04 CS (@Rf 0 KRbڰ5%0  p p @p% 0(`Z ჷq`nR `F(%` V ,00P0S |0P0$ 0B$0X@@aV  @ Q[Q $ 0(@0C,00 K[Z pH40,0@$!,1010zd4`000 P ^$ $@$#@ P(@h0 Rv ,,Zq  P+ x# d l# (@$@ ?#R W( , #\ $6 (@  P O0(@$ R  P $@@ lP " ) 20,  , l40 S +\ (( H20$ ,B@0S 0P0$ 0B$0 $ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S  0P0$ 0B$0@,0%A@0S m0P0$ 0B$0 @,0ꔨxhH xȣ040<̠pxОLO-lsl3phC@00 S M  400040,c`(,P Zm34@3`0T&#0C S402PK袟  [0@DS(00S00lP 0S 20 07 204@,P0T0hP \RP0 @P 0( 0CS P 20 0 P1040 ,( Ѝ00S00h0S00~1 0T0 @P,P  ድ@1(`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( p0  04@SSCPE@D4@P,L 00SL004P@0؜hlp 4$@- ,(4 00\@-  ,(4 00(O-x1x!0 p *⨒YX!X P!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 00 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/G-MuPp/ 5` 80s2  S̠\D Pr HR!1S45@050 50 `\Pᴖ 40 00P 40 040 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SJ\Q*gnSt@ Q _SP9 Q ZmSV2 Q iSPV+ Q `jS`" Q _SP Q kS` Q[PS 0Y[=20  0SP R!=-pRt000 0S@"R 42U8,Ÿ= @0A00+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  YPUЍY 0   0 0 00R0  00!R 0ʀl2 00 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf STc,TlPi\1P0PP PKPK 8 QD\B@- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    //,|^1P0= 00` P7ʀ :l“3\0 /@ P0000CS000000000000000000/\tN@-@P@M&\\ Y #3t P P 00 E000 0Ѝ8l`P @-P\P Y͌# /p@-00  |00S d d0 8=0!D00 R tc,Ԍ@-$!$1 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ A\  @b, ( 0 000:h/p@-A1@`P0M*l"R R &Ѝp   P 00 00@ 00 @ &Ѝpx   P `00 0L0@0D 0@ @ @ &Ѝpľlx02C-00$RSP@ M "2` @  "0S 1#{0 Q  l"R R, !`@ '( v@ Ѝ1=00QM0SJ\1`20lL10 0J0剑Q:20h1=00Q!0S0`20 00 0*0剑Q:20t 00 00`0`60!Q 00`*0!Q ꨉl0 000/<p@-x0x 000@00CS0 S 0 S P00p!P00p@-0CS@0 S 0 S P00pP0p@-,0, 000Pu@pp@-Puu@p0 000S  @-@J Q P\,Q    @/輹D0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp0O-3$MC0PP`@ V 0upP 0h#0C S-000$ЍpT0 S80  2 0@Ꮿ @D BT p`$ЍIɟ,0  1A!R 1A0 CQc(^01H1H1PWZ0!! ! :  J T0@ 0?Z 0q$P@ `SqP@+  T  @ PW(0p SCIWC00 (0C\00Cb$Ѝ\ X@ @  D0|0;p H0@D002 T `V `OsV ``  @~|Է(0 00(Dp@-@Pppp@p@-@80800P  @ppp@̳DO-P6lM0@P,0 f Q 0pt`P~] Pp0P0W W   0<0P 0R 080P 0@SF00800`P0S 0P 0 0PEPUR 080 00PS0P<0; 00 5 000p`P0 @R <0T R8 . 0<00800C?80sP0`FsPY00` s, d480pP p$K 080 `0p`8ppP P08 E<,QpQpP Qձ4pp( X< R!! B qH" RW`!: pGTUH0< S8 8 (P4`< @p$0,0 1400H0@0 @0 0DPU<$0 (Q00C a0 Ss 0( 0C04 Q00SP{ 80 0C s2, 8 P I000 0P8p0m08 o800C?80rP0pGS00C0`FUrP00C00p000P0 0PS08 F!q Xj 0 0H000尡H XD0|0pqlЍ80< p` 0T<0T pR0`<0 yPo 0<qlЍ`Dqꀳ0 00 [Dp@-`@Ppp p@M K00 C갬Dp@-@Pppp@ 6p@-@@ @  `  @Ppp p@ PDp@-@<0<00P  @ppp@ Dp@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``꠫O-ܑMS D@HP 0T p `@ 0Z  A 4/ 0[ 8 $[0<SD0.S00#10>P0 0@0 0}00 P  0G8#8 S R0 0?{P4/ZXЍ0G\  8#8 S R@0p0]pP4/pWꔪQ# @-@ RM !R "R pPĜ\  00@`Ѝ/0Q # @-  MS S PpP$R ,@6Ѝ/@-0@,M @Ѝds@-@044M0 @ Ѝsp@- RP\\0N ^\1   %@@ _ ,\'\ { X"LB!!N0 ("!! L}0 p% !  <{  \@@ RA 0BP8dP P @@  T0 B! { c\ "0  '  p  o %X  +p {o\\:\   ꠦQO-$M l/ 0 w0`f S` 0S0\S 0 Sa0 000ꠣp@-P0P`@0MS SP!  00 0Pl 0 Q00Q H  8 x0 Ѝp,0<Dj0jiiA-@0MS0D0@!0@P0S? 7 0 !~r!!`"bNL LL 0 0210B qP `0 pW$P@WP 0fS|PЍЍ 0Ѝ8NgA-@0MS0D0@!0@p0SE  0 !^RRN  L !0 120B Q4P `0 pW$P@TP 0nS PЍ"0ЍЍkLx>G-`0MS00! 0@0S[ z 0 3`1` I $L0!b!bI4ቐ გ1c1cL0 0Ã#3cl 10B qP P)0< X" pW $@r0sSP @WXV @T oP&PPЍЍD-?L*S0 O-TMliPPPR ,$   0 : 0 @P> 5e000` 0: @P 0S  R 0Z I #Z =Z =dP  00pLP0 p WZp  0 0X*Sk0P0 0S0, 0  ZP  4oY P k0q,0@  0M p3$ 112cAT3112c B L0L,s0'pr!qpC 0P q 0 p@B `@, Hp@W 0S  n M= 0PP  n B@WP00TЍ 6  0  "$p΀‚ €衟‚ N G !1 qrpB PqK  @:p   0d1$  0K $$N04!b1c$$!b1c 0N Kϊ 00  0ɉ)1i1c1⃐BXP㉑ 0tS0cS0Spp~G@ < pPUY j00u,hNgkL>-?L *SxA-P`p0\ %\0@pS sS lS P0\UUW 000@1CP0PCV` 1E! 00O-̟qM PQ P` 00S040 p$ Z  l@H P Z 1  RS G> Z P P 4 Z %Z%Z400 R,:@iP 400@,%,d+P p` L˟,@ 0:ZAZ JQ 0JPPp0-00 >Z A0J =R* =S00C?QRp  Wp1PW -.R0 XZD cJQ  Rp PA0JlRpY PA0Ja0J Rr11OSu 00qߍI@[/gP 00040zgP, 000#pRp  Pp1l X   QU PEQQQ W! 3400`P, U*R 0 Vp 40P040 P PPp1  \1SF 0C111SC Z0! J 2 ( R'Z OP0S'Sl 0S'S'SPPAT 0DS11a h7@D!&J0AqVZ ຠ `OT` a 1l!01ATf @DAAAa0J RA0JS3J Aؕ 0000 0 B10 OQ4 }RRT0  R}R}RP!RV 1h BY!r P`!`1,` Q*P  0ᝅp^ 40040i10J Rd1lp1OS!!0l1PUAT @D`1AP }OT0a11@A?0Sl00l0 0St00t030S&   ?R ;R P0S %S0 01S3 0C11AT0 400 Q,,*P  4 @ , 40,0PPp1AA0JS30J1OS!l!011@b00@`xgPu 400`,Vp p2lg Pi 400p, H000S   ?R ;RH eRQ` P0S %S0 0AT @D1A !OT= `V ᪣```&``VP``P``ü`@oobP``V ``@Q ANQ AAT @D1!ZAo!᪢Vp p2fP 400p,PY00!Jo0 0媢0`0001&J0GZ @pn0`00000,0 0|@V``pS@`V`pN@`fpJ@opF`@pBoo@bp=Z' Z V8D-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/&A-PQp@M 0S XD fP `V! 0v0+ V T 00 -PP0T0n 00ЍT _: 0 0 R T PT\I5P0S T`P 8 4壍p 0S R 8(C8B((0 000ST00P ic 8 C8(0P [c 8 C80`T}H,80Pht@ %L00R @-M<0@S  ЍA-pPP U) .@`TV 0PS |@P0DV  P oO-PRM pQ B00Ѝ@ `Pc % Pc Pd `%0 ES  >eP  P p  0PPP0PS  P  0PS  P  0Sq 0S 0PS 뼐Y$ P e$%dP !dPdP 뼰 0$[PP "j [ $@P  8C(CnR  sR fRR0S  V R00000@H$H TP 0:  0S 0C8#80 P p0x  n 0 Y V P`Y 00pa U뼠PZi  L 㼰G 8C8PR 0VJ *ZPK  /PU; o`嫲  $  PEX%XU !  X `*   `0 00 R0V00i0S00   0/V  R000Vd  cP$' 0(C-pQ@!P`M0 r P 000S< @Ѝ\PP d p 0p  R 0S 0KP@ P@" @Ѝ  0 jP  LPP+ P*PP004tF0EDO-M Mp:S$0S:S@ 0PS:S``E[ P!* E `0  kP 0P:S ۍ Ѝ@ۍ ЍC-8B82M@M0`PpP9 0/SH @P 0@dT PI heA@4P 0 ۍЍCD0P  L ⚀P"0 @\ۍЍCx0P 0S/S KP t@cT0 ۍЍC0  PۍЍ p 0acYX H0H 0 (04ۍЍ,0, 0 04CAAG-p`@P  Y0@wcT  OP @\PPP P @T  @0G a fU& L00L0 Ѝ @CP Ѝ@P _ 0S0080Y 08 H0@ HL00L008 (x400H0@ 40 0H0@04 H00H04 0H0L00L0 @H0R ,0 0H00H000, R0 0H00H0 O-0@M0D`[  =Z p 6p(080H0_P; P  `j0 0d0 ἀ^[0   W0 pQZ0 0   I0 0  0 @ 0@Ѝp@-1!000 @S0 0Sp:PA_oRQ@ \T  0SpQ@00p@Tp\SET00 0Sp0SppkA-`p PPU@M"R& _P !0P ᴀ00V0  p   0 0 0ЍPЍ]^ p  O-`0@ 4M 0 "P p`pZ6 P PF_0P  0z`pP|@P P+@@_Pe` 4Ѝ eZ` X`0, Y 0(0$0,0& PX@,p P, PAR   0S00UPu Y  ;T㼂 4P" %` L@PX@ H D L F ,p P$fU6  0 P- X;  BHDXDnUDH sU  "0 S   ,@  P_ 4Ѝ  B P$_,T@[H;[@PA-Pp ``V@M(R, ^P$ A0` ඀ 000P00 0 0 0 0ЍPЍ&]@-0P pW@` MR ^P 0 `g0  00P 00 0 ЍP Ѝ\0O-LM<  <|*, , 0@P |CP0`|0xPP p00 ZPdV PI9PdP]PP @ @P  W 0 V 0,P / p 0100#$0\90400 0Iye 0s 0P^ ,P 0S  $ .S  ROSF = P# @P[ }hFhv 0n  P Db[D0 0SP P+ 0 ' 0S v0 ( 000  00 n0RP^TPLЍ0TS 0  0 00=0S (0(W8 (]8 0S! *@0@S* Hx00 0 0f0 Pm[N (p`@V 0 Vp 0P: '\VQ,W%U^VP< P@U P0&0HS y  0iP (p20 FQ4E F/R)  p`V@ V,%`  @ ` @ T%,  / P P``P p`([8 e@T@@B`  4X Y0 0IP%x0  80c80P p `P P P P P P P 0  80<80P P?U P#v 0 S00Pp@` 0AP<, ,0  80 W80V0@A T@@p`F 0 0 0000000s0P (pX@ Hx] hFhv9 @0n @PC 0S00 <P9qPVVp P:p 00 F(p ၘP00gP hFhv0 0@s 0 P0PI 0  S0 x}< \LЍ 0 Mp  i(00 ]h < `Vp  ,d0tP4P/Q$P00//x0@-MP>0  0^S!1l!1"b2cNL 0@@0$@B!A@C0PЍ0赁Ng P0`0K?//p@-MP0  0nPcl b N00PEK 28@0$AB@C1d^PЍpkL(>$0P00?//p@-M`0  P0ec`E $`L0b!b4!b E|@R1c1c@L?MD@D 0P0@$$C!d!b8A@C1PЍp-?L*Sp@-0P0M`2#@P 0Ѝpj^, 0 0S Q20ЍpG- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00(&U%@-@P c[a[_[ ][$[[,Y[W[,00!R  !$ 001/$ 001P/ P/p$@- M`p P0P0@0Ps WP 0ţP Ѝ 0@P ЍSpC-@P,MA!`n``HXp@\ X" $>$>"!00,ЍP P =00 00X0B; P P ~P =00 X 0"' P 0cP0d=00 00ˬXj  P[ 0cP0=00X 0 0E"P<<"P 0cP0ʰ<00X 0 0"P 0cP0h<00X 0/ P cP   \=X`p";" 0PP _0cP0-ʠ;00X 0 |O0cP0.h;00X 0";"P <0cP0) ;00X 0":"zP$ )0cP0i:00X 0V":"gPC cPʐX  0"TPx 0cP0GH:0I? 00ኢ PT;9X" :P 0cP0190E? 00ޫX $Pf 0cP0kʐ90A? 00ȫX P" 0cP0<900X 0"8"P} 0cP080t0X 0"8"P 0cP0=ʬ80l0X 0-"<8"P 0cP0d8000X 0"8"P q0cP0800 00X"  P ^0cP070 00X": P L0cP0wʐ70W?X 0d"7"P 90cP0hH700xXB 0 xPw '0cP070S?X 0"6"ePI 0cP0ʼ60\0X 0"06"RPn 0cP0t60P0X 0"5"?P6 0cP0,60@0X 0"5",P 0cP0K50O? 00X" PS 0cP0&ʜ50M? 00X" P 0cP0T50I?U 0 01X"~ P 0cP050l0X 0 "\4"PW 0cP0ʸ40d0X 0"4"P y0cP0p40\0X 0"3"P f0cP0(40S?X 0"3"P S0cP030Q? 00X"$ P @0cP0ʘ30d0 00X" ~P  -0cP0P30E? 0 0"X hP 0cP0w20t0X 0g"T2"UPY cP!Arʬ X  @P 0cP0Ad20W?X 01"1"-P 0cP0H20P0X 0_ P  0cP0-10\0 00X"B P 0cP04ʌ10d0X 0$"0"Pf 0cP0D10l0 00X"[ P  L0X"{!0000`000p04Sp\hGh?X t \x,Ll <Lhp$@l4dTD l\$L<,dTdTl! @-DT?0 ( 0X"!00 10`0 d0X" "00410T0 0X"C"00h1004 0X"n"001080_ 0ڨX!0010Y?100[ Ph1\1X""00(200420K?@20G? 1X" "00t20|0200220N? 2X"!0020h020= T2X"r!00}30p0 30R?( 2X"`"00k@30U?LSX30C? 2X"J!00U30p0300 L3X"-8!00C30U? 3X"X*"00540H0I 40K?~400 0&X!00X400 4X""004004006Xf!00400W400f 0X!00X!00 5" 0gP#Xk"00N 0ŧX!0050050h0y 5X""0060Y? 5X"!00860|0D60`0P60G?h\60T0h( T6X"r!00}60h0i"00td!00o_"00jႁP1!_700wK!00VF"00Q<700V="00H8!00CB/!00:*"005%"000 "00+"00&"00!"00 !00!00@PX B"P  t8L@P 0P 8"0S!000Sv !000S !000S !000S !000S !000SK !000S! !000SE "000S !000S "000S !000S[ !000S y!00Pb ~0S k!00v0S c"00n0S [!00f0Su S!00^0S K!00V0S C"00N0S ;!00F0S3 3!00>0S +!0060S #!00.0So !00&0S+ !000S !000S "000Sr "000S !000S !000S !00<00<00"00"00"00"00"00"00"00"00"00"00"00 0ÍP =" 0᷍P5">"1> 0 0u,> @@< 0+ 5 0 0/40 04 @@ 040 0qp40 0oH4\0 0!m 480 0k30 0k3 @@T 0~ 300 %t!00`30 0f83 @@.P 0XU300 0N2 0 0D20 0:20 0[0s`20 0z&82|0 0O2X0 0!001 0 010 0 L1 @@ 0~L1 @@ 01p0 0u>0L0 0~0(0 0 j00 0kt00 02.L00 0 $00 0e:(lDlDpL$Խ\ `8pA-t ANL\0@Po\.DQ 00P \QHTL a`0 # 0-3\ \/ ANN1 0QU^46 0b0#6(7(0Ta`  0 A0ܽ /2G-0@P Q0BA N `@ƌό@0pG/p0PϠ B`@T 0 P\Q \2 0C@PU 0. R\B\A ! QI%RL:  H  b3Ό2@XX 0z 0P t` 0` 0徙P tP`P@P056 0e 0H 0Q 0Yn?P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BT@! V @D 8,0400G ,04 00 @(0( 4/P840,0S00 40Q 0 @-P0 , IR 0  H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0P  A,00040q@aR 7 8S1R  1PA-@ 0`S ! ($ R  3/PP! p 0P@8p0P$0(3/p@  $ 4  (0 0/'4? 0 P 0S $0S 0S P? @4@P/Q < @ Q@ P@-@<!,< /O-/? 0000t?0$ R&4000  0`@`>0U 0PEd@T$0S`0  0@`>0U 0PEd@T$0S  &$   0   0c 0@$ `R`p=0Ut 0PEd@Tf8`x<0U0 0PEd@T0S` @<000<0LQcD0*; <0\0T  0T :K0PEd 0@SAU 0P0,P0p 0U@@ <`D 0S\ 0TS5 0`PCU0`I00000 00 0 0#19@@ 0S03R0 TRR  4,00`VS[*p: 0 40 30 <Ѝ QSQ 0  CbP 0S  0  B0S 0}0`0`I00U 0PEd@T 0  C0R0!1000 00 00S9 0S 0Vt p90q?0:00 0Dl 80B4 R,5@0 000 000 DQ1 P !ADL B S000D0S808 UR000 0pP <`@@ q0$(pS0 P  <` *@@;,TU 0PEd@00 S  Sa@D S700@T6c0PEd@TUL\70Q H0 @S0 0CR**+R~ T70i?070  Q 0SU 0PEd@T 0S 60w?0X70U 0PEd@T:0D10*D0 @D6adh0l[ X0P#$U 0PEd@ 0S\6c@D0l0[$l6 R` ?0S50E?0<60UD[L U10[![l 0 PE C0 p 00D0 0CD00i`l Pv4T UN 0PEd@00Rl @Da0_ T 0 $ R40,0000 6,400U'  PEd@T   !R H40d0040U 0PEd@ T:H00*H0; @D 06l;  0$ R D #  $ R D # $ R$# 0+R D U1![ $Q ^ LQ0Q 0 ! B0e0  0D PE B pD R000 R=0X U 0PEd@T20F?o20Y$0S 0   h"L2$&$B0#22cR0S 2000l20D10PG;6cD@D10 Rq  B0 D  0h10)@`Ud 0PEd@T$0D`S`  0  @D`+kUK G$0S  $P (D0 S2D57[U0  0 $ 6$ [PEp(0? 00%?? 6?7?8?=?>?N?P?5?J? M?H?A?L?xL\:?;?$ <Ë 1(00^y(,$ 0PEd< 0@QrU( Y T2a00@DS L D0B @2&8#[ 20002093 HL0:P;6cD@D t 0;=0 ^ `300DSt30 @`30x00`3030)6c0D@C c PBl090r0\ln^PEd@^U,( 粰*@D6`'R h 00P0l00X0S>0p0T0P0?0X00 p0tP 400 @{ 50>040f8 0X⽿p0P0tp0 (0$P$(0/ 80O?080Ꝅ80}?080 0cSR: @3 0@l0%49@0A( \ p T d \ h P 90V?090a@ `0S908*p@-@PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S     0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-T#T3 0 M000P@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 \2#p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R0*Q  R*0Q  R:0l00p0C0l0pSp)x0 00 0P,04C0p0 p0 0 0 30 Ѝl0Spp l0@@@ T S???pP 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pXpW`P 0`!(3/@P] t!:8pW7  ( 0(3/pPK 8 v0!rP S>0R *p  BS>00p00 8b8p@oRS B P T W B T p 0Bpp8 Fp BP S>0R*pS. 0A pp oR$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰPX 0C00$P $p`0 sRpW-0p  p0 Ѝ0` Q`V00pJ\S0b608#8P0X 0 C∀0S 0X\!\ ! 10 T" Tb T 00,0(00040080 00 0 00C$0 B U@\ q W3> BJ  p Wۄ2  B37RN q`36 B Lq`36 BC@g  @PKU 2@EAa P%A0@  2 `"<0@ 4ЍP [P1:  \X8@p`0 pW`6@^ B37[`pNV*jkV`HV$+ `\``\pWLNW\NW`Np\ \2Wۅ  >`V7*pG(p\ p`$p`p`(p$p$p@ V(`$` PI:`@`````^Lp\`@\j \b$`\``$(@$$, V,(`@  $$(@$$, VpLF$(0$00W\(0`@]mQ???(|@-LD, qR0N80#8\0@qR0N80#8\00 6O-,Pl0AOE@DS8@$M@AO<00x00@@D@^00S| Pt0`"!!^!@p4 0TT* RR 0 P^ ^ ^YY  0PU<PU=PU>PU?PU@PUAP0UAPR@oPP 0CX20;(8ӗ1Ӆ1&=ftPxl0PAPEN NxtP0NPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPP`l h\0S8 B0l0\000S l`IP0` R P lp#p  G R ` h0S:l R1#P0 6SH \0P8 Bl0\00PЍl08  : RƃPƃPƃ !hP\0P8 Bl0\000SЍ(O-xj P,M`t \l 80H00XT0#D04@@QH0  ,0BA?C0CP`PƙYp00B8#( ƙ#<0ƙ@30 B0(1I>RX30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80X`TptR` l H 06#0H0Xl \0P8 B l0\000S,Ѝ806&6 &!9096tl L Qtl \e 1t0 S` R S; SY`l r *l `m 0D 0 4 @0 0A$H0   @`@ Pl @!0P PH0P `   @P$ll R1#\ Q \P80 B0 l0\0n0P,Ѝ\P80 B0 zl0\0[00S,ЍO- ,0JZ!Q@o00`MA0P0 4 CR U   t p 0s 0 0B 00%C00 A #4 0BV U`1\08  7\ 0 0 00PE0C0000\ UW0$&* Q!A2:\ l``F RP!P1UP! U:Rpp  W 0 B0 0 `V P ,8^L0 6A,0 l0&\0`Vp Pl0&R65W06( `&0SZ 000#400q00&0SB*0 B000 B00,R 50 00+Zt 6l8&`6&6 &!909&tl0I0Qtl0" YFt0SW :W㴖 6S \0l S 8 B0 l0\000S\ R8 C0 l0\000SꄣZt0(l 8`R B  ^H 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l St0 SW S Sl 8`g00&0  W c0S~[0 B00O ^ ^  [ [ [  [ [  [  [ KoP᫲[@ `S`1`05:P0@&ƅ&0 !ƅ0 01I>  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\000S8#  #800#"0 80B 0 0 0 0 0 S0 S00ӈ R01q 00  R000 060%*W6B &R \ R80l0 C8 0 B 0<PL0DC0C PKt0*SVyl0\06Z0Sxu\0l S 8 B0g l0\0H00S20]\ R80l0 CG-`<pPVq@PD Q00V0SK0儐S< (0s T Y 1@0@!A00000 |0 `Zp* 0S,t l00\ R&6S S L D 0 BⲐC Ȗ060@D0 0!1 0Rppp@-@PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS $0Sw wpVnV`F0HSw0FSRs WqZoFo[㩒YhV 0!( `3/@Pm !:0*@1PXL@TA 0`, `4(P6/ `,8(6/ `L@(6/0jD 0(Ė3/68 R! ( @ R% D PR! 00C60p删$0 ЍOv `fp00$0`(0 y Ѝ8 80  000" -M 0 0 =ЍA-PpUpWm8 `! 0(3/@P` !|!@ 0 ,(P3/ 0 ,8(3/ 0 L@(3/z 0D (3/080P8 @ R5 D SR1 Z&86@S@, L DD  00C 6&&-> 0$+0;l0ƕ 0CS /XO-Q M Rp 0 R 0#01,#0Pp0` 0  0 + P%*0 @)0 @$0 q0B0PQ1;`,:(9p'463041 R P%BQ` 01 0 0# Q#4,!!01\!#00#0#\#4!  01Q #0P%0%x 0S,!R4@0HSPS aS,d&P%PN&, QS,T% S%, QS,T% S%, QS,T% ^%,00B0 R | 0 0#01 R,# ЍL0#20S!B2PpvX]hW@@0 #406 0C00k6 &S0k. 6ςO- 1 p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @ O-pj P`50 0  0p0S01YQ ⵏ 0100W0Y0[ B   װ 0Z.061#60S\+ ೎LY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0P 00U00S@ T R 802^02N00 R0@ T<ЍW@  |xP 01LY 1R 6 G2#6pP^p N00=G-@TppR!ಐ0N+m^\dT( Y!. Q =^0p R. \HANpR 5 ^0@ Tp5  \ ʰ Q ^0 Q ^0 Rp^0@Q^0p ^0@ Tp@@  @O-鲠MZPPRt0+!  k ^pZ ἖` S 1>@i0nh S&hU0N P` `P`,ĠƘ lTLh&h἖0@0lih S&h 0P``0P`#406L0cTCh&hN\.ƈ0̆@ Ƞ,ȠPP0@#4PP 0Ƙ0l^h&hLW`ƈ7 W0@Q `W Q^kp`徐v0`i7W8`I#8 pp00p0#40v0gQ8#8p\0v`pV0@S `Vp0@T PpW Y0*`p ^F @0@Pc UYX%X@ 0P`P0CP`P%TPV0PeTEH$H S6L3@P8#8k`0`0@0P#4``06W@c\Ġ 0C6D0@Qi `V pm 0@P9`d8 V#8 @`0@D0`0#406@0cUS8#8 TFS LDPH$Hk>`@`@@P.``W@n\Ġ N 0@Q$ `W*0@S P palh&h`@ p0T0 V4 p@` 0@SЍ༖ N.CkΈ0W@6 N.4kΈ@W0Fv P p'0@S P p0@S  Pp0T 0W `@ 0 OO-ʀ6MS 4004`003k^0 0300300 A @b98 T#8@p000@p#406 B 0c^&6S0@ 编0$` pḀn98 Z#8 0N 00#4 060cX8#8qX tq@DH$Hph>W8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಀph>8Y#8H000#4060cWs8#8 p0@sWz `D B("(>@g8T#8?@000@#406pGp0cR#6 Sv\kN&0Pn28R#8  P`0`00 @#4PP0&N0bQ8#8 k0&Ѝ 0&0p0v, `PPP@P4P(P0 0@-( ;0,8J&̀k $ˀ0 G&&)0S0 0xS0 0LS0I0&&&&A-Pk΁@`&8#8 R   pp "$ &bS0  Bk>& 0  8#̠  4##<V0 0 000*6p@-S Sp0k@@6 0C6pk>@PP@@!PPƂpp@-k6 S#("(00@P P 0 #4@@06 c\  ("( 0Ck΁ S 600@PP  0@@@#406 0CS6 Sp0k.@@6 0C6p k>@PP@ @"$PP ƁpO-0 QR@ M[, R 0+p&]%P+(+0N  q/ ! RH@P jƖ  \& R Q3 "[&kΆ 0("(1 Q8#8000#400aR#8#8 A+ QB Ƞ(,Ƞ!k>0#400a\38#8 A Ƞ,Ƞ18 Q#8k000#40缦0j\38#8 J Z㼦@ Ƞ,Ƞ!k>0#40缦0j\3! JDM⼦k> / ! Z! ! 缦jR!! J^ἦ 1 . Ml  \ P+R +R ,RE R  Q ,\3 "[R&k R0f 2 8#8000 #40&0bP8#8 Bdk0&N.V 0G. 0R0 0xS0   0LSI>X&&&& Ѝ R3 "&][Pj 0 ЍOc @!:!<18#8!28#8 G(E@C:Ɠp@-PV Ɠ!DPV @Ɠ@QF !6@opƓAƃDQ  !I.Ì!ܕ"܅&  HA0S A-P p@0 C`0@PTUT @%P 2%/@- MP`p)@P @   Pp P * @P  Ѝ 0@0 Ѝ0@00@)T  Ѝp@-P(@P @@p 00p@-@(0P 0000 00p@-MP`(@P @ @w0 0tPp )@Ѝp0@)T @Ѝp0p@-S P@0 C`40@/PT 0 p6%0P@p$yara0p@-S P@0 C`0@ PTl 0 p%0P@pk$tcid0S p@-`@0 CP0@OT @Fpp/0S p@-P@0 C`0@OT $,0P@&p0$p/yara0S p@-P@0 C`0@OT $,0P@p $p/tcid0@- M@ Op  P Ѝ0 Ѝ00 0 Ѝ00@- M@ Op  < P Ѝ0 Ѝ00 0 Ѝ0yara0@- M@ {Op  < uP Ѝ0 Ѝ00 0 Ѝ0tcid- M Ѝ- M} Ѝtcidp@-@ PB$0PPptcidp@-@P6$$0P p00ploobp@-P`@P  =0@}#p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@% @-@@B @-@@[ @-@@t @-@@ @-@@ @-@@ @-@@ @-@@ @-@@@-@@@-@{@,@-@u@C@-@o@Z@-@i@sp@-P`x @P  0@"pp@-P`f @P  0@"pp@-P`T @P  0@"pp@-P`B @P  }0@"pp@-P0`P. @P  i0@"pp@-P` @P  W0@"pp@-P` @P  E0@"pp@-P` @P  30@s"pp@-P` @P  !0@a"pp@-P0`P @P   0@M"pp@-P` @P  0@;"pp@-P` @P  0@)"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P0`P @P  0@!pp@-P`| @P  0@!pp@-P`j @P  0@!pp@-P`X @P  {0@!pp@-P`F @P  i0@!pp@-P0`P2 @P  U0@!pp@-P@,"(0P p 0P 0pgntsp@-P`@P  20@r!pp@-P`@P  !0@a!pp@-`P@!<P p P U patadp@-P`@P  0@7!pp@-P`@P  0@%!pA-P@!X0P p#`P  P `%gntsp@-Pe@!(0P p0P 0pgntsp@-P` @P  0@ pp@-P`@P  0@ p@-@R 0@ p@-@P`!$0P p00ploobp@-P`@P  0@ pp@-P@P 0@ p@-@@ @-@|@ @-@v@ @-@p@ @-@j@1 @-@d@@ @-@^@] @-@X@v @-@R@ @-@L@ @-@F@ @-@@@ @-@:@ @-@4@ @-@.@ @-@(@. @-@"@G @-@@^ @-@@u @-@@ p@-P`@P  '0@ pp@-P@P Z0@pp@-P`q@P  0@pp@-P`@P 80@pp@-P`O@P  0@pp@-P>@P 0@pp@-P`-@P  0@pp@-P@P 0@pp@-P0`P @P  0@pp@-P0P@P 0@rpp@-P`@P  y0@`pp@-P@P 0@Ppp@-P`@P  W0@>pp@-P@P 0@.pp@-P`@P  50@pp@-P@P h0@ pp@-P`@P  0@pp@-Pn@P F0@pp@-P0`P[@P  0@pp@-P0PH@P  0@pp@-P`O@P  0@p p@-P=@P 0@pp@-P`,@P  0@p p@-P@P 0@~pp@-P` @P  0@lp p@-P@P 0@[pp@-P`@P  b0@Ip p@-P@P 0@8pp@-P0`P@P  =0@$pp@-P0P@P n0@pp@-P`@P  0@p p@-P@P K0@pp@-P`z@P  0@p p@-Ph@P (0@pp@-P`W@P  0@p p@-PE@P 0@pp@-P`4@P  0@p p@-P"@P 0@pp@-P0`P@P  0@rpp@-P0P@P 0@`pp@-PJ@(0P p0P 0pgntsp@-P`y@P  V0@=pp@-Pi@P 0@.pp@-P`_@P  60@pp@-PO@P j0@pp@-`P@<P pP U patadp@-P`F@P  0@pp@-P`U@P  0@pp@-P#@P 0@pp@-P4@P 0@pA-P@IX0P 2p=`P  IP `!gntsp@-P~@+(0P p0P 0pgntsp@-P`@P  0@qpp@-P@P 0@bpp@-P`@P  j0@Qpp@-P@P 0@Bp@-@Q 0@8@-@R G0@.p@-@0 P ! !p@PP!0S !p}!0<@-$@@!|<<XP 0R @-P Q o//%t%P t0, @-H╾H%@-P Q @0ft0 Hℾg0 H}%$ 0S p@-\@`@@ PGPpP p@ pW WA-P`p&" *@P  x`P pp4!SP` k+!U @] "!T Q V$:p@-P @`Pp7P p@-@- @P $ 30 0 0 UA-pP @P   0 0 0 ӹP`P  ` P((0 Hؽ@tUP"/@-@P @ k0E/H!}-A-M `V $P0 P<@PpP  0Pv< EЍAЍ/ЍAЍ/>Q/HⒽ8!U!@-@P m@ $0E/Hz }p@-@P x0 0 0R0 PB0P Q " p@pphS8 p@-@P `0 0 0R P 0P Q " p@pRP/0 0 0R /\RP/<0 0 0R0/P///0RD0P @-od  QP  QQ u"/QP/ 0 0 0R/TQ@-@P \0 0 0R  0P Q L"00QP/00 0 0RP///PA-PPM /o00 0"P R Ѝ R0 0 pp`P 0 S  R L  Y/h; P`   00TPA-@PM 0 0 0R ЍQP 0 G 0p4`P 0S `  PY/0; pP` s(00 [?-H=XO,; P @-/o<0"0 0^ R  R@p/`NP/D0 0 0R /@-P woNP/D0 0 0R /@-P `oMP /ol00 0"\ R RP Q B Q: /TMD8fP 40 0 0RP (%/LfA-(0`SM.P@U Ѝ P0P |pP 00  0P+ S(P0S0"Q00+ ]@P \ 0 0 0 @Ѝ, gP KP 00#0 0 P 0S S R/P/ R0/@-@ /d8.) .@-0,MS/a @! S   P `:` `P )P /,ЍX  ,ЍD P ` 9$0\ x$XJ|$@-@☩-@-(@@▨,\I 00 S 0 P :\03#/S 0 P \0///A-P``~d@P (spP  K@P zᕨW@n$$0 xrH+8H`M 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ |Ѝ00@- @PM  @ nЍ00@- @PM  @ `Ѝ0@-@P ,0 0 0R:F /P/0 0 0R / 00 !S R!* R0*/@-  ^0 : 0P0*  R*/@@/ / EP $0 0 0R //DP $0 0 0R //DP $0 0 0R //pDP $0 0 0R //8DP/h0 0 0R / 00 !R0* /  P 5*/DP/h0 0 0R / 00 ! R0* /  P 1*/CP/x0 0 0R / 00 !R0* /@-  ^ :CP/x0 0 0R / 00 !R0* /@-  ^ :|BP/@0 0 0R / 0 0 S /AP/x0 0 0R / 00 !R0* /@-  ^ :AP/h0 0 0R / 00 !R0* /  P 5*/AP/h0 0 0R / 00 ! R0* /  P 1*/@P/x0 0 0R / 00 !R0* /@-  ^ :@P/@0 0 0R / 0 0 S /?P/`0 0 0R / 00 ! R0* /  \ 5*/8?P/`0 0 0R / 00 !R0* / \ 1*/>P/h0 0 0R / 00 0S00/ P %:/P>P/h0 0 0R / 00 0S00/ P %:/=P/P0 0 0R / 00 R/! /X=P/h0 0 0R / 00 0S00/ P %:/<P/`0 0 0R / 00 ! R0* /  \ 5*/x<P/`0 0 0R / 00 !R0* / \ 1*/<P/h0 0 0R / 00 0S00/ P %:/;P/P0 0 0R / 00 R/! /; P @-/o<0"0 0^ R  R@q/:P/L \ /  JQ\/T:P/L \ /  JQ\/9P/P \ / Q/S/Q\/9P/P \ / Q/S/Q\/090C-M`000 00Sp pP Ѝ(@YP+ A) 0Q xRK ͸ P p'*0 00 0S  P Ѝ訸 P p:0"Sꖸ0"S Yqp  0 00 S  z0"SO-MM(@PqD1 p000$0`0$ 0 0[ Q` $ 0`;/0 `P Mߍ 忔P 03/P 00  $ 0:/P 000 \PMߍhG0A-@@PAL70L.0Pa`L8 0LWL Vp 8 W8T#80O-3KM `0 0@R @@@$@@@(@0 0C0S50fSQ ="SE [Sl2 0 @3/P 0p0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 R(P0/S7 0(00>S: SA 0S p03  0B0SR 0 S S5 S3 .S 0 S S+/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 8% S =SB0"SQ0SN   0"R "R RAC$ >R<0 G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R"@ tRT Ѝ mR8 pR oR sR ;R'@ tR ;R>@P P"Pn \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R<\ BR  ;R<@{  @d0 8d"R /R 0nP 0 +("( R:Y Y +     SP,0 Rg \Rd  uR` ?P Z +  PU6I0     0 # <  P,!*-"-  ƠP  * --  (  " "0  L  O-Ÿ M @ 0D0S<^QQ@`Q  0>S 0 T @P (0SP  R @ ЍT" T& @ P0 S00qP @P T eP0S  0S HO-PMၕ`@PM ,9pPD ;pF 0F fppSp>0 PN0P0|9u%   `p :Ѝ00 P0(p``:`ЍL9`Ao/A-PP P`p @@P@@@P p40,p0P4080<0$@-k@  @-(@@n ?@$@-@@O-4@T p`, ήP @@D¤@`T P礀Qㅑ8080 0UPZ PZ P  @-R 0P< P 4Q ,  4)`0 0(0 0!$#T 8 p@-@M4 00R1SP,0S@R 1`V, P` 0 08P 40, 0C40P" 5`ЍpS" R_ЍpЍphZ<.0ݰPPj?.0ְ<co?.0ϰ$$N?.0Ȱ( y iA-P`,p@P W 0 !,@0`,@0`C-`0@SPpMH  P 00Ѝ!0 .P ,0SW !0 v/P ,0S(0S00  0hP 0S?0S0"S_0:S V0}S "S000"S v\P  VP @X 0 @dP R$$w?{/0  0 4 0p@-S X  Q P@0@zp`0!.0l 0S ,0 00@-?%. 0h 4 @-R 0, B4 P @ 00'>/0կo?/0ί  O-80M@ Ѝ@p`. APP @ ` @Ѝ娒 u \PP0 004QY  4 ,R\ 牱Q1v   P 0YIV  B B!ὗ,0 P 04 `<0 04 <0 [MP,UM<U7U+6Y& xx @ P ? PP( w 70,S<SS8 etPp @ <0P0`<04 y< !i,0P 0YP  |,\0\02.0 LW?/04?/0LD| 2 p@-@PPa0S D  Q <0 0 p@R`0/0خ p@-@P 0`0VPP h h0 0  0@S0<  0pPp `0/0⭮\ 00,PY 10Z/ @0R+ P$ [] P 06P 0S P( Hqp0` ЍO L P 0  03/P  40R1# P P6>/0j 00C 0 P l`*@yTT?/0@+? 0x  , X  \@-@├0,S<SS ?/0׭  PG-V Pp0`WSW@6 404 S @ 2 0S3 E000,0 100,0$ 100,0, P  ?o @ 2\0S0S P@P :  404 SS@  @<<-B> 0p$$-F> 0hx !X 7G-PS @- Y`' T 0p 0R {  004 00R$ uP y 0S 0 G[XXG>I.00(*0,S <2.0tX 1 HGG-PP' 0 0R"py4:`P 4 R @,0儡ᄑ1 ( & ,04 儑@ 0T:804 80[`L0P 0  Q@-P80080/p@-@P?80080p@8p@-@P 80 0R@ pP*4@'pp@-@P \0 0R@ pP`00S@#:p@p@-@P@pA-PP 0 0R4p`40S @40S ,0 P@ `(A-@P 0`0VpP0S P @T <+? 0?@@ A-PP /o0`0"Q@@T @0R p @P @T @+? 0 0P T@- ^ 400\@+/<2.0 h 0P o@-p@ T\ @\400\@/<2.0ȫ  @-PP M 81 0R Ѝ`@)80  Ѝ@" 5P 4 0R S *,\$0 B!p@ݓ400C40<00<0``K.'> 0₫HHK.M> 0z00N>K.0 0q  u v w P/?o0 2 R0S/0@ S/ 0P @-?o82 ^0S 0 S@ /` P/0 0@0R/ P/0 0@0R/  P @-/o<0"0@0^ R  R@d /  A-`P @P?pP (0Sp 0P  pAQ4`   ` O-0S@9 0@S7  ` P. X6qPp@ P  P  P HXPU0UU !B< #1 0@?,B PO 0s0L d⟪X% XP0@#r 1C? d7 G-@` QP p 20 Q0衟 ᐜPY @N Y5V W%*000p@ Q<Q =Q R YB Y<R O RS R0 <R R 0BY 0UpS 0Y V W*V0 X " pV0 X ! p<R@ 0B RS R <R R=R X ` A-`P{ @P h0 U0 0 j pP  Ὺp P@p@-`QV  RPP`P @P 0`0 Pp\PQp@-PP @`9 PP  Ꭺ`0 @P $~0P0 `Ppp@-`QV  RPP` @P d0`0 Ppt@-@P \0 00R00S S P0008P/0 00R /P/0 00R/0P @-o\  QP  \Q\ /dPp@- 0 00R P@U T `P  @pT @@M?W/d⼨@p [?W/dⲨ  P/0 00R/0 P @-/o<0"00^ R  R@/P/@-H@T ?o 2^0S%o0S A-(`@VMPP !0 e/rP $0S7Ѝ/ 0P `#pP   0 P5 0S2  TP* V6  @P. V0p0 `@Q `  p` 0$ 0R0"S xxg?j/d 1 Ѝ20"S' @# @Ppd < /P/?o8  2\0S /0SP/Xp@-4P4@P@0 0p0S   0@-@<< T (@@@@ @lT<@-@P (0 0R0P/0 0R/P/0 0R/0P @-?o82 ^0S 0 S@/0S /(0p@-S@ `P`0 hP0 aP dd X@@ @t@p<<<@ @0p 3 įA-PP P`p @@PF @@@P p<``=`o 0,p0P4080<0H@-@r @o  @-R 0P< P 4Q  ,  0000L tܦ 0L tզ Q VPG-? Pp0`W<W@ 404 S P - + S -000P,0 10,0$ 10P :   404 SSP  P00 t⃦0 t|l P p@-@M400 S,RP, R4S 1CaV' P` 0 0P 400C40`ЍpR Sz vЍpЍpLkE?M/t?4|n?M/t8lR?M/t1\ @ $ A-P`,p@P W 0 !R,@0`E,@0`p@-00P4Q8 @Q 64 <0,04Q<0pPpE?s/t o@-P MU4 0`Sp@%  P00 Ѝ 0 /P ,0S @l 0 @P  Ѝ0]Sw?}/t⫥ L Rp@-@P 0`0VPP d d0 0 0@S0<  0pPp00/t‥|\ w0G-S@PK Up40SG |  ?P@#P P 00S 0=P6 0 03/P/  40R 1#P& >`P 00C 0P  I@t `G sL?).tf(?).t  | 40S 0C40/ =/@-tD 0p@-S T  Q P@]0@Wp00/.tܤ ip@-@P |0`0VP?0S R  <0 0 p@2,0,0/t⹤00/tⳤD@ ( wG-S )X@ `V 0P 0R 00p {` V 0S  G883>/ty{0,SD ?>A-PP 0 0R41pP 40S @,0a, 40a@T:8 408 p@-P80080p@-@P 80 0R@ pP0@pp@-@P 80 0R@ pP4@pp@-@P \0 0R@ pP`x00S@#:rp@8p@-@PeH@`pp@-@PY80080p@Rp@-@PM8@@@Hpp@-@P x0 0RP`:40S ,0AT 1p@p@n?/tⰣ4 aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@k@44?/tv ?/to8  p@-@P H0 0R@ pP`D@pA-PP0 0R@`4P%80,0!qW# P P ,0P < 0@ 40< A]A4?;.tn?;.t0 0P @-?o82 ^0S 0 S@D/ p@-`P pP@P (0S p@ p  T0 //@-TP0p0 â8 O-IMP  @T p `0 R 2/0TX P Y  9/0  pPP @TL0P ⒢003/Y@ 9/T LTT T @T@" 000Q 1/0AT# P/0S% 03/P& Y 9/%T@TL0p Rd0P KIߍd0p Bh0p ;Y 9/Z 0 03/(0p *x x \ 8  P0/O-@MM(p IT 000 0\0+`P$  T%0 `eP4 0@ 4/@P`P@003/0 `JPMߍT00 0P 0 $ \00 Mߍ((0 ⺡ R00 # 0/0/@-@@A-pP`PM1 @T. 0@0W   WO 0 /R C 0CW /RW  W0 0 B/Q P!0C@T@! ᦢ0@ 0.0 0P 0 S* 1sp@  (U 0P(*@}Pۍx?00@ۍ S0(p ')P%)H(p (p [0P@(  p@-R 0@S PR:   PpZ0P  , 0T90( D<:p0( D$;0( Dp<  p@-@Q PPpQpC-0 MS~@; rbp`PAQ <Q$ >Q &Q ĐQ P ЍP Q Ѝ&㼐Q P&㴐Q xPPU a/U`U"0E'S0rP\bP ]P PU /U\U fPnPtPbPUt 0  O/G PQQ 8P(0F/DRt p l T ؼ 0S p@-P@ P@p 0Sp/p@-@QP Q  PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@>0Q/D̺ #0p@-S+@PPU Q PpQp<Pp/P PQ P Qp@>Q0Y/D⪟ 0p@-SG@`PU Q Q rP<mPp PU Q aP QPU Q TP QpPQ GP Q/?P p@>90-DV똸 cA-PPa Qpp0` XpWW@PS  PL <V`p p0 8/PZPW`<`nQ P P 0S 0P P 0SPT T /P P 0 Pз |, $p@-P@PP Ț 6P 0@@p yx011/A-\@`pP \1S 0 €  P 1P1 `p P 0,0A0 4➞B`0 4◞ @-@^ P ^%QRS  T00NQRS"  TŒ 00Z0 4] G-@R0(M0QP P 0 ` p Pt p `50T?o20S00(Ѝp`0 8 p@- @PM`00O0 0I0 0C0   Q Ѝp 0@-@P M0- ( #0     P  Ѝ0p@-@ P0Ml,`.4l4#0 4 40 4 400   Q Ѝp 0@-P@ M0ߞxl,.l! ֞ 4!40Ϟ0  ,  P Ѝ0p@-@PP`(M/ 0S, R00c$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0W P0V00(Ѝp@ R 0S V00 @-@ 'T00@-@$p00T0%0%0%%@-@T @-@T000 000S/@-<t000 000S/@-t000 000S/@-t000 000S/@-|t000 000S/@-؞<t000 000S/@-Ȟt000 000S/@-㸞t000 000S/@-㨞|t000 000S/@-㘞<t000 000S/@-㈞t @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#蘳< 0 01/Ḳ001/ᘲ0 01 /x0S@-@1/00/p@-P0P0 0@0PS` V#Pp=pHt/#000 000S-/@--t@-000 000S/@-tAo//0@-p@P M , P$ Ѝ00;0 vtܭ @-p@M D $P pЍ 0;0 ޛwt@ 0@-pP@ M T T T ̝ 0 Ѝ0, @|$ Ѝ00:0 ⹛td p@-@ @ h$080 ⧛^t X p@-@PP (P$Pp070 ▛P p@-@PP (Pp070 ⇛T p@-@PP $Pp070 x\ @-@P  Y.<+ < 00;0 ^8 @-@P (070 Q(D @-@P $070 C$P R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@y P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@P80 0 @  0""048# /UUUU3333  cجp@-PQ@v : Sl G Sd0 c Sp0  S?0c0 r-w-!- R00M >Rx  -   r-w-T  Q7 &Qx-$1r-@w- T$ T T-x0   p Ss0  Sw0 S?0l0Q s! R0s  t0T0SS   S?0b0A0a0-0090 ⲙP O-0AP@:  cpP? P?  ᳅pP% 00e` 0@T% ᲖP0=S AP` AT BX ! -`A<0>0 h c00` G-P2M0 DBD P @@0H PLj X`P ㌠吠唠嘠圠刀&pm pp pb  P A p[ X0p 0S0R00000048t 0 `PT nuL 0 `PT cjd d \ < p P $ @- M|id@` @0S H @0 0 |0 30ЍЀ  A2PL 0@-M04B@ Ѝ0 0 0 9/gmNA00/gG-@SP, pE`J2Q# 2Q J2\XP0 S0C0 PY 000 # O-I,MQ@p 0N R` 0S 0) 09 P0S009`0S x) l)l  `)`    @PT0+0CP I @p  q 0| 0  0C 0B0 0 S00Q?0 0X0-SQT0P0-S 0 !000 ,Ѝ(8(H(0@00q p 70  ,Ѝ01 0 B0C0@崧 :Q 5 0+ B R巆P 0( WY :R 0S00087@0| | -Q000 7$  0 0R& 0 `=ᇆPt A 0Z @P @` Pp@T RP܏ P2N v `  Q Q 0@RTZ@Phv 0 Z Q! 500S 0:S   0Sp5 00+ C :S:P ? ,Ѝ0JS0 S P0S,Ѝ@P像TPX `0 ΐW 0S 0 ⵓTPX` H0 ᫓ 0S dH0 ⡓,400S 0:S (  30 h0X ↓r;R0S00%X03 00S 0:S gW d30 0+ C}0{  0S /0:S  X 010300 0 0S000200S 0:S 020LQ 0N00P200S 0:S hRZ; 01 S0$0001100S 0:S I00C 00!S0 0 00+ C H0  0S lh0|10 ޒ4 h08ؒ0 Ӓ88!0 00S 0:S 000+ CR@@q 0  10R th0⦒H@({ .@؉PV$!1 0 40 30=8Ѝ@@(4P 0Y) @P@ PU 1P 0 0  | 2  ᣉ @Pd@P@XX0( 4ݍ X0׍+PtĀ d P  - M ЍA-tt1 0!M@P0<80P`J p4 41p4ʄPP !1 0 <8 309!ݍ0 P  @ 0Pp剏PP@T Cn` x0P8T坄PᮊP @T@UR,0,0 e*0 A-!1 0!M@P0<80`d QPP 14cPAp4t1 pW0P5P  0$0(0,0000@ 0pp!PP"@T Cn` 0P8T5PFP @T@0S  TX| d0 0 <8 30!ݍT00ӎD<0<0D &*|Dy  ww O-ğFM MPQdč@`ᐤt嘄 T V Z XX ( 0K0;d 0P0S  0KpPW  0 gP(00rP  $Px Ps$Wj ,Pj(,rP D$W , Fa #3 0 d4 30Fލ Ѝ|0%P3Ԓ M⌉PᇉPi /RP@@W  QRnE0Sk SIT" W?@Y/ 70 Z0 I2PB0 TF0 V?0 Z8x_0 0X!0 W/70/$0S㈀ !P  0-7  W?@. 7 K60(pE)qlԠl} D} | | | t| D| $| y| z{ {{ { D{ { z z z z @-XX1 0M`P000@P:  9T p T0U0P @@P@ 0 0 0 30)Ѝ_/000U00000~P 4"48#80H]?a/ B@0@;@{(Px @-@P @ ~]?f/ #|x O-LLǟ M Mčĝ,(ĝP 48 $0 80S 0St $0S{ (0Sf IPD@PHh0  <0@pI P`6&@06 0!>0t6@000}?, @p0 Fp!  PjɌ00S# Ō0=SPX PUPVPU dP@`게0#S< v)@T <@00C@0Ꝍ0 倀0 00 05寁P%000 @0 00 4囁P 4 / nh,0$zw00$zzw40S@00C@0  0p@D0 T !6* > p@-p!p1 0MPP0 00@@ TG R00 113R0a `0~? S ` 0~? S U PE0"0 1<3R0x l0 0 0 30ЍpPP0 zT44d0 zZ= Y$= = 0@- 0 0M@P000P' U  0 @  ""DD 0S0(0h \0 0 0 30Ѝ0)PP(0F0 ?zX(= hX< G- MM砐 p@(U,eSPI0T W0FA +@@P3  |PUo0 ;u0 UD -@P   iU0PUo0{0@9{@  q 0 0 5 30!܍Ѝ{0P#{TP  0qQP~p pP|` WV 0- M } Ѝ@-0 0lM@P0d00p`    $P H0 0 d0 30 lЍ(X0d yUU9 00-$P@,@0!0  /#EgܺvT20O-tM@ 0oz 0 P( P% P4Zj( ,8lɁh+% " (<j+eK,j@$@dJ@hKD`l "h bD he e[j{b$ l!` `.aH`lnd lˆ. Lbb+`!,P ˠdˌdKa+. " T@*`+` nK,@$X@ a alK"@$\@annbK @$@`HlKlˎ`!. dh[ kknbb+ϟp ,hŒȌ̌ p' pa$,h ̠`ˌ` L {"(, P P%Pd+. " 0[ig[ `i `&`jhkjl+a+an , P?`%` f[L`d l"`dkl!`@@nbk `@nKbk&`fmd@lk`!@lK`.n4@ba& @bKa,ɠX@`ˌf+. @`Kf+" T@BHL@`K@H*a+a8IkKk(舠gn ,n l f f\`dbhl`gk pPP%l"l!  pgpmNSvmz靠e `c{&D`l̠daˌni "mn `ak  `H8古n` md d8@,b3De (nIp M@gy荠k{n`[n@`dk&@ lK@$@dJbhKPP%X @m3k`@ j+NNNbP[lT0Pick ci!0c0k @$ Pl @DPH`K `ˌ*d @Pꭠh jˌkg+" dP,i+0 iˌf;# 0͠T0+>C3C7Ch; . 0cPP T2gˌ a " 0g;a HPpᄢf b;,0 b;#f `@P娢makl; 0 l;#a 4PТab`;&0 `;#bLP n P*e Phe C3C7Cn;`+AmAhkAh*jhL堅b*l+`$l`.Xzmv逈eehPd" zTd,mXv\ȠP`ˌ`[Xg;n@0lb . b ` d 4@n[,`(@P%Pl@e\b[b+D@0#el@ 0+NDCDGDaK$@lK @$@MnK`+% " b*l+Lbˌ(e$, ˠ`ˌ<f;+@@@n a, j ` d" )i8e[eP0+H╃H⫇Hj0#0c9g;.Pdc`cb,* \ꭠ+K╳K⫷KgHp +~G芠sGfwGfk.c;ndKal%! h`abahk(e+$ " 0$0# 0Hpb-=l+`;d !l{ ``&` e `a{"p'd pyb ddK+ ja\0j`$ ! bbˌ a+h+  0q0pP`m \m` 0` (`Sm0PPP#PGmCm` 0`(`:mP PP @ \-m*mlЍlЍ'S 0H0 tp@B @- M`NYpqp1pP@P`@@T 0Q P Ѝ A @2YP @ ЍP 'YP"0S, -S?@0 0000 P  U RP +R@@D!0DS  XP0S +S!@?@!@ 04 X ?P L0P00 1 R/@P/!R/(/(0 @>R0 00//.@-Mp @q`P`W P0D>S 0!3100 0qЍ>SD 0!3100q00q00l./-p@-MqP@U@0 ` ` EP|0| 08 R;0Ѝp@Ѝ/0 a0, ,  &- X   p A-@PP`p; =U( X0ES  S0+0E0VpP00Vp&2!0` 0`00+XPp -X =X00-0V0X0+00+0`0p@00(0]0 #o00 4 p@-PP@F 0a `0RuSpWS6X0CS0p à 0R Q PSPQPQ  0    P0 0+S -Sp0 b40D n I@ O-0wSpTM 0@@ 0`004080<0pn 0(0p @( p@T%X7(P0p000000G @ @  0 a0GS00p00p0@vzp@PTЍ+W = W0 -S0000 0` X B R = G/oS"!"   ( P:0,PLp ,p Dp R, ("@P0 @(偑  ( 0S# (p W:,P)pp ,M !p0S,0"@(p剑pGPp(pW [0 0X I0 0p(ppW ,Wp`uS(`! Y0,Po` , o Rm, "@(`0`FP`(`   q`(=W +0G?o 2R0S$ Y,Po ` , o0SB,0(`""`FP` @(`傑V [0 0X I000 `(` 0 V:,Po ` , o0S,0(`""`FP` @(`傑0X0 0!0($ KR; I?I00 KR<I xo0 @$$0`0Slo0"SB  V*(@ T:,Pbo @, [o0S(0,@0CP@(@Ty (2-+ 00 ` 0TЍ'pC  001]0 0m1]0 )moꔱ1Fs!o00(0UpJ 0Xp+`-@ +B XR R  +B0 -R +R XR 0 -R  X@P`QpP0]0 l~80o0P l *  h L   @-@PPM 0` p P@`)p`Ѝ0:0 l P 0 @-Tm/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`^P+^U PU  0   P@P PPr6aP `000p@8000n0PcanPP   p@-0P@`T R@T0rS JPpp@B@P0+Spp@20@-2$M000P0n 0Ss 0P 0N 1 00S$Xp@2 P! X0rSB $0 P0p1 0  T1 P @00S5$Ѝ00kP0T X@\5_m@X0 00S  m@PE$0 P0p8 0P$Ѝ0T 0 hk8@0 `kt |H  0@-$M 00P0  d 0Si 0P0@ 1 00S<_p@& P 0rS: 8$0 P0sP10  41 P @00S-$Ѝ0Vm0 @00S NLm@P#0 P08l0P$Ѝ0P 0d j4@0d jdt<hX$  @-TAPP@ MI D1p0S+41@T4 `0`S( @0S$0V0, 0S%Pl0S   v?p  ЍX0@T0S hNl00PGD  088l0x wjDtȼ, G-`PPHM6 p 0 p@  3p@ HЍ P 0 p p@ 7HЍ7l0S @X@0>0 *jLM0P R@t O-P4M@P\pw WmX0S0 `00 S 5/040 00!S5+0$0 00!WaW0] Y[ X00Ud5S`50 0 0 0 0@0` P(0`0r5`0D0$0Xe 0S20`iW ,A 0`BeVW@P ,(05#[0P` X $ 2P0 4%*&  # #. BPU 3ß2#0!/#1##* 0 #   (`V4Ѝ3+00 00!n|3/00 00!f`30$0H\.d0La#0L0|2pST0, P `@!dP 0`V ^ @P,w ^[X"$:600%$0<"%>!!!0C$"0TP%"A0$AO#QX00 0 0$00?S%4P!( `1T101! T$?01>! R01"_0`A(0l10X00`d(00@t`dP(0 d  R.AP5Q4 0A`X0 0A$0PE `0P 0  [`1`190T dht8H0T dh` GzG@ Q(\)\ x SQt ̰ h O-PP@` Mo Tu V| p0 (T:R P- Ÿ P2 1L PPm@pQ @T*RP P 1L P R 0Q[ SQ Ѝ\ P @@0 <0\; \ @ p R@p\ p W R:\#Yp 00 hT80 gVllD0 gzp,@ \?[*!]-  p@-@PP U p@HHT0` gU((h0` gp@H EG-P@U T\ Pp ppq W00"1aP: P] 0S\ 0 R 0C ` 8PP0 X= V  00S0 0 Q 0  ! 00S-*_oRe`VcP" U  !hxxt0 TgT\\0 KgDG0 CgAi00P4   C-1 M0 M@P040`P$ Q? U5  00S0 0@ $03/!1 0 4 30<ۍ ЍQpp 0fV U G0 f0 ftt0 f P0fD40 f h  C E` D( O-\\ƟMM PMPč pTDe0^ XA 0SH VO 㰰hU[0U@@ R R 50B?o2 000RU$00 S0E0@c0S0000SgV (0+F0S 0@ 03/[o 0@ 0000,00G(0 03/P     0S00 * z 0.S  Z0S0 Wy:0S 0S  ,P80: S $ P (0JQ/03 10J10 00@P~000$0 000S  0P*80: S&V 00S 0  000S0 P@T  00S0g04/P/ 0,0" $2 MލЍ  0.S0Sm 0.S|i0S  0@ 0J  2/0S0=  000.SP _ $P 0 @JP? @ d  2/0GH(100+$0 00 `P0\\0C/uer0rg R 0E00 ce0S0 YeV0 Pe0 He0$ 0QS=g0/ 0 @0 03/0}EE0xm  * |P /p H $  O-hhßKM MPčp`Pؔܤ; WB UI YP \U /\@ @ 0\/\0 V'"2 0 4 30KލЍRZ/\3/00P/\V\% pD0G/dW$$0G/dU0G/dY0G/d@Pp PkP 0   R  Q 0T/S 0: S+ S 0 0 0 0 PX# +00S0 0@ (03/0S0: ST/03 301 1:l R0|P|P 0I/LdG 0 GdDf/0 0ᲰOt m n o SO-şM5$M 0`P000P 4 QD @0~S<   pH 0S/S;RL 0B0 4ZS 0H*0; P4S 0 0CPR- IR*0S0;R# 0X @H p S    hhh*S1 00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QR Რ@  P+m@PU 8#$3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0n 0]S  000-S]Q 0]S  0@< 0<20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 SY0 [0!^0  @E  p4` N0P H *; P 6010Q@@Kp0 bU 0M/b0K/b0M/b 0lb0TM/b@7@5?**([-]$ !x 0  O-`QM@pM R W T   DcI^ @P}\ @\ [\ {\PU PE0]\\ \8(<PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S00 8(B 0SV 0F0C  0#c0 0 @ ]RR ]RR xdd0R/bX Wf@FU?R/a\$$0R/aR  p@-@P`PM( V/ 0  0 S /0{S 0\ {\ P 0# Ѝp0}S0S Ѝp@T0.aV40.ac 0 A-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ| \R@ @R@ )\ L 0 R+ލЍ0[/Sa\@0 p@-`P Pp@0T1@D 0CPP 9@T*5000p0]//a 0S$ @-*S ?0C\S0P0S Q 0S 0 0/D 0p@-0@ TpP"TC ^ (a`00 0DS'000@T7 "T- 0 P \T0"S0@T&0@00 CR S 00p@T "T P 0#00p P@.T \00p @- ! a 1 `0 QM MR050 @ 0 0 5 30-Qލ Ѝ ,p p@ P 0 p @EO0 ;P@30, P 0Tl 5O-0$eP`M C500S E@ p#S"59b0 CP$ 0S $%P @ 0Sb0SЍt `p  0@S0 0 40  0Sy t匤匔匄p ,p<0fS0fS 00#3R0 4$ 0000@SS 0oS 0oS0nS 00#3R0 # 000 \P  00#3R0000 4\P 00#3R0 (# 000 \P( 00#3R04 " 000 0#S 20@ R@@QP00Ѝ0 S S D\P 00#3R0 (" 0@00u L|\P  Tt\P3 00#3R0* ! 0 00V 00#3R0 ! 000GlPT ❼0@S0 @  \8\P =QIQ 0P0 0 d%\P=Q 0@0 0l+Q 0P0 0H` \ X 8$x \ h h8 8p@-PP t[P d@PDPPP 00p I0 ^p p  @-,@@P00O-ȟ MȟpP P`@ UVYT{ 4 TpJ09, _W Z iU} 0p00 2c110 0p 00S> A0$00 0op P2;`<000S[ ^U_ `'T7 0 0 30Ѝ `s?0l0` Ⰸipp  0PWpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #S R BQ #S# I BQ #S& H BQ #S% G BQ #S> L BQ #SS M BQ #SI N BQ #S? O BQ #S8 D BQ #S E BQ #S F BQ #R 0S:U 0p0S8 Rh BD{ᗾP `0000  00  X$   840000   $   30000S0 @  # 00   ApW p[ p*_000n@#_@W 0] _000S _0 0g _Y 0 ![ _000G@^@00f@#p00,(@ ((@(@00,0rX X[  ーPk|0Sy[t+]Ǿ_0 \G^00^  Pp~pc Tpt0`00U0`0 0SCN DqpLp Y*0p0Z0 ^0SY00M pl0S0/ `00C0'  L{p8pPpMpJ[= 3pCkp-pk@<T  @ \  $ 0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpFK?pP ˻P Ѝp8A-P`? A@0S'A@Q0+pPpPP 3M@@奻P  %p0 @BAQA p0  p0 $0<0 [ p@-p`pP`P@T T0T0 R@@xpP00m꜁pA-P@P`@p_0S |@@LW R"@`Q\@wP00~]0@>\<Ȁ@-I 00 @-B`@MPlFpP 0S|0A@@V ! @p UpЍ 0P  R 0QTG B&R 8A@)4&P!RS' Sp@ S'@z@ @S@u@@S 4@q0@@@4q6@q4@0P@@4q; @ p X D0 ` D (  0O-HH% BM M $$ ,u,%,p     000 0000+0夛P 4 @0 4qHP (`P,@\ {P 0S x400#S \ lP 0S @4@D0@8@\ ]P 0S 4 D0@8@\ NP 0S 30   \ ?0P 0S n30\ 20P 0S nl30d3dS`F0\P+ aG `< `P\ @P 0S UPPU PU cWP20P0xS~ "p2 0 $4 30Bލ ЍP@\ P{ 0S `200#SJ \ P 0S (2(B0@@\ Pa 0S 100xS0xS0S& 10 0sSA0wS>0S;!  1A0@ @\ 0P 0S :n\10\ 0P 0S -n,10 1P0P!0 $ 0 ⡚0xS}0S y00  00 0000@VPxD < H x `L {<h ľ T н hXHp@-`@@0S P Dp

02d Q@NS pP@J0V0  ! @T3 0 Pc/T @0 $ @@T S0T0g /H70]Sf /Sj \ST Է @0P@-@ P [X 0 Q 8Q?o2c̵ p@-p`@`PqSP lSP T00pT 00p(X 0 p| O-0Ÿ M pc P    10 230Zߍ 塵PT 0 p H  㓵P 7 R @; 0`  0P P& PP 0 pP 0 P0@T*p@ V 0 pP W - R  (O-0Ÿ M pc P   { y10 230Zߍ PT 0 jp H  P 7 R @; 0`  0P lP& PP 0 RpP 0 7P0@T*p@ 5V 0 5pP #W - R  [ lO-0Ÿ M pc P   10 230Zߍ 呴PT 0 p H  ヴP 7 R @; 0`  0P P& PP 0 pP 0 P0@T*p@ U 0 pP V - R  Lp@-\@0@`P@ [P0S S'P 0p蜮 p@-\@0@`P@ P0S S P 0p0 p@-\@0@`P@ 5P0S SP 0pĭ 0 00 v-H- M 0 S 0  00\100M0 R0    R 8 00 0 0 30KH Ѝ/<,-H- M 0 S 0  00\100M0 R0    R  8 00 0 0 30KH Ѝ/Ծ< -- M0 0](--M  Q--M  gA-pPPp` V Q @Q #PD@h0 0000Ag@00 }S(80 uS0砽 0P R   0//d`O-H'H7 0?0#ό Ό C+ C+0c̠0: /07 Ϡ? 0S! Q/o/o @bPG-?b P) P @pBb&`b4')3V4( X4G1Y 010.? "1?1>( B24 5 /00@ Ϡ P! 0Soo G-@@a5T?a"6T3 7T `a2V7pX F3Q g>>> 36 / "A11 A>+@A4+a21/4 6:  / 0Q!*?B0CS?S3S4 cC0 0c11/C.B0B#B# b0/// Q":::CA@- @@Q?Q$&3Q&40a0Aa223 C$LC>CC.#@C$#0c0## P ೠ;0 SJ?Q Qa01!/ B //@-C C0c0,PP `@-P00p@-@PP  p@010 vND p@-P@` 7Ppp@-P@ 7Ppp@-P@`D 7Ppp@-@PP psP nPppC-PMP`V @T |00,OЍp :  /6p@`$ 븝 00 R ,@-7P00 0S@PA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`{I@ 6P PXY  P A-1 0M0201 0@`0pS 00S \P#P3.000R`0@ t d0 0 2 30ߍgPP @@ @0(@$0qȥO-ϟ 0 0XP(<Ѝ00S S 002  /#b!!"A XXΟK/"PbP 3 :DbQ # 38,P b4 . ,  Q000000 &00?3c112A -K?##-cR 3:t-cR # 300d0010!, 00C0 00@X ͟v. r00aRaa1B0"B 10#/A!b!b0C 0#/A!b!b0C0q0$`Ph08P `C P(H PQ5P^  Z R0 50 ,iP(BU0Z0,p 0U =0$`0P 0`C PG P#5P? Z R0p (000@ 000@(X(P 0 *P(000(PzZ05  GS(  +S -Sv 00 00$P P䅐ಐPx:Uh X$P(" 2c2c2D*S \0c$00P 0(00PG0  P4P GP  4PP 0(P 0  R,0X0!0 d =0 P(Z 50 ,P(Q0PX%S(PV 0 ,, ,0 0CP0({0008Xu  0 0P S(N 0 00'Xd0| 00H80   0 P( D8 ,, r,0 0CXP0(G000 0 `P(9000 0, S,0!/A!b!b0C P0( ! 0 B0 Sl0(00X07 0 0P(0 0000X60   0P( c0 ,0PS(, 5 00?2c11!, 0 00000XX0< 005 0  0yP(0 ,0 c0,0PS,0(111v>C 0C,0   /"b!!A0,0 X0X 0P(*XoX580   09P(D(P000m c0 ,P(500000c4 ,0 4,,0 v>C 0CXP0(] 000P 0 v0 S0 (0XJ(P 0 eP(> ;0   RW 0s: 0 `00LSvΌ %@|@ dRBnnA!AAL L! $ßR@Dnn B @ b ϠNll B1c000C 00000PX$`(P000,P30PX$`(P000  /#b!!0"A K/"bQ:1bS0#03" 1 ,0 B00DRd , 40 00N(00 S!0㘁 @XPO}"  JPIq 0 40N Q @(P0Pa 0(P00:(PP @ ACLC ^ \JS S 0 0#3P0 z J/o"(PCzZQ (Pꌤ P)\(\ ף, @ $IQT ň  l'ȇ 7QUS< ZSP  @ 0\ P ( 0$0010PE0,P& ( $P( P!/"b!C;R, a2ba12TQ(tP ⎀Ḁ@CP(fMP P(P @j @0C2c2c2P$00( (0  @ 0 @ [X( 000jX( 000b0@>0S; 00@70S 0@0 㴂,0 0P P(00, 0C$0(A,^3000c^\0M0c$P   0P  P(00 , 0C$00(0    0P ,  #P ( (0 b$ 00 0M0Ѝ<A-1@0QPHP P MS Q(h10d0 P1&PDp\@@ ",. R!  vΌ @p `U# Ѝ0 P0  $ Ba @L p ` UIT 0 ЍL HHI00 * \ P D gfff  @-0M@ 0P ~00Ѝ@-0M@0P q00Ѝ@-P@eꔃp@-@@1 00Mp0,00`@P< U2    P00Q Q Q 9 0 0 ,0 30 0Ѝp * p%hI 0 P;@0 \G40:0 UG뤍t,t,t, t p@-@PP U 0DPp P @p8070 5GU880 ,G@  G-pP`' X- Y BV @P0PES  R  D'/0PEV R  RS0@0D@ 80H0 FXI@0 F~ h~ R@- 0BAs @Q 0CR G@O-錡PP p MT WC 2@PH 3PH  2p`J oB(101S Y3 Ѝ020P@2P* 0 0P e20 0  G= 0  G`D<0 }F72yH00(0C0 oFZ3T| | RQ@-M @PЍTT XH@ЍoЍOH 00O-]M 琡Mpō @pG h1PP tpH @PAP`0 80xQ|Qب8O80`TQ>Ch5 sA$`040P@P9P p0 0 5 30]ލЍT0D0 EG00@G00%<8{ 0   M Ѝt--M  =Ѝ Ѝ/ -- M0 0 ЍЍ/O-鈒@P p`M X X00?;^900P @ P 00 00 P! !  D1XPF  9VP WT V[XPVppPpW` B 0`f`0 pP `PED8 0 YEW`!00 ! 1 00\; ЍB0XP C0PP00 G; Ѝ 0 -E`ӤpPP V ̤pP `P00?0 Ee\x w @-@ M ;(0S2 80 `0( `1/qpPp0)  0 0 PUR <0PU: ЍPPTp 0S  0CP:F00Pp:@-P M:(0S: v80 "p0( p1/qp@`0/  0 0 @ToR <0@To:1`V ЍP@T` 0S  0C@oFT00:}F00:p@-PPD (A0S5 @Tp1 Rp00P0 \ P 0S P0R 0c0(M 0P0 H0 SC,P ?4P ;8P 7p@4HM@0 2D0Sp 0K0 (DeEt xt p@-@$PPRp@ڦP#u@- @@ӦR@ͦ#pup@-,PPƦ S@ῦp"cP%dP:00L000L0 0<00sP00n{p pq Pq o Xo n TLm O-`RM@p , [3 X PE 0 0H P@0 `D/PBV0F3 `  [ 0U( 00?7.EA[?7. 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@-0081003/0P !p0 $@ j0V0 00 R (UP000P3/0P! U  R  SV  0STLP000U ti/>3ihdTr 4hh=A- R@P 0`Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@Q-00810 03/0P !p0 $@ ؾ0V0 00 R (ßP00 0P3/0P! U   R  SV  0S㺠P00 0U (gf@f p eL A-@P| P;`Px rpPh  00^c<!"#b!0CaqV8 X p<PXU $001p00S ,\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(!P` p  0000St*P0000H0003/P 0d/>30dcDcc0c=XA-@P{ P:`Pw rp Pg  00^c<!#b!b0CaqV8 X pW<PXU $001p00S ',\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(㈞P` p  000$0S㑟P0 $000D0003/P 0hba(pa@a(a` SR: G-P0`00Sp 3/0Y @IOP T 00 00 Y @IOP ~ T P00 D0D 0 p`P/ ___l_X_ SR; G-P0`00Sp 3/00 Y @IP I T 00 00  Y @IP 6 T P00 D0D 0 p` P$/t ^^^L^8^ O-PPM M Q \ /\E AP9P:p/\ p P/ `K`\n @ /RR.\)  B R/0  D0>  I p c 0: S#  S/ L/o" R/\  @ DQ6 .PQ X0  [K/Ra0W0]0娐 !uP-W  ]9   RY  >0/\0#p0 @/R0 X0/ ލ Ѝ @ sލ Ѝ.00n? X 0/ ?    PFZ?00 T?>00O?00J?00E??00@?00A-@P Q iP`\PIp@P ZP`V "?0"S ?00@p@-La P`M=  800QP0尜P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P ƞ 800  > 0 @\cYXXp@-@PP`2 U( 0Pp:P@ P0P \:V \0@Sp\ \@P :VP:Pp<80 < 00 {< pa a 00/p@-@PP" U( 0PER R:Q|Q00Q0SP0@|R  :RRp@0@0D D<U(P0D ;<p` ` O-ȟ M MDčpĝP$ 0x 0S 0S 0S t4!S S 00S00S\S00 RAPp 0S7\S5 00S1 :S000 0 S4Sl A 00S :S|S@0@ A@0S'!|1 0 8 30V ލ Ѝ   @P 00 C P10 Z P @P @@QP P @ 00   0⠸P 3~t0 80 80 0tP_ @\UUL LU KKK0C04 8 0S:SYD H R0 0  Q!0A00M@04@@0@7 {0:S 38 00UePaE40D P#6F0 :SS008$ 0:SS00T4 0JL K K I,K J I I I @-0 00 G-H-M0 S0 00 0 0 0@  00^100M0 R@0    R L00 @ 00 0 0 30KH Ѝ/FF,Fp@-0@@ZH0PP0pHH \<O-@`,M$xxP5d20 R[ 00@`pR 0 HP Z p P p J ) J PP0 S": g6$ U10 r 1$4S1!$6@ 000P$ P0S "<100S (!1 0 $0 307 ,Ѝ U r pP Р ,P 5SX0(, VT00#    52PP "P0SGC=El;(;F :D 7F ˠ@-(@M@@0@PЍT9@-Q@0M 0    ",  0$0(0T 6P0 0# 00Ѝ 60Ѝ0-$M  00 0ĻP$Ѝ0-$M  00 0崻P$Ѝ0 -M 00 0 壻ЍA-p`p0PsM  l`P:@Ѝ輼p@v6X0 ,p0i6dCxC @ 㦼 㭼0㥼A-$$ rMPPp`, V2 @X0^00pAtA0O5 `p00TAΌ 00`L PP役0x @h0 0 1 30rߍL0F0 4V0G<0 4T@?HB (B 0   M Ѝ4? -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/>/O-44 sMPPp`0 V6 @X0^00pAtAz0Oⴖ PP0P >TACn/0 0$00 @/t h0 0 1 30sߍL0G0 3V0H<0 3>D=@ d@ 0   M Ѝ(=O-ϟp/  M # P 0_ We 000!R !X P  *.P4%X 00S)00 R .> 0 3 30 ߍ`. 0zS 000P0C0 pXP l@0 0 -P 0C PS|P =0 $3W H0 $2a`0`F p0p0S8@0 -P, 0P0CS0 0000偼0S0p0@0 0 -P0 0C P0 S0P 00 pj0p0S#P 0Se0 0b00S 0p000Sp000e  0 P_P\+PV  PR00SVp!p3`0 S` 0䥱P P` 00 000050p0S 00hʠ@0^T@pp,(03TIQ 0', 0$ 0 0$`-QV ]QP0 ` Q; @$00!0SVp!p3@`0 0X:P0X00 ۔P& 0  B00  `30 ⎔p PTPpG@0SW `㴔P 0@0080偼0S RP -00SB0p00p0S00 .P 08pG0W^p8pFWp!> ᔈ m@(0H0p0+0AMS00 [m0H000CS0d000pWH R0XS 00 0 (* 0        0H 0 0(0 B0P0000F SK*N0 `p(@l0V'(0 `@C8@ 0p>(00S lP V ,$00SIV`@ T@0  R  R=  0 BV0 5 R@P/0pH  R{ @0H  R'  `V B   H 00 0SP HX A 0p0 0000P00p BH H HQF@<<<L? @ @ |< >: 9 9 8 8 l7 T,5 `1 0% . p, `pG00P0W0S`J 0000P T0$@p@00Lp0X0 0P00(  P6 0  B0 0  E0 0Ñp P p/ p 弑0S $0 PS0pS`F V ڑ P0 0@00]}P ($@X T 0@0 0b0SlP [($@  0(u00Dj00?V~0$  ]R R@Pp00@0 0P00r$  ($ n4X  @P0 0P 00p,004@hP P  P P Pc P 0 $.000C,00V[ 0$@(k ` @vV @ ^(0R0BH0R 3P-@0 `$V`p ,X@0Vp@H0 )PH0 B   H `V  0SP H0 p H00CP`X0p0|5Lp0X@P0 00 (?oV20SX 00 0 0p B0V 0b RhP\0 (P U0 ᮐ P 0  B0?0C  .. 0(  ^p0 P s ᤐPX P`Fp0S +P [[ (0 {1(0 SA-@P`p#0 %0@#@-@`P MDp#@0p0 00 0@# ЍX%A-R/H,04% 00 0M0ЍXO-MD`PpZ@@Z T6 0US``$ZC 0S@ [= 0 `;/0S) @$lV 0S H[ 0 ;/@PЍ-@Ѝ0$lV?%.H+0Hh[y?/^+0HJ>s/H+0$}>[/^+T$ ,$ $ # @-$$@M Ѝ`@-0P$L`T M 0S 8pW  07/@P Ѝo-@ Ѝ ?/Hd+08p# 0 00M 0Ѝ@-@`pP.-xx0p尀 T  ᰿0 [$  L(@% $ 09O-ğ$M `H0  0P 0u pP3ʿ00000! B b09<Bp  UQPE @ 04BL3@0S0 MTT  MT  ^DQ #2!Q   "  R  R  \000!#300@ 00@00 @0`PU*$Ѝ@0 0M  0P-0 S^^?0@0 0`0  P 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `\00 00 00C0S ``0\  a  `0\  b  `0\  t  `y0\  n  `r0wP0U 0 D RQ0\  @`b$ qA- Q@Pp`# |P=0D?o! D2]R0S =p0$!0@<  14 40 0 V V 0 P0 A ` A-P@p`P.T T |0! D32 0 A_T %D0$!0@<  1x x0 (0D,TSI6 O-00ȟ SMDȟPP x`pt  ?o2V0S Y W w@\0P0  T0P0 [00 p1# 0 S@ P4*T- U T 0 1 #P00? PPk@T`P @  *TP 0@T0P00HC1S@1@! <%` pPD 0 (0)0S V <0 G0CPap1  * 50_?  Rp1  ' 50>  Rp1 00p1 00p1 00p1 "00p1@\00p100Mp1 L IP@T`|P$> (@MI? ( 㢉P( PzS? ( )TPS~0 (0 (YdE? (H T$ `p@T 0p 9/P*00ᕊ哊告及#3 0 D1 30 Sߍ@@x0`S$O 0S,0  /)VR U 0004p@p`00 0 (  @ `ɠ8ʌ `pPQ^_A (, ^\*  P2 0*A5)q @. 00 (0<֊p (aP ~$0~s$@ 20 ,0(T 0 0S0"700 0P {00, 0R 00$00S$0000P04p0S 0SV W``w? '4p)00J81 `@`,P(f(0 [PY4*( ( $0@0S$0 EQ  KP U@I) 00P0p0   @8    | X `4D L@-@ M(0|0x000000@  @ 80P @0 0 30 ЍP  @-@ M,0 0(00x0 00000 @@ 80P @0 0 30 Ѝ X p@-@QM`P0 "0 `sЍp0@-@RMP0 "0( P]Ѝ0@-@M 0 00 LЍ-M $=Ѝ-M $(/Ѝ@-@ M00000l0} @ D 80P @0 0 30 Ѝ  L @-@ M (0}/ 0 0  @ D <0P @0 0 30 ЍT  0@-@QMP0 ;"0  }ό Ѝ0x 0@-@RMP0 $"0( }PЍ0 0p@-@QMP0`0  "0$ }ό`Ѝp -M00  }όyЍd -M, }gЍ, -8M  $}όUЍ 0-$M  09$Ѝ@֖pP֖0P`p  S 0*< ,0 0 L1 30Uߍ蟫;@<|Sp@-`PP`@M& T, G`PЍp cP _P  _P p0 0  P@0G0 $"T$HL0 $dX@ O-@P(p,_P ` V&S/Z V@0So000S @Z 9/P V@PV nP< Qk0SZ@P VX G-`R p@P8/PPV @G-!1 0M@Q000`PR U: U30) p00P 00 S00 0PP  0PP 0PS !1 0 0 307Ѝl.00P0 paUp0T  ˕PTpPp Pp 0 P@*0 00⣕Pzԥ/ B/0  Q B  /0 R % B   %3 %//Q0 / 0R ,` , `! B  // R 0  B@-  ` .$`$"  /0S :p@-@P0C0 00 0p/0p@-S@ :P0C0  00 0pp0S Pb"! b, @-@M0C0   00 0Ѝ/0S/ p@- PM0C@`0  0b"!4Pb4#0 PЍp0 $000  / 00$0ꬔp@-PP@ T {`P 0S Sp@p`^Ppp@^800 $Y TH0 $P ꜳ | p@-PP@ T J`Pp >p@`4Xh0T $5 0W0T $.  p@-PP@" T( Pp !`P 0S Su^P p@o^p0p@/80w0t $ Tx0t $ 0  p@-@PP U p@ %`80g0 $ Uh0 $ 꼱 0@-PP@ M T /^P Ѝ0_P 0SX00 `<00 $ T 0 $ 긑 ԰ p@-PP@! T' 0 Q p]P _P ]P  ]P p@]800 $v T0 $m  G-PP@H T  R! R `V" V  0LXqXp$, 0M  R R2 0 00 0 `V000 0`V 0.+ 0 F0R#  0 0I0,$  0\K/ `  00 00 0000 0Lx %Į  @-/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`1 V' T ^ 0S^  S 0RR00p@@Tp4;@0  0:0  ܭ C- MpPÍ`@PL TB A< WP8 .Y` 0S `!X1 0 3 30Mߍ(#@+ R> R/ ! T  p0S J % 0p 0 D0 6 00 /   T و  RP  R0SL  x O-|IMxğ4M IM,J͍,@@P p`WP W0  $4 I0, 0 30Iݍ4Ѝ0 SJ=00SX30"l @ J- 岰p~ # 4+4J8 #8T  n rJ- 0S UV0  SV S RNJ= 001:02 00d'$000H0 40SP @,VU  W3 0Sa0S  0S0s S0S RJ= 0 J= 00ZWJ O<  VP^ 0SI oge1a! 4a4#Q #< p0<0J8 0 J= 00 0$ X\0Pl J- 0SJ=  0=pS SuJ͍ 0 %! 00S`LP P P J= 00W0  *VPJ͍ YP )$Ė Ъ < O-DDğ M@pQ `@$0 0CPS0#3 0 0 30Ѝ#3 0 0 300 HD@pЍOWXf t4"4 8 #8 KpPT0S RM 4"4$!$("( #8 #8 D1PT8VT00QWX00 R0SY 0Sf S4YP00SP"0 T T@@O 00QWX00VT<y!  0T X: FpYp  0PȠpY 0@D    ƆT00? ,!0  ⹆piT 1i #Y4pܐP 0PȐp   ᝆT00?pW 0@D DP^T[pAL   x눒 $L ܥ ( d  O-p 0 IM8 P@`Tp/ P PW  PWD K0@S000h &h0a00  0 P 0 0 1 30!Iߍ Z h0VX 0S P 0 0ꎤA-@P`p  0 { 0P p@-MP`^P@@P@T 0S  R0S +P @PЍpP PЍpp@-@P PuX%Xp0@0 \ 0S/. AA0C.S .R Q P-S Q P_S /A-0 S@RO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJR 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0S0p@-d M."@0' P  0R0 0S  R la  haR 0Sd .P 00 Ѝp  0S S0S,  R R R  R/@-/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP0 PCE@0S0S 0S  Ѝ00n0 T @-pQM @Q`P Q Ѝ0SSp P*(4"<8#8V R# R!  `0S Ѝ Ѝ00S SD<0 >P 0  @<  p@-@PP` U V 0pᮢPp``D0P *UDD`0P !V((l0P ꐙ l H O-ŸM2 J 1 #E 01p $0p8 `I P0 0 000000 8 P c\0 0,1040300؍<Ѝ0  R 4"48, #80,000(0PU,(Q Z Z Z/\ ``x0 ecꦡ"\00\00\00H @|  @-00AM M@P čP`p1 U P P0  P,@  0 0 4 30#AލЍ0SP 0@ .Rd P @ ‚HHx0 [00DLȕ (  @-X!X1 0$M0000@S`: S, V& p,0< S9* @\ 0S PU S  S0S \Rp`Vl d0 0 0 30$Ѝ e 0,1 ~}G-@P`p W"  VdPP   @ @ !<<D0 tW 0 k긒  O-Mɟ4M M,&̍tiQ,@`P(0 (0S 0S  @0 <0&<00!S8 &<00S &<00S @(8 0, 0 30'ݍ4ЍS80$000 S:0_>pC P 0 0`DZP00 $03/P 0P&<00&,SS00 80R0S^ 0S@p(p$&$(V"(H 0@@:D`04,Uq*0 C 0YpPg00  $03/P^ PZ}ZpzZW pN80S@&<00S ![@jZp gZdZ6Pz00 Y0P3   z PJ P* `8b0P& D&D04D0Q t $RhZ $Rc 4 40 [ &<00 Sl 0K'[SP@T4,Z0@M pW| 5000p0,0H00P0hP$0 JdY: `p$``p ,055U0  `  FP $8$#,(@0"(@0S S000 0S dY[w 0LE0S3 Y00Y00440$0&<00S1 @~PPX  (5$%0 5s~ ,0S #0S cY00@ (0R [? [[a[ @U~PPXX,0S <0C 0D\D [<0 C00P; 0P00,00,000@@T@SY@@^@0P2z0 0XPP00 $03/P 0Z 00 S P@  0QRCPG.@fB&<00 (0%/ell0,G(0SLLC?,=0S,,D0,3 0qRCpG.@.%@0/e X0@8 \D0OXPD0~4 4 R  Q QZ Q 0?|l|{Pip  ܉   O-@ğ SMDP0``P `pP $0  08X0`00pS0  PO 000 OPK @@PX 0  >Pbb@|#t3 0 D1 30SߍY 00KX00 Q0 0 .Q0Q RS% d! St*+ 0 Pgbeb @S Rd! Sf*.[ 0 P< D Pdo 0 DDQ0000 0000 Px60=S W0S# S S Q 0 Pc0s70SQ0S W000000  Q000S0000 P=ʻW00 0 P3ʱW0.[0 0 0sx W00tx0/I0 PʔW000 DDQW00WaW00TrqX O-`@VpPM 83 0 S_ `PL 00P0T0X0\0`0d0h00000 00000PSC S$ S0 0% 0#04pTp0  0Ppp0000 0000 d1S Ѝ 04p#ጀ9대XW00WP P P 04p#p_P p08 P 0  d0 S㮟= 00<1 0T0 0 P  0 p P!004000 "0Pa0S 0 S00d1S%lXH   00S _d O-Ÿ @00@$0` pY i:92 I520Y0 0 S   S  R  R Q\z  ^ \/oQ" S R0S  0PQ ,-0 0S Q0S %0P 0 岚P7  0 B   (LP(?Y 0( P p0`8P<p`P,@4Y 0S@TC 0SV 0S S 00S P(0 0< R=P R: R70S0S `;0S PU`;35 \ ^  (;00U Q  P \ ^  R R  p  Y ` P 0S   0?S C" 0c6#PY C ^h #\S㔐Q^'@ pTp0S 0`@ p$p T d:42 D52H 0SE0 S > S PR  PL 0@P0 0`P`&0 )0 e?0 @?/YP^(0@ S0`P@T $PP@P ^^T$PY@T@ pTt W 000`P 0 `pVPUS \0P$0M PH0:L0 0``H`h_PPP<$]0S4 0S ] 0`@pp?3.QRSP㔐  P  P \?oR20S c R㔐Q OP\JR PMVs `$p(,PP00 00SrP@T0 @6$p0(,PpP S 00 0 P@T 0S00S`<`:  0 P pY 0߃P- 0P R ,00S R00U  P3 0PW 00S*%S㔐R!0S  =6. 00q8P p<,@P]RSQ \`@ T& P@P \\TS㔐e ``\@ 0BP 0  0?P ` @P \\Y@HH?/ ` `Sdb P\` 00UZP  0 ``^PPH [:PCZP HHH HL0[`0L* \P20;>(0$00PpU 0@Yᠰ @yHv대`pPUp`K|0` B  l` 0  0(TP`ph !ЂP ᄁP20K D Dp,0婂P`K(,5H|,20[ Se S \` R` 003 Q  R0R`U`M PgPfhYXVSu u t 0t @xO@q fo xn tIi $@0P0 0g0 a"0S0$0[H@P P0U 0P[P0U [0`$p(,P  Kb_.o> f. hP1x00x0 [w`@H`0V00L0`[Pb`O-PTMb Zi @` 41q0=>p0=~  PP` /0PE `0S S S T@ P `0S 0 0 0 0GP0 0 U  Y [ 00  [ YU,@TЍTDD?/Z((D0/j j Pi k ,i l G-XMp@yP `P@ 00  0 yP 40S0. XЍ UP Z 0 yP Z8 8<3P 4PPtP 0 h ,h O-ŸM2M 0`Q<000 Z 0Sq p@ lr < p A.=~ *u9PPh 0#S( D0P$  =<0P  @ PRP R R UP)P tP4 @ R0 @PtP $K(0K$ K$ ?P0(X PPU 00   P 0@PwP0 x0 0< 0 30ݍЍTTD0/i<<x0/_?Q(g g he Oe  d  0A-(M@ p`pPw .P @PP ű$0S0(Ѝhd @-@ XP 0  @0O-Ÿ 0 M* `@p1Rp! P PX  PPQ P Q0p!1 0 2 30`ߍ.0@SPX &0@SZ00 0P_ Z00 0 c P ZY0 Y  0P 0 Y:[ 0 0 X  R  XR P 0 ~[MMA-pP`P@ 0 I 0P 00 $f @-0AL. R@O-0LMp  D@00`P840 <0T8 0 0'00# 0(<  .  " |b*. ,`Hǂ@# @!P(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 0< <<8  00$00 Hꉫ#EgܺvT2\ G-PPp`4 W* 0!ᣑ000? 0"@@i>V0: +A0iS@I"p ` *80V@@p`F G4\0P  00P [ h[ p@- ! 1 0MPP0 00@( T/ `  !? 7R8 bx b   x0 0 0 30X Ѝp@Lh0t T,00t ?Z t>pZ LZ C-<"<2 0 M000$2$"00 @00$ p P`0R   0XS 00 Q .. 0N l!\1 0 0 30 ЍQ  Aa 000C 80BS.R ^U* 00ꔐRP 0ES0 S S^*0W 0n(."4n4#00 00@^0 8< 4^*0 8<==<- McP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0DT;:W TW A- rM`PpP: U@ @X0^00pAtAUU0OU$1 000TAΌ L=RP2  0 xpP# 0@SP 0 0 1 30rߍx0<0 jU\=@0 aP WT00Y 0P0ꗏ9B9U U 0   M Ѝ@8 -- M0 0 ЍЍ/--0 M0( 0 oЍ Ѝ/7p@- MP@0x x` 0 l0  `@P@X@0@T  ЍpT `7(@-HH1 0M` !000yzp @P   zp !y@ 0 0 0 30'ЍyPpW @@T PU 0SP@^TY00@6il6 0p@-P0@ 0 p0S(0PS(P,PSt` 0`0PP 01P 00 0pLqP 00 0ppR 0@-@ 0 0 0 0 0 O 0 00@- 0 MP @0FS 00P 0 RA?o20c Ѝ02 00 0p@-@P 0U0 0pp@-@PS0PPS(0PS(P,PpO-p0Pn `,Pf 0@00 S S0 S S 0PT 00k(4P"<8#8U 07 0P,@P! 0P0,0S S S@ 0AS A@PQ% 0 PS0Q0000QP  tQPP0@}@PPP `P P O G-@ 0PpM,0(Sy:  (T] 0 T0T 00SP 0 RJ@D@T0`E   RA 0@D@D0`0S* T0U 0 1  @D@T`H 00S#0A S0偠0E  j>0S000 4  Y-0S% )0p@R0ppR(0pR(p,p@Ѝ/QP  (,@(~  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ07p 0$  $ 0 1 Ѝ0O-PTMe pE,P@<@0 pp5SPb,aO`P^ 0 pp(SPS,PPU0 @\ \G \Q \A pp 0U00S 1OP, p0 08 0@ ` R  R2 R[ R 0 @U 0 `YQ 0JX0L 0 TЍ @\L@ 0U  0⼰  50 ` ` 0Gp@71@- P0 P  000<890 A><à 0 00 AЍ00 01 0 0 0@-S@ 3/@NO-M@Y Qs` 0  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \ᧇ" 00\|3 L0 1 00p0`0`Ff& G B$"HHࢆ(0F0C(6# B B("HA!0C0C1# B B%"AA!0 Ѝ ZTr `  !  P 0 p 0 J0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧇# 0Z" Z Z 0 0 0 0 0 p 0`\\ 1L0 10`ZZ- Z) Z+ 0  p 0`p0L0 1 0p0`fZd Z Z Z0d0`YHp`F8p`0|0x0t0l0hy7X> T< ; @-@P @ %J0/0 {$; p@-1!00 P@0 00D@1011.T 0@\0 S@ P p0  00C1000L   00LDLT; ʚ;: 0  Ã0@-lPP B1!1 M@@XD0 #2 AD ( @iK  Ѝ0p: QA-2"00 P0p 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> `0@C0a`.SM @000@000@ 0@E0C2Sp 2S 000 @ @  @0`00n l afAdaDn l lA`00@  0@A00  0@@0000@00 @ @@`i$@8 S8 O-``!P@@R@@ǟ IMMčpǟT ด`D4T7I0P@0 0 4p 0c'7 0x PT < 0P00U0<06080H060`0X06 0` 8 x@,0, 04P<0, R00S D0`1  P0 R 0 0 0R P Ti00S2x0S 468 0/Hp岀0p 0W9 X%U80 P?Ⱀ-h0 8h봄TP 0t P+h 0 %hq0SgKP I0P@0X 4 0 @$3 0 4 30IލЍX t 00g/ X,A0S <0Z00S D0`1   9/QMh  `h@0S H#2 0 4 30@IލЍOKP4 ("(#8 80? 0LPhUN2p@0E?l020B?\020d020h0 \hL0@C0DSL0OT 04  SD$#$(D(H"($H. X  p lhd0H   HhXd 0  11`  p0pG00  .pG@*Wh 0 Aꀑ 0 䠉  X 0  p@ 0 t``ppG   pGEhT 0  t`0` p0pG00  .pG)TʽoL  #h>ꨅ8|6 $ H6 46 `5   5 4 44 \03 0d3 |2 2 1 1 1 1 0 / O-lM8@p PP v0 0HjH` 0  0^`!0R(0ᴴẤ,  |&| p&M B.P  SD00 0Y0g`!R   ;`!R0  eW0  0Pa0  0 PM  P90  0P%0  0P0  0P0  0P0 0P`!RwXy PP Q< `0Y  0R  0)g R 0 R  0Q(0sg Rn 0 Ri  0Q,0sg RN RK 0 `SL 0sf`!R   80 P 0 P@0 P0 P(0, 000Z lЍ   X倂 O40@h" 40t e738" t 0e*/ &" t 0e/ 0! t e/ m ! 0t xeŸMJp SuflЍ lЍ@0 o $0 n 0 m 0 0 k 0j0 i0 D(. - - + + `+ + * * ) ) |) D) ) ( ( ( d( D( $( ( ' @-@`00AMM0 400p00 Q=PP0S zD 80 0 4 30AލЍ.5nh0,@-@ M pp P&=`PP 0SD 4 Ѝ00S.S 0S Ѝ & p@-|0|AMPt 0 ` $ 0 @P &8 00 0 4 30Aލpp@-P@Q`  @Q YbPV 00pV00pp@-P@P P  ^U00p4  0t QdU00px$ 0p@-S@P  \ \U00p4  0t -dU00p#  p@- P8@@T  UpT``0t  dUvO"*(@0@ cpT# \# hQ@-@ ||  Q< 0 TPrH  0t ci  O" " |" $  p@--@<Q  TpH\PP0t c?T"*00@ cpL" "  P} @-@ P P= 2 @0R8  P@ &@Pm P.P]  P:  Pc  P P+ PH Pp P\ P HP4*$!3 (0/Qc3'}{)t/h\%R! O-QlM@ 0 R  $ Č(Ȍ ,bH"̌ $DLbD$a!l(,2"$.,l$"a.T!20dRSN|B bD$ChbBdAAB aLƆb^fL` aBW E RnH %%SRr%/"bRlQQNT !C22c1LLJrg`\ X0Pp qN$  [X0 \ `E Z H Y K , T 0( d P0$ H 0 (!D0 0 0L0@Pp`/84`[ DZ DY DlЍ00Cd~W㔀R@(H  @/`lЍ`Z -LY -Ό8-  igMbQ  <    @-@P 0D .R S0@*ST .P@Q QA.@P@@?5. @-$MP`@P` \0pv> 00pp@ pp_p  /?`Pc$Ѝ4 C-AQ@P p` MO0P?͍0,0= 0080=͍p000\ @P48@LpHDp 0 PW )0@S2 P_P0⯭<0H0 0 0Ep 0(00H=`0= <<0@PV *0,. 0> 0;/0H=0`F$`` 0m x`d0 [ 0  p ( 0$p Y3 Y@ H= I0R# P0⯭<0H0 0 0p  R 0S .S 0S 0S00S.S=L@0@=00Sༀ@tL 0@d/ @@S[ 0 p 0 D;S0f*2墏$0#8(08$0( 000@ C0 `CBZ 00P<0p0dd +[U@ 80 pU Z8@P@0 Z}pI 0 0@pA 8;0 02,0#80B; B00a0.0 .0 V0$ V@ A80 Pp <0 0S 0D;:04H+B 0?R0S d d?/00<*: 0  0 30  ݍЍP0⯭<0H00 0 p@  0.p(ꠉ฀> P0⯭<0H0 0 0p0< 0@08 BP0H4 0R0IY0S ?/=00S3(@ 0dR/ pD{^ZP 0 p < 0@8 BUPH=00Sc30<pd^/D{ 6Z 0 pd =00`C 7x @P T T㐀 Pp` 0U0 0 FzpF 00e0T0PEo  0 lp7<0P@p8`@C 0PP( 0 Sp 0  P`=00S2@`20@DKx0df/ `Y 0 'p .P*=00CF@@LFd@R_ 0 Y 0 p  0D;d 0 Y 0 p 2 0d Y 0 p `0pVD{ -8P8 zO d0 tY 0  p 0SD[ =8803Y t 0p p 0DK`VD @0TF1!PDQp ` 0  PPr DD0p@D{ 0pe =00YU  0 PX=00@C+Y =00SCD`@R_d 0 Yp 0 mp9  d0 X 0 ap- 0PU0D[q* p`zOUD[h  d0 X 0  GpD@ Pe @0TDKV:UP 0 fP=+L0T 10"3d" 01;L0==1;L020 201;L000301;L0<=1;L0L10 1;L 0  p 0D 0 S @10k`V! P  @$`U 0S @` 0V4 K 0d lX 0 p @T +A0T 10"3  01;A0==1;A020 1;A0; 0  d    P t Yl . $ * X    X  t , X    ====== $ x VUUU  | p ( 0 4 D T  =+L0T 10"3  01;L0==1;L020 201;L0L00 1 ;L>L CC+A0T !1 0014!;A>A C@1;3@ U 0 +p@ 0 < @8 BP0Dk 0PCU.ȁ@pQk@T# 1 W2 y 0d W 0 p=00S#0@0P0p"PP0p@ 2U/D{xW` 0 p < @0@8 BoPH=00S}0@z0S0p@P2S/D{DpNW` 0 p{  @ ` 0Pr Pp 0 DpD{pf 0 P_ 0D0D;P 0pS 0 0PL $0D; 0tp@ < 0@8 B P60@0 0D 0d _U 0 p X <0`@8p@C 0`LPy,[ 0P pp 0 @;Ph 0 pa 0DK 0CY@J.0pD{` 0 pK 0dA/ U` 0 rp>  0 p6 0 Bcp/ .pP 0 DVp" =H{` 0 PPV *0,, 0< 09/=`F``pH{ 00 Qp } 0p E%p - P 0 D p =H`  0n PPV *0,- 0 08/=`F``H00 p ~ 0p p -P 0 Dp =H`  02 PPV *0,. 0 08/p`F=P`H0 0p n 0` Kpy i-@DK@ 0 pm =H{P 0@PcU *0,/ 0 08/=PEP_`P0 0pNH{ypE 0 p= 0 OjpT5=00S /0 S00=00S ?d0RO 0 SP 0 Fp `0 dD; 0S 0 7p  d0 S 0 +p > @0DKR .d $0w/ S 0 p'`< 0@8` BPd^ 0P p pDK, 0@,,d0v/ S 0 p H 0 PM=@0@=00S  d0]/ aS 0 p PUpDD7 1R@0`` $0@@@@=0Hp 0!Pl ;W` *, <0@@ 04/D0$ pG0- p UD0HD; 0D S\ @ 0 upA 0~- <!?C0 S 0 o_pt*=00SK 0D @C@=00S 0 < @8 BP 0DK 0SQ`+C100 SrD 0 o+p@0Hk=P0 0T 0 Np "0 db/ P 0   p 0 p @RWT@ 0 p LT 2@$` 0`@T0DK: 0@ C` PP@U3U qpp@` 0T0 0 Fps 00d0U0@D= 0 pd 0 p] p_TUp 0p |pH pD@nȀ=0@帀  x VUUU L  T 8 H D  d *H d \ X d P +E T0T! ##,00 !+E T--!+E TT" !" !+E TT  # !+E T,-!+E TT! " !+E T 01 ;E 0p `VDK@H@- R  MAP  ,@0@(@@; Ĝ0P ЍX MM$000 1 2Ѝ/]A-PS`/p@@W0 V:0 $4"48#80@PU 'P(0@0T0T0@DT0S$0l0 (P@ G-0pW9:P0 @4$#4T0/` 0 4$#40 @T"0 T4$#400S X0T0 $( ,0 P0@:(00A-QMp$0PS@` 0! $, (0v(`V|0Sx(0S0! , $P, (0V3100'Pi,0 \, d0U4#4 00,004#40,T(0P0T(0 S0P$00Q (0, Ѝ 0F#P5, (` , Q/:04800XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQ 00000  0C Q700C20@?D0 $0>0 Ԥ t T A-Pp@HU`. T @0 x0W``W0 .pPEVp P7000 2000 S70Q00 V00gD0T H /o////`@-` @0 0DM p0<00 02ZK0 RP100000C0< 00 0 <0 30DЍi tO-d2drP0੒ 0 M 'r @rgqC8(0,B刀B$ C@$AR i!dP @`3@CG*TNXWmY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 H{p# W0Y[0S    00000000SW 0 Xp@@ 0 DMp XW  0 M@p Y H_0$ 4 Ѝ @: %I$T, A-`pP0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@( 0 p@-M P@ ȍp k`\ p Ho4 (0 0 8 30ލph뤝0PRp@- `@{PPP0 ?p@SZ00pPRp@- `@YPPP0 ?p@S800pp@-@Q `9PPP0 ?p@So00pp@-P@SP p@ p@ p@-@P 0PS <0S 1P B00p00pQP@- 0R R  00p@-PP Q@ @Q Q Q ARt032 00pP @pP Qp@-@P PP  U 40,E0S 00p UPpp@-@P2 T 0 4. kl\ ʠ5 6} 0p0O-MP0@,p쮟> 0S @P00 00. L0P-Q000Q0 0 00A SH ` @ a0`A L @00A S,TT Љ0A>01 0Q. pQ$ P  ( EQH 0 0@@0SЍ0S0 EQJ@(L0L00+S -Sp" 0 C R0SL(L00S 1 CR  R $^iSL +ISI NSLLP@,uP L00(S t00XS PLP0Q Q0 0q@]z T0Tpp(0$0<<01$C| Iz0 |0S%$0S| $0S~0$ %0cS0`S%0 $a@V@L| 0|e0$ pC 0pS R 0S00 0W0pMWW'r 0+  |0pWS \刁5A\ |:L*0Sh&BS5\l :%h PPP 0S T:%PHF DB @"00 RL000S 1Ѝ( T0K@Xpp$0y XRdLT 0Rs 00L0 0R 0l10BS ER. 0 ' L000L0Q P00p0L00@@ 0 0000 sP $0( S B  ?R    < (08m@P@07A0C3@0 U  0``R 0RK`FPES[\$0SVU DPV P嗀PQ 0  0z 0S P  s T7@PsPU&6ArP 0S \ (70jS k&0B0X!{[ 0> \PXq {Pg~e~ c~ a~ ~pP   ! .l0d PP P d lR0(0`C 0(`S 0 B  B PPR6ag0@0ms0S 1%(0^ L 0C10 |L 0B QQL0{ (L00C Q2Q0k (pP(d Ta@`T Љ T\@}T ㉐0 CL00C [!L 00 B0C [@PX$W knS ~PU P~ P, v P}, P ZpPpj(~pPPU  r\` 1@P,`rPu [X0S46S l3 rP! `3z0 !1040, Hc2`VC <0jV00S "2qP P3w[1@D0Dk6PCX 0z%vz@28 0S  R yw 0rzX00 0@P!;1qP PA}?} =};} 9} 1!Tz 1Zz 0[!H1040 0R ER R 6p40 l@00 0lP0x LT n0@ S 0S{  0S 0% 00C?o20 0^ 1 0 zW X!#N h0#!Iꜘ @ |A5? |h N?55?P9?L@LP@ qP L0$0CL0qPL00XL0b h0%P56BXE\0#y%y 0Q56Ut 0% 0# 1!LP00B(0 0@a`_ ER@(C`v 0@PXbP 00S0 Sv@PApg0GruW0j0 0H mypq p0S% D0$^L|R GQ@ `L` `@( 2}pP"2xpP 2%Sv,0Ss 0%P dPR 5qP{0T X5F\@!$o 0@( #1 0 yW ~ 0S \3!:k cR R4R 76K0cXp\0\ 0aP 0Si0X0f0 `S80S 0SS V@TP{{ {{ { 0SK 4 x40SC>K 0 %Q6# 5# 45!l 0@lPvp0l 46%#p5\ [0n S ^X0 X 0]xVX0@SUN\ 46SI50jS\9k&PBX 0ZxX00\ 46SX60kS0S0S |Ps |P\ w 0S60T kSR7SP{{ zz zp |P |P@ W 0S \ 070jSS7X0S ^5 G X% 0w 0% 0`P8 X02X0 0XS 70jS# k`Q ^! ge6C#: :X \0^X0 qH8R 006\00X0 (0 00M 0Ѝ꤀ Q":?C0CS S $4c&&0C0c2///A-P@U `0pS @ YP 0S U@Dp@-P@QPMP0 S :pSSp 0R:pp,0e0$ @fh0$ @밲 A-P`#@ T*P- P0 pPW 0P P B $$P W 0 P TC0 @<D0 @$E0 @褱 l 0 0#@-@PDQO-^ `Pp  A@ 0S 00CS 0\V0 S  RYWppXpQpW\`\\U0 SP\pꜰ Q@-P0-r-w0-0x000, 00'000S wS -S rS  0S /xS  / p@-^ PB2 p 0 pP P//0S/ S S/0S/0S/@-@ᕾ0@0T S R RT/ ?/PP/=?0PQ/?SQ 0p0@- 0/x  ??SS 0p0@- 0r/8 ?S S S`/Q/AQ/Q Q/?0 @0p0@- 0PQ/?S0?/0?/ᰭ QP0 ?0/@-h 0  p@- "P 0P0(@`W P|^P0SpJ0@A$E@`p@-@P`M P0ES  aЍp / PT^(0S 0 0Z0 h p@-@PpP Q 0S P$0PS#p@#A-PPp X P@PEX `#P@`008 `ꈫ O-` MV " p@IV PP @0SV F!ҩ0 `F`1 Ѝ Ѝ #` @- ^ x 010C. *  $    Ԫ A-RP`p(M @x 0 @0@0 P0 P0` P@ 0 (Ѝ  T00 5CS /0cS#:3 3Q31:0CS! 2#0p@-PP@ T Pp S 0\\0 0p80L0 TMP0 Ȩ O-PM`p 0FV"S00 0\ PȻ@P-UN +UP0+ 㐽p#"@0 P00E Qa0ESW0EA0ES70EVt PSQ @0U0 V)  `(q 0T00S0 S` 0J0 ЍS T 0P 00 0R0  Ѝr `00XS 0A0C0A PSVr `Pr `0?0 oiꙙ 00 0M0ЍXpUO-PMp 0GW"S`@ "P-TPs +T [ ?0 0Ż0 㿻00DP p P:Q PS \1 !ʎ\ @00D ^ a0D0SW0DA0D0S)70DS&| [YQ PS \!"00"00 0S \0F0 Ѝ[@`K ?0 0Q  0J0b 000D00 R0  Ѝ[@`f0TI W>0 p 000Dl0T00XS<@ 00DA B QR ap >` R0T1 W  0pt pp 0@`> p PPD1?0 k0p 0>00D-00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pg0p 0> 0W 0@ p p0@ p 4333333Ԣ 00 0M0Ѝk | 0 Q?0S @-N\-- Mo ЍЍ/G-PP`P VV 00 !PER !U6@  PG0 ܿPU pWW@8yPp X1 00Ѵ  @@pG  pế00  0@0 0ᶴH0B0 ➾V,C40 ╾ᡴ ܟ A-@PiH`H0``@p <>T  R A8i( p@-@Ps00CS0 S  P `0 Pjp>`@-@P Q 0`00@P060 :괞 - M ? Ѝ0@- 0 0 MPP000@ T!   " Ӿ0 0 0  p h0 0 0 30 Ѝ0H0H0 T00D0 :[g\g M NA-pP@`' T. V5 0S 0S 0P Q 00 00 R` FQ`00`6P0\ ⼽T@@p0\ ⳽V$$|0\ ⪽ Ԝ a bO-ß OM4`lPP `p@dh V Vv Z.` ƯP 30 00 [ .Q Q\.Q a :0 壯P 0X [ 00:[.[#4N[0Q.SH Yf0IS00_00 I Z  0V 2 P00 0 ` `0 0C SA: $0  `0  %+00/00H!81 0 41 30EOߍ:[ 000$0( @,屸0 0 0 `0P P00 ZX00߾000 ռC<4 *PPI U.R}  :P qZexeLc]ș b\ BO-`PM@  0X0 X0_( 0MP? % 000 00 P @ p SP 0 "00P > R  R 0 @`V  pWI1:pG`W:\pG`S C0 ^ ` Z`pGA R H 0 0 H00@ߍ R R0 S S   P} ` Q PD ]P@ !T: p; P@D X0P@- #[0i0 Z  [` pG Ka   pG  Va ᣷XV P 0$P 䠊` `p R R R RR T * ዩP  RPB(P@D PT p@`V0  P% T ::`P ӸP !T014@1:q0 ⍻0 0@ 0 @ 0 @0`pP`o, 0@ 0@ 0  PP P 0 `@p Ԗ t < ^@-pp10LMpP0D00@I LP0`S. @.0 rP) V) QPP0 0 0  <P 0   0 0 0 D0 30LЍ;PpPPP O@ T88C?F/ 8X\\l̒ [$ C-`P@M: pPU, Y @@NO00叶 0 ;P0   0 Ѝ|@@JO @T Ѝp;P P$$C?R/ ⥺h O-||ʟ UMMLō`z|ŝ`PpxU別( 0 (0S 0 S00X :0$0(%0P,0 0 @[ S#p`P ,i0)09 0 L5 30UUލЍ5 0 0dP0 $03/P @[:0CoᨂS  Rj  P0 `PPP0,W4'4p8#8X 05400 0 T0R?HDL@08< `\ T^*`P0 C 0`PS0 $03/PK @ Y& p@ T`0@W4<0S 0 S  R0n6P0 0S!0S H0S0P况P0X`*\0L 0R *p  俺H0`0LpH0 00S 0 84H0S 0, d0L P0QH RXK p p XPH `BZO[P0 0 0PS ! R  ȠLȠoQ \ V SppQPW  WX0 B@GAq 0SPSPڰP^!P"@Qp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @<1L0X C0 0CS`:.040$0S?0 @0&@Pe0 s V?@ɴX00`VX @`0@``(PK S  C'SRE 0P 0`~0%P `a@1V?Z/ (0SW]?Z/ ׸O(0P04D0,0^?R0 0 @P0 8 VT D0,1Q:*,pPmP P`Pf0` CR00V 84,p@PPPpQ0`P@ CR00T@थP`@:$03/P `2,0D(`C 0T00Pu  , D00D0Dhl 0(4PG0 g@P0 D VH0S0P T D0,1Q<*,0P,0XLp@ 0% |   N/81p` V `pVTX 0  0`!L1 0 <0 30GDЍ(aPPE pP 6P@M P0 0 0 0V 0Jp `pP0 00 0  0 00000pCRp`HG} } | XDp@-M`@P ),0,0   0kЍphh@-M@ $$ 9 Ѝgg@-MP` @ݶpP0P0 ɠ@0@ 0   @0PܶЍLgdg0@-P MP@T 0t  P00 000[ P 9 @ Ѝ0@TI 00fffA-a@P`PM^ Ud !0  `p0S  H  0C QA0 .SNV 0  @Ѝ0 XR   9S 1 @ `F V 0  RU 8 <04 c#!$c4" 0%\0m0 U@n<0  @S Ax x O-ß3 0,MPQ0$00@` RM Pg PU0@:T000 0j Tl 0ßP P` ` @0H  P [ `VV @ZpW` p$@WH(4"<00S W0G> S0 sP d ᫴(rJp<0p ❳T TS / 0 !1 0 $0 30j,Ѝ!1 0 $0 30_,ЍO@:TP \p ᲥP :Z<V2 0S 0$ S$!, P`qIp0p QV T T0| FUU0| ><0| 7F0S ep$@r @.T`p$@WPdbPWp? x w `=4=u |u @- 1 0,M@P0$00P`' U- 0p0H 00000001P*   0 0 $0 30,Ѝ 0 L0h0 ٲU0i<0 вP\; u :t ht O-HHş tMQl@p 0 R P P* / 0 $4 0 l0 300tЍTIP`<0T ⛲Tu T 0S0` ⏲x<0` ∲ 0$40(,04801@ R@0`S U P Q 0S0@S Pu0Su00 Y0S @\T<0000j:000@T `0> Zg 0Sg* 0CR00`:=t"2 0 l0 30 tЍOP@PUF*0: T00S DX"H 0l 0[P3@T` 0Z00S RZ  @T0`zu YPr S 0 S P0@n Pa0SC:ų 0 Y Y Y@,!0Q 0  HP dx8 @R0PHP`0T ✱W Tt T0` ⑱uC0< P@0 j0~ : L0@

0P000P @ P b00 0 PZ 00 jP'0S$: I y ?J0C0]9PPT 0S  0CPß01G0 8APU0 Z 0CJ P&JPP @0P 0000 00#P0  0 0 480 04<tj i pi O-P,MPp@P` T 000S000Z00٥$0 0PP`W0 00 @P $ 0R00SQR+X` P  0P 0尰0  VP`P尥 [XhU,Ѝ CRoo$ b  B0 S $ `R``V8 PB0S0: `P`$ R``VR`%X00S P0D0P \[ TP|[  0P \ PPdP^[ CTs[H U $P` Pc z qP 0S   00S S0S S ^ S@@T000S00忪i0\#00% ^@ [ @@ S@ U80h0 00De p@-@PP` U 00F G p 00pt060 ĮUX7<0 ⻮0 0@p貰0TS00Le ,e  -M0 3/Ѝ/0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04P0 q00 jPd 0d 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04h0\ :00\ 3tc Tc p@-@PP U 0S S S 0p@0/p0p@0/p40t  00t b b p@-@PP U 0S S S 0p@0/p0p@0/p40 ޭ00 ׭b a 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 ⧭00 ⠭(a a 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 n00 gD` &$` %0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 500 .`_ F@_ E0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044>,0Y0,|^ e\^ 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044K?G/Ĭ0a0G/⽬] |] 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04iS?O/⌬00O/Ⅼ\ \ 0@-PP@ M T 00P00 Ѝ08080.iT q[?.`,\  \ 0@-PP@ M T 00P00 Ѝ08080^/DT [?^/;[ x[ 0@-@PP M, U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ044>a/00a/Z Z 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044j?g/̫00g/ūY Y A-PP`@7 T- V: 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0t A0/Co<0<0m/~(#[?m/v Y X *dX A-PPp@`M2 W8 T& P R P P P @ЍPX F 00@R X ЍA|&w?q/700q/0W>q/' P` Y0@SP $q{hW HW ^(W _V p@-@PP U  ;p@8080,U ?,XV 8V A-PPp@`, X2 W9 T P  R 0 R 0\A/V 0A/|| =/⳪d0d0/⬪XLL?/⣪W0?/⚪XU 8U U T 0A-@PMP` 0J U@ 0pS S  P R`V V V ЍW $ 0SP[ 00Ѝ W` 0SPVD ll>%.@T0/0%.9 Pp %{S lS 4S p@-@PP U p@@ <0<0/U$ >/ (#R ?R 0@-@PP M0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ08080/˩U ?/©Q WQ 0@-@PP M0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ08080/₩U ?/yP {pP p@-@PP U p@cD00/eU((?/\p@PP O p@-@PP U p@D0D0/EU,,?/<p@yO |O p@-@PP U p@"D00/$U((?/p@O N p@-@PP U p@KD0D0/U,,?/p@8N xN @-M@P0.S00Ѝ6@-M@gp  B0?R0S Ѝ 00 0̨0CЍP 0S.G .S > @-.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S .00 R0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 / H0 00/L0 4# /0 48Sc B P_^p0Q ^ QC (00H0S 0Q* 0F S0S 0 `  0AS^01"0!0\Yp 00o(00@$ЍATw0S"@@A@pZ ^@0Ġ?  0^0A>Sp0pSB000^ 0AA^ AN[ ^& SQ0SP5 Zp? 0.$ @C /Q Rv?}/P 00@G0?Q0Shv?}/P Vw*p.Y P LP m?.PݣB= = <= p@- M P0 `00Fp @ !p < 40 0 1 30ލp@@p  A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ@ \ Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ W(000 R!  Q 0 ARL ?R@- RQ0A  RL ?R.00C'(00/C/A-@P`TP% UVT P @TP 0?Sp 00(00QSp@-`@P ŋP@`VP  0R p/pA-PAUQ?UU@A`pp W ڀ1AP貤(00譤00ꩤ?00Q @-A?SSRB 0@S A莤00艤(00/-- M ЍЍ/@-M@ *p T ЍR/0S0 \ R 0S0000/O-P MPp 0EU"S} `@P-TR +T} Y ?pi`00D" [*SP# K@00D P a0D0SW0DA0D0S70DS| Y[SP;+0S \0J0 ЍY@0Te UGp Pa 0A0C0B QSlUPPh`V?pa00D£0 0R0   ЍY @~0T+ U# Pp0a00D~0T00XS"@ 00DAA PQ0Pp>cj p>cP0?0 ⊡BPp>c00DZ00XS UPpb 0N00XS UpbPPp>c 0?U0@PP0@ p>cP433 5 00 0M0Ѝ| O-@SM \ YX` 0pS000!R !01 MPP E`#3`7P*Q30A 0#1#2#4#8 7P 6    U 0C  pSr[P0 0@pQ 0S  ЍT 0 @0000@0  0 03 A-@`Ppۖ0 0@ۖ$0$ 0 M Ѝ4 PWp@-0 000St@@@pdddPPK9@PK@P '0000 0 tHW4$Wp@-P@ጢ p@G-@`Patpt0plp 3 T  40 ے   G  (@2 1 A-pP@`  @ f000a@P p@-@PpPpp@O-@b@B`M@ ( RpPv r@0p RD 00m^1P[ 0S` P U [@0Z P 0@[P  0`V P:Z P4a`0pS PP @T P 0S  3/0S 0PU@:W 0@@00ĹY Qx00p@@tЍToЍ0<0 0!긝1 UBލЍ{P (z@P  4/P Q Q 0 0ා0 00P ^0 0 Y @" P 0S 3/ H000P FX<T  <. @R $ę0@-@PP$M U! 0 P% 0 0   0P $Ѝ0XX<0H XU<<|0H Xٞ@tPX+ ~+ O-@PU  RM `100Xqp0S@ @@@ P ఀ $)A0PS,00a000S 000  000 000 000 OJ@00044<0 Xmt+ h+ D+ <+ 0+ * <* (* A-pP8  0S@P$ 0 @S 0`PP0S PU @P <@U0600 N 0P@@ P ((<0B/X NTM( O-(ğlMR  0 S X 3`000Sa# 0S00 =#3  04 4 0P YP|3|s|0@p 0V^ p p @QS  QN ^P0 Sh @p $ 3/0  0PY@@RP00SS" 00C0T@lЍjxB0@@@_d20\ 000SN  R0200(   @(,0F @p 0TTP 0S 0 @00D00@00rP 0 S PW @@(0XS,  , @0 R1 1S@X 1 0(   @(,06&>I/X-0S XQ?I/X!@lЍE?I/X@^(  (,0l tLddLL@KpJJ<I(% $ b$ aC-LLŸ DMpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W@!1 0 0 30^ЍU00ì?dPER ?\00S T?* S 0  B1<0Q/,0A!b0\P  @'Y$0`0S00 S0 p@` ; 0Q,00\P  @Y0`0S00 S0 p@`H; 0Q,00\P  @Y0`0S00 S[0Q!/ b !S : 0,00\P @Y0`0S00 S;p: 0Q,00\P  @Y0`0S00 Y" 0 p @d``p0 |@`t9 0Q,00 \P  @gYd0`0S00] S()Q2?0c01Q 009 00\P @0@GYD0`0S00= S8 Q00\P  @0@.Y+0`0S00$ Sd8 Q00 \P  T0@Y0`0S00 SU3PU/P7 Q00\P  @0@Y0`0S00 Sx7 0Q,00\P  @Y0`0S00 S_0 400080 0@<00\P@00D0000 0P0 &  Y0 `0S00 S8 0@90@ S0 Ř Y0`0S00 S!Y@0&  `0S00 S00(&@2?2c 1 R11Aãd0Sâ/c1S0c05\P0 0\YY0`0S00R S 00  @0  p%00 S0R`05:4 0\P  0@0Y-0`0S00& S0 p@`0\PS00D4 0 0@ Y0`0S00 SY@0#  `0S00 S0 p@` 0@S 0 @ !qp  mqp  0@Sn R-Q Ry0c"QÁ22"0"b0A Yh0 ^ YP ` R  \P Y0`0S00 Y0 p|@V`q0@S 1Yi I` R  ` S`\UPs 0@ST P 0P Y   R ` R  yP<0`p p@x`10@ S 1h Y(0`0S00! Yh H " lP)\(\ ףm 0   ,  *\   ,  @  T  D   D   D    T n 0   $IQ8   4 0@S 1 Y0`0S00 Yj 0  0@ P  0 P$  VR\ 0gS 0` p`! 710 0@ ! },0L!?$A1c P0 T?"dN2c 1 11N @1?2cQ  111@/ d0 S  á/c1S0c01\P0 0pYm0`0S00f S082Q0,00\P YYV0`0S00O S ` `o 0P 4 \75C-MP@`ep<0@000 08 @pT `pRpFЍL"00Ѝ@-$$@M Ѝ$ O- M`p@Pf뀠P 0 X0X 0 0p0 @] Ѝ@ Ѝ LO- M`p@P7|P 0 T000p 0~@/ Ѝ@ Ѝ L@-0N \0N@ T \˘T00\˜00p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-10#Lc\3j*0Sn SW @Q 5?T0cQ@҃01Lo 1fcf Qq P@\ |q00Ⓡ?G1c0 0@1\00C L``S0B0S0BPD@Q``@P QS5 0S l lTàn 000@002c2cPÌ 0;S0C l là0Tc\0#3S l là)\P*Qgfff$I( ף@-000 0,@ @M Ѝ P`+A-0 000SP``/0S@P 1(Pp@ P n t +ps*19p@-mΠpl6@NaG` 128"&.2db `3c@Ey:E.€Q_uk9"mnףp= ף Sc$IųQ\(\ D Q(\)\x c 030 ):60 0($0(>! 0)Q` _P!!!0C0 YÏ(" ?00 #2>PVX c 0 ):60 0($0(>! 0!‚!!!0C00!)aYoÏ(" ?00 #2>[?@G'PE@Gp1#! +" 10Q,U#1 ?0 25:$20 #4"".<2Q  3 #L201d0T\`"2? B4sppp0/SX0 is c 0㛏"):60 0($0"(>!!!0C"0Y)Q_("Z0%R^PVXPo`v c 0s0#&: 600+$0+.P3&1110Bh#`V :+"#2 >t3P0 PcRP@ U0#V B!a!b0CX0 c 09$):60 0($0!(>@$ 0‚!!!0C0`$)YÏt4(" ?00 #2>0r/D B  1?A1c 1c0R@ 0B05@ @ 502c,%2c2A@" "b1C S/  0@ p0\\%\;#吅  00u!ό#1 W?0|:5&  +4Ϡ! 5+111A V 1# 00! C2 ! 02">"`V0`000&  0@00TPP@D0S0@@ @$ 0Ѝ& vc 0 '):60 0($0'(>!!!0C4'0Y<)("0,".L<0@0P<0000' 0 P<0@0PÔT 0 O-`@PpM 0S*  U 0%-> ZP0>Ÿ !"⑳<0  0  S 0 P00^00;0 S! 01P0 U 0~? UP౟ !"; 0U 0  R!h&0pP l6m&NSp@0GSH0P0 0Z0b 0S0010ƒ!100[ 0;hhPx@2[ O\1X00 1@T$ <T=0 S0S >S@ <S*S0S -S0 C Rp@0G100H 0 b9@h&lFpFtF0N  0hZ@1 0 0*T@T -T00D S0@0JSn0S,S  ;S  RjH .BL Sa ,S;S\d00PU 0,SRx@PL 0SI   HLu& `h& ltp&l6g.D<$0(,P0` P`ş p%cR0#03 1d002c2c# b?0ppcW"Z  ^  R P`N |4|$cR*p$lpLP 0(,P0`p 04(p0,$p 00P#cR0#03 1d002c2c3?0  cRP c sP  RP0t#3>#!BcR*x3t3(p01c00,^00P00D#4p 8 00N  0h֐@0@ ϐ @s 004p80R'  Z0S  |*n a\Z R `S@ʟ@ < VP@@% .[y(  W.y5:IP % ^, Ό3# qdO0RS@dyWEVPP $ ` @E`E`ȟ(ȟ垫 ,`&AOĘ.hY11:hH.B Nh, ΌT3# d S 0@W `PLH@1S\` VPE_ 0":60 0 0Ϡ!  >00Cइ 0R ?#0Ϡ 0,ό~(C1   ၢᡍ  Dǟ 0R0 pǟ0 ' ^, Όp3p#p q\ ` V PE    U6 00cP:S8;Q$0(080` Pp@`PL40#XT YW W0#Qp? 00?0S 8@<W 80<8p< 0 5/P `0Z\ QX Q~T QzP QvL Qr p0`S P Q$% Q!S, Rl0S pWg 0 SdJ1F Pe,Px` BrIX 0S@`TJ#M @A 0S7 0N080+0g+P0P 0姾`@EOo [*[:[$4[4*[\4$*[B@#[1 "*[$![[*[[ *[ [$Č*[[ *[$[*[ *[$ [*[ Z2\}Q [ *[$ [$ R S X .`,^TF 0 FC9  0PS.`Z00æ0@T )9 F0 0 30MFۍߍ0/S <0BQ 0R/S  8P O,I@@K0 0cꔌ0@TU ZSZXQ  `p@@@,3OD $(004U? 0\ 4 Q"<$1Vp- ⁡ZF` R!X0@(` $,004^`Tz  \Os`0\ \0$0\4 \$!?8:[ S]0J08*S RX RXP 8ZC4PK L|p@W P0E+C;E?. @a 0Z`0Nh@@Z !P0Z0 @0PW a 0兑`mPq VPP  P0/SN0/SKSP0/Sn B`Fh QP{QPv Q Q@Q@QDQ PbR8 僯AN h 0 及 0Nh    Q! p j@P h`$0(P0 0 ^ 4Q"<$1 X W  Q\ p W`@0^ ^04 ^$0^$!? L\ @dv0S PW$@0W[0 S -=0- @0 R s Q t̔<\070A+- h@0`RTRPP0SZ0P?0c@T`↡a`Z` }Tx``Qa00=00 RW@0# C !p@pZ! AP $0(pPF̉S n 1 R X0o!0S 0J0B 0 10S01 R  0SO !0S RE00Nht0 0P000W @0A%<02sp ,僯B<  @ 0 hhNA-pQ@Z 0Sl00 01ɀN  hh6l68`P`P 0:S  IP `VpFPU N hu0PPT`VNLg@_ `S T 0:S*S+0C013ZS@Sa0CSY`P 8 p@-4P4@P@ KPp p@I 0 00P/X t,0, 000S  /0 tT<P/ (<@-\F< p@-1!00`0S2 n@P/0 00PU  0`PT p PppD` `0 `P@`@P t2<2d1x1=4p@-@PP H p@0s44D|$ $0p@ e0<|p@-@Q0 0PP L 0p@R44D[$ $0p@ D@0PD<P0 0np@-@P0P44 0D? 0p@ (/;@-0@`4M000$0(00 0 000D00$`00P0` `0 0pS`4Ѝ\/d8;@-h BR\ ZR00cSAT 0 ̌ p@-818!00@0PS4  m`P:1080So" 00P ʀ0h T 0S"ZV p<02@T_V C` 0X008P H00P`0`p t.L4.\--G-P@UH\PRp^@DtPEp`Ϡ pcWV 0 0 \V 超T 0 T<0BT00 W0p@- 00S" P@ `P008Q x00P  0P@T p 0`yP`@} t++l+p@-`@P`P U 0 D0Pp000\ Lp@0A0 PU$BT0 G| Th H D0@-00@S $000S 3/ p@- TP@Tp   03/P څ @TpA-h0`0pP@P UP   $0p `@ DG-Pp@  ?o2W0S Z #`v% :/P@D @p@TP0F0 ͂hPGP p` 80ÂZ p8HT0 ⸂ HT0Ⲃ꼿 l A-PP`@! ppiT KP `L2 @0L€[00#S €^"R000 (⁂A謇 p@-@R`P  p@L0X (fꈾ p@-@RP`  p@L0X (S< O-PB@ Mp ?0P2ܑܱ0 P2LB TH `SW !Q L 3/L2S"P2S`% @T2 W0 R S `@T& 0RS> ! L3/L2S @00P2S T/0#03T0#S0 P0P@T@@P20CP2P2SU PU Ѝ\00P2S `@T 0400P2S@4؅P ̄T A-`0P0Q0PP MS@P1 V7 T=p`0 80xq|qU8OT@D @@`@p8P1TA`NPP0@ 0 0 1 30ލd0P0 (uVHQL0 (ljT 0 u (u (  -(0( 00M 00Ѝ|t  --8M$ 00  0 0 0~ЍЍ/4t 0--M0 pЍЍ/p@-0 0@PX*w`00CS`0p S  P `X0 X PX!wpXH`s (\0\ 0 `00CS`0pS P X0X /X)(s (--00 M (0 XQ ЍЍ/r (--4 M0( 0 XYЍ Ѝ/`r (G-@SpP\ 0S:X' (S" WH v0` V V,* ᨁ0p0J0 ;PM`ꘂT 0 @00 `pp`:P,0`Vp C000 v {0 0SJ 0 00}vQ40 dp0=0 ]I|PD@0 P0 0CZv I|@ --M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-Q`PP@M8  9pP& o@P#  K0P S 0p@ 0$  0, 0 (0 0 ЍH0000@Ѝ 0pwЍ00>0 o 8H @-@P u 0#C@u0;0 l Rg@- p@-@QPI 00!R ! 00! \ P 0B RQ`' Q0AP R 0 U00SpsP ysP `ssP0 PW40 y 00B(0<0 om 00d 8 A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`2 0[1!@  x0S< 0[1!r@  x0S p x0SB 0[1!T x0S, 0[1!EKPKNx0S 0[1!4 @?   x0S pT 0[1!@@@J@@#J!@ @@ 00B S01 00B 0B P$R x0S p% [1 0!0 *R# 0B Qp 00B S@ i  x0S  p q  x0S np  ;  x0SV 0[1!x0S Qp  0[1!xX0S 0[1!x0S 0[1!~xM0S 0[1!qx0S px/0S 0[1!Xx0S 0[1!K pu pn pgs R  0p 0Z  [p 1- pJ pC  x0S p6  0[1!  x0S 0[1! I x0S p J x0S 0[1! |pD uppW g ip$ bp [pI Tp)_ x0S 0[1!] x0S 0[1! , xt0S (p 0[1!oE x0S p$R_0p' p7 x10S py  0[1!@x0Sj 0[1!3x0S pXx[0S pL@ x>0S p?  0[1!  x 0S p*  0[1! pP  pC p pD {pP m 0B Q^p 0B 0B P$R8 x" R 0Yp0 [1pP GP BP =P 8P 3P .P )P $q0 S  p  0[1p!sP $Rp00P P P }Pz xPu sPp nPk iPf dPa _P\ ZPW UPR PPM KPH FPC AP> <P9 7P4 2P/ -L P( &P# !x0S p  0[1!P P |P wP rP mO-@ϟoM M0Pƍ0PD L@ D0S 0P00!R !0s0m0d00 O 0SL   RR l D 0  , H /ܰ 0 G/@$匰` 00040h0\0 00@T `%T @T0PFU~ 0pJ0(0QPPu pT 0 @P `r01(0`0 0EZS00PnP5   R00s D0SE P`p=*X1RRXOX>TQ.`Czˠ0N@QPDD D,PTD0l(8   S , ,p @ 0, 0`  S 1, / +0Pr0`xf0`0,0^ 0 SrR0P0,P0#0R00S^ 0 ,P` @o x0, SL0ML0P0P ]pp ,P_`rnPJ@P @@P@`,e0`0,0^` 0 Sr0,0PK, `pT0SL0a`L0V@? @T~ kPP' PEUP,prp*PKz`@d` @,:9 ^ 0!S0 r0FP00,0`p40S Y뀠ZL0,0PQL0U 0Su 0S@ho Kx@,0PJ P @0  0 0@s,`P4`` ? P'xP0 p 0@4 T`0rP P*U& 00E S0`0 P! 00E S P@r0PS 0r0P@PP00s0s0 PSR\  0SL0s0\0P00E S pp qp00B S$R0V S,L0 1,  (0, ( L0(0S0c(0@0, SL 0L Sx01:`0r PZ 0SP00RQ0r0M0pd`@P,_XpTp8p@pQP)P @tX  T ^T ' ̒ D ď D , ` t L0`,0@p0S , ,p1S0qSt0P0 P0p@@@PJ@@3```. @,: ^ 0!S0 r0Vu s0@<0\0L,@ R MRd d`00! , 0f 0dp,pG@PI0`0`a,`  : R+ 1P0 S0r0<0V ] @D`S-0`r0 @0\M sdp\`pGWdW0 0 rWPP@X0T080@01SY H008 @0 10R+ S0bB- C S!!/.(BcS0C0P0`00pBEQ0@*n0 Bv   B0 `bS00dp`Fdp`,pG,0BpGQ 0^r0P Q0` 0 0Y"( BZZlڌ0$  JZ   R Q g P JZ$0(% 0  \0 S0>0$@ R| R4 Hp8 @GT@T ڐ 0 R`@0 98TJZ2\8 Y`    d 0RM@ 0 pGWpW ڐ 0 R`p0 ,WHXXڠf$p``@HX   0R`0 S Jg0P000TB8$ ⌀@DT   0R0 S #g0P00@DT 0'0 P @ 0=S0 g0P000$/f0P00?  R pMqdppP@qH00Q@`0 S f0P000$ HLXnhP00- Rڌ  ` K[0Q0S f0P00dK[0$ 0^ 0rQjQS$0ld0Vr< 0 X0WPP@T080@0AS] _fP@@,08 ( $PBU0Uj$p`@PEU   0R`0 S 6f0P00PEU0p+0 PP0 fS5<0 0eS$0 \ f0P00H0$ 0C`0 ;0@P0`02Sj eP@@0h 0> 00$ (  0 R ,0     d 0   0 R |@T H  4 p=S0 e0P00r0St 0rQ00e0Pk$-0  P0 S e0P00& RS |e0PH$~400NS `Ur Tn`(`0P@p0X@T@8@?@0S80Sp0pS@ @  X%n$p``@HX 0\`0S 8e0P00HX 0T0P0  [ 0   SL0, L0Ϡ 0S-0qr00@S࠳ C P@|  RT ,0P 0P0DTX  ܯ/s@  XP@@P@T 8pUT`U@ PEI@D0Q 0T8 BXX ڐ0Q@0SXppAWW 0ጀp`P@JZ   R Q d P `JZ$@0P` pT 0^p0\S0 pd0P00<0$S*0$Z[ڰ-$ @⌀JZP   0R@0 S Ed0P00 08d0P$u 0D \q) 80D \ql`0`S0$6R ,0P S ,!0P, 0 P  0aS0 c0P000$S@4`X0T0@0_ 0D \:qx00CH00\yMyo\ P{8 @TX@ `""   . B Q/D;2#0/0 0 !.BϠ # *@ Qʯ  A0F,PPF# 8 `P QP Y <"N8" P8@N@8@ @ `N BP(Q B IQ/2#΂0/ 00, $!L Q. ! A0  @8PϠPB!.#uS0[0$00 <,00s<<M,dp\ ,`PpG`, @0Kj ^T ,  r0R @PmS00$. *   S ,>+7 ^ 0, Sr  &@SL0 00,pL0+>;+ ^ ,0r 0S ϠP0@SL , 0101,0p0L ,0ML   R ,0PϠ# 000SQ`', @0j ^ ,  r0R@ P\0S 8  B0S0S S0\8 TXp@4`_@@Q`U$f`$`p0P@0rXT8ne`,`S00$e` jS  ! L0 00 ,pL0S |0s  H00S00$r1S} 000QG0$S@ 00 ER0 nn"!  00Bh00?R0S= 0h Srpe@p4`_X@T@8@Pb0P$80SpH0pS0@H00$0a0P00 a0P00 SL,01L , ^j 0S r`6 @P"; ^ ,0r 0S Ϡ^Z 0S r`@Rq ,P ^. 0, Sr S , ,p@0l P}R ,0P1 fta0P00 ?ka@0P00^ 600 0a` ` P% p ,! EQ0#^0  M50 c`!39lL000L0t@d@\pp$p⌀@DT4   0Rp0 S  `0P00} 0080@4`X0T0_{L000L0PS `0P00 \`!0  P@0 ?|@? Pn P0p@ 0@00BL0P00L0L ,p0L dL000 0L :L0 00rRL0 |0PL0 00rRL0 mL0PL07PXP8p\V`!0D \{mx00CH0L0LY040no 0 0 SL0,L0 00, 0H 8 BR @® sc@`0`L0 Rr L0JL0 Rr L0A_ 0P $X  0A/\-mSm , ,p1^$ ,0r`0S@ l^w  ,R! r0j^\  ,R! r0]R7 ,P1 ^ ,0r`0S @=h > 00$ @$@L0P L0}aL0,p@L00yL0 R rL0L0 Rr L0@T PL0 Rr L0@L0 \lSP$|@0xL0 R rL0kL0PL0z0D \lx B0?V0H0D 0p 0SL0 ( L0L0 RrL0@ @ SL0,L0 0, 0! @^ 0P $|@ L0 Rr ϠL0L0 Rr ϠL0 L0PϠL0; @w4TL0 RrL0@`L0,p @ L00L0 RrL0@L0PL0L0 RrL0@ 0@00`0X0T00S* P,pP`00E SJpqp00A S$Q0!S- 10P` b SL0,L0 0, 0m 0 0 A0D 0pCS,L0`1 `0,, L00D 0p- 0SL0  L0 p,Pm@-@`P MDpa@0p0 00 0@a Ѝ( A-@P`pqa0 0@qaO- M4P@`p08DP $ ЍO3 0:}T.T>P.P>j`p<.<>} 0^`p 0P  05PKPE@E[ @1=1 P_ 0KD0'=010=, 0   l 0ЍOj@@C>0 SA. @0c 0c6"ш0@DX06A0D0 0S0e0$00$0 0[$0 0C$00H00k@00@COo0B SL@S0C0 < B0@R  0H 0 00@000C?o200XU 00eD 0H$$0 H0d080 0\00S400P(0Z  40S00R  x Q  RP * S0S[c$0 SR(@0S @ P6 0@0p$`@ PP. H0S@0 0R0L '  0`S)$0`0$00` 0~0d080S\0400d00d0 Pm0(0(Ѝ0P(0 @T[0 0\ P04 X0S@CN 0@6@dP$` PpP@ VU@0S^ @? pP PP !0$`@0$@ x ,00 ЍOi0d0[\9 0 1+b@!%V 9p '`@P 0`pD0S 8YP D 0 8 40@S UA 40|`0Fp8`01CXP* 0'd\  &%(@0PP`p'Pn`Pd`Ѕh Zk 7 7`p & 0 000 0PU 0( 0P dPT]`pwSd@T[6x0P0408 S00Ӣ?1  40S2 6 0P(10(@0OM(0T" 0$  0r 46U@ UA 6[ 0`pP 1P )'0 0(@ 0 (, Q0@Ѝ 5@k01 ?$B`p @5P 2@`p @P 0 0$ ` $ 0 0$0S 0SD0S40S@0S VH0SV00 `@Pp 00S0 0 0S0@ T  R 000S(0V?t 40( S 0@0 PD W > pP< P6 000 00^ `pP$ 0S$R0$$0p $0S  Rv 0070S;V 04 S` p0@ s0R \\48L20",`BPPZPW PK @0S\ R\040`(@4 P` 00S0S[ V`0S S P P(T~  0t9S 00@00C040S TPP10(@0W PP @0 0R0L 03H001c `N ?aCoc?`(?yPD?a 'a ` ] ?@,Y ?@$@ 0P(e@`00PTP@# X0p`&P 0 0`pP e0PP 0%P`#%P00[0?0Sx0P0$ @R00P B0A`p$ 0$ @R00P B@D0A$ 0#0`$@@0aZ<0`Z R0Z @0SJ |0 4018 P 2pPS@P   ! fPG @PZ(0@DT Pt9U P|PP0( 0$ V$ + 000SK0S 9Y @` pW VW  40S \0Sq K<3| `p> 0t3 \0@`0 UAx0P01 a (@4 ZC  3`p D  0 0`pP `pI0PP 0PP A10(@0:d0S x0P0B|01Po @qP0 S  0S% S  0 `pP `P  |B\W0 X-P p0S046S01::S $00$0 00 00H0@hTd`[کd| V0E0SQP@Q0a Q^ Q TZ0P P09Y ` p 1@ P0S 0S? S040 S @P @VI 0Q 0Q@ T40S `@ p0S0SdP0@S00$`@0$@>(  0S0SN0` pWe 00S0S0@QPQ0Q0( 00S0H046S0H001::S $00$0 00 00H0100@e0 S`q p|( `0 pc0S0SS(0RP0S 0S S0Z  pP \ R\040k0@90`( p0@00C04 \040D1( n00C04 P\0S9 ( 09Y @V `1 p$`@ p(0`@ p`(0 p 0d \08 40M@- M@P`e p dUT 0S*P  d@ep Ѝ @@dep Ѝ$S eT@pe@D !460/\ /460/P@-@00 R@XP@Rp@-P`0@0R@*G0Pp@ R 0 R Vp@ 0@!|O-0@ MSX@DPa`101 0_Yq`":0 6  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ -`@0UM0@,P.0L10c 0..      dd E  @-K E @-D @-p@-`P@ TP P0F R I@P  c00pP P 0?0 bPE p@-@P :^`)PP  ~cp0:0 rbE -M Ѝp@-@ P` !LN_ !@Ap- Ml ЍP/D -2")2b3c1@2`M1 pЍC@-@PPM ` p  0a Pp`Ѝ0;0 bD  p@-0@Q r P p0 S P1 pPP   ! b@0O-`M p0D A QP *5Y @0S SnF @ 01P j P T@r   <0SY`Ѝ<0S Qn@ 0SC Y 0P  0 8 0` 0S00 000c"00 0`V [00T00SL<00 21` b ! 0V0FTP 00Q-<0S 媠  @+ TQ P@  @ ZqT  aPPl"! 0#  @ y`P 0~ 0Q/ R  B / 0RA-@P'`Bp1W@* R0C@C   aV X@@pp0 `f360@p1W@:bPPO-p(M@ $0{\0000. 0P-Q000Q 00A S00P0 ` @ a0`A @00A S TT Љ0A0SpЍ0S0 EQ 000 00S 0@@ 4 8 S ?o2T00 0R000Tpp 0 T" =01$C   0 5[T40 S 40S4 %0dS40 D pDpW(0Sp  "WD 0PH pBW 吰 0 A0SX0QD0pLW p W0pw0000P0D S  X00SD0X00(0p 0 000 40@ 8S B @ T 0 R ?\0 0dt p0d@0P 0  p ! `0P    !`@p0P D `0 V@0\00 D@`PC0D@`\P@Q0C @D@P@T00S0S@DPE`F@0S DQʒ40SUVS0P0 P 0S0S @ ` @tpPppW= T0 R"2 VX0D S00 0@ T0 @DT`Q (`Z``Vm0 x0@9#$(0p0 0#W00S0`0/0 @PX QZP  !KPG (0S (OM[`0 P0V00C?o20S 4(48jP@ 08W1h@l0&`p P  0 P(0S5 ! 00XS" PP0Q Q3 Q000S000R , Ѝ@(p000+S -S 0  0C \0S 5 00S 1CP 8 *X=( R4iSy ;ISv NS-|@  P% 0 00$0000(S 0 00Q QN P  @( EP00<0 p0'X%% HPX@P@u吥\ "#AA  0HX 0!z0 G,pGHPX@\ p  먀 T0y0S  00S l 1 CR& 0ES  7 p8 e pg0p T$1 0 W 'X)($ HPX@P@t죟\ "#AA  0FHX 0!z0 G,pGHPX@\ p Y ,먀0000Q5 P00000000@ 8 00C PP0E @00C PP 0> @\ @7 Ta@`T ЉQQ@T ㉐T0C00C Z 00L0C Z@P!8 0 R8  b8 nS s1 8 @0 0C10 j 0T"0 0 $0aPg0D0046(q56,0!z0 G pG@iP T 1@PPk Vn 0 x00`#$P3  B\<(0Sa 00 0R0 (0P H? V瞯<,7 A??X) Nh' 40P0 pP  DQM PJ Q 0P 0G \0P 0>P X0 0C BX0 0(0 1@PVD[" 9R 4 01a,06D0`X"4 5\ 0T"0 0 $0P? ( 0#P 0 x0x0`00cx0  0@(@ 0 D0 CeTd" 400C1 0  0PTx0 0 x0%0D05`P$DR!0000V0j (0S 0   ~\0w (!D0 00C 0yV0a!0Z0(0D @X0S@TP P(@_@ 0$ 00 0S0S AS00 (000D00P00w46|56,0!z< G pG0x06Z! 6 (0  # [  R T VZ 00K 0f 3 S 000@ P  @1Z@d@P000!00*X0D 匠S 0  0C吰0C!000 R0SP00P0000  0C吰0aPj @ O-@ 0Q@P MPP+`PO  0p$Q@  "($(!(  X"8H XA3pIqW K "8 80W#8S 0Y 0  0 Ѝ@P   ! Z.``O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X \ 50QR j T0#03\0SWf*0 GV*0F@S3 F B S   34Y0WR 06S PW*@DPD@ Q0B Q0Q l  l>U00XS Q0X j00Q )Q  0Ѝ;^0  n2>000 )AoR㩒Y 0u Q=0>0l1 c, 0# Q:i O-M<0p HJH:@`00S 000S 0@0S DA R[ % PD  \  P 0PS8 ZPP@Ѝ P0Q[V R 0 BPS10W ^P0E0CSڣ0S{ P [ PSU 0  UE\ PN Q UP   U 0CC10B=P0DS0 SE@TS@DTDX`  `R ߰ BP[10P0+S -S0P: P80 0@B\ P~sPP0 PBU0L[0lZD^ PdP [ 0 S S80S 000 0 b@0Y"00IZP0D^0[ @0 QL 0S@00S P3 4^E *@C b`P `D21 2 Q\` 00 00S@0T@DUQV`Db  218 PE x @0T0 T1 T@00@0PS  Z @D@ R, 0 R Q 00PS00= 0P0@E SP 0 C0 RZ@Rh@DU 0S{ S SUUv EPq iXP@"00ЍSn Sh S4 `Pb@00@0 0( 0V@ !VT 0 PeS5 0 0@0saF PeP\  0 S S S %X@"00Ѝ@?0PS- P l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@0@0  B0 QP[ 0Q SP߰ P[A1P0[80S@[- Z0`, D^  000P0E80S |0  BR "@w0P03880S P `Z ^  0`p 1P50PSP P A-P@p` P  0 P  0 PA-P@p` P  0x P  0q P@-00 0 00/ @A-@< RP`pn3 ^ P 0 W@0 p0U0`PEPV 0 B P @` pT  0 By Pp0U`98C- M V @PQ 0  C 0C2SzP 0 Ѝ6c @-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ AU0"S1 1  !2R / 3RS/0 00 c Ra `` 0 ` RA 880 ` R/ 4  A-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R!0 0U U0D1 0CC!S R 0 @-P@M: Q @ 0 R Q K @ЍO-1!0 M000000 !1 0 0 30WЍ`pD00@0P(@0 `as U0< @( R  00     U| _T@ePe0TD00D0 0D00D00D0NP 70  000 ̾ ( \1A-0@`T@p Tp P. Tpp8#8S!Q*' q/ q90R0 SP aT@X@@@  000COPX@ TppPZCW@00?2  000aXA-P0 Qp0e S W`TUU WS\0 P@ WPUP  @P@?0p@-tQ@AT# SQ ^& RT50d035DPP2 0 QARp@LRp ^ Q(0@&Q Q0/#p@T $%R p@ U/p2U0A Q "0Nt@D23  0R020N 0p@-ˠ Q @NT#S0^8 ^RR:10@op^0 \# QT=0d035DPP!PBU3@!A1#T2D1$!$L ! A"Np@\U /Bp@T  $%R# p@Rp^ !Lt@D2   QAU@DP PE 0@ pAR@D P ?$l O-8`4! Q [P@p M7 ^ [ R&B *p  ЍT>WP 0 [ 0:^ [>  0 R&B*`PVP3 "[0   Ѝ$>' G- PXl X` PC Xa`  P)2Q>Ϡ8 qD ?qV   @)pYP X Y  0  $Šˌ '5  ?@pY 0 X``@pW]VVA? pAAG pa2GA n2.! N3!3 a@G-pDR凄!#ࠋ A Zb @Ġ)Q" Y A= b?ZN j? 2 B> Pb0502 0j 0J66j 0P 0 GH% Y# Q0I4 2 Q Q%0/Q  G2 0 0 10 I?z? J :> Pj<5<: 0b 0B88    2 0G-逓Š ˌ!Z #j pEAŠ"ˌW Š9 Uj U`P \0W: Z0:30Ao U^ VA(0UP Z@T6\ 0D:p `Sp241"#<  N2!@NE4!n<>"G V;4A?WN`F?` F62 f<26 0g<ǠÌ 0G>Ì Z>GT T`#0p!`3p3810 Z@ S0:\ 0* `p 8 4 G U( APF?w.?0 @2 `:1:%0 0e# 0E4#4E \1P@(` Z@0p0 \@ S0P(:0Pp 00P`\A@0p(o?Se? A! a< ! c<àŒ! E>Œ Z>C0pVLP/P / /BR30!#11S041 #<120A#a/ P/R30!#11SP41#<120A#a$00 0A#a\,P / /BR03!0#1QϠH1!020 C 0c2C>`0//P P03 !0##1RD$1",!020 C cA.c00 //\p@-K@T0TUo JP& 6V @DOoUB@dp~TTQ03@d5 L  000V`pp@  000ppм@-@;0$SM% SR # 0 Ġ,̠ 0C,0cΠ!= ЍR h0h 0S 4#6>ЍȠ\03:045S ?S/ 1 ?S/  (1+ p@-R@;0 ? S5 RTJ JP 3H: 4Q P  BB bS^7 ;Q039:0!00C0cAT  p@0 QABAR^   pT C/o^" R p@50^p p 08;!0ˠSA- P   \ \ RL0R :QR^\RB AA!@L,lS^ 3Q031:0!00C0c @C0$qaVp }@~@q4? 0\S00 AiQ3:0T0   0 P /45S @o/0  p0d 0S \0P 0S //Q @-P00 00 ?S/P 3# /R /45S @-45S /00 00 ?S/P 3# /R //45S @-Z45S p@-$$!!:S$&O3S%C>c0&0T @c PC22 Q 5pQ/pa1^ Qp  000pPS \  000p0C?oP20S d pԴ0@-0!*P M!: %+ %U  C!A Ѝ0@c O Ѝ0P0P 0S % Ѝ04>70 -Ϡ M\Ϡ # Ѝ Ѝ-Ϡ M\Ϡ ~ Ѝ ЍG-鸒!__%!J #  Z Tp`8 0O} @JOo\B@Tj GtP0 #* @@8S*p@@4q#<p100 @CĠ+C+0ct0Ì@dZ0V R0`! #* `8SQ:P#<1` ` F:+F1+`f2fj Š'ˌejህ0 auP6`Ǧ0!03\ 3 0 Q @DA 0DGa ʯ X00 \ 0p#*0 ^0`#:4`XO-d!D㣏MfF㡏(!# Y YP00 T4 @ Ѝ` Y@ ЍO0 T0#: 4#<100 CI+CA+0cY2Ci\ e kuEJaU AQ 0L22*0 20 W Q0P0Q\`0 R 3#0 \IP0 # 0!K* 01 0Q @*Ā ~  Wp`\p`Wp pp3p#^3#\` \`Vp R0P 3# `p ЍOp0H 0(P 0! #* 0(R#*0 $1Ѝ2p``R0 #* 8S6*0V 0#:$",!E0 0 C+Cba+c0a"e"kuJUa AQ 0c 0C*W0 #0!*W00#!-*%$! # QP   00 / @- \ llQ  QP/> 4>70@-! # Ϡ\Q^ ^0030# P  00  k @-! # Ϡ\QP P03# ^   00  = 5A-(a(1`pP0MS3 U10AT !0S 000ͬ 㯩@T  0S00 0Ѝ  @00D1S@000奬0S 000圬ꜗ thE 0p@-@P0p R pPQ`00App@踫D `}80 0QApp@qT thd0  ,0#10/!Q#8Q#4  00/Q #2#01  //30A-`p@P p1,0@U00p 0Sp1P@P#pP   ! DJk`gP0301#S412ss /"r3J / R//@-@P0@0O-0Z  @ S MpP; PaU* F B  I  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-聟0PpS%Q@Y A@iV'10SQ`P] 00001010i0S p1X @P4 P1 p@T `P@T10SfP@$ 000S 0.0)@T 0C  pP@h0iV0S <0 ,0R0i PtqhG-`0b@TP塢ڃ0TP$ Zp  H p0   a!  \2)R0L`0C\0030 `-pG \ `#@-0P!1^(23\ *G-0@`@DTP  !1QF*32\ I*@@P`P @P @pq0 0S 0S W 0G`WL3 ``PQ@! H 00P0S 3 # Q0 A B  02NS bP 0 00P` A-P@Q`pE9 ` P0 T @*R0 b3ΠŒ2 ET* 2> P08 T `6 # 502,130?C-` MpP@P А'V`0Y 0 CII5` Ѝ s P `!300SY 0C@@1` Ѝ0S0/0 R /@-\ap`@PMB D1P5PP3 #pP-0S  Q4 p 0: S-n6P  8#800@ 0$  0,  0( 0 0ЍH00Ѝ<0L0E0 FH00HO00 8H $p@-@P <00CS00 P<pP0=0 vF@-@P 00CS00 @0I04 ^F$p@-@PPD 0rS= wS+ aS3`0S  +S" e0C\S00S``p0S0S0S`0`SH 0 p`0>0  F8p@-@P8 0S< < P00P! !' 0S 3/PP೼000P @ P 00 00`ܧ00aa;\0`` 0pΧ9P,080 EG 0P0`@-@P 00!R !#P 0C 0;0 E@-@P 0 0 S @V90;0 Ep@-Q@PPP 100S3 0 SQ 4000S8 0"$0 3/0P:03p00P @ P Z00< R 800p40PᒨWK፨9P009`0J08 6E  0@000 p,G 0 @00T <-Ѝ/@-^@S S S  `0@ t D0@ fG 0  0@ x6@000 0 0000/<P@- 0At @F41S O- @fQM  Q 5/p0 `( "Tl @`t&`p p \ P P pd` X |< $p4  P` tP(  `!p%(),$-P,0d t415 T9 8 ċ<=0  "#&'*x+|./` 2`03X6`\7:`;Ȍ̌`><`?`  +dl+kh+&dlk&@kh+&dlk&D kh+&dlk&H$kh+&dlk&L(kh+&dlk&P,kh+&dlk&jh*T&li)j&+dXi*h(\g'+d)lh*gt&`dp0ex%j*(n.jd+)h`l'n&lx,p eT('lP`X d%xl( `+ẗ|x|FGEPKJ`DIpŐlĀH`ĐŀPt l [`0 `pA/`4]pd APpM_ĀmXQ 0pkPSQ 0pkPHQ 0pkP> Q 0pkP4Q 0pkP*Q 0pkP Q 0pkPPQ 0pkP YQߍZEOWEp,qQߍ/aQ@-P @41S  P aP06EA-4!@w pPP/1S 0L1 @P!;PPPUQPMoP PQp IW Dp_oRDpDpp@-@P 0@@A-@`㠣P] VapPᓣPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V yD0@BtD@SSO-P M1 Sz$aVp$q( qSSp A`TR X`D (1 Sʃ P `0(q\ 0} P@  Ѝ Co$B/갰[" (hr ^ P `岰VH$8 S pV pGpK(VJ (1 $ AT$$( 0 [ `( A^% \ :0  . @PC@@,A 0 S$1N(!r5 V(* T$$H0 $A(1 [$9((~ 0Q0 0 $A0 $ 1@(!$AV 0 $A(\ 0 yqP_ Qp{`$aV@O-,M0 0 S ! rp2/0, (Q0 Py @`P@P\&$P 0  CZC 0@PUpWW 0 `PQ 0@SPPU2J[Ipp,Ѝ 0 oPPu2  $`pP$`  0 _`P% 0@SP㲀0C  P\ \1 \"  gP  0 kPp@`@@,Ѝ 0 jP@ @ †Ằ[ PಐU 0I   gP(A0DS V(Q  0oP 0 @-@ ! \ @$B,B00,1S@-@0@ B00,1R@-@1  @0B,B ,!O-`ᴙ0S ]M> pPw3@P Uq  @| cBP 0  p4 < pɟ00 8p4  D@@ @ PXP )V P0pS40X W!3^ XL ^^@4<P3  uD H 0$ hP 02 KA<,0(  Q PV\^ |P  0p pt 0} V( 0S% A/ 1++< *0)4 p)<(0<( '4 '<.0<. ,4 ,<0 4< < 0 4< $0 #<$* <($0 4< (, 4< ,0 4< 04 4< 804#<8 <80< 4<< < <080  80    0   8|  4p p ̇$  x $ (p < ,Ġ( 0$8 ,  p0̇(,044 4x 8 8<0 @ 4<|8*8p | *̇ <0@)t )  p' pK0  | 嶀S(tpN ) ) x 岰+, t, SZ,CC r AZ2X pG^ز  9/@P OP᫠@P]ߍŸ 0( P p1DN90  !NtVr QU0 aPP$4Q$$Pd q!Qq@A0 ` 0 `]ߍ]@ Y@QsT@ R2 < p 800p4  D>@ >4@00& Z )@ &@@Pp"@Pm@P@PcS0a@@ @@\p TaȾ``O-(P`P10p5fS@(Pp6 R ؑ寞P. ( ,0[ D`D` S`1 005,`5Ohꂡ sP ر % Jx> ḟؑ@-@ 13/, (Q0@-@Q /00 2? 0 O-fMS` $ [pW 00/>0S+>0` X-P  R-`P pW010!! 0 p< . .F>O00000 0000&-0$L00JPdd0 ,;w?q尀Xe <80b1,*@-@`pQPM -00U' `P$ 0S r?(p0 9" 2 pЍ -Ѝp -Ѝ=00p 2/A-Q@M .$4,.,80!<004.T"48<08#80CSP!4< Ġ!l 4 ̌8 0<04 80<"04"80< 0*0(S"( SR~  B("(p`p0#$ 0F0VP   9< 0   '  P       P  0    V/ 000   0 0   0 0   00   00 0ЍR 0B8#8` `0#0BR0PP      VЍ40b0 $: 0(0S"( S: 2/QA-@6 10CSP* 8 R#8 RZ ,$ 4,,,80 09(0  0RM 1S RS  RYH  % 20 2 A0Q0m*08#80CZd P^K0V㰐`0 2 e Sb $ p 0,00 4000S0(p0000(01 S0"1!{/010CSP*8#80C S {?尐!0b0 $2^0 )ἐ`尐0400D0b0 $2,0b0 $2h? > @ԏO-(0pM O @aP0fl0PP P FP 1X*%8J1Z!a@%X0 R 0 1Q@@10CS㣰Q* 0K8#8S0C8#80 V!S10C1(0  0R/ Ѝ@ Q! R b0 `(0p) 0  PR  p 0 0 p1 S0C1ȁ 3b0 $1T? Y4 0I 1pP(00(0V QPEUP*0EY*0 p1Pt YQFQPEUP~*X%XPEY Vp崑 (00(0=10CS0I*S ```@0 `p崑.P Q #PP @ PAPW(00 (0#0!0!0 #PPn 1P0CS㣠8*0J 1oP(00  v#0b0 $b10 1pYP(00(00X0%Xb $PEL1 UrQPEUP:P0b0 $?1y80b0 $81 @#r괍x,Њp@-@PQQp "P 0 0%#Q "P 0 0#ppO-P,a V0Fn  1}"@P" `Vp0ഀ0 0 pu 10CS08#8*S0SX PP 1b0 $0  H 1 Fp(8V㴠(1!p 0 R 0 1Spp10CS㣰7*0K8#8S  C("( 0 S0081#810W10C1 " R \P  0! 0 ;P" ~"0b0 $j0$O-Pp@QM i"00 2~T T R200Ѝ(  @j ꀧ0 0$00 @ `PW  R U8#8Y* *P 0Pj1 "0C @iT㴐: 0 b08#8Y:Aᴐ@DT@* 0H$H @DOoS0CB0  0wp@ 0S0C@0  P 10CS0R*8#8STP@ \!pP 10CS0*8#8SE 1 E1@0CS0 *8#8S"P !g !bTr*H$HTtPW 20 2Ѝ4b0 $/T !4b0 $/ !T` !0 0 P*  0SB @D `S: Z t!q,`W@ H$H@DXG d!qWo 0G 1 P AᴀW@DT@:b0 $?/p3b0 $8/ A! @0X0 0UXS 00; Is0, T:)[' P0K/S  0|0P00: S /000S0I S/?00 1X0 -QP@PV# 4- p!/0SY  \0 RK Y P/00W 7p z6P /@oo ( Gx' ~}}R Q0P:Q0Q:y.@-@-@@2 $ @ p@-@P#*P$ p@l \ 0@-@T M 000 @尐P 0S  Ѝ{O-@0dM\`P T0 `%. \$.\p @p.\0  (0.\` D` .\ ,.\ 0.\@ H@-\ 4- \8-\ <- \P LP-`` ( \40 0  0< ,@8p$0P` " P% 0#0b0ea8` . p'gH, alngx+b(*gLb0`l$`&eX)0n, fe l c8(쬊cfj!g|*g̉b,, bH ,l*l$gx" fb(*錈gl* e\(e!c<+ci eX(eni!c8+bLc fj$n Yc-!  \  6-!  \  /-$ \  '-@ \  -( \  -D \  -,  \  -0 \  $-H( \  ,04, \  ,80 \  ,< 4 \  ,L  \ 8 ,P0 0< \0,dЍ2-bynd 3te kexpa0@-\M @ RTP`p000 0@  , 4,@ W P H0 0 T0 30 \Ѝ(( 0, <+,  Hu7O- `@<1<M0`0p ,8P@)   000 0ێp' R$ X |  h  L,  < 40 0 0 30Ѝz]( t  @-pQpP`MD͎f0S7 帎@P PUЍ Ѝf0S" 4p1#'p+0 00  0p@  ᖳp {Tp@@ePU ᫍ @ Plxe$ +@ 0 0O-ŸlM `d000 00A0PEY!0 B"3*S*@p? e: Rs:0KY 0%Y*[V 0@0 oT0@0@0T@PZ0&Yd!1 0 d0 30]lЍxx0 <}*$@ J00 00t+[0Z A 0S$@ 010 0S0000X+@  Z 0$@h0 <C* T:0KY 0Y ``0 <3*0KY 0Y[$@jD L p po O-$Ÿ$2 M0p@`000 刀 * !0  S P [  @ 㔑?P N^艐     P@PF *Z3 Z0  D 0F 7P  P 00e @@P0 f0`00d X (0 0 0 30Ѝ| nn n|  0@- 04M 0P0,00D @T d 0T T H0 0 ,0 304Ѝ0$    A-$!$1 0HM Q0D00@P ` @vT( 0T ` fV p 0V  T h X0 0 D0 30 HЍ$ $ ΋K\   C- 0 04MP`0,003&`@ "pW:T p 0T &T H0 0 ,0 304Ѝ$ ꑋ   0@- 0 ,M0 0$00 @ P+T ` 0T P D0 0 $0 30,Ѝ0$ Tc(   @- 0 0,MPQ0$00` X p@ T 0T p d0 0 $0 30,ЍHV?Z/<m($ *p 8  hA-@P` A!8M11!X 0 P 0p0S   L Ƞ,Ƞ PU00  000 0=ЍS)!1 0C8##Ȅ00P ` /0  ) P 0 0 0YO-qpGW@t*8#811 PaP`Fp`5 VM*X%XPpCx0'0岑ᶑ PaP`F ` VC*X%X'X00 000 0 OVh&h7*V 00("(RP:Vh&h *V  8#8SP:1bL0d p'|bL0d p'1\bL0d p'@bL0d p'$0$0 $|'`g@ggffO-4M 01X0CSPᰐ0-*A0@D8@808#8T0)*0S6 H$H0Dp@` 040 $ ,P(0Y P P0ES0001P0P0PYo 0V 0@  `P9hU&hj*P0H$HS0SZ 000pxV'x:@@T,P*8#8!01(0  0R 1 S0"8!#8!1!V 0 0C01ő YX0X 0Ӂ 0C00 V* S 0P0@Pr V@ HB$HQ01Y00 0(0"(Sl* 0Vi YPU:( $0$&01 P0P P P k01P0 P0P a\P   Ƞ,Ƞ` @ h0&h@HV$H@TH*8#8  Y !08#808 #814Ѝ   Ƞ,Ƞ   Ƞ,ȠpGx'x@@T,P>:0 $=&600 $3&hbL0d p+&L0 $#&`0pWefdaaa|aC-Mp`@P&  PP!  00 000 0` Ƞ,Ƞ0@@!! 0 040000 00q@PЍЍO-M@ p8PPO 01 0 0 0رR 0ⲱ 0 1`0CS㣰H* 8#8V: ر }`PF 01 00 00Q00岱000 'P 0 0<0 00!p&Vp@PЍဇpЍ 0p!0@P,bL0d pp% x^O-\M`0儀pS:@0< Pတ(0$  r@T X=*1 #0C8 #  a#Ȅ 0 Q 0L 0<S@@ a,^p  8 00t8,000F 1Pc `V 0`h0 &h0CcS00 p㰑1 0CS&*0S 00$ (0pO `VO 00 0 00CS001!R p0p  0  00!0VS00 IY㩐* )ቐ1 0 0TPLH0PH2/  Wp 00 1p0 pp,0 !0 B(S"8110  p"      0<00@pS- 0S 2  0 y   a0S @ M3@ 00 ,w 0 S<@p  ` \ X\Ѝ3<S00 01040封HX㨀*004 1pCx0'x(0qqᰁpHX㨀*0(03<S00 01040封H⨀X(*X 0 08#8S:00H 4(0 岁ᴁqpGpWx'x*W 0 08#8S:00T#( IY㩐i* 8#8V * ("( B``F  001`01]p@   @  Z`V<@p "  p D$D P 0 0 0각HX㨀d*(ሀ10406각HX㨀P*(ሀ1040RbL0d pc# 2  0+ Y*C@P00,bL0d pH# bL0d p@#0bL0d p8#IbL0d p0#pybL0d p$# 0!UbL0d p#hbL0d p#Lq0 $ #@pKT0]@]|VVUUUUTU4UUO-@`PşM ,p00 q p jPK 10C0XS%X:*U2 @ PHX$HU px'x p 륰PPE0X 0#0!01p0 P T pDx'x 0l0p b$"0  0Ѝ 2 p TQ\@10CSP*8#8TQ 0 0@Ѝ P  ᴡi PP r0㼡 W0 8 #80CR _뼡P W 0J 1P 0ZK[0嫰:2b0 $9" 2 p @ P 10CS@d*0D@ 1 PPF %0㼡 W0 E@ZTk 뼡0 W P0J 1P _1b0 $!1@DHPE$H up@! @10p  _P 10CS@: B01b0 $!A  ?0b0 $!0pPEu0) 1 01p01 &P0@D1 H$H @U0PE10Z!08#80 !URQPPR0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P , D"@ (! 0"OO-@2 (P0 $Mp\0$ 0 @`0 @` pP "l(,"$l$"0 g  Z  &e .e  x10\0@0 ` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 000000 00 0 0 00 000 000 00$ЍNM 0G-1?p@P` @g(X, ! 0P0 0$0@`F0($0`7#?V@F?p@pp+ 0$ <@P U 0$ ?@PP?`V (S! 0$ a0 0$ ?V@F?@(p@ @! 0$ <@P U 0$ ?`@?V PC-@PP M) $ap:?`V&7 ) `0(0 `!W``paa8!#4a4# 0!Y@h  ЍC  08R(@R )`@ b (`8  )`8 b (`R @-G/ @-@-@P 0  @ (v 0"IR @-(/w @-@-@P 4@  PV 0$$HO-,6TM0^_~?40H0800؁p @P,0,$4 (8 H`D <P0`<p P 0`p 0, $0@0,`P p @P`p(0 8W l00$Ǡ$97Ɍ,%%97.0$ 0;4,; 4.0*0&.0"0( 0'   "0, Ϡ'& .*̠Ì !  ,  , 00$0 40(0[0340~?00<@ P0    ,   @0 !1P"0?0#`%o#,.0#.,',YW) " g Y i WP&R @-</jG-@PM  PH(`p ` U@ Ѝ0 ` a!, a c,/0@-<PM0 P907@0;P4zP DP7E@05P'6P %6P 0P0Ġ@ 0F P0H p Hߍ00ߍ?CPv 0P@  @0H p HP ߍh0Ġ@ EDCB4P@ P0H A4pH0<,+*)(&%`Rp a@ 0Ġ@ 0P]wc_GiFe0Ġ@ L-t0Ġ@ <X0Ġ@ ;73/+'1-HNP HDP |0Ġ@ ,X0Ġ@ |<0Ġ@ d     d@P0H A~p h@ P0H A~p D ? 0=@0S,ྣ0Ġ@ `d0Ġ@ XAAA@?>>d>=\=<= i;p;P;O-p  B+7/P  7/Py 0 S 0SN 0#10S0S0壀S0嘣# 0 0 X BuPS0P1 0 07/`P  7/P0H 07/`P w7/Pڅ0`DP 7/P ]7/P 7/P]P$0@ "! R0 B  7/P P0P0Sz,Ѝ! ^ @E"PBPEUP!U  B%QPU P 0 "P 0 C07/PH 7/PP@7/P 7/P7/Pm  7/P e0@S@4 ' 7/Pf  7/PO0 00@哩)YP `c⃰Z}* P  Ut@P 7/PlY Y   0 T0 0#0Q0 4mL0 (0l0 (l-0 M0 Ѝ8R Q0P:Q0Q:(t@-鰬A- 4PS@M  $3/0dp  QP00 q4P4S  $3/000Ѝ900A- 4dpV:@T@T 0P0 S  00 S  0o@P0`0dp@A A-`M p᭗@P0: StoPP ˅P@ P 0 d tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0w@, (  0@-SN 00AS 0ypO-4 MS|@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0     Ѝ P@ 0 QP300 p$R P1)00@000dS0  pq0Vp 0  $6/ Ѝ 00 Ѝ00O000Q 000A/0@-S@  R   0 o0Sop@-@PT @T 0 `pp@TP`p  0S S/P/$(0#   @// / ////@-P0S`@M:Q !S@Ѝ0 0p{ P G @xЍdT 0 @00O-PP X 0SL K 0SH p@ap-[0T B,B R`  0S7*V5* 6000P<0@D0CS0 T0@p@pT T 1 ! ,03/P00CS@D0(PQQ  4  D R ! ,03/`Pʼ@00 "R( T`1 `! 00PVQlRO ,03/`PY R 00CS@D0 T@0Tp   P @V`!  0 0C0   BR @pZT `@ 0`V:m0P 00``F0``G  0Y0C00 00dP  s 0 0C0 ` i 000NP nX0G0 W X<H<0 N L00]H 00Y<p@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0Z0  t0p@-PP0 @`v p@ 0@0, P6o @0opP R0  R/ S/p@-Q@PP9 100S 0  R 0   p+  0R0x0  0 0c0 0 P @P m0 0 $0 $0<0  pt <@-$aPP`p@M* W0 T7 p   4P0:*C/o" R  S L 0( 0R  ; 0 Ѝ;0d00 V WH<0 M T(L0 D H (C-"2 R0lM@PP0d00= 0 C 00  P"D2 0 d0 30lЍ 0`0S$ pj0PR ! WP00_0pS p 3PP0001|0`  0Sh$p@l ᔉPC @10F L010/R 0 p 00 0SP ` 000p p00` ppX0`  xPק  \@p@-@0MPFm00TaHnV( Yn0T1S Om0T1SKn0`3n 00UTX!\!R Ѝp@!m\!8n00Ѝp@m00UX\! X\!0 000S/< tp@-0 00PUp@0l00TQmU0` TQUP lpX1P0X1m0T0`X1 th0h 000S/@-@0l0X10CSX1 @lT1O#m0@ll t0 000S/g t0 000S/p@-P@0lU0 \AQ\ X10CSX1 p@l`m0T1Ol0p@l̖ t-X X0 04M 0,008 00 0 ,0 304Ѝ  p@-@QP  p@[090  t,@O-M8@0 p 000Dl0T00XS<@ 00DA B QR ap >` R0T1 W  0pt pp 0@`> p PPD1?0 $:0p 0>00D-00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pg0p 0> 0W 0@ p p0@ p 4333333t00 0M0Ѝ 0@-PPM @0  ֍P 8 ,0 0 0 30Ѝ08댊 ( H0 S8 0 / 00 @- 0 S 0,/00(@-H0 S8 0 / 004@-< H0 S 0,/00<@-H0 S8 0  / 00H@-o蘈 0 S 0, /00P@-[TH0 S8 0 / 00\@-F 0 S 0,/00d@-2H0 S8 0 / 00p@-P \0 S 0,/00x@-  H0 S8 0 / 00@-謆 0 S 0,/00@-hH0 S8 0 / 00@- 0 S 0,/00@-H0 S8 0  / 00@-d p0 S 0, /00@- H0 S8 0 / 00@-y 0 S 0, /00@-e|H0 S8 0 @/ 00@-P (0 S 0,@/00@-<H0 S8 0 / 00@-'x 0 S 0,/00@-4H0 S8 0  / 00@-Ԃ 0 S 0, /00B@-D0 S4 0 / 00E@-0 @0 S 0,/00G@-D0 S4 0 / 00J@-蔁 T0 S 0,/00@-X @/ /H-M 0ЍA-`p@P0 8#@T0P@@-M/"O R ?#0!PO$T P!Ѝ  0S RP/0    P/p@- MP 0 0000`@`0@PP  7P< (0 0 0 30 ЍpA | 8 A-QPp@` S V '"RSQ P_ 0Cj ?o/o0CS 00cÎ10VS& /o?o BR Z 0b0Î01pϠT\ ^ R0V0 BV  T$ 0d0?oc008/ooAq!  R! b0r8·V pV000e0?o0c80@b>08Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000+ / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q@- S 0S  P0 000S0p@-Q@% TS 0 C0 P @D^TPPU0N QP Q  0pS @R S Q0 S 00 /0 0/U/S 0 0R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ S^ QNP  S^ PU@Q @0SQ RU // Q#/  //s R PS 0 0/0 0/U/0 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@R`P R U  V  R 0 p00 (QRp@-`P@ 0S0 0 0R0  0pP0l ($R S 0Q00S0 0/0 0/0 // Q#/Q@- S# PQ P P0C S00UPP@-Q S0S P 0000S0@-M | @0000 4 ,0 0 0 30Ѝthp p - BMMRč d X @ P   P1   o P<0@- @-||Ÿxr M Mp$ȍP|`@M TE <" `0b0R @`$@  P0u!1 0 $8 30kލ ЍB~p0\ @p ] Ɔ0 xQBnP`.d0a/ dH100: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !0#00  9P0ЍL00 0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ)00@-@@0 00/g 0-$0$0 0M 0Ѝlg -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ g t@-@p@-0@ ,ppPU0PpT@////// //1O-0pPW`,M y n1 0 0  (05/,Ѝ{@PL 0S LLL S0 S0S3*$! 00S S( S000S  0S S * RpC 0QW 00+ 00 0 0 00hT0 0W0H00 0O~{@괃| hT@//O-̟ M 00P0Q0S Y [00<,0 0$00  00%SS   SP p  04 HZR X< 0 `P,0 ,@ S     Q  R0 [ ʄPU* R [ Ԅ ʄ`V*  0BS0C [ ʄ0S*0 H0 H RE  `  \ rSe{- R@0%%%!:0Z0Ņ% 0C` RxZ%dȅP  dV0  d/*00  D@D P `pnpk@ph  0  ` 0P0,@, m *XJ 0 H R 0R0100 H R ?H|D P@T S 0[ P0  BS0 P cP0 `C> p(x $ p SPSP` p@0 0P  Q < Z* 0[ʅ Q  BR B0 [ʄ R* 0F ?   0lX pp|    Sp!\{0S P`@0 0P  Q Z 5 4px,  Sy@ 0  d0R\ @RC0?T0S PA`B 0Se     +  dpa R  [{X,}  * ( S ǣp@ "".!d  `,  b S       R!0P0000p@P`00@  BR B R$ R) Z 04 0D Tu  BR B  [ʄ R* R[ [ R   RR R k     x  BR B8`0P0@00 Z0J0#2 0 0 30Ѝ    0  D @A 4       [  { 0 Rz*; P0C C   @.   +  @ ("(   "@ (B(pp-DA@  @("(    ]v(0D T)Y|0D T *@(  ' 0 ? p T0 0 FGpZd  Z |<A-|@P@ `l0pP@PU J0S 8/`PEuX@pW0:0 V x 0SS S  0R @-<o/ 0R0@o/O-,,@CM Mp4čP`0@  0 @0 44 30,Cލ Ѝ 00 00p0 `0pP ]x0 h 0p,yL+  '^ 0"^/꣖U U pU (P0G-0pS+ S'QU$ X!`@0S  0 0#S0S 0S0S0S(  P# `VP@ Q@0 R!R  "R0 R R QO-BM MdQčH!d2 hԀ&h Pp 0`V' 0  OP@P UPP0 ZP,-PH <0 0 4 30BލЍ,S XR O-\\AM @ MTč9 0Y4:0px0(S`; 0 T#T4"4X8%X#8U"U0 0@T ]PZP  0 zP PU p   0OPL @0 0 4 30Aލ Ѝ0x0(SꦕR P O-M Mtϟ0 p X0 [ !R & R* ` 0  0 ?x@X@0  0p t  0 H   R: R20P တuo@ pR ?P p ᰐP R!Rs *P PZ@ 0S 00 0[ p@`u_``0S 0@Sʰ00 9 S 0S*< d 8, [g0 @0040Xv?D0\4 0` S1S @ 300S S00T01@ 021QU[0H0St0(0p0<0400SyATv @0CPu D0PPPxs 0;b<@ (P r@p0 P jP H @0 40@ 040D00D0 0S \0S 3 H0S(80S K<00p  R  H RY *0㌋00ppt`0|@ 0 @5/P|<+,; 0 6 30Zݍ Ѝ00S0 Q 4@PD0Px !D0P0 y  0 : X0x aD0q4000SB0T0C@0`S\0c  ʽ`@V  0p`G0?`-0 0$P '9`0>P090Z?L0/ 00 ,   F  }PP. U<(0 0R0K `1  0 l90 X0L80Z   80C080<$ 00 0 SL@0b0!0|刀?A9c!}P g0S c@a0 P ~Z0`ȟ-  ,80P80I Q"  (<  0 0P _R`1  0 70PX0 800 00   1 01 080<`0 0()}P& I 0 PU `1 p 0 60X0 ^80]0 M 00 T`6PL0&0@@ 0 Xu@1Q 00U0pI} M 0W 0@`vQ@  ˆ20W000QP M  0 0vp1000P w 0 H5@X0 M0HP80 |P0D x@v0 P Y0ğR/0  D (0d0080Y08lğK/0d @u0W 0ʤG0 +S .0CS?>P<0 @e6@ 0@.0Pf)P AQPRn `1SC 0    R 0H080n |P8R6`!!! Q2   30 @| X0X  0H R; 9 qW *`xR|@P 0p t@7/P0 80k`V q0 <2@X0 ~40`!02 @XUstP S0 \01S@ 3`0`00S S````P13 w`0 }P00 `{P101<0@PD `LhP p0< (00 p{<00PP00 P 㸠D-xP hP \\K T|lC`4h Ⱥx$X(@Զt($ TP B("(R D V{P(0d0%P#0@@ d06SV `s KXpV0H0("( D0 P TP B("(R D #{P0d0@0P X|0` 0S\(0 0RS 0`1 u 0 10XP 0:X0   | bW0 0d @ss PD 0 <2 X@l0rZ0   W }}H0Sp=00aW00  dEsh0|p { G0("(0R D0 P T B("(R D  R,#zPʈil AZ0@ 0<|P`P 61011S1 H000 30 X0/0 4(@X@" 0cZ0   <0d0%d000 x4 X000`n0d0 @ 0P )W0 08 (0d0`0d00` `0 x; 0+S .0CS&@0P V0X V%00 dr05 @XvrP0 @x V0&008X d`rk/0-@P@0/M@-  0 08  R1#0e(6,@0Ѝ/ɚ;M@- 0 0S  R B 0S N @0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@zP$Ѝ0 zP 0"c110$Ѝ000$Ѝ00@-$MP@zP$Ѝ0 zP 0"c110$Ѝ000$Ѝ0M0- 2a@@0Ѝ/M0-  0/@A#b@0 Ѝ/MbO-@44ß CMM,čßS1 PXd ,p0$P0000 0  p 0p v P<QP0\400D PJ0T0= !8 S000 $0<j\40 ; P0 0000 ; PP` P0. 5I l10,430RCލЍS! !I 0S0Q7 Q1 Q+  I    `  4.48#804"4| $,$8(|#8"(1pHHHR6 ̴ȴ$@ @4 lC-XXPAM M č@`p04$ R6 o!0 @` o P-8ĝ0  0 0 4 30"AލЍR PP 0@ .Rd @ @H koD owH 3 @,t2 dO-AM⨑ M  čR$ypPLpA@PF YpPPB t @+0k1P7 0S4 `  0S+ 00@ p$P00@S 0S0S 00@ @K @ U @; 7@ ,0 0 4 30AލЍw1 1 0 O-ß CMM`,čPp@X\@G0Sa  .S@0SVJ:TX d10T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!  T00 0 00P00S !  @D DR0$0 0s<  IG80 tP0 1 00S|z0000   Rl@00S}0000 q 0s0S0S Gv Gꃌ/ H. O-p0ß\M P@`iT V  0 #à  #4 :4 4U@ 0W 0 P 0FSX0 0 0 FFP0x 'xFF0SUPPm   B RX00 0 BEP FFF PHFUTѺ7H10 I ( 0  m0 `F 0S0   F F F0 F0S   <PHUT0XU `$0@ P\Ѝ<P0\ЍPHUT+ D`C-@0 Mp`P(1@D T@C)@F0X 8F0 ' .F +F @4"40(4"< U @D0T00S  Ѝ\x LL$0 P& Ѝ,@D,G-@P` p崒Ḃ. F0S@`>0WV!: E@E @,0G?o`D2V0S ?V0*G `DE0?U0S XHH$0 P,,0 P`ԥA=(0`( "4`43Z1S//O-0 MP䑐 0S2 @s胟p$` S S0  P$  <P- XPC  tP-0V Z0  SR 0  SRS ЍPd1 00d1 ,vlP0 Hjl {P uP060 P0 dNl _P  YP090  |9l0002lt0:0 ?P 9P090090x )P010{   P020r  B0P0Yi @-?P1?# Q0 2Z E0P0YQ @?P1?# Q0 (3B P< @ KP0102  MP010)@-@HMux^u% 0`p D  |- 0 xa 0sxHЍЀ̡p@-AMT t 0P0w ``q00 0j&u 0 0cЍp@@4>@- 0 A0|MT0t00& t0p`0# P0C 6 6@ 80 0 t0 30|Ѝ@@ep  X=A-@Pas 1!01n0SPpuOp Qsp0PSp@-Q@U x3s|p M01P M01000p0sctVx)sP //P /W/ḞA-pP@>WP``UW@0SP  P  PO-@ ;_MM0+ 0: 0P050^C0XU 0 5K01+`,8 05p d!  d!. 0`1q1110/LPP~  ʟ ~0ʏ Wό d10 d1 YRP& `P P`0DPS_H N p\ S S00 PpP0S SR#3:0 0CQS0 0CQS000008jP >000{o0p+0+P 1#S;S 0x(S$ 0l(So 0`(S@ 0T(S 0H(S0 88R00sS1 S S(0 n/ 7R1 S S0S00 S S SS@@ `0 vO_A_u0P@00Q"0A'A+S}? H7R1 S S00R00S 0P0 S S00  e@@0S S| 0p @ @@@@@800sOg/0050#i 0GiPd,P R`P 0c,P 0R@mZ9@L0d!S 0 0 2d1pC Qq|51|rp @ όp0`0S W`0`SHPDHp .Sp0SWP`.YpGWV0 0TPP /Q0$00x4 0 5 30_ލЍ4 Rq W W Zt$  k?00$` `P k V V` VV00;V0SJ`V 4 @0p ;V  00@`V  PP 00P 0 Qh!P ``V;V \# 0 00@`V;V  00P 0 Zl` $`| 2R1 S S0Sq00 S S SS@@f `P 'N _AP@`0DPSH  \ S S00 QP0S R:0 SQ 0 SQ0000045{_P.pP `tN0!x3!|3p\aDP` DQ }o(hQ(z`,QP 0 Qh!- =pPB-6j`P@8pY 2 @P$  ̛L domasearnamesortoptionؚinPer5 listchp@-!1 P@hlHM QP T 000HЍpp Qx#r c_qV p 0 xT00oPT $000HЍp/|/đ.A-P RP@p0`  R  @P  R0`\ R [0 V0O-0PQMp 0 LL40Hh0P0 `G0P0 0@($      2P dPX" RM  0!#X㴠`Fe 0PP P dP R X@00PU% 0  0 `F@YP) $@  Q PX `F #Z Y御 0 I00`Qߍ @$ 0P PEQ*0$ 010 $]  嘡 ` 0 Q0 :0 AQ1 :PACⴐ R PZPK $ 0 Y  uTP P K) ( p  i0 IQX P p Z p  GX  0 EIH 0 0 0 6Iy- 0 r긒 L@-@0@ 0@P @($$00Hf 0 @-$0$ 0@P00t 00/0 @-@P @(00Hf蔍 @-@P00p@-@PP  P  0 p|L0X $p@-@PPM0  0`   00HfPP0 9P  0Pᤠ  0 ЍpᜠЍp  0 Ѝp L0h $긌 @-dA`P@ MI T!T1 PQ0 Pp 0 RpGS( `oGp; ЍA@D@bP 0bP 0S@ R bP@0 DL J Ѝp0 L `J ЍH00 <00 T @&&pD(0A-0PU" 0U"0PUP!q@@``F4GP $,GP 0!E`1$(`P 02~P%''T%0O-F帖@ MR ,0004 6P0$ (0xfxvx`{np`S8 X&Q !GT@ d(!< ,&0C S00 60< (  A0dP@A <8@P( 4<0P(0P{ PQE@40Sf0S h 4 0Sm87S H% 4 0S4E@00S S504 RT 4 ,00,000S4ğ0 @( 0TA4*02P10S P1p1 S^ h40( \40 0Sp @4@$0 T(81P(6VrP0440^ 30(P PЍpAR 0Q*# 0T@!6# 40(P8@@P(0&1pRv4"0# <*Ȝ1\ \0X 0T:p @( 2<01P6(P_4*20(  20< (  l20< (  X20< ( D20< ( 0200 ( 208  ( 0 0(0 (  10 ( ̡ (0( 10( 0Q0001刡0 0 0 0p10Fp ( 4PЍ>p M9p  u p\TmpP/ 0. S 00KL `H$ $ȉ$$H##(X#8##""" ""L!!$!  `   hD0@O-01M0 X B* 1 a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y $00 ЍthtdX@-(0 $0 scr` (HA-@@`V 0 CQPqDP pG SPZDP 0`0 @-@00 R \\  $0!0D0 0@ ($ T0@-@PL  0S  T0S@EECE@@EP/0@-` 00 0Q,000 P0($0  p@-@P0`H P 0(S  1T  0 $000`pp@-`0PB@P PBP 00p C) A- 0@S  P p00  ( $ 8PP(p`P0X+O- ,0S 4Ms 0 +娫   / +~` P @l+0`{p^/  L[@P^_@@ T@ } @Q0 :Q , @T  :R^@Z :0 Z:P00<0 0Px` `@ 00H4S   !d$R; PSu00,0Q090( RC 900 RB ) 0S  Q )0 0($kIj@(p` 0\90 4 R B<ɟ  B QR 90  P`0N( ( ( X 0 80P ` I 2F4Ѝ8 0K`P P @h8p0 00  H( 00Du0DS:$8B0`800H@004  P`0 0 0H0C 0 1 ,Pp$p$p(,(\y*ppQq(pW pA$pW P$G@X@`A$ppW0@  ^(0 1,P1 @P(@ @(`P, P  [BP P  BR \`A$Nf0@(`P,  P1#0S0 0 PPp`@(( yp( Pr $0 0@SA @`p  1P$  pW+00^00$p ^P; 0000 @`000%4000C?00s( $0A$00( P A ,P$ppT (0$0 1000@`p $P1(P$@ `P@` p$0 W$000\KW 30$1,k, V0, 02$@0@(P (k`P G R-CP( 01 (0p_PP$ 0 1(P$@;0 (P$@$10$)QNSIKE 0ppP10<0S  p|! ^O0}ς00P +.000P4! /(1:Q0@ Q10 `{@ @0`/V ̅h$ (؂|TpP0h {{{X{8{z  z@-@P  0Q ^  00$0000 0@ ($ X  p@-l@@`VpPPp0U1pPE1PSp ( 0$ 0p QA-pA@PT`QV0>@P  0 p"PP``p`@ Y`wA-p`@>PP T  0 000P    A _=|whw@-@@0/ 00(/000/004/00/00/လ 00(/000/t008/`008/LA-``PU 0AP p[pM0AP@404 0 ,(04 F>?@/-@@ <0 Mb00a.B Ѝtu@ @-@P 0`00@050 np{@-@Q q00 2 \ 0 O-hs`Pp@M 0p T 0S000 0  0 0$ -0ᜠPP 0 2$ "V &= " 29 0 0 0qp } Z Z 00 0@¤ Oej <R 2"00@ᲤZ 2: 2 (fP0 0] 2< 210 010010 010 0100100x100RP 0 R00   0T 0 2 13/p ЍTf0-00PP 02 2x00@V@P0S}Z 2: 2d Px 2 @0 28001,00h 48,xC-@`pQP M p000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH kP (0 $( p 2 P7 ЍP Ѝ!00P("- $X000X "R0#03(0 $X "X002S13/p  ЍR bw@-@`pQP M 00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ  Ѝ00PO-1PSM3:00 X'*q`I`[ p@ p W ;0 PtZ 2< 2ЍЍЍ=P O-MXr=*`00A̱P引pP W [K D`=@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 Pu 0SЍЍC-1`S M.:rWB R* U"R  R00U00SR 0 { PpXB Ѝ 2< 2 Ѝ<P ЍG-pZ RbM* U0U @ RD0 F P XЍ@ 2< 2ЍЍG-`഑p 0@L PP IPx1Q1X%81 @a%XC !QA! @0 R 0 1Q@10CS㣐3* 8#8 0 BR ("(R B("(  0V08#80R!2 B0C!20pT00 (A<00 (:$bP0h t2onnp@- @YP P ~0@P (p "@p@-P`@Q 00T T 00p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-P`@Q4M 00 Vu 2+ RI 13/p)  0! 2$  00 3 p`0 9/P 0 9/P  a0P 4Ѝp$  0Vqp 0 P 2: 24Ѝ?p`(0 0,9/P 0 & DD>I/,,I/D0 WqhW}HWu 0A-% !@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!A{pPQ?U/dVW0O- @ştMTP @p 0P(0q 0  P4 i (H0$H 000 00P000SFH00@0 ` 0\ D@ ) ෼  I Ა@ `Rڴ R  D@D Ζ0I ȠP,Ƞ  BHL  (@(04P`@AH$HQ 0,0080X0$0<00CS@H$H@0S*<0A0A8#8 @YᲀT0@:0@I@00ഐ0, {0P,0 R 80S* 80 <0,080 R4*Q^P0@00Q0 00 RPP ` 000@H$HQ<08#80 ᳠Z100S B CX TP\20S$0Q0 00 R 0P 0R 0 $0t 000 PkQ0b80S 880,0`00 0 0 0P)d0S 0% `P0U$0 h0`S,0 80q0B8#8 Y0@0:0 I 0( Pഐ0004 000tЍ( 0,0 800<0S80StB,0h800 <0HLUY?]/c0,=.Z0P\PO- @\T @0`S0P p@D%P 95 4P( [  8#8R40  C 0(10S0 1$10$10 0S0VP 0 P0S 0FP  00S 1$10$100O-MYP@000X00 ``FV*:S 1 !* `p pGx'x  0 F pF000H00 B 00p0@000 ``FVA*hY&hI V `!0p pGx'x 0I`h&h08#8አG0Zp01`*0ಠ0`0p00rPP Y```0S0`0Fyp0 ,v0p0 ,mhY0&h0``FVr*hX&h\ 88 p0 0 00000``FVS*hX&hD Vp1p!8#8 R0C8#8p  ` `Fh&hJ0Hpx'x08#8ቐF0Y`01p *0ಐ0X0`0p0 00PP @00S.0`0FDЍЍ 0 ,0p0 ,p0 ,heT0 ,0Dkh`40b0 ,lNHNMM8LLKKG-p`P@ S  R0 U@ T8 P X0SJ0SQ 0R0Ӳ00ô00 00A8#8R0 BY001 *("(00 000oUU800C80t 剐BY001*\ ZHHp0 ,` 0R0ಐ0CSJO- R P0@ B( * R(-W ᷯ0P P I$ o@P! 0R  B( *Z`pV Z@  P@@p@-P@ 0^\ ^ P0Q0 Pp\ p pG-@` 0PS 0S  0 Q@PS" 00S ᲀ\: 0 BS P> 0 \P   00(!S$! 10$1P0 ߗP @p0弐ᲀ 0Ap 0 S ࣸ10 B\x ἐᾗ'xP  $1 0$1(!q00O- @T @0`0CS0P@D p M!P R2 1P' 0 0  dP 8#8R0 U Ѝ0 0S0rP 0 0P&000@- M@ P p10 Ѝ0O-@pM 0 0p`Hpb H P PM0STD0Z 00 @ @ 0 pWM0 @  pG W0G*0@p 0@000S p0C8p#8W㲀Ḱ07*0p00ᴀPP D0ZPPЍ0 P0 ,x0 ,0 pLLp0 ,44p0 ,{0BfBB}BG-Ÿw?`0 0MR,@pq2SP:0JSM P P崀2Spp1!pp BRJ:0CS㣠o* 8#8X * 8#80C 00CJ1!0C8 !# 刀#(9  20 2#4!,1 0 ,0 30B0Ѝ 6P1 ZP崀 Z (0 p凩P202 ╶p 000 $  ` 0} 4p $0b0 $ lȬ d @A-@pPQ`M 00 2   Q Y:1Q|0" BZ1"0001 0 VA00PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " 6ЍS00Ѝ0PU Q:(0 $P0PU`P-P   I/P 21 z0?@-0 -M )Ul lP 0PS @P000S 3/ UVT 8 80 $0Q/ $0S/X Ԧ l=<<0 0R/$ 0S/X td=A-@T 0SPp`/XP0P@QD 0 <mMP 0A/P'O-@$Mp]0T|$;pp4pD0q$4SO 0! 0  0TpC(yBP b0@S3S10 3,3 3$$ 3$ $ 3  3$$ 3$ x3($ h3$,$`< D3$ D @L$Ѝ $40$0($0,$0$0 S3000`V" WP  2RCLPP2&C*0 p00ShP\R0 p0 00CS0z 5p`  RF(4S VZ  4S8 0V0$R0S  L6@) 0@ K*000`006@FU0`00 ᳆ 4S ! DrL6@ 4S $Op ` V V ,4S ^Op IOp4S VMOp -Op `000 ^Op V?@0`Nj"2"" '|'i"H>.0'"''G"'M""f"O-@PMp`P\H/ @@00,3,#,7p: RPGP P {O f0@3 hP>  2H@ PPxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y  NxPPXPPqT! (]`P "  JPP* xP0SQ t*xYPdqPfTp`@ 8x%,1 B R 0S ᥫV X \ 0S X  R 7/P  R )$ / $ / \ YCH]#k&^#"H>. 'o####(#"##O-yMP[.0`Hx00 00 (8p8`K[( 0RJ S| 00 0 `wvPePRPGPQf0@S(H0@ SaP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SR0RK 4R q'  P M6pP/W  0 1r0S |Sp0S &0S0@0@P0P/S VS 0: S00! [sUSq0: S 00000#/W00S %v0S0(00S00JpW   0P0M l50 0";0P @/P05,%0CS0$ `. c  _ `pPP]0S v0Ss 00   B R\ L` V `,Q' /0 C P@0`@0 i P0` J/R  S/R/  # C  R:  ` ' 3 0S S/R$ 0hSR& R0sX/ HL!R\0X\!R\ 0 X00: S ԩ C C `uR0: S P1: S  : S!  Sp  Sh M Sa S L0S !OPL,0SJ ! $HE0(尥 0Z  Z80 S800 `Q x(RPP1: S 00Z0S 80`!0CS!80 TT0 @LPR X0P X 0S !O0S !N喧 F[ (0S0S 0 0 Qp!|u$'#$ '($]$$k&$k&<$$$$(&$%%6%\%&%'%6%?%$O-@PmY\],H&6p@<6NXP\`0O ( C(0, PU`00 XP\`> ;7Dc+d+ '+/(o&0(++0(*0(+0(h l 1(+,hO-MMW*jHGw '4p 0 Q 0  xH0(0h7G@-Pn0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S XAsPU R8nR oR0P<0,$`P  'P8(s`P,PPP{ FCRN , 05 PjPpla4 1SzH0S?80S<@0S9 P0SP jP4PD0S 0$M, +⥳p P44X(D`尠XV 0PU 0040D0S PލЍS ,0SX sP 娠=`0@0S0H0S 0  F SP P 3R㓵( F OP3m W` Fۑ0Z ⸤P t3  dI&P \T 0D40`FP NPP RPPT0S#0: SRPPP4 01!ऑP4L  0R p 01P0 T0S|H R 0 T0SP pRP4T0S 04YX 8SU # WpVJ  g."  ."  $."  (,." 0 4   8<  @ D  H L  3]P +  OP40SP8`-1(H>.g0|0,//00'0 '0 10)1F1I1W1@-04eP000U00SOr0C?ou21@ 2p0 1000C00S9 000-S40 2R)0pP EP SP l hDAsP xPqDH84 4" 4" 4" 3!00000C0Y(P&}zwR@P |S!dTXcQLWPN<32S L#L0D@VuS 3 0S 000S 0_P 0VPPH000!S 0 岱0S XRd000S ĺPdDC@n#A1S bVqQ"zdᦺP2S 1"D:Ua`0:ERlQ100S S ^d!0`00~01JZ@PC_ Po KYPj @xrPg 2S 0"r r r2S`A["&dRPG2Sl p0"PFP, H0"`(C0 0C42( '6'H>.Tcd3(5(45L4(70'=7'(7@-@MP`/P@P@PH"3 0@B@r0 T1p= 2Q=0 q E - PW RZ R\ R3 0!BSQX YLPS0: SO00 o $1pd10 ER!KpDowPePLP PP0 FP if0@ S00000 0 0 0 0  Q |h@ K@P0: SpGP h@99(7(M8 '99mO-`M@S&JqpP!0p 10a1S 000`F0PmP pP rQRTP xfo`SP %[A Lp@L,0Z 0KP0 0KP 00d 0 * R 0Z /0 0 U:pJp @T?ZdKP U:ZJp;; 'H>.;;;O-JM M@S%`R""0p1 @DTӸ)0 aS T  rH?iP fP hP rvP00`000 00` 0QDKpP0: S !{ PP nP 0Y/S / J>00$CP@T 0p/SX/DP0 S:L+p` B !rp}<7(= 't=A-`P@MqRD4 0傎 JP  I JP  I JP  I JP  IPhd3P0\3P P$P@3( 0P+( P3( P7( P;( P?P ( PP( P qP8$@Ѝ(P (PP"ㆣ(0S (yP(0S (oP(0S (eP(0S ([Pq0S HPf|!0S0S {p T``PLa @1R`PU 0E /R  P(עPU  <00,0/000 0CS0P|P0$0v00S tmm}0s00R~i~{('`P(N`ht&``!a`(a8(` 8(Sap@-@PQQA$`LP PP `t h.ph00SV᠃P+mP $ 0@=kk '0''kO-MPQ $`pF&6.p |6@X/d60S ЍfP WP! PP p `RP dP vP iP0p0 `rPxP pp0p0p$pq [+1xES ᪶Vpe  0P0SP$0`S 0S@ 㻝pP PP4P0S l @[*0/S /CP0.S0S .S0SZt% L4 0 R  @ 50$0C SR00$S P P0$ 00$ @&$ 0Il0S $ ?RR00R0SV5 $ $ 0Sd3X  SP ɟ 0!0 0C0| 0S- GP 0S0 C0S 5S# 0S 0S#IHP%0 0X 0 0Sx2X  PKX2X  PCF0S<mP 60S 0S/ 0?S+ 0S6<S # k00PU  HP$0 S`0S<L0: S R(L  S/o" R 0: SFP0S  0婡P SG 0SG P "0S 0?S 0Sl(ll 'llvlkllilllG-P@\O0L"`p!y,p 1 R1 p0C@P ;pP vP0p`٢FPWp0S VP /ѳP 0S 0S FP09p0S mm '(m0@-TM ; 70 $ ENFPNF@\GU0F0T000D 0EP00իCS!ⅩP3 ]LP 30S S S" 30S!  R h#6 R P#!SRL3 G (3! ,3 003 3  2%20S! ( 2 20S 0S(002PU%B;P@ 0@pB00CS00 5 0 4 0S60016 R0S 10S<0PT<0 01 10SQ 10SM(p1\1PNL10S H10S \1 P1 t0S 3160S (E@1 F01U(H  0S0F0S 00ip0S0S 00\@pP@ ToC({Xu&(,((@(((qdv&lv&{(t& |({{C-@MP M 2b@@0 S Op W"*pC 0 L1 0妳Pl7h FPTPx EP<88 EP$T7 0DS 00S8 @0xL 0QD0@0 0Q%@0SV L quPQfi!a0@S0@q7DP `Ri@@L  P rP P 0@0 00 U@LF!LR!0@0 00 0 PL D0S lx xEPX7t9뿨 ' 'èɨϨBt @٨ht@t@'H>.gt@-LCY9O-MpL0q@0o0C?oPd20@@@@3#Z'p3 X XT 0S9 ZP7 [PP3 hRPGPP l3H@ PPhP dP fP00vP00 3@00P00Pk 1 00T㠢 00B R; :hP" @ A0S #S(d{ 00 0 tPP4 p00#ᡚ@P/0Sx '. P  |p |pq  Dp 4h0S<0 0@00t*h5h!0C S?00S ᶛ$ p p0 R qX  Pp P    3/P00 S $ p |p[p000S g~E8(v& '*H>.%K(*;5DϩO-M M`pRI ^^{R5 00 5R5005YR89, 00ZP p  UPZJ {PA Q gA0@6S0Y S~((pQ tQl 0D(`ȟS SS L`g05505 00505058 4P .P 7 ꤷ zp0"S /g\ hp ϼ0"S 4 Wp0"S P 06Agp 0z05000001 00 00g0e0c ^P ^  ^ QS00 00055UU f 37Y5S50`FV%R" 2) 0%0;VpP%5S 0 CP80: S055L%0IS00YV05(VZ8脟$0P0 H8ɋpP $sPP`  Ap$iBN%pt500000 0A%@P6 AA[AAAF4PPP0 0S3 C7f0#S  @ FXmBƓ # Bep@N H0D?o2?  @ PU 9@P.f/dPsU PP3BcB8冭00CS0 sP Pp PNU}0 P00CS0<s0 V0S:00S:0,V511S#1S   PdPd!iB%h|V`9P 0aRP P0V0 KPE0`FVvP@eP  f/ йT  t= P(RZXֺFH>.)&xv& '(Xe@(F'0'mdθ((P@-g 0P @`P@p7 p`00CS`0 P9@T ЍX0 X @)8'D0'O-dM@` $e P 0t䄟4 $0!&p0+$p@DTlUU!Z %rUdU t0?pd$0 y dUQ 'RU2 SU> QU040,   dtPcPSP PPd @" nP tP0 aPP pU] [1lUT    $]h$ @pX dЍ $O4$ @p3!d 8A8 @p2/( 8ո 80Y  H*T@DPP`p Xdy`TE`8 @pP P <"X0B!v t  0!;X 0  1 pP Q !d8 0P0 dTKy 0@Sd6\6p08"U08 pլ0PU 8 ̬ F P P  P0ZS R`V  y tt370P`\\QH>.T '`~DtD{D|D(}D!N8km'yaratcidO-0`pOaM⌯匏22242222322$ T/$pjH?"42`FS 20000b2^S R2SVV10 dbV% ``L0p LpP  ``L0}ppd2S P?PX0: S0d2232d2o``Sm}0 =SPpmٸ0S e zPRP3P/PS@'Pt=1@P A@PP=P00j0000] ,23,00SP b<P0d2M042J02G02D02A02>@\ | @5Taߍ02/202+02(P P>PX0: S : PP /'P )0 $$ P*bMS=PP JU=2|>p X:{\10  [ *<[| d )!14\)ST <̲03U8  803N88 P 0@C R\ 2SY 2S 0sUp <pd2SL >plV X!\1 DR\1X! 0 \02T7,2P7.!) H!)1;X")]^uh()U${@!)&)rdAedA )O>(X!)'Du x&i)')8DP P \+0`p!` 00",00!` 0,"? 0,! 0 0("-(E P d0$    02S3 쒕Y081@tW@2SXP# h1`pt 0 0 0a?@JP 1! Y!0T2<<23Sa 2AS``b2S w"8$)0 0t4PO I D0g2  s @T' 0@ET @@  ]  RT 0 S`0   0s r `Vm De1T X_1"20"0z0P6*P0-0O- EM MP 00P00`PPP@ 0 $pԄ0040pV4$w% ލ ЍyPcP PP! TP' ۳\4 ST1.H$d0@S0000000  +0 000003M30S : pP^00X x" P"0SH8S R) Q$nQoQ0 )#0_PPq "K"002"@xẮP' 嵮P" 尮P  |]U.;P Mp@.D F8"8:PB8$R#00 ="ZpWD ` jGP/ IP1Z /Z#X@PW?o[20S@ W `@T  jF`P4j/n]P  9p. W8ì>04P(`CQښ. . a0C2,S!R. !$RU>"05]hH)] '$'H)H>.xH).N) 'PO-H4MD$` 8P! 8PE70pD00PPP#p4W00S 0S 0S Pp3 a X( 0S00P h奱0S T埱L圱WPY430S ЍzPOPBP FPL J"P0@*S002 P2 P200㘒"0 0b I .00P2` P00 @P00 0 c IPx s000o00l00i!0 mI1 P :1[100000P000L00I`!000D000@1p=0000070003P10S_LPR_U 0btP J`IFi_IZ 6IZ4`)0X)   '8`)H>.   0 U x&[)  O-@Mp@@v?,NP6WpG102 vPlP+HP1 TPH 7p0` 0& D D0`Z   g?qp` 0S ,[ 5m@ Pက $Sp R 0S00!S0  4 00Q40 P000S ` 0, THtPH?00-S 0`0@0( 0P@`PЍ@}0 0<TP@ᅰ000 R0Sk3<0 @ t#  lG B R. 0<00@ R T 0 00S00 ZR R@u0DKT$0o R" 0:E%KU0<0 iR BR0<0 BR0<00ST  R\" :J%FZ R  :O%A_$U@*DP Q@:IP0.,@\p $0S$ 0@  200S0Q@$0S0S (00(0@`4P@ `$`(`$0S (,$TUT[D0$ 1ă00S00g?;;0 4;$#(Ć,4 03/p V `p P2\]\] '`]]]''\]??H>.^^y&@-44Ǧ,ͦ$0$00æ Ѝզ4y&c)O-@P8M -`$@"LF8 (@v`^ 4%p, ( p Y6 R|, 0H L,P00P(\80pHP U6hEVIPHPUpPH5`dh0%p)D5O005SO /5,* 0 0$00 00 0  F_PPP$VBAJY PzZ `Z NZ4 AZ% CZp| ᐥpRܥda J0R WZ00!0 0 寣0DS ,K0L0J0ؓO005N03Y YH0CM0H0500!0 0 h 偣0@S LXI03Ypj0zZ0fkZLZb 3mJ Z] PV䒟TUmPH0SI0SO005SQ LPM  pp 0S  0C !P @P4 N@ᳩኡp``p/>P 26ѥP!< 0S!0L BB@3/ (Ҭt8 P``P (@xP414+ C @R #( ⾰p0l  PP 0"0C" B @ (( ⣰p0 |`y& c)8z& z&9pc)y&Qy& 'z&Pz&؎H>.jhz&{z&ؗ*D[iHiui m@-&P W@Fh)@-HHޤ@<<ݤ,0400٤ Ѝ&h)h)@-HHĤ@ʤ<<ä,0400忤Ѥ Ѝ֤&h)ph)0@-t@t ⩤h0(,⥤ ⫤(⩤0H墤8@坤@040圤0⮤8⣤Ѝ@豤h)&pG-`M 3POPQ3P1 Xp* PA3`B3@PP@3HPR0 0 K0@O@"u 3 Hp HQ %3P  @ p1a 0Z0 @ pP0 t@J dF080<0@0D00 0000P0 0 080$@P | 81 HL@P@T@X@\@HP壬 H㟬111 0400,0@@,0( 00P pPPUPT0PP 0/`Ѝ !&8I`2$&0t0//Di)O-`pPH6MDF(` 0 0&p$6U K V0S8`@@0VoP 0SЍuPfPFP RPZ G5g@PPU0P 0 hV0#S P` $$0`0S  $$0`0SU;P iV0#S (.jP $$0(0S x $$0(0S|00y0P $P(q (q ( (` @s0KSq01P1 C@Q 0cR pR bRJ  VJK[g0Y`[0J^00I?oP2000 U.Ux U,P 88 0,3/8 RPSX s:@K10S_ 0P|0 0C?oR20SV X_w00 0$,0$00S 0U00S 0 _0S0P000010S1 0S 0{P0 0  Q00s  h1000T,0 0181P0S& SR 0@0@0 #  R S 0P(0s  0pz10S c0 00h6H>. 'Li)vм #S3'vO-P ` 'M M܆F$ &Gp.6p0@KशT00S 0C 0T T#!q>@P YTTiP㧀HM /pP:0S  mwP`PAP- WP' 5a@P00`50S $ⴸ`Y T|uۻ`000`0000p(ᎥP 剥P 儥P- 堻P( 咸P#0p sP UP( ~T}p q>Plq/yT00 000#0 00$00 0嚸P@(K@PPt4]T( [P( PU@Yhi1 PP(!pP( MNPP@ p@0P@ 0(PpP q=P 00 00$0 00B@PNP pNPNP hNP @hޤP T٤P XԤP H2!Uc82@ ɤPZ 穷P( M@pP ិP( +⑔ /{P]PP'U!:r0 0.pP `!`0P.0SD00 000$000 0P0@(p /p..0Pa0SJ(S'- 29S!S| 1༄X0S T0C>0MPP'ݍ ЍXi) '<H>.u*B hi)zd@j)edAp@-P@X7Kp@-P@P7 p@-P@H7Ꮌ@-p@-P@>7p@-P@67App@-P@,7p0O-NMM@00PN`4Pᡨd}P 0,~0 P PG 0~S$0Gp000=(00$0 0  p@4=10>0S=D$R$r R  $T}t $I;<$9n0A2 x0@ <$00(0I].p0 R`PEB@D4T@@0$0<@ᏣP < $冣P   X<  H<$$r $PL` oP <$0 00 , 0 <0(00 K0, ;0@r _R; x;$i0 00 |0  @;[0!00 D0 \ ; M0(00 0*( :$?0!00 0  ~:(10!00 0  p`:,#0(00 d0  b(:0@:@:0S .P00 L: 000 4 !00 0 =:0!00 0  /l:0!00 `0  !$940c 00 (0 h 9 0!00 0 4 888夘@0S C.0 :PQ:}P0@4 vP@ 0 =Q48團@gPD40 _PD40D4~  G 0P(0s $@00 1 1 7Cbt7@P00Z7 000  jM 7F: P-P/ (P h-Q0SX 0T450 020<4 4"8 #!PEU UYv z ~v0$V 0 `S 4S<4Y1 H4L$0 B-pk?HL4`@09S㬵 $E~G?GHtLW09> $?pP5WLHt4SH$L4R0ĕ %+p`  #-p  4S@C`; @`P\%\ -p h19: S8 5 $Rv+@P <&HP  t _P 00,0000XZ3$R  $~?0H0bp!t$Ts = 040>P40, r0 4BP ,=P $$03}pTs 40S0X44S9>@#R$ !SR+ >C0 # Pr 0[T4P |3L# [T4ST31P <3 50 >C0p1"R 2H$L4P*Opp 0 L4H/0#! 0]p02 C  O$0- (opvHz )0P 0 $  0L$H? "q $R 0z"_W [P0$$4RT SQ  W  [*pp pWS  S!0$Q[ +S0$0 Q$ Qf*,bxk)  'sH>.'TX_k''DTa &r}o)Gk)%8DaM,oP&HL$ P,} P+P *+0$PvS0\ 4S$iP 44pS04144 0S @4S 0 @ 50@4,4S $4R#1ѣ1,40 000(01Vv )t )0S 0볈p@$ P& 0d!6!m^`E}-@nP9X/ Q :$45041$4+dT4S.  "+d00"!%*)))Tk*\4$82 H4h42 x0<$0@ 00*ptBrsP Z aPhPa  Dwp  TD Q C 0/ 05O-0pM$IM i44  )pP_8`4pGs04WZ pB⮢  ᪢Ya 4S<44S $$4R0|x()p h p*p P 4 SP40S 0x0$N $tZ0 0U 0$B P$ 1SL  $$4PE*`MZU CU'7DPEUPPbPEUUPP7 0*,'8#800 R'0C Rn ("(M044s04b0 00 0 c6T0(00 PV0,|U0@E d0 00  0<C50*00 +07 )0*00 +0+0!00  00c 00 0 \50!00 h 0400 1 <1 40(40S :M00Z; p$"=0P0X$-Mp)p 4S $(PP$,D`P#l ht  X4P C00 0 0`V Z 80Hp%#4,p =  $00̝P$0 r004 ΝP ɝP$#0L3}p,p4S@0S4p 1S !10"L 0S .X 'u0|)u&n%6x)8 &oO-GM MP`h L@t@4$ p(4PEPEUq\@@5P3 D04030033ܳ(3 Rp0,0p0d3000T3080DL3L#?$ 037@ 3/D 2'H2"20L02"t2|" T|2\"{4d2 p0V0  82Wi$2 p0X01!W 1`Op0x0p0t1 p'p㸐%Ӡ  G/qpǠ0 S à D 0Z $K0S0SPT0 Y@PA/ݐP 0$ 0 0@ xAx<@PJ Gލ ЍX 'H>.U\hr /JO-`PMD \`[P&DOP8J &P%p%&p `Pp.@` .D pRĎ 0\: P  Z .>> Z %P t>HP %Pd<;S%PL #O $N 0SQ >]QP PX( { =0 2S1<+02D0WC=0S =C@4P 09 0| `x`0P 00R0S DJ 0;8;08; 00<ppGx`M<`00S 0JHP  ,!.u8P:P :2@0SUȌp Upp̌ ňppzPt  I 0@ @ 9 0PUP 0C S0400000,00(00$00 0000000000 0000000 0V0p  Rn PPlWo Zs8;  00 |\0$ph8; 00 D\0$p48; 00 \0$p8; 00 \0$p pW  |0 x;0 E y;z+C0;0; ; '0cy;0z;(0x;P+D@+P \0$P;"0#10@00 0p[`QHf  p   p 0d$P[0S PP [0W$PX 0  00 86J$P,d 0 Vpp6&8$Pp5%0$Y!2P(10[[[[,Q0Q4QE 0@PPPP喝@<;SdE$>؀C 0 7P8L@P%L P4O 0N 0N 0$胟N# 07PL@XPL 3O 0N 0N`"2Rz 0FPt ' 84$44@PEPt40S 0 8' &@P 0EP@P 0EP D2 h0弖F"pt00 e@+lY@0W0 00D4(Pt3 ppW & P 2i#P0:CS0 a#PD 2$ 0%bB &NN`p l29N@P 0yELPZA@P 0N 0@PfEP D 0_EP .1 NoM  h!@T 0S I0㈠d0d000p+t!pP0S < 8yꐒ*-G*{Gz??leA 'H>.4V`RMb@Aoԝ*$*'***"x*#'u**u؝* hԎ&@  `*-C6?4*;E8~A*$@H*@@'*(**q&!L*0't**>[ -F`r:"  7 R j      !!%!7!L!_!!q!L*y!*!!!f"t;@000aV WL0 0 Q d|0d"R!RT 0 Q @ PG1@S4 2R`2嶰0C(4"<8#8[1LR?L0 d0ᢏ0 d2$2    pசp0xt|0z?lxzt 0L#L 0ILIᰒ )DP # !$DP #! 4+4#0à3D0h2 0h22d0D#Wp! Uأ0$#$@0(00"(D02 0BS@ (SH; B 0;YpD0S?0#3!(0H0C8C8S!/< 0 0H 8(#8<"(: 0 DX4币  xvxΙs 0#;    0; 4 0W؃0$#$@0(00D0"( pd4 U T JXwP@0V/W !@ 0RZWأ0$#$@0(00D0"(4u%0 H0D 0Xp4<H&0CS00 P 6Q20 0#!M0 #0pD0 0 LPk 40 CPb X7Q0lP|C0 %PD 0$#$0(#"(!/0 P/ %0 P% 0 P Q Q TXp\n 0 P| r0 P 0 P 0 P 0 P 0 P  0 P @ 0 P d X9 02 @.0SD S`& Ss W؃0$#$@0(00D0"(p  SHZFWH `K F ` P  JZ0H(`F`J 0XHZFW&:;Z  uPW V  ḫ  >W( Hp JZ |X ;Wh 6;O-M`P@0-S@HP- @3 pȣ#p*30SP a`F0P[:PQ9 JKP9  H .C8P@ 3 C d0@S Lp@20S8K@HGG 0o 0`]X dBY':`PQP`8b2 R  0 S  U+ 0 !0!00Wt p4 ,pL0S7pWI2p` tp:0S0Pc p00@@I 0xlB Vh p` "t+!" '%""#"("!/"<"N"!{"a""""""O-PAM M@`6P&0P0V00-S' @P ᚑ0P0-B@0p0I\[00`F0S0`@DDA@Du%<p ,0S@bLP53 Q  ZJP -00 `@[-00  D0B5S0 #00S APA0 0꼄4P A0000x4 |4 0S dA L4 00 8P   300S Pm0$0h0(0e0,0bt0C?o#2p R0S0$0P㤖t㡖P㜖Xy)x0H= E@DT43a00@`FrS= RS iS1 tS xSd㨢в+ ux0p 0@00@00S  0Y]]0S 88< Q (0 B b/S CD"(0S ܳ 0`k,,0S (0S |Ƴ1 00TXS @ⷳg(0S (孳 0`<WM1IPp+ 0 pPUU%$$+"%&%H>.0%H%+j%&%%%%% '''N&d)&,0'Z&l&&:&(O-PLM'P0N0n(.p>,# PER a0:  9@@0SCT@vPcPSP TP LP d0@S00D003030800H00 30$30(30,30<00",0Y0@)0,0-p ? qW3S(>)P @ P< P/P LЍO>3S 700Zp,U0P4 K8F<A@< 0RWS[Z0DSPQp! 100gS @{D EY0`,  aR @L0Z S ?0-S0 @ 3R: "0 0: ` P0 0|:0 0h:43043{0830<3@30@3ppzzyyx||{U ,0U ,0U ,0U ,0U ,0 {0 0U ,0nL00L0U ,vU S S0X0X(0CS00 PD#8 D#<#  P Q0P0083 !00b0,X0$X 0X@0X0 X0X0,0  ,0 =٦P唏PdH0S7 0N09@PH0SX'BB0- ,0SSX p43 S40P//aUF cU2 gU0BP!03S_0Sa 00gS# H0S |&Z` 0  d0Sa PpWpUpWX 0S00  ,048<@DULЍ0000H3P0P xH30娐P֒D30& 4 004 SSCP 0C00 ,0  4    0R:400,R0T ,0 R  B   0y< Q $0Q P0 00 R  B   0y< Q $0Q P0 40 R  B   0y< Q $0Q P0 80 R  B   0hy< Q $0Qp P0 @0 R  B   0Py< Q $0Q^ P0  <0 R  B   08y< Q $0QL P<0PESZ $3S0S :D0S] @p907S  00&c;sr<  R  d  v      UlP꽒0S 0S 0S  Q 0   xpqPU 8 30(#0<  | +KQ 'R+R!RK2RNRRRK&p++Kx+++++h+IRHRR+RbSkSxS`+(+VQSS)S7SHSUStQ~SG-PXM` PHx z C 0C0 0@0 B "00P 00A00C1#C Q0P 00A00C1# 00CSP0 00C0A1#S0  00 B00C2#;S0 qpD4z 0P 0PQT+,`; ɊJZ2V  w`'o`F#P% 0SU030#:U 5%PȜ P  2 lP&T6K/r06S\<3PvTS0 0(S9# G@hSPEX!EK/r06SBPh 0 0<6Sr46Sr 06rS 0GpP2R01 hw6S 4rP W0`W  0P rh,6S m/X`P b`Q0Q  "fD-ShD<<6S46S^E`^E`@6D&SD1 0 00R4!P H& R ! Q $&R! 8&R0&@PR  Q   @ k' @ y!@X+WZH>.Z 'ZYZ+[t+h+[Y&['ZXZ'[5[eZYPZ`ZH[[+$\'\*\0\OY-\N\A-P`pI䁟HM!jp10PEU HP h0@ S SHHIIp1Ch1X1 T1 pa 8P (1`   h aPP 9 L`$@@Ԁ`(` `C EP PP0S EPxW 3=P X90 0000 ^\\ 'H>.И&\+\\yt \Ct \\0G-pHM`0BR"p 2B1 pGS 1S 0$  !RS@# P+PTP<$9xP`PAP MP !a0@S0 00 04044041P100101@30@3101101101101ДY 000 0HЍP  PP  490S  0 `PFPW a W pGW R $Sw ,0< sW p$+ii 'i"]ؘ&H>.imd(+0'C-Mp`ӉPPEUy%p5U@U`F V/@T x廉P h嶉P aP tP,5 R +0%  PV 0S A@D P `VD    tP@PA@3PzP0S<0S000S00S00S00S00S 000#pPU 3 `V= V30SU7 0S4000000S@0000000 0 3b 0Sr<0Sm00Sh2P0$0:]0S 0SW`V UUQpP `P dPB UB U UR<2PEUNPPUH Q bPA 7 U2 @U U60000  - U+$2PJ 0000 0 P    $0S | p  #pqp3*fV@e T ) 0"600"$0U $P @mP thPdA q+,nq '6ppH>.q'qq`noGrq r r0rpprrC-@PpMa M!p10S QฑPE R ލ ЍRP fP74p P` 77WOJLP1 JpP/0: S2  S)J P0 JN@n` 0r 4S00`T뷌0S /ph%J PJ @PJ0@ +t 'tttttO-0 <[*u@P P ;T(X[@I0Pd+TX8\ uP;P  0S4;8+,(Kh8S <PU hXJtP@ "OoB:p *:(8p P `ZT`h CPdhQd:xJ 0pP0 `*Ep`W0 J D,* 0 W0C 00܌10 l>  \a8P`T0>0 XP嚋0P- S)0 ]P\9Tp P 49h(gP 9T(X(]mX⥆P 8h(\40FDS00 8(W 8X(T( |8,8 8P 00S| h8l 5(8, ,, ,o 8,k 7H(g7l 8ZQMQ^ 7L(Zg+7v PS:?@> 0 x7P(H7hg  l? >s` c?5sU [?-sV S? %s  M?sW F? srq/??= s 8?Y sZ 0?`LtBhB`BTBHB 0S0SA  =/@288S2@Px |b<S P 0S O OD2 kN @+t P:B?l |081<Sa\+Tt P*rB|0:yP 0MP .@PvYB VB!@k@PLB IB0@`yPP0@P`Pp@+t0(@0@000pUp,`40U0 (P<P8P,(PR00S ,R  \0,0S O,8S= +a,8S \,M'0'ҕ& 'M?H>.Ƞ&k),'͚D>. ch @ rjt , D A-P`f Eeh6P03Zp2S l2 P@3U,^"}PO p 9P/P00@˜7' shvP303D$Mp840pEWQU 4 000`rP C,sPE0S3 4# 3YP741.[P|2`ph `\qPT304 110101$1]YWU,ȇ# 2R CzCAQlp`d Pa Q18C8S `T`qȁx]  lQ00S ^ P +`3P?o20S R=?o20 P P l^18C8S 0 S ƓS 0RA]  \]=`S 0 0000 l]^18C8S `__d08,fi} ''H,òW ɲز0'&&D,p,/ X'ܱ@-@`၇PՂP p1 lqd!pX10SAH81P@ e 1*$qⷂP  ⲂP 0 nPbP 9P0P &  c0@ S0VP  00@0 P0  @0  00 mde0Sꝺ,S ''Ⱥ(&A-`4C0P@00$ 0p댅P0 0ZP00Y{塣ʅ5j3r%z뫬볶GP0r0Ȳ0"SBKP U 0+0C0SdPaP d\p8"PPE M)P 0S!<P105P1 0Q 媐U 0S"P'䙐]PEh10S \10L婯딿DQYh80S(1(ҁP#uP唯f娾aPqp 000000S m ѭGk }ֈPP`0S JPPp00S8,)$-.18?BKZl,-q-&-H---O-`pPLBD@`4"p(2 0 qQ pwPpGefuP`P GP IP EP 0 a0@S0000P O000 |>P tMP\0@=P <07- 1 0 1 'R1 'H>. 1 0' 1 11 '-1 O-ppMyP\/P4,LL0@(4/x4P@ 000 0P0#X00@T.`P@@#p?30HXD[p 60S h\n@P @TPH3 @3 8Y -R R -R iQeRQiR kR eR" ""sPPPEP IPF -PF 2Q@"P00h2h7T2XD20P^U0S ?SPP20`^V0S ?S``10@^T|0Sy ?S@@u1100jhfꈱ400x (0\  `0 !1R- S` \0 = 0zZ, ,A0aP  ;Y  a0SG@ d ` \9S`0S   Rڰ1\0| 1> A-N5 z5.']5 |5 '5 5 5 85 5 p&u&z&Z4 H>.c5 k5 r5 :.ht@B-5 '5 5 gtO-@Pp`LM@"p1 UV! UPZp .gP uP GP B`0S@0000T \PUP  : p  !n.LP0P 0S UW. p U  p T _ p V pB.`V K \lX@PPPm 0- JH>.16 '86 s6 q6 J6 v6 x6 6 6 6 )6 0G-@8M04$@4P@4b 4p@c4b/mDdY0$`5$D5 4%0`0lP `%ؠUP P Z@nmP. DP fP(ğ CP 廠pP" rP#p!L/ :M pP 3 3 C;|3`3SOO0@ JU`P(T %jP TjM2,t(ɂƂÂ@>d 0@00P@UP@`Q nV ((P,@44`(PV,@0,@tB((P404`V(P,@((P,@4` V(P# 0  0S0 0 0 0 0 p   W3@P  @900,1" 131S00%iP0Q \Y. 0 8Ѝp<-X- -h-`--l ---h-8- ' H>.+ q | -l-% -5.- dr 4v Xr H- t ų d--GjpB-O-poM0 @e 8@0 @$pPT4 W\Y npP 0  P(0: S ) 0T0[0Sf Y \T5@PH  P #y y:P P#f@Pr  ><4pUaUbPEUPzU" (|!0 p 0d6 00 0@3 1 ( 0 $x300t@r pT 0!0 02QX 000ḐsX%X dpP0; 0MP* Pt%ePPh!! A I !0+"0F+P + {  P"   nP^0S { xU0S {\0 0/X0 `p0 } 0  Q   S  R#4p UP`#0S T { 㬀 V@p.!h! 's!v!!!!!!H>.Q!]!0'ht@! ! !- !!!M !? !0O-PMp00@|P |PO .@ⶌߍ(@/!.t?P01l?.01011(2,211Q!,1P2T2pppn&k0^0<10 .0>tp>0^0C 0 0R080 @忐0 D10 B1\!`1Hq坢0 ;`Pl0_ ^ 0R =F 0-=p I 0 80 0ZSVPMP 6P@ ?P7 4Ptp=N@PfP j@PD=P0=001@)=@f`0f30 k{0000u00pl `j㐼g㈼d 0pÞP 0P ҋ0#Qb4 ˋ0 R*0 稟`P  0p垞Ʀ 屋&庽0081}~pxѐx1S&P 7;p+G:0P @@ @0  ,p 0 ;p A@D< 08 P 0Q819: x*0  lZpE(cP6@ "*81`1 R  yPP Z9 Z00Yp!& <1 ($uP D P G x 1A ~p  X9X@̌p0 \܌p tX (0SP 姎GPS 0SL(81] 8 0 <8 0} 0 1s~0 S 7 0}1s ~0 S }1sV 0f }P>H0   0p P ~00p 138G[2 l7@ыP~ 0S0 E 00 7@幋pELH 6@\p~0S hJ- 0HXp~0Stu+si~0So e~0 Q i 8 0 *z(pU~0S &B5pF~0S [H AH(?P q( T_9x0 V  0ԑp`d Ebp& P Hu 0$A>0 0,1\ $5,@p_. A @⼍Z$0 ,1Kptwbp8Pp Xp$z t4,@庉p. A @X0004P0(@00 P  ꠰0 T30 ;|p`v E # ## 32 p a,pdNq  P3@jp. A @@\!R040`1圏Ptx: 0 `!P0`!/00\!xR00SRl0(Ȁ0 h R`!T Q0x1Y;(px N0 ᤀx1Y30x!  z X~| ybሀZx1`Vh 0S P1`1` 0S  I 0S ~ ᷍!!^!p!!$& !A!|&! '!3!8 !A !H>.7!.!<!!!!!@0! !!!`!!!! !"!! [!q!!!!!!!'!!o!!!!"!!!!)!hDg!0' P   RX  R   X0pƉ0 S   0xPUxQ!0@0@(d܌@}nn|y  Q/0p@-x@0Ppp@ P T0Ia,fp@6 0 0$010`4X l3O-1bM!0Mb  [ !1 b0  0 30_bݍЍ  0  "\ ,z`  $;(0(0 +Pp0G  80G( Gpn x8_S  000 00 0 PЀ @G 0  0wP x8##[`@* %wP0 l8 40G ]PU P0l8  40GOPM8X X LGL0ƒ S$*p@- R P@ 0\ R^ H00"@ 800 p^ 00"@p/KKlK p@-`M TAT!@ `` @!  4!  (! 0  QpP 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp ܋XtU `` d| P4D @-M   Ѝah  0S/ -PM00 0I p 0 S 0 0 Ѝchhc /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/*/*/*/c*/2*/|*/y*/9v*/s*/p*/8m*/j*/g*/d*/a*/ ^*/[*/X*/0U*/QR*/O*/)L*/{I*/|F*/#C*/)@*/==*/:*/7*/"4*/1*/.*/+*/(*/////^*/*/*/<*/*/*/ */ */*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/\ */*/*/ */*/*/*/K}*/Wz*/+/ju*/Or*/ho*/il*/vi*/f*/c*/ `*/]*/Z*/W*/T*/Q*/pP/< /G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/4T*/@-@%y@*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: l p v `y |    $ ( l   D   | | T    \   `  `1 7 8 = `D!M !P!V!(^$!H^1!h^;!^H!^T!^^!^j!_p!_z!q!{!!!!0!0!!!`!!!!!!!!!"`"` """"""+"`  %s%s: %s not compiled in catchmodcpdddfedlnlsmkdirmvpaxtarpwdrmrmdirsh-shsttysyncchownchgrpdisklabeldkctldrvctlfdiskfsckfsck_msdosfsck_ffsgptifconfiginitmknodmountmount_cd9660mount_ext2fsmount_ffsmount_kernfsmount_msdosmount_nfsmount_tmpfsnewfsmount_mfsnewfs_ext2fsnewfs_msdospingreboothaltrestorerrestorerouteshutdownslattachsysctlswapctlumountftptipcugzipgzcatgunziplessmoresedtsetchrootsysinstprogressdhcpcd// //////////"'+stdin-%s: not a regular file%sstdoutmalloc, using %zu bufferrfrUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s 16!**33Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_open%s: %s%sfts_readreference $(*,. HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s is not a directory%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLENpushdne/usr/src/bin/cp/cp.cdnesp >= 0popdnedirectory %s encountered when not expected.%s -> %s fts_read%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeblock sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %sg*xj*<n*,s*y*`@@***@@**** **@@*L*@@*%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsbscbsconvcountfilesibsififlagiseekmsgfmtobsofoflagoseekprogressseekskipunblock and -DNO_CONV?%s%sdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape device.usage: dd [operand ...]stdin\8$,llfiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblockblocks %llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) %sskip reached end of inputllll%,l2llllll8lllllllllll l"(/ll5ll;%*s1024-blocks1K-blocks100 0NAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksSizenon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapAvailUsediUsed %*s %*s %%iCapiAvail Mounted onhflag == 0prtstat/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s%s is not a mount pointfile systemWarning: %s is not a local %sWarning: %s mounted as a %s %stotal%s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+%scannot open temp file%s: %s cannot close temp file%s out of memoryp unexpected end-of-file& no previous commandinvalid pattern delimiter%s out of memorycannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input file%lu cannot write filewcannot open output filecannot close output filestdin: %s cannot read stdinunexpected end-of-file%ld \  \abfnrtv\TTT(IT@TTTI(1TITTT1vHY|#Gp(f#>|Tiinvalid addressno matchinvalid mark characternumber out of range%s out of memorywed.hupHOME shell access restrictedno previous commandno current filename..invalid filenamefilename too longainvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimitercrypt unavailable%ld !unknown commandcrypt unavailable ? Usage: %s [-] [-ESsx] [-p string] [name] p:sxES ? interrupt? %swarning: file modifiedscript, line %d: %s unexpected end-of-file*unbalanced brackets ([])trailing backslash (\)%s out of memoryinvalid pattern delimiterno previous patternno previous substitution%s out of memorynumber out of rangeinfinite substitution loop no matchnothing to undo%s out of memory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file %s%s/%swarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s linkFLPfhinsvw.EG9 total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too long%sout of memory!usage: %s [-p] [-m mode] dirname ... Cannot set file mode `%s'm:p/%susage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm rename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long3Rg-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) files%lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itself.Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingcpioCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s,,$,,))Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %scpio%b %e %Y%b %e %H:%M%s %s%2lu %-*s %-*s %4lu,%4lu %9llu %s %s == %s -> %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing 999999999999999999999999999999999999999999999999999f9999np999999p999999999999$9'+-/91AOQSYQ[]_9c @@@@@@@@@@@@@@$'@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@"'+0@5:A@lnuz@ Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory /Cannot create directory `%s'tarInvalid block size %sbzip2write_opt=nodirgzipxzcompress+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-I-rUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0paxInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ -%cDestination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2createfiledereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdatelistverboseinteractiveconfirmationextractgetgunzipread-full-blocksdirectoryto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursionchroottimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)Removing leading / from absolute path names in the archiveCPU time limit reached, cleaning up.Signal caught, cleaning up./tmp/LC_TIMEUnable to set up signal handler.Can't open current working directory.TMPDIRCannot allocate memory for temp file name.cannot gzip while appending2 )  AUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory "33"}c}Tcc}c/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %s00MODEUIDGIDMTIMECHKSUM././@LongLinkpathname too long: %srcannot open %s: %spathname too long, line %d of %s%s: /dev/ttywrFatal error, cannot open %s (%s)usage: %s [-LP] PWD/.//../.LPstdout+PPP=PPusage: %s [-f|-i] [-dPRrvWx] file ... %s '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %sdfiPRrvWx"." and ".." may not be removedfts_open failed%s: %sexamine files inremovefts_read%s: is a directoryusage: %s [-pv] directory ... pv%sAlias count botchalias %s=aalias: '' not found alias: %s not found 5$+iEM=aO]Varithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expression:C5@FP%-V"SKarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'%lldexpecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld .getcwd() failed: %sPWDOLDPWD..Unable to determine new working directory%s PeHOMEHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryLPunexpected argumentUnable to find current directorystdout: %sffffikfXZfffffff\fff^f`fb-n-ewrite error%s: : %sYq eq {qqqqqqqqqqqqrErZ,rAr[rqr#{r {r_r^rFr<r>r?rrerror %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistentnot foundis a directorytoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long@NI$2Vkks{%.4f0.0PATH=Pipe call failed: %sNode type = %d for using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedPATH=Cannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss G   048%s: %sCommand from PATH[%d]: special builtin %sfunction () { ; }internal error: %s cmdtype %dbuiltin%builtinfunc%s not defined in %s%s: %s bcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string %s is a shell keyword is an alias (multiline)... for: is : %s is a shell function is a shell builtin is a special shell builtin : not found usjQ?>TTTT7goujjW-EHOME :]./%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier%lldnull or %s %.*s: parameter %snot set%d%zunot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misused$4ad;AD:ZZP'/]}64/dev/ttysh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes%ld [%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d %ld[%d] %ld /dev/nullCan't open %slpZ%smore than one -p unsupportednp:invalid name: -p '%s'%s readonly%dYou have stopped jobs. ${#${"(()(...)$(...)">>|>>>&<<&<>; && || ! | &(if then else fiwhile until do donefor in ; do case ) ;& ;; esac() { ... }-<<...???Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profileHOME/.profileENV Can't open %sOut of spacestunalloc ststrcat() over length botch d:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...IFSSu=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error ~~t~~f~~d~~s~~c~~m~~l~~r ~pn#~v +2b HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9lld%cerror getting limit (%s)error setting limit (%s)unlimited %lld ulimit: I/O error (stdout) timesecondsfileblocksdatakbytesstackcoredumpmemorylocked memorythreadthreadsprocessprocessesnofilesdescriptorsvmemorysbsizebytesInvalid number: '%s'Number out of range: %strueyeson#$PSc: , onoffCurrent option settings+-%s%c%c%-19s %s set -o default %co %s %c%cdefaultUnknown option %co %sUnknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option %dOPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that many   allexportcdprintemacserrexitforkignoreeofinteractivelocal_linenologinmonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailposixpromptcmdsquietprofilestdintabcompletetrackallverbosevixtrace%7:/\(8nYShjrltEEEEEEEEEEH66I8%d: Syntax error: %sBad fd numberEOF reading here (<<) documentWord "%.13s" unexpectedWord "%.10s..." unexpectedr~ÆȆφֆ݆ %s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: \58=BGJPVZ]bdfkpUnimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'}-+?=-o promptcmds not set: Bad for loop variableinBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentifthenelseeliffiwhileuntilfordodone{}caseesac!end of filenewline";""&""&&""||""|""("")"";;"";&""`"redirectionword"if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"7c/gkkPipe call failedUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %scannot open %s: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)GN@TYbhntz@%d: +%s%s-%s, +%#x insufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error 1368;>ADD%d'...'...>>|<<>>>>&<&<<appendasyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecexitEXIT%d%s ---l--p-Ptrap -- - %strap -- ''trap -- %s Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d''|&;<>()$`\"' *?[]#~=%%s\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# #$PScNBSH_INVOCATIONL(0(1(1(88(0 $(0<(0C(0J~(0SHPS1np%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1>>0>&*->>>7;W[_cccc $/:EN%% %s: out of range'%s': bad number         "$&),/2 5!8;>ACE!=[]missing ]unsupported expression when built with -DSMALLGLOSbcdefghknprstuwxzefeqgegtleltnentot<=>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %s grouppgrppidunknown signal number: %d%s option requires an argument -- s0--bad job id: %sbad process%s id: '%s'%s %s                  breakcontinue.evalexecexitexportreadonlyreturnsetshifttimestrap:unsetX`b,,Ö}ǖ͖̂pӖؖhږ commandaliasbgcdchdirechoexpletfalsefdflagsfg%getoptshashfcinputrcjobidjobskilllocalprintfpwdreadsetvartest[truetypeulimitumaskunaliaswaitwordexp`Яh,n ?qtzpp`8SSD((p@K —LȗlϗԧӗiؗߗLLhpmL x'#$%dPPIDIFS1OPTINDPSc20220122 BUILD:20260826132837Z SMALL REJECT_NULSNETBSD_SHELLLINENO %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4incomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complexL#-+ 0'0123456789%s: missing format character%s%s: invalid directivewrite errorprint failed^f lpty    NRXoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sbrkflushrprntdiscarddsuspeofeoleol2eraseintrkilllnextminquitreprintstartstatusstopsusptimewerasegfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 option:illegal gfmt1 option -- %s%lxcflagiflagispeed%ldlflagoflagospeed/dev/urandom%d %d %d TIOCSETDTIOCSTARTTIOCSTOPߠp)H+)))() )**#+'(*+.*5,<4,B+F)K)P+U(+[+illegal option -- %soption requires an argument -- %sallcbreakcolscolumnscookeddeceverythingextprocinsaneispeednewnloldospeedostartostoprawrowssanesizespeedtty#3# 3233$#+28? F@L@PW_fv~ @¥ǥ̥ҥ٥ߥ C$CC$CȤѤۤ "@*@2 : CHOV@]d kpw @litout-litouttabs-tabsopostonlcrocrnloxtabsonocronlretcrt-crtnewcrt-newcrtkerninfo-kerninfoechoechoecrterasecrtbsechokechokecrtkillaltweraseiextenechonlechoctlctlechoechoprtprteraseisigicanonnoflshtostopflushopendinnokerninfodecctlq-decctlqignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonflowixofftandemixanyimaxbelcs5cs6cs7cs8parity-parityevenp-evenpoddp-oddppass8-pass8cstopbcreadparenbparoddhupclhupclocalcrtsctsmdmbufcdtrcts%d%s: %s %s %s-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscs5cs6cs7cs8cchars%s = %s;%-8s usage: %s [-a|-e|-g] [-f file] [operand ...] %s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1illegal option -- %stcsetattrTIOCSWINSZ====0==0=9owner:group|owner|:groupgroupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s%s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.userCannot stat `%s'fts_open%s: %sfts_readreference { {{%{ {{{{{{ /"&),FBXi|~ DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentlebechanging %s byteorder to %s_go@;@u@}@@@@@@@@ @@@¾@ʾ@QWѾ־ܾ $+17C@J@OT^dov|>Ŀ̿ӿڿ%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%sattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:orɻڻ,@Pc̼߼  %s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=5u p&y)/28%s:unknown%u:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u: (/55<AINSW`kpuy}t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# typeunknownline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO3;AEJQX_fovĽʽӽڽ ").5>CKQW/tmp//usr/bin/viMACHINEMACHINE_ARCH%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXwforkEDITOR%s %smalloc-c/bin/shrre-edit the label? [y]: unknown disk type: %s[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)-l(to show all known file system types)aarch64alphaarmearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebarmebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300hb68kews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64arccobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd )!1%s %s [a-%c] define named partition cylinderssectorsRounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesnoAutomatically adjust partitions [%s]? Invalid answerreallocarr%s: # Current values:A<EoSDisk type [%s]: ?Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: %uInvalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition> #,7<AEISY]eios~Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuAadjust the label size to the max disk sizeCmake partitions contiguousEprint disk label and current partition tableIchange label informationLlist all known file system typesNname the labelPprint current partition tableQquitRrounding (c)ylinders (s)ectorsWwrite the current partition tableunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdDYDYYTYDYYLYYYYD# %s: GKPX]bhnt{ type: %s type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u GNS]gpw  '3C%10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u) %u partitions: # size offset fstype [fsize bsize cpg/sgs] unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdUsage: %s device %s device command [arg [...]] Available commands: %s %s force%s: %snonerwrwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: %s %s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd characterssqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes list%s: badsectors list%s: blocks %lld - %lld failed at %sflush%s: badsectors flushretryfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - failedokWedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %s%syesnosuccessfully scanned %s. IR[%s: strategygetcachelistwedgesaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetwedgeinfogetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grew %s truefalse%lld %sArray:Unhandled type %dQRSa:dlnprt/dev/drvctlopen %sDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': /Select neither dict nor array with `%s' unknown command `%c'147:&@)SLO,0  ,%lu/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidextendedprimaryCan't read %s partition table%s partition table invalid, no magic in sector %lldsectordecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbmbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrNested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootable <Oe A `    )<v *!:#:$C&:1:2K3:4:5g6:8r9x9:;<=@A BGCsDEFGHJLM NO P0QBRWSqTzUVW\acde@fTgghgigpnq:s:t:uv:wx!6EWx !;Yk888Xx:::: #5Nej};Zg&Xl#::W\o::"EXkw%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable "OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: EPART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidstartStart sector already allocatedsize%sExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:%d: Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSNetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table ;]`rorwrq,%snoufsffsfsck_%s-o,start %s %swait %svfork%s: file system is mounted read-write on %s; not checking %s/%sexec %s for %sexec %swaitpid%s: %sInvalid option stringonly one -t option may be specified.empty type list[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]usage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s%s%s%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypet y  "&06:BFLP[jvvfstype `%s' on partition `%s' is not supported/sbin/usr/sbinv7fsmsdoslfsext2fsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check S, /etc/fstabCan't open checklist file: %s%spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: %sUnknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%s Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %snoyesFIXED%s? %s %s? [yn] ** %s (NO WRITE) Can't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block fixUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors out of rangereservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidnot freeLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULLreadDosDirSection/usr/src/sbin/fsck_msdos/dir.cTruncatelong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters..%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 Correct.`.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo %s directory No space for bufferNo space in %s could not read LOST.DIR%ucould not write LOST.DIR%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dDIRFILE%s NAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%s DIRFILE%s %s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block go!@GJ]cjsv|usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** belenumberAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dmodebad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sBADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)CORRECTUNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) XX))_*w_ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORY.BAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s ..BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %d (ADJUSTED)ADJUSTDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luRECONNECTCOULD NOT FIND NAME IN PARENT DIRECTORY29@CG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluEXPANDCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUP%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %s: BAD SUPER BLOCK: %s  MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x f** F Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockCan't open %s%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ffsappleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKCLEARUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)CORRECT (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool%s (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of range/?..cannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) CG %d: ALLOCBLK: BAD MAGIC NUMBER cannot allocate quota entry   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblock4<4<4<4;        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?unknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%.*s/%s%s/XXXXXXXXXX/dev/rfss%d DUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)FIXCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK userUSERgroupGROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %llu (CLEARED)CLEARNO %s QUOTA INODE (CREATED)CREATEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number CONTINUEno user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_read/usr/src/sys/kern/vfs_wapbl.cwapbl_circ_advancewr->wr_blkhashcnt > 0wapbl_blkhash_clearwr->wr_blkhashcnt == 0wapbl_replay_stop calledwapbl_blkhash_free!((wr)->wr_scratch != 0)wapbl_replay_freewapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_space_usedwapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wapbl_blkhash_initwb->wb_blk == blkwapbl_blkhash_inswapbl_blkhash_remUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSCONTINUEwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d a:i:s:b:l:t:G8x&@index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on device%dPartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:H=x&No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdec%s/%sCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]|ICx&AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]9JpEx&@@frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]%s: (%s) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %ju%sGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged gptUsage: %s%s %s %s%s %*s%s %s %s%s %s%s %s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x),QWZWuW|WWWWWWX3X[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirrored6\=\A\O\b\w\\\\bogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%juunusedmbrmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrGG,,,",>,,W,,Pgpt[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: FhlGIIhXY_`vwxxD{~~d܅@^ Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %s%s %smedia size too largeCommand %s needs a device parameter*  "Unknown FreeBSD partition (%d)*%u*eefff!f(f7f>fDfKfSfXf`fefjfnfwfffffffffffffffffPartition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %se~x&@Afp:sNo MBR in disk to convertfgg0gFgggzggg "h Ah lh h hhhhh iiWi|iiiiii j!j#j$$j&j1j2,j3j4j5Hj6j8Sj9Yj9`j:yj;j<j=j@jAjB(kCTkD{kEkFkGkHkJkLkMkNkOlPlQ#lR8lSRlT[lUclV{lWl\lalcldle!mf5mgHmhHmiHmpOmqjsjtjuemvjwkmxmmmmmnn&n8nYnynnnnnoo:oLocooooooopppp9pYpapfnpuppppppjjjjpp q%qrVrkrrrrrrr/sCscs~ssssjj.t3tFt[tuttjttjtu/uBuNuquuMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486NetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %swPx&@Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'No room for the PMBRError reading MBRCan't write PMBRRecreated PMBR (you may need to rerun 'gpt biosboot'recoverremovedwx&@ab:i:L:s:t:remove-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]xĆx&@a:i:s:b:qEntry at index %u is unusedCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]z0x&@s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT header; run create or recoverNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q] /{x& a:b:i:lNset-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]-l+%')Hx %%jx%ju %*jx %*juBKMGTPE%s: %llu (%s)%den_GB.UTF-8 (active)UnusedExtended MBR - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %l- %sPMBRUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: GUID: %s %sTypeID: %s Type: %s Long_Type: %s Attributes: %s Label: %s ()start %*ssize index contents%5d unknown%*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s %s%ju%s = %s%*s Label: %s %*s Attributes: None %*s[ %*s ]Could not find index %dDetails for index %d: StartSizeType: %s (%s) Attributes: ~lx&gi:b:luaxAhHpW:wCOLUMNSGPT not found, displaying data from MBR. %*s%ju %ju %u %5d show[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changed ~x&@ab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-l Xx& a:b:i:lunset-a attribute -i index-a attribute -b startsec-lSFH0eCGMSFU0eCWaHah!IdontNeedEFIkp(s*K>;z~|nQn- q+|nQn- q+|nQn- q+ă|nQn- q+Ճ|nQn- q+=rGy=iG};Mt? mWC 3KOO"-yD<#*=(8BYbBRuoqrL[3Dh&jr\ M}-@Mjy֬-чHɄ̈́-чHZIчHIчHIчH&+2IчHFKL6 %?aW\S'@ )Ѹip*1@ )Ѹ1x )ѸST.qBHo6֯i%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx-?%s%18.18s %s /dev/urandomCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL Py&@UUID changedab:i:L:s:t:U:uuid-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]-8y&o:gpt->secsz <= INT_MAXbackup/usr/src/sbin/gpt/backup.csector_sizecodeindexflagstart_headstart_sectorstart_cylindertypeend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failureMBRmbr_arrayrevision%dguidle32toh(hdr->hdr_entries) <= INT32_MAXstore_gptentriesGPT_HDRi <= INT_MAXstore_tblstartendattributesnamegpt_arrayGPT_TBLwCan't open `%s'backup[-o outfile]-/dev/stdinNԸy&@Fi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeproplib failureSector size does not match backupGPT_HDRrevisionbackup is not revision 1.0entriesguid%s: not able to convert to an UUIDGPT_TBLgpt_arraytypestartendBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endMBRcodembr_arrayindexflagstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highUnable to seek/write MBRattributesnameEntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTEFI PARTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flags%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s/%d -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sin_status%s: getifnamegetifaddrsinetcommit_address%s: getsock%s: getifnameaddressdstalias%snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sififflagsafethercaprcsetethercaps/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)do_setethercapsSIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeee,[$+-/EZZZZZZZZifflagrcsetifflags/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlensetifprefixlenprefixlen_to_mask%s: prop_data_create_copynetmask%s: prop_dictionary_setdstsetifdstormask%s: getifflagsdstormaskd != NULLsetifbroadaddrnot a broadcast interfacebroadcastdescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRlinkstrmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCGIFFLAGS %sifcapsifcapsetifcapsaddresssetifaddrclonecmdclone_commandNote: trailers are no longer sent, but always receivedmetricsetifmetricSIOCSIFMETRICmtusetifmtuSIOCSIFMTUsetifnetmask, %s byte%s, byte[-m] [-L] usage%s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimegetifaddrstimed outerrorSIOCZIFDATASIOCGIFDATAstatus%s: getsock%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s `hm linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collisionprintall%s: prop_dictionary_copy/createifparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numbermainexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferencedo_setifpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)do_setifcapsSIOCSIFCAPunknowndownupifaceiface-opt-familyopt-familyoptional silent familyopt-clonemisccloningifflagssilent familyaffamilyiface-opt-family-onlycommand-rootoptional commandopt-family-onlybroadcast address (address 3)destination/netmask (address 2)local address (address 1)family-onlyno commandsnonewait DADlist clonerscreatedestroyziz&yialiasdeletetrailers-linkstrdescription-descr-description000z&%}&600z&~&ܑh~&}&[~&a8~&=<z&|&F<z&/}&O}&[Tz&bTz&broadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6ʝ՝ @(4@H Q0Z@clqarpdebugunnumberedlink0link1link204: EK Q@hmgetifnameinitmediaSIOCGIFMEDIAinit_current_media%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULLsetmediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediaoptsetmediaoptmediasetmediasubtypemediainstrcsetmediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA,%s mode %s%s%s instance %dبGب,  ب`@media_status%s: getsock%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s (unknown supported %s media: media mediaopt media_constructormedia keywordsinstanceanymediainst-mediaoptgp$;H&yp$;H&$p$p~&pg&~p$,&px&no carrierno networkbackupmasteractivedownno ringinserted1+ 0af,%u.%u%npaddr_match%s: prefixlen_to_mask(%d, %ld)%s: prop_data_create_copy%s: prop_dictionary_setunknown keyword type %d|XhPtunsrctundstsettunnel%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] ???0 tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnelP z&&bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanifTX&<&ެVLAN tag(ELly{}NONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersavercsetifpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepsetifpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchansetifchanSIOCS80211CHANNEL%sSIOCS80211hidessidsethidessidapbridgesetapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragsetiffragIEEE80211_IOC_FRAGTHRESHOLDrtssetifrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA> fatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinPATH/bin/shcan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedrootsetlogin() failed/dev-MMshinitMAKEDEV exit status %dUnable to run MAKEDEV ,V4kern.driversmallocusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group nameCannot set file mode `%s'%s: invalid user namelrRF:g:m:u:%s character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid major numberinvalid minor numbertoo many fields for formatinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxisclinuxnativenetbsdosf1scosolarissunossvr3svr4ultrix( "%s,%s,Usage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsrw/uniongetmntinfopuffs|%s on %s type %.*s: %s already mountedforceroupdateffsmount_puffsrumprump_%smount_%s-oexec: %sCannot create pipeforkCannot open fd to mount program%s/%sexec %s for %sexec %s for %s: %swaitpid%s: %sstatvfs %s (, s) /dev/dk%sNAME=%sNAME=%s (%s)%s (NAME=%s) on %s type %.*s@ "*29=EP@Vahoy  /$3 9@EVd{@%s%s%sunknown flag%s %#x%smounted by %d%sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s])nfsOnly one -t option may be specified.Aadfo:rwt:uvWrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/sbin/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddenlognoatimenocoredumpnodevnodevmtimenoexecnosuidread-onlyrelatimesoft dependenciessympermsynchronousexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsffsmsdoslfscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmalloc(usage: %s [-G gid] [-M mask] [-m mask] [-o options] [-U uid] special node   @ % getmntoptsegG:jM:m:o:rU:stat %scd9660%s on %sbnorripbgensbextattbnojolietbnocasetransbrrcaseinsuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedupdategetargsextattgensmaplcasecasetransnrrrripjolietrrcaseinsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node    ',8@>CJQW@_@hngetmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceext2fs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdatereloadforcegetargsdevmtimeatimerelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node 9CNQTYbfkpw }  @@@getmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceffs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountednfs4aclsposix1eaclsasyncsyncupdatereloadatimedevmtimeforcesoftdeploggetargsextattrdiscardrealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: mount_kernfs [-o options] /kern mount_point   @getmntoptso:kernfskernfs on %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsrealpath '%s' failed"%s" is a relative path.using "%s" instead. & 2usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath   ' -4 <AM@SX_@getmntoptsGsl9Uu:g:m:M:o:t:stat %smsdos%s on %sbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirroruid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdategetargsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead. '*?1,$25GJM/$Conflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cstrdupoy  @ @ &+/3 S@X^d9mw @Agetmntoptsportrsizewsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iL:lo:PpqR:r:sTt:w:x:UuXnfs%s on %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacbnowccmsgaddr=%s, port=%s, addrlen=%d, getnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedforceupdategetargsbgconndumbtimerintracnfsv3rdirplusmntudpresportnqnfssofttcpudpnfsv2maxgrpswccmsgrealpath '%s' failed"%s" is a relative path.using "%s" instead.Unsupported socket family %drecvrpc%s: reject, astat=%d, errno=%d rpc_getport%s: %srpc_call%s: error = %d sendrecv%s: short write! (%zd < %zu)no : or @ specnfscan't get net id for host "%s": %s $vhw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s' "%(-6:?DK QX `eq@ygetmntoptsram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o updateuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsatimerelatimeunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.untitled. 2 0 #:NSao}A*LZo%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).#Jx"{3S 1Q$Iusage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsbeleWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableappleufsApple UFS%s partition type is not `%s'ffs4.2BSDUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatime rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead.%s: %s/+-$ ")7IKWco|%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file Bad inode size %d (only 128 and 256 supported)formatsector sizesector size `%s' is not a power of 2.verboseblock sizefragment sizebytes per inodefree space %number of inodesfile system sizeVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:can't open file %scan't fstat opened %s%s: open for read%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk labelno default sector size%s partition is unavailableext2fsLinux Ext2%s partition type is not `%s' (or use -I)Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageilog2%s: %u is not a power of 2rdfs%s: read error for sector %lldwtfs%s: write error for sector %lldSSSWTWTbiput%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)alloc%s: inconsistent bitmap block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O bufferPreposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%llu%s%*llu, ...init_resizeino%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize featurefsinit%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: %s  #'+3;CKSW_goy%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: @BCFILNO S' a8 bH cS eg fy h i k m n o r s& u7  -%c %s offsetcreate sizevolume IDbytes/sectorsectors/FATblock sizesectors/clusterdirectory entriesdrive headsinfo sectorbackup sectormedia descriptornumber of FATshidden sectorsreserved sectorsfile system sizeCan't parse timestamp `%s'sectors/track@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:/dev/%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyOEM stringBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per trackunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: no default %s%s: illegal %ss%#x%uCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file size%sgetmntinfo/dev/%s is mounted on %swarning, %s is not a character devicecannot seek to %jd}@@@h pp pp ` @  $%s: unknown standard formatCan't get disk size for `%s'bytes/sectorsectors/trackdrive heads"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u1м|^t0 Non-system disk Press any key to reboot %s: can't write sector %u1601803203606407201200123214402880%s: %sgo"&FUX[lru@Ig{  "$&(*,. usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%x     pusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%s?<0&),080I0Z]0`usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure       &A]uC+P%command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue5/ f|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c ũ©)+S QJNChecksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s D]]]D]]]D]|]x]Cannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxy %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"prefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood SSSSSTHTpTTTTT.UVU~UUUU%s: #%d: len %d, if# %d, %s, flags: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTpid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: UGHRBD M@dmCLS1@2plb%-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s unspec       " % ( +?[* Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL s/usr/bin/wall%s -nw%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in ~30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at ph???PFPF0* XXX,,x<<rebootpoweroffhaltshutdown/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already past-Shutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-d-n-p-lCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:/dev/%s%s%stcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip ~W  " "&%07x%02x%07zu bytes %s,%zu%zubitmask_print%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s: %s#%zu: %s: the value is not available (%s) %s: %s , bad size %zu for kern.drivers%s%s%s[%d %d %s]0x%0*x%#x%u%d0x%0*llx%#llx%llu -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%.*sunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)/gjwjjjjjjjjjjjjj@kPkL,k;kEkXk]k<skkPkkkkkkkkkklllk!l3l;lSlZlyl}lllllll mm m;m mVm mmmmmmmmmmPm nnn#nregcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f bitmask_scan%s,Invalid port: %sPort out of range: %s.???%s%d%s (%s): iiijjjCTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDENALIAS%x, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! addrsymbolstringstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address typenodeintboolquad%s: '%s' is not a valid type size%s: '%s' is not a valid size n%s: '%s' is not a valid mib number flags%s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long =Aabdef:Mnqrwxmalloc regexrNODEINTSTRINGQUADSTRUCTBOOLtopsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?ps/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor !&ADGINPSV]bg9?KhKKK2usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260718NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260718NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverUnsupported redirection Location `%s'Too many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c`421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection2?\x "*.;MQag|usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBA]Token in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384) disconnecting...interruptunknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedr%s: hayes timeout error (%s) [sh] ! can't execlcan't forkS can't create %s [cd] %s: bad directory ! %s [EOT] -c%s%d %s%c W %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for on[set] Boff/bin/sh~{[*?$`'"\pipeecho %sfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo r%s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourshellreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend break9>plEt9VxUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardsoftnonebad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifieddircu%dall ports busylink downunsupported speed %ldConnect failedhelpescapeflowparityphoneportlinespeedhalfduplexnostop%sHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrfsdu%s: missing device spec%s: missing phone numberhdraecbenbsctbvbnvtantrwdchfesfoprrcdlcletatdvcmcuelieoepndiexrepausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s n r t fEb%c %2s%-2s %c %s Lost carrier.writenoneoddzerooneeven%s: unknown parity value Connected connected cumust be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busylink downPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKcan't forka'1HBHHHPaccess denied out of core %s%s=%s=%-5d n r t bf allrecord%s: unknown variable %s/.tiprcrset %sbeautifybebaudratebadialtimeoutdialeofreadeofreofwriteeofweolescapeesexceptionsexforcefoframesizefrhosthophonespromptprraiseraraisecharrcrecordrecremotescriptsctabexpandtabverboseverbSHELLHOMEechocheckecdisconnectditandemtalinedelayldelaychardelaycdelayetimeoutetrawftprawhalfduplexhdxlocalecholeparityparhardwareflowhf AT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234 OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x),:EMT]eit| malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.2failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory 0000000)<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0.invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bCH @j18RnMHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEkkk=kkkk>ddddddd+1Y  2I'7+5 +n+ _r !Yi}>MPd{++h/J;#'++++SY+i++++++++++++++++++++++++++++++QPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYt t pclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file2&*.)/35;!#%'+-1%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s 2"$&(*, " $ & log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %s1!4]WValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGS, + , , %s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty   vm A\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'$*-5?Br setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %s7}}}}}}>}}[g}}}}}L}h}}}}}}}}}}}}}}}}K}}Ubn}}s}0}X}}}r%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu  . 'malloc><@=!:illegal -m option format: %s%swrite to stderr Terminal type? [%s] Terminal type? unknownTERMterminal type %s is hardcopyterminal type %s is unknown &26:usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] isset to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptSHELLcsh%s%s%sUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-i #&/)  #&- ),/ $     "2( &" msdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgzFTPSSLNOVERIFY1/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.7 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.7 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.7 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.7 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.7 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.7 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.7 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this? Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. γ ֳ ޳ - r- p- - ! 8-2 < 7-M U 6-r } - q- 5- S-ʴ R-Դ -ݴ t- - Ȝ- -  -! γ s-+ < H-H U t-Z U p-k t - - -õ ε -ߵ - - - t - - -# 1 -C -O ק-[ ֨-r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.7machineevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy%sFTPSSLNOVERIFY/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7FTPSSLNOVERIFY# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed/dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula q  %s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5 f k ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptunFuT?????RE%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalid      $ ) 1 6 ; ? H S X ] a e o u y a%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:863: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF  /sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entriesmount_disks/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%      "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == lenstr_arg_subst/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmdm >= 0 && m <= nget_available_cds%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadevice-parentsdmmc /netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICmodulesbasedtbetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugxdebug#.     ' - 1 9 = C G R a m }   %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -ndx == cntedit_fs_type_ext/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s B j q , + $, ? @ 0W LW 1L<, e, u|, %zu%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packedit_and_check_label/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd//boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES dhcpcd=YES "/bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/etc/resolv.confpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-30s %40s%-50s %-10s%a, %d %b %Y %X%Y%m%d%H%M%-30s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error& - 2 < F O V e l r y   " /dev/%s%c%s%c/dev/r%s%cr%s%carg != NULLdisklabel_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypedisklabel_set_part_info%u%s (%u)parts->l.d_secsize != 0disklabel_write_to_diskparts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sijzܒ  | H \ X Н ܑ L p L ԑ ̑ | ܖ H disklabel_change_geomunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS( X ! %7%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_optsouter_fill_part_menu_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %s%s%sparts && parts->pschemeedit_outer_partsUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalselect_part_scheme.%s/%s%s%s/libOut of memorymv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s etc/etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0rD%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------/boot@//tmp/usr/var  (target-ui) >= 0 && (size_t)(target-ui) == *numnormalize_clones/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0replace_by_default " %2RAHXblv%/9#AJPV\bhck<258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalsepm_from_pe/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sparts != NULLgpt_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s0gpt_create_new( t8\Ԓ4ȑD|dL|<{H| Ę4Tlx~$}xx ~}},}out of memoryz b X X ` ` d  i t   z     ! -a      ,gpt %s %s -b %llu %s[ b g j m r w z ~    %s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEgpt_get_part_device/dev/%s/dev/r%sr%sparts->disk_size > 0gpt_get_part_alignmentStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)t != NULLgpt_get_uuid_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1181: internal errorstart == 0gpt_read_from_diskhave_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullUnused Pri GPT tableSec GPT tableSec GPT headerGPT part - gpt resizedisk %sunusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataappleraidvmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequiredSFH0eC SFU0eC Hah!IdontNeedEFI (s*K>;!!|nQn- q+!!|nQn- q+.!8!|nQn- q+E!N!|nQn- q+_!j!|nQn- q+x!|!=rGy=iG}!!;Mt?!!mWC 3KOO!!yD<#*=(!!YbBRuoqr!!3Dh&!!\ M}-! !@Mjy֬1!B!-чHS!W!-чHl!p!ZIчH!!IчH!!IчH!!2IчH!!L6 %?a!!S'@ )Ѹ!!*1@ )Ѹ!!1x )Ѹ%!0!ST.qBHo6֯i@!K!%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/! !!*!9!A!N!Y!i!An!x!!!!! !!%u%s (%u)falsembr_get_generic_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0mbr_init_default_alignmentsstart == 0mbr_create_new( !!\4L8X8XĴ(x` 4ܭDpl%s_%lli@%lliwedge_dev[0] != 0mbr_get_part_device/dev/%s/dev/r%sr%smbr_read_from_disk/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorwrite_mbrparts->geo_sec != 0mbr_write_to_diskt != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal errorinside_ext_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal erroradjust_ext_partinfo->nat_type != NULLmbr_add_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts != NULLmbr_free%d%d%d%dNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition!usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s ! ! ! ! ! ! ! %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA KiBMiBGiBTiBPiBEiB%.2x/-4-6./var/run/dhcpcd/%s%s%s%ssockcontrol_recvmsg%s: no terminator%s: no arg buffer%s: no args%s: dhcpcd_handleargscontrol_handle1%s: unexpected event 0x%04x%s: eloop_event_addcontrol_startcontrol_handle_read%s: getpeereidcontrol_handle_datacontrol_handle_write%s: writecontrol_handle_listen7#&))디 dhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOPu!x!}!%s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %struefalse--version10.5.2--getconfigfile--getinterfaces--isprivileged--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:dhcpcd_handleargs%s: control_queuefALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.5.2 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid.main%s: asprintf/%s: chdir: /%s: eloop_init%s: signal %d%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_senddhcpcd_control_read%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.5.2 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: if_init_os !&*Hw{22222^{/4im22t22L`2W[_2kotw{ {NNR[dV_hx|cgH{{.Chsplitv, backoff_cutoff (%u) is less than initial_interval (%u); raising backoff_cutoff to matchnd_dhcp6_invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled out%s: set_default_allow%s: set_defaut_allow DHCPoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %sinvalid initial interval: %sinvalid backoff cutoff: %sinvalid backoff jitter: %soption %d requires an argument/!b#/!c*/!d0/!e4/!f;/!gG/!h!iP/!jX/!k`/!lj/!mq/!n$!ox/!p/!qM#!r/!s/!/!t !u/!/!e !v/!w/!x/!z/!y/!A/!B/!C/!D/!E/!F/!G0!H!!I0!J0!K!0!L*0!M20!N80!OA0!PN0!QV0!S]0!Tb0!Ul0!Vv0!W0!X0!Z0!10!40!60!0!/!|0!~0!}0!0!0!1!1!!1!&1!-1!21!91!A1!F1!L1!R1!X1!g1!k1!q1!x1!1!k$!q$!1!1!1!1!1!1!1!1!1!1!1!1!1!2!2! 2!2!2!*2!%!32!?2!I2!U2!h2!u2!2!2!2!2!2!2!option requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:strslen >= len + 1alloc_args/usr/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configread_config%s: realloc %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupreadgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosysloginitial_intervalbackoff_cutoffbackoff_jitterallowrt1->rt_ifp != NULLrt_compare_proto/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(((((null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %sctx != NULLrt_disposert_new0rt != NULLrt_setififp != NULLrt_newrt_free&ctx->froutes != rtsrt_headclear0rt->rt_ifp != NULLrt_proto_addaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt_recvrtrt->rt_ifp->ctx != NULLpid %d deleted(rt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_delete(sa != NULLsa_addroffset/usr/src/external/bsd/dhcpcd/dist/src/sa.csa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbackbuf != NULLsa_addrtoplen > 0link#%dsa1 != NULLsa_cmpsa2 != NULLsa_toprefixsa_cmp(sa, ss_sa) == 0sa_toprefix(sa) == prefixsa_fromprefixsa_in_initaddr != NULLG9!Q9!Y9!b9!i9!m9!w9!9!9!9!9!9! - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%sifxname=%s%9!*9!/9!69!99!?9!protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceifxnameprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncated%udhcpcd%s-%s10.5.2%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt dst != NULLif_copysa/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)G!G! G!G!G!G!!G!ifadata != NULLif_carrierrt != NULLif_routert->rt_ifp != NULLrt->rt_ifp->ctx != NULLif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif( PT@P HEPT$ @CDHD/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkeley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addbootp != NULLget_lease/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initfromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %sAS!LS!XS!gS!pS! %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %s|S!S!S!S!S!P!gL!J! S!BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULLdhcp_inform%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated lease%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAKIPv6-Only Preferred received (%u seconds)no address offered%s: message: %sreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEWstate->addrinet_dhcproutes/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host routeaddr != NULLipv4_deladdr%s: deleting IP address %s%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa tcrer/etc/group: : :r/etc/master.passwdOOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- ____: (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc__VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory .\Z!bZ!̂hZ!nZ! tZ!,zZ!LZ!lZ!Z!Z!̃Z!Z! alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646tolowertoupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~Z!'Z!_!g!Z!c!$g!Z!Z!Z!Z!Z!Z!Z!Z!Z! Z!@[! [!H","("ASCIIcs_patho!Xp! bc_base_maxp! bc_dim_maxp! bc_scale_maxp! bc_string_maxp! coll_weights_maxp! expr_nest_max p! line_maxp!  re_dup_maxp!  posix2_version p!  posix2_c_bindp!  posix2_c_devp!  posix2_char_termp! posix2_fort_devp! posix2_fort_runp! posix2_localedefp! posix2_sw_devp! posix2_upep! stream_maxp! tzname_maxp! atexit_maxp!/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinUnknown error numberUnknown signal number%m (%s)aaaaae%JaaaaaaT[p!`p!p!p!Lp!p!p!8p!p!p!$q!q!l[:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%ld rk  UHC:"viV Mv&& januarygmtmidnightyearama.m.pmp.m.dst !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: mnnoonmiddayabcdefghiklmnopqrstuvwxyzututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirstonetwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekdayhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurthfridayfrsaturdaysa,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!  HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n31RLHD@;75+)++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cb'''''''''''''''''''''''''''hn''bk'''''Y'Y'''etq,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K-}Sjr_LvcI 36 TA@.f-}Sjr_LvcI 36 TA@.f acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C059N13xfr?tZunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`K #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @ inflate 1.3.2 Copyright 1995-2026 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.2 Copyright 1995-2026 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.2need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger0963array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist